3IWOA

X-ray crystal structure of the extended-spectrum ampc y221g mutant beta-lactamase at 1.90 angstrom resolution
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
358
structure length
352
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAGGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Structural bases for stability-function tradeoffs in antibiotic resistance.
pubmed doi rcsb
source organism Escherichia coli
total genus 117
structure length 352
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3iwoA00
1FCNA 4C3QA 1KGGA 5DTKA 3BECA 4EBLA 1M6KA 1H8ZA 2P9VA 3Q82A 2Y2IA 3G32A 4PM8A 4EBNA 5BOHA 2P9VB 4N1HA 1OMEA 5I94A 3TG9A 2XD1A 3W4QA 1U60A 3V5MA 1BULA 3S22A 1YLTA 3A3DA 2Y2OA 5EVIB 2R9XA 5FDHA 3LY4A 2A3UA 4X6TA 3WS4A 2HDQA 3FZCA 3VP4A 4JXVA 4LV0A 1IKGA 1MY8A 3CZDA 4O7DA 1O7EA 4KZ7A 1PW1A 2WADA 5A90A 1S6RA 2HP6A 3VFHA 2X71A 5FASA 5FI7A 1BSGA 1SDEA 4MBHA 4WMCA 2G2WA 3CMZA 4OONA 2WAEA 3G4PA 4JF6A 2RCXA 3HUOA 1K56D 1YMXA 5EVIC 1DJBA 1GA0A 4EV4A 3DWZA 4P0MA 4BL3A 1EWZA 2ZM8A 4Y7PA 4S2NC 2J8YA 1EI5A 5TFQA 5GL9A 3AGEA 3HLDA 3G34A 4OP5A 1BTLA 1PYYA 3SS3A 4R23A 5G18A 4IVIA 1NY0A 3GQZA 1PZOA 1E25A 1ZG6A 5FQQA 3E2LA 3SH8A 1LL9A 2ZQAA 1K56A 3WS2A 3O86A 1KGEA 5FAQA 5E2HA 3UPNA 4DDSA 4ID4A 2PBYA 5FQKA 3ZG9B 4QJGA 2WZZA 3NI9A 4N1XA 1BLPA 1HD8A 2H5SA 2WGIA 2ZC4B 1HZOA 1JTGA 2C5WB 4M3KA 3BM6A 5GLBA 4N9KA 4E6WA 4RVAA 1PW8A 3DW0A 3G2ZA 3PBSA 4DF6A 1I2WA 3HREA 1K54C 3IHBA 2DRWA 2EFXA 2UWXA 4NK3A 1CEGA 3ITAA 4GDBA 3SOIA 4DXBA 2V1ZA 4E3IA 5CRFA 2EX9A 2X02A 1BLCA 3A3FA 5A93A 4JKTA 4UA7A 4WZ5C 2Q9NA 2XFTA 5GHXA 3FKWA 4HESA 2ZC6B 4RYEA 5F82A 3S1YA 5CHMA 5AQ9A 1FCMA 1XP4A 2B5RA 4KG5A 1IELA 4KZ4A 4E3MA 4LV1A 4QY6A 3W4PA 3G30A 4ZDXA 3TSGA 1CK3A 2P74A 4BD1A 5F1GA 1FCOA 1FOFA 1K4EA 4DE2A 5CTMA 4P85A 3MKEA 3OPLA 1XKZA 4U0XA 5GLAA 2WK0A 3N4IA 2EFUA 1YLJA 4ZJ2A 1L0DA 2OV5A 4S2LA 3P09A 2VGJA 5JYPA 2XEPA 3SH7A 4E3KA 2EX6A 1W8YA 3HUMA 2C6WB 4UAAA 3ZNTA 5DTSA 4BLMA 5EUAA 4F94A 1PWGA 1FR6A 4DE1A 1GHPA 5FA7A 1L0GA 4BENA 3LEZA 3W8KA 1GA9A 1JWZA 1JTDA 4PMAA 3A3JA 4WELA 4YINA 5FQJA 1YLYA 5EECA 2ZC3B 2X01A 3O88A 4BQMA 1G68A 2OLVA 1ES5A 1XA7A 5HAPA 1QMFA 3IF6C 5CXWA 5FQ9A 5KSCA 2EXBA 4R0QA 4MEZA 4X69A 4EWFA 3JYIA 2J7VA 3EQVA 4PPRA 3HLEA 1DJCA 3ZG8B 5E43A 2Y59A 1XX2A 4UHUA 3ZFZA 5EE8A 5KMWA 4R3JA 5CEBA 2Y2KA 1WYBA 4B4XA 1KE0A 1KE4A 1XGJA 5GLDA 2XGNA 3VP2A 3MXRA 3IT9A 1RP5A 4GB7A 1NZOA 3VOZA 1NXYA 4S2MA 4MLLA 5TGFA 4U3TA 3UDXA 1BT5A 2XQZA 4WMCD 3UPOA 2V2FF 4LENA 4S2IA 5DF9A 4XXRA 3Q7ZA 5FQIA 4OLDA 5GHZA 1SKFA 1W7FA 1RCJA 1YLZA 4GNUA 4KZ9A 2VGKA 4ZJ3A 5A92A 4KZBA 4XUXA 2WZXA 1K4FA 1K55C 2A49A 1LHYA 4KQQA 3N8RA 1IYSA 2J9PA 4BJPA 3ZVTA 1JWVA 4PM9A 5AQAA 3MKFA 3PBRA 5CGXA 4OPQA 2ZC5B 2XF3A 4K0WA 3PAGA 5CERA 3SS4A 2EX8A 2WKIA 3SS5A 1MPLA 3NBLA 5AQBA 2V20A 1KVLA 5EOEA 3Q1FA 4P87A 4R4RA 1CI8A 2H0TA 2J9OA 3E2KA 2Y2LA 3HUNA 3FV7A 3N6IA 4XUZA 3ZHHA 3LCEA 1LI0A 4P6BA 1GCEA 1H5XA 4MBFA 2Y91A 3ZCZA 3PTEA 4E3JA 3IXHA 4OQIA 1XA1A 2HPBA 2PU2A 4X68A 1MWUA 3IF5A 4Y0TA 4DE0A 1VQQA 3OZHA 3MBZA 1IKIA 1QMEA 1YMSA 4GN2A 3VSKA 5FAPA 3VP0A 4E3LA 3OPPA 4JBFA 1HVBA 4Y0UA 5CGWA 4FCFA 4E3OA 1ZC2A 3UY6A 3BRMA 3QNBA 4OH0A 1I2SA 4LCLA 4Y0OA 1WYCA 2ZQ8A 3VOYA 4OKPA 5F1FA 1BUEA 3MZFA 4K0XA 2HP9A 4JXGA 1CEFA 2QPNA 2WUQA 1O07A 1DJAA 1NJ4A 1PIOA 3IH9A 5EPHA 5AQ7A 1Y54A 2ZD8A 4X56A 4OQ0A 4S2JA 1NYMA 2FFFB 2ZC7A 1W8QA 2ZMAA 1MWSA 3BFFA 2WKHA 4OPYA 3NCKA 3ZGAB 4OOLA 1M40A 4R3BA 4ZBEA 3UE1A 2Q9MA 1WE4A 2ZQ9A 4E3NA 1TVFA 2QZ6A 5E2FA 4D2OA 4EQIA 3HLWA 2RL3A 2BLSA 4JLFA 4WEJA 3VSLA 5A91A 3GMWA 2Z2LB 4FSFA 3UE3A 3IHAA 1NRFA 1EROA 4KZ5A 4YFMA 1YLPA 4DDYA 5EVLA 3A3EA 5HL1A 1AXBA 3IH8A 4KQOA 5CHUA 1K25A 3AGFA 3QHYA 1PI4A 5FI6A 4Q8IA 1IEMA 4OOMA 2IWDA 1MBLA 5FSRA 3OCLA 1KDWA 2XR0A 2WGVA 3IQAA 1H8YA 2JC7A 3ZDJA 5TR7A 4RX3A 3A3IA 5HARA 3C5AA 4C75A 4IBXA 1ESUA 3AGDA 1Q2QA 1N4OA 3PBQA 3MFDA 4E6XA 1ALQA 2IWBA 4FH2A 1G6AA 2JBFA 5KZHA 2Y2MA 2I72A 1E3UD 2E8IA 3M2KA 3UDFA 3V3SA 4S2OA 3Q7VA 3M6BA 1LI9A 2WGWA 3FKVA 5M1AA 3W4OA 3BEBA 2WGWB 1W5DA 1NZUA 5EOOA 5CECA 4FD8A 4QD4A 4OOYA 4GOGA 3G35A 2ZLYA 1MWRA 4ZTKA 5KSHA 2OSUA 1ESIA 2XLNA 5FAOA 3MZEA 4JPMA 3TOIA 3VMAA 1E3UA 4UA6A 3NC8A 2EXAA 1BZAA 2Y2PA 3N8LA 4HBUA 2DNSA 3G31A 5GLCA 4HBTA 3VFFA 5HAQA 4DKIA 3C7UA 2XD5A 3IWOA 5U47A 3IXBA 4BD0A 4CJNA 4UA9A 4C6YA 2ZQ7A 1SHVA 3HLGA 4KG6A 5L2FA 3I7JA 4KQRA 2HDRA 4MBKA 4PM7A 1YM1A 3C7VA 4A5RA 4DE3A 4JF5A 2H10A 1IYQA 1PI5A 5EVIA 3ZG5A 3OC2A 4OQGA 5JYOA 2XDMA 3O87A 5DF8A 4OVDA 3V3RA 1C3BA 2ZQCA 1K57A 4S2NA 5FATA 3IXDA 1HTZA 1L2SA 2QMIA 3BFCA 3Q07A 4IEDA 2JCHA 3WWXA 3WRTA 1MKIA 1W79A 4X53A 5E2GA 3QNCA 2XFSA 1K6RA 1ONGA 3PBTA 4HEFA 4JF4A 3PBOA 1KE3A 3SH9A 4WZ4A 4GDNA 1RGYA 1TDGA 2HP5A 3LO7A 1K38A 1LL5A 1YQSA 4KZ6A 2H0YA 4OP8A 4WYYA 4GZBA 4EUZA 1GHMA 3G2YA 3IWIA 4RX2A 3CJMA 4QB8A 2WYXA 3V50A 1ES2A 2EX2A 1SCWA 1KVMA 3OCNA 5E2EA 1IYOA 1ONHA 1SDNA 2Y2GA 3IWQA 4IBRA 4S2PA 4CPKA 2PU4A 1Q2PA 4QU3A 2ZM0A 1RGZA 4OPZA 3RXXA 1KDSA 1K57C 2G2UA 5D3OA 3C4OA 3BLMA 4LCMA 5DVAA 1FQGA 1PWDA 1K6SA 3ZG7B 2XH9A 3IXGA 3M2JA 3NIAA 3P98A 3V39A 1K54A 3HVFA 3VP1A 5M19A 2Y2JA 1ZG4A 3WRZA 1E4DA 4K91A 3HL9A 2IWCA 2DCFA 4R1GA 3UO9A 5GHYA 4RA7A 4R4SA 5DF7A 3N8SA 3O3VA 3GR2A 1L0EA 3B3XA 4GD6A 4KZ8A 1DY6A 3MZDA 4PM6A 4WZ5A 4N92A 1ERMA 2WKEA 1XPBA 4BL2A 5CEDA 4GD8A 4EBPA 2Z2MB 1LLBA 3NDGA 3PBNA 4ZAMA 4H8RA 3ZG0A 1GHIA 4MNRA 4JXSA 1YT4A 4OQHA 3WS0A 1PZPA 2Y4AA 1PWCA 2ZQDA 5FI2A 1FSYA 3DTMA 1MXOA 3GTCA 4OPRA 3BFEA 3GRJA 1ERQA 3HLBA 3ITBA 1IYPA 1XGIA 4IVKA 2HDSA 5HW3A 4X55A 4B88A 3RJUA 3BFGA 3BLSA 5CGSA 1ZKJA 2Y55A 3PAEA 2R9WA 4S2KA 3LY3A 3HLFA 3GSGA 4KG2A 2JE5A 4LV3A 5CHJA 3ZVWA 1ES4A 2ZM2A 4KZ3A 3NY4A 1FR1A 3BYDA 3HBRA 3WS1A 1MWTA 4QY5A 3GV9A 3EQUA 4N9LA 1BLHA 1TEMA 2OLUA 2Y2HA 4LV2A 4Z9QA 5DTTA 3UN7A 4QHCA 1NYYA 1TDLA 3CG5A 3IF6A 3NDEA 3IF6B 5IHVA 1XXMA 4DRTA 1FSWA 3M6HA 3BFDA 3MXSA 4NETA 4OLGA 3D4FA 1N9BA 4FH4A 1I5QA 4KZAA 5HAIA 5HX9A 3UPPA 5F83A 4WM9A 3OPRA 1VM1A 2BG1A 2CC1A 5CTNA 3RXWA 3FWLA 3UDIA 3Q81A 1JVJA 4ZJ1A 4PM5A 4DXCA 3GVBA 1CI9A 3OPHA 2ZJ9A 3UNWA 3ZNYA 2Y2QA 3Q7VB 1J9MA 4WBGA 1S0WA 1BLSA 4B4ZA 3N7WA 3WS5A 1JWPA 2XK1A 1KGFA 3C4PA 3DWKA 2WAFA 4L0LA 3FYZA 1YLWA 1L0FA 2Y2NA 5J8XA 2FFYA 4KENB 5EVID 5FQMA 3S4XA 4U0TA 2HDUA 1ES3A 3VP3A 3UE0A 1Z6FA 3ISGA 4JXWA 3HLCA 5HFOA 4GKUA 4WEKA 2GDNA 1K55A 5M18A
chains in the Genus database with same CATH superfamily
2UV0E 4EBLA 2Y2IA 3G32A 4PM8A 1OMEA 2NUPC 2XD1A 3RH8B 1U60A 1BULA 4JGOA 3WS4A 2KX6A 2HDQA 1PW1A 3G6OA 5FI7A 1BSGA 4MBHA 5F69A 2I9VA 2G2WA 2WAEA 4K08A 1GA0A 4BL3A 2EWVA 5CX7A 3G34A 5G18A 1E25A 1LL9A 2QYBA 3WS2A 3O86A 4WF0A 5E2HA 2ZC4B 1HZOA 2VLGA 1IOUA 1XJ6A 2L1MA 1MZUA 3DW0A 2PDRA 3HREA 3LIFA 5G4YA 3ITAA 3KYZA 4KQDA 2P08A 4EEPA 4E3IA 2X02A 4JKTA 4WZ5C 5FEGA 3FKWA 1YKDA 2QKPA 4HESA 5F82A 3S1YA 1IELA 3EGDC 4I3JA 3W4PA 4EERA 2W1TA 4NXFA 2W1TB 5CTMA 3OPLA 5GLAA 1YLJA 1WA9A 2J80A 3UE6A 3P09A 3SH7A 5J3WA 4E3KA 1W8YA 5EUAA 1PWGA 1FR6A 4BENA 1D1JA 3A0VA 4HP9A 2GNXA 3UB9A 4HHDA 2HF6A 5FQJA 5EECA 4NEED 3T4QA 2ZL1B 3F1PA 2V8CA 3F1PB 3IF6C 5FQ9A 4UHUA 4X1LA 4O8GA 2V1BA 3R4KA 2Y2KA 1KE4A 3VP2A 3HCYA 3IT9A 4FOFA 3VOZA 2PR5A 4MLLA 2V0UA 3E4PA 1BT5A 4WMCD 2V2FF 4G3WA 5GHZA 1W7FA 4KZ9A 5A92A 1UGUA 3IX4A 1LHYA 3N8RA 3ZVTA 4XT2A 4XT2B 2ZC5B 1S1ZA 4K0WA 4JGRA 3SS4A 3NBLA 5KIZA 4P87A 3ZHHA 3NHQA 3SW1A 4E3JA 2HPBA 2PU2A 4O0PA 2L0WA 2XA7M 3MBZA 3UMEA 5FAPA 4JBFA 4Y0UA 4E3OA 1ZC2A 4LGWA 4MDZA 4MN6A 4IUKA 2ZQ8A 4NXBA 4Y17A 4ME4A 1OTDA 3MS6A 1O07A 5AQ7A 1Y54A 4S2JA 4EESA 3LI8A 1V9ZA 1P9WA 1G6OA 3BFFA 4R3BA 3HJIA 4D2OA 2A24B 2BLSA 3MJQA 3IHAA 1YLPA 3IH8A 5FI6A 1K25A 2IA2A 4OOMA 2IWDA 1LSXA 5FSRA 1H8YA 1YSQA 2JC7A 5TR7A 3C5AA 1ESUA 5AVEA 4AFIA 3MFDA 5DKKA 2IWBA 4FH2A 3ZQ5A 4KUKA 4MN7A 2I72A 4R70A 3M2KA 3UDFA 3EEHA 1H8MA 5M1AA 3BEBA 3UB8A 1NZUA 2HJEA 5CECA 3H82A 1EW0A 3H82B 5HDCA 4JPMA 3TOIA 3NC8A 2Y2PA 3N8LA 5HAQA 4DKIA 2XD5A 5U47A 1YAXA 1T18A 2PYRA 4KG6A 5EM0A 2PAVP 3C7VA 4DE3A 1PI5A 2A2LA 5EVIA 4B9OA 4OQGA 1K57A 2QMIA 3WRTA 4X53A 5E2GA 1S66L 1K6RA 4HEFA 3SH9A 4GDNA 2HGVA 1TDGA 5FDSA 3LO7A 3L7HA 4UQIS 1K38A 4OP8A 1ZHHB 3CUEC 4R38A 2HV1A 2V1AA 1SDNA 4S2PA 4CPKA 1Q2PA 4QU3A 3KYEA 4OPZA 4Y13A 5DVAA 4LRXC 4X25A 3KX0X 3M2JA 4R6LA 3V39A 1K54A 3HVFA 1ZG4A 3C2WA 4K91A 1CF0A 2DCFA 4R1GA 3C8CA 3O3VA 4DN0A 2M1CA 3B3XA 2WKEA 5EV0A 4BL2A 5CEDA 4GD8A 1N9NA 3D9YA 3JVVA 4ZAMA 1VEUA 5TBMA 1GHIA 4MNRA 3UB5P 3ICYA 5TBMB 3BQ8A 2Y4AA 5FI2A 3GTCA 2K7SA 2D01A 3GRJA 1ERQA 3ITBA 2HDSA 5HW3A 3BFGA 4QPRA 4S2KA 3HLFA 5EVEA 3MQOA 5G4ZA 4LV3A 2O0YA 2ZM2A 4KZ3A 3NY4A 1FR1A 1D06A 3EQUA 4N9LA 4Z9QA 4LV2A 3UN7A 4QHCA 1TDLA 5IHVA 3ZYTA 2VJWA 1FSWA 3M6HA 3E4OA 4ETXA 4HP4A 3O5YA 4WM9A 2BG1A 4X1MA 3UDIA 3Q81A 4PM5A 4EETB 3GVBA 2Y2QA 1J9MA 1FIKA 4WBGA 3WS5A 3MMHA 1KGFA 2V9AA 3MQ0A 2ZOHA 4YOFA 3TRCA 2HDUA 2GDNA 1FCNA 1NRJA 1SKOA 1KGGA 4EBNA 1SKOB 1H8ZA 3CITA 5I94A 1PRQA 4NKPA 2A3UA 3DTEA 3T1SA 1S6RA 1V9YA 5HWVA 1SDEA 1AWIA 4JF6A 2RCXA 3HUOA 1DJBA 5HZHA 4S2NC 2J8YA 3T12B 3AGEA 3HLDA 1BTLA 1PYYA 4GCZA 3SS3A 4R23A 3S7NA 4IVIA 3T4TA 3GQZA 3E2LA 3LYXA 3LIEA 3UPNA 1OT9A 2PBYA 4PKYA 2WZZA 4P6ZS 2PD8A 3NI9A 1CJFA 1HD8A 1JTGA 5GLBA 4N9KA 4E6WA 4DF6A 1I2WA 2HZ5A 3IHBA 2UWXA 4NK3A 4GDBA 2V1ZA 5CRFA 4UA7A 5GHXA 2Q9NA 1TS6A 3KSIA 1MKMA 5CHMA 1FCMA 2B5RA 4KG5A 4E3MA 3TSGA 3C38A 1FCOA 1S4RA 1FOFA 1K4EA 4DE2A 1XKZA 4M4XA 3TE8A 4ZJ2A 3K3CA 2G7UA 1L0DA 2VGLS 3OOVA 3H7WA 5JYPA 2XEPA 3H7WB 2OOLA 3H9WA 4EUVA 3MFXA 2C6WB 4UAAA 5DTSA 5L10A 4DE1A 1GA9A 1JWZA 4YINA 1YLYA 2OLVA 3MQQA 4LPZA 5HAPA 1QMFA 2GZAA 5A8BA 4EWFA 2J7VA 3EQVA 4Y5FA 4PPRA 1DJCA 4WN5A 1XX2A 3ZFZA 5CEBA 5HL6A 4IJGA 4B4XA 1KE0A 5GLDA 2XGNA 1F9IA 3MXRA 1RP5A 4GB7A 1ZTUA 3UPOA 4XXRA 4OLDA 2ZMVA 3QP1A 1YLZA 4GNUA 2OAQ1 4ZJ3A 1TS7A 5HPFA 4XUXA 2WZXA 1K4FA 4BJPA 4PM9A 5IS1A 3MKFA 2XF3A 4MN5A 1H0MA 1N9LA 2EX8A 3IBJA 2V20A 1FILA 3HUNA 3N6IA 2Y2LA 3LCEA 4P6BA 2BASA 5EFWA 4OQIA 4X68A 3T4KA 4DE0A 4JGQA 3OZHA 1N9OA 3VOLA 3VE4A 4QWOA 1YMSA 4GN2A 4HI4A 3OPPA 2JHEA 2NUTC 1XJ3A 2PHYA 4OH0A 4CLCC 1WYCA 4EU0A 2J3TC 4K0XA 2HP9A 1NJ4A 3IH9A 5EPHA 4X56A 4HOIA 3PR6A 1W8QA 2ZMAA 3NCKA 1M40A 2V0WA 3QP8A 3R7WA 5E2FA 2YKHA 1F5MA 4EW7A 1JNUA 4UQIM 4JLFA 4F3LA 5A91A 1OT6A 2Z2LB 4FSFA 3UE3A 4F3LB 1NRFA 1VB6A 5EVLA 1AXBA 4Q8IA 3OCLA 1G28A 4IBXA 1Q2QA 4LLOB 2MJ6A 3L9KA 4L9GA 4E6XA 1ALQA 4Y2FA 2JBFA 3F1OA 3F1OB 5MC7A 1E3UD 5L8MA 5HPIA 3Q7VA 3FKVA 1W5DA 2Y8HA 4FD8A 1OTBA 5L09A 4QD4A 2W3GA 2ZLYA 2OSUA 5FAOA 3MZEA 1E3UA 4UA6A 2EXAA 3JPUA 1DP8A 4HBTA 5GLCA 3C7UA 2H28A 3IWOA 4UA9A 4MBKA 4PM7A 2H10A 2PBDP 3O87A 5DF8A 3V3RA 1C3BA 2ZQCA 4ZRRA 5FATA 3IXDA 4I38A 4FUWA 1ONGA 1NLYA 1XFQA 2HP5A 2VV8A 1LL5A 3LGOA 4KZ6A 2H0YA 3CPTA 3CPTB 4HJ6A 3V50A 1ONHA 2OWHA 2PU4A 2ZM0A 1K57C 2G2UA 5D3OA 4LRZE 1FQGA 3ZG7B 2W3EA 5M19A 1GSXA 1HLUP 3HL9A 4ETZA 5GHYA 3MZDA 4WZ5A 2QWSA 1ERMA 2XROA 1TF1A 3CAXA 1YT4A 2QJ5A 1T1CA 4HY8A 3EOIA 1IYPA 4GS9A 4GS9B 3BLSA 2Y55A 2EA9A 3PAEA 2R9WA 4KG2A 5CHJA 2OWJA 5HD5A 2OAP1 1BLHA 4UEYA 1NYYA 3IF6A 3NDEA 3LR4A 5C5KA 3IF6B 1XXMA 3BFDA 4NETA 4OLGA 4PHTA 2JKGA 3VV4A 1I5QA 3UPPA 3NULA 5AVFA 1D7EA 5F83A 1LSWA 5J7EA 2ZJ9A 3ZNYA 4MMNA 1BLSA 2WKRA 1YPRA 3N7WA 4B4ZA 1STZA 1JWPA 2XSSA 4L0LA 5HWTA 1L0FA 4CLCE 5J8XA 5FQMA 5EVID 3S4XA 3UE0A 4GKUA 4WEKA 5M18A 5DTKA 3BECA 2P9VA 3LIAA 2ACGA 2P9VB 4N1HA 3TG9A 3W4QA 2W1RA 3MSHA 3SZTA 1YLTA 3A3DA 2VGLM 3DBAA 5EVIB 5FDHA 3LY4A 3T1XA 1KOUA 3FZCA 4LV0A 1IKGA 3CZDA 4O7DA 1O7EA 4KZ7A 3IBRA 2HP6A 3VFHA 3EWKA 5FASA 1LL8A 3CMZA 4OONA 2KDKA 4G3KA 1YMXA 3DWZA 4P0MA 1EWZA 4Y7PA 5TFQA 5IT5A 4OP5A 3NOTC 3V67A 3LR5A 2PT7A 2VEAA 1NY0A 1PZOA 1ZG6A 5FQQA 2ZQAA 1KGEA 4ID4A 3ZG9B 4Z1WA 4N1XA 2WGIA 4WUJA 4M3KA 3OBFA 1VEUB 2EFXA 1CEGA 3SOIA 4DXBA 2EX9A 5A93A 2XFTA 1XP4A 1T1BA 5J4EA 3G30A 2VA0A 1S1YA 4ZDXA 2P74A 5F1GA 5DKLA 4Q0JA 3MKEA 4Y15A 4U0XA 3N4IA 2OV5A 2KOIA 3KYQA 4GJ4A 3ZNTA 3CHWP 4F94A 2JKRM 4I39A 1TD5A 1GHPA 1L0GA 3LFVA 4PMAA 2GJ3A 2ZC3B 2X01A 3O88A 3A0SA 2WKQA 3ULFA 3KSGA 5CXWA 4R0QA 4X69A 2CMNA 1NLZA 4GLQA 3EEAA 3IS2A 2VZWA 3HLEA 2M7UA 5E43A 2ZOIA 3TW8A 1ODVA 1WYBA 4HIAA 4JGPA 2O9BA 4O01A 3QP4A 1NXYA 4S2MA 5TGFA 2JKTM 4U3TA 3UDXA 5DF9A 4LENA 4S2IA 3Q7ZA 2INWA 4Q0HA 1K55C 1IYSA 1JWVA 3LR0A 5AQAA 3CUEA 3PAGA 5CERA 2WKIA 3SS5A 1MPLA 3NECA 1KVLA 5EOEA 3Q1FA 1OPXA 4R4RA 3KO6A 4NXGA 3FV7A 5EM1A 1LI0A 3E0YA 1GCEA 1H5XA 1PNEA 4MBFA 2Y91A 3ZCZA 3PTEA 3OLOA 5K5BA 1XA1A 3BWLA 4Y0TA 1VQQA 3TJZC 1IKIA 3VSKA 3VP0A 4E3LA 1HVBA 4FCFA 3UY6A 3QNBA 1I2SA 3VOYA 5F1FA 1BUEA 2K2NA 3MZFA 4B93A 4JXGA 1CEFA 2QPNA 2WUQA 1OJ5A 2ZD8A 5I5LA 2VK3A 2ZC7A 2LB9A 2WKHA 3ZGAB 4GHIA 3UE1A 3C30A 2FH5A 3D72A 1TVFA 2QZ6A 3U4LP 1K0KA 4WEJA 3GMWA 3FG8A 2LB5A 4E04A 4KZ5A 4YFMA 4DDYA 3T4JA 1IEMA 1MBLA 1KDWA 2E8JA 2XR0A 2WGVA 3IQAA 4BWIA 3ZDJA 1GSWA 5HARA 1XFNA 4WL9A 3AGDA 3PBQA 1G6AA 5KZHA 2E8IA 4S2OA 1ACFA 2WGWA 3M6BA 2WGWB 3B47A 5EOOA 3FC7A 4DMZA 3G35A 5KSHA 1ESIA 2XLNA 2YKFA 5HDSA 1S67L 1BZAA 4HBUA 2DNSA 1TS0A 4BD0A 4CJNA 4C6YA 2ZQ7A 1SHVA 3HLGA 5L2FA 4KQRA 2HDRA 1YM1A 1LT0A 4A5RA 4JF5A 3CWFA 3OC2A 2JKFA 2XDMA 4S2NA 3S7QA 1XJ2A 4IEDA 1W79A 3QNCA 5FEFA 4JF4A 3S7OA 3PBOA 4I5SA 4HH2A 3MF0A 1NWZA 1YQSA 4EUZA 4WYYA 1GHMA 3G2YA 3CJMA 2Z6CA 4QB8A 2WYXA 1ES2A 1SCWA 1KVMA 3F1NA 3T1RA 5E2EA 3IWQA 2Y2GA 3F1NB 2W3FA 4RQ9A 1L3LA 1KDSA 3C4OA 3BLMA 3IXGA 3P98A 3NIAA 3WRZA 3K3DA 5DF7A 4R4SA 4GD6A 1L0EA 4KZ8A 1DY6A 4N92A 1W63M 1XPBA 2QJ7A 5DFYA 1XJ4A 1TS8A 3NDGA 3PBNA 2AVXA 4CQHA 3ZG0A 3LEQA 4NG2A 3WS0A 1PZPA 1PWCA 2ZQDA 1FSYA 3R7WB 3DTMA 1MXOA 2PYPA 3BFEA 1XGIA 4B88A 4EQ1A 3RJUA 4L9FA 3T4OA 4R3AA 4PKYG 4GW9A 3LY3A 2BTFP 1T19A 3ZVWA 1ES4A 2O99A 3BYDA 3HBRA 3GV9A 1TEMA 2Y2HA 2DMWA 3CG5A 3B33A 3P01A 1P9RA 4LFUA 3D4FA 1H3QA 1N9BA 4FH4A 5HX9A 3OPRA 1VM1A 2CC1A 4DJ3A 3CI6A 2ZL1A 1CI9A 3OPHA 3Q7VB 3DWKA 2WAFA 2WKPA 3QP6A 1T1AA 1VHMA 2Y2NA 2FFYA 1DP9A 4U0TA 3VP3A 1UWNX 3ISGA 4JXWA 3HLCA 2O9AA 4C3QA 2HJ9C 2VV7A 1M6KA 5BOHA 2J3WA 3IX3A 3Q82A 2EWWA 1P0ZA 3HJKA 3V5MA 3B42A 3S22A 4H6JA 3VE3A 5HDDA 1G5UA 2Y2OA 4H6JB 3T50A 2R9XA 4X6TA 3VP4A 4JXVA 1BYWA 1MY8A 2Q0OA 2WADA 2VKSA 5A90A 4CLCD 2X71A 2J3TD 2L4RA 4WMCA 5F6AA 1A0KA 3QP2A 3G4PA 2ZBBA 1K56D 5EVIC 1SZVA 4EV4A 2ZM8A 4ARZA 1EI5A 4YNRA 4ARZB 5GL9A 4CLCA 1W63Q 1OTAA 4CLCB 2XRNA 1F2KA 3SH8A 1K56A 5FAQA 4DDSA 4LRYC 1OTEA 5FQKA 4QJGA 1BLPA 2H5SA 5HSQA 3T4SA 2C5WB 3BM6A 2JN7A 2B95A 4RVAA 1PW8A 3G2ZA 3PBSA 1K54C 2DRWA 2D02A 2B18A 1BLCA 3A3FA 2B02A 4HQAA 4RYEA 2ZC6B 5IU1A 5AQ9A 4KZ4A 3PXPA 4LV1A 4QY6A 2W27A 1CK3A 4BD1A 3JVUA 5DJUA 3T4LA 4P85A 1Y4OA 2WK0A 5LBRA 2EFUA 2A24A 4S2LA 5DFXA 2VGJA 4DJ2A 2EX6A 1IFQA 3HUMA 4P6ZM 5TJJA 4BLMA 5FA7A 3LEZA 3W8KA 4BBUA 1JTDA 3NOPC 3A3JA 4WELA 4BQMA 1G68A 1OJGA 1ES5A 1XA7A 5KSCA 2EXBA 4MEZA 3JYIA 2VX8A 2KLIA 3EGXC 4L9EA 3ZG8B 4BBVA 1YSPA 2Y59A 5EE8A 5KMWA 4R3JA 3KSFA 1DRMA 1XGJA 3BY9A 1NZOA 1F98A 2XQZA 2M7VA 5FQIA 1SKFA 2ZMFA 1RCJA 2VGKA 5F68A 4KZBA 3LIBA 3LIDA 2A49A 4KQQA 2J9PA 3BJNA 5HWWA 3PBRA 5CGXA 4OPQA 3NOUC 4BMWA 4KUOA 1GSVA 5AQBA 3LUQA 4IHQA 1CI8A 2H0TA 2J9OA 3E2KA 4HJ4A 4XUZA 1OTIA 3A0RA 3U2AA 3RTYA 3IXHA 1MWUA 3IF5A 1QMEA 5CGWA 4MCWA 4PAUA 1P97A 3BRMA 4LCLA 4Y0OA 2P7JA 4OKPA 3MXQA 1DJAA 1PIOA 4OQ0A 1NYMA 2FFFB 3QP5A 1MWSA 4I3IA 4OPYA 4OOLA 4ZBEA 2Q9MA 1WE4A 4HJ3A 4Y3IA 3MR0A 2Z6DA 2ZQ9A 4E3NA 3S7PA 4HH3A 3HLWA 2RL3A 3VSLA 1EROA 2K31A 3E4QA 1UWPX 3LR3A 3DAVA 3A3EA 5DJTA 5HL1A 5CHUA 4KQOA 3AGFA 3DTIA 3QHYA 1PI4A 3PHYA 1PFLA 2PRFA 3UB7A 4RX3A 3A3IA 4C75A 4Q0IA 1N4OA 3BW6A 3RFBA 3IS2B 2Y2MA 1S4SA 3BY8A 3V3SA 1LI9A 3W2ZA 3W4OA 2XA7S 3D3OA 4OOYA 4GOGA 4ZTKA 1MWRA 3VMAA 3UMDA 5F5YA 3G31A 3VFFA 3IXBA 4BBTA 2W3HA 5AJGA 3I7JA 1J3WA 2GX5A 3GECA 1IYQA 2PD7A 3ZG5A 5JYOA 4OVDA 2Y79A 3KSHA 1HTZA 1L2SA 3BFCA 3Q07A 1X0OA 2JCHA 3K2NA 3WWXA 1MKIA 2XFSA 3PBTA 1KE3A 1DP6A 2P04A 4WZ4A 3PYPA 1RGYA 4GZBA 3IWIA 3BQAA 4RX2A 4EEUA 2EX2A 2V8FA 4WLAA 5L07A 3OCNA 5HD3A 1IYOA 4IBRA 3T1QB 1RGZA 3P7NA 3RXXA 4LCMA 4YWZA 1PWDA 1K6SA 2R78A 2XH9A 5FL3A 3VP1A 2Y2JA 1E4DA 2IWCA 3UO9A 4NXEA 4RA7A 3N8SA 3GR2A 4PM6A 4II7A 2FZ0A 4EBPA 2Z2MB 3LI9A 1LLBA 4H8RA 4GHIB 3E98A 4JXSA 4OQHA 4EXOA 4OPRA 1VETA 3HLBA 2JKRI 3IX8A 3LICA 1VETB 4IVKA 3DTKA 4X55A 5CGSA 4FTXA 2O9CA 1ZKJA 3NJAA 3GSGA 2JE5A 2QHKA 4D60A 3WS1A 1MWTA 1Z09A 4QY5A 3UB6A 2PR6A 4G3VA 4EQIA 2OLUA 5DTTA 4ESPA 3GDIA 4DRTA 3MXSA 3FPVA 4KZAA 5HAIA 5CTNA 3RXWA 3CLOA 3FWLA 2JKTI 1Y28A 1JVJA 4ZJ1A 4DXCA 3UNWA 1MC0A 4I3AA 1S0WA 4IUHA 2W0NA 2VV6A 1CQAA 2XK1A 3C4PA 3FYZA 1YLWA 1LSVA 2W3DA 4KENB 1ES3A 1Z6FA 3FPWA 4HNBA 5HFOA 1K55A
chains in the Genus database with same CATH topology
1FCNA 4C3QA 1KGGA 5DTKA 3BECA 4EBLA 1M6KA 1H8ZA 2P9VA 3Q82A 2Y2IA 3G32A 4PM8A 4EBNA 5BOHA 2P9VB 4N1HA 1OMEA 5I94A 3TG9A 2XD1A 3W4QA 1U60A 3V5MA 1BULA 3S22A 1YLTA 3A3DA 2Y2OA 5EVIB 2R9XA 5FDHA 3LY4A 2A3UA 4X6TA 3WS4A 2HDQA 3FZCA 3VP4A 4JXVA 4LV0A 1IKGA 1MY8A 3CZDA 4O7DA 1O7EA 4KZ7A 1PW1A 2WADA 5A90A 1S6RA 2HP6A 3VFHA 2X71A 5FASA 5FI7A 1BSGA 1SDEA 4MBHA 4WMCA 2G2WA 3CMZA 4OONA 2WAEA 3G4PA 4JF6A 2RCXA 3HUOA 1K56D 1YMXA 5EVIC 1DJBA 1GA0A 4EV4A 3DWZA 4P0MA 4BL3A 1EWZA 2ZM8A 4Y7PA 4S2NC 2J8YA 1EI5A 5TFQA 5GL9A 3AGEA 3HLDA 3G34A 4OP5A 1BTLA 1PYYA 3SS3A 4R23A 5G18A 4IVIA 1NY0A 3GQZA 1PZOA 1E25A 1ZG6A 5FQQA 3E2LA 3SH8A 1LL9A 2ZQAA 1K56A 3WS2A 3O86A 1KGEA 5FAQA 5E2HA 3UPNA 4DDSA 4ID4A 2PBYA 5FQKA 3ZG9B 4QJGA 2WZZA 3NI9A 4N1XA 1BLPA 1HD8A 2H5SA 2WGIA 2ZC4B 1HZOA 1JTGA 2C5WB 4M3KA 3BM6A 5GLBA 4N9KA 4E6WA 4RVAA 1PW8A 3DW0A 3G2ZA 3PBSA 4DF6A 1I2WA 3HREA 1K54C 3IHBA 2DRWA 2EFXA 2UWXA 4NK3A 1CEGA 3ITAA 4GDBA 3SOIA 4DXBA 2V1ZA 4E3IA 5CRFA 2EX9A 2X02A 1BLCA 3A3FA 5A93A 4JKTA 4UA7A 4WZ5C 2Q9NA 2XFTA 5GHXA 3FKWA 4HESA 2ZC6B 4RYEA 5F82A 3S1YA 5CHMA 5AQ9A 1FCMA 1XP4A 2B5RA 4KG5A 1IELA 4KZ4A 4E3MA 4LV1A 4QY6A 3W4PA 3G30A 4ZDXA 3TSGA 1CK3A 2P74A 4BD1A 5F1GA 1FCOA 1FOFA 1K4EA 4DE2A 5CTMA 4P85A 3MKEA 3OPLA 1XKZA 4U0XA 5GLAA 2WK0A 3N4IA 2EFUA 1YLJA 4ZJ2A 1L0DA 2OV5A 4S2LA 3P09A 2VGJA 5JYPA 2XEPA 3SH7A 4E3KA 2EX6A 1W8YA 3HUMA 2C6WB 4UAAA 3ZNTA 5DTSA 4BLMA 5EUAA 4F94A 1PWGA 1FR6A 4DE1A 1GHPA 5FA7A 1L0GA 4BENA 3LEZA 3W8KA 1GA9A 1JWZA 1JTDA 4PMAA 3A3JA 4WELA 4YINA 5FQJA 1YLYA 5EECA 2ZC3B 2X01A 3O88A 4BQMA 1G68A 2OLVA 1ES5A 1XA7A 5HAPA 1QMFA 3IF6C 5CXWA 5FQ9A 5KSCA 2EXBA 4R0QA 4MEZA 4X69A 4EWFA 3JYIA 2J7VA 3EQVA 4PPRA 3HLEA 1DJCA 3ZG8B 5E43A 2Y59A 1XX2A 4UHUA 3ZFZA 5EE8A 5KMWA 4R3JA 5CEBA 2Y2KA 1WYBA 4B4XA 1KE0A 1KE4A 1XGJA 5GLDA 2XGNA 3VP2A 3MXRA 3IT9A 1RP5A 4GB7A 1NZOA 3VOZA 1NXYA 4S2MA 4MLLA 5TGFA 4U3TA 3UDXA 1BT5A 2XQZA 4WMCD 3UPOA 2V2FF 4LENA 4S2IA 5DF9A 4XXRA 3Q7ZA 5FQIA 4OLDA 5GHZA 1SKFA 1W7FA 1RCJA 1YLZA 4GNUA 4KZ9A 2VGKA 4ZJ3A 5A92A 4KZBA 4XUXA 2WZXA 1K4FA 1K55C 2A49A 1LHYA 4KQQA 3N8RA 1IYSA 2J9PA 4BJPA 3ZVTA 1JWVA 4PM9A 5AQAA 3MKFA 3PBRA 5CGXA 4OPQA 2ZC5B 2XF3A 4K0WA 3PAGA 5CERA 3SS4A 2EX8A 2WKIA 3SS5A 1MPLA 3NBLA 5AQBA 2V20A 1KVLA 5EOEA 3Q1FA 4P87A 4R4RA 1CI8A 2H0TA 2J9OA 3E2KA 2Y2LA 3HUNA 3FV7A 3N6IA 4XUZA 3ZHHA 3LCEA 1LI0A 4P6BA 1GCEA 1H5XA 4MBFA 2Y91A 3ZCZA 3PTEA 4E3JA 3IXHA 4OQIA 1XA1A 2HPBA 2PU2A 4X68A 1MWUA 3IF5A 4Y0TA 4DE0A 1VQQA 3OZHA 3MBZA 1IKIA 1QMEA 1YMSA 4GN2A 3VSKA 5FAPA 3VP0A 4E3LA 3OPPA 4JBFA 1HVBA 4Y0UA 5CGWA 4FCFA 4E3OA 1ZC2A 3UY6A 3BRMA 3QNBA 4OH0A 1I2SA 4LCLA 4Y0OA 1WYCA 2ZQ8A 3VOYA 4OKPA 5F1FA 1BUEA 3MZFA 4K0XA 2HP9A 4JXGA 1CEFA 2QPNA 2WUQA 1O07A 1DJAA 1NJ4A 1PIOA 3IH9A 5EPHA 5AQ7A 1Y54A 2ZD8A 4X56A 4OQ0A 4S2JA 1NYMA 2FFFB 2ZC7A 1W8QA 2ZMAA 1MWSA 3BFFA 2WKHA 4OPYA 3NCKA 3ZGAB 4OOLA 1M40A 4R3BA 4ZBEA 3UE1A 2Q9MA 1WE4A 2ZQ9A 4E3NA 1TVFA 2QZ6A 5E2FA 4D2OA 4EQIA 3HLWA 2RL3A 2BLSA 4JLFA 4WEJA 3VSLA 5A91A 3GMWA 2Z2LB 4FSFA 3UE3A 3IHAA 1NRFA 1EROA 4KZ5A 4YFMA 1YLPA 4DDYA 5EVLA 3A3EA 5HL1A 1AXBA 3IH8A 4KQOA 5CHUA 1K25A 3AGFA 3QHYA 1PI4A 5FI6A 4Q8IA 1IEMA 4OOMA 2IWDA 1MBLA 5FSRA 3OCLA 1KDWA 2XR0A 2WGVA 3IQAA 1H8YA 2JC7A 3ZDJA 5TR7A 4RX3A 3A3IA 5HARA 3C5AA 4C75A 4IBXA 1ESUA 3AGDA 1Q2QA 1N4OA 3PBQA 3MFDA 4E6XA 1ALQA 2IWBA 4FH2A 1G6AA 2JBFA 5KZHA 2Y2MA 2I72A 1E3UD 2E8IA 3M2KA 3UDFA 3V3SA 4S2OA 3Q7VA 3M6BA 1LI9A 2WGWA 3FKVA 5M1AA 3W4OA 3BEBA 2WGWB 1W5DA 1NZUA 5EOOA 5CECA 4FD8A 4QD4A 4OOYA 4GOGA 3G35A 2ZLYA 1MWRA 4ZTKA 5KSHA 2OSUA 1ESIA 2XLNA 5FAOA 3MZEA 4JPMA 3TOIA 3VMAA 1E3UA 4UA6A 3NC8A 2EXAA 1BZAA 2Y2PA 3N8LA 4HBUA 2DNSA 3G31A 5GLCA 4HBTA 3VFFA 5HAQA 4DKIA 3C7UA 2XD5A 3IWOA 5U47A 3IXBA 4BD0A 4CJNA 4UA9A 4C6YA 2ZQ7A 1SHVA 3HLGA 4KG6A 5L2FA 3I7JA 4KQRA 2HDRA 4MBKA 4PM7A 1YM1A 3C7VA 4A5RA 4DE3A 4JF5A 2H10A 1IYQA 1PI5A 5EVIA 3ZG5A 3OC2A 4OQGA 5JYOA 2XDMA 3O87A 5DF8A 4OVDA 3V3RA 1C3BA 2ZQCA 1K57A 4S2NA 5FATA 3IXDA 1HTZA 1L2SA 2QMIA 3BFCA 3Q07A 4IEDA 2JCHA 3WWXA 3WRTA 1MKIA 1W79A 4X53A 5E2GA 3QNCA 2XFSA 1K6RA 1ONGA 3PBTA 4HEFA 4JF4A 3PBOA 1KE3A 3SH9A 4WZ4A 4GDNA 1RGYA 1TDGA 2HP5A 3LO7A 1K38A 1LL5A 1YQSA 4KZ6A 2H0YA 4OP8A 4WYYA 4GZBA 4EUZA 1GHMA 3G2YA 3IWIA 4RX2A 3CJMA 4QB8A 2WYXA 3V50A 1ES2A 2EX2A 1SCWA 1KVMA 3OCNA 5E2EA 1IYOA 1ONHA 1SDNA 2Y2GA 3IWQA 4IBRA 4S2PA 4CPKA 2PU4A 1Q2PA 4QU3A 2ZM0A 1RGZA 4OPZA 3RXXA 1KDSA 1K57C 2G2UA 5D3OA 3C4OA 3BLMA 4LCMA 5DVAA 1FQGA 1PWDA 1K6SA 3ZG7B 2XH9A 3IXGA 3M2JA 3NIAA 3P98A 3V39A 1K54A 3HVFA 3VP1A 5M19A 2Y2JA 1ZG4A 3WRZA 1E4DA 4K91A 3HL9A 2IWCA 2DCFA 4R1GA 3UO9A 5GHYA 4RA7A 4R4SA 5DF7A 3N8SA 3O3VA 3GR2A 1L0EA 3B3XA 4GD6A 4KZ8A 1DY6A 3MZDA 4PM6A 4WZ5A 4N92A 1ERMA 2WKEA 1XPBA 4BL2A 5CEDA 4GD8A 4EBPA 2Z2MB 1LLBA 3NDGA 3PBNA 4ZAMA 4H8RA 3ZG0A 1GHIA 4MNRA 4JXSA 1YT4A 4OQHA 3WS0A 1PZPA 2Y4AA 1PWCA 2ZQDA 5FI2A 1FSYA 3DTMA 1MXOA 3GTCA 4OPRA 3BFEA 3GRJA 1ERQA 3HLBA 3ITBA 1IYPA 1XGIA 4IVKA 2HDSA 5HW3A 4X55A 4B88A 3RJUA 3BFGA 3BLSA 5CGSA 1ZKJA 2Y55A 3PAEA 2R9WA 4S2KA 3LY3A 3HLFA 3GSGA 4KG2A 2JE5A 4LV3A 5CHJA 3ZVWA 1ES4A 2ZM2A 4KZ3A 3NY4A 1FR1A 3BYDA 3HBRA 3WS1A 1MWTA 4QY5A 3GV9A 3EQUA 4N9LA 1BLHA 1TEMA 2OLUA 2Y2HA 4LV2A 4Z9QA 5DTTA 3UN7A 4QHCA 1NYYA 1TDLA 3CG5A 3IF6A 3NDEA 3IF6B 5IHVA 1XXMA 4DRTA 1FSWA 3M6HA 3BFDA 3MXSA 4NETA 4OLGA 3D4FA 1N9BA 4FH4A 1I5QA 4KZAA 5HAIA 5HX9A 3UPPA 5F83A 4WM9A 3OPRA 1VM1A 2BG1A 2CC1A 5CTNA 3RXWA 3FWLA 3UDIA 3Q81A 1JVJA 4ZJ1A 4PM5A 4DXCA 3GVBA 1CI9A 3OPHA 2ZJ9A 3UNWA 3ZNYA 2Y2QA 3Q7VB 1J9MA 4WBGA 1S0WA 1BLSA 4B4ZA 3N7WA 3WS5A 1JWPA 2XK1A 1KGFA 3C4PA 3DWKA 2WAFA 4L0LA 3FYZA 1YLWA 1L0FA 2Y2NA 5J8XA 2FFYA 4KENB 5EVID 5FQMA 3S4XA 4U0TA 2HDUA 1ES3A 3VP3A 3UE0A 1Z6FA 3ISGA 4JXWA 3HLCA 5HFOA 4GKUA 4WEKA 2GDNA 1K55A 5M18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FCN A;  4C3Q A;  1KGG A;  5DTK A;  3BEC A;  4EBL A;  1M6K A;  1H8Z A;  2P9V A;  3Q82 A;  2Y2I A;  3G32 A;  4PM8 A;  4EBN A;  5BOH A;  2P9V B;  4N1H A;  1OME A;  5I94 A;  3TG9 A;  2XD1 A;  3W4Q A;  1U60 A;  3V5M A;  1BUL A;  3S22 A;  1YLT A;  3A3D A;  2Y2O A;  5EVI B;  2R9X A;  5FDH A;  3LY4 A;  2A3U A;  4X6T A;  3WS4 A;  2HDQ A;  3FZC A;  3VP4 A;  4JXV A;  4LV0 A;  1IKG A;  1MY8 A;  3CZD A;  4O7D A;  1O7E A;  4KZ7 A;  1PW1 A;  2WAD A;  5A90 A;  1S6R A;  2HP6 A;  3VFH A;  2X71 A;  5FAS A;  5FI7 A;  1BSG A;  1SDE A;  4MBH A;  4WMC A;  2G2W A;  3CMZ A;  4OON A;  2WAE A;  3G4P A;  4JF6 A;  2RCX A;  3HUO A;  1K56 D;  1YMX A;  5EVI C;  1DJB A;  1GA0 A;  4EV4 A;  3DWZ A;  4P0M A;  4BL3 A;  1EWZ A;  2ZM8 A;  4Y7P A;  4S2N C;  2J8Y A;  1EI5 A;  5TFQ A;  5GL9 A;  3AGE A;  3HLD A;  3G34 A;  4OP5 A;  1BTL A;  1PYY A;  3SS3 A;  4R23 A;  5G18 A;  4IVI A;  1NY0 A;  3GQZ A;  1PZO A;  1E25 A;  1ZG6 A;  5FQQ A;  3E2L A;  3SH8 A;  1LL9 A;  2ZQA A;  1K56 A;  3WS2 A;  3O86 A;  1KGE A;  5FAQ A;  5E2H A;  3UPN A;  4DDS A;  4ID4 A;  2PBY A;  5FQK A;  3ZG9 B;  4QJG A;  2WZZ A;  3NI9 A;  4N1X A;  1BLP A;  1HD8 A;  2H5S A;  2WGI A;  2ZC4 B;  1HZO A;  1JTG A;  2C5W B;  4M3K A;  3BM6 A;  5GLB A;  4N9K A;  4E6W A;  4RVA A;  1PW8 A;  3DW0 A;  3G2Z A;  3PBS A;  4DF6 A;  1I2W A;  3HRE A;  1K54 C;  3IHB A;  2DRW A;  2EFX A;  2UWX A;  4NK3 A;  1CEG A;  3ITA A;  4GDB A;  3SOI A;  4DXB A;  2V1Z A;  4E3I A;  5CRF A;  2EX9 A;  2X02 A;  1BLC A;  3A3F A;  5A93 A;  4JKT A;  4UA7 A;  4WZ5 C;  2Q9N A;  2XFT A;  5GHX A;  3FKW A;  4HES A;  2ZC6 B;  4RYE A;  5F82 A;  3S1Y A;  5CHM A;  5AQ9 A;  1FCM A;  1XP4 A;  2B5R A;  4KG5 A;  1IEL A;  4KZ4 A;  4E3M A;  4LV1 A;  4QY6 A;  3W4P A;  3G30 A;  4ZDX A;  3TSG A;  1CK3 A;  2P74 A;  4BD1 A;  5F1G A;  1FCO A;  1FOF A;  1K4E A;  4DE2 A;  5CTM A;  4P85 A;  3MKE A;  3OPL A;  1XKZ A;  4U0X A;  5GLA A;  2WK0 A;  3N4I A;  2EFU A;  1YLJ A;  4ZJ2 A;  1L0D A;  2OV5 A;  4S2L A;  3P09 A;  2VGJ A;  5JYP A;  2XEP A;  3SH7 A;  4E3K A;  2EX6 A;  1W8Y A;  3HUM A;  2C6W B;  4UAA A;  3ZNT A;  5DTS A;  4BLM A;  5EUA A;  4F94 A;  1PWG A;  1FR6 A;  4DE1 A;  1GHP A;  5FA7 A;  1L0G A;  4BEN A;  3LEZ A;  3W8K A;  1GA9 A;  1JWZ A;  1JTD A;  4PMA A;  3A3J A;  4WEL A;  4YIN A;  5FQJ A;  1YLY A;  5EEC A;  2ZC3 B;  2X01 A;  3O88 A;  4BQM A;  1G68 A;  2OLV A;  1ES5 A;  1XA7 A;  5HAP A;  1QMF A;  3IF6 C;  5CXW A;  5FQ9 A;  5KSC A;  2EXB A;  4R0Q A;  4MEZ A;  4X69 A;  4EWF A;  3JYI A;  2J7V A;  3EQV A;  4PPR A;  3HLE A;  1DJC A;  3ZG8 B;  5E43 A;  2Y59 A;  1XX2 A;  4UHU A;  3ZFZ A;  5EE8 A;  5KMW A;  4R3J A;  5CEB A;  2Y2K A;  1WYB A;  4B4X A;  1KE0 A;  1KE4 A;  1XGJ A;  5GLD A;  2XGN A;  3VP2 A;  3MXR A;  3IT9 A;  1RP5 A;  4GB7 A;  1NZO A;  3VOZ A;  1NXY A;  4S2M A;  4MLL A;  5TGF A;  4U3T A;  3UDX A;  1BT5 A;  2XQZ A;  4WMC D;  3UPO A;  2V2F F;  4LEN A;  4S2I A;  5DF9 A;  4XXR A;  3Q7Z A;  5FQI A;  4OLD A;  5GHZ A;  1SKF A;  1W7F A;  1RCJ A;  1YLZ A;  4GNU A;  4KZ9 A;  2VGK A;  4ZJ3 A;  5A92 A;  4KZB A;  4XUX A;  2WZX A;  1K4F A;  1K55 C;  2A49 A;  1LHY A;  4KQQ A;  3N8R A;  1IYS A;  2J9P A;  4BJP A;  3ZVT A;  1JWV A;  4PM9 A;  5AQA A;  3MKF A;  3PBR A;  5CGX A;  4OPQ A;  2ZC5 B;  2XF3 A;  4K0W A;  3PAG A;  5CER A;  3SS4 A;  2EX8 A;  2WKI A;  3SS5 A;  1MPL A;  3NBL A;  5AQB A;  2V20 A;  1KVL A;  5EOE A;  3Q1F A;  4P87 A;  4R4R A;  1CI8 A;  2H0T A;  2J9O A;  3E2K A;  2Y2L A;  3HUN A;  3FV7 A;  3N6I A;  4XUZ A;  3ZHH A;  3LCE A;  1LI0 A;  4P6B A;  1GCE A;  1H5X A;  4MBF A;  2Y91 A;  3ZCZ A;  3PTE A;  4E3J A;  3IXH A;  4OQI A;  1XA1 A;  2HPB A;  2PU2 A;  4X68 A;  1MWU A;  3IF5 A;  4Y0T A;  4DE0 A;  1VQQ A;  3OZH A;  3MBZ A;  1IKI A;  1QME A;  1YMS A;  4GN2 A;  3VSK A;  5FAP A;  3VP0 A;  4E3L A;  3OPP A;  4JBF A;  1HVB A;  4Y0U A;  5CGW A;  4FCF A;  4E3O A;  1ZC2 A;  3UY6 A;  3BRM A;  3QNB A;  4OH0 A;  1I2S A;  4LCL A;  4Y0O A;  1WYC A;  2ZQ8 A;  3VOY A;  4OKP A;  5F1F A;  1BUE A;  3MZF A;  4K0X A;  2HP9 A;  4JXG A;  1CEF A;  2QPN A;  2WUQ A;  1O07 A;  1DJA A;  1NJ4 A;  1PIO A;  3IH9 A;  5EPH A;  5AQ7 A;  1Y54 A;  2ZD8 A;  4X56 A;  4OQ0 A;  4S2J A;  1NYM A;  2FFF B;  2ZC7 A;  1W8Q A;  2ZMA A;  1MWS A;  3BFF A;  2WKH A;  4OPY A;  3NCK A;  3ZGA B;  4OOL A;  1M40 A;  4R3B A;  4ZBE A;  3UE1 A;  2Q9M A;  1WE4 A;  2ZQ9 A;  4E3N A;  1TVF A;  2QZ6 A;  5E2F A;  4D2O A;  4EQI A;  3HLW A;  2RL3 A;  2BLS A;  4JLF A;  4WEJ A;  3VSL A;  5A91 A;  3GMW A;  2Z2L B;  4FSF A;  3UE3 A;  3IHA A;  1NRF A;  1ERO A;  4KZ5 A;  4YFM A;  1YLP A;  4DDY A;  5EVL A;  3A3E A;  5HL1 A;  1AXB A;  3IH8 A;  4KQO A;  5CHU A;  1K25 A;  3AGF A;  3QHY A;  1PI4 A;  5FI6 A;  4Q8I A;  1IEM A;  4OOM A;  2IWD A;  1MBL A;  5FSR A;  3OCL A;  1KDW A;  2XR0 A;  2WGV A;  3IQA A;  1H8Y A;  2JC7 A;  3ZDJ A;  5TR7 A;  4RX3 A;  3A3I A;  5HAR A;  3C5A A;  4C75 A;  4IBX A;  1ESU A;  3AGD A;  1Q2Q A;  1N4O A;  3PBQ A;  3MFD A;  4E6X A;  1ALQ A;  2IWB A;  4FH2 A;  1G6A A;  2JBF A;  5KZH A;  2Y2M A;  2I72 A;  1E3U D;  2E8I A;  3M2K A;  3UDF A;  3V3S A;  4S2O A;  3Q7V A;  3M6B A;  1LI9 A;  2WGW A;  3FKV A;  5M1A A;  3W4O A;  3BEB A;  2WGW B;  1W5D A;  1NZU A;  5EOO A;  5CEC A;  4FD8 A;  4QD4 A;  4OOY A;  4GOG A;  3G35 A;  2ZLY A;  1MWR A;  4ZTK A;  5KSH A;  2OSU A;  1ESI A;  2XLN A;  5FAO A;  3MZE A;  4JPM A;  3TOI A;  3VMA A;  1E3U A;  4UA6 A;  3NC8 A;  2EXA A;  1BZA A;  2Y2P A;  3N8L A;  4HBU A;  2DNS A;  3G31 A;  5GLC A;  4HBT A;  3VFF A;  5HAQ A;  4DKI A;  3C7U A;  2XD5 A;  3IWO A;  5U47 A;  3IXB A;  4BD0 A;  4CJN A;  4UA9 A;  4C6Y A;  2ZQ7 A;  1SHV A;  3HLG A;  4KG6 A;  5L2F A;  3I7J A;  4KQR A;  2HDR A;  4MBK A;  4PM7 A;  1YM1 A;  3C7V A;  4A5R A;  4DE3 A;  4JF5 A;  2H10 A;  1IYQ A;  1PI5 A;  5EVI A;  3ZG5 A;  3OC2 A;  4OQG A;  5JYO A;  2XDM A;  3O87 A;  5DF8 A;  4OVD A;  3V3R A;  1C3B A;  2ZQC A;  1K57 A;  4S2N A;  5FAT A;  3IXD A;  1HTZ A;  1L2S A;  2QMI A;  3BFC A;  3Q07 A;  4IED A;  2JCH A;  3WWX A;  3WRT A;  1MKI A;  1W79 A;  4X53 A;  5E2G A;  3QNC A;  2XFS A;  1K6R A;  1ONG A;  3PBT A;  4HEF A;  4JF4 A;  3PBO A;  1KE3 A;  3SH9 A;  4WZ4 A;  4GDN A;  1RGY A;  1TDG A;  2HP5 A;  3LO7 A;  1K38 A;  1LL5 A;  1YQS A;  4KZ6 A;  2H0Y A;  4OP8 A;  4WYY A;  4GZB A;  4EUZ A;  1GHM A;  3G2Y A;  3IWI A;  4RX2 A;  3CJM A;  4QB8 A;  2WYX A;  3V50 A;  1ES2 A;  2EX2 A;  1SCW A;  1KVM A;  3OCN A;  5E2E A;  1IYO A;  1ONH A;  1SDN A;  2Y2G A;  3IWQ A;  4IBR A;  4S2P A;  4CPK A;  2PU4 A;  1Q2P A;  4QU3 A;  2ZM0 A;  1RGZ A;  4OPZ A;  3RXX A;  1KDS A;  1K57 C;  2G2U A;  5D3O A;  3C4O A;  3BLM A;  4LCM A;  5DVA A;  1FQG A;  1PWD A;  1K6S A;  3ZG7 B;  2XH9 A;  3IXG A;  3M2J A;  3NIA A;  3P98 A;  3V39 A;  1K54 A;  3HVF A;  3VP1 A;  5M19 A;  2Y2J A;  1ZG4 A;  3WRZ A;  1E4D A;  4K91 A;  3HL9 A;  2IWC A;  2DCF A;  4R1G A;  3UO9 A;  5GHY A;  4RA7 A;  4R4S A;  5DF7 A;  3N8S A;  3O3V A;  3GR2 A;  1L0E A;  3B3X A;  4GD6 A;  4KZ8 A;  1DY6 A;  3MZD A;  4PM6 A;  4WZ5 A;  4N92 A;  1ERM A;  2WKE A;  1XPB A;  4BL2 A;  5CED A;  4GD8 A;  4EBP A;  2Z2M B;  1LLB A;  3NDG A;  3PBN A;  4ZAM A;  4H8R A;  3ZG0 A;  1GHI A;  4MNR A;  4JXS A;  1YT4 A;  4OQH A;  3WS0 A;  1PZP A;  2Y4A A;  1PWC A;  2ZQD A;  5FI2 A;  1FSY A;  3DTM A;  1MXO A;  3GTC A;  4OPR A;  3BFE A;  3GRJ A;  1ERQ A;  3HLB A;  3ITB A;  1IYP A;  1XGI A;  4IVK A;  2HDS A;  5HW3 A;  4X55 A;  4B88 A;  3RJU A;  3BFG A;  3BLS A;  5CGS A;  1ZKJ A;  2Y55 A;  3PAE A;  2R9W A;  4S2K A;  3LY3 A;  3HLF A;  3GSG A;  4KG2 A;  2JE5 A;  4LV3 A;  5CHJ A;  3ZVW A;  1ES4 A;  2ZM2 A;  4KZ3 A;  3NY4 A;  1FR1 A;  3BYD A;  3HBR A;  3WS1 A;  1MWT A;  4QY5 A;  3GV9 A;  3EQU A;  4N9L A;  1BLH A;  1TEM A;  2OLU A;  2Y2H A;  4LV2 A;  4Z9Q A;  5DTT A;  3UN7 A;  4QHC A;  1NYY A;  1TDL A;  3CG5 A;  3IF6 A;  3NDE A;  3IF6 B;  5IHV A;  1XXM A;  4DRT A;  1FSW A;  3M6H A;  3BFD A;  3MXS A;  4NET A;  4OLG A;  3D4F A;  1N9B A;  4FH4 A;  1I5Q A;  4KZA A;  5HAI A;  5HX9 A;  3UPP A;  5F83 A;  4WM9 A;  3OPR A;  1VM1 A;  2BG1 A;  2CC1 A;  5CTN A;  3RXW A;  3FWL A;  3UDI A;  3Q81 A;  1JVJ A;  4ZJ1 A;  4PM5 A;  4DXC A;  3GVB A;  1CI9 A;  3OPH A;  2ZJ9 A;  3UNW A;  3ZNY A;  2Y2Q A;  3Q7V B;  1J9M A;  4WBG A;  1S0W A;  1BLS A;  4B4Z A;  3N7W A;  3WS5 A;  1JWP A;  2XK1 A;  1KGF A;  3C4P A;  3DWK A;  2WAF A;  4L0L A;  3FYZ A;  1YLW A;  1L0F A;  2Y2N A;  5J8X A;  2FFY A;  4KEN B;  5EVI D;  5FQM A;  3S4X A;  4U0T A;  2HDU A;  1ES3 A;  3VP3 A;  3UE0 A;  1Z6F A;  3ISG A;  4JXW A;  3HLC A;  5HFO A;  4GKU A;  4WEK A;  2GDN A;  1K55 A;  5M18 A; 
#chains in the Genus database with same CATH topology
 2UV0 E;  4EBL A;  2Y2I A;  3G32 A;  4PM8 A;  1OME A;  2NUP C;  2XD1 A;  3RH8 B;  1U60 A;  1BUL A;  4JGO A;  3WS4 A;  2KX6 A;  2HDQ A;  1PW1 A;  3G6O A;  5FI7 A;  1BSG A;  4MBH A;  5F69 A;  2I9V A;  2G2W A;  2WAE A;  4K08 A;  1GA0 A;  4BL3 A;  2EWV A;  5CX7 A;  3G34 A;  5G18 A;  1E25 A;  1LL9 A;  2QYB A;  3WS2 A;  3O86 A;  4WF0 A;  5E2H A;  2ZC4 B;  1HZO A;  2VLG A;  1IOU A;  1XJ6 A;  2L1M A;  1MZU A;  3DW0 A;  2PDR A;  3HRE A;  3LIF A;  5G4Y A;  3ITA A;  3KYZ A;  4KQD A;  2P08 A;  4EEP A;  4E3I A;  2X02 A;  4JKT A;  4WZ5 C;  5FEG A;  3FKW A;  1YKD A;  2QKP A;  4HES A;  5F82 A;  3S1Y A;  1IEL A;  3EGD C;  4I3J A;  3W4P A;  4EER A;  2W1T A;  4NXF A;  2W1T B;  5CTM A;  3OPL A;  5GLA A;  1YLJ A;  1WA9 A;  2J80 A;  3UE6 A;  3P09 A;  3SH7 A;  5J3W A;  4E3K A;  1W8Y A;  5EUA A;  1PWG A;  1FR6 A;  4BEN A;  1D1J A;  3A0V A;  4HP9 A;  2GNX A;  3UB9 A;  4HHD A;  2HF6 A;  5FQJ A;  5EEC A;  4NEE D;  3T4Q A;  2ZL1 B;  3F1P A;  2V8C A;  3F1P B;  3IF6 C;  5FQ9 A;  4UHU A;  4X1L A;  4O8G A;  2V1B A;  3R4K A;  2Y2K A;  1KE4 A;  3VP2 A;  3HCY A;  3IT9 A;  4FOF A;  3VOZ A;  2PR5 A;  4MLL A;  2V0U A;  3E4P A;  1BT5 A;  4WMC D;  2V2F F;  4G3W A;  5GHZ A;  1W7F A;  4KZ9 A;  5A92 A;  1UGU A;  3IX4 A;  1LHY A;  3N8R A;  3ZVT A;  4XT2 A;  4XT2 B;  2ZC5 B;  1S1Z A;  4K0W A;  4JGR A;  3SS4 A;  3NBL A;  5KIZ A;  4P87 A;  3ZHH A;  3NHQ A;  3SW1 A;  4E3J A;  2HPB A;  2PU2 A;  4O0P A;  2L0W A;  2XA7 M;  3MBZ A;  3UME A;  5FAP A;  4JBF A;  4Y0U A;  4E3O A;  1ZC2 A;  4LGW A;  4MDZ A;  4MN6 A;  4IUK A;  2ZQ8 A;  4NXB A;  4Y17 A;  4ME4 A;  1OTD A;  3MS6 A;  1O07 A;  5AQ7 A;  1Y54 A;  4S2J A;  4EES A;  3LI8 A;  1V9Z A;  1P9W A;  1G6O A;  3BFF A;  4R3B A;  3HJI A;  4D2O A;  2A24 B;  2BLS A;  3MJQ A;  3IHA A;  1YLP A;  3IH8 A;  5FI6 A;  1K25 A;  2IA2 A;  4OOM A;  2IWD A;  1LSX A;  5FSR A;  1H8Y A;  1YSQ A;  2JC7 A;  5TR7 A;  3C5A A;  1ESU A;  5AVE A;  4AFI A;  3MFD A;  5DKK A;  2IWB A;  4FH2 A;  3ZQ5 A;  4KUK A;  4MN7 A;  2I72 A;  4R70 A;  3M2K A;  3UDF A;  3EEH A;  1H8M A;  5M1A A;  3BEB A;  3UB8 A;  1NZU A;  2HJE A;  5CEC A;  3H82 A;  1EW0 A;  3H82 B;  5HDC A;  4JPM A;  3TOI A;  3NC8 A;  2Y2P A;  3N8L A;  5HAQ A;  4DKI A;  2XD5 A;  5U47 A;  1YAX A;  1T18 A;  2PYR A;  4KG6 A;  5EM0 A;  2PAV P;  3C7V A;  4DE3 A;  1PI5 A;  2A2L A;  5EVI A;  4B9O A;  4OQG A;  1K57 A;  2QMI A;  3WRT A;  4X53 A;  5E2G A;  1S66 L;  1K6R A;  4HEF A;  3SH9 A;  4GDN A;  2HGV A;  1TDG A;  5FDS A;  3LO7 A;  3L7H A;  4UQI S;  1K38 A;  4OP8 A;  1ZHH B;  3CUE C;  4R38 A;  2HV1 A;  2V1A A;  1SDN A;  4S2P A;  4CPK A;  1Q2P A;  4QU3 A;  3KYE A;  4OPZ A;  4Y13 A;  5DVA A;  4LRX C;  4X25 A;  3KX0 X;  3M2J A;  4R6L A;  3V39 A;  1K54 A;  3HVF A;  1ZG4 A;  3C2W A;  4K91 A;  1CF0 A;  2DCF A;  4R1G A;  3C8C A;  3O3V A;  4DN0 A;  2M1C A;  3B3X A;  2WKE A;  5EV0 A;  4BL2 A;  5CED A;  4GD8 A;  1N9N A;  3D9Y A;  3JVV A;  4ZAM A;  1VEU A;  5TBM A;  1GHI A;  4MNR A;  3UB5 P;  3ICY A;  5TBM B;  3BQ8 A;  2Y4A A;  5FI2 A;  3GTC A;  2K7S A;  2D01 A;  3GRJ A;  1ERQ A;  3ITB A;  2HDS A;  5HW3 A;  3BFG A;  4QPR A;  4S2K A;  3HLF A;  5EVE A;  3MQO A;  5G4Z A;  4LV3 A;  2O0Y A;  2ZM2 A;  4KZ3 A;  3NY4 A;  1FR1 A;  1D06 A;  3EQU A;  4N9L A;  4Z9Q A;  4LV2 A;  3UN7 A;  4QHC A;  1TDL A;  5IHV A;  3ZYT A;  2VJW A;  1FSW A;  3M6H A;  3E4O A;  4ETX A;  4HP4 A;  3O5Y A;  4WM9 A;  2BG1 A;  4X1M A;  3UDI A;  3Q81 A;  4PM5 A;  4EET B;  3GVB A;  2Y2Q A;  1J9M A;  1FIK A;  4WBG A;  3WS5 A;  3MMH A;  1KGF A;  2V9A A;  3MQ0 A;  2ZOH A;  4YOF A;  3TRC A;  2HDU A;  2GDN A;  1FCN A;  1NRJ A;  1SKO A;  1KGG A;  4EBN A;  1SKO B;  1H8Z A;  3CIT A;  5I94 A;  1PRQ A;  4NKP A;  2A3U A;  3DTE A;  3T1S A;  1S6R A;  1V9Y A;  5HWV A;  1SDE A;  1AWI A;  4JF6 A;  2RCX A;  3HUO A;  1DJB A;  5HZH A;  4S2N C;  2J8Y A;  3T12 B;  3AGE A;  3HLD A;  1BTL A;  1PYY A;  4GCZ A;  3SS3 A;  4R23 A;  3S7N A;  4IVI A;  3T4T A;  3GQZ A;  3E2L A;  3LYX A;  3LIE A;  3UPN A;  1OT9 A;  2PBY A;  4PKY A;  2WZZ A;  4P6Z S;  2PD8 A;  3NI9 A;  1CJF A;  1HD8 A;  1JTG A;  5GLB A;  4N9K A;  4E6W A;  4DF6 A;  1I2W A;  2HZ5 A;  3IHB A;  2UWX A;  4NK3 A;  4GDB A;  2V1Z A;  5CRF A;  4UA7 A;  5GHX A;  2Q9N A;  1TS6 A;  3KSI A;  1MKM A;  5CHM A;  1FCM A;  2B5R A;  4KG5 A;  4E3M A;  3TSG A;  3C38 A;  1FCO A;  1S4R A;  1FOF A;  1K4E A;  4DE2 A;  1XKZ A;  4M4X A;  3TE8 A;  4ZJ2 A;  3K3C A;  2G7U A;  1L0D A;  2VGL S;  3OOV A;  3H7W A;  5JYP A;  2XEP A;  3H7W B;  2OOL A;  3H9W A;  4EUV A;  3MFX A;  2C6W B;  4UAA A;  5DTS A;  5L10 A;  4DE1 A;  1GA9 A;  1JWZ A;  4YIN A;  1YLY A;  2OLV A;  3MQQ A;  4LPZ A;  5HAP A;  1QMF A;  2GZA A;  5A8B A;  4EWF A;  2J7V A;  3EQV A;  4Y5F A;  4PPR A;  1DJC A;  4WN5 A;  1XX2 A;  3ZFZ A;  5CEB A;  5HL6 A;  4IJG A;  4B4X A;  1KE0 A;  5GLD A;  2XGN A;  1F9I A;  3MXR A;  1RP5 A;  4GB7 A;  1ZTU A;  3UPO A;  4XXR A;  4OLD A;  2ZMV A;  3QP1 A;  1YLZ A;  4GNU A;  2OAQ 1;  4ZJ3 A;  1TS7 A;  5HPF A;  4XUX A;  2WZX A;  1K4F A;  4BJP A;  4PM9 A;  5IS1 A;  3MKF A;  2XF3 A;  4MN5 A;  1H0M A;  1N9L A;  2EX8 A;  3IBJ A;  2V20 A;  1FIL A;  3HUN A;  3N6I A;  2Y2L A;  3LCE A;  4P6B A;  2BAS A;  5EFW A;  4OQI A;  4X68 A;  3T4K A;  4DE0 A;  4JGQ A;  3OZH A;  1N9O A;  3VOL A;  3VE4 A;  4QWO A;  1YMS A;  4GN2 A;  4HI4 A;  3OPP A;  2JHE A;  2NUT C;  1XJ3 A;  2PHY A;  4OH0 A;  4CLC C;  1WYC A;  4EU0 A;  2J3T C;  4K0X A;  2HP9 A;  1NJ4 A;  3IH9 A;  5EPH A;  4X56 A;  4HOI A;  3PR6 A;  1W8Q A;  2ZMA A;  3NCK A;  1M40 A;  2V0W A;  3QP8 A;  3R7W A;  5E2F A;  2YKH A;  1F5M A;  4EW7 A;  1JNU A;  4UQI M;  4JLF A;  4F3L A;  5A91 A;  1OT6 A;  2Z2L B;  4FSF A;  3UE3 A;  4F3L B;  1NRF A;  1VB6 A;  5EVL A;  1AXB A;  4Q8I A;  3OCL A;  1G28 A;  4IBX A;  1Q2Q A;  4LLO B;  2MJ6 A;  3L9K A;  4L9G A;  4E6X A;  1ALQ A;  4Y2F A;  2JBF A;  3F1O A;  3F1O B;  5MC7 A;  1E3U D;  5L8M A;  5HPI A;  3Q7V A;  3FKV A;  1W5D A;  2Y8H A;  4FD8 A;  1OTB A;  5L09 A;  4QD4 A;  2W3G A;  2ZLY A;  2OSU A;  5FAO A;  3MZE A;  1E3U A;  4UA6 A;  2EXA A;  3JPU A;  1DP8 A;  4HBT A;  5GLC A;  3C7U A;  2H28 A;  3IWO A;  4UA9 A;  4MBK A;  4PM7 A;  2H10 A;  2PBD P;  3O87 A;  5DF8 A;  3V3R A;  1C3B A;  2ZQC A;  4ZRR A;  5FAT A;  3IXD A;  4I38 A;  4FUW A;  1ONG A;  1NLY A;  1XFQ A;  2HP5 A;  2VV8 A;  1LL5 A;  3LGO A;  4KZ6 A;  2H0Y A;  3CPT A;  3CPT B;  4HJ6 A;  3V50 A;  1ONH A;  2OWH A;  2PU4 A;  2ZM0 A;  1K57 C;  2G2U A;  5D3O A;  4LRZ E;  1FQG A;  3ZG7 B;  2W3E A;  5M19 A;  1GSX A;  1HLU P;  3HL9 A;  4ETZ A;  5GHY A;  3MZD A;  4WZ5 A;  2QWS A;  1ERM A;  2XRO A;  1TF1 A;  3CAX A;  1YT4 A;  2QJ5 A;  1T1C A;  4HY8 A;  3EOI A;  1IYP A;  4GS9 A;  4GS9 B;  3BLS A;  2Y55 A;  2EA9 A;  3PAE A;  2R9W A;  4KG2 A;  5CHJ A;  2OWJ A;  5HD5 A;  2OAP 1;  1BLH A;  4UEY A;  1NYY A;  3IF6 A;  3NDE A;  3LR4 A;  5C5K A;  3IF6 B;  1XXM A;  3BFD A;  4NET A;  4OLG A;  4PHT A;  2JKG A;  3VV4 A;  1I5Q A;  3UPP A;  3NUL A;  5AVF A;  1D7E A;  5F83 A;  1LSW A;  5J7E A;  2ZJ9 A;  3ZNY A;  4MMN A;  1BLS A;  2WKR A;  1YPR A;  3N7W A;  4B4Z A;  1STZ A;  1JWP A;  2XSS A;  4L0L A;  5HWT A;  1L0F A;  4CLC E;  5J8X A;  5FQM A;  5EVI D;  3S4X A;  3UE0 A;  4GKU A;  4WEK A;  5M18 A;  5DTK A;  3BEC A;  2P9V A;  3LIA A;  2ACG A;  2P9V B;  4N1H A;  3TG9 A;  3W4Q A;  2W1R A;  3MSH A;  3SZT A;  1YLT A;  3A3D A;  2VGL M;  3DBA A;  5EVI B;  5FDH A;  3LY4 A;  3T1X A;  1KOU A;  3FZC A;  4LV0 A;  1IKG A;  3CZD A;  4O7D A;  1O7E A;  4KZ7 A;  3IBR A;  2HP6 A;  3VFH A;  3EWK A;  5FAS A;  1LL8 A;  3CMZ A;  4OON A;  2KDK A;  4G3K A;  1YMX A;  3DWZ A;  4P0M A;  1EWZ A;  4Y7P A;  5TFQ A;  5IT5 A;  4OP5 A;  3NOT C;  3V67 A;  3LR5 A;  2PT7 A;  2VEA A;  1NY0 A;  1PZO A;  1ZG6 A;  5FQQ A;  2ZQA A;  1KGE A;  4ID4 A;  3ZG9 B;  4Z1W A;  4N1X A;  2WGI A;  4WUJ A;  4M3K A;  3OBF A;  1VEU B;  2EFX A;  1CEG A;  3SOI A;  4DXB A;  2EX9 A;  5A93 A;  2XFT A;  1XP4 A;  1T1B A;  5J4E A;  3G30 A;  2VA0 A;  1S1Y A;  4ZDX A;  2P74 A;  5F1G A;  5DKL A;  4Q0J A;  3MKE A;  4Y15 A;  4U0X A;  3N4I A;  2OV5 A;  2KOI A;  3KYQ A;  4GJ4 A;  3ZNT A;  3CHW P;  4F94 A;  2JKR M;  4I39 A;  1TD5 A;  1GHP A;  1L0G A;  3LFV A;  4PMA A;  2GJ3 A;  2ZC3 B;  2X01 A;  3O88 A;  3A0S A;  2WKQ A;  3ULF A;  3KSG A;  5CXW A;  4R0Q A;  4X69 A;  2CMN A;  1NLZ A;  4GLQ A;  3EEA A;  3IS2 A;  2VZW A;  3HLE A;  2M7U A;  5E43 A;  2ZOI A;  3TW8 A;  1ODV A;  1WYB A;  4HIA A;  4JGP A;  2O9B A;  4O01 A;  3QP4 A;  1NXY A;  4S2M A;  5TGF A;  2JKT M;  4U3T A;  3UDX A;  5DF9 A;  4LEN A;  4S2I A;  3Q7Z A;  2INW A;  4Q0H A;  1K55 C;  1IYS A;  1JWV A;  3LR0 A;  5AQA A;  3CUE A;  3PAG A;  5CER A;  2WKI A;  3SS5 A;  1MPL A;  3NEC A;  1KVL A;  5EOE A;  3Q1F A;  1OPX A;  4R4R A;  3KO6 A;  4NXG A;  3FV7 A;  5EM1 A;  1LI0 A;  3E0Y A;  1GCE A;  1H5X A;  1PNE A;  4MBF A;  2Y91 A;  3ZCZ A;  3PTE A;  3OLO A;  5K5B A;  1XA1 A;  3BWL A;  4Y0T A;  1VQQ A;  3TJZ C;  1IKI A;  3VSK A;  3VP0 A;  4E3L A;  1HVB A;  4FCF A;  3UY6 A;  3QNB A;  1I2S A;  3VOY A;  5F1F A;  1BUE A;  2K2N A;  3MZF A;  4B93 A;  4JXG A;  1CEF A;  2QPN A;  2WUQ A;  1OJ5 A;  2ZD8 A;  5I5L A;  2VK3 A;  2ZC7 A;  2LB9 A;  2WKH A;  3ZGA B;  4GHI A;  3UE1 A;  3C30 A;  2FH5 A;  3D72 A;  1TVF A;  2QZ6 A;  3U4L P;  1K0K A;  4WEJ A;  3GMW A;  3FG8 A;  2LB5 A;  4E04 A;  4KZ5 A;  4YFM A;  4DDY A;  3T4J A;  1IEM A;  1MBL A;  1KDW A;  2E8J A;  2XR0 A;  2WGV A;  3IQA A;  4BWI A;  3ZDJ A;  1GSW A;  5HAR A;  1XFN A;  4WL9 A;  3AGD A;  3PBQ A;  1G6A A;  5KZH A;  2E8I A;  4S2O A;  1ACF A;  2WGW A;  3M6B A;  2WGW B;  3B47 A;  5EOO A;  3FC7 A;  4DMZ A;  3G35 A;  5KSH A;  1ESI A;  2XLN A;  2YKF A;  5HDS A;  1S67 L;  1BZA A;  4HBU A;  2DNS A;  1TS0 A;  4BD0 A;  4CJN A;  4C6Y A;  2ZQ7 A;  1SHV A;  3HLG A;  5L2F A;  4KQR A;  2HDR A;  1YM1 A;  1LT0 A;  4A5R A;  4JF5 A;  3CWF A;  3OC2 A;  2JKF A;  2XDM A;  4S2N A;  3S7Q A;  1XJ2 A;  4IED A;  1W79 A;  3QNC A;  5FEF A;  4JF4 A;  3S7O A;  3PBO A;  4I5S A;  4HH2 A;  3MF0 A;  1NWZ A;  1YQS A;  4EUZ A;  4WYY A;  1GHM A;  3G2Y A;  3CJM A;  2Z6C A;  4QB8 A;  2WYX A;  1ES2 A;  1SCW A;  1KVM A;  3F1N A;  3T1R A;  5E2E A;  3IWQ A;  2Y2G A;  3F1N B;  2W3F A;  4RQ9 A;  1L3L A;  1KDS A;  3C4O A;  3BLM A;  3IXG A;  3P98 A;  3NIA A;  3WRZ A;  3K3D A;  5DF7 A;  4R4S A;  4GD6 A;  1L0E A;  4KZ8 A;  1DY6 A;  4N92 A;  1W63 M;  1XPB A;  2QJ7 A;  5DFY A;  1XJ4 A;  1TS8 A;  3NDG A;  3PBN A;  2AVX A;  4CQH A;  3ZG0 A;  3LEQ A;  4NG2 A;  3WS0 A;  1PZP A;  1PWC A;  2ZQD A;  1FSY A;  3R7W B;  3DTM A;  1MXO A;  2PYP A;  3BFE A;  1XGI A;  4B88 A;  4EQ1 A;  3RJU A;  4L9F A;  3T4O A;  4R3A A;  4PKY G;  4GW9 A;  3LY3 A;  2BTF P;  1T19 A;  3ZVW A;  1ES4 A;  2O99 A;  3BYD A;  3HBR A;  3GV9 A;  1TEM A;  2Y2H A;  2DMW A;  3CG5 A;  3B33 A;  3P01 A;  1P9R A;  4LFU A;  3D4F A;  1H3Q A;  1N9B A;  4FH4 A;  5HX9 A;  3OPR A;  1VM1 A;  2CC1 A;  4DJ3 A;  3CI6 A;  2ZL1 A;  1CI9 A;  3OPH A;  3Q7V B;  3DWK A;  2WAF A;  2WKP A;  3QP6 A;  1T1A A;  1VHM A;  2Y2N A;  2FFY A;  1DP9 A;  4U0T A;  3VP3 A;  1UWN X;  3ISG A;  4JXW A;  3HLC A;  2O9A A;  4C3Q A;  2HJ9 C;  2VV7 A;  1M6K A;  5BOH A;  2J3W A;  3IX3 A;  3Q82 A;  2EWW A;  1P0Z A;  3HJK A;  3V5M A;  3B42 A;  3S22 A;  4H6J A;  3VE3 A;  5HDD A;  1G5U A;  2Y2O A;  4H6J B;  3T50 A;  2R9X A;  4X6T A;  3VP4 A;  4JXV A;  1BYW A;  1MY8 A;  2Q0O A;  2WAD A;  2VKS A;  5A90 A;  4CLC D;  2X71 A;  2J3T D;  2L4R A;  4WMC A;  5F6A A;  1A0K A;  3QP2 A;  3G4P A;  2ZBB A;  1K56 D;  5EVI C;  1SZV A;  4EV4 A;  2ZM8 A;  4ARZ A;  1EI5 A;  4YNR A;  4ARZ B;  5GL9 A;  4CLC A;  1W63 Q;  1OTA A;  4CLC B;  2XRN A;  1F2K A;  3SH8 A;  1K56 A;  5FAQ A;  4DDS A;  4LRY C;  1OTE A;  5FQK A;  4QJG A;  1BLP A;  2H5S A;  5HSQ A;  3T4S A;  2C5W B;  3BM6 A;  2JN7 A;  2B95 A;  4RVA A;  1PW8 A;  3G2Z A;  3PBS A;  1K54 C;  2DRW A;  2D02 A;  2B18 A;  1BLC A;  3A3F A;  2B02 A;  4HQA A;  4RYE A;  2ZC6 B;  5IU1 A;  5AQ9 A;  4KZ4 A;  3PXP A;  4LV1 A;  4QY6 A;  2W27 A;  1CK3 A;  4BD1 A;  3JVU A;  5DJU A;  3T4L A;  4P85 A;  1Y4O A;  2WK0 A;  5LBR A;  2EFU A;  2A24 A;  4S2L A;  5DFX A;  2VGJ A;  4DJ2 A;  2EX6 A;  1IFQ A;  3HUM A;  4P6Z M;  5TJJ A;  4BLM A;  5FA7 A;  3LEZ A;  3W8K A;  4BBU A;  1JTD A;  3NOP C;  3A3J A;  4WEL A;  4BQM A;  1G68 A;  1OJG A;  1ES5 A;  1XA7 A;  5KSC A;  2EXB A;  4MEZ A;  3JYI A;  2VX8 A;  2KLI A;  3EGX C;  4L9E A;  3ZG8 B;  4BBV A;  1YSP A;  2Y59 A;  5EE8 A;  5KMW A;  4R3J A;  3KSF A;  1DRM A;  1XGJ A;  3BY9 A;  1NZO A;  1F98 A;  2XQZ A;  2M7V A;  5FQI A;  1SKF A;  2ZMF A;  1RCJ A;  2VGK A;  5F68 A;  4KZB A;  3LIB A;  3LID A;  2A49 A;  4KQQ A;  2J9P A;  3BJN A;  5HWW A;  3PBR A;  5CGX A;  4OPQ A;  3NOU C;  4BMW A;  4KUO A;  1GSV A;  5AQB A;  3LUQ A;  4IHQ A;  1CI8 A;  2H0T A;  2J9O A;  3E2K A;  4HJ4 A;  4XUZ A;  1OTI A;  3A0R A;  3U2A A;  3RTY A;  3IXH A;  1MWU A;  3IF5 A;  1QME A;  5CGW A;  4MCW A;  4PAU A;  1P97 A;  3BRM A;  4LCL A;  4Y0O A;  2P7J A;  4OKP A;  3MXQ A;  1DJA A;  1PIO A;  4OQ0 A;  1NYM A;  2FFF B;  3QP5 A;  1MWS A;  4I3I A;  4OPY A;  4OOL A;  4ZBE A;  2Q9M A;  1WE4 A;  4HJ3 A;  4Y3I A;  3MR0 A;  2Z6D A;  2ZQ9 A;  4E3N A;  3S7P A;  4HH3 A;  3HLW A;  2RL3 A;  3VSL A;  1ERO A;  2K31 A;  3E4Q A;  1UWP X;  3LR3 A;  3DAV A;  3A3E A;  5DJT A;  5HL1 A;  5CHU A;  4KQO A;  3AGF A;  3DTI A;  3QHY A;  1PI4 A;  3PHY A;  1PFL A;  2PRF A;  3UB7 A;  4RX3 A;  3A3I A;  4C75 A;  4Q0I A;  1N4O A;  3BW6 A;  3RFB A;  3IS2 B;  2Y2M A;  1S4S A;  3BY8 A;  3V3S A;  1LI9 A;  3W2Z A;  3W4O A;  2XA7 S;  3D3O A;  4OOY A;  4GOG A;  4ZTK A;  1MWR A;  3VMA A;  3UMD A;  5F5Y A;  3G31 A;  3VFF A;  3IXB A;  4BBT A;  2W3H A;  5AJG A;  3I7J A;  1J3W A;  2GX5 A;  3GEC A;  1IYQ A;  2PD7 A;  3ZG5 A;  5JYO A;  4OVD A;  2Y79 A;  3KSH A;  1HTZ A;  1L2S A;  3BFC A;  3Q07 A;  1X0O A;  2JCH A;  3K2N A;  3WWX A;  1MKI A;  2XFS A;  3PBT A;  1KE3 A;  1DP6 A;  2P04 A;  4WZ4 A;  3PYP A;  1RGY A;  4GZB A;  3IWI A;  3BQA A;  4RX2 A;  4EEU A;  2EX2 A;  2V8F A;  4WLA A;  5L07 A;  3OCN A;  5HD3 A;  1IYO A;  4IBR A;  3T1Q B;  1RGZ A;  3P7N A;  3RXX A;  4LCM A;  4YWZ A;  1PWD A;  1K6S A;  2R78 A;  2XH9 A;  5FL3 A;  3VP1 A;  2Y2J A;  1E4D A;  2IWC A;  3UO9 A;  4NXE A;  4RA7 A;  3N8S A;  3GR2 A;  4PM6 A;  4II7 A;  2FZ0 A;  4EBP A;  2Z2M B;  3LI9 A;  1LLB A;  4H8R A;  4GHI B;  3E98 A;  4JXS A;  4OQH A;  4EXO A;  4OPR A;  1VET A;  3HLB A;  2JKR I;  3IX8 A;  3LIC A;  1VET B;  4IVK A;  3DTK A;  4X55 A;  5CGS A;  4FTX A;  2O9C A;  1ZKJ A;  3NJA A;  3GSG A;  2JE5 A;  2QHK A;  4D60 A;  3WS1 A;  1MWT A;  1Z09 A;  4QY5 A;  3UB6 A;  2PR6 A;  4G3V A;  4EQI A;  2OLU A;  5DTT A;  4ESP A;  3GDI A;  4DRT A;  3MXS A;  3FPV A;  4KZA A;  5HAI A;  5CTN A;  3RXW A;  3CLO A;  3FWL A;  2JKT I;  1Y28 A;  1JVJ A;  4ZJ1 A;  4DXC A;  3UNW A;  1MC0 A;  4I3A A;  1S0W A;  4IUH A;  2W0N A;  2VV6 A;  1CQA A;  2XK1 A;  3C4P A;  3FYZ A;  1YLW A;  1LSV A;  2W3D A;  4KEN B;  1ES3 A;  1Z6F A;  3FPW A;  4HNB A;  5HFO A;  1K55 A; 
#chains in the Genus database with same CATH homology
 1FCN A;  4C3Q A;  1KGG A;  5DTK A;  3BEC A;  4EBL A;  1M6K A;  1H8Z A;  2P9V A;  3Q82 A;  2Y2I A;  3G32 A;  4PM8 A;  4EBN A;  5BOH A;  2P9V B;  4N1H A;  1OME A;  5I94 A;  3TG9 A;  2XD1 A;  3W4Q A;  1U60 A;  3V5M A;  1BUL A;  3S22 A;  1YLT A;  3A3D A;  2Y2O A;  5EVI B;  2R9X A;  5FDH A;  3LY4 A;  2A3U A;  4X6T A;  3WS4 A;  2HDQ A;  3FZC A;  3VP4 A;  4JXV A;  4LV0 A;  1IKG A;  1MY8 A;  3CZD A;  4O7D A;  1O7E A;  4KZ7 A;  1PW1 A;  2WAD A;  5A90 A;  1S6R A;  2HP6 A;  3VFH A;  2X71 A;  5FAS A;  5FI7 A;  1BSG A;  1SDE A;  4MBH A;  4WMC A;  2G2W A;  3CMZ A;  4OON A;  2WAE A;  3G4P A;  4JF6 A;  2RCX A;  3HUO A;  1K56 D;  1YMX A;  5EVI C;  1DJB A;  1GA0 A;  4EV4 A;  3DWZ A;  4P0M A;  4BL3 A;  1EWZ A;  2ZM8 A;  4Y7P A;  4S2N C;  2J8Y A;  1EI5 A;  5TFQ A;  5GL9 A;  3AGE A;  3HLD A;  3G34 A;  4OP5 A;  1BTL A;  1PYY A;  3SS3 A;  4R23 A;  5G18 A;  4IVI A;  1NY0 A;  3GQZ A;  1PZO A;  1E25 A;  1ZG6 A;  5FQQ A;  3E2L A;  3SH8 A;  1LL9 A;  2ZQA A;  1K56 A;  3WS2 A;  3O86 A;  1KGE A;  5FAQ A;  5E2H A;  3UPN A;  4DDS A;  4ID4 A;  2PBY A;  5FQK A;  3ZG9 B;  4QJG A;  2WZZ A;  3NI9 A;  4N1X A;  1BLP A;  1HD8 A;  2H5S A;  2WGI A;  2ZC4 B;  1HZO A;  1JTG A;  2C5W B;  4M3K A;  3BM6 A;  5GLB A;  4N9K A;  4E6W A;  4RVA A;  1PW8 A;  3DW0 A;  3G2Z A;  3PBS A;  4DF6 A;  1I2W A;  3HRE A;  1K54 C;  3IHB A;  2DRW A;  2EFX A;  2UWX A;  4NK3 A;  1CEG A;  3ITA A;  4GDB A;  3SOI A;  4DXB A;  2V1Z A;  4E3I A;  5CRF A;  2EX9 A;  2X02 A;  1BLC A;  3A3F A;  5A93 A;  4JKT A;  4UA7 A;  4WZ5 C;  2Q9N A;  2XFT A;  5GHX A;  3FKW A;  4HES A;  2ZC6 B;  4RYE A;  5F82 A;  3S1Y A;  5CHM A;  5AQ9 A;  1FCM A;  1XP4 A;  2B5R A;  4KG5 A;  1IEL A;  4KZ4 A;  4E3M A;  4LV1 A;  4QY6 A;  3W4P A;  3G30 A;  4ZDX A;  3TSG A;  1CK3 A;  2P74 A;  4BD1 A;  5F1G A;  1FCO A;  1FOF A;  1K4E A;  4DE2 A;  5CTM A;  4P85 A;  3MKE A;  3OPL A;  1XKZ A;  4U0X A;  5GLA A;  2WK0 A;  3N4I A;  2EFU A;  1YLJ A;  4ZJ2 A;  1L0D A;  2OV5 A;  4S2L A;  3P09 A;  2VGJ A;  5JYP A;  2XEP A;  3SH7 A;  4E3K A;  2EX6 A;  1W8Y A;  3HUM A;  2C6W B;  4UAA A;  3ZNT A;  5DTS A;  4BLM A;  5EUA A;  4F94 A;  1PWG A;  1FR6 A;  4DE1 A;  1GHP A;  5FA7 A;  1L0G A;  4BEN A;  3LEZ A;  3W8K A;  1GA9 A;  1JWZ A;  1JTD A;  4PMA A;  3A3J A;  4WEL A;  4YIN A;  5FQJ A;  1YLY A;  5EEC A;  2ZC3 B;  2X01 A;  3O88 A;  4BQM A;  1G68 A;  2OLV A;  1ES5 A;  1XA7 A;  5HAP A;  1QMF A;  3IF6 C;  5CXW A;  5FQ9 A;  5KSC A;  2EXB A;  4R0Q A;  4MEZ A;  4X69 A;  4EWF A;  3JYI A;  2J7V A;  3EQV A;  4PPR A;  3HLE A;  1DJC A;  3ZG8 B;  5E43 A;  2Y59 A;  1XX2 A;  4UHU A;  3ZFZ A;  5EE8 A;  5KMW A;  4R3J A;  5CEB A;  2Y2K A;  1WYB A;  4B4X A;  1KE0 A;  1KE4 A;  1XGJ A;  5GLD A;  2XGN A;  3VP2 A;  3MXR A;  3IT9 A;  1RP5 A;  4GB7 A;  1NZO A;  3VOZ A;  1NXY A;  4S2M A;  4MLL A;  5TGF A;  4U3T A;  3UDX A;  1BT5 A;  2XQZ A;  4WMC D;  3UPO A;  2V2F F;  4LEN A;  4S2I A;  5DF9 A;  4XXR A;  3Q7Z A;  5FQI A;  4OLD A;  5GHZ A;  1SKF A;  1W7F A;  1RCJ A;  1YLZ A;  4GNU A;  4KZ9 A;  2VGK A;  4ZJ3 A;  5A92 A;  4KZB A;  4XUX A;  2WZX A;  1K4F A;  1K55 C;  2A49 A;  1LHY A;  4KQQ A;  3N8R A;  1IYS A;  2J9P A;  4BJP A;  3ZVT A;  1JWV A;  4PM9 A;  5AQA A;  3MKF A;  3PBR A;  5CGX A;  4OPQ A;  2ZC5 B;  2XF3 A;  4K0W A;  3PAG A;  5CER A;  3SS4 A;  2EX8 A;  2WKI A;  3SS5 A;  1MPL A;  3NBL A;  5AQB A;  2V20 A;  1KVL A;  5EOE A;  3Q1F A;  4P87 A;  4R4R A;  1CI8 A;  2H0T A;  2J9O A;  3E2K A;  2Y2L A;  3HUN A;  3FV7 A;  3N6I A;  4XUZ A;  3ZHH A;  3LCE A;  1LI0 A;  4P6B A;  1GCE A;  1H5X A;  4MBF A;  2Y91 A;  3ZCZ A;  3PTE A;  4E3J A;  3IXH A;  4OQI A;  1XA1 A;  2HPB A;  2PU2 A;  4X68 A;  1MWU A;  3IF5 A;  4Y0T A;  4DE0 A;  1VQQ A;  3OZH A;  3MBZ A;  1IKI A;  1QME A;  1YMS A;  4GN2 A;  3VSK A;  5FAP A;  3VP0 A;  4E3L A;  3OPP A;  4JBF A;  1HVB A;  4Y0U A;  5CGW A;  4FCF A;  4E3O A;  1ZC2 A;  3UY6 A;  3BRM A;  3QNB A;  4OH0 A;  1I2S A;  4LCL A;  4Y0O A;  1WYC A;  2ZQ8 A;  3VOY A;  4OKP A;  5F1F A;  1BUE A;  3MZF A;  4K0X A;  2HP9 A;  4JXG A;  1CEF A;  2QPN A;  2WUQ A;  1O07 A;  1DJA A;  1NJ4 A;  1PIO A;  3IH9 A;  5EPH A;  5AQ7 A;  1Y54 A;  2ZD8 A;  4X56 A;  4OQ0 A;  4S2J A;  1NYM A;  2FFF B;  2ZC7 A;  1W8Q A;  2ZMA A;  1MWS A;  3BFF A;  2WKH A;  4OPY A;  3NCK A;  3ZGA B;  4OOL A;  1M40 A;  4R3B A;  4ZBE A;  3UE1 A;  2Q9M A;  1WE4 A;  2ZQ9 A;  4E3N A;  1TVF A;  2QZ6 A;  5E2F A;  4D2O A;  4EQI A;  3HLW A;  2RL3 A;  2BLS A;  4JLF A;  4WEJ A;  3VSL A;  5A91 A;  3GMW A;  2Z2L B;  4FSF A;  3UE3 A;  3IHA A;  1NRF A;  1ERO A;  4KZ5 A;  4YFM A;  1YLP A;  4DDY A;  5EVL A;  3A3E A;  5HL1 A;  1AXB A;  3IH8 A;  4KQO A;  5CHU A;  1K25 A;  3AGF A;  3QHY A;  1PI4 A;  5FI6 A;  4Q8I A;  1IEM A;  4OOM A;  2IWD A;  1MBL A;  5FSR A;  3OCL A;  1KDW A;  2XR0 A;  2WGV A;  3IQA A;  1H8Y A;  2JC7 A;  3ZDJ A;  5TR7 A;  4RX3 A;  3A3I A;  5HAR A;  3C5A A;  4C75 A;  4IBX A;  1ESU A;  3AGD A;  1Q2Q A;  1N4O A;  3PBQ A;  3MFD A;  4E6X A;  1ALQ A;  2IWB A;  4FH2 A;  1G6A A;  2JBF A;  5KZH A;  2Y2M A;  2I72 A;  1E3U D;  2E8I A;  3M2K A;  3UDF A;  3V3S A;  4S2O A;  3Q7V A;  3M6B A;  1LI9 A;  2WGW A;  3FKV A;  5M1A A;  3W4O A;  3BEB A;  2WGW B;  1W5D A;  1NZU A;  5EOO A;  5CEC A;  4FD8 A;  4QD4 A;  4OOY A;  4GOG A;  3G35 A;  2ZLY A;  1MWR A;  4ZTK A;  5KSH A;  2OSU A;  1ESI A;  2XLN A;  5FAO A;  3MZE A;  4JPM A;  3TOI A;  3VMA A;  1E3U A;  4UA6 A;  3NC8 A;  2EXA A;  1BZA A;  2Y2P A;  3N8L A;  4HBU A;  2DNS A;  3G31 A;  5GLC A;  4HBT A;  3VFF A;  5HAQ A;  4DKI A;  3C7U A;  2XD5 A;  3IWO A;  5U47 A;  3IXB A;  4BD0 A;  4CJN A;  4UA9 A;  4C6Y A;  2ZQ7 A;  1SHV A;  3HLG A;  4KG6 A;  5L2F A;  3I7J A;  4KQR A;  2HDR A;  4MBK A;  4PM7 A;  1YM1 A;  3C7V A;  4A5R A;  4DE3 A;  4JF5 A;  2H10 A;  1IYQ A;  1PI5 A;  5EVI A;  3ZG5 A;  3OC2 A;  4OQG A;  5JYO A;  2XDM A;  3O87 A;  5DF8 A;  4OVD A;  3V3R A;  1C3B A;  2ZQC A;  1K57 A;  4S2N A;  5FAT A;  3IXD A;  1HTZ A;  1L2S A;  2QMI A;  3BFC A;  3Q07 A;  4IED A;  2JCH A;  3WWX A;  3WRT A;  1MKI A;  1W79 A;  4X53 A;  5E2G A;  3QNC A;  2XFS A;  1K6R A;  1ONG A;  3PBT A;  4HEF A;  4JF4 A;  3PBO A;  1KE3 A;  3SH9 A;  4WZ4 A;  4GDN A;  1RGY A;  1TDG A;  2HP5 A;  3LO7 A;  1K38 A;  1LL5 A;  1YQS A;  4KZ6 A;  2H0Y A;  4OP8 A;  4WYY A;  4GZB A;  4EUZ A;  1GHM A;  3G2Y A;  3IWI A;  4RX2 A;  3CJM A;  4QB8 A;  2WYX A;  3V50 A;  1ES2 A;  2EX2 A;  1SCW A;  1KVM A;  3OCN A;  5E2E A;  1IYO A;  1ONH A;  1SDN A;  2Y2G A;  3IWQ A;  4IBR A;  4S2P A;  4CPK A;  2PU4 A;  1Q2P A;  4QU3 A;  2ZM0 A;  1RGZ A;  4OPZ A;  3RXX A;  1KDS A;  1K57 C;  2G2U A;  5D3O A;  3C4O A;  3BLM A;  4LCM A;  5DVA A;  1FQG A;  1PWD A;  1K6S A;  3ZG7 B;  2XH9 A;  3IXG A;  3M2J A;  3NIA A;  3P98 A;  3V39 A;  1K54 A;  3HVF A;  3VP1 A;  5M19 A;  2Y2J A;  1ZG4 A;  3WRZ A;  1E4D A;  4K91 A;  3HL9 A;  2IWC A;  2DCF A;  4R1G A;  3UO9 A;  5GHY A;  4RA7 A;  4R4S A;  5DF7 A;  3N8S A;  3O3V A;  3GR2 A;  1L0E A;  3B3X A;  4GD6 A;  4KZ8 A;  1DY6 A;  3MZD A;  4PM6 A;  4WZ5 A;  4N92 A;  1ERM A;  2WKE A;  1XPB A;  4BL2 A;  5CED A;  4GD8 A;  4EBP A;  2Z2M B;  1LLB A;  3NDG A;  3PBN A;  4ZAM A;  4H8R A;  3ZG0 A;  1GHI A;  4MNR A;  4JXS A;  1YT4 A;  4OQH A;  3WS0 A;  1PZP A;  2Y4A A;  1PWC A;  2ZQD A;  5FI2 A;  1FSY A;  3DTM A;  1MXO A;  3GTC A;  4OPR A;  3BFE A;  3GRJ A;  1ERQ A;  3HLB A;  3ITB A;  1IYP A;  1XGI A;  4IVK A;  2HDS A;  5HW3 A;  4X55 A;  4B88 A;  3RJU A;  3BFG A;  3BLS A;  5CGS A;  1ZKJ A;  2Y55 A;  3PAE A;  2R9W A;  4S2K A;  3LY3 A;  3HLF A;  3GSG A;  4KG2 A;  2JE5 A;  4LV3 A;  5CHJ A;  3ZVW A;  1ES4 A;  2ZM2 A;  4KZ3 A;  3NY4 A;  1FR1 A;  3BYD A;  3HBR A;  3WS1 A;  1MWT A;  4QY5 A;  3GV9 A;  3EQU A;  4N9L A;  1BLH A;  1TEM A;  2OLU A;  2Y2H A;  4LV2 A;  4Z9Q A;  5DTT A;  3UN7 A;  4QHC A;  1NYY A;  1TDL A;  3CG5 A;  3IF6 A;  3NDE A;  3IF6 B;  5IHV A;  1XXM A;  4DRT A;  1FSW A;  3M6H A;  3BFD A;  3MXS A;  4NET A;  4OLG A;  3D4F A;  1N9B A;  4FH4 A;  1I5Q A;  4KZA A;  5HAI A;  5HX9 A;  3UPP A;  5F83 A;  4WM9 A;  3OPR A;  1VM1 A;  2BG1 A;  2CC1 A;  5CTN A;  3RXW A;  3FWL A;  3UDI A;  3Q81 A;  1JVJ A;  4ZJ1 A;  4PM5 A;  4DXC A;  3GVB A;  1CI9 A;  3OPH A;  2ZJ9 A;  3UNW A;  3ZNY A;  2Y2Q A;  3Q7V B;  1J9M A;  4WBG A;  1S0W A;  1BLS A;  4B4Z A;  3N7W A;  3WS5 A;  1JWP A;  2XK1 A;  1KGF A;  3C4P A;  3DWK A;  2WAF A;  4L0L A;  3FYZ A;  1YLW A;  1L0F A;  2Y2N A;  5J8X A;  2FFY A;  4KEN B;  5EVI D;  5FQM A;  3S4X A;  4U0T A;  2HDU A;  1ES3 A;  3VP3 A;  3UE0 A;  1Z6F A;  3ISG A;  4JXW A;  3HLC A;  5HFO A;  4GKU A;  4WEK A;  2GDN A;  1K55 A;  5M18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...