5A90A

100k neutron ligand free: exploring the mechanism of beta-lactam ring protonation in the class a beta-lactamase acylation mechanism using neutron and x-ray crystallography
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
260
structure length
260
Chain Sequence
SVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE CTX-M-97
publication title Exploring the Mechanism of Beta-Lactam Ring Protonation in the Class a Beta-Lactamase Acylation Mechanism Using Neutron and X-Ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 91
structure length 260
sequence length 260
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5a90A00
2JCHA 4WYYA 3N6IA 3SH7A 5HL1A 1H5XA 3WRTA 1YLTA 3TG9A 4OLGA 1LHYA 4JBFA 3WRZA 1YLZA 3OC2A 5FSRA 3HLCA 5U47A 3SS3A 2PU2A 1ES3A 1K56D 3OPRA 4N1XA 4WZ5A 2Y2MA 4E3KA 5CGXA 5E2GA 1DY6A 3AGDA 4BL2A 3VP0A 2HPBA 3N8SA 4XXRA 3CJMA 5FAQA 2BLSA 4DE3A 1LI0A 2OLUA 3BRMA 3N8LA 2Y2JA 4HBTA 5IHVA 1IKGA 4X69A 5F1FA 4MNRA 2EX9A 2EX2A 4KQRA 1CI8A 4GDBA 5CXWA 4DXCA 4OPQA 2WUQA 4KG6A 3SH9A 5F1GA 2WGVA 1J9MA 3HREA 4HBUA 3N8RA 4BL3A 1ONGA 1W8YA 2HDQA 3Q81A 4JLFA 4KQQA 3IT9A 2OLVA 4JF6A 1MWSA 1XXMA 3ITAA 5EVIB 2WZXA 5F82A 3NY4A 5HAIA 4Y0TA 3VOZA 1NYYA 5CRFA 4MLLA 4R3JA 1DJBA 2ZC4B 1ZG4A 5EUAA 4GN2A 1GHMA 3BFDA 1FCOA 4R0QA 2Y2LA 1K4FA 1YQSA 3Q1FA 5HAPA 2DRWA 3MFDA 1IYPA 4DDSA 4C3QA 4E6WA 3RXWA 5I94A 3UN7A 3M2JA 2WZZA 2Y4AA 5DF8A 3OCNA 4H8RA 4RYEA 1N9BA 3BFCA 1WYCA 3GTCA 4DE0A 2V2FF 1W8QA 4XUZA 3W4PA 1BLCA 1PWCA 1PWGA 4M3KA 1HD8A 4YFMA 4ZJ3A 1OMEA 4R4RA 3QHYA 3M6HA 1GHPA 2JC7A 4KG2A 4OP8A 3WS1A 5J8XA 3LCEA 3UE1A 4HESA 3WS0A 5M19A 4IEDA 4E3NA 4GNUA 4R23A 2JE5A 3PTEA 4JF5A 4DXBA 2RCXA 5GL9A 3FZCA 1SHVA 2WYXA 2ZQCA 4X6TA 4BQMA 2H0TA 1NZOA 2XGNA 1EROA 3HUOA 3O87A 1K57C 2HDRA 4KENB 4S2NA 4X56A 3JYIA 1KVLA 1K56A 1Q2QA 1DJAA 1MY8A 2V20A 3NIAA 4FD8A 4JXGA 3UDIA 4OKPA 2ZC6B 2ZC3B 4GKUA 4OP5A 4DF6A 2P9VA 4N92A 3NDEA 3IH8A 5KSCA 1JVJA 3D4FA 1I2SA 3PBRA 3OPPA 1L0DA 3IF6A 4OH0A 5EVID 4OQGA 1PZPA 1RGZA 2IWDA 1U60A 5DTKA 3G32A 4YINA 4CJNA 5GHXA 3RXXA 4WELA 2QPNA 3VSKA 3I7JA 1M6KA 1NYMA 5AQBA 3A3DA 3W8KA 5KSHA 3FWLA 5CTNA 1SDNA 1LI9A 2XDMA 3G2YA 4DDYA 3V39A 1XGJA 2Y2GA 4OQIA 4WZ4A 1KDWA 4WM9A 3C7VA 4WMCA 1FR6A 3PBOA 1E3UD 2UWXA 2ZQAA 4LV0A 5KZHA 5EVIC 4FH2A 4WEKA 1JTGA 1L2SA 3FKWA 1YLWA 1PW1A 2V1ZA 4F94A 1FQGA 5CEBA 4R4SA 1W7FA 3W4QA 4S2OA 3RJUA 3E2KA 1K57A 3ZCZA 5FI7A 3HBRA 2Q9MA 1NRFA 2Y2KA 2Y2IA 5FDHA 3BLSA 4BD0A 3PBTA 4FSFA 1JWVA 4NETA 1KGEA 2Y2HA 2WADA 3FV7A 2WAFA 3A3EA 1H8ZA 3SS5A 3LO7A 2XD1A 3GMWA 3S22A 4EUZA 3TSGA 3LY4A 3MZFA 1BLHA 4KZ4A 4N1HA 4KZ6A 1JWZA 3MKEA 4MBHA 4BD1A 3MBZA 3CMZA 5FQKA 4KQOA 3UPOA 2EXBA 4OQHA 1L0FA 4KZ7A 4KZAA 1SCWA 3HLEA 4Y0UA 2VGJA 1I5QA 4GB7A 5DTSA 5FQQA 4PM6A 4BJPA 2EX6A 3G4PA 3VP4A 1NXYA 3IF5A 3VSLA 5G18A 2QZ6A 3GQZA 3M2KA 3P98A 4NK3A 2DCFA 5FQJA 5GHZA 3WS4A 5AQ9A 1YMSA 3GSGA 2WGWB 3NC8A 4LV2A 4ZDXA 1IKIA 5FI2A 5EVIA 1E4DA 3ZVWA 4EBNA 4S2NC 2C6WB 4MBFA 4X53A 3N4IA 3V50A 4K91A 4Z9QA 4OOMA 2PU4A 2WKHA 2ZMAA 4B4ZA 5FAPA 2VGKA 3MZEA 4GD8A 3QNBA 3VP1A 1FSYA 3IF6C 3HLGA 4K0WA 3HL9A 5FASA 3A3FA 4A5RA 5JYPA 1NJ4A 5A92A 1FCNA 1ES5A 3CZDA 5EE8A 2QMIA 4MEZA 3AGEA 1PWDA 1EWZA 1BSGA 1YLYA 3HUNA 3Q7ZA 4S2PA 3E2LA 4IBRA 4ZJ2A 3UE3A 1BTLA 4KZ8A 2EFUA 1E3UA 3BM6A 3HVFA 1ES4A 1HVBA 1K6RA 1BUEA 1N4OA 1QMFA 4OONA 1O7EA 1LL5A 5FI6A 4ZBEA 3IHBA 3WWXA 1YLJA 5D3OA 1K4EA 5F83A 5BOHA 2FFFB 5CHJA 2WK0A 1ESIA 3C7UA 3VP2A 1PW8A 1CK3A 3UE0A 4C6YA 1KE3A 4R3BA 1XA1A 4P85A 3OPLA 4EWFA 4ZAMA 3NBLA 4UHUA 2OV5A 3V5MA 3WS2A 1Q2PA 1CEFA 2Q9NA 1XP4A 2Y2QA 4LENA 2HP9A 2A49A 2HP5A 1GHIA 4OPZA 1K38A 3ZNYA 3BFEA 4KZ5A 4UAAA 5E2HA 5TFQA 3NDGA 3P09A 3Q7VA 1KDSA 1S0WA 1Z6FA 3DWKA 4LV1A 4X68A 3V3SA 1YLPA 5CGWA 1BZAA 5JYOA 3C4PA 1KGGA 1YT4A 3A3JA 4GZBA 1ERQA 2XLNA 4GD6A 4KZBA 1XX2A 1K55C 2C5WB 2Y59A 4DKIA 3AGFA 3M6BA 2EFXA 2J9OA 2WKIA 2Z2LB 1NY0A 4GDNA 5FA7A 3C4OA 3ISGA 1GA9A 1ALQA 5EPHA 1L0GA 3ZFZA 2EXAA 4DE1A 5EVLA 1K25A 5GLDA 4KG5A 1GA0A 1BLPA 3IXBA 4MBKA 3EQVA 1MPLA 4E6XA 4PM7A 4S2MA 1I2WA 4EBPA 4PM8A 3DW0A 1MXOA 3PBNA 3ZVTA 4FH4A 2EX8A 2B5RA 1IYQA 3G35A 3ZG9B 4BLMA 3A3IA 1PI5A 5FQ9A 5KMWA 1FOFA 2ZM8A 3FYZA 5EECA 4OPYA 4X55A 3ITBA 5DF9A 5DF7A 4PMAA 1O07A 1MKIA 5AQAA 4QHCA 4JXVA 2OSUA 1XA7A 4B88A 4E3JA 4PM5A 4ZTKA 1JWPA 1TDGA 2GDNA 1LL9A 1XGIA 4JKTA 2XEPA 1IELA 1TVFA 4QJGA 3IXHA 4U0XA 4DE2A 3LY3A 3VFFA 2X02A 1FR1A 1RCJA 3O3VA 3NCKA 2G2UA 1BT5A 1MBLA 1CEGA 5HFOA 1C3BA 3BYDA 4QB8A 2HDUA 1MWUA 3S1YA 1VQQA 1XKZA 4B4XA 1G6AA 1PZOA 4RVAA 1K55A 2ZQDA 4LCLA 5M1AA 4QY5A 4Y0OA 3VP3A 3BECA 3IXDA 1L0EA 4P87A 4UA9A 2ZQ7A 3Q07A 3Q82A 5CERA 1PYYA 4CPKA 1FSWA 3IWIA 2ZD8A 1K54C 2XH9A 3UPNA 4U0TA 3VFHA 2H5SA 2Y2PA 1NZUA 2I72A 2XK1A 5GHYA 1PI4A 1S6RA 2E8IA 4C75A 1IEMA 3HLWA 1ES2A 1WYBA 1KVMA 2WGWA 3B3XA 3G2ZA 3IXGA 1BULA 3BEBA 5E2FA 3OCLA 2XFSA 3UY6A 2BG1A 4JXSA 3ZG0A 4RX2A 3W4OA 3BFGA 3UDXA 1GCEA 1PIOA 1SDEA 2P74A 2R9WA 2ZM2A 3HUMA 3PBSA 4UA6A 2WGIA 5FQIA 1HTZA 1MWRA 1SKFA 3VOYA 1EI5A 5E2EA 4XUXA 4JPMA 3ZG5A 3IHAA 2FFYA 5L2FA 4R1GA 4EQIA 3BFFA 3EQUA 5GLCA 4OLDA 2HDSA 1DJCA 1ZC2A 4E3MA 1XPBA 2X71A 4LV3A 3PBQA 4GOGA 4OQ0A 4IBXA 3ZG7B 2J7VA 3NI9A 2ZC5B 1BLSA 4D2OA 4E3IA 3GV9A 3HLDA 3OPHA 5HX9A 4OOLA 4WMCD 2PBYA 2XFTA 4P0MA 3GRJA 1KGFA 1YM1A 4EBLA 5CEDA 1KE4A 1K54A 3IWOA 4QY6A 5CHMA 3IH9A 4QD4A 2WAEA 5FAOA 3IWQA 3PAGA 5CHUA 4OOYA 3PAEA 4P6BA 3TOIA 4EV4A 3UDFA 3UPPA 3S4XA 3MXSA 4JXWA 3MKFA 4Q8IA 4IVIA 1KE0A 3OZHA 4LCMA 5HAQA 1W79A 2XF3A 3ZGAB 4RX3A 5A93A 5DVAA 4L0LA 3UNWA 4S2IA 5HW3A 4U3TA 4OVDA 2JBFA 4FCFA 5M18A 2ZQ9A 5DTTA 3ZDJA 4BENA 1AXBA 2IWCA 4K0XA 4DRTA 4E3LA 1QMEA 1MWTA 3MZDA 5TR7A 2Z2MB 2RL3A 3GVBA 5A91A 3WS5A 1IYSA 3SOIA 2X01A 4ID4A 5A90A 2G2WA 3HLFA 4UA7A 4E3OA 3IQAA 4KZ9A 1VM1A 2HP6A 3Q7VB 2IWBA 2Y2OA 3SS4A 5CECA 1ONHA 1RGYA 3V3RA 1WE4A 2XD5A 1TEMA 3DWZA 3FKVA 5CGSA 2P9VB 2A3UA 5AQ7A 4N9KA 3G30A 3G31A 4WBGA 2XR0A 3C5AA 3MXRA 3CG5A 4HEFA 2J9PA 3IF6B 4WZ5C 2H10A 4Y7PA 3GR2A 5EOEA 4O7DA 2CC1A 3G34A 4S2KA 3QNCA 4ZJ1A 1ZG6A 4IVKA 4PM9A 4PPRA 2Y55A 2R9XA 1ERMA 5GLBA 3ZHHA 2ZQ8A 3N7WA 1LLBA 3HLBA 4RA7A 4WEJA 2WKEA 4QU3A 1K6SA 4N9LA 4OPRA 2ZC7A 4S2JA 2Y91A 4JF4A 1M40A 3O86A 5GLAA 5FATA 3ZG8B 3SH8A 4S2LA 3ZNTA 1HZOA 1JTDA 5E43A 1W5DA 5FQMA 1ZKJA 1FCMA 2DNSA 2J8YA 1RP5A 1E25A 1Y54A 1H8YA 3BLMA 3O88A 2H0YA 5CTMA 3UO9A 1CI9A 1IYOA 3DTMA 3LEZA 5EOOA 3VMAA 2Y2NA 1TDLA 2XQZA 2ZJ9A 4KZ3A 5HARA 1G68A 1ESUA 5TGFA 2ZLYA 1YMXA 2ZM0A
chains in the Genus database with same CATH superfamily
3N6IA 5HL1A 1H5XA 3WRTA 3S7NA 1YLTA 1STZA 4OLGA 5FSRA 5U47A 1ES3A 1K56D 2Y2MA 1DY6A 3AGDA 3TRCA 2DMWA 4HBTA 4X69A 2NUPC 1CI8A 4KG6A 5F1GA 2WGVA 5FEGA 1J9MA 2W0NA 3F1NA 5HPFA 1ONGA 3EOIA 4JLFA 1S1YA 3K2NA 2JN7A 5HAIA 4JF6A 1MWSA 2ZBBA 4QPRA 3FC7A 5EUAA 3BFDA 2VV8A 2Y2LA 2ZOHA 2MJ6A 4DDSA 3RXWA 5J4EA 5DF8A 3MR0A 1N9BA 3BFCA 4WLAA 3CI6A 2V2FF 2QHKA 2M7UA 3CLOA 1BLCA 3NULA 4JGRA 3OLOA 2J3TC 5TBMB 1Y28A 2JC7A 3WS0A 4IEDA 4GNUA 3PTEA 5FL3A 2GJ3A 2V8CA 2WYXA 2ZQCA 3ICYA 4BQMA 3C2WA 3TW8A 5K5BA 1K57C 4KENB 4S2NA 4X56A 3JYIA 1KVLA 3UDIA 4EWFA 4OP5A 4DF6A 3NDEA 3SW1A 3IH8A 1X0OA 1G28A 5EVID 4GS9A 3G32A 1UWPX 1M6KA 5KSHA 3G2YA 4G3KA 4DDYA 1XGJA 2Y2GA 4XT2B 4WMCA 5HSQA 2UWXA 2ZQAA 5DKKA 1OTAA 1JTGA 1OT9A 1PW1A 4EEPA 4BMWA 4E04A 3RJUA 3ZCZA 5FI7A 1NRFA 2Y2IA 2WKQA 3PBTA 4FSFA 4NETA 2Y2HA 1VB6A 3SS5A 3LO7A 3QP6A 1TS7A 3GMWA 3S22A 3TSGA 1CJFA 3MZFA 1BLHA 5L8MA 3MKEA 4MBHA 4BD1A 2B95A 3T4TA 4EU0A 4KQOA 2EXBA 1SCWA 4Y0UA 5DTSA 2CMNA 3P7NA 1XJ4A 3G4PA 3VP4A 5G18A 3S7OA 4I38A 1LSXA 5FQJA 5GHZA 5HD3A 5CX7A 4LV2A 4ZDXA 3ZVWA 4K91A 1D06A 4B4ZA 1J3WA 3MZEA 3T4QA 4GD8A 3VP1A 2YKHA 5FASA 3HL9A 4ARZA 4A5RA 5JYPA 1NJ4A 1ES5A 3CZDA 5HL6A 3AGEA 2HV1A 1EWZA 5FDSA 3B42A 2HJEA 4S2PA 3UE3A 1LL8A 1BTLA 4KZ8A 4PKYA 1ES4A 4OONA 1N4OA 5FI6A 3IHBA 4PHTA 5F83A 1HLUP 2FFFB 3DBAA 1ESIA 2WK0A 3VP2A 1PW8A 4HP9A 3UE0A 1S67L 3E4OA 5L07A 4NKPA 4EW7A 1UGUA 1YAXA 4UHUA 3WS2A 1T1AA 2Y2QA 4LENA 2HP9A 4KUKA 3IX3A 3S7QA 3ZNYA 4B93A 1LSVA 5TFQA 4LV1A 3V3SA 3C4PA 1YT4A 2EWWA 1ERQA 2XLNA 2C5WB 4DKIA 2Z2LB 5FA7A 4HJ3A 2WKRA 1ALQA 3ZFZA 1S4SA 2EXAA 3MSHA 1GA0A 3IXBA 4KG5A 4MBKA 3EQVA 3HJIA 2K7SA 4PM8A 3MFXA 4R3AA 2D02A 2EX8A 2B5RA 5EM0A 1FILA 2Z6DA 1PI5A 2ZM8A 4OPYA 4X55A 5DF7A 2OSUA 1XA7A 4JKTA 3UB8A 4U0XA 3VFFA 1RCJA 3LR0A 1CEGA 3U2AA 1PZOA 1K55A 4O8GA 5HZHA 4Y0OA 3BECA 1L0EA 4GW9A 2V0UA 3Q07A 4CPKA 1CF0A 3T4KA 1XFQA 1NZUA 2E8IA 2EWVA 1WYBA 2EA9A 4EERA 5E2FA 4EXOA 2XFSA 1PIOA 2R9WA 3PBSA 3CPTB 4YWZA 5E2EA 4XUXA 2W3HA 4FOFA 3NOUC 2FFYA 4R1GA 3BFFA 3EQUA 3C38A 1Y4OA 2HDSA 1DJCA 2V1AA 2X71A 4LV3A 3UB6A 3NI9A 1BLSA 2BTFP 2ZL1B 4KUOA 1LSWA 3GV9A 3HLDA 4Q0HA 2PDRA 1VETB 2XFTA 4Y17A 1KGFA 1YM1A 1KE4A 4QY6A 1TD5A 3IWQA 3PAGA 1YSPA 4P6BA 3L9KA 3BQAA 4Z1WA 4U3TA 4FCFA 3ZDJA 4DRTA 3MZDA 5LBRA 1IYSA 3MMHA 3MS6A 4KZ9A 2HP6A 2IWBA 1TF1A 5CECA 1ONHA 1RGYA 3V3RA 1WE4A 3G6OA 2XD5A 3G31A 2XR0A 2J9PA 3PXPA 3VE4A 3GR2A 5EOEA 5HDSA 4HH2A 4Y2FA 4PM9A 1SKOB 3B33A 3N7WA 4CLCB 2HGVA 2ZC7A 1XFNA 1YSQA 3CAXA 5J7EA 1HZOA 1OTIA 2DNSA 5HARA 1ESUA 1V9YA 2ZLYA 2K31A 2JCHA 1GSVA 4JBFA 3WRZA 3T1QB 3OC2A 4LLOB 2PU2A 2VV6A 3OPRA 3DAVA 3PHYA 4E3KA 5CGXA 4I3AA 3VP0A 3N8SA 4XXRA 2YKFA 2Y2JA 5F1FA 4MNRA 2EX9A 2EX2A 3SH9A 4HBUA 5I5LA 2LB5A 2O99A 4I5SA 3Q81A 4ZRRA 3IT9A 3NY4A 5IU1A 4LRXC 1NYYA 5CRFA 4R3JA 4O01A 1ZG4A 4R0QA 1K4FA 5HAPA 3MFDA 3A0VA 3GECA 2Y4AA 1OJGA 2VEAA 1H0MA 4DE0A 1W8QA 2PR6A 3W4PA 4EQ1A 1PWCA 4M3KA 1HD8A 4Q0JA 5J8XA 4R23A 4DXBA 4JF5A 2QKPA 5GL9A 1SHVA 2GZAA 2VJWA 3LI9A 1NZOA 1EROA 4EUVA 2HF6A 3NIAA 5MC7A 2ZC6B 2ZC3B 4P6ZM 2P9VA 1JVJA 3D4FA 1TS6A 2ZMVA 4RQ9A 1XJ6A 1PZPA 1RGZA 5DTKA 3TJZC 4CJNA 2QPNA 3VSKA 1NYMA 3W8KA 3FWLA 1SDNA 3F1OB 4X25A 2ACGA 4WZ4A 4OQIA 5HDDA 3C7VA 4Y13A 1MKMA 1NLYA 1OT6A 5KZHA 5EVIC 4NEED 4F3LA 4F94A 3D3OA 1W7FA 4S2OA 3E2KA 5FDHA 4EESA 1DRMA 1JWVA 2WAFA 3JVVA 3LY4A 1JWZA 2J3WA 4MN7A 3CMZA 5FQKA 4OQHA 1L0FA 4KZ7A 4KZAA 4MDZA 3HLEA 1I5QA 3LEQA 4PM6A 4BJPA 2EX6A 2J80A 2QZ6A 2PR5A 3P01A 2PAVP 2DCFA 5AQ9A 1VEUB 3GSGA 2WGWB 3HCYA 1DP6A 1YPRA 1FIKA 2C6WB 3N4IA 4Z9QA 2PU4A 2WKHA 2ZMAA 3UMEA 4ETXA 2QJ7A 5A92A 2QMIA 4MEZA 2V1BA 3MF0A 3E2LA 1E3UA 3K3DA 3BM6A 3HVFA 1HVBA 1K6RA 1QMFA 1F9IA 4ZBEA 5D3OA 1K4EA 4WL9A 4CLCC 2WKPA 5BOHA 4BBVA 3KSIA 3C7UA 5TBMA 3EGXC 3D72A 1GSXA 4R3BA 2UV0E 4ZAMA 1Q2PA 2Q9NA 2HP5A 4OPZA 3UB9A 4UAAA 1F2KA 5E2HA 3P09A 1KDSA 3H82B 2P08A 5DJUA 5CGWA 5JYOA 1P97A 3A3JA 4GZBA 2VK3A 3AGFA 2J9OA 1NY0A 4NXFA 3ISGA 5EPHA 1VHMA 5L10A 4XT2A 3PBNA 1IYQA 3ZG9B 1FOFA 3LUQA 3FYZA 5DF9A 1MKIA 4JXVA 4BBUA 5AJGA 1GSWA 1W63Q 4ZTKA 1TDGA 1P0ZA 2GDNA 2XEPA 1FR1A 2KOIA 3O3VA 3NCKA 2G2UA 2W3FA 4R70A 1C3BA 2QWSA 1MWUA 3S1YA 1VQQA 5IT5A 4QY5A 3VP3A 5AVFA 1S1ZA 4I39A 2ZQ7A 1A0KA 4LRYC 3R7WB 1FSWA 3EWKA 3QP8A 4GLQA 4U0TA 3EEAA 2XK1A 1PI4A 3F1PB 4MCWA 4C75A 4UEYA 1BULA 3OCLA 4JXSA 3ZG0A 3BFGA 1GCEA 2P74A 4UA6A 1SKFA 1MWRA 1T19A 4JPMA 3ZG5A 5GLCA 1ZC2A 4NXEA 4E3MA 3PBQA 4GOGA 2Z6CA 4L9EA 4E3IA 3E4PA 5IS1A 2J3TD 4EBLA 1K54A 3IWOA 4NXBA 5CHMA 4PAUA 5FAOA 3UDFA 3S4XA 4JXWA 1PFLA 3UMDA 1KE0A 3S7PA 2XF3A 3ZGAB 4L0LA 2Y8HA 2JBFA 1EW0A 5DTTA 1ODVA 1AXBA 2Y79A 3GVBA 1YKDA 4ID4A 4E3OA 3VOLA 1BYWA 2Y2OA 3PYPA 3U4LP 3T4SA 5AQ7A 1XJ3A 4N9KA 3T12B 4WBGA 3C5AA 4HEFA 2QJ5A 3T4OA 3IF6B 1G5UA 4DMZA 2H10A 2GX5A 3G34A 4HHDA 4ZJ1A 4IVKA 3QP2A 3T4JA 5GLBA 2ZQ8A 3LICA 4LPZA 1LLBA 4RA7A 2WKEA 5F69A 3HJKA 4QU3A 4S2JA 2Y91A 3O86A 3ZG8B 4WN5A 5E43A 5AVEA 1ZKJA 1E25A 3BLMA 2H0YA 3DTMA 3NHQA 3PR6A 3KYEA 5TGFA 3H7WB 3CITA 3BJNA 3HLCA 4QWOA 2I9VA 3C8CA 4WZ5A 4GCZA 3CWFA 4MMNA 2HPBA 3CPTA 1TS8A 3CJMA 5FAQA 2BLSA 4DE3A 3BRMA 5IHVA 3BY8A 5CXWA 4KQRA 3HREA 3N8RA 1W8YA 2HDQA 4UQIS 1PNEA 2W1RA 2ZL1A 3LR4A 4KQQA 2OLVA 1XXMA 5EVIB 2WZXA 4AFIA 5HWVA 4G3WA 3T1RA 1SZVA 1VETA 1FCOA 2XA7S 3Q1FA 1N9LA 1IYPA 4C3QA 4E6WA 1OPXA 2VLGA 3KSGA 4EETB 4RYEA 3LYXA 3GTCA 2V9AA 3LGOA 4ESPA 3T1XA 4YFMA 3LR5A 4ZJ3A 2JKFA 3QHYA 3M6HA 4KG2A 4OP8A 3WS1A 4CLCE 3LCEA 5M19A 5F6AA 4YOFA 4X6TA 3ULFA 3O87A 1DJAA 2V20A 4FD8A 4JXGA 2PYRA 4N92A 1I2SA 3PBRA 3OPPA 5HPIA 1L0DA 4OQGA 2IWDA 3VV4A 4YINA 3MQ0A 1H3QA 3RXXA 3I7JA 5EV0A 3OBFA 2A24B 1SKOA 5CTNA 2O0YA 2W3GA 3V39A 4CLCA 1FR6A 4JGOA 1E3UD 3FKWA 4R4SA 3W4QA 5L09A 4Y15A 1K57A 4HH3A 2Y2KA 2M1CA 2WADA 3BWLA 3IS2B 4IUHA 4IHQA 1H8ZA 2JKGA 2XD1A 4HIAA 2VZWA 4KZ4A 3TE8A 4KZ6A 3FPWA 3MBZA 5FQQA 1NXYA 3IF5A 3M2KA 3WS4A 1YMSA 4IUKA 3NC8A 4EBNA 1T18A 4MBFA 3K3CA 2JKRM 5FAPA 3QNBA 1FSYA 3IF6C 5KIZA 1FCNA 1T1CA 2PT7A 2PD7A 1BSGA 3HUNA 4ZJ2A 2W3EA 2EFUA 1BUEA 1O7EA 2PRFA 3NECA 2PYPA 4X1LA 4H6JB 4P85A 3OPLA 3BQ8A 1NWZA 3NBLA 3CHWP 1CEFA 2A49A 4UQIM 1GHIA 1K38A 5HWWA 3BFEA 4KZ5A 3NDGA 3Q7VA 2W1TB 1S0WA 2O9CA 3DWKA 4X68A 2OAQ1 4M4XA 2G7UA 4LRZE 1KGGA 1JNUA 4KZBA 1XX2A 1K55C 2EFXA 4GDNA 2XSSA 1GA9A 4DE1A 5GLDA 1BLPA 3F1OA 1MPLA 4E6XA 4PM7A 1I2WA 4EBPA 2P7JA 2VKSA 3ZVTA 1OTBA 3EGDC 3G35A 3MQOA 4BLMA 5FQ9A 3RH8B 5EECA 2H28A 4GHIB 4PMAA 5F68A 5DFYA 4QHCA 1V9ZA 4B88A 2A2LA 2W27A 4LFUA 1JWPA 1LL9A 1IELA 4QJGA 4DE2A 1BT5A 1DP8A 1MBLA 5HFOA 2HDUA 4B4XA 1G6AA 2ZQDA 4LCLA 5M1AA 4F3LB 3ZYTA 4UA9A 2XROA 4Y3IA 1PYYA 3IWIA 2ZD8A 4HJ6A 3UPNA 3VFHA 2H5SA 2M7VA 2I72A 5GHYA 1PRQA 4L9GA 3HLWA 1ES2A 1VEUA 1KVMA 2WGWA 3B3XA 3G2ZA 3OOVA 3W4OA 5FQIA 1SDEA 3A0SA 2WGIA 4I3IA 1HTZA 1EI5A 2B18A 3IX4A 1N9OA 4EQIA 3ZQ5A 3F1NB 1XPBA 4OQ0A 4I3JA 2W3DA 3ZG7B 4DJ3A 2J7VA 2ZC5B 2ZMFA 4OOLA 2PBYA 5A8BA 4L9FA 2AVXA 3GRJA 5CEDA 4NXGA 4EV4A 3UPPA 3MKFA 4Q8IA 4HP4A 2Q0OA 3D9YA 4LCMA 5HAQA 2D01A 5DVAA 3H82A 3UNWA 5HW3A 4FUWA 2R78A 2IWCA 2P04A 4E3LA 1QMEA 2QYBA 5TR7A 2RL3A 5A91A 3SOIA 2X01A 2G2WA 3HLFA 3IBRA 4JGPA 3O5YA 4NG2A 2HJ9C 2L4RA 1TEMA 2INWA 2A3UA 3G30A 3CG5A 5C5KA 4MN5A 4GS9B 4Y7PA 3QNCA 1ZG6A 4PPRA 4WUJA 3IBJA 2Y55A 2R9XA 1ERMA 3IX8A 4II7A 2JKRI 4GJ4A 5FEFA 4OPRA 3CUEC 3KX0X 4DJ2A 4JF4A 5DJTA 5FATA 3T4LA 3ZNTA 4S2LA 1K0KA 2O9AA 3KYQA 1RP5A 1Y54A 3BW6A 4ME4A 5CTMA 3R7WA 3UO9A 1CI9A 1IYOA 3LEZA 2Y2NA 1TDLA 4KZ3A 3QP5A 2PHYA 1OTEA 2ZM0A 3F1PA 4WYYA 3SH7A 3TG9A 1P9RA 1LHYA 3VE3A 5EVEA 1YLZA 3SS3A 4N1XA 4KQDA 4FTXA 5E2GA 4BL2A 1S66L 1LI0A 2OLUA 3N8LA 1IKGA 1OTDA 4HJ4A 4GDBA 4DXCA 1L3LA 2OWJA 3E0YA 2WUQA 4OPQA 2PBDP 3DTKA 4BL3A 4IJGA 3RTYA 3ITAA 5F82A 5A90A 3LIEA 4CLCD 4Y0TA 3VOZA 4MLLA 1DJBA 2ZC4B 4GN2A 1GHMA 5G4ZA 4B9OA 1YQSA 1D7EA 2DRWA 4WF0A 4ARZB 5I94A 3V67A 3UN7A 3M2JA 4R38A 2WZZA 3OCNA 4H8RA 3MJQA 3KSHA 1WYCA 3LIFA 2E8JA 3MXQA 4DN0A 1P9WA 5EM1A 4Q0IA 4XUZA 5TJJA 1PWGA 2FZ0A 2FH5A 1OMEA 2HZ5A 2NUTC 4R4RA 3NJAA 1GHPA 3UE1A 4HESA 4E3NA 2JE5A 2KX6A 2RCXA 3FZCA 2VGLS 2H0TA 2XRNA 2XGNA 3HUOA 3T1SA 2HDRA 4PKYG 1K56A 1Q2QA 1MY8A 2OWHA 4OKPA 4GKUA 5KSCA 3JPUA 3IF6A 4OH0A 1U60A 3B47A 5GHXA 4WELA 2L0WA 5AQBA 3A3DA 5HWTA 3UB7A 1LI9A 2JKTM 2VA0A 2XDMA 4ETZA 1KDWA 4WM9A 3PBOA 4YNRA 3E4QA 4LV0A 4FH2A 4WEKA 1L2SA 1YLWA 2V1ZA 1FQGA 5CEBA 1S4RA 3HBRA 2Q9MA 3GDIA 3KYZA 3BLSA 4BD0A 3KSFA 3H7WA 4Y5FA 1KGEA 3FV7A 3A3EA 1MC0A 3L7HA 2V0WA 4EUZA 4N1HA 4R6LA 3UPOA 1IOUA 2VGJA 4GB7A 3W2ZA 4HY8A 2OAP1 3VSLA 3GQZA 3P98A 3FPVA 4NK3A 1AWIA 3QP4A 1IKIA 5FI2A 5EVIA 1E4DA 1Z09A 4S2NC 4X53A 3V50A 2O9BA 4OOMA 2VGKA 3HLGA 4K0WA 3DTIA 5G4YA 3A3FA 5EE8A 1T1BA 1PWDA 1YLYA 3Q7ZA 3EEHA 1CQAA 4IBRA 2B02A 3SZTA 3WWXA 1LL5A 4HNBA 1YLJA 5CHJA 5EFWA 4P6ZS 2VX8A 5F5YA 2PD8A 3JVUA 1CK3A 4C6YA 1KE3A 3FG8A 1XA1A 1F98A 2OV5A 3V5MA 2ZOIA 1W63M 1XP4A 3MQQA 2VV7A 3BY9A 1Z6FA 1LT0A 1DP9A 1YLPA 1BZAA 1TS0A 1OJ5A 4K08A 4GD6A 1ACFA 1NRJA 2Y59A 3M6BA 2WKIA 3C4OA 1D1JA 1L0GA 2A24A 5EVLA 1K25A 3NOTC 5J3WA 4S2MA 3DW0A 1MXOA 3LIDA 4FH4A 3A3IA 5KMWA 2IA2A 3ITBA 5AQAA 1O07A 1ZHHB 2VGLM 1NLZA 4E3JA 4PM5A 3LFVA 3LIBA 3RFBA 1XGIA 1TVFA 1XJ2A 4HQAA 3IXHA 3T50A 3UE6A 3LY3A 2X02A 3IS2A 3NOPC 4HI4A 3BYDA 4QB8A 3UB5P 1XKZA 4RVAA 3R4KA 5HDCA 1MZUA 2BASA 3IXDA 4P87A 5HD5A 3Q82A 5CERA 1K54C 2XH9A 2Y2PA 1S6RA 4BBTA 1UWNX 1IEMA 1IFQA 3IXGA 3BEBA 3UY6A 2BG1A 4RX2A 4D60A 3UDXA 2ZM2A 3HUMA 3VOYA 3IHAA 5L2FA 4EEUA 4OLDA 3CUEA 4IBXA 4D2OA 2GNXA 4CQHA 3OPHA 5HX9A 4WMCD 4P0MA 4X1MA 3A0RA 2JKTI 3IH9A 3KO6A 4H6JA 2WAEA 4QD4A 5CHUA 4OOYA 3PAEA 3TOIA 3MXSA 4IVIA 3DTEA 3OZHA 1W79A 4RX3A 2W1TA 2KDKA 5A93A 4G3VA 4S2IA 4OVDA 5M18A 2ZQ9A 2XA7M 3LIAA 1KOUA 4BENA 4K0XA 1MWTA 2LB9A 2OOLA 2Z2MB 3WS5A 4O0PA 4BWIA 4HOIA 5DFXA 4UA7A 3IQAA 2V8FA 1G6OA 1VM1A 3Q7VB 3SS4A 1ZTUA 1N9NA 4JGQA 3DWZA 3FKVA 5CGSA 2P9VB 3E98A 3MXRA 1F5MA 4WZ5C 4GHIA 4O7DA 2CC1A 4S2KA 2K2NA 2KLIA 4LGWA 3ZHHA 3C30A 1WA9A 3HLBA 4WEJA 5DKLA 1K6SA 4N9LA 2L1MA 1H8MA 3LI8A 1M40A 5GLAA 3SH8A 2JHEA 1JTDA 1W5DA 5FQMA 3QP1A 1FCMA 2J8YA 1H8YA 3O88A 3LR3A 3VMAA 5EOOA 4MN6A 2XQZA 2ZJ9A 1G68A 1YMXA 3H9WA
chains in the Genus database with same CATH topology
2JCHA 4WYYA 3N6IA 3SH7A 5HL1A 1H5XA 3WRTA 1YLTA 3TG9A 4OLGA 1LHYA 4JBFA 3WRZA 1YLZA 3OC2A 5FSRA 3HLCA 5U47A 3SS3A 2PU2A 1ES3A 1K56D 3OPRA 4N1XA 4WZ5A 2Y2MA 4E3KA 5CGXA 5E2GA 1DY6A 3AGDA 4BL2A 3VP0A 2HPBA 3N8SA 4XXRA 3CJMA 5FAQA 2BLSA 4DE3A 1LI0A 2OLUA 3BRMA 3N8LA 2Y2JA 4HBTA 5IHVA 1IKGA 4X69A 5F1FA 4MNRA 2EX9A 2EX2A 4KQRA 1CI8A 4GDBA 5CXWA 4DXCA 4OPQA 2WUQA 4KG6A 3SH9A 5F1GA 2WGVA 1J9MA 3HREA 4HBUA 3N8RA 4BL3A 1ONGA 1W8YA 2HDQA 3Q81A 4JLFA 4KQQA 3IT9A 2OLVA 4JF6A 1MWSA 1XXMA 3ITAA 5EVIB 2WZXA 5F82A 3NY4A 5HAIA 4Y0TA 3VOZA 1NYYA 5CRFA 4MLLA 4R3JA 1DJBA 2ZC4B 1ZG4A 5EUAA 4GN2A 1GHMA 3BFDA 1FCOA 4R0QA 2Y2LA 1K4FA 1YQSA 3Q1FA 5HAPA 2DRWA 3MFDA 1IYPA 4DDSA 4C3QA 4E6WA 3RXWA 5I94A 3UN7A 3M2JA 2WZZA 2Y4AA 5DF8A 3OCNA 4H8RA 4RYEA 1N9BA 3BFCA 1WYCA 3GTCA 4DE0A 2V2FF 1W8QA 4XUZA 3W4PA 1BLCA 1PWCA 1PWGA 4M3KA 1HD8A 4YFMA 4ZJ3A 1OMEA 4R4RA 3QHYA 3M6HA 1GHPA 2JC7A 4KG2A 4OP8A 3WS1A 5J8XA 3LCEA 3UE1A 4HESA 3WS0A 5M19A 4IEDA 4E3NA 4GNUA 4R23A 2JE5A 3PTEA 4JF5A 4DXBA 2RCXA 5GL9A 3FZCA 1SHVA 2WYXA 2ZQCA 4X6TA 4BQMA 2H0TA 1NZOA 2XGNA 1EROA 3HUOA 3O87A 1K57C 2HDRA 4KENB 4S2NA 4X56A 3JYIA 1KVLA 1K56A 1Q2QA 1DJAA 1MY8A 2V20A 3NIAA 4FD8A 4JXGA 3UDIA 4OKPA 2ZC6B 2ZC3B 4GKUA 4OP5A 4DF6A 2P9VA 4N92A 3NDEA 3IH8A 5KSCA 1JVJA 3D4FA 1I2SA 3PBRA 3OPPA 1L0DA 3IF6A 4OH0A 5EVID 4OQGA 1PZPA 1RGZA 2IWDA 1U60A 5DTKA 3G32A 4YINA 4CJNA 5GHXA 3RXXA 4WELA 2QPNA 3VSKA 3I7JA 1M6KA 1NYMA 5AQBA 3A3DA 3W8KA 5KSHA 3FWLA 5CTNA 1SDNA 1LI9A 2XDMA 3G2YA 4DDYA 3V39A 1XGJA 2Y2GA 4OQIA 4WZ4A 1KDWA 4WM9A 3C7VA 4WMCA 1FR6A 3PBOA 1E3UD 2UWXA 2ZQAA 4LV0A 5KZHA 5EVIC 4FH2A 4WEKA 1JTGA 1L2SA 3FKWA 1YLWA 1PW1A 2V1ZA 4F94A 1FQGA 5CEBA 4R4SA 1W7FA 3W4QA 4S2OA 3RJUA 3E2KA 1K57A 3ZCZA 5FI7A 3HBRA 2Q9MA 1NRFA 2Y2KA 2Y2IA 5FDHA 3BLSA 4BD0A 3PBTA 4FSFA 1JWVA 4NETA 1KGEA 2Y2HA 2WADA 3FV7A 2WAFA 3A3EA 1H8ZA 3SS5A 3LO7A 2XD1A 3GMWA 3S22A 4EUZA 3TSGA 3LY4A 3MZFA 1BLHA 4KZ4A 4N1HA 4KZ6A 1JWZA 3MKEA 4MBHA 4BD1A 3MBZA 3CMZA 5FQKA 4KQOA 3UPOA 2EXBA 4OQHA 1L0FA 4KZ7A 4KZAA 1SCWA 3HLEA 4Y0UA 2VGJA 1I5QA 4GB7A 5DTSA 5FQQA 4PM6A 4BJPA 2EX6A 3G4PA 3VP4A 1NXYA 3IF5A 3VSLA 5G18A 2QZ6A 3GQZA 3M2KA 3P98A 4NK3A 2DCFA 5FQJA 5GHZA 3WS4A 5AQ9A 1YMSA 3GSGA 2WGWB 3NC8A 4LV2A 4ZDXA 1IKIA 5FI2A 5EVIA 1E4DA 3ZVWA 4EBNA 4S2NC 2C6WB 4MBFA 4X53A 3N4IA 3V50A 4K91A 4Z9QA 4OOMA 2PU4A 2WKHA 2ZMAA 4B4ZA 5FAPA 2VGKA 3MZEA 4GD8A 3QNBA 3VP1A 1FSYA 3IF6C 3HLGA 4K0WA 3HL9A 5FASA 3A3FA 4A5RA 5JYPA 1NJ4A 5A92A 1FCNA 1ES5A 3CZDA 5EE8A 2QMIA 4MEZA 3AGEA 1PWDA 1EWZA 1BSGA 1YLYA 3HUNA 3Q7ZA 4S2PA 3E2LA 4IBRA 4ZJ2A 3UE3A 1BTLA 4KZ8A 2EFUA 1E3UA 3BM6A 3HVFA 1ES4A 1HVBA 1K6RA 1BUEA 1N4OA 1QMFA 4OONA 1O7EA 1LL5A 5FI6A 4ZBEA 3IHBA 3WWXA 1YLJA 5D3OA 1K4EA 5F83A 5BOHA 2FFFB 5CHJA 2WK0A 1ESIA 3C7UA 3VP2A 1PW8A 1CK3A 3UE0A 4C6YA 1KE3A 4R3BA 1XA1A 4P85A 3OPLA 4EWFA 4ZAMA 3NBLA 4UHUA 2OV5A 3V5MA 3WS2A 1Q2PA 1CEFA 2Q9NA 1XP4A 2Y2QA 4LENA 2HP9A 2A49A 2HP5A 1GHIA 4OPZA 1K38A 3ZNYA 3BFEA 4KZ5A 4UAAA 5E2HA 5TFQA 3NDGA 3P09A 3Q7VA 1KDSA 1S0WA 1Z6FA 3DWKA 4LV1A 4X68A 3V3SA 1YLPA 5CGWA 1BZAA 5JYOA 3C4PA 1KGGA 1YT4A 3A3JA 4GZBA 1ERQA 2XLNA 4GD6A 4KZBA 1XX2A 1K55C 2C5WB 2Y59A 4DKIA 3AGFA 3M6BA 2EFXA 2J9OA 2WKIA 2Z2LB 1NY0A 4GDNA 5FA7A 3C4OA 3ISGA 1GA9A 1ALQA 5EPHA 1L0GA 3ZFZA 2EXAA 4DE1A 5EVLA 1K25A 5GLDA 4KG5A 1GA0A 1BLPA 3IXBA 4MBKA 3EQVA 1MPLA 4E6XA 4PM7A 4S2MA 1I2WA 4EBPA 4PM8A 3DW0A 1MXOA 3PBNA 3ZVTA 4FH4A 2EX8A 2B5RA 1IYQA 3G35A 3ZG9B 4BLMA 3A3IA 1PI5A 5FQ9A 5KMWA 1FOFA 2ZM8A 3FYZA 5EECA 4OPYA 4X55A 3ITBA 5DF9A 5DF7A 4PMAA 1O07A 1MKIA 5AQAA 4QHCA 4JXVA 2OSUA 1XA7A 4B88A 4E3JA 4PM5A 4ZTKA 1JWPA 1TDGA 2GDNA 1LL9A 1XGIA 4JKTA 2XEPA 1IELA 1TVFA 4QJGA 3IXHA 4U0XA 4DE2A 3LY3A 3VFFA 2X02A 1FR1A 1RCJA 3O3VA 3NCKA 2G2UA 1BT5A 1MBLA 1CEGA 5HFOA 1C3BA 3BYDA 4QB8A 2HDUA 1MWUA 3S1YA 1VQQA 1XKZA 4B4XA 1G6AA 1PZOA 4RVAA 1K55A 2ZQDA 4LCLA 5M1AA 4QY5A 4Y0OA 3VP3A 3BECA 3IXDA 1L0EA 4P87A 4UA9A 2ZQ7A 3Q07A 3Q82A 5CERA 1PYYA 4CPKA 1FSWA 3IWIA 2ZD8A 1K54C 2XH9A 3UPNA 4U0TA 3VFHA 2H5SA 2Y2PA 1NZUA 2I72A 2XK1A 5GHYA 1PI4A 1S6RA 2E8IA 4C75A 1IEMA 3HLWA 1ES2A 1WYBA 1KVMA 2WGWA 3B3XA 3G2ZA 3IXGA 1BULA 3BEBA 5E2FA 3OCLA 2XFSA 3UY6A 2BG1A 4JXSA 3ZG0A 4RX2A 3W4OA 3BFGA 3UDXA 1GCEA 1PIOA 1SDEA 2P74A 2R9WA 2ZM2A 3HUMA 3PBSA 4UA6A 2WGIA 5FQIA 1HTZA 1MWRA 1SKFA 3VOYA 1EI5A 5E2EA 4XUXA 4JPMA 3ZG5A 3IHAA 2FFYA 5L2FA 4R1GA 4EQIA 3BFFA 3EQUA 5GLCA 4OLDA 2HDSA 1DJCA 1ZC2A 4E3MA 1XPBA 2X71A 4LV3A 3PBQA 4GOGA 4OQ0A 4IBXA 3ZG7B 2J7VA 3NI9A 2ZC5B 1BLSA 4D2OA 4E3IA 3GV9A 3HLDA 3OPHA 5HX9A 4OOLA 4WMCD 2PBYA 2XFTA 4P0MA 3GRJA 1KGFA 1YM1A 4EBLA 5CEDA 1KE4A 1K54A 3IWOA 4QY6A 5CHMA 3IH9A 4QD4A 2WAEA 5FAOA 3IWQA 3PAGA 5CHUA 4OOYA 3PAEA 4P6BA 3TOIA 4EV4A 3UDFA 3UPPA 3S4XA 3MXSA 4JXWA 3MKFA 4Q8IA 4IVIA 1KE0A 3OZHA 4LCMA 5HAQA 1W79A 2XF3A 3ZGAB 4RX3A 5A93A 5DVAA 4L0LA 3UNWA 4S2IA 5HW3A 4U3TA 4OVDA 2JBFA 4FCFA 5M18A 2ZQ9A 5DTTA 3ZDJA 4BENA 1AXBA 2IWCA 4K0XA 4DRTA 4E3LA 1QMEA 1MWTA 3MZDA 5TR7A 2Z2MB 2RL3A 3GVBA 5A91A 3WS5A 1IYSA 3SOIA 2X01A 4ID4A 5A90A 2G2WA 3HLFA 4UA7A 4E3OA 3IQAA 4KZ9A 1VM1A 2HP6A 3Q7VB 2IWBA 2Y2OA 3SS4A 5CECA 1ONHA 1RGYA 3V3RA 1WE4A 2XD5A 1TEMA 3DWZA 3FKVA 5CGSA 2P9VB 2A3UA 5AQ7A 4N9KA 3G30A 3G31A 4WBGA 2XR0A 3C5AA 3MXRA 3CG5A 4HEFA 2J9PA 3IF6B 4WZ5C 2H10A 4Y7PA 3GR2A 5EOEA 4O7DA 2CC1A 3G34A 4S2KA 3QNCA 4ZJ1A 1ZG6A 4IVKA 4PM9A 4PPRA 2Y55A 2R9XA 1ERMA 5GLBA 3ZHHA 2ZQ8A 3N7WA 1LLBA 3HLBA 4RA7A 4WEJA 2WKEA 4QU3A 1K6SA 4N9LA 4OPRA 2ZC7A 4S2JA 2Y91A 4JF4A 1M40A 3O86A 5GLAA 5FATA 3ZG8B 3SH8A 4S2LA 3ZNTA 1HZOA 1JTDA 5E43A 1W5DA 5FQMA 1ZKJA 1FCMA 2DNSA 2J8YA 1RP5A 1E25A 1Y54A 1H8YA 3BLMA 3O88A 2H0YA 5CTMA 3UO9A 1CI9A 1IYOA 3DTMA 3LEZA 5EOOA 3VMAA 2Y2NA 1TDLA 2XQZA 2ZJ9A 4KZ3A 5HARA 1G68A 1ESUA 5TGFA 2ZLYA 1YMXA 2ZM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JCH A;  4WYY A;  3N6I A;  3SH7 A;  5HL1 A;  1H5X A;  3WRT A;  1YLT A;  3TG9 A;  4OLG A;  1LHY A;  4JBF A;  3WRZ A;  1YLZ A;  3OC2 A;  5FSR A;  3HLC A;  5U47 A;  3SS3 A;  2PU2 A;  1ES3 A;  1K56 D;  3OPR A;  4N1X A;  4WZ5 A;  2Y2M A;  4E3K A;  5CGX A;  5E2G A;  1DY6 A;  3AGD A;  4BL2 A;  3VP0 A;  2HPB A;  3N8S A;  4XXR A;  3CJM A;  5FAQ A;  2BLS A;  4DE3 A;  1LI0 A;  2OLU A;  3BRM A;  3N8L A;  2Y2J A;  4HBT A;  5IHV A;  1IKG A;  4X69 A;  5F1F A;  4MNR A;  2EX9 A;  2EX2 A;  4KQR A;  1CI8 A;  4GDB A;  5CXW A;  4DXC A;  4OPQ A;  2WUQ A;  4KG6 A;  3SH9 A;  5F1G A;  2WGV A;  1J9M A;  3HRE A;  4HBU A;  3N8R A;  4BL3 A;  1ONG A;  1W8Y A;  2HDQ A;  3Q81 A;  4JLF A;  4KQQ A;  3IT9 A;  2OLV A;  4JF6 A;  1MWS A;  1XXM A;  3ITA A;  5EVI B;  2WZX A;  5F82 A;  3NY4 A;  5HAI A;  4Y0T A;  3VOZ A;  1NYY A;  5CRF A;  4MLL A;  4R3J A;  1DJB A;  2ZC4 B;  1ZG4 A;  5EUA A;  4GN2 A;  1GHM A;  3BFD A;  1FCO A;  4R0Q A;  2Y2L A;  1K4F A;  1YQS A;  3Q1F A;  5HAP A;  2DRW A;  3MFD A;  1IYP A;  4DDS A;  4C3Q A;  4E6W A;  3RXW A;  5I94 A;  3UN7 A;  3M2J A;  2WZZ A;  2Y4A A;  5DF8 A;  3OCN A;  4H8R A;  4RYE A;  1N9B A;  3BFC A;  1WYC A;  3GTC A;  4DE0 A;  2V2F F;  1W8Q A;  4XUZ A;  3W4P A;  1BLC A;  1PWC A;  1PWG A;  4M3K A;  1HD8 A;  4YFM A;  4ZJ3 A;  1OME A;  4R4R A;  3QHY A;  3M6H A;  1GHP A;  2JC7 A;  4KG2 A;  4OP8 A;  3WS1 A;  5J8X A;  3LCE A;  3UE1 A;  4HES A;  3WS0 A;  5M19 A;  4IED A;  4E3N A;  4GNU A;  4R23 A;  2JE5 A;  3PTE A;  4JF5 A;  4DXB A;  2RCX A;  5GL9 A;  3FZC A;  1SHV A;  2WYX A;  2ZQC A;  4X6T A;  4BQM A;  2H0T A;  1NZO A;  2XGN A;  1ERO A;  3HUO A;  3O87 A;  1K57 C;  2HDR A;  4KEN B;  4S2N A;  4X56 A;  3JYI A;  1KVL A;  1K56 A;  1Q2Q A;  1DJA A;  1MY8 A;  2V20 A;  3NIA A;  4FD8 A;  4JXG A;  3UDI A;  4OKP A;  2ZC6 B;  2ZC3 B;  4GKU A;  4OP5 A;  4DF6 A;  2P9V A;  4N92 A;  3NDE A;  3IH8 A;  5KSC A;  1JVJ A;  3D4F A;  1I2S A;  3PBR A;  3OPP A;  1L0D A;  3IF6 A;  4OH0 A;  5EVI D;  4OQG A;  1PZP A;  1RGZ A;  2IWD A;  1U60 A;  5DTK A;  3G32 A;  4YIN A;  4CJN A;  5GHX A;  3RXX A;  4WEL A;  2QPN A;  3VSK A;  3I7J A;  1M6K A;  1NYM A;  5AQB A;  3A3D A;  3W8K A;  5KSH A;  3FWL A;  5CTN A;  1SDN A;  1LI9 A;  2XDM A;  3G2Y A;  4DDY A;  3V39 A;  1XGJ A;  2Y2G A;  4OQI A;  4WZ4 A;  1KDW A;  4WM9 A;  3C7V A;  4WMC A;  1FR6 A;  3PBO A;  1E3U D;  2UWX A;  2ZQA A;  4LV0 A;  5KZH A;  5EVI C;  4FH2 A;  4WEK A;  1JTG A;  1L2S A;  3FKW A;  1YLW A;  1PW1 A;  2V1Z A;  4F94 A;  1FQG A;  5CEB A;  4R4S A;  1W7F A;  3W4Q A;  4S2O A;  3RJU A;  3E2K A;  1K57 A;  3ZCZ A;  5FI7 A;  3HBR A;  2Q9M A;  1NRF A;  2Y2K A;  2Y2I A;  5FDH A;  3BLS A;  4BD0 A;  3PBT A;  4FSF A;  1JWV A;  4NET A;  1KGE A;  2Y2H A;  2WAD A;  3FV7 A;  2WAF A;  3A3E A;  1H8Z A;  3SS5 A;  3LO7 A;  2XD1 A;  3GMW A;  3S22 A;  4EUZ A;  3TSG A;  3LY4 A;  3MZF A;  1BLH A;  4KZ4 A;  4N1H A;  4KZ6 A;  1JWZ A;  3MKE A;  4MBH A;  4BD1 A;  3MBZ A;  3CMZ A;  5FQK A;  4KQO A;  3UPO A;  2EXB A;  4OQH A;  1L0F A;  4KZ7 A;  4KZA A;  1SCW A;  3HLE A;  4Y0U A;  2VGJ A;  1I5Q A;  4GB7 A;  5DTS A;  5FQQ A;  4PM6 A;  4BJP A;  2EX6 A;  3G4P A;  3VP4 A;  1NXY A;  3IF5 A;  3VSL A;  5G18 A;  2QZ6 A;  3GQZ A;  3M2K A;  3P98 A;  4NK3 A;  2DCF A;  5FQJ A;  5GHZ A;  3WS4 A;  5AQ9 A;  1YMS A;  3GSG A;  2WGW B;  3NC8 A;  4LV2 A;  4ZDX A;  1IKI A;  5FI2 A;  5EVI A;  1E4D A;  3ZVW A;  4EBN A;  4S2N C;  2C6W B;  4MBF A;  4X53 A;  3N4I A;  3V50 A;  4K91 A;  4Z9Q A;  4OOM A;  2PU4 A;  2WKH A;  2ZMA A;  4B4Z A;  5FAP A;  2VGK A;  3MZE A;  4GD8 A;  3QNB A;  3VP1 A;  1FSY A;  3IF6 C;  3HLG A;  4K0W A;  3HL9 A;  5FAS A;  3A3F A;  4A5R A;  5JYP A;  1NJ4 A;  5A92 A;  1FCN A;  1ES5 A;  3CZD A;  5EE8 A;  2QMI A;  4MEZ A;  3AGE A;  1PWD A;  1EWZ A;  1BSG A;  1YLY A;  3HUN A;  3Q7Z A;  4S2P A;  3E2L A;  4IBR A;  4ZJ2 A;  3UE3 A;  1BTL A;  4KZ8 A;  2EFU A;  1E3U A;  3BM6 A;  3HVF A;  1ES4 A;  1HVB A;  1K6R A;  1BUE A;  1N4O A;  1QMF A;  4OON A;  1O7E A;  1LL5 A;  5FI6 A;  4ZBE A;  3IHB A;  3WWX A;  1YLJ A;  5D3O A;  1K4E A;  5F83 A;  5BOH A;  2FFF B;  5CHJ A;  2WK0 A;  1ESI A;  3C7U A;  3VP2 A;  1PW8 A;  1CK3 A;  3UE0 A;  4C6Y A;  1KE3 A;  4R3B A;  1XA1 A;  4P85 A;  3OPL A;  4EWF A;  4ZAM A;  3NBL A;  4UHU A;  2OV5 A;  3V5M A;  3WS2 A;  1Q2P A;  1CEF A;  2Q9N A;  1XP4 A;  2Y2Q A;  4LEN A;  2HP9 A;  2A49 A;  2HP5 A;  1GHI A;  4OPZ A;  1K38 A;  3ZNY A;  3BFE A;  4KZ5 A;  4UAA A;  5E2H A;  5TFQ A;  3NDG A;  3P09 A;  3Q7V A;  1KDS A;  1S0W A;  1Z6F A;  3DWK A;  4LV1 A;  4X68 A;  3V3S A;  1YLP A;  5CGW A;  1BZA A;  5JYO A;  3C4P A;  1KGG A;  1YT4 A;  3A3J A;  4GZB A;  1ERQ A;  2XLN A;  4GD6 A;  4KZB A;  1XX2 A;  1K55 C;  2C5W B;  2Y59 A;  4DKI A;  3AGF A;  3M6B A;  2EFX A;  2J9O A;  2WKI A;  2Z2L B;  1NY0 A;  4GDN A;  5FA7 A;  3C4O A;  3ISG A;  1GA9 A;  1ALQ A;  5EPH A;  1L0G A;  3ZFZ A;  2EXA A;  4DE1 A;  5EVL A;  1K25 A;  5GLD A;  4KG5 A;  1GA0 A;  1BLP A;  3IXB A;  4MBK A;  3EQV A;  1MPL A;  4E6X A;  4PM7 A;  4S2M A;  1I2W A;  4EBP A;  4PM8 A;  3DW0 A;  1MXO A;  3PBN A;  3ZVT A;  4FH4 A;  2EX8 A;  2B5R A;  1IYQ A;  3G35 A;  3ZG9 B;  4BLM A;  3A3I A;  1PI5 A;  5FQ9 A;  5KMW A;  1FOF A;  2ZM8 A;  3FYZ A;  5EEC A;  4OPY A;  4X55 A;  3ITB A;  5DF9 A;  5DF7 A;  4PMA A;  1O07 A;  1MKI A;  5AQA A;  4QHC A;  4JXV A;  2OSU A;  1XA7 A;  4B88 A;  4E3J A;  4PM5 A;  4ZTK A;  1JWP A;  1TDG A;  2GDN A;  1LL9 A;  1XGI A;  4JKT A;  2XEP A;  1IEL A;  1TVF A;  4QJG A;  3IXH A;  4U0X A;  4DE2 A;  3LY3 A;  3VFF A;  2X02 A;  1FR1 A;  1RCJ A;  3O3V A;  3NCK A;  2G2U A;  1BT5 A;  1MBL A;  1CEG A;  5HFO A;  1C3B A;  3BYD A;  4QB8 A;  2HDU A;  1MWU A;  3S1Y A;  1VQQ A;  1XKZ A;  4B4X A;  1G6A A;  1PZO A;  4RVA A;  1K55 A;  2ZQD A;  4LCL A;  5M1A A;  4QY5 A;  4Y0O A;  3VP3 A;  3BEC A;  3IXD A;  1L0E A;  4P87 A;  4UA9 A;  2ZQ7 A;  3Q07 A;  3Q82 A;  5CER A;  1PYY A;  4CPK A;  1FSW A;  3IWI A;  2ZD8 A;  1K54 C;  2XH9 A;  3UPN A;  4U0T A;  3VFH A;  2H5S A;  2Y2P A;  1NZU A;  2I72 A;  2XK1 A;  5GHY A;  1PI4 A;  1S6R A;  2E8I A;  4C75 A;  1IEM A;  3HLW A;  1ES2 A;  1WYB A;  1KVM A;  2WGW A;  3B3X A;  3G2Z A;  3IXG A;  1BUL A;  3BEB A;  5E2F A;  3OCL A;  2XFS A;  3UY6 A;  2BG1 A;  4JXS A;  3ZG0 A;  4RX2 A;  3W4O A;  3BFG A;  3UDX A;  1GCE A;  1PIO A;  1SDE A;  2P74 A;  2R9W A;  2ZM2 A;  3HUM A;  3PBS A;  4UA6 A;  2WGI A;  5FQI A;  1HTZ A;  1MWR A;  1SKF A;  3VOY A;  1EI5 A;  5E2E A;  4XUX A;  4JPM A;  3ZG5 A;  3IHA A;  2FFY A;  5L2F A;  4R1G A;  4EQI A;  3BFF A;  3EQU A;  5GLC A;  4OLD A;  2HDS A;  1DJC A;  1ZC2 A;  4E3M A;  1XPB A;  2X71 A;  4LV3 A;  3PBQ A;  4GOG A;  4OQ0 A;  4IBX A;  3ZG7 B;  2J7V A;  3NI9 A;  2ZC5 B;  1BLS A;  4D2O A;  4E3I A;  3GV9 A;  3HLD A;  3OPH A;  5HX9 A;  4OOL A;  4WMC D;  2PBY A;  2XFT A;  4P0M A;  3GRJ A;  1KGF A;  1YM1 A;  4EBL A;  5CED A;  1KE4 A;  1K54 A;  3IWO A;  4QY6 A;  5CHM A;  3IH9 A;  4QD4 A;  2WAE A;  5FAO A;  3IWQ A;  3PAG A;  5CHU A;  4OOY A;  3PAE A;  4P6B A;  3TOI A;  4EV4 A;  3UDF A;  3UPP A;  3S4X A;  3MXS A;  4JXW A;  3MKF A;  4Q8I A;  4IVI A;  1KE0 A;  3OZH A;  4LCM A;  5HAQ A;  1W79 A;  2XF3 A;  3ZGA B;  4RX3 A;  5A93 A;  5DVA A;  4L0L A;  3UNW A;  4S2I A;  5HW3 A;  4U3T A;  4OVD A;  2JBF A;  4FCF A;  5M18 A;  2ZQ9 A;  5DTT A;  3ZDJ A;  4BEN A;  1AXB A;  2IWC A;  4K0X A;  4DRT A;  4E3L A;  1QME A;  1MWT A;  3MZD A;  5TR7 A;  2Z2M B;  2RL3 A;  3GVB A;  5A91 A;  3WS5 A;  1IYS A;  3SOI A;  2X01 A;  4ID4 A;  5A90 A;  2G2W A;  3HLF A;  4UA7 A;  4E3O A;  3IQA A;  4KZ9 A;  1VM1 A;  2HP6 A;  3Q7V B;  2IWB A;  2Y2O A;  3SS4 A;  5CEC A;  1ONH A;  1RGY A;  3V3R A;  1WE4 A;  2XD5 A;  1TEM A;  3DWZ A;  3FKV A;  5CGS A;  2P9V B;  2A3U A;  5AQ7 A;  4N9K A;  3G30 A;  3G31 A;  4WBG A;  2XR0 A;  3C5A A;  3MXR A;  3CG5 A;  4HEF A;  2J9P A;  3IF6 B;  4WZ5 C;  2H10 A;  4Y7P A;  3GR2 A;  5EOE A;  4O7D A;  2CC1 A;  3G34 A;  4S2K A;  3QNC A;  4ZJ1 A;  1ZG6 A;  4IVK A;  4PM9 A;  4PPR A;  2Y55 A;  2R9X A;  1ERM A;  5GLB A;  3ZHH A;  2ZQ8 A;  3N7W A;  1LLB A;  3HLB A;  4RA7 A;  4WEJ A;  2WKE A;  4QU3 A;  1K6S A;  4N9L A;  4OPR A;  2ZC7 A;  4S2J A;  2Y91 A;  4JF4 A;  1M40 A;  3O86 A;  5GLA A;  5FAT A;  3ZG8 B;  3SH8 A;  4S2L A;  3ZNT A;  1HZO A;  1JTD A;  5E43 A;  1W5D A;  5FQM A;  1ZKJ A;  1FCM A;  2DNS A;  2J8Y A;  1RP5 A;  1E25 A;  1Y54 A;  1H8Y A;  3BLM A;  3O88 A;  2H0Y A;  5CTM A;  3UO9 A;  1CI9 A;  1IYO A;  3DTM A;  3LEZ A;  5EOO A;  3VMA A;  2Y2N A;  1TDL A;  2XQZ A;  2ZJ9 A;  4KZ3 A;  5HAR A;  1G68 A;  1ESU A;  5TGF A;  2ZLY A;  1YMX A;  2ZM0 A; 
#chains in the Genus database with same CATH topology
 3N6I A;  5HL1 A;  1H5X A;  3WRT A;  3S7N A;  1YLT A;  1STZ A;  4OLG A;  5FSR A;  5U47 A;  1ES3 A;  1K56 D;  2Y2M A;  1DY6 A;  3AGD A;  3TRC A;  2DMW A;  4HBT A;  4X69 A;  2NUP C;  1CI8 A;  4KG6 A;  5F1G A;  2WGV A;  5FEG A;  1J9M A;  2W0N A;  3F1N A;  5HPF A;  1ONG A;  3EOI A;  4JLF A;  1S1Y A;  3K2N A;  2JN7 A;  5HAI A;  4JF6 A;  1MWS A;  2ZBB A;  4QPR A;  3FC7 A;  5EUA A;  3BFD A;  2VV8 A;  2Y2L A;  2ZOH A;  2MJ6 A;  4DDS A;  3RXW A;  5J4E A;  5DF8 A;  3MR0 A;  1N9B A;  3BFC A;  4WLA A;  3CI6 A;  2V2F F;  2QHK A;  2M7U A;  3CLO A;  1BLC A;  3NUL A;  4JGR A;  3OLO A;  2J3T C;  5TBM B;  1Y28 A;  2JC7 A;  3WS0 A;  4IED A;  4GNU A;  3PTE A;  5FL3 A;  2GJ3 A;  2V8C A;  2WYX A;  2ZQC A;  3ICY A;  4BQM A;  3C2W A;  3TW8 A;  5K5B A;  1K57 C;  4KEN B;  4S2N A;  4X56 A;  3JYI A;  1KVL A;  3UDI A;  4EWF A;  4OP5 A;  4DF6 A;  3NDE A;  3SW1 A;  3IH8 A;  1X0O A;  1G28 A;  5EVI D;  4GS9 A;  3G32 A;  1UWP X;  1M6K A;  5KSH A;  3G2Y A;  4G3K A;  4DDY A;  1XGJ A;  2Y2G A;  4XT2 B;  4WMC A;  5HSQ A;  2UWX A;  2ZQA A;  5DKK A;  1OTA A;  1JTG A;  1OT9 A;  1PW1 A;  4EEP A;  4BMW A;  4E04 A;  3RJU A;  3ZCZ A;  5FI7 A;  1NRF A;  2Y2I A;  2WKQ A;  3PBT A;  4FSF A;  4NET A;  2Y2H A;  1VB6 A;  3SS5 A;  3LO7 A;  3QP6 A;  1TS7 A;  3GMW A;  3S22 A;  3TSG A;  1CJF A;  3MZF A;  1BLH A;  5L8M A;  3MKE A;  4MBH A;  4BD1 A;  2B95 A;  3T4T A;  4EU0 A;  4KQO A;  2EXB A;  1SCW A;  4Y0U A;  5DTS A;  2CMN A;  3P7N A;  1XJ4 A;  3G4P A;  3VP4 A;  5G18 A;  3S7O A;  4I38 A;  1LSX A;  5FQJ A;  5GHZ A;  5HD3 A;  5CX7 A;  4LV2 A;  4ZDX A;  3ZVW A;  4K91 A;  1D06 A;  4B4Z A;  1J3W A;  3MZE A;  3T4Q A;  4GD8 A;  3VP1 A;  2YKH A;  5FAS A;  3HL9 A;  4ARZ A;  4A5R A;  5JYP A;  1NJ4 A;  1ES5 A;  3CZD A;  5HL6 A;  3AGE A;  2HV1 A;  1EWZ A;  5FDS A;  3B42 A;  2HJE A;  4S2P A;  3UE3 A;  1LL8 A;  1BTL A;  4KZ8 A;  4PKY A;  1ES4 A;  4OON A;  1N4O A;  5FI6 A;  3IHB A;  4PHT A;  5F83 A;  1HLU P;  2FFF B;  3DBA A;  1ESI A;  2WK0 A;  3VP2 A;  1PW8 A;  4HP9 A;  3UE0 A;  1S67 L;  3E4O A;  5L07 A;  4NKP A;  4EW7 A;  1UGU A;  1YAX A;  4UHU A;  3WS2 A;  1T1A A;  2Y2Q A;  4LEN A;  2HP9 A;  4KUK A;  3IX3 A;  3S7Q A;  3ZNY A;  4B93 A;  1LSV A;  5TFQ A;  4LV1 A;  3V3S A;  3C4P A;  1YT4 A;  2EWW A;  1ERQ A;  2XLN A;  2C5W B;  4DKI A;  2Z2L B;  5FA7 A;  4HJ3 A;  2WKR A;  1ALQ A;  3ZFZ A;  1S4S A;  2EXA A;  3MSH A;  1GA0 A;  3IXB A;  4KG5 A;  4MBK A;  3EQV A;  3HJI A;  2K7S A;  4PM8 A;  3MFX A;  4R3A A;  2D02 A;  2EX8 A;  2B5R A;  5EM0 A;  1FIL A;  2Z6D A;  1PI5 A;  2ZM8 A;  4OPY A;  4X55 A;  5DF7 A;  2OSU A;  1XA7 A;  4JKT A;  3UB8 A;  4U0X A;  3VFF A;  1RCJ A;  3LR0 A;  1CEG A;  3U2A A;  1PZO A;  1K55 A;  4O8G A;  5HZH A;  4Y0O A;  3BEC A;  1L0E A;  4GW9 A;  2V0U A;  3Q07 A;  4CPK A;  1CF0 A;  3T4K A;  1XFQ A;  1NZU A;  2E8I A;  2EWV A;  1WYB A;  2EA9 A;  4EER A;  5E2F A;  4EXO A;  2XFS A;  1PIO A;  2R9W A;  3PBS A;  3CPT B;  4YWZ A;  5E2E A;  4XUX A;  2W3H A;  4FOF A;  3NOU C;  2FFY A;  4R1G A;  3BFF A;  3EQU A;  3C38 A;  1Y4O A;  2HDS A;  1DJC A;  2V1A A;  2X71 A;  4LV3 A;  3UB6 A;  3NI9 A;  1BLS A;  2BTF P;  2ZL1 B;  4KUO A;  1LSW A;  3GV9 A;  3HLD A;  4Q0H A;  2PDR A;  1VET B;  2XFT A;  4Y17 A;  1KGF A;  1YM1 A;  1KE4 A;  4QY6 A;  1TD5 A;  3IWQ A;  3PAG A;  1YSP A;  4P6B A;  3L9K A;  3BQA A;  4Z1W A;  4U3T A;  4FCF A;  3ZDJ A;  4DRT A;  3MZD A;  5LBR A;  1IYS A;  3MMH A;  3MS6 A;  4KZ9 A;  2HP6 A;  2IWB A;  1TF1 A;  5CEC A;  1ONH A;  1RGY A;  3V3R A;  1WE4 A;  3G6O A;  2XD5 A;  3G31 A;  2XR0 A;  2J9P A;  3PXP A;  3VE4 A;  3GR2 A;  5EOE A;  5HDS A;  4HH2 A;  4Y2F A;  4PM9 A;  1SKO B;  3B33 A;  3N7W A;  4CLC B;  2HGV A;  2ZC7 A;  1XFN A;  1YSQ A;  3CAX A;  5J7E A;  1HZO A;  1OTI A;  2DNS A;  5HAR A;  1ESU A;  1V9Y A;  2ZLY A;  2K31 A;  2JCH A;  1GSV A;  4JBF A;  3WRZ A;  3T1Q B;  3OC2 A;  4LLO B;  2PU2 A;  2VV6 A;  3OPR A;  3DAV A;  3PHY A;  4E3K A;  5CGX A;  4I3A A;  3VP0 A;  3N8S A;  4XXR A;  2YKF A;  2Y2J A;  5F1F A;  4MNR A;  2EX9 A;  2EX2 A;  3SH9 A;  4HBU A;  5I5L A;  2LB5 A;  2O99 A;  4I5S A;  3Q81 A;  4ZRR A;  3IT9 A;  3NY4 A;  5IU1 A;  4LRX C;  1NYY A;  5CRF A;  4R3J A;  4O01 A;  1ZG4 A;  4R0Q A;  1K4F A;  5HAP A;  3MFD A;  3A0V A;  3GEC A;  2Y4A A;  1OJG A;  2VEA A;  1H0M A;  4DE0 A;  1W8Q A;  2PR6 A;  3W4P A;  4EQ1 A;  1PWC A;  4M3K A;  1HD8 A;  4Q0J A;  5J8X A;  4R23 A;  4DXB A;  4JF5 A;  2QKP A;  5GL9 A;  1SHV A;  2GZA A;  2VJW A;  3LI9 A;  1NZO A;  1ERO A;  4EUV A;  2HF6 A;  3NIA A;  5MC7 A;  2ZC6 B;  2ZC3 B;  4P6Z M;  2P9V A;  1JVJ A;  3D4F A;  1TS6 A;  2ZMV A;  4RQ9 A;  1XJ6 A;  1PZP A;  1RGZ A;  5DTK A;  3TJZ C;  4CJN A;  2QPN A;  3VSK A;  1NYM A;  3W8K A;  3FWL A;  1SDN A;  3F1O B;  4X25 A;  2ACG A;  4WZ4 A;  4OQI A;  5HDD A;  3C7V A;  4Y13 A;  1MKM A;  1NLY A;  1OT6 A;  5KZH A;  5EVI C;  4NEE D;  4F3L A;  4F94 A;  3D3O A;  1W7F A;  4S2O A;  3E2K A;  5FDH A;  4EES A;  1DRM A;  1JWV A;  2WAF A;  3JVV A;  3LY4 A;  1JWZ A;  2J3W A;  4MN7 A;  3CMZ A;  5FQK A;  4OQH A;  1L0F A;  4KZ7 A;  4KZA A;  4MDZ A;  3HLE A;  1I5Q A;  3LEQ A;  4PM6 A;  4BJP A;  2EX6 A;  2J80 A;  2QZ6 A;  2PR5 A;  3P01 A;  2PAV P;  2DCF A;  5AQ9 A;  1VEU B;  3GSG A;  2WGW B;  3HCY A;  1DP6 A;  1YPR A;  1FIK A;  2C6W B;  3N4I A;  4Z9Q A;  2PU4 A;  2WKH A;  2ZMA A;  3UME A;  4ETX A;  2QJ7 A;  5A92 A;  2QMI A;  4MEZ A;  2V1B A;  3MF0 A;  3E2L A;  1E3U A;  3K3D A;  3BM6 A;  3HVF A;  1HVB A;  1K6R A;  1QMF A;  1F9I A;  4ZBE A;  5D3O A;  1K4E A;  4WL9 A;  4CLC C;  2WKP A;  5BOH A;  4BBV A;  3KSI A;  3C7U A;  5TBM A;  3EGX C;  3D72 A;  1GSX A;  4R3B A;  2UV0 E;  4ZAM A;  1Q2P A;  2Q9N A;  2HP5 A;  4OPZ A;  3UB9 A;  4UAA A;  1F2K A;  5E2H A;  3P09 A;  1KDS A;  3H82 B;  2P08 A;  5DJU A;  5CGW A;  5JYO A;  1P97 A;  3A3J A;  4GZB A;  2VK3 A;  3AGF A;  2J9O A;  1NY0 A;  4NXF A;  3ISG A;  5EPH A;  1VHM A;  5L10 A;  4XT2 A;  3PBN A;  1IYQ A;  3ZG9 B;  1FOF A;  3LUQ A;  3FYZ A;  5DF9 A;  1MKI A;  4JXV A;  4BBU A;  5AJG A;  1GSW A;  1W63 Q;  4ZTK A;  1TDG A;  1P0Z A;  2GDN A;  2XEP A;  1FR1 A;  2KOI A;  3O3V A;  3NCK A;  2G2U A;  2W3F A;  4R70 A;  1C3B A;  2QWS A;  1MWU A;  3S1Y A;  1VQQ A;  5IT5 A;  4QY5 A;  3VP3 A;  5AVF A;  1S1Z A;  4I39 A;  2ZQ7 A;  1A0K A;  4LRY C;  3R7W B;  1FSW A;  3EWK A;  3QP8 A;  4GLQ A;  4U0T A;  3EEA A;  2XK1 A;  1PI4 A;  3F1P B;  4MCW A;  4C75 A;  4UEY A;  1BUL A;  3OCL A;  4JXS A;  3ZG0 A;  3BFG A;  1GCE A;  2P74 A;  4UA6 A;  1SKF A;  1MWR A;  1T19 A;  4JPM A;  3ZG5 A;  5GLC A;  1ZC2 A;  4NXE A;  4E3M A;  3PBQ A;  4GOG A;  2Z6C A;  4L9E A;  4E3I A;  3E4P A;  5IS1 A;  2J3T D;  4EBL A;  1K54 A;  3IWO A;  4NXB A;  5CHM A;  4PAU A;  5FAO A;  3UDF A;  3S4X A;  4JXW A;  1PFL A;  3UMD A;  1KE0 A;  3S7P A;  2XF3 A;  3ZGA B;  4L0L A;  2Y8H A;  2JBF A;  1EW0 A;  5DTT A;  1ODV A;  1AXB A;  2Y79 A;  3GVB A;  1YKD A;  4ID4 A;  4E3O A;  3VOL A;  1BYW A;  2Y2O A;  3PYP A;  3U4L P;  3T4S A;  5AQ7 A;  1XJ3 A;  4N9K A;  3T12 B;  4WBG A;  3C5A A;  4HEF A;  2QJ5 A;  3T4O A;  3IF6 B;  1G5U A;  4DMZ A;  2H10 A;  2GX5 A;  3G34 A;  4HHD A;  4ZJ1 A;  4IVK A;  3QP2 A;  3T4J A;  5GLB A;  2ZQ8 A;  3LIC A;  4LPZ A;  1LLB A;  4RA7 A;  2WKE A;  5F69 A;  3HJK A;  4QU3 A;  4S2J A;  2Y91 A;  3O86 A;  3ZG8 B;  4WN5 A;  5E43 A;  5AVE A;  1ZKJ A;  1E25 A;  3BLM A;  2H0Y A;  3DTM A;  3NHQ A;  3PR6 A;  3KYE A;  5TGF A;  3H7W B;  3CIT A;  3BJN A;  3HLC A;  4QWO A;  2I9V A;  3C8C A;  4WZ5 A;  4GCZ A;  3CWF A;  4MMN A;  2HPB A;  3CPT A;  1TS8 A;  3CJM A;  5FAQ A;  2BLS A;  4DE3 A;  3BRM A;  5IHV A;  3BY8 A;  5CXW A;  4KQR A;  3HRE A;  3N8R A;  1W8Y A;  2HDQ A;  4UQI S;  1PNE A;  2W1R A;  2ZL1 A;  3LR4 A;  4KQQ A;  2OLV A;  1XXM A;  5EVI B;  2WZX A;  4AFI A;  5HWV A;  4G3W A;  3T1R A;  1SZV A;  1VET A;  1FCO A;  2XA7 S;  3Q1F A;  1N9L A;  1IYP A;  4C3Q A;  4E6W A;  1OPX A;  2VLG A;  3KSG A;  4EET B;  4RYE A;  3LYX A;  3GTC A;  2V9A A;  3LGO A;  4ESP A;  3T1X A;  4YFM A;  3LR5 A;  4ZJ3 A;  2JKF A;  3QHY A;  3M6H A;  4KG2 A;  4OP8 A;  3WS1 A;  4CLC E;  3LCE A;  5M19 A;  5F6A A;  4YOF A;  4X6T A;  3ULF A;  3O87 A;  1DJA A;  2V20 A;  4FD8 A;  4JXG A;  2PYR A;  4N92 A;  1I2S A;  3PBR A;  3OPP A;  5HPI A;  1L0D A;  4OQG A;  2IWD A;  3VV4 A;  4YIN A;  3MQ0 A;  1H3Q A;  3RXX A;  3I7J A;  5EV0 A;  3OBF A;  2A24 B;  1SKO A;  5CTN A;  2O0Y A;  2W3G A;  3V39 A;  4CLC A;  1FR6 A;  4JGO A;  1E3U D;  3FKW A;  4R4S A;  3W4Q A;  5L09 A;  4Y15 A;  1K57 A;  4HH3 A;  2Y2K A;  2M1C A;  2WAD A;  3BWL A;  3IS2 B;  4IUH A;  4IHQ A;  1H8Z A;  2JKG A;  2XD1 A;  4HIA A;  2VZW A;  4KZ4 A;  3TE8 A;  4KZ6 A;  3FPW A;  3MBZ A;  5FQQ A;  1NXY A;  3IF5 A;  3M2K A;  3WS4 A;  1YMS A;  4IUK A;  3NC8 A;  4EBN A;  1T18 A;  4MBF A;  3K3C A;  2JKR M;  5FAP A;  3QNB A;  1FSY A;  3IF6 C;  5KIZ A;  1FCN A;  1T1C A;  2PT7 A;  2PD7 A;  1BSG A;  3HUN A;  4ZJ2 A;  2W3E A;  2EFU A;  1BUE A;  1O7E A;  2PRF A;  3NEC A;  2PYP A;  4X1L A;  4H6J B;  4P85 A;  3OPL A;  3BQ8 A;  1NWZ A;  3NBL A;  3CHW P;  1CEF A;  2A49 A;  4UQI M;  1GHI A;  1K38 A;  5HWW A;  3BFE A;  4KZ5 A;  3NDG A;  3Q7V A;  2W1T B;  1S0W A;  2O9C A;  3DWK A;  4X68 A;  2OAQ 1;  4M4X A;  2G7U A;  4LRZ E;  1KGG A;  1JNU A;  4KZB A;  1XX2 A;  1K55 C;  2EFX A;  4GDN A;  2XSS A;  1GA9 A;  4DE1 A;  5GLD A;  1BLP A;  3F1O A;  1MPL A;  4E6X A;  4PM7 A;  1I2W A;  4EBP A;  2P7J A;  2VKS A;  3ZVT A;  1OTB A;  3EGD C;  3G35 A;  3MQO A;  4BLM A;  5FQ9 A;  3RH8 B;  5EEC A;  2H28 A;  4GHI B;  4PMA A;  5F68 A;  5DFY A;  4QHC A;  1V9Z A;  4B88 A;  2A2L A;  2W27 A;  4LFU A;  1JWP A;  1LL9 A;  1IEL A;  4QJG A;  4DE2 A;  1BT5 A;  1DP8 A;  1MBL A;  5HFO A;  2HDU A;  4B4X A;  1G6A A;  2ZQD A;  4LCL A;  5M1A A;  4F3L B;  3ZYT A;  4UA9 A;  2XRO A;  4Y3I A;  1PYY A;  3IWI A;  2ZD8 A;  4HJ6 A;  3UPN A;  3VFH A;  2H5S A;  2M7V A;  2I72 A;  5GHY A;  1PRQ A;  4L9G A;  3HLW A;  1ES2 A;  1VEU A;  1KVM A;  2WGW A;  3B3X A;  3G2Z A;  3OOV A;  3W4O A;  5FQI A;  1SDE A;  3A0S A;  2WGI A;  4I3I A;  1HTZ A;  1EI5 A;  2B18 A;  3IX4 A;  1N9O A;  4EQI A;  3ZQ5 A;  3F1N B;  1XPB A;  4OQ0 A;  4I3J A;  2W3D A;  3ZG7 B;  4DJ3 A;  2J7V A;  2ZC5 B;  2ZMF A;  4OOL A;  2PBY A;  5A8B A;  4L9F A;  2AVX A;  3GRJ A;  5CED A;  4NXG A;  4EV4 A;  3UPP A;  3MKF A;  4Q8I A;  4HP4 A;  2Q0O A;  3D9Y A;  4LCM A;  5HAQ A;  2D01 A;  5DVA A;  3H82 A;  3UNW A;  5HW3 A;  4FUW A;  2R78 A;  2IWC A;  2P04 A;  4E3L A;  1QME A;  2QYB A;  5TR7 A;  2RL3 A;  5A91 A;  3SOI A;  2X01 A;  2G2W A;  3HLF A;  3IBR A;  4JGP A;  3O5Y A;  4NG2 A;  2HJ9 C;  2L4R A;  1TEM A;  2INW A;  2A3U A;  3G30 A;  3CG5 A;  5C5K A;  4MN5 A;  4GS9 B;  4Y7P A;  3QNC A;  1ZG6 A;  4PPR A;  4WUJ A;  3IBJ A;  2Y55 A;  2R9X A;  1ERM A;  3IX8 A;  4II7 A;  2JKR I;  4GJ4 A;  5FEF A;  4OPR A;  3CUE C;  3KX0 X;  4DJ2 A;  4JF4 A;  5DJT A;  5FAT A;  3T4L A;  3ZNT A;  4S2L A;  1K0K A;  2O9A A;  3KYQ A;  1RP5 A;  1Y54 A;  3BW6 A;  4ME4 A;  5CTM A;  3R7W A;  3UO9 A;  1CI9 A;  1IYO A;  3LEZ A;  2Y2N A;  1TDL A;  4KZ3 A;  3QP5 A;  2PHY A;  1OTE A;  2ZM0 A;  3F1P A;  4WYY A;  3SH7 A;  3TG9 A;  1P9R A;  1LHY A;  3VE3 A;  5EVE A;  1YLZ A;  3SS3 A;  4N1X A;  4KQD A;  4FTX A;  5E2G A;  4BL2 A;  1S66 L;  1LI0 A;  2OLU A;  3N8L A;  1IKG A;  1OTD A;  4HJ4 A;  4GDB A;  4DXC A;  1L3L A;  2OWJ A;  3E0Y A;  2WUQ A;  4OPQ A;  2PBD P;  3DTK A;  4BL3 A;  4IJG A;  3RTY A;  3ITA A;  5F82 A;  5A90 A;  3LIE A;  4CLC D;  4Y0T A;  3VOZ A;  4MLL A;  1DJB A;  2ZC4 B;  4GN2 A;  1GHM A;  5G4Z A;  4B9O A;  1YQS A;  1D7E A;  2DRW A;  4WF0 A;  4ARZ B;  5I94 A;  3V67 A;  3UN7 A;  3M2J A;  4R38 A;  2WZZ A;  3OCN A;  4H8R A;  3MJQ A;  3KSH A;  1WYC A;  3LIF A;  2E8J A;  3MXQ A;  4DN0 A;  1P9W A;  5EM1 A;  4Q0I A;  4XUZ A;  5TJJ A;  1PWG A;  2FZ0 A;  2FH5 A;  1OME A;  2HZ5 A;  2NUT C;  4R4R A;  3NJA A;  1GHP A;  3UE1 A;  4HES A;  4E3N A;  2JE5 A;  2KX6 A;  2RCX A;  3FZC A;  2VGL S;  2H0T A;  2XRN A;  2XGN A;  3HUO A;  3T1S A;  2HDR A;  4PKY G;  1K56 A;  1Q2Q A;  1MY8 A;  2OWH A;  4OKP A;  4GKU A;  5KSC A;  3JPU A;  3IF6 A;  4OH0 A;  1U60 A;  3B47 A;  5GHX A;  4WEL A;  2L0W A;  5AQB A;  3A3D A;  5HWT A;  3UB7 A;  1LI9 A;  2JKT M;  2VA0 A;  2XDM A;  4ETZ A;  1KDW A;  4WM9 A;  3PBO A;  4YNR A;  3E4Q A;  4LV0 A;  4FH2 A;  4WEK A;  1L2S A;  1YLW A;  2V1Z A;  1FQG A;  5CEB A;  1S4R A;  3HBR A;  2Q9M A;  3GDI A;  3KYZ A;  3BLS A;  4BD0 A;  3KSF A;  3H7W A;  4Y5F A;  1KGE A;  3FV7 A;  3A3E A;  1MC0 A;  3L7H A;  2V0W A;  4EUZ A;  4N1H A;  4R6L A;  3UPO A;  1IOU A;  2VGJ A;  4GB7 A;  3W2Z A;  4HY8 A;  2OAP 1;  3VSL A;  3GQZ A;  3P98 A;  3FPV A;  4NK3 A;  1AWI A;  3QP4 A;  1IKI A;  5FI2 A;  5EVI A;  1E4D A;  1Z09 A;  4S2N C;  4X53 A;  3V50 A;  2O9B A;  4OOM A;  2VGK A;  3HLG A;  4K0W A;  3DTI A;  5G4Y A;  3A3F A;  5EE8 A;  1T1B A;  1PWD A;  1YLY A;  3Q7Z A;  3EEH A;  1CQA A;  4IBR A;  2B02 A;  3SZT A;  3WWX A;  1LL5 A;  4HNB A;  1YLJ A;  5CHJ A;  5EFW A;  4P6Z S;  2VX8 A;  5F5Y A;  2PD8 A;  3JVU A;  1CK3 A;  4C6Y A;  1KE3 A;  3FG8 A;  1XA1 A;  1F98 A;  2OV5 A;  3V5M A;  2ZOI A;  1W63 M;  1XP4 A;  3MQQ A;  2VV7 A;  3BY9 A;  1Z6F A;  1LT0 A;  1DP9 A;  1YLP A;  1BZA A;  1TS0 A;  1OJ5 A;  4K08 A;  4GD6 A;  1ACF A;  1NRJ A;  2Y59 A;  3M6B A;  2WKI A;  3C4O A;  1D1J A;  1L0G A;  2A24 A;  5EVL A;  1K25 A;  3NOT C;  5J3W A;  4S2M A;  3DW0 A;  1MXO A;  3LID A;  4FH4 A;  3A3I A;  5KMW A;  2IA2 A;  3ITB A;  5AQA A;  1O07 A;  1ZHH B;  2VGL M;  1NLZ A;  4E3J A;  4PM5 A;  3LFV A;  3LIB A;  3RFB A;  1XGI A;  1TVF A;  1XJ2 A;  4HQA A;  3IXH A;  3T50 A;  3UE6 A;  3LY3 A;  2X02 A;  3IS2 A;  3NOP C;  4HI4 A;  3BYD A;  4QB8 A;  3UB5 P;  1XKZ A;  4RVA A;  3R4K A;  5HDC A;  1MZU A;  2BAS A;  3IXD A;  4P87 A;  5HD5 A;  3Q82 A;  5CER A;  1K54 C;  2XH9 A;  2Y2P A;  1S6R A;  4BBT A;  1UWN X;  1IEM A;  1IFQ A;  3IXG A;  3BEB A;  3UY6 A;  2BG1 A;  4RX2 A;  4D60 A;  3UDX A;  2ZM2 A;  3HUM A;  3VOY A;  3IHA A;  5L2F A;  4EEU A;  4OLD A;  3CUE A;  4IBX A;  4D2O A;  2GNX A;  4CQH A;  3OPH A;  5HX9 A;  4WMC D;  4P0M A;  4X1M A;  3A0R A;  2JKT I;  3IH9 A;  3KO6 A;  4H6J A;  2WAE A;  4QD4 A;  5CHU A;  4OOY A;  3PAE A;  3TOI A;  3MXS A;  4IVI A;  3DTE A;  3OZH A;  1W79 A;  4RX3 A;  2W1T A;  2KDK A;  5A93 A;  4G3V A;  4S2I A;  4OVD A;  5M18 A;  2ZQ9 A;  2XA7 M;  3LIA A;  1KOU A;  4BEN A;  4K0X A;  1MWT A;  2LB9 A;  2OOL A;  2Z2M B;  3WS5 A;  4O0P A;  4BWI A;  4HOI A;  5DFX A;  4UA7 A;  3IQA A;  2V8F A;  1G6O A;  1VM1 A;  3Q7V B;  3SS4 A;  1ZTU A;  1N9N A;  4JGQ A;  3DWZ A;  3FKV A;  5CGS A;  2P9V B;  3E98 A;  3MXR A;  1F5M A;  4WZ5 C;  4GHI A;  4O7D A;  2CC1 A;  4S2K A;  2K2N A;  2KLI A;  4LGW A;  3ZHH A;  3C30 A;  1WA9 A;  3HLB A;  4WEJ A;  5DKL A;  1K6S A;  4N9L A;  2L1M A;  1H8M A;  3LI8 A;  1M40 A;  5GLA A;  3SH8 A;  2JHE A;  1JTD A;  1W5D A;  5FQM A;  3QP1 A;  1FCM A;  2J8Y A;  1H8Y A;  3O88 A;  3LR3 A;  3VMA A;  5EOO A;  4MN6 A;  2XQZ A;  2ZJ9 A;  1G68 A;  1YMX A;  3H9W A; 
#chains in the Genus database with same CATH homology
 2JCH A;  4WYY A;  3N6I A;  3SH7 A;  5HL1 A;  1H5X A;  3WRT A;  1YLT A;  3TG9 A;  4OLG A;  1LHY A;  4JBF A;  3WRZ A;  1YLZ A;  3OC2 A;  5FSR A;  3HLC A;  5U47 A;  3SS3 A;  2PU2 A;  1ES3 A;  1K56 D;  3OPR A;  4N1X A;  4WZ5 A;  2Y2M A;  4E3K A;  5CGX A;  5E2G A;  1DY6 A;  3AGD A;  4BL2 A;  3VP0 A;  2HPB A;  3N8S A;  4XXR A;  3CJM A;  5FAQ A;  2BLS A;  4DE3 A;  1LI0 A;  2OLU A;  3BRM A;  3N8L A;  2Y2J A;  4HBT A;  5IHV A;  1IKG A;  4X69 A;  5F1F A;  4MNR A;  2EX9 A;  2EX2 A;  4KQR A;  1CI8 A;  4GDB A;  5CXW A;  4DXC A;  4OPQ A;  2WUQ A;  4KG6 A;  3SH9 A;  5F1G A;  2WGV A;  1J9M A;  3HRE A;  4HBU A;  3N8R A;  4BL3 A;  1ONG A;  1W8Y A;  2HDQ A;  3Q81 A;  4JLF A;  4KQQ A;  3IT9 A;  2OLV A;  4JF6 A;  1MWS A;  1XXM A;  3ITA A;  5EVI B;  2WZX A;  5F82 A;  3NY4 A;  5HAI A;  4Y0T A;  3VOZ A;  1NYY A;  5CRF A;  4MLL A;  4R3J A;  1DJB A;  2ZC4 B;  1ZG4 A;  5EUA A;  4GN2 A;  1GHM A;  3BFD A;  1FCO A;  4R0Q A;  2Y2L A;  1K4F A;  1YQS A;  3Q1F A;  5HAP A;  2DRW A;  3MFD A;  1IYP A;  4DDS A;  4C3Q A;  4E6W A;  3RXW A;  5I94 A;  3UN7 A;  3M2J A;  2WZZ A;  2Y4A A;  5DF8 A;  3OCN A;  4H8R A;  4RYE A;  1N9B A;  3BFC A;  1WYC A;  3GTC A;  4DE0 A;  2V2F F;  1W8Q A;  4XUZ A;  3W4P A;  1BLC A;  1PWC A;  1PWG A;  4M3K A;  1HD8 A;  4YFM A;  4ZJ3 A;  1OME A;  4R4R A;  3QHY A;  3M6H A;  1GHP A;  2JC7 A;  4KG2 A;  4OP8 A;  3WS1 A;  5J8X A;  3LCE A;  3UE1 A;  4HES A;  3WS0 A;  5M19 A;  4IED A;  4E3N A;  4GNU A;  4R23 A;  2JE5 A;  3PTE A;  4JF5 A;  4DXB A;  2RCX A;  5GL9 A;  3FZC A;  1SHV A;  2WYX A;  2ZQC A;  4X6T A;  4BQM A;  2H0T A;  1NZO A;  2XGN A;  1ERO A;  3HUO A;  3O87 A;  1K57 C;  2HDR A;  4KEN B;  4S2N A;  4X56 A;  3JYI A;  1KVL A;  1K56 A;  1Q2Q A;  1DJA A;  1MY8 A;  2V20 A;  3NIA A;  4FD8 A;  4JXG A;  3UDI A;  4OKP A;  2ZC6 B;  2ZC3 B;  4GKU A;  4OP5 A;  4DF6 A;  2P9V A;  4N92 A;  3NDE A;  3IH8 A;  5KSC A;  1JVJ A;  3D4F A;  1I2S A;  3PBR A;  3OPP A;  1L0D A;  3IF6 A;  4OH0 A;  5EVI D;  4OQG A;  1PZP A;  1RGZ A;  2IWD A;  1U60 A;  5DTK A;  3G32 A;  4YIN A;  4CJN A;  5GHX A;  3RXX A;  4WEL A;  2QPN A;  3VSK A;  3I7J A;  1M6K A;  1NYM A;  5AQB A;  3A3D A;  3W8K A;  5KSH A;  3FWL A;  5CTN A;  1SDN A;  1LI9 A;  2XDM A;  3G2Y A;  4DDY A;  3V39 A;  1XGJ A;  2Y2G A;  4OQI A;  4WZ4 A;  1KDW A;  4WM9 A;  3C7V A;  4WMC A;  1FR6 A;  3PBO A;  1E3U D;  2UWX A;  2ZQA A;  4LV0 A;  5KZH A;  5EVI C;  4FH2 A;  4WEK A;  1JTG A;  1L2S A;  3FKW A;  1YLW A;  1PW1 A;  2V1Z A;  4F94 A;  1FQG A;  5CEB A;  4R4S A;  1W7F A;  3W4Q A;  4S2O A;  3RJU A;  3E2K A;  1K57 A;  3ZCZ A;  5FI7 A;  3HBR A;  2Q9M A;  1NRF A;  2Y2K A;  2Y2I A;  5FDH A;  3BLS A;  4BD0 A;  3PBT A;  4FSF A;  1JWV A;  4NET A;  1KGE A;  2Y2H A;  2WAD A;  3FV7 A;  2WAF A;  3A3E A;  1H8Z A;  3SS5 A;  3LO7 A;  2XD1 A;  3GMW A;  3S22 A;  4EUZ A;  3TSG A;  3LY4 A;  3MZF A;  1BLH A;  4KZ4 A;  4N1H A;  4KZ6 A;  1JWZ A;  3MKE A;  4MBH A;  4BD1 A;  3MBZ A;  3CMZ A;  5FQK A;  4KQO A;  3UPO A;  2EXB A;  4OQH A;  1L0F A;  4KZ7 A;  4KZA A;  1SCW A;  3HLE A;  4Y0U A;  2VGJ A;  1I5Q A;  4GB7 A;  5DTS A;  5FQQ A;  4PM6 A;  4BJP A;  2EX6 A;  3G4P A;  3VP4 A;  1NXY A;  3IF5 A;  3VSL A;  5G18 A;  2QZ6 A;  3GQZ A;  3M2K A;  3P98 A;  4NK3 A;  2DCF A;  5FQJ A;  5GHZ A;  3WS4 A;  5AQ9 A;  1YMS A;  3GSG A;  2WGW B;  3NC8 A;  4LV2 A;  4ZDX A;  1IKI A;  5FI2 A;  5EVI A;  1E4D A;  3ZVW A;  4EBN A;  4S2N C;  2C6W B;  4MBF A;  4X53 A;  3N4I A;  3V50 A;  4K91 A;  4Z9Q A;  4OOM A;  2PU4 A;  2WKH A;  2ZMA A;  4B4Z A;  5FAP A;  2VGK A;  3MZE A;  4GD8 A;  3QNB A;  3VP1 A;  1FSY A;  3IF6 C;  3HLG A;  4K0W A;  3HL9 A;  5FAS A;  3A3F A;  4A5R A;  5JYP A;  1NJ4 A;  5A92 A;  1FCN A;  1ES5 A;  3CZD A;  5EE8 A;  2QMI A;  4MEZ A;  3AGE A;  1PWD A;  1EWZ A;  1BSG A;  1YLY A;  3HUN A;  3Q7Z A;  4S2P A;  3E2L A;  4IBR A;  4ZJ2 A;  3UE3 A;  1BTL A;  4KZ8 A;  2EFU A;  1E3U A;  3BM6 A;  3HVF A;  1ES4 A;  1HVB A;  1K6R A;  1BUE A;  1N4O A;  1QMF A;  4OON A;  1O7E A;  1LL5 A;  5FI6 A;  4ZBE A;  3IHB A;  3WWX A;  1YLJ A;  5D3O A;  1K4E A;  5F83 A;  5BOH A;  2FFF B;  5CHJ A;  2WK0 A;  1ESI A;  3C7U A;  3VP2 A;  1PW8 A;  1CK3 A;  3UE0 A;  4C6Y A;  1KE3 A;  4R3B A;  1XA1 A;  4P85 A;  3OPL A;  4EWF A;  4ZAM A;  3NBL A;  4UHU A;  2OV5 A;  3V5M A;  3WS2 A;  1Q2P A;  1CEF A;  2Q9N A;  1XP4 A;  2Y2Q A;  4LEN A;  2HP9 A;  2A49 A;  2HP5 A;  1GHI A;  4OPZ A;  1K38 A;  3ZNY A;  3BFE A;  4KZ5 A;  4UAA A;  5E2H A;  5TFQ A;  3NDG A;  3P09 A;  3Q7V A;  1KDS A;  1S0W A;  1Z6F A;  3DWK A;  4LV1 A;  4X68 A;  3V3S A;  1YLP A;  5CGW A;  1BZA A;  5JYO A;  3C4P A;  1KGG A;  1YT4 A;  3A3J A;  4GZB A;  1ERQ A;  2XLN A;  4GD6 A;  4KZB A;  1XX2 A;  1K55 C;  2C5W B;  2Y59 A;  4DKI A;  3AGF A;  3M6B A;  2EFX A;  2J9O A;  2WKI A;  2Z2L B;  1NY0 A;  4GDN A;  5FA7 A;  3C4O A;  3ISG A;  1GA9 A;  1ALQ A;  5EPH A;  1L0G A;  3ZFZ A;  2EXA A;  4DE1 A;  5EVL A;  1K25 A;  5GLD A;  4KG5 A;  1GA0 A;  1BLP A;  3IXB A;  4MBK A;  3EQV A;  1MPL A;  4E6X A;  4PM7 A;  4S2M A;  1I2W A;  4EBP A;  4PM8 A;  3DW0 A;  1MXO A;  3PBN A;  3ZVT A;  4FH4 A;  2EX8 A;  2B5R A;  1IYQ A;  3G35 A;  3ZG9 B;  4BLM A;  3A3I A;  1PI5 A;  5FQ9 A;  5KMW A;  1FOF A;  2ZM8 A;  3FYZ A;  5EEC A;  4OPY A;  4X55 A;  3ITB A;  5DF9 A;  5DF7 A;  4PMA A;  1O07 A;  1MKI A;  5AQA A;  4QHC A;  4JXV A;  2OSU A;  1XA7 A;  4B88 A;  4E3J A;  4PM5 A;  4ZTK A;  1JWP A;  1TDG A;  2GDN A;  1LL9 A;  1XGI A;  4JKT A;  2XEP A;  1IEL A;  1TVF A;  4QJG A;  3IXH A;  4U0X A;  4DE2 A;  3LY3 A;  3VFF A;  2X02 A;  1FR1 A;  1RCJ A;  3O3V A;  3NCK A;  2G2U A;  1BT5 A;  1MBL A;  1CEG A;  5HFO A;  1C3B A;  3BYD A;  4QB8 A;  2HDU A;  1MWU A;  3S1Y A;  1VQQ A;  1XKZ A;  4B4X A;  1G6A A;  1PZO A;  4RVA A;  1K55 A;  2ZQD A;  4LCL A;  5M1A A;  4QY5 A;  4Y0O A;  3VP3 A;  3BEC A;  3IXD A;  1L0E A;  4P87 A;  4UA9 A;  2ZQ7 A;  3Q07 A;  3Q82 A;  5CER A;  1PYY A;  4CPK A;  1FSW A;  3IWI A;  2ZD8 A;  1K54 C;  2XH9 A;  3UPN A;  4U0T A;  3VFH A;  2H5S A;  2Y2P A;  1NZU A;  2I72 A;  2XK1 A;  5GHY A;  1PI4 A;  1S6R A;  2E8I A;  4C75 A;  1IEM A;  3HLW A;  1ES2 A;  1WYB A;  1KVM A;  2WGW A;  3B3X A;  3G2Z A;  3IXG A;  1BUL A;  3BEB A;  5E2F A;  3OCL A;  2XFS A;  3UY6 A;  2BG1 A;  4JXS A;  3ZG0 A;  4RX2 A;  3W4O A;  3BFG A;  3UDX A;  1GCE A;  1PIO A;  1SDE A;  2P74 A;  2R9W A;  2ZM2 A;  3HUM A;  3PBS A;  4UA6 A;  2WGI A;  5FQI A;  1HTZ A;  1MWR A;  1SKF A;  3VOY A;  1EI5 A;  5E2E A;  4XUX A;  4JPM A;  3ZG5 A;  3IHA A;  2FFY A;  5L2F A;  4R1G A;  4EQI A;  3BFF A;  3EQU A;  5GLC A;  4OLD A;  2HDS A;  1DJC A;  1ZC2 A;  4E3M A;  1XPB A;  2X71 A;  4LV3 A;  3PBQ A;  4GOG A;  4OQ0 A;  4IBX A;  3ZG7 B;  2J7V A;  3NI9 A;  2ZC5 B;  1BLS A;  4D2O A;  4E3I A;  3GV9 A;  3HLD A;  3OPH A;  5HX9 A;  4OOL A;  4WMC D;  2PBY A;  2XFT A;  4P0M A;  3GRJ A;  1KGF A;  1YM1 A;  4EBL A;  5CED A;  1KE4 A;  1K54 A;  3IWO A;  4QY6 A;  5CHM A;  3IH9 A;  4QD4 A;  2WAE A;  5FAO A;  3IWQ A;  3PAG A;  5CHU A;  4OOY A;  3PAE A;  4P6B A;  3TOI A;  4EV4 A;  3UDF A;  3UPP A;  3S4X A;  3MXS A;  4JXW A;  3MKF A;  4Q8I A;  4IVI A;  1KE0 A;  3OZH A;  4LCM A;  5HAQ A;  1W79 A;  2XF3 A;  3ZGA B;  4RX3 A;  5A93 A;  5DVA A;  4L0L A;  3UNW A;  4S2I A;  5HW3 A;  4U3T A;  4OVD A;  2JBF A;  4FCF A;  5M18 A;  2ZQ9 A;  5DTT A;  3ZDJ A;  4BEN A;  1AXB A;  2IWC A;  4K0X A;  4DRT A;  4E3L A;  1QME A;  1MWT A;  3MZD A;  5TR7 A;  2Z2M B;  2RL3 A;  3GVB A;  5A91 A;  3WS5 A;  1IYS A;  3SOI A;  2X01 A;  4ID4 A;  5A90 A;  2G2W A;  3HLF A;  4UA7 A;  4E3O A;  3IQA A;  4KZ9 A;  1VM1 A;  2HP6 A;  3Q7V B;  2IWB A;  2Y2O A;  3SS4 A;  5CEC A;  1ONH A;  1RGY A;  3V3R A;  1WE4 A;  2XD5 A;  1TEM A;  3DWZ A;  3FKV A;  5CGS A;  2P9V B;  2A3U A;  5AQ7 A;  4N9K A;  3G30 A;  3G31 A;  4WBG A;  2XR0 A;  3C5A A;  3MXR A;  3CG5 A;  4HEF A;  2J9P A;  3IF6 B;  4WZ5 C;  2H10 A;  4Y7P A;  3GR2 A;  5EOE A;  4O7D A;  2CC1 A;  3G34 A;  4S2K A;  3QNC A;  4ZJ1 A;  1ZG6 A;  4IVK A;  4PM9 A;  4PPR A;  2Y55 A;  2R9X A;  1ERM A;  5GLB A;  3ZHH A;  2ZQ8 A;  3N7W A;  1LLB A;  3HLB A;  4RA7 A;  4WEJ A;  2WKE A;  4QU3 A;  1K6S A;  4N9L A;  4OPR A;  2ZC7 A;  4S2J A;  2Y91 A;  4JF4 A;  1M40 A;  3O86 A;  5GLA A;  5FAT A;  3ZG8 B;  3SH8 A;  4S2L A;  3ZNT A;  1HZO A;  1JTD A;  5E43 A;  1W5D A;  5FQM A;  1ZKJ A;  1FCM A;  2DNS A;  2J8Y A;  1RP5 A;  1E25 A;  1Y54 A;  1H8Y A;  3BLM A;  3O88 A;  2H0Y A;  5CTM A;  3UO9 A;  1CI9 A;  1IYO A;  3DTM A;  3LEZ A;  5EOO A;  3VMA A;  2Y2N A;  1TDL A;  2XQZ A;  2ZJ9 A;  4KZ3 A;  5HAR A;  1G68 A;  1ESU A;  5TGF A;  2ZLY A;  1YMX A;  2ZM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...