5A90A

100k neutron ligand free: exploring the mechanism of beta-lactam ring protonation in the class a beta-lactamase acylation mechanism using neutron and x-ray crystallography
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
260
structure length
260
Chain Sequence
SVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE CTX-M-97
publication title Exploring the Mechanism of Beta-Lactam Ring Protonation in the Class a Beta-Lactamase Acylation Mechanism Using Neutron and X-Ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
total genus 91
structure length 260
sequence length 260
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5a90A00
4OLDA 1ES3A 5EVIB 4BL2A 4KZ9A 5HL1A 2DNSA 2H0TA 5KZHA 1LI9A 4KENB 1K57C 2Y2PA 3FKWA 5GHYA 2J8YA 4OQ0A 4DDSA 2XFTA 4WYYA 1TVFA 1E25A 5D3OA 3HLEA 5DTKA 1MY8A 3P09A 4Y0UA 3IF6A 1HTZA 1JTDA 2J9PA 4C6YA 4HBUA 1GA0A 4GDNA 1JTGA 3MZFA 3A3DA 3ITBA 4E6XA 1IELA 2WAFA 3UE3A 3P98A 1FR6A 5M18A 2ZQDA 4FSFA 3S1YA 3PBQA 2RCXA 3QHYA 4KZBA 1KGGA 4HESA 1KGEA 4S2JA 5HW3A 1LI0A 3G34A 5EVIC 3ZG0A 1YLJA 3LO7A 4BL3A 4KZ5A 4DE0A 3OPLA 5FDHA 4EBPA 3FV7A 3Q07A 4OPRA 5CTNA 1CK3A 3UY6A 3W8KA 1NZOA 2OLVA 4FD8A 4E3KA 4LV2A 3NIAA 5FA7A 1FR1A 1SDEA 4YINA 3S22A 4OP8A 4OQIA 4QU3A 3QNCA 2ZQ7A 2XFSA 3N8LA 3IF6C 1QMFA 1K54A 2PU2A 1N9BA 1XKZA 4ZJ3A 4X53A 1S6RA 2WZXA 3LEZA 4DRTA 1XXMA 1VQQA 1IEMA 3ZCZA 1OMEA 1EROA 3A3IA 4WELA 5CGXA 1NRFA 1H8ZA 2Q9MA 3Q1FA 1K25A 5KSHA 1PIOA 1JVJA 5TR7A 4BJPA 1DJCA 3BFCA 1IYQA 4DE2A 2I72A 4E6WA 2FFYA 1MWUA 3BFDA 3BLMA 3D4FA 3ISGA 1W7FA 4BD1A 1SKFA 3M6HA 5CXWA 3G31A 2PBYA 1YLYA 4MBHA 4E3NA 3PBOA 2HP9A 2ZC4B 4YFMA 2QZ6A 4DXCA 1ZC2A 5HX9A 2ZQ9A 2JCHA 3BFFA 5AQ7A 2EX9A 1G68A 5AQAA 3OZHA 4X55A 1GA9A 5DF7A 3MKFA 2EX8A 3BEBA 3PAEA 4XUZA 1L0GA 2Y2JA 5G18A 3C5AA 3G4PA 1KE0A 4ZDXA 3C7UA 5GLBA 3RJUA 1K54C 3E2KA 3HLFA 3GTCA 4JXSA 5M1AA 4Z9QA 3SH9A 3GRJA 3HL9A 4WMCA 1GCEA 4R1GA 2OLUA 4FCFA 5HAQA 3NCKA 2BG1A 2A49A 4UA9A 4OOMA 3EQUA 1Z6FA 3N7WA 4PM6A 3VFHA 3I7JA 1H8YA 2EX2A 3CJMA 4N1HA 1NY0A 4ZBEA 2P9VB 1MWSA 2XK1A 3N8SA 2P74A 3VMAA 1W5DA 2HP5A 2WGVA 2J9OA 4OVDA 5A92A 2ZM0A 5IHVA 5CEDA 5DTTA 5EOOA 3VFFA 1ALQA 4K0XA 4B4ZA 4R4RA 3VP2A 4PMAA 1PWGA 3MZEA 1VM1A 2WKIA 5DF9A 4EBNA 2X02A 1M40A 1PI5A 2OV5A 4BD0A 3ZG9B 1RGZA 4IBXA 1WE4A 2X01A 5CGSA 2WAEA 1W79A 3DWKA 3FWLA 5KMWA 4EUZA 3HUMA 4KQRA 3BLSA 3SS5A 4IVIA 1FQGA 2WYXA 1IKGA 3IWQA 4KQQA 5F83A 4GOGA 3DTMA 4S2LA 1O7EA 1ONGA 1NYYA 4OONA 3N8RA 5CRFA 5FQMA 1BSGA 3SS4A 1SHVA 1S0WA 2UWXA 3NDEA 2ZD8A 4KG6A 1NZUA 2QPNA 3G32A 4IEDA 5AQ9A 1L2SA 2ZM2A 2WK0A 2ZJ9A 3IXHA 4NK3A 4B4XA 3WRZA 1K55A 1M6KA 1MWTA 4O7DA 3G30A 3IF6B 4N1XA 3UE0A 4F94A 3MXRA 2Y2OA 2Z2LB 1K4EA 4QY6A 1YLTA 3Q7ZA 1CI9A 3C4PA 3G2YA 4RYEA 2EFXA 2G2UA 4GKUA 2ZC5B 3IT9A 1MXOA 1DJBA 3MXSA 5GLDA 3W4PA 2VGJA 3A3FA 1JWPA 3VP3A 3CZDA 3HLBA 5A93A 3PBTA 2DCFA 2EX6A 4DE3A 3M2KA 5BOHA 4JLFA 5FQIA 3LCEA 4KZAA 1FOFA 4U3TA 1XGIA 1DJAA 4KZ6A 3O88A 3DWZA 4E3IA 2ZLYA 3Q7VA 1FCMA 4WM9A 3QNBA 4Y0TA 4RX3A 4U0TA 4OKPA 5TGFA 5FAOA 4QB8A 3JYIA 3UN7A 1ES2A 2IWCA 3HUNA 2HPBA 4LV0A 3SOIA 4C75A 1K55C 3ZVWA 1AXBA 5E43A 1ES4A 2EXBA 2QMIA 4P0MA 4S2OA 3RXWA 4ZJ2A 2VGKA 4XUXA 2OSUA 3HLDA 4X69A 4S2PA 1ZKJA 2G2WA 3Q81A 4UA6A 4PPRA 3VSLA 4PM8A 1XP4A 1QMEA 4LV1A 4D2OA 1BT5A 5DVAA 1PW1A 3AGFA 4QY5A 3TSGA 3V3RA 1LLBA 1PYYA 3BECA 3WS0A 3BFEA 3WWXA 4R23A 1K56D 5FAPA 2H5SA 1RP5A 4MNRA 1EI5A 3VOYA 2Y2HA 4P85A 3ZHHA 1XX2A 1L0EA 1HZOA 2WKHA 2JE5A 4FH4A 1KVMA 1KE3A 4X56A 4JF5A 5TFQA 1LHYA 3V5MA 1FCNA 3LY3A 1XPBA 4NETA 4GB7A 3VOZA 3C4OA 5GHZA 3ZNTA 3OC2A 3PAGA 4OP5A 2X71A 3SS3A 3NBLA 4RX2A 3AGEA 3FZCA 5GLAA 4ZTKA 5FI6A 2Y4AA 2Y2KA 1K38A 4X68A 4ZJ1A 3WS5A 5HAPA 1L0FA 1PI4A 5FQJA 1PW8A 4OPYA 1DY6A 1NJ4A 5I94A 3UDFA 1WYCA 4WBGA 1RCJA 3VP4A 3WS2A 2BLSA 2XD1A 3ZNYA 1H5XA 3OCNA 1J9MA 3O86A 1JWVA 3MFDA 3IQAA 2ZC7A 3M2JA 1BULA 3MZDA 1YLWA 3B3XA 3N4IA 5GHXA 1XA7A 4MBFA 4CPKA 1NXYA 4KZ7A 1JWZA 5CEBA 4DKIA 1ESUA 1U60A 3HLGA 3W4OA 3W4QA 1ZG4A 1ZG6A 1MPLA 4JF4A 1BLPA 4JXVA 4PM9A 3MKEA 3UO9A 3V39A 5DF8A 3HUOA 2PU4A 5FI7A 2ZC3B 1FSYA 4BLMA 3ITAA 2HDRA 4FH2A 4P87A 2Y55A 1PZPA 1TEMA 1SCWA 4E3MA 5E2HA 4WEJA 4OQGA 1ESIA 1BLSA 3HBRA 5J8XA 2Y2QA 4JF6A 4PM7A 1HD8A 3IH8A 3NDGA 1K6SA 4HEFA 1XA1A 1G6AA 4XXRA 5CHJA 3UPNA 1IYPA 3TOIA 2Q9NA 1RGYA 2Y2LA 5EOEA 3UDIA 2JC7A 5FQ9A 2RL3A 4OPQA 2C5WB 4HBTA 4ID4A 3S4XA 2Y2GA 1CEFA 1XGJA 3GV9A 1BZAA 2XH9A 1YQSA 3G2ZA 1E3UA 2ZMAA 3IWIA 5CECA 2Y2MA 3DW0A 4LV3A 4QD4A 2Y2NA 4P6BA 3SH7A 4OH0A 4LENA 1SDNA 1Q2PA 5EUAA 5EPHA 3CG5A 3IXGA 3ZGAB 2IWBA 2V20A 4N9LA 3O87A 1LL9A 1BTLA 2R9WA 3UDXA 3IXBA 3LY4A 4JKTA 5EE8A 3NC8A 1I2SA 1GHIA 2WADA 3GSGA 1L0DA 4KG2A 3ZG7B 2EFUA 4S2IA 5FSRA 4K91A 1K56A 2WUQA 4R4SA 3OPPA 3Q7VB 1ES5A 5E2EA 2WGWA 2WGWB 3E2LA 5E2GA 1K4FA 4UAAA 4E3LA 2B5RA 3O3VA 5A91A 5DTSA 4X6TA 4DXBA 1E3UD 1O07A 1FCOA 3TG9A 5EVID 5HARA 3N6IA 1N4OA 1IKIA 3PTEA 4U0XA 4KQOA 4CJNA 3OCLA 3IH9A 5F1FA 1MKIA 4WZ4A 3UPOA 4OQHA 3VSKA 3FYZA 1KDSA 4UHUA 1BUEA 4S2KA 5AQBA 3A3JA 1YLZA 4R3JA 2CC1A 4QHCA 1NYMA 3RXXA 1C3BA 3HREA 1LL5A 4IVKA 2XF3A 4E3OA 4GDBA 4S2NA 3IF5A 5FATA 5EECA 3AGDA 4MBKA 1TDLA 3WRTA 2XQZA 4GD6A 1YT4A 3UNWA 3OPHA 2WKEA 2A3UA 1ERQA 3BM6A 1W8YA 4DF6A 2DRWA 4WEKA 2XD5A 2WGIA 4C3QA 3GMWA 1BLCA 1K6RA 4JBFA 4LCLA 3Q82A 2HDSA 1Q2QA 3VP1A 1E4DA 1YM1A 3HLCA 5CHMA 5FQKA 4QJGA 4OOLA 1KGFA 1IYSA 5A90A 3V3SA 1IYOA 3A3EA 4E3JA 5F1GA 4EBLA 3V50A 5GL9A 4OLGA 5FQQA 2H0YA 4ZAMA 1FSWA 3C7VA 5L2FA 5M19A 4OPZA 5JYOA 2ZQ8A 2HDUA 5FASA 3BYDA 3BFGA 3M6BA 1WYBA 2V1ZA 2Y91A 3NI9A 4WZ5A 3BRMA 5EVLA 4KZ4A 4OOYA 4MEZA 4JPMA 4S2NC 4UA7A 2J7VA 4GD8A 1Y54A 2ZM8A 2XEPA 3NY4A 1CEGA 3IWOA 3MBZA 5CERA 2H10A 4JXGA 5GLCA 1I2WA 4R3BA 5KSCA 2Y2IA 3PBSA 4N9KA 3CMZA 2ZQCA 3UPPA 1YMXA 2XR0A 4KZ3A 4RA7A 1BLHA 1MBLA 2WZZA 3IHBA 4KG5A 4BQMA 1YLPA 3HLWA 4JXWA 4EQIA 4RVAA 4Y7PA 1KE4A 3UE1A 2R9XA 4IBRA 2HDQA 5HAIA 3OPRA 4GN2A 3IXDA 1ERMA 1MWRA 5E2FA 4EV4A 2IWDA 3ZG5A 3IHAA 1K57A 1YMSA 4MLLA 1KVLA 1I5QA 1PWDA 3G35A 5U47A 3PBNA 2FFFB 1PWCA 3HVFA 2Z2MB 2GDNA 2P9VA 2V2FF 2EXAA 5FI2A 3SH8A 3VP0A 1CI8A 3EQVA 3GQZA 3WS1A 4N92A 4Y0OA 3ZG8B 2E8IA 4WZ5C 4L0LA 5CTMA 4KZ8A 2XLNA 3FKVA 2XDMA 1PZOA 5HFOA 1EWZA 2JBFA 2HP6A 5CHUA 1GHMA 3PBRA 4M3KA 2ZC6B 1TDGA 1ONHA 4A5RA 4GNUA 4DDYA 2Y59A 4K0WA 2ZQAA 4R0QA 5FAQA 5F82A 3GR2A 4H8RA 1KDWA 4GZBA 4WMCD 5CGWA 4LCMA 4B88A 3GVBA 4DE1A 4BENA 4Q8IA 1HVBA 1GHPA 2XGNA 3ZDJA 3ZVTA 4S2MA 4EWFA 3ZFZA 3WS4A 4PM5A 5JYPA 2C6WB 1W8QA 5EVIA
chains in the Genus database with same CATH superfamily
4BL2A 4KZ9A 2DNSA 4PKYG 3MMHA 1K57C 4HJ3A 2Y2PA 5EM0A 5GHYA 2J8YA 4NG2A 4DDSA 4WYYA 4DJ3A 3LICA 1MY8A 2W3DA 4G3VA 1HTZA 4C6YA 4HBUA 4Y3IA 3ITBA 5J4EA 4ETXA 1T18A 1LI0A 3G34A 3F1PB 3BWLA 4KQDA 3OPLA 4EBPA 1CK3A 3UY6A 3LUQA 5TBMB 4UQIS 3CI6A 1NZOA 4E3KA 1T1CA 5DJTA 1FR1A 4MN5A 4Y17A 4WUJA 3QNCA 3T12B 2XFSA 2Y79A 4ZJ3A 4X53A 1S6RA 1VQQA 2VZWA 3A3IA 1H8ZA 2Q9MA 3FG8A 4CLCB 1K25A 2PYRA 1VETA 2FFYA 1MWUA 3BFDA 3BLMA 2O9AA 3D4FA 5KIZA 2OAP1 3M6HA 4EQ1A 2QZ6A 1ZC2A 4G3WA 3U4LP 3S7QA 3BEBA 2Y2JA 3C5AA 4ETZA 3GTCA 4CLCD 2L0WA 5AVEA 2VV8A 2A49A 4WLAA 2V1AA 3EQUA 3I7JA 3VE3A 3CPTA 1W5DA 1X0OA 3F1NA 3DBAA 4B4ZA 1MZUA 4YWZA 3LIAA 4PMAA 1PWGA 5DF9A 1M40A 1PI5A 4BD0A 1SZVA 3QP5A 3T4QA 3HUMA 4KQRA 1S67L 2GJ3A 4I3IA 1ZTUA 3S7NA 4KQQA 4GOGA 3N8RA 3KSFA 1SHVA 1S0WA 2ZD8A 2VGLS 2QPNA 3G32A 4I3AA 4IEDA 2WK0A 3WRZA 1K55A 5A8BA 1EW0A 3IF6B 4F94A 3IBJA 2AVXA 2G2UA 5GLDA 2QHKA 5FDSA 2EX6A 4DE3A 1XFNA 4F3LA 3MXQA 2V0UA 3T1RA 4WM9A 3QNBA 4RX3A 1PRQA 5FAOA 3UN7A 1ES2A 2IWCA 2GZAA 5J7EA 1K55C 5E43A 4S2OA 3RXWA 4XUXA 2OSUA 4X69A 5J3WA 2G2WA 4UA6A 3UB9A 4PPRA 3VSLA 4PM8A 1P9WA 5DVAA 1PW1A 1W63M 2R78A 1PYYA 3BECA 2J3TD 3T4TA 3WS0A 3WWXA 4R23A 1K56D 1RP5A 3VOYA 4PKYA 4EUVA 4E04A 5HL6A 4JF5A 2W3GA 1LHYA 2XRNA 5GHZA 1TS6A 4IJGA 4R3AA 3D72A 4RX2A 5FI6A 1T1BA 4BMWA 3T1SA 1PW8A 5L8MA 3PXPA 5IU1A 3ZNYA 2BLSA 1J9MA 2PR6A 3M2JA 4GCZA 1BULA 1F98A 3B3XA 4CLCE 5GHXA 4MBFA 4CPKA 1GSWA 1U60A 3HLGA 4XT2A 3W4QA 2WKRA 3KYZA 1T1AA 4JF4A 1MPLA 4PM9A 3UO9A 3V39A 3CHWP 4BLMA 3ITAA 4FH2A 4P87A 3VE4A 4PHTA 4MN6A 2M1CA 2O0YA 4WEJA 4OQGA 4PM7A 3UPNA 1IYPA 2IA2A 3TOIA 3GECA 4GLQA 3D9YA 2RL3A 5IT5A 3CAXA 2C5WB 4LLOB 3GV9A 3R4KA 5CECA 2Y2MA 4QD4A 4P6BA 3SH7A 1SDNA 3CG5A 2IWBA 1GHIA 2WADA 4MDZA 3HJKA 2EFUA 2WUQA 1TF1A 3KSGA 5LBRA 1K4FA 5A91A 3VV4A 2OWHA 1FCOA 1N4OA 4U0XA 4CJNA 5HWVA 3OCLA 3MQQA 1MKIA 3UPOA 4S2KA 5AVFA 4IVKA 1LL5A 1OTAA 4GDBA 4MBKA 1TDLA 2XQZA 4I38A 3BM6A 3GMWA 1BLCA 1XFQA 3H7WA 2P08A 3SZTA 2WKQA 1OTEA 1YM1A 3HLCA 2GX5A 1KGFA 1IYSA 1PNEA 5F1GA 2PD7A 4ZAMA 3C7VA 5M19A 3M6BA 1WYBA 2V1ZA 1T19A 2Y91A 5F69A 3NI9A 4KZ4A 4Q0JA 4MEZA 4JPMA 2J7VA 1Y54A 2B02A 2XEPA 1OT9A 3DTEA 3IWOA 2H10A 2YKHA 2FH5A 4R3BA 4RA7A 4EXOA 3HLWA 3LYXA 3H82A 3UE1A 2HDQA 4O0PA 3ZG5A 1PWCA 2Z2MB 3VP0A 2ZL1A 4L0LA 4KZ8A 1S4RA 3FKVA 2XDMA 2JBFA 2O99A 2HP6A 3PBRA 1SKOA 2ZC6B 3MJQA 4H8RA 3GVBA 4BENA 1HVBA 1GHPA 2XGNA 3ZVTA 3WS4A 5JYPA 1W8QA 3LR4A 5EVIA 1ES3A 4HIAA 4DJ2A 3FPWA 3FKWA 4IHQA 1DP8A 2PT7A 5DTKA 3P09A 3IF6A 1CJFA 2DMWA 4GDNA 3DTIA 3RH8B 4LRXC 1IELA 2WAFA 3P98A 2ZQDA 4GHIA 1S4SA 3QHYA 4KZBA 3LGOA 5EVIC 3T1XA 5HDCA 4KZ5A 5HD5A 4FD8A 3NIAA 2VV7A 5EV0A 1SDEA 4EW7A 4QU3A 1OTBA 3IF6C 1XKZA 2WZXA 1J3WA 1PFLA 1EROA 3Q1FA 2W3EA 5KSHA 4E6WA 4CQHA 1IFQA 3S7OA 2PBYA 4MBHA 4E3NA 3NOPC 2ZQ9A 2JCHA 3BFFA 1V9ZA 1GA9A 4FTXA 1L0GA 1KE0A 4AFIA 3RJUA 3SH9A 3GRJA 1GCEA 1G6OA 1WA9A 2OLUA 4FCFA 2B18A 4PM6A 3VFHA 2OWJA 2EX2A 3CJMA 1NY0A 2PHYA 4ZBEA 2P9VB 4HH2A 2XK1A 2P74A 3VMAA 1UWNX 4OVDA 2J9OA 1ZHHB 5EOOA 2A24B 3VP2A 1VM1A 4NEED 2X02A 2V8CA 5EFWA 2XA7M 1RGZA 3SS5A 1FQGA 3IX3A 1O7EA 1ONGA 1NYYA 1TS0A 4OONA 1L2SA 2ZM2A 2O9BA 3ULFA 3QP1A 1M6KA 4N1XA 4X25A 3LIDA 3MXRA 2Z2LB 4QY6A 1K4EA 1CI9A 4RYEA 3TW8A 3IS2B 1LSXA 1MXOA 1DJBA 3VP3A 2ACGA 3CZDA 3PBTA 2DCFA 3M2KA 2D01A 4JLFA 3LCEA 4HI4A 5IS1A 4FUWA 1VEUA 2KDKA 2ZLYA 1FCMA 2VLGA 4Y0TA 4JGRA 3JYIA 1YSQA 1S1YA 1UGUA 3HUNA 2V0WA 5HWTA 4P0MA 3T1QB 1TD5A 2VGKA 1XP4A 1BT5A 3AGFA 3TSGA 1EI5A 1S1ZA 4P85A 3ZHHA 2WKHA 3KYEA 2M7VA 3L9KA 2KLIA 3DTKA 1FCNA 3LY3A 4NETA 4P6ZS 3VOZA 3OC2A 3NBLA 3AGEA 2PYPA 4GS9B 3FZCA 2Y2KA 4Q0HA 4MCWA 5HAPA 1XJ6A 1DY6A 5I94A 1RCJA 3VP4A 5C5KA 2XD1A 3MR0A 1H5XA 3OCNA 4BBVA 2VV6A 3KX0X 3MZDA 1YLWA 3N4IA 3MFXA 1XA7A 3C38A 1DRMA 5CEBA 4I3JA 4QPRA 4DKIA 1ZG4A 1ZG6A 4JXVA 3UB5P 5FI7A 2WKPA 4HJ6A 4JGOA 5MC7A 1PZPA 4E3MA 2PD8A 2JKRI 1BLSA 4ARZA 3NDGA 4HEFA 1G6AA 2BTFP 1RGYA 3JVUA 4OPQA 4YOFA 2K31A 4H6JB 3SW1A 4ID4A 1CEFA 3G2ZA 1E3UA 2ZMAA 2PDRA 3DW0A 4LV3A 2ZOIA 4Y5FA 1F5MA 3DAVA 3ZGAB 2V20A 4EETB 2R9WA 4JKTA 4NXFA 4KG2A 2VA0A 1ES5A 2KX6A 2WGWB 3E2LA 2JKGA 4E3LA 2B5RA 5DTSA 1O07A 3TG9A 5EVID 3D3OA 5F1FA 1H3QA 3T4LA 3QP2A 2Q0OA 4L9FA 5AQBA 4KUOA 3RXXA 4E3OA 4S2NA 1LT0A 3WRTA 1YT4A 3B42A 3E4PA 2DRWA 4WEKA 2XD5A 2WGIA 4C3QA 1K6RA 3LIBA 3QP8A 1MC0A 4LCLA 2HDSA 1E4DA 5FQKA 3F1OB 3R7WA 4EBLA 4LGWA 2H0YA 2W1TB 3B47A 1FSWA 3BY9A 4OPZA 5JYOA 2ZQ8A 1H0MA 4HP4A 3BYDA 3BFGA 3BQAA 4OOYA 4S2NC 4UA7A 4GD8A 1CEGA 1OJ5A 3NOUC 3MBZA 3KSIA 5GLCA 4X1LA 2P7JA 1YMXA 4KUKA 2E8JA 4BQMA 2WZZA 1MBLA 3IHBA 1YLPA 2JKFA 3CUEA 2M7UA 4LRZE 3OPRA 3IXDA 1MWRA 4EV4A 1LSWA 4GJ4A 2IWDA 5FEGA 4GW9A 4I5SA 1PWDA 3G35A 2FFFB 3HVFA 2GDNA 2P9VA 2V2FF 5FI2A 3SH8A 1CI8A 3GQZA 1PZOA 2H28A 5CHUA 1YPRA 2YKFA 1TDGA 1ONHA 3MQ0A 2Y59A 4K0WA 2ZQAA 5F82A 5HDDA 4ESPA 3LR5A 2C6WB 5DFXA 4OLDA 1D7EA 3CUEC 2H0TA 5KZHA 1LI9A 4KENB 4EERA 4OQ0A 2XFTA 3NJAA 1OTDA 5DFYA 3UMEA 4Y0UA 3E4QA 1GA0A 1YKDA 3MZFA 4Z1WA 4E6XA 1LL8A 1GSVA 1FR6A 3PYPA 5M18A 1TS8A 3S1YA 1KGGA 2HJ9C 2V9AA 1KGEA 2XSSA 3ZG0A 4L9GA 3F1PA 5FDHA 3FV7A 3Q07A 5CTNA 4Y15A 5TBMA 3W8KA 2OLVA 1AWIA 1Y28A 4YINA 3A0VA 3S22A 4OQIA 2ZQ7A 3N8LA 1K54A 1N9BA 4WL9A 3LEZA 4DRTA 1F2KA 1IEMA 1OMEA 4WELA 5CGXA 4PAUA 1NRFA 4CLCA 2JN7A 1PIOA 3A0RA 4IUKA 3BFCA 1G5UA 4HJ4A 3LIFA 1W7FA 3UB6A 3G31A 1YLYA 4UQIM 1JNUA 2HP9A 5AQAA 1G68A 2PAVP 3OZHA 1TS7A 3MKFA 4B93A 3PAEA 2HV1A 4ZDXA 1K54C 3E2KA 3HLFA 3U2AA 4Q0IA 4Z9QA 4WMCA 2G7UA 1W63Q 4CLCC 4OOMA 3N7WA 2V8FA 1MWSA 3EEAA 3N8SA 3CPTB 2HP5A 4R70A 5A92A 5CEDA 3F1NB 3VFFA 4K0XA 3BQ8A 3IBRA 3MZEA 2WKIA 4LPZA 4R6LA 4IBXA 1WE4A 4R38A 5CGSA 2WAEA 2K2NA 2Z6CA 3FWLA 4ZRRA 4EUZA 3RFBA 3BLSA 3UE6A 2WYXA 1IKGA 3IWQA 5FQMA 3DTMA 4S2LA 5CRFA 3SS4A 3MQOA 3NDEA 4KG6A 4M4XA 1NZUA 4QWOA 5AQ9A 3IXHA 4NK3A 4B4XA 4DN0A 4IUHA 4L9EA 2I9VA 4UEYA 4O7DA 3UE0A 2Y2OA 3G2YA 2OAQ1 2XROA 4GKUA 4HQAA 2VGJA 3A3FA 1JWPA 3CLOA 1N9LA 3HLBA 5BOHA 4HY8A 3FPVA 1FOFA 4F3LB 1DJAA 3O88A 3DWZA 5TGFA 4OKPA 2VGLM 5F6AA 1N9OA 2HPBA 4C75A 1Z09A 1AXBA 4NKPA 4ZJ2A 4S2PA 1ZKJA 3OOVA 1QMEA 4D2OA 4QY5A 1LLBA 3BFEA 2H5SA 4MNRA 3VOLA 1HZOA 3V67A 5HWWA 1KE3A 4X56A 2QJ5A 2ZOHA 4WN5A 5TFQA 3EEHA 1CF0A 5L09A 1XPBA 4OP5A 3B33A 5GLAA 4ZTKA 2Y4AA 1K38A 4X68A 1VHMA 4EEPA 1OTIA 4OPYA 1NJ4A 3UDFA 2VK3A 4WBGA 2JKTI 2FZ0A 3E98A 5I5LA 4KZ7A 1JWZA 4O8GA 2W0NA 4XT2B 2JKRM 2QJ7A 5DF8A 5FEFA 3HUOA 2PU4A 1FSYA 2HF6A 1TEMA 1SCWA 5DJUA 3HBRA 5J8XA 2Y2QA 4JF6A 3IH8A 1K6SA 4XXRA 1XA1A 2Q9NA 1D1JA 3JPUA 1ODVA 5HD3A 3S4XA 1BZAA 1YQSA 4X1MA 2D02A 2Y2NA 4LENA 3LFVA 5EUAA 5EPHA 3QP6A 3IXGA 3T4JA 3O87A 3IXBA 5EE8A 3NC8A 1N9NA 3GSGA 1NLZA 3ZG7B 4S2IA 4K91A 4R4SA 3MSHA 3LEQA 3OPPA 3Q7VB 5E2EA 3EGXC 5EVEA 2HJEA 5G4YA 3O3VA 4X6TA 1NWZA 1BYWA 3BW6A 2HGVA 1MKMA 2W3FA 1XJ4A 3IH9A 4WZ4A 4OQHA 3VSKA 3A3JA 1YLZA 3HREA 5EM1A 5FATA 3MF0A 3AGDA 5TJJA 4GD6A 3UNWA 3OPHA 2A3UA 1OT6A 1W8YA 4DF6A 1DP9A 4I39A 4NXGA 3H7WB 3VP1A 2QWSA 5CHMA 4OOLA 3V3SA 3A3EA 4E3JA 5L2FA 4DMZA 4WZ5A 5EVLA 3H9WA 3OBFA 4JGQA 3ICYA 5CERA 1I2WA 4HP9A 4LRYC 5KSCA 3PBSA 5FL3A 4N9KA 3UPPA 1KE4A 3QP4A 2KOIA 2R9XA 3H82B 1ERMA 4EEUA 5L10A 4MLLA 1KVLA 1I5QA 2LB9A 5U47A 3PBNA 1XJ3A 2EXAA 3FC7A 2ZL1B 4Y0OA 2E8IA 3PR6A 4WZ5C 2XLNA 1EWZA 4M3KA 4HOIA 1V9YA 1SKOB 4DDYA 4A5RA 3CITA 1G28A 5FAQA 4WMCD 4GZBA 5CGWA 4Q8IA 3ZDJA 3ZFZA 4PM5A 5EVIB 2NUTC 5HL1A 4BBUA 3OLOA 1TVFA 1E25A 5D3OA 3HJIA 3HLEA 2EWWA 1JTDA 2J9PA 2J3WA 2BASA 1JTGA 2W3HA 3A3DA 3MS6A 2EWVA 3UE3A 5HZHA 2A2LA 5DKKA 4FSFA 4GHIB 3PBQA 2RCXA 4HESA 4S2JA 3K3CA 5HW3A 1YLJA 3LO7A 3P01A 4BL3A 3W2ZA 4DE0A 2CMNA 4OPRA 3GDIA 1ACFA 4MN7A 5DKLA 4LV2A 1P9RA 5FA7A 4OP8A 3LI8A 1QMFA 2PU2A 3E4OA 3UB7A 1S66L 2K7SA 1XXMA 4HH3A 3ZCZA 1STZA 5CX7A 4JGPA 1JVJA 3EWKA 5TR7A 4BJPA 1DJCA 1IYQA 5HPFA 4DE2A 2I72A 3UMDA 3ISGA 4BD1A 1SKFA 5CXWA 3PBOA 2ZC4B 4YFMA 2O9CA 1NLYA 5HX9A 4DXCA 3T4OA 5AQ7A 2EX9A 4X55A 5DF7A 2EX8A 4XUZA 5G18A 3G4PA 3C7UA 3C30A 5GLBA 2XA7S 4JXSA 5M1AA 1XJ2A 4LFUA 3HL9A 1Y4OA 4RQ9A 4R1GA 5HAQA 3NCKA 2BG1A 4UA9A 2HZ5A 1Z6FA 2L4RA 1H8YA 2EA9A 2V1BA 4N1HA 2PRFA 5HPIA 3LI9A 2WGVA 1A0KA 2ZM0A 5IHVA 4Y2FA 5DTTA 2UV0E 1ALQA 2A24A 4R4RA 2MJ6A 4MMNA 4EBNA 3NECA 3G6OA 2OV5A 3BY8A 2ZMFA 3ZG9B 2X01A 1W79A 3DWKA 5KMWA 4IVIA 5F83A 1BSGA 2UWXA 4NXEA 2ZJ9A 2PBDP 3IX4A 1MWTA 3NULA 2B95A 3G30A 1YSPA 1YLTA 3Q7ZA 3C4PA 3TRCA 3IS2A 2EFXA 1KOUA 2ZC5B 3IT9A 3MXSA 4B9OA 3LR3A 2W27A 3W4PA 5A93A 3JVVA 2OOLA 3P7NA 2Y8HA 2INWA 5FQIA 4KZAA 1L3LA 5HDSA 4U3TA 1XGIA 4KZ6A 1VEUB 4E3IA 3Q7VA 3L7HA 2QKPA 4U0TA 4QB8A 3RTYA 2NUPC 4LV0A 3SOIA 3ZVWA 4HNBA 1ES4A 2EXBA 2QMIA 3HLDA 3Q81A 4LV1A 3KYQA 1UWPX 3V3RA 4II7A 3TJZC 1LSVA 5FAPA 2Y2HA 1XX2A 1L0EA 4K08A 1VETB 2JE5A 4FH4A 1KVMA 1YAXA 3V5MA 4GB7A 3C4OA 3ZNTA 3PAGA 2X71A 5F5YA 3SS3A 3ZYTA 4GS9A 2JKTM 5HSQA 4ZJ1A 3WS5A 4G3KA 4Y13A 1L0FA 1PI4A 5FQJA 1WYCA 1HLUP 1IOUA 3WS2A 5AJGA 3O86A 1JWVA 3MFDA 2GNXA 3IQAA 2ZC7A 4ME4A 1NXYA 3BJNA 5G4ZA 1ESUA 3W4OA 4P6ZM 1BLPA 2PR5A 3MKEA 3C8CA 2ZC3B 2HDRA 3S7PA 2Y55A 5E2HA 5K5BA 1ESIA 4ARZB 1HD8A 1OJGA 5CHJA 2Y2LA 5EOEA 3UDIA 2JC7A 5FQ9A 4H6JA 4HBTA 2Y2GA 1XGJA 2XH9A 3LR0A 3IWIA 4OH0A 3T4SA 5F68A 1Q2PA 3IX8A 4N9LA 1LL9A 1VB6A 1BTLA 3UDXA 3LY4A 1I2SA 1L0DA 3CWFA 5FSRA 1K56A 3EOIA 2QYBA 3NHQA 3LIEA 2WGWA 5E2GA 1GSXA 4UAAA 4DXBA 1DP6A 1E3UD 3K2NA 2Z6DA 2VX8A 5HARA 2LB5A 3N6IA 3PTEA 1IKIA 3ZQ5A 4KQOA 2W1RA 2ZBBA 4EESA 2VJWA 3FYZA 1KDSA 4UHUA 1BUEA 3T4KA 4BBTA 3KO6A 4R3JA 2CC1A 4QHCA 1NYMA 2VKSA 1C3BA 2XF3A 3IF5A 5EECA 3KSHA 2VEAA 1P97A 1FILA 1F9IA 2WKEA 1P0ZA 2ZMVA 3E0YA 1ERQA 2J3TC 1CQAA 4O01A 4JBFA 3PHYA 3Q82A 1OPXA 1Q2QA 4NXBA 3F1OA 4FOFA 4QJGA 3UB8A 5A90A 1IYOA 3R7WB 3V50A 5GL9A 4OLGA 5FQQA 2W1TA 2L1MA 2JHEA 2HDUA 3HCYA 5FASA 3BRMA 2ZM8A 3NY4A 1NRJA 3NOTC 2J80A 4JXGA 4YNRA 2Y2IA 2P04A 1K0KA 3CMZA 2ZQCA 4D60A 3K3DA 2XR0A 4KZ3A 1BLHA 3C2WA 4EQIA 4KG5A 3O5YA 4JXWA 4RVAA 4Y7PA 4IBRA 5HAIA 4GN2A 3T50A 5E2FA 1FIKA 3IHAA 1K57A 1YMSA 3WS1A 3EQVA 4N92A 1H8MA 3ZG8B 5CTMA 3TE8A 1D06A 5HFOA 4HHDA 1GHMA 4GNUA 3EGDC 4R0QA 4WF0A 3GR2A 4BWIA 1KDWA 4B88A 4LCMA 5L07A 4DE1A 3A0SA 4S2MA 4EU0A 4EWFA
chains in the Genus database with same CATH topology
4OLDA 1ES3A 5EVIB 4BL2A 4KZ9A 5HL1A 2DNSA 2H0TA 5KZHA 1LI9A 4KENB 1K57C 2Y2PA 3FKWA 5GHYA 2J8YA 4OQ0A 4DDSA 2XFTA 4WYYA 1TVFA 1E25A 5D3OA 3HLEA 5DTKA 1MY8A 3P09A 4Y0UA 3IF6A 1HTZA 1JTDA 2J9PA 4C6YA 4HBUA 1GA0A 4GDNA 1JTGA 3MZFA 3A3DA 3ITBA 4E6XA 1IELA 2WAFA 3UE3A 3P98A 1FR6A 5M18A 2ZQDA 4FSFA 3S1YA 3PBQA 2RCXA 3QHYA 4KZBA 1KGGA 4HESA 1KGEA 4S2JA 5HW3A 1LI0A 3G34A 5EVIC 3ZG0A 1YLJA 3LO7A 4BL3A 4KZ5A 4DE0A 3OPLA 5FDHA 4EBPA 3FV7A 3Q07A 4OPRA 5CTNA 1CK3A 3UY6A 3W8KA 1NZOA 2OLVA 4FD8A 4E3KA 4LV2A 3NIAA 5FA7A 1FR1A 1SDEA 4YINA 3S22A 4OP8A 4OQIA 4QU3A 3QNCA 2ZQ7A 2XFSA 3N8LA 3IF6C 1QMFA 1K54A 2PU2A 1N9BA 1XKZA 4ZJ3A 4X53A 1S6RA 2WZXA 3LEZA 4DRTA 1XXMA 1VQQA 1IEMA 3ZCZA 1OMEA 1EROA 3A3IA 4WELA 5CGXA 1NRFA 1H8ZA 2Q9MA 3Q1FA 1K25A 5KSHA 1PIOA 1JVJA 5TR7A 4BJPA 1DJCA 3BFCA 1IYQA 4DE2A 2I72A 4E6WA 2FFYA 1MWUA 3BFDA 3BLMA 3D4FA 3ISGA 1W7FA 4BD1A 1SKFA 3M6HA 5CXWA 3G31A 2PBYA 1YLYA 4MBHA 4E3NA 3PBOA 2HP9A 2ZC4B 4YFMA 2QZ6A 4DXCA 1ZC2A 5HX9A 2ZQ9A 2JCHA 3BFFA 5AQ7A 2EX9A 1G68A 5AQAA 3OZHA 4X55A 1GA9A 5DF7A 3MKFA 2EX8A 3BEBA 3PAEA 4XUZA 1L0GA 2Y2JA 5G18A 3C5AA 3G4PA 1KE0A 4ZDXA 3C7UA 5GLBA 3RJUA 1K54C 3E2KA 3HLFA 3GTCA 4JXSA 5M1AA 4Z9QA 3SH9A 3GRJA 3HL9A 4WMCA 1GCEA 4R1GA 2OLUA 4FCFA 5HAQA 3NCKA 2BG1A 2A49A 4UA9A 4OOMA 3EQUA 1Z6FA 3N7WA 4PM6A 3VFHA 3I7JA 1H8YA 2EX2A 3CJMA 4N1HA 1NY0A 4ZBEA 2P9VB 1MWSA 2XK1A 3N8SA 2P74A 3VMAA 1W5DA 2HP5A 2WGVA 2J9OA 4OVDA 5A92A 2ZM0A 5IHVA 5CEDA 5DTTA 5EOOA 3VFFA 1ALQA 4K0XA 4B4ZA 4R4RA 3VP2A 4PMAA 1PWGA 3MZEA 1VM1A 2WKIA 5DF9A 4EBNA 2X02A 1M40A 1PI5A 2OV5A 4BD0A 3ZG9B 1RGZA 4IBXA 1WE4A 2X01A 5CGSA 2WAEA 1W79A 3DWKA 3FWLA 5KMWA 4EUZA 3HUMA 4KQRA 3BLSA 3SS5A 4IVIA 1FQGA 2WYXA 1IKGA 3IWQA 4KQQA 5F83A 4GOGA 3DTMA 4S2LA 1O7EA 1ONGA 1NYYA 4OONA 3N8RA 5CRFA 5FQMA 1BSGA 3SS4A 1SHVA 1S0WA 2UWXA 3NDEA 2ZD8A 4KG6A 1NZUA 2QPNA 3G32A 4IEDA 5AQ9A 1L2SA 2ZM2A 2WK0A 2ZJ9A 3IXHA 4NK3A 4B4XA 3WRZA 1K55A 1M6KA 1MWTA 4O7DA 3G30A 3IF6B 4N1XA 3UE0A 4F94A 3MXRA 2Y2OA 2Z2LB 1K4EA 4QY6A 1YLTA 3Q7ZA 1CI9A 3C4PA 3G2YA 4RYEA 2EFXA 2G2UA 4GKUA 2ZC5B 3IT9A 1MXOA 1DJBA 3MXSA 5GLDA 3W4PA 2VGJA 3A3FA 1JWPA 3VP3A 3CZDA 3HLBA 5A93A 3PBTA 2DCFA 2EX6A 4DE3A 3M2KA 5BOHA 4JLFA 5FQIA 3LCEA 4KZAA 1FOFA 4U3TA 1XGIA 1DJAA 4KZ6A 3O88A 3DWZA 4E3IA 2ZLYA 3Q7VA 1FCMA 4WM9A 3QNBA 4Y0TA 4RX3A 4U0TA 4OKPA 5TGFA 5FAOA 4QB8A 3JYIA 3UN7A 1ES2A 2IWCA 3HUNA 2HPBA 4LV0A 3SOIA 4C75A 1K55C 3ZVWA 1AXBA 5E43A 1ES4A 2EXBA 2QMIA 4P0MA 4S2OA 3RXWA 4ZJ2A 2VGKA 4XUXA 2OSUA 3HLDA 4X69A 4S2PA 1ZKJA 2G2WA 3Q81A 4UA6A 4PPRA 3VSLA 4PM8A 1XP4A 1QMEA 4LV1A 4D2OA 1BT5A 5DVAA 1PW1A 3AGFA 4QY5A 3TSGA 3V3RA 1LLBA 1PYYA 3BECA 3WS0A 3BFEA 3WWXA 4R23A 1K56D 5FAPA 2H5SA 1RP5A 4MNRA 1EI5A 3VOYA 2Y2HA 4P85A 3ZHHA 1XX2A 1L0EA 1HZOA 2WKHA 2JE5A 4FH4A 1KVMA 1KE3A 4X56A 4JF5A 5TFQA 1LHYA 3V5MA 1FCNA 3LY3A 1XPBA 4NETA 4GB7A 3VOZA 3C4OA 5GHZA 3ZNTA 3OC2A 3PAGA 4OP5A 2X71A 3SS3A 3NBLA 4RX2A 3AGEA 3FZCA 5GLAA 4ZTKA 5FI6A 2Y4AA 2Y2KA 1K38A 4X68A 4ZJ1A 3WS5A 5HAPA 1L0FA 1PI4A 5FQJA 1PW8A 4OPYA 1DY6A 1NJ4A 5I94A 3UDFA 1WYCA 4WBGA 1RCJA 3VP4A 3WS2A 2BLSA 2XD1A 3ZNYA 1H5XA 3OCNA 1J9MA 3O86A 1JWVA 3MFDA 3IQAA 2ZC7A 3M2JA 1BULA 3MZDA 1YLWA 3B3XA 3N4IA 5GHXA 1XA7A 4MBFA 4CPKA 1NXYA 4KZ7A 1JWZA 5CEBA 4DKIA 1ESUA 1U60A 3HLGA 3W4OA 3W4QA 1ZG4A 1ZG6A 1MPLA 4JF4A 1BLPA 4JXVA 4PM9A 3MKEA 3UO9A 3V39A 5DF8A 3HUOA 2PU4A 5FI7A 2ZC3B 1FSYA 4BLMA 3ITAA 2HDRA 4FH2A 4P87A 2Y55A 1PZPA 1TEMA 1SCWA 4E3MA 5E2HA 4WEJA 4OQGA 1ESIA 1BLSA 3HBRA 5J8XA 2Y2QA 4JF6A 4PM7A 1HD8A 3IH8A 3NDGA 1K6SA 4HEFA 1XA1A 1G6AA 4XXRA 5CHJA 3UPNA 1IYPA 3TOIA 2Q9NA 1RGYA 2Y2LA 5EOEA 3UDIA 2JC7A 5FQ9A 2RL3A 4OPQA 2C5WB 4HBTA 4ID4A 3S4XA 2Y2GA 1CEFA 1XGJA 3GV9A 1BZAA 2XH9A 1YQSA 3G2ZA 1E3UA 2ZMAA 3IWIA 5CECA 2Y2MA 3DW0A 4LV3A 4QD4A 2Y2NA 4P6BA 3SH7A 4OH0A 4LENA 1SDNA 1Q2PA 5EUAA 5EPHA 3CG5A 3IXGA 3ZGAB 2IWBA 2V20A 4N9LA 3O87A 1LL9A 1BTLA 2R9WA 3UDXA 3IXBA 3LY4A 4JKTA 5EE8A 3NC8A 1I2SA 1GHIA 2WADA 3GSGA 1L0DA 4KG2A 3ZG7B 2EFUA 4S2IA 5FSRA 4K91A 1K56A 2WUQA 4R4SA 3OPPA 3Q7VB 1ES5A 5E2EA 2WGWA 2WGWB 3E2LA 5E2GA 1K4FA 4UAAA 4E3LA 2B5RA 3O3VA 5A91A 5DTSA 4X6TA 4DXBA 1E3UD 1O07A 1FCOA 3TG9A 5EVID 5HARA 3N6IA 1N4OA 1IKIA 3PTEA 4U0XA 4KQOA 4CJNA 3OCLA 3IH9A 5F1FA 1MKIA 4WZ4A 3UPOA 4OQHA 3VSKA 3FYZA 1KDSA 4UHUA 1BUEA 4S2KA 5AQBA 3A3JA 1YLZA 4R3JA 2CC1A 4QHCA 1NYMA 3RXXA 1C3BA 3HREA 1LL5A 4IVKA 2XF3A 4E3OA 4GDBA 4S2NA 3IF5A 5FATA 5EECA 3AGDA 4MBKA 1TDLA 3WRTA 2XQZA 4GD6A 1YT4A 3UNWA 3OPHA 2WKEA 2A3UA 1ERQA 3BM6A 1W8YA 4DF6A 2DRWA 4WEKA 2XD5A 2WGIA 4C3QA 3GMWA 1BLCA 1K6RA 4JBFA 4LCLA 3Q82A 2HDSA 1Q2QA 3VP1A 1E4DA 1YM1A 3HLCA 5CHMA 5FQKA 4QJGA 4OOLA 1KGFA 1IYSA 5A90A 3V3SA 1IYOA 3A3EA 4E3JA 5F1GA 4EBLA 3V50A 5GL9A 4OLGA 5FQQA 2H0YA 4ZAMA 1FSWA 3C7VA 5L2FA 5M19A 4OPZA 5JYOA 2ZQ8A 2HDUA 5FASA 3BYDA 3BFGA 3M6BA 1WYBA 2V1ZA 2Y91A 3NI9A 4WZ5A 3BRMA 5EVLA 4KZ4A 4OOYA 4MEZA 4JPMA 4S2NC 4UA7A 2J7VA 4GD8A 1Y54A 2ZM8A 2XEPA 3NY4A 1CEGA 3IWOA 3MBZA 5CERA 2H10A 4JXGA 5GLCA 1I2WA 4R3BA 5KSCA 2Y2IA 3PBSA 4N9KA 3CMZA 2ZQCA 3UPPA 1YMXA 2XR0A 4KZ3A 4RA7A 1BLHA 1MBLA 2WZZA 3IHBA 4KG5A 4BQMA 1YLPA 3HLWA 4JXWA 4EQIA 4RVAA 4Y7PA 1KE4A 3UE1A 2R9XA 4IBRA 2HDQA 5HAIA 3OPRA 4GN2A 3IXDA 1ERMA 1MWRA 5E2FA 4EV4A 2IWDA 3ZG5A 3IHAA 1K57A 1YMSA 4MLLA 1KVLA 1I5QA 1PWDA 3G35A 5U47A 3PBNA 2FFFB 1PWCA 3HVFA 2Z2MB 2GDNA 2P9VA 2V2FF 2EXAA 5FI2A 3SH8A 3VP0A 1CI8A 3EQVA 3GQZA 3WS1A 4N92A 4Y0OA 3ZG8B 2E8IA 4WZ5C 4L0LA 5CTMA 4KZ8A 2XLNA 3FKVA 2XDMA 1PZOA 5HFOA 1EWZA 2JBFA 2HP6A 5CHUA 1GHMA 3PBRA 4M3KA 2ZC6B 1TDGA 1ONHA 4A5RA 4GNUA 4DDYA 2Y59A 4K0WA 2ZQAA 4R0QA 5FAQA 5F82A 3GR2A 4H8RA 1KDWA 4GZBA 4WMCD 5CGWA 4LCMA 4B88A 3GVBA 4DE1A 4BENA 4Q8IA 1HVBA 1GHPA 2XGNA 3ZDJA 3ZVTA 4S2MA 4EWFA 3ZFZA 3WS4A 4PM5A 5JYPA 2C6WB 1W8QA 5EVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OLD A;  1ES3 A;  5EVI B;  4BL2 A;  4KZ9 A;  5HL1 A;  2DNS A;  2H0T A;  5KZH A;  1LI9 A;  4KEN B;  1K57 C;  2Y2P A;  3FKW A;  5GHY A;  2J8Y A;  4OQ0 A;  4DDS A;  2XFT A;  4WYY A;  1TVF A;  1E25 A;  5D3O A;  3HLE A;  5DTK A;  1MY8 A;  3P09 A;  4Y0U A;  3IF6 A;  1HTZ A;  1JTD A;  2J9P A;  4C6Y A;  4HBU A;  1GA0 A;  4GDN A;  1JTG A;  3MZF A;  3A3D A;  3ITB A;  4E6X A;  1IEL A;  2WAF A;  3UE3 A;  3P98 A;  1FR6 A;  5M18 A;  2ZQD A;  4FSF A;  3S1Y A;  3PBQ A;  2RCX A;  3QHY A;  4KZB A;  1KGG A;  4HES A;  1KGE A;  4S2J A;  5HW3 A;  1LI0 A;  3G34 A;  5EVI C;  3ZG0 A;  1YLJ A;  3LO7 A;  4BL3 A;  4KZ5 A;  4DE0 A;  3OPL A;  5FDH A;  4EBP A;  3FV7 A;  3Q07 A;  4OPR A;  5CTN A;  1CK3 A;  3UY6 A;  3W8K A;  1NZO A;  2OLV A;  4FD8 A;  4E3K A;  4LV2 A;  3NIA A;  5FA7 A;  1FR1 A;  1SDE A;  4YIN A;  3S22 A;  4OP8 A;  4OQI A;  4QU3 A;  3QNC A;  2ZQ7 A;  2XFS A;  3N8L A;  3IF6 C;  1QMF A;  1K54 A;  2PU2 A;  1N9B A;  1XKZ A;  4ZJ3 A;  4X53 A;  1S6R A;  2WZX A;  3LEZ A;  4DRT A;  1XXM A;  1VQQ A;  1IEM A;  3ZCZ A;  1OME A;  1ERO A;  3A3I A;  4WEL A;  5CGX A;  1NRF A;  1H8Z A;  2Q9M A;  3Q1F A;  1K25 A;  5KSH A;  1PIO A;  1JVJ A;  5TR7 A;  4BJP A;  1DJC A;  3BFC A;  1IYQ A;  4DE2 A;  2I72 A;  4E6W A;  2FFY A;  1MWU A;  3BFD A;  3BLM A;  3D4F A;  3ISG A;  1W7F A;  4BD1 A;  1SKF A;  3M6H A;  5CXW A;  3G31 A;  2PBY A;  1YLY A;  4MBH A;  4E3N A;  3PBO A;  2HP9 A;  2ZC4 B;  4YFM A;  2QZ6 A;  4DXC A;  1ZC2 A;  5HX9 A;  2ZQ9 A;  2JCH A;  3BFF A;  5AQ7 A;  2EX9 A;  1G68 A;  5AQA A;  3OZH A;  4X55 A;  1GA9 A;  5DF7 A;  3MKF A;  2EX8 A;  3BEB A;  3PAE A;  4XUZ A;  1L0G A;  2Y2J A;  5G18 A;  3C5A A;  3G4P A;  1KE0 A;  4ZDX A;  3C7U A;  5GLB A;  3RJU A;  1K54 C;  3E2K A;  3HLF A;  3GTC A;  4JXS A;  5M1A A;  4Z9Q A;  3SH9 A;  3GRJ A;  3HL9 A;  4WMC A;  1GCE A;  4R1G A;  2OLU A;  4FCF A;  5HAQ A;  3NCK A;  2BG1 A;  2A49 A;  4UA9 A;  4OOM A;  3EQU A;  1Z6F A;  3N7W A;  4PM6 A;  3VFH A;  3I7J A;  1H8Y A;  2EX2 A;  3CJM A;  4N1H A;  1NY0 A;  4ZBE A;  2P9V B;  1MWS A;  2XK1 A;  3N8S A;  2P74 A;  3VMA A;  1W5D A;  2HP5 A;  2WGV A;  2J9O A;  4OVD A;  5A92 A;  2ZM0 A;  5IHV A;  5CED A;  5DTT A;  5EOO A;  3VFF A;  1ALQ A;  4K0X A;  4B4Z A;  4R4R A;  3VP2 A;  4PMA A;  1PWG A;  3MZE A;  1VM1 A;  2WKI A;  5DF9 A;  4EBN A;  2X02 A;  1M40 A;  1PI5 A;  2OV5 A;  4BD0 A;  3ZG9 B;  1RGZ A;  4IBX A;  1WE4 A;  2X01 A;  5CGS A;  2WAE A;  1W79 A;  3DWK A;  3FWL A;  5KMW A;  4EUZ A;  3HUM A;  4KQR A;  3BLS A;  3SS5 A;  4IVI A;  1FQG A;  2WYX A;  1IKG A;  3IWQ A;  4KQQ A;  5F83 A;  4GOG A;  3DTM A;  4S2L A;  1O7E A;  1ONG A;  1NYY A;  4OON A;  3N8R A;  5CRF A;  5FQM A;  1BSG A;  3SS4 A;  1SHV A;  1S0W A;  2UWX A;  3NDE A;  2ZD8 A;  4KG6 A;  1NZU A;  2QPN A;  3G32 A;  4IED A;  5AQ9 A;  1L2S A;  2ZM2 A;  2WK0 A;  2ZJ9 A;  3IXH A;  4NK3 A;  4B4X A;  3WRZ A;  1K55 A;  1M6K A;  1MWT A;  4O7D A;  3G30 A;  3IF6 B;  4N1X A;  3UE0 A;  4F94 A;  3MXR A;  2Y2O A;  2Z2L B;  1K4E A;  4QY6 A;  1YLT A;  3Q7Z A;  1CI9 A;  3C4P A;  3G2Y A;  4RYE A;  2EFX A;  2G2U A;  4GKU A;  2ZC5 B;  3IT9 A;  1MXO A;  1DJB A;  3MXS A;  5GLD A;  3W4P A;  2VGJ A;  3A3F A;  1JWP A;  3VP3 A;  3CZD A;  3HLB A;  5A93 A;  3PBT A;  2DCF A;  2EX6 A;  4DE3 A;  3M2K A;  5BOH A;  4JLF A;  5FQI A;  3LCE A;  4KZA A;  1FOF A;  4U3T A;  1XGI A;  1DJA A;  4KZ6 A;  3O88 A;  3DWZ A;  4E3I A;  2ZLY A;  3Q7V A;  1FCM A;  4WM9 A;  3QNB A;  4Y0T A;  4RX3 A;  4U0T A;  4OKP A;  5TGF A;  5FAO A;  4QB8 A;  3JYI A;  3UN7 A;  1ES2 A;  2IWC A;  3HUN A;  2HPB A;  4LV0 A;  3SOI A;  4C75 A;  1K55 C;  3ZVW A;  1AXB A;  5E43 A;  1ES4 A;  2EXB A;  2QMI A;  4P0M A;  4S2O A;  3RXW A;  4ZJ2 A;  2VGK A;  4XUX A;  2OSU A;  3HLD A;  4X69 A;  4S2P A;  1ZKJ A;  2G2W A;  3Q81 A;  4UA6 A;  4PPR A;  3VSL A;  4PM8 A;  1XP4 A;  1QME A;  4LV1 A;  4D2O A;  1BT5 A;  5DVA A;  1PW1 A;  3AGF A;  4QY5 A;  3TSG A;  3V3R A;  1LLB A;  1PYY A;  3BEC A;  3WS0 A;  3BFE A;  3WWX A;  4R23 A;  1K56 D;  5FAP A;  2H5S A;  1RP5 A;  4MNR A;  1EI5 A;  3VOY A;  2Y2H A;  4P85 A;  3ZHH A;  1XX2 A;  1L0E A;  1HZO A;  2WKH A;  2JE5 A;  4FH4 A;  1KVM A;  1KE3 A;  4X56 A;  4JF5 A;  5TFQ A;  1LHY A;  3V5M A;  1FCN A;  3LY3 A;  1XPB A;  4NET A;  4GB7 A;  3VOZ A;  3C4O A;  5GHZ A;  3ZNT A;  3OC2 A;  3PAG A;  4OP5 A;  2X71 A;  3SS3 A;  3NBL A;  4RX2 A;  3AGE A;  3FZC A;  5GLA A;  4ZTK A;  5FI6 A;  2Y4A A;  2Y2K A;  1K38 A;  4X68 A;  4ZJ1 A;  3WS5 A;  5HAP A;  1L0F A;  1PI4 A;  5FQJ A;  1PW8 A;  4OPY A;  1DY6 A;  1NJ4 A;  5I94 A;  3UDF A;  1WYC A;  4WBG A;  1RCJ A;  3VP4 A;  3WS2 A;  2BLS A;  2XD1 A;  3ZNY A;  1H5X A;  3OCN A;  1J9M A;  3O86 A;  1JWV A;  3MFD A;  3IQA A;  2ZC7 A;  3M2J A;  1BUL A;  3MZD A;  1YLW A;  3B3X A;  3N4I A;  5GHX A;  1XA7 A;  4MBF A;  4CPK A;  1NXY A;  4KZ7 A;  1JWZ A;  5CEB A;  4DKI A;  1ESU A;  1U60 A;  3HLG A;  3W4O A;  3W4Q A;  1ZG4 A;  1ZG6 A;  1MPL A;  4JF4 A;  1BLP A;  4JXV A;  4PM9 A;  3MKE A;  3UO9 A;  3V39 A;  5DF8 A;  3HUO A;  2PU4 A;  5FI7 A;  2ZC3 B;  1FSY A;  4BLM A;  3ITA A;  2HDR A;  4FH2 A;  4P87 A;  2Y55 A;  1PZP A;  1TEM A;  1SCW A;  4E3M A;  5E2H A;  4WEJ A;  4OQG A;  1ESI A;  1BLS A;  3HBR A;  5J8X A;  2Y2Q A;  4JF6 A;  4PM7 A;  1HD8 A;  3IH8 A;  3NDG A;  1K6S A;  4HEF A;  1XA1 A;  1G6A A;  4XXR A;  5CHJ A;  3UPN A;  1IYP A;  3TOI A;  2Q9N A;  1RGY A;  2Y2L A;  5EOE A;  3UDI A;  2JC7 A;  5FQ9 A;  2RL3 A;  4OPQ A;  2C5W B;  4HBT A;  4ID4 A;  3S4X A;  2Y2G A;  1CEF A;  1XGJ A;  3GV9 A;  1BZA A;  2XH9 A;  1YQS A;  3G2Z A;  1E3U A;  2ZMA A;  3IWI A;  5CEC A;  2Y2M A;  3DW0 A;  4LV3 A;  4QD4 A;  2Y2N A;  4P6B A;  3SH7 A;  4OH0 A;  4LEN A;  1SDN A;  1Q2P A;  5EUA A;  5EPH A;  3CG5 A;  3IXG A;  3ZGA B;  2IWB A;  2V20 A;  4N9L A;  3O87 A;  1LL9 A;  1BTL A;  2R9W A;  3UDX A;  3IXB A;  3LY4 A;  4JKT A;  5EE8 A;  3NC8 A;  1I2S A;  1GHI A;  2WAD A;  3GSG A;  1L0D A;  4KG2 A;  3ZG7 B;  2EFU A;  4S2I A;  5FSR A;  4K91 A;  1K56 A;  2WUQ A;  4R4S A;  3OPP A;  3Q7V B;  1ES5 A;  5E2E A;  2WGW A;  2WGW B;  3E2L A;  5E2G A;  1K4F A;  4UAA A;  4E3L A;  2B5R A;  3O3V A;  5A91 A;  5DTS A;  4X6T A;  4DXB A;  1E3U D;  1O07 A;  1FCO A;  3TG9 A;  5EVI D;  5HAR A;  3N6I A;  1N4O A;  1IKI A;  3PTE A;  4U0X A;  4KQO A;  4CJN A;  3OCL A;  3IH9 A;  5F1F A;  1MKI A;  4WZ4 A;  3UPO A;  4OQH A;  3VSK A;  3FYZ A;  1KDS A;  4UHU A;  1BUE A;  4S2K A;  5AQB A;  3A3J A;  1YLZ A;  4R3J A;  2CC1 A;  4QHC A;  1NYM A;  3RXX A;  1C3B A;  3HRE A;  1LL5 A;  4IVK A;  2XF3 A;  4E3O A;  4GDB A;  4S2N A;  3IF5 A;  5FAT A;  5EEC A;  3AGD A;  4MBK A;  1TDL A;  3WRT A;  2XQZ A;  4GD6 A;  1YT4 A;  3UNW A;  3OPH A;  2WKE A;  2A3U A;  1ERQ A;  3BM6 A;  1W8Y A;  4DF6 A;  2DRW A;  4WEK A;  2XD5 A;  2WGI A;  4C3Q A;  3GMW A;  1BLC A;  1K6R A;  4JBF A;  4LCL A;  3Q82 A;  2HDS A;  1Q2Q A;  3VP1 A;  1E4D A;  1YM1 A;  3HLC A;  5CHM A;  5FQK A;  4QJG A;  4OOL A;  1KGF A;  1IYS A;  5A90 A;  3V3S A;  1IYO A;  3A3E A;  4E3J A;  5F1G A;  4EBL A;  3V50 A;  5GL9 A;  4OLG A;  5FQQ A;  2H0Y A;  4ZAM A;  1FSW A;  3C7V A;  5L2F A;  5M19 A;  4OPZ A;  5JYO A;  2ZQ8 A;  2HDU A;  5FAS A;  3BYD A;  3BFG A;  3M6B A;  1WYB A;  2V1Z A;  2Y91 A;  3NI9 A;  4WZ5 A;  3BRM A;  5EVL A;  4KZ4 A;  4OOY A;  4MEZ A;  4JPM A;  4S2N C;  4UA7 A;  2J7V A;  4GD8 A;  1Y54 A;  2ZM8 A;  2XEP A;  3NY4 A;  1CEG A;  3IWO A;  3MBZ A;  5CER A;  2H10 A;  4JXG A;  5GLC A;  1I2W A;  4R3B A;  5KSC A;  2Y2I A;  3PBS A;  4N9K A;  3CMZ A;  2ZQC A;  3UPP A;  1YMX A;  2XR0 A;  4KZ3 A;  4RA7 A;  1BLH A;  1MBL A;  2WZZ A;  3IHB A;  4KG5 A;  4BQM A;  1YLP A;  3HLW A;  4JXW A;  4EQI A;  4RVA A;  4Y7P A;  1KE4 A;  3UE1 A;  2R9X A;  4IBR A;  2HDQ A;  5HAI A;  3OPR A;  4GN2 A;  3IXD A;  1ERM A;  1MWR A;  5E2F A;  4EV4 A;  2IWD A;  3ZG5 A;  3IHA A;  1K57 A;  1YMS A;  4MLL A;  1KVL A;  1I5Q A;  1PWD A;  3G35 A;  5U47 A;  3PBN A;  2FFF B;  1PWC A;  3HVF A;  2Z2M B;  2GDN A;  2P9V A;  2V2F F;  2EXA A;  5FI2 A;  3SH8 A;  3VP0 A;  1CI8 A;  3EQV A;  3GQZ A;  3WS1 A;  4N92 A;  4Y0O A;  3ZG8 B;  2E8I A;  4WZ5 C;  4L0L A;  5CTM A;  4KZ8 A;  2XLN A;  3FKV A;  2XDM A;  1PZO A;  5HFO A;  1EWZ A;  2JBF A;  2HP6 A;  5CHU A;  1GHM A;  3PBR A;  4M3K A;  2ZC6 B;  1TDG A;  1ONH A;  4A5R A;  4GNU A;  4DDY A;  2Y59 A;  4K0W A;  2ZQA A;  4R0Q A;  5FAQ A;  5F82 A;  3GR2 A;  4H8R A;  1KDW A;  4GZB A;  4WMC D;  5CGW A;  4LCM A;  4B88 A;  3GVB A;  4DE1 A;  4BEN A;  4Q8I A;  1HVB A;  1GHP A;  2XGN A;  3ZDJ A;  3ZVT A;  4S2M A;  4EWF A;  3ZFZ A;  3WS4 A;  4PM5 A;  5JYP A;  2C6W B;  1W8Q A;  5EVI A; 
#chains in the Genus database with same CATH topology
 4BL2 A;  4KZ9 A;  2DNS A;  4PKY G;  3MMH A;  1K57 C;  4HJ3 A;  2Y2P A;  5EM0 A;  5GHY A;  2J8Y A;  4NG2 A;  4DDS A;  4WYY A;  4DJ3 A;  3LIC A;  1MY8 A;  2W3D A;  4G3V A;  1HTZ A;  4C6Y A;  4HBU A;  4Y3I A;  3ITB A;  5J4E A;  4ETX A;  1T18 A;  1LI0 A;  3G34 A;  3F1P B;  3BWL A;  4KQD A;  3OPL A;  4EBP A;  1CK3 A;  3UY6 A;  3LUQ A;  5TBM B;  4UQI S;  3CI6 A;  1NZO A;  4E3K A;  1T1C A;  5DJT A;  1FR1 A;  4MN5 A;  4Y17 A;  4WUJ A;  3QNC A;  3T12 B;  2XFS A;  2Y79 A;  4ZJ3 A;  4X53 A;  1S6R A;  1VQQ A;  2VZW A;  3A3I A;  1H8Z A;  2Q9M A;  3FG8 A;  4CLC B;  1K25 A;  2PYR A;  1VET A;  2FFY A;  1MWU A;  3BFD A;  3BLM A;  2O9A A;  3D4F A;  5KIZ A;  2OAP 1;  3M6H A;  4EQ1 A;  2QZ6 A;  1ZC2 A;  4G3W A;  3U4L P;  3S7Q A;  3BEB A;  2Y2J A;  3C5A A;  4ETZ A;  3GTC A;  4CLC D;  2L0W A;  5AVE A;  2VV8 A;  2A49 A;  4WLA A;  2V1A A;  3EQU A;  3I7J A;  3VE3 A;  3CPT A;  1W5D A;  1X0O A;  3F1N A;  3DBA A;  4B4Z A;  1MZU A;  4YWZ A;  3LIA A;  4PMA A;  1PWG A;  5DF9 A;  1M40 A;  1PI5 A;  4BD0 A;  1SZV A;  3QP5 A;  3T4Q A;  3HUM A;  4KQR A;  1S67 L;  2GJ3 A;  4I3I A;  1ZTU A;  3S7N A;  4KQQ A;  4GOG A;  3N8R A;  3KSF A;  1SHV A;  1S0W A;  2ZD8 A;  2VGL S;  2QPN A;  3G32 A;  4I3A A;  4IED A;  2WK0 A;  3WRZ A;  1K55 A;  5A8B A;  1EW0 A;  3IF6 B;  4F94 A;  3IBJ A;  2AVX A;  2G2U A;  5GLD A;  2QHK A;  5FDS A;  2EX6 A;  4DE3 A;  1XFN A;  4F3L A;  3MXQ A;  2V0U A;  3T1R A;  4WM9 A;  3QNB A;  4RX3 A;  1PRQ A;  5FAO A;  3UN7 A;  1ES2 A;  2IWC A;  2GZA A;  5J7E A;  1K55 C;  5E43 A;  4S2O A;  3RXW A;  4XUX A;  2OSU A;  4X69 A;  5J3W A;  2G2W A;  4UA6 A;  3UB9 A;  4PPR A;  3VSL A;  4PM8 A;  1P9W A;  5DVA A;  1PW1 A;  1W63 M;  2R78 A;  1PYY A;  3BEC A;  2J3T D;  3T4T A;  3WS0 A;  3WWX A;  4R23 A;  1K56 D;  1RP5 A;  3VOY A;  4PKY A;  4EUV A;  4E04 A;  5HL6 A;  4JF5 A;  2W3G A;  1LHY A;  2XRN A;  5GHZ A;  1TS6 A;  4IJG A;  4R3A A;  3D72 A;  4RX2 A;  5FI6 A;  1T1B A;  4BMW A;  3T1S A;  1PW8 A;  5L8M A;  3PXP A;  5IU1 A;  3ZNY A;  2BLS A;  1J9M A;  2PR6 A;  3M2J A;  4GCZ A;  1BUL A;  1F98 A;  3B3X A;  4CLC E;  5GHX A;  4MBF A;  4CPK A;  1GSW A;  1U60 A;  3HLG A;  4XT2 A;  3W4Q A;  2WKR A;  3KYZ A;  1T1A A;  4JF4 A;  1MPL A;  4PM9 A;  3UO9 A;  3V39 A;  3CHW P;  4BLM A;  3ITA A;  4FH2 A;  4P87 A;  3VE4 A;  4PHT A;  4MN6 A;  2M1C A;  2O0Y A;  4WEJ A;  4OQG A;  4PM7 A;  3UPN A;  1IYP A;  2IA2 A;  3TOI A;  3GEC A;  4GLQ A;  3D9Y A;  2RL3 A;  5IT5 A;  3CAX A;  2C5W B;  4LLO B;  3GV9 A;  3R4K A;  5CEC A;  2Y2M A;  4QD4 A;  4P6B A;  3SH7 A;  1SDN A;  3CG5 A;  2IWB A;  1GHI A;  2WAD A;  4MDZ A;  3HJK A;  2EFU A;  2WUQ A;  1TF1 A;  3KSG A;  5LBR A;  1K4F A;  5A91 A;  3VV4 A;  2OWH A;  1FCO A;  1N4O A;  4U0X A;  4CJN A;  5HWV A;  3OCL A;  3MQQ A;  1MKI A;  3UPO A;  4S2K A;  5AVF A;  4IVK A;  1LL5 A;  1OTA A;  4GDB A;  4MBK A;  1TDL A;  2XQZ A;  4I38 A;  3BM6 A;  3GMW A;  1BLC A;  1XFQ A;  3H7W A;  2P08 A;  3SZT A;  2WKQ A;  1OTE A;  1YM1 A;  3HLC A;  2GX5 A;  1KGF A;  1IYS A;  1PNE A;  5F1G A;  2PD7 A;  4ZAM A;  3C7V A;  5M19 A;  3M6B A;  1WYB A;  2V1Z A;  1T19 A;  2Y91 A;  5F69 A;  3NI9 A;  4KZ4 A;  4Q0J A;  4MEZ A;  4JPM A;  2J7V A;  1Y54 A;  2B02 A;  2XEP A;  1OT9 A;  3DTE A;  3IWO A;  2H10 A;  2YKH A;  2FH5 A;  4R3B A;  4RA7 A;  4EXO A;  3HLW A;  3LYX A;  3H82 A;  3UE1 A;  2HDQ A;  4O0P A;  3ZG5 A;  1PWC A;  2Z2M B;  3VP0 A;  2ZL1 A;  4L0L A;  4KZ8 A;  1S4R A;  3FKV A;  2XDM A;  2JBF A;  2O99 A;  2HP6 A;  3PBR A;  1SKO A;  2ZC6 B;  3MJQ A;  4H8R A;  3GVB A;  4BEN A;  1HVB A;  1GHP A;  2XGN A;  3ZVT A;  3WS4 A;  5JYP A;  1W8Q A;  3LR4 A;  5EVI A;  1ES3 A;  4HIA A;  4DJ2 A;  3FPW A;  3FKW A;  4IHQ A;  1DP8 A;  2PT7 A;  5DTK A;  3P09 A;  3IF6 A;  1CJF A;  2DMW A;  4GDN A;  3DTI A;  3RH8 B;  4LRX C;  1IEL A;  2WAF A;  3P98 A;  2ZQD A;  4GHI A;  1S4S A;  3QHY A;  4KZB A;  3LGO A;  5EVI C;  3T1X A;  5HDC A;  4KZ5 A;  5HD5 A;  4FD8 A;  3NIA A;  2VV7 A;  5EV0 A;  1SDE A;  4EW7 A;  4QU3 A;  1OTB A;  3IF6 C;  1XKZ A;  2WZX A;  1J3W A;  1PFL A;  1ERO A;  3Q1F A;  2W3E A;  5KSH A;  4E6W A;  4CQH A;  1IFQ A;  3S7O A;  2PBY A;  4MBH A;  4E3N A;  3NOP C;  2ZQ9 A;  2JCH A;  3BFF A;  1V9Z A;  1GA9 A;  4FTX A;  1L0G A;  1KE0 A;  4AFI A;  3RJU A;  3SH9 A;  3GRJ A;  1GCE A;  1G6O A;  1WA9 A;  2OLU A;  4FCF A;  2B18 A;  4PM6 A;  3VFH A;  2OWJ A;  2EX2 A;  3CJM A;  1NY0 A;  2PHY A;  4ZBE A;  2P9V B;  4HH2 A;  2XK1 A;  2P74 A;  3VMA A;  1UWN X;  4OVD A;  2J9O A;  1ZHH B;  5EOO A;  2A24 B;  3VP2 A;  1VM1 A;  4NEE D;  2X02 A;  2V8C A;  5EFW A;  2XA7 M;  1RGZ A;  3SS5 A;  1FQG A;  3IX3 A;  1O7E A;  1ONG A;  1NYY A;  1TS0 A;  4OON A;  1L2S A;  2ZM2 A;  2O9B A;  3ULF A;  3QP1 A;  1M6K A;  4N1X A;  4X25 A;  3LID A;  3MXR A;  2Z2L B;  4QY6 A;  1K4E A;  1CI9 A;  4RYE A;  3TW8 A;  3IS2 B;  1LSX A;  1MXO A;  1DJB A;  3VP3 A;  2ACG A;  3CZD A;  3PBT A;  2DCF A;  3M2K A;  2D01 A;  4JLF A;  3LCE A;  4HI4 A;  5IS1 A;  4FUW A;  1VEU A;  2KDK A;  2ZLY A;  1FCM A;  2VLG A;  4Y0T A;  4JGR A;  3JYI A;  1YSQ A;  1S1Y A;  1UGU A;  3HUN A;  2V0W A;  5HWT A;  4P0M A;  3T1Q B;  1TD5 A;  2VGK A;  1XP4 A;  1BT5 A;  3AGF A;  3TSG A;  1EI5 A;  1S1Z A;  4P85 A;  3ZHH A;  2WKH A;  3KYE A;  2M7V A;  3L9K A;  2KLI A;  3DTK A;  1FCN A;  3LY3 A;  4NET A;  4P6Z S;  3VOZ A;  3OC2 A;  3NBL A;  3AGE A;  2PYP A;  4GS9 B;  3FZC A;  2Y2K A;  4Q0H A;  4MCW A;  5HAP A;  1XJ6 A;  1DY6 A;  5I94 A;  1RCJ A;  3VP4 A;  5C5K A;  2XD1 A;  3MR0 A;  1H5X A;  3OCN A;  4BBV A;  2VV6 A;  3KX0 X;  3MZD A;  1YLW A;  3N4I A;  3MFX A;  1XA7 A;  3C38 A;  1DRM A;  5CEB A;  4I3J A;  4QPR A;  4DKI A;  1ZG4 A;  1ZG6 A;  4JXV A;  3UB5 P;  5FI7 A;  2WKP A;  4HJ6 A;  4JGO A;  5MC7 A;  1PZP A;  4E3M A;  2PD8 A;  2JKR I;  1BLS A;  4ARZ A;  3NDG A;  4HEF A;  1G6A A;  2BTF P;  1RGY A;  3JVU A;  4OPQ A;  4YOF A;  2K31 A;  4H6J B;  3SW1 A;  4ID4 A;  1CEF A;  3G2Z A;  1E3U A;  2ZMA A;  2PDR A;  3DW0 A;  4LV3 A;  2ZOI A;  4Y5F A;  1F5M A;  3DAV A;  3ZGA B;  2V20 A;  4EET B;  2R9W A;  4JKT A;  4NXF A;  4KG2 A;  2VA0 A;  1ES5 A;  2KX6 A;  2WGW B;  3E2L A;  2JKG A;  4E3L A;  2B5R A;  5DTS A;  1O07 A;  3TG9 A;  5EVI D;  3D3O A;  5F1F A;  1H3Q A;  3T4L A;  3QP2 A;  2Q0O A;  4L9F A;  5AQB A;  4KUO A;  3RXX A;  4E3O A;  4S2N A;  1LT0 A;  3WRT A;  1YT4 A;  3B42 A;  3E4P A;  2DRW A;  4WEK A;  2XD5 A;  2WGI A;  4C3Q A;  1K6R A;  3LIB A;  3QP8 A;  1MC0 A;  4LCL A;  2HDS A;  1E4D A;  5FQK A;  3F1O B;  3R7W A;  4EBL A;  4LGW A;  2H0Y A;  2W1T B;  3B47 A;  1FSW A;  3BY9 A;  4OPZ A;  5JYO A;  2ZQ8 A;  1H0M A;  4HP4 A;  3BYD A;  3BFG A;  3BQA A;  4OOY A;  4S2N C;  4UA7 A;  4GD8 A;  1CEG A;  1OJ5 A;  3NOU C;  3MBZ A;  3KSI A;  5GLC A;  4X1L A;  2P7J A;  1YMX A;  4KUK A;  2E8J A;  4BQM A;  2WZZ A;  1MBL A;  3IHB A;  1YLP A;  2JKF A;  3CUE A;  2M7U A;  4LRZ E;  3OPR A;  3IXD A;  1MWR A;  4EV4 A;  1LSW A;  4GJ4 A;  2IWD A;  5FEG A;  4GW9 A;  4I5S A;  1PWD A;  3G35 A;  2FFF B;  3HVF A;  2GDN A;  2P9V A;  2V2F F;  5FI2 A;  3SH8 A;  1CI8 A;  3GQZ A;  1PZO A;  2H28 A;  5CHU A;  1YPR A;  2YKF A;  1TDG A;  1ONH A;  3MQ0 A;  2Y59 A;  4K0W A;  2ZQA A;  5F82 A;  5HDD A;  4ESP A;  3LR5 A;  2C6W B;  5DFX A;  4OLD A;  1D7E A;  3CUE C;  2H0T A;  5KZH A;  1LI9 A;  4KEN B;  4EER A;  4OQ0 A;  2XFT A;  3NJA A;  1OTD A;  5DFY A;  3UME A;  4Y0U A;  3E4Q A;  1GA0 A;  1YKD A;  3MZF A;  4Z1W A;  4E6X A;  1LL8 A;  1GSV A;  1FR6 A;  3PYP A;  5M18 A;  1TS8 A;  3S1Y A;  1KGG A;  2HJ9 C;  2V9A A;  1KGE A;  2XSS A;  3ZG0 A;  4L9G A;  3F1P A;  5FDH A;  3FV7 A;  3Q07 A;  5CTN A;  4Y15 A;  5TBM A;  3W8K A;  2OLV A;  1AWI A;  1Y28 A;  4YIN A;  3A0V A;  3S22 A;  4OQI A;  2ZQ7 A;  3N8L A;  1K54 A;  1N9B A;  4WL9 A;  3LEZ A;  4DRT A;  1F2K A;  1IEM A;  1OME A;  4WEL A;  5CGX A;  4PAU A;  1NRF A;  4CLC A;  2JN7 A;  1PIO A;  3A0R A;  4IUK A;  3BFC A;  1G5U A;  4HJ4 A;  3LIF A;  1W7F A;  3UB6 A;  3G31 A;  1YLY A;  4UQI M;  1JNU A;  2HP9 A;  5AQA A;  1G68 A;  2PAV P;  3OZH A;  1TS7 A;  3MKF A;  4B93 A;  3PAE A;  2HV1 A;  4ZDX A;  1K54 C;  3E2K A;  3HLF A;  3U2A A;  4Q0I A;  4Z9Q A;  4WMC A;  2G7U A;  1W63 Q;  4CLC C;  4OOM A;  3N7W A;  2V8F A;  1MWS A;  3EEA A;  3N8S A;  3CPT B;  2HP5 A;  4R70 A;  5A92 A;  5CED A;  3F1N B;  3VFF A;  4K0X A;  3BQ8 A;  3IBR A;  3MZE A;  2WKI A;  4LPZ A;  4R6L A;  4IBX A;  1WE4 A;  4R38 A;  5CGS A;  2WAE A;  2K2N A;  2Z6C A;  3FWL A;  4ZRR A;  4EUZ A;  3RFB A;  3BLS A;  3UE6 A;  2WYX A;  1IKG A;  3IWQ A;  5FQM A;  3DTM A;  4S2L A;  5CRF A;  3SS4 A;  3MQO A;  3NDE A;  4KG6 A;  4M4X A;  1NZU A;  4QWO A;  5AQ9 A;  3IXH A;  4NK3 A;  4B4X A;  4DN0 A;  4IUH A;  4L9E A;  2I9V A;  4UEY A;  4O7D A;  3UE0 A;  2Y2O A;  3G2Y A;  2OAQ 1;  2XRO A;  4GKU A;  4HQA A;  2VGJ A;  3A3F A;  1JWP A;  3CLO A;  1N9L A;  3HLB A;  5BOH A;  4HY8 A;  3FPV A;  1FOF A;  4F3L B;  1DJA A;  3O88 A;  3DWZ A;  5TGF A;  4OKP A;  2VGL M;  5F6A A;  1N9O A;  2HPB A;  4C75 A;  1Z09 A;  1AXB A;  4NKP A;  4ZJ2 A;  4S2P A;  1ZKJ A;  3OOV A;  1QME A;  4D2O A;  4QY5 A;  1LLB A;  3BFE A;  2H5S A;  4MNR A;  3VOL A;  1HZO A;  3V67 A;  5HWW A;  1KE3 A;  4X56 A;  2QJ5 A;  2ZOH A;  4WN5 A;  5TFQ A;  3EEH A;  1CF0 A;  5L09 A;  1XPB A;  4OP5 A;  3B33 A;  5GLA A;  4ZTK A;  2Y4A A;  1K38 A;  4X68 A;  1VHM A;  4EEP A;  1OTI A;  4OPY A;  1NJ4 A;  3UDF A;  2VK3 A;  4WBG A;  2JKT I;  2FZ0 A;  3E98 A;  5I5L A;  4KZ7 A;  1JWZ A;  4O8G A;  2W0N A;  4XT2 B;  2JKR M;  2QJ7 A;  5DF8 A;  5FEF A;  3HUO A;  2PU4 A;  1FSY A;  2HF6 A;  1TEM A;  1SCW A;  5DJU A;  3HBR A;  5J8X A;  2Y2Q A;  4JF6 A;  3IH8 A;  1K6S A;  4XXR A;  1XA1 A;  2Q9N A;  1D1J A;  3JPU A;  1ODV A;  5HD3 A;  3S4X A;  1BZA A;  1YQS A;  4X1M A;  2D02 A;  2Y2N A;  4LEN A;  3LFV A;  5EUA A;  5EPH A;  3QP6 A;  3IXG A;  3T4J A;  3O87 A;  3IXB A;  5EE8 A;  3NC8 A;  1N9N A;  3GSG A;  1NLZ A;  3ZG7 B;  4S2I A;  4K91 A;  4R4S A;  3MSH A;  3LEQ A;  3OPP A;  3Q7V B;  5E2E A;  3EGX C;  5EVE A;  2HJE A;  5G4Y A;  3O3V A;  4X6T A;  1NWZ A;  1BYW A;  3BW6 A;  2HGV A;  1MKM A;  2W3F A;  1XJ4 A;  3IH9 A;  4WZ4 A;  4OQH A;  3VSK A;  3A3J A;  1YLZ A;  3HRE A;  5EM1 A;  5FAT A;  3MF0 A;  3AGD A;  5TJJ A;  4GD6 A;  3UNW A;  3OPH A;  2A3U A;  1OT6 A;  1W8Y A;  4DF6 A;  1DP9 A;  4I39 A;  4NXG A;  3H7W B;  3VP1 A;  2QWS A;  5CHM A;  4OOL A;  3V3S A;  3A3E A;  4E3J A;  5L2F A;  4DMZ A;  4WZ5 A;  5EVL A;  3H9W A;  3OBF A;  4JGQ A;  3ICY A;  5CER A;  1I2W A;  4HP9 A;  4LRY C;  5KSC A;  3PBS A;  5FL3 A;  4N9K A;  3UPP A;  1KE4 A;  3QP4 A;  2KOI A;  2R9X A;  3H82 B;  1ERM A;  4EEU A;  5L10 A;  4MLL A;  1KVL A;  1I5Q A;  2LB9 A;  5U47 A;  3PBN A;  1XJ3 A;  2EXA A;  3FC7 A;  2ZL1 B;  4Y0O A;  2E8I A;  3PR6 A;  4WZ5 C;  2XLN A;  1EWZ A;  4M3K A;  4HOI A;  1V9Y A;  1SKO B;  4DDY A;  4A5R A;  3CIT A;  1G28 A;  5FAQ A;  4WMC D;  4GZB A;  5CGW A;  4Q8I A;  3ZDJ A;  3ZFZ A;  4PM5 A;  5EVI B;  2NUT C;  5HL1 A;  4BBU A;  3OLO A;  1TVF A;  1E25 A;  5D3O A;  3HJI A;  3HLE A;  2EWW A;  1JTD A;  2J9P A;  2J3W A;  2BAS A;  1JTG A;  2W3H A;  3A3D A;  3MS6 A;  2EWV A;  3UE3 A;  5HZH A;  2A2L A;  5DKK A;  4FSF A;  4GHI B;  3PBQ A;  2RCX A;  4HES A;  4S2J A;  3K3C A;  5HW3 A;  1YLJ A;  3LO7 A;  3P01 A;  4BL3 A;  3W2Z A;  4DE0 A;  2CMN A;  4OPR A;  3GDI A;  1ACF A;  4MN7 A;  5DKL A;  4LV2 A;  1P9R A;  5FA7 A;  4OP8 A;  3LI8 A;  1QMF A;  2PU2 A;  3E4O A;  3UB7 A;  1S66 L;  2K7S A;  1XXM A;  4HH3 A;  3ZCZ A;  1STZ A;  5CX7 A;  4JGP A;  1JVJ A;  3EWK A;  5TR7 A;  4BJP A;  1DJC A;  1IYQ A;  5HPF A;  4DE2 A;  2I72 A;  3UMD A;  3ISG A;  4BD1 A;  1SKF A;  5CXW A;  3PBO A;  2ZC4 B;  4YFM A;  2O9C A;  1NLY A;  5HX9 A;  4DXC A;  3T4O A;  5AQ7 A;  2EX9 A;  4X55 A;  5DF7 A;  2EX8 A;  4XUZ A;  5G18 A;  3G4P A;  3C7U A;  3C30 A;  5GLB A;  2XA7 S;  4JXS A;  5M1A A;  1XJ2 A;  4LFU A;  3HL9 A;  1Y4O A;  4RQ9 A;  4R1G A;  5HAQ A;  3NCK A;  2BG1 A;  4UA9 A;  2HZ5 A;  1Z6F A;  2L4R A;  1H8Y A;  2EA9 A;  2V1B A;  4N1H A;  2PRF A;  5HPI A;  3LI9 A;  2WGV A;  1A0K A;  2ZM0 A;  5IHV A;  4Y2F A;  5DTT A;  2UV0 E;  1ALQ A;  2A24 A;  4R4R A;  2MJ6 A;  4MMN A;  4EBN A;  3NEC A;  3G6O A;  2OV5 A;  3BY8 A;  2ZMF A;  3ZG9 B;  2X01 A;  1W79 A;  3DWK A;  5KMW A;  4IVI A;  5F83 A;  1BSG A;  2UWX A;  4NXE A;  2ZJ9 A;  2PBD P;  3IX4 A;  1MWT A;  3NUL A;  2B95 A;  3G30 A;  1YSP A;  1YLT A;  3Q7Z A;  3C4P A;  3TRC A;  3IS2 A;  2EFX A;  1KOU A;  2ZC5 B;  3IT9 A;  3MXS A;  4B9O A;  3LR3 A;  2W27 A;  3W4P A;  5A93 A;  3JVV A;  2OOL A;  3P7N A;  2Y8H A;  2INW A;  5FQI A;  4KZA A;  1L3L A;  5HDS A;  4U3T A;  1XGI A;  4KZ6 A;  1VEU B;  4E3I A;  3Q7V A;  3L7H A;  2QKP A;  4U0T A;  4QB8 A;  3RTY A;  2NUP C;  4LV0 A;  3SOI A;  3ZVW A;  4HNB A;  1ES4 A;  2EXB A;  2QMI A;  3HLD A;  3Q81 A;  4LV1 A;  3KYQ A;  1UWP X;  3V3R A;  4II7 A;  3TJZ C;  1LSV A;  5FAP A;  2Y2H A;  1XX2 A;  1L0E A;  4K08 A;  1VET B;  2JE5 A;  4FH4 A;  1KVM A;  1YAX A;  3V5M A;  4GB7 A;  3C4O A;  3ZNT A;  3PAG A;  2X71 A;  5F5Y A;  3SS3 A;  3ZYT A;  4GS9 A;  2JKT M;  5HSQ A;  4ZJ1 A;  3WS5 A;  4G3K A;  4Y13 A;  1L0F A;  1PI4 A;  5FQJ A;  1WYC A;  1HLU P;  1IOU A;  3WS2 A;  5AJG A;  3O86 A;  1JWV A;  3MFD A;  2GNX A;  3IQA A;  2ZC7 A;  4ME4 A;  1NXY A;  3BJN A;  5G4Z A;  1ESU A;  3W4O A;  4P6Z M;  1BLP A;  2PR5 A;  3MKE A;  3C8C A;  2ZC3 B;  2HDR A;  3S7P A;  2Y55 A;  5E2H A;  5K5B A;  1ESI A;  4ARZ B;  1HD8 A;  1OJG A;  5CHJ A;  2Y2L A;  5EOE A;  3UDI A;  2JC7 A;  5FQ9 A;  4H6J A;  4HBT A;  2Y2G A;  1XGJ A;  2XH9 A;  3LR0 A;  3IWI A;  4OH0 A;  3T4S A;  5F68 A;  1Q2P A;  3IX8 A;  4N9L A;  1LL9 A;  1VB6 A;  1BTL A;  3UDX A;  3LY4 A;  1I2S A;  1L0D A;  3CWF A;  5FSR A;  1K56 A;  3EOI A;  2QYB A;  3NHQ A;  3LIE A;  2WGW A;  5E2G A;  1GSX A;  4UAA A;  4DXB A;  1DP6 A;  1E3U D;  3K2N A;  2Z6D A;  2VX8 A;  5HAR A;  2LB5 A;  3N6I A;  3PTE A;  1IKI A;  3ZQ5 A;  4KQO A;  2W1R A;  2ZBB A;  4EES A;  2VJW A;  3FYZ A;  1KDS A;  4UHU A;  1BUE A;  3T4K A;  4BBT A;  3KO6 A;  4R3J A;  2CC1 A;  4QHC A;  1NYM A;  2VKS A;  1C3B A;  2XF3 A;  3IF5 A;  5EEC A;  3KSH A;  2VEA A;  1P97 A;  1FIL A;  1F9I A;  2WKE A;  1P0Z A;  2ZMV A;  3E0Y A;  1ERQ A;  2J3T C;  1CQA A;  4O01 A;  4JBF A;  3PHY A;  3Q82 A;  1OPX A;  1Q2Q A;  4NXB A;  3F1O A;  4FOF A;  4QJG A;  3UB8 A;  5A90 A;  1IYO A;  3R7W B;  3V50 A;  5GL9 A;  4OLG A;  5FQQ A;  2W1T A;  2L1M A;  2JHE A;  2HDU A;  3HCY A;  5FAS A;  3BRM A;  2ZM8 A;  3NY4 A;  1NRJ A;  3NOT C;  2J80 A;  4JXG A;  4YNR A;  2Y2I A;  2P04 A;  1K0K A;  3CMZ A;  2ZQC A;  4D60 A;  3K3D A;  2XR0 A;  4KZ3 A;  1BLH A;  3C2W A;  4EQI A;  4KG5 A;  3O5Y A;  4JXW A;  4RVA A;  4Y7P A;  4IBR A;  5HAI A;  4GN2 A;  3T50 A;  5E2F A;  1FIK A;  3IHA A;  1K57 A;  1YMS A;  3WS1 A;  3EQV A;  4N92 A;  1H8M A;  3ZG8 B;  5CTM A;  3TE8 A;  1D06 A;  5HFO A;  4HHD A;  1GHM A;  4GNU A;  3EGD C;  4R0Q A;  4WF0 A;  3GR2 A;  4BWI A;  1KDW A;  4B88 A;  4LCM A;  5L07 A;  4DE1 A;  3A0S A;  4S2M A;  4EU0 A;  4EWF A; 
#chains in the Genus database with same CATH homology
 4OLD A;  1ES3 A;  5EVI B;  4BL2 A;  4KZ9 A;  5HL1 A;  2DNS A;  2H0T A;  5KZH A;  1LI9 A;  4KEN B;  1K57 C;  2Y2P A;  3FKW A;  5GHY A;  2J8Y A;  4OQ0 A;  4DDS A;  2XFT A;  4WYY A;  1TVF A;  1E25 A;  5D3O A;  3HLE A;  5DTK A;  1MY8 A;  3P09 A;  4Y0U A;  3IF6 A;  1HTZ A;  1JTD A;  2J9P A;  4C6Y A;  4HBU A;  1GA0 A;  4GDN A;  1JTG A;  3MZF A;  3A3D A;  3ITB A;  4E6X A;  1IEL A;  2WAF A;  3UE3 A;  3P98 A;  1FR6 A;  5M18 A;  2ZQD A;  4FSF A;  3S1Y A;  3PBQ A;  2RCX A;  3QHY A;  4KZB A;  1KGG A;  4HES A;  1KGE A;  4S2J A;  5HW3 A;  1LI0 A;  3G34 A;  5EVI C;  3ZG0 A;  1YLJ A;  3LO7 A;  4BL3 A;  4KZ5 A;  4DE0 A;  3OPL A;  5FDH A;  4EBP A;  3FV7 A;  3Q07 A;  4OPR A;  5CTN A;  1CK3 A;  3UY6 A;  3W8K A;  1NZO A;  2OLV A;  4FD8 A;  4E3K A;  4LV2 A;  3NIA A;  5FA7 A;  1FR1 A;  1SDE A;  4YIN A;  3S22 A;  4OP8 A;  4OQI A;  4QU3 A;  3QNC A;  2ZQ7 A;  2XFS A;  3N8L A;  3IF6 C;  1QMF A;  1K54 A;  2PU2 A;  1N9B A;  1XKZ A;  4ZJ3 A;  4X53 A;  1S6R A;  2WZX A;  3LEZ A;  4DRT A;  1XXM A;  1VQQ A;  1IEM A;  3ZCZ A;  1OME A;  1ERO A;  3A3I A;  4WEL A;  5CGX A;  1NRF A;  1H8Z A;  2Q9M A;  3Q1F A;  1K25 A;  5KSH A;  1PIO A;  1JVJ A;  5TR7 A;  4BJP A;  1DJC A;  3BFC A;  1IYQ A;  4DE2 A;  2I72 A;  4E6W A;  2FFY A;  1MWU A;  3BFD A;  3BLM A;  3D4F A;  3ISG A;  1W7F A;  4BD1 A;  1SKF A;  3M6H A;  5CXW A;  3G31 A;  2PBY A;  1YLY A;  4MBH A;  4E3N A;  3PBO A;  2HP9 A;  2ZC4 B;  4YFM A;  2QZ6 A;  4DXC A;  1ZC2 A;  5HX9 A;  2ZQ9 A;  2JCH A;  3BFF A;  5AQ7 A;  2EX9 A;  1G68 A;  5AQA A;  3OZH A;  4X55 A;  1GA9 A;  5DF7 A;  3MKF A;  2EX8 A;  3BEB A;  3PAE A;  4XUZ A;  1L0G A;  2Y2J A;  5G18 A;  3C5A A;  3G4P A;  1KE0 A;  4ZDX A;  3C7U A;  5GLB A;  3RJU A;  1K54 C;  3E2K A;  3HLF A;  3GTC A;  4JXS A;  5M1A A;  4Z9Q A;  3SH9 A;  3GRJ A;  3HL9 A;  4WMC A;  1GCE A;  4R1G A;  2OLU A;  4FCF A;  5HAQ A;  3NCK A;  2BG1 A;  2A49 A;  4UA9 A;  4OOM A;  3EQU A;  1Z6F A;  3N7W A;  4PM6 A;  3VFH A;  3I7J A;  1H8Y A;  2EX2 A;  3CJM A;  4N1H A;  1NY0 A;  4ZBE A;  2P9V B;  1MWS A;  2XK1 A;  3N8S A;  2P74 A;  3VMA A;  1W5D A;  2HP5 A;  2WGV A;  2J9O A;  4OVD A;  5A92 A;  2ZM0 A;  5IHV A;  5CED A;  5DTT A;  5EOO A;  3VFF A;  1ALQ A;  4K0X A;  4B4Z A;  4R4R A;  3VP2 A;  4PMA A;  1PWG A;  3MZE A;  1VM1 A;  2WKI A;  5DF9 A;  4EBN A;  2X02 A;  1M40 A;  1PI5 A;  2OV5 A;  4BD0 A;  3ZG9 B;  1RGZ A;  4IBX A;  1WE4 A;  2X01 A;  5CGS A;  2WAE A;  1W79 A;  3DWK A;  3FWL A;  5KMW A;  4EUZ A;  3HUM A;  4KQR A;  3BLS A;  3SS5 A;  4IVI A;  1FQG A;  2WYX A;  1IKG A;  3IWQ A;  4KQQ A;  5F83 A;  4GOG A;  3DTM A;  4S2L A;  1O7E A;  1ONG A;  1NYY A;  4OON A;  3N8R A;  5CRF A;  5FQM A;  1BSG A;  3SS4 A;  1SHV A;  1S0W A;  2UWX A;  3NDE A;  2ZD8 A;  4KG6 A;  1NZU A;  2QPN A;  3G32 A;  4IED A;  5AQ9 A;  1L2S A;  2ZM2 A;  2WK0 A;  2ZJ9 A;  3IXH A;  4NK3 A;  4B4X A;  3WRZ A;  1K55 A;  1M6K A;  1MWT A;  4O7D A;  3G30 A;  3IF6 B;  4N1X A;  3UE0 A;  4F94 A;  3MXR A;  2Y2O A;  2Z2L B;  1K4E A;  4QY6 A;  1YLT A;  3Q7Z A;  1CI9 A;  3C4P A;  3G2Y A;  4RYE A;  2EFX A;  2G2U A;  4GKU A;  2ZC5 B;  3IT9 A;  1MXO A;  1DJB A;  3MXS A;  5GLD A;  3W4P A;  2VGJ A;  3A3F A;  1JWP A;  3VP3 A;  3CZD A;  3HLB A;  5A93 A;  3PBT A;  2DCF A;  2EX6 A;  4DE3 A;  3M2K A;  5BOH A;  4JLF A;  5FQI A;  3LCE A;  4KZA A;  1FOF A;  4U3T A;  1XGI A;  1DJA A;  4KZ6 A;  3O88 A;  3DWZ A;  4E3I A;  2ZLY A;  3Q7V A;  1FCM A;  4WM9 A;  3QNB A;  4Y0T A;  4RX3 A;  4U0T A;  4OKP A;  5TGF A;  5FAO A;  4QB8 A;  3JYI A;  3UN7 A;  1ES2 A;  2IWC A;  3HUN A;  2HPB A;  4LV0 A;  3SOI A;  4C75 A;  1K55 C;  3ZVW A;  1AXB A;  5E43 A;  1ES4 A;  2EXB A;  2QMI A;  4P0M A;  4S2O A;  3RXW A;  4ZJ2 A;  2VGK A;  4XUX A;  2OSU A;  3HLD A;  4X69 A;  4S2P A;  1ZKJ A;  2G2W A;  3Q81 A;  4UA6 A;  4PPR A;  3VSL A;  4PM8 A;  1XP4 A;  1QME A;  4LV1 A;  4D2O A;  1BT5 A;  5DVA A;  1PW1 A;  3AGF A;  4QY5 A;  3TSG A;  3V3R A;  1LLB A;  1PYY A;  3BEC A;  3WS0 A;  3BFE A;  3WWX A;  4R23 A;  1K56 D;  5FAP A;  2H5S A;  1RP5 A;  4MNR A;  1EI5 A;  3VOY A;  2Y2H A;  4P85 A;  3ZHH A;  1XX2 A;  1L0E A;  1HZO A;  2WKH A;  2JE5 A;  4FH4 A;  1KVM A;  1KE3 A;  4X56 A;  4JF5 A;  5TFQ A;  1LHY A;  3V5M A;  1FCN A;  3LY3 A;  1XPB A;  4NET A;  4GB7 A;  3VOZ A;  3C4O A;  5GHZ A;  3ZNT A;  3OC2 A;  3PAG A;  4OP5 A;  2X71 A;  3SS3 A;  3NBL A;  4RX2 A;  3AGE A;  3FZC A;  5GLA A;  4ZTK A;  5FI6 A;  2Y4A A;  2Y2K A;  1K38 A;  4X68 A;  4ZJ1 A;  3WS5 A;  5HAP A;  1L0F A;  1PI4 A;  5FQJ A;  1PW8 A;  4OPY A;  1DY6 A;  1NJ4 A;  5I94 A;  3UDF A;  1WYC A;  4WBG A;  1RCJ A;  3VP4 A;  3WS2 A;  2BLS A;  2XD1 A;  3ZNY A;  1H5X A;  3OCN A;  1J9M A;  3O86 A;  1JWV A;  3MFD A;  3IQA A;  2ZC7 A;  3M2J A;  1BUL A;  3MZD A;  1YLW A;  3B3X A;  3N4I A;  5GHX A;  1XA7 A;  4MBF A;  4CPK A;  1NXY A;  4KZ7 A;  1JWZ A;  5CEB A;  4DKI A;  1ESU A;  1U60 A;  3HLG A;  3W4O A;  3W4Q A;  1ZG4 A;  1ZG6 A;  1MPL A;  4JF4 A;  1BLP A;  4JXV A;  4PM9 A;  3MKE A;  3UO9 A;  3V39 A;  5DF8 A;  3HUO A;  2PU4 A;  5FI7 A;  2ZC3 B;  1FSY A;  4BLM A;  3ITA A;  2HDR A;  4FH2 A;  4P87 A;  2Y55 A;  1PZP A;  1TEM A;  1SCW A;  4E3M A;  5E2H A;  4WEJ A;  4OQG A;  1ESI A;  1BLS A;  3HBR A;  5J8X A;  2Y2Q A;  4JF6 A;  4PM7 A;  1HD8 A;  3IH8 A;  3NDG A;  1K6S A;  4HEF A;  1XA1 A;  1G6A A;  4XXR A;  5CHJ A;  3UPN A;  1IYP A;  3TOI A;  2Q9N A;  1RGY A;  2Y2L A;  5EOE A;  3UDI A;  2JC7 A;  5FQ9 A;  2RL3 A;  4OPQ A;  2C5W B;  4HBT A;  4ID4 A;  3S4X A;  2Y2G A;  1CEF A;  1XGJ A;  3GV9 A;  1BZA A;  2XH9 A;  1YQS A;  3G2Z A;  1E3U A;  2ZMA A;  3IWI A;  5CEC A;  2Y2M A;  3DW0 A;  4LV3 A;  4QD4 A;  2Y2N A;  4P6B A;  3SH7 A;  4OH0 A;  4LEN A;  1SDN A;  1Q2P A;  5EUA A;  5EPH A;  3CG5 A;  3IXG A;  3ZGA B;  2IWB A;  2V20 A;  4N9L A;  3O87 A;  1LL9 A;  1BTL A;  2R9W A;  3UDX A;  3IXB A;  3LY4 A;  4JKT A;  5EE8 A;  3NC8 A;  1I2S A;  1GHI A;  2WAD A;  3GSG A;  1L0D A;  4KG2 A;  3ZG7 B;  2EFU A;  4S2I A;  5FSR A;  4K91 A;  1K56 A;  2WUQ A;  4R4S A;  3OPP A;  3Q7V B;  1ES5 A;  5E2E A;  2WGW A;  2WGW B;  3E2L A;  5E2G A;  1K4F A;  4UAA A;  4E3L A;  2B5R A;  3O3V A;  5A91 A;  5DTS A;  4X6T A;  4DXB A;  1E3U D;  1O07 A;  1FCO A;  3TG9 A;  5EVI D;  5HAR A;  3N6I A;  1N4O A;  1IKI A;  3PTE A;  4U0X A;  4KQO A;  4CJN A;  3OCL A;  3IH9 A;  5F1F A;  1MKI A;  4WZ4 A;  3UPO A;  4OQH A;  3VSK A;  3FYZ A;  1KDS A;  4UHU A;  1BUE A;  4S2K A;  5AQB A;  3A3J A;  1YLZ A;  4R3J A;  2CC1 A;  4QHC A;  1NYM A;  3RXX A;  1C3B A;  3HRE A;  1LL5 A;  4IVK A;  2XF3 A;  4E3O A;  4GDB A;  4S2N A;  3IF5 A;  5FAT A;  5EEC A;  3AGD A;  4MBK A;  1TDL A;  3WRT A;  2XQZ A;  4GD6 A;  1YT4 A;  3UNW A;  3OPH A;  2WKE A;  2A3U A;  1ERQ A;  3BM6 A;  1W8Y A;  4DF6 A;  2DRW A;  4WEK A;  2XD5 A;  2WGI A;  4C3Q A;  3GMW A;  1BLC A;  1K6R A;  4JBF A;  4LCL A;  3Q82 A;  2HDS A;  1Q2Q A;  3VP1 A;  1E4D A;  1YM1 A;  3HLC A;  5CHM A;  5FQK A;  4QJG A;  4OOL A;  1KGF A;  1IYS A;  5A90 A;  3V3S A;  1IYO A;  3A3E A;  4E3J A;  5F1G A;  4EBL A;  3V50 A;  5GL9 A;  4OLG A;  5FQQ A;  2H0Y A;  4ZAM A;  1FSW A;  3C7V A;  5L2F A;  5M19 A;  4OPZ A;  5JYO A;  2ZQ8 A;  2HDU A;  5FAS A;  3BYD A;  3BFG A;  3M6B A;  1WYB A;  2V1Z A;  2Y91 A;  3NI9 A;  4WZ5 A;  3BRM A;  5EVL A;  4KZ4 A;  4OOY A;  4MEZ A;  4JPM A;  4S2N C;  4UA7 A;  2J7V A;  4GD8 A;  1Y54 A;  2ZM8 A;  2XEP A;  3NY4 A;  1CEG A;  3IWO A;  3MBZ A;  5CER A;  2H10 A;  4JXG A;  5GLC A;  1I2W A;  4R3B A;  5KSC A;  2Y2I A;  3PBS A;  4N9K A;  3CMZ A;  2ZQC A;  3UPP A;  1YMX A;  2XR0 A;  4KZ3 A;  4RA7 A;  1BLH A;  1MBL A;  2WZZ A;  3IHB A;  4KG5 A;  4BQM A;  1YLP A;  3HLW A;  4JXW A;  4EQI A;  4RVA A;  4Y7P A;  1KE4 A;  3UE1 A;  2R9X A;  4IBR A;  2HDQ A;  5HAI A;  3OPR A;  4GN2 A;  3IXD A;  1ERM A;  1MWR A;  5E2F A;  4EV4 A;  2IWD A;  3ZG5 A;  3IHA A;  1K57 A;  1YMS A;  4MLL A;  1KVL A;  1I5Q A;  1PWD A;  3G35 A;  5U47 A;  3PBN A;  2FFF B;  1PWC A;  3HVF A;  2Z2M B;  2GDN A;  2P9V A;  2V2F F;  2EXA A;  5FI2 A;  3SH8 A;  3VP0 A;  1CI8 A;  3EQV A;  3GQZ A;  3WS1 A;  4N92 A;  4Y0O A;  3ZG8 B;  2E8I A;  4WZ5 C;  4L0L A;  5CTM A;  4KZ8 A;  2XLN A;  3FKV A;  2XDM A;  1PZO A;  5HFO A;  1EWZ A;  2JBF A;  2HP6 A;  5CHU A;  1GHM A;  3PBR A;  4M3K A;  2ZC6 B;  1TDG A;  1ONH A;  4A5R A;  4GNU A;  4DDY A;  2Y59 A;  4K0W A;  2ZQA A;  4R0Q A;  5FAQ A;  5F82 A;  3GR2 A;  4H8R A;  1KDW A;  4GZB A;  4WMC D;  5CGW A;  4LCM A;  4B88 A;  3GVB A;  4DE1 A;  4BEN A;  4Q8I A;  1HVB A;  1GHP A;  2XGN A;  3ZDJ A;  3ZVT A;  4S2M A;  4EWF A;  3ZFZ A;  3WS4 A;  4PM5 A;  5JYP A;  2C6W B;  1W8Q A;  5EVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...