3Q7ZA

Cbap-acylated blar1 sensor domain from staphylococcus aureus
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
252
structure length
252
Chain Sequence
b'QSITDYNYKKPLHNDYQILDKSKIFGSNSGSFVMYSMAADAYYIYNEKESRKRYSPNSTYKIYLAMFGLDRHIINDENSRMSWNHKHYPFDAWNKEQDLNTAMQNSVNWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWMEDSLKISNLEQVIVFKNMMEQNNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIVNGKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGVLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-lactamase regulatory protein BlaR1
publication title Lysine Nzeta-decarboxylation switch and activation of the beta-lactam sensor domain of BlaR1 protein of methicillin-resistant Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase regulator/antibiotic
total genus 85
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3q7zA00
1LI0A 3ZG8B 2WGWA 3N8RA 1YM1A 2Y2NA 3NDGA 5EPHA 1I5QA 1N4OA 4OLDA 5CERA 3AGEA 3V3SA 3UPNA 2UWXA 4GB7A 4KQRA 5DTSA 2Y59A 5FAOA 2Z2LB 2X71A 3ISGA 3VFFA 3P09A 1Y54A 5E2GA 1ESUA 3NC8A 5FATA 4WZ4A 2WADA 5EVIC 2Y2IA 5EOEA 3RXXA 5CTNA 3W8KA 3AGDA 2P9VA 4CJNA 2FFYA 3ZGAB 1IKGA 2ZQCA 3N8LA 4ID4A 2WZXA 3IF6B 2XDMA 1SDNA 3O3VA 1YMSA 4KZ8A 4QY5A 1YLYA 1ESIA 3C4PA 4PM5A 3IWOA 1GCEA 4X53A 3WS5A 4GOGA 5GLAA 4KZAA 5E2FA 5EE8A 1VQQA 1K57A 1LL5A 4KZ5A 3FYZA 4LV3A 1ZKJA 1TDLA 2XH9A 3GV9A 3MXRA 3HLDA 3IXHA 2XR0A 3IWIA 1PWGA 4JLFA 4R3JA 5TR7A 1E3UA 4OQ0A 5DTKA 2A3UA 3UPPA 4JPMA 3GMWA 3LCEA 4PM6A 4DE0A 1RGYA 1KGEA 2HP9A 4E3NA 2H0YA 5FASA 1SHVA 1MXOA 3IH9A 3DW0A 5CXWA 3FV7A 1L0EA 4EBLA 5AQ9A 3VOZA 5GLBA 2XF3A 1KVMA 5FQQA 1AXBA 2PU2A 4P87A 1PI4A 4N92A 2Y55A 1ES2A 1IYQA 2Y2OA 1CI9A 3CZDA 4GKUA 4BJPA 4C75A 5HW3A 1K57C 4WBGA 3ZCZA 4QJGA 3TOIA 4S2NC 1DJBA 2WGVA 3HLGA 4X6TA 5HL1A 2JC7A 3WS1A 5CECA 2EX6A 4B88A 3VSKA 1CK3A 1CI8A 1YQSA 4JF5A 4DDSA 4KZ3A 3UE0A 3BLSA 5M18A 1KE0A 1N9BA 5FQJA 1JWZA 3IHAA 2CC1A 2WAFA 2V2FF 3ZHHA 3MZFA 3IF6A 5EECA 5EVID 3BRMA 4LENA 4WMCA 4E3MA 4N1HA 3BEBA 5CEBA 3VP1A 1MY8A 1NRFA 3ITBA 4NK3A 5GL9A 2EXBA 4GNUA 3RJUA 1HZOA 3HL9A 2C5WB 1PWCA 2ZQAA 2XD1A 5DTTA 5FI6A 2X02A 3M2KA 4HESA 4BENA 3SH8A 3V39A 3NIAA 1ES3A 4HBUA 1ZC2A 4E3LA 3BECA 1LL9A 3MKFA 3Q7ZA 2J8YA 4S2OA 1BULA 2R9XA 4R23A 4UA6A 3MZDA 1FR1A 2Y2PA 4K0WA 2XFTA 4R3BA 1BLHA 4PM7A 4O7DA 1HTZA 1PWDA 4ZAMA 1GA9A 2QPNA 2G2WA 4S2MA 1KGGA 3BFFA 4X55A 1MWSA 1K55C 4PM8A 4S2IA 4FSFA 5AQ7A 3IF6C 3BFCA 2DCFA 4GN2A 3M6BA 1GHIA 4DKIA 4YFMA 5M19A 3HUNA 1H5XA 4M3KA 3IWQA 1NYYA 3NY4A 4MNRA 3E2KA 4BQMA 1JWVA 1YT4A 1K56A 3BYDA 2HP6A 3SS5A 4C6YA 2XEPA 1ERQA 2OSUA 3RXWA 4E6WA 4CPKA 3UE3A 4X69A 2J9PA 3FWLA 4QU3A 3TSGA 3C4OA 1KE3A 3HBRA 4X68A 1L0FA 1S6RA 3UY6A 1SKFA 4JXVA 3ZFZA 1VM1A 1BUEA 3HLBA 3VP4A 2B5RA 5TFQA 4BD1A 4EUZA 3EQVA 1IYPA 4KENB 2X01A 3S1YA 5CHMA 4IEDA 1BTLA 4UHUA 2QMIA 2Y4AA 4KQOA 4OQIA 5DF9A 4ZJ1A 3IH8A 1K6RA 2IWBA 3PBTA 5FI7A 4BLMA 4EV4A 1NY0A 3IXGA 2ZC7A 1MWUA 1NJ4A 1GHPA 3QNCA 4JXGA 3OPPA 2Q9MA 2ZM0A 3HLWA 4XUXA 2OLUA 2WKEA 2Y2JA 2XK1A 1GHMA 3Q7VB 1CEFA 3LY4A 3MZEA 3GTCA 2HDUA 3GQZA 2H0TA 2HP5A 1S0WA 3BFEA 5FQKA 3V50A 3SH7A 2Y2LA 2JE5A 2ZC6B 1KDSA 4WM9A 4R0QA 2XD5A 4JXSA 4OLGA 4OOLA 3QNBA 3W4PA 4WYYA 1RCJA 1M40A 3G34A 4LCLA 1L0DA 3DTMA 2ZM2A 3ITAA 4IBXA 3VFHA 2C6WB 4OQGA 4XUZA 3VMAA 4KZ7A 5HFOA 2Z2MB 3S4XA 1JWPA 4XXRA 5FI2A 4DDYA 4DXCA 2HDRA 3M6HA 5G18A 5JYOA 1U60A 3W4OA 4N9KA 5DF7A 2A49A 3DWKA 4EBNA 1G6AA 3FKVA 4FCFA 1Z6FA 2Q9NA 3BM6A 1IKIA 4JBFA 3ZVTA 5D3OA 2WZZA 5FA7A 1NZUA 1ZG4A 2ZLYA 3UO9A 4OOMA 1K38A 4BL3A 4E3IA 1Q2PA 2ZQ7A 4KZ6A 3NCKA 5FQ9A 5A91A 3UNWA 1FQGA 2ZM8A 3OPLA 4GDNA 3GR2A 5CHUA 4H8RA 2H10A 1JTDA 4RX2A 5A90A 1EI5A 2ZMAA 3A3JA 4LCMA 1EWZA 3Q7VA 1H8YA 1PZPA 3LY3A 2HDQA 2EX9A 2Y2QA 5CGSA 5FDHA 2WGIA 4QD4A 3UPOA 1MWTA 4UA9A 5EVIB 5JYPA 4ZBEA 3A3FA 2PU4A 1KDWA 4DRTA 5A92A 3WWXA 1PI5A 4PMAA 1JTGA 4EWFA 4DF6A 2J7VA 5KMWA 3GSGA 4MBFA 3WS2A 3WRTA 1MWRA 1I2WA 1IYOA 2WUQA 4S2PA 4NETA 4MEZA 1YLJA 2VGJA 2FFFB 5GHYA 5L2FA 1FSWA 4S2JA 1BSGA 1BT5A 4IVKA 3SS3A 3VP2A 1XPBA 3HREA 4KZ4A 4C3QA 4OP5A 4R1GA 1L0GA 3FKWA 3I7JA 2ZQ9A 1O07A 1K6SA 3OZHA 4FH2A 3MFDA 4MBKA 3G31A 1HVBA 2IWCA 2WAEA 2J9OA 4Y0UA 5FSRA 3NBLA 1KE4A 5DF8A 2H5SA 3JYIA 4MLLA 1HD8A 4EQIA 4OOYA 2RL3A 3PBSA 5E2EA 3ZNTA 1IEMA 1XA7A 3HLEA 4IBRA 1JVJA 3SOIA 4R4RA 2ZC4B 3Q1FA 5EVLA 2JBFA 2IWDA 1SDEA 1W7FA 4OPZA 4RYEA 4WZ5A 3MXSA 4KG2A 1E25A 2GDNA 3WRZA 2ZJ9A 1IYSA 1NXYA 3Q81A 1QMFA 3PBRA 4Y0OA 3TG9A 3V5MA 1BLSA 1ONGA 1PYYA 2EX8A 1YLPA 5J8XA 1WYCA 3OCNA 4OONA 4P85A 3WS0A 4P6BA 4OKPA 5KZHA 1XGIA 1CEGA 5F1GA 3IQAA 3M2JA 1FCNA 4JKTA 1LLBA 1E3UD 3WS4A 1GA0A 4X56A 1ES5A 3N7WA 1ONHA 3G30A 4DXBA 4KG6A 5F1FA 1MBLA 1NYMA 5EOOA 5EVIA 2EXAA 3OPHA 5CRFA 4LV0A 3CMZA 4QY6A 5FQMA 4Q8IA 4FD8A 4PM9A 3S22A 1YLWA 2XLNA 4PPRA 4OPYA 3Q82A 5HAIA 3A3DA 3A3IA 1SCWA 1WYBA 5CTMA 4WZ5C 1XGJA 2Y2MA 3UDIA 1KGFA 1PIOA 4WELA 1K4FA 3PBOA 3B3XA 1Q2QA 3G2ZA 2Y2KA 1E4DA 4ZTKA 4U0TA 2G2UA 2OLVA 2P74A 4QHCA 1XXMA 3MBZA 4GD6A 3IT9A 1PW1A 3O86A 1XA1A 1YLZA 2BLSA 4P0MA 3IXDA 5E43A 5E2HA 5KSCA 4EBPA 3IF5A 3CG5A 3O87A 1MKIA 4WMCD 3EQUA 4KZ9A 3VP3A 1BLPA 1W8YA 3ZG9B 4E6XA 4YINA 4FH4A 5HAQA 3O88A 1ALQA 3V3RA 5AQAA 3ZNYA 1BLCA 4OP8A 5AQBA 1W5DA 2ZQDA 3C5AA 4RA7A 1FR6A 3IHBA 1ERMA 4ZJ2A 5DVAA 1G68A 1C3BA 1EROA 1FCMA 2Y2GA 4A5RA 2XFSA 4S2NA 4OH0A 1YMXA 4E3KA 4F94A 1I2SA 1RP5A 4LV2A 5GHXA 4K0XA 2V1ZA 3IXBA 2Y2HA 3MKEA 3PAEA 5IHVA 3DWZA 1NZOA 4KQQA 5GLDA 4JF6A 3UE1A 3Q07A 1PW8A 4KZBA 4N1XA 3ZVWA 2DNSA 1WE4A 1ZG6A 4E3OA 4WEKA 4BL2A 3G32A 1H8ZA 4HEFA 5HAPA 4ZDXA 3E2LA 3NI9A 3ZG7B 1J9MA 2WKHA 2ZC5B 4OQHA 4RVAA 5BOHA 2EFXA 2XGNA 4WEJA 2ZQ8A 5M1AA 1M6KA 2V20A 5GHZA 1K25A 2WKIA 2ZC3B 3PBQA 1TVFA 1K56D 5EUAA 1FCOA 2VGKA 1LHYA 3QHYA 5KSHA 4U3TA 3VP0A 3HLCA 1LI9A 3UN7A 3NDEA 3C7VA 5F82A 3GRJA 4OPRA 1YLTA 2Y91A 5F83A 3HUMA 4L0LA 1FOFA 4D2OA 4S2LA 3N8SA 3OPRA 3PTEA 4U0XA 2I72A 2XQZA 3G4PA 4OPQA 1K55A 2QZ6A 5CEDA 3W4QA 4JF4A 1OMEA 4JXWA 5CHJA 2WGWB 1K54A 2EX2A 3UDXA 4GZBA 4B4XA 3FZCA 3HLFA 3OC2A 5FAPA 3D4FA 5CGWA 5TGFA 2OV5A 4KG5A 4QB8A 3VSLA 3BLMA 2HDSA 1DJCA 2R9WA 3BFGA 1MPLA 3A3EA 1TEMA 1K4EA 1DY6A 5FAQA 2HPBA 1ES4A 2E8IA 3BFDA 4N9LA 4K91A 2JCHA 1RGZA 2RCXA 2P9VB 4RX3A 3CJMA 4LV1A 1QMEA 3UDFA 4Y7PA 2WK0A 4DE3A 4UA7A 1KVLA 3N4IA 3N6IA 4Z9QA 3ZG0A 4R4SA 3AGFA 4S2KA 5HX9A 4GDBA 5HARA 3SS4A 1L2SA 4GD8A 4MBHA 3OCLA 4DE2A 1XKZA 4HBTA 4BD0A 1BZAA 4DE1A 1FSYA 5U47A 2PBYA 1W8QA 5FQIA 4E3JA 2BG1A 1K54C 3ZDJA 5A93A 4ZJ3A 5I94A 1O7EA 1DJAA 3LEZA 3G2YA 1PZOA 4OVDA 2ZD8A 5CGXA 5GLCA 3P98A 3VOYA 1TDGA 3HVFA 1XP4A 3HUOA 3C7UA 2DRWA 1W79A 4Y0TA 2EFUA 3LO7A 1IELA 1XX2A 3GVBA 3PAGA 3G35A 4IVIA 4B4ZA 3SH9A 3ZG5A 4UAAA 3PBNA 2WYXA
chains in the Genus database with same CATH superfamily
5F68A 3ZG8B 1YM1A 3PXPA 1GSXA 4GB7A 5DTSA 1SZVA 2JKGA 1Y54A 4R6LA 5FATA 4BWIA 3S7NA 2P08A 5HD3A 2ZL1A 2Y2IA 2J3TD 2W3DA 1IKGA 2ZQCA 3N8LA 3EEHA 1SDNA 1YSPA 1F9IA 4PM5A 5FL3A 3FYZA 1TDLA 4JGQA 3HLDA 1D7EA 3IWIA 1PWGA 5IU1A 4FTXA 1DP9A 4R3JA 5TR7A 1E3UA 4OQ0A 4MN6A 4JPMA 1L3LA 2FH5A 2XA7S 4E3NA 3DW0A 3FV7A 4EBLA 5FQQA 1PI4A 3DTKA 4C75A 3T4OA 3ZCZA 3K3DA 4QJGA 5HL1A 3TRCA 4ZRRA 3HLGA 1PNEA 2O9CA 4L9GA 4LGWA 4DDSA 3BLSA 1KE0A 5EV0A 2V2FF 1F5MA 5EECA 4E3MA 2O99A 3MMHA 3VP1A 5EM1A 1NRFA 3ITBA 4NK3A 5GL9A 4GNUA 1HZOA 5FI6A 1PWCA 2XD1A 3SH8A 1ZC2A 4E3LA 3BECA 5EM0A 2M7UA 3T4KA 2R9XA 3QP8A 4R3BA 1FR1A 3BY8A 1GA9A 2QPNA 2G2WA 1KGGA 4EEUA 1MWSA 4HJ4A 3IF6C 3NJAA 5M19A 3HUNA 4M3KA 2FZ0A 4MNRA 3E2KA 4BQMA 2HP6A 2XEPA 4ETXA 1ERQA 2QKPA 4E6WA 4CPKA 5HWWA 3UE3A 4X69A 2J9PA 1EW0A 3FWLA 1D1JA 4QU3A 4X68A 1H0MA 2VX8A 3VP4A 2B5RA 3EQVA 2X01A 3IX8A 4UHUA 1FILA 4ZJ1A 2INWA 3IH8A 2A24B 3EWKA 3TE8A 1T1AA 2ZC7A 3QNCA 3OPPA 4XUXA 2Y2JA 3F1NB 3GTCA 2HDUA 2H0TA 2XA7M 2PYRA 3NECA 5FQKA 4CQHA 3BJNA 2JE5A 2G7UA 3L9KA 4JXSA 4OLGA 1MKMA 4WYYA 3G34A 3MS6A 1L0DA 3ITAA 3T4TA 2C6WB 4OQGA 3EGXC 4KZ7A 1OTIA 3T1SA 3LIBA 3S4XA 1JWPA 4XXRA 3TJZC 4DDYA 2HDRA 1U60A 4EBNA 5J7EA 2QWSA 1G6AA 4FCFA 3ZVTA 3CWFA 3VE4A 5FA7A 4I39A 3KSGA 4E3IA 2ZQ7A 2A24A 5FQ9A 1FQGA 5HL6A 4P6ZM 3OPLA 5HPFA 1JTDA 2ZMAA 3F1NA 1EWZA 4Q0HA 1H8YA 3LI8A 2Y2QA 5CGSA 2WGIA 4QD4A 4HH2A 3WWXA 1OT6A 2J7VA 1I2WA 1IYOA 1Z09A 5FEGA 3EGDC 4LRZE 4S2JA 1BSGA 1BT5A 3SS3A 3VP2A 4C3QA 1VEUB 1JNUA 1K6SA 3MFDA 1KE4A 5DF8A 1HD8A 4EQIA 2VZWA 3OLOA 1XA7A 4IBRA 3U2AA 4MN7A 2ZC4B 5EVLA 1SDEA 4I38A 1G5UA 1E25A 1IYSA 1NXYA 3LR5A 3V5MA 3UB6A 3WS0A 4OKPA 3IQAA 4MMNA 4X56A 3N7WA 1ONHA 3G30A 1MBLA 1YAXA 2O9AA 3TW8A 4LV0A 4QY6A 4FD8A 3S22A 5HWTA 3ZQ5A 1KOUA 1W63M 2VEAA 1WYBA 5CTMA 4WZ5C 3BWLA 4ESPA 1WA9A 1PIOA 3B3XA 1Q2QA 1LSXA 1VEUA 2P04A 1E4DA 4U0TA 2P74A 4LRYC 4QHCA 2KOIA 1XXMA 1YLZA 4P0MA 5KSCA 1P0ZA 4EBPA 3MXQA 3CG5A 3NHQA 1BLPA 4E6XA 4HJ3A 3E4QA 1DP8A 5AQBA 1W5DA 4RA7A 5DVAA 4A5RA 3B47A 4HIAA 1YMXA 1TD5A 1RP5A 3IXBA 4O01A 4EQ1A 3C30A 4LRXC 4Y5FA 5IHVA 1P9RA 4EUVA 3DWZA 1NZOA 4KQQA 3K3CA 4LFUA 4WEKA 5DJTA 3E2LA 4OQHA 4RVAA 3RH8B 4CLCD 4YWZA 1M6KA 2V20A 2WKIA 3PBQA 5IT5A 5EUAA 4YNRA 3FC7A 4U3TA 1DP6A 4IUKA 3MQ0A 3UN7A 5IS1A 3C7VA 4OPRA 2Y91A 1FOFA 4S2LA 3N8SA 3OPRA 3PTEA 4U0XA 2I72A 2XQZA 4OPQA 2QZ6A 3MQQA 3UDXA 1K54A 1S4SA 4I5SA 2JKTM 3A3EA 1TEMA 1DY6A 4JGRA 2OWHA 2RCXA 2P9VB 3CJMA 4LV1A 4Y7PA 3UE6A 4DE3A 5KIZA 2Q0OA 4GDBA 5HARA 3SS4A 3FPWA 1XKZA 4HBTA 4BD0A 1BZAA 5U47A 4WUJA 2BG1A 1ZHHB 4ZJ3A 1T18A 1O7EA 5GLCA 3HVFA 1Y28A 2DRWA 1IOUA 4NXFA 1AWIA 1W79A 4Y0TA 2EFUA 3LO7A 4IVIA 3SH9A 3ZG5A 4UAAA 1LI0A 2HJEA 2Y2NA 5CERA 1I5QA 1N4OA 1N9NA 3V3SA 5L09A 2UWXA 5FAOA 4HOIA 1TF1A 4FOFA 2WADA 3W8KA 2P9VA 2OAQ1 4ID4A 3D72A 4L9EA 1GCEA 4X53A 4GOGA 4KZAA 5E2FA 1VQQA 2B02A 2D02A 3OBFA 4KZ5A 2AVXA 2W1RA 1ZKJA 2XH9A 3EEAA 2O9BA 3IXHA 2PAVP 4JLFA 3GMWA 4DE0A 3ZYTA 1TS7A 2H0YA 5FASA 3IH9A 1L0EA 5GLBA 5EFWA 4P87A 2QYBA 2Y55A 1ES2A 3IBJA 3CZDA 2Y2OA 1CI9A 4BJPA 5HW3A 1K57C 4S2NC 1CF0A 1XJ3A 1HLUP 1CI8A 4JF5A 5M18A 1PFLA 2CC1A 2WAFA 3KYEA 5EVID 3BRMA 4LENA 4WMCA 3HL9A 2C5WB 2K31A 2PR6A 3T1XA 3MKFA 5DJUA 4Y2FA 2Y2PA 1BLHA 1HTZA 4ZAMA 4S2MA 3BFFA 5HSQA 3KX0X 1K55C 4WL9A 4PM8A 4S2IA 4FSFA 2PT7A 4NKPA 3IWQA 1S4RA 3SS5A 1YT4A 1K56A 1LL8A 3TSGA 1S6RA 4JXVA 3HLBA 5TFQA 2R78A 1XJ4A 4EUZA 3S1YA 1BTLA 5DFYA 4EXOA 5DF9A 1W63Q 5FI7A 1NY0A 1OTAA 3IXGA 1NJ4A 4JXGA 3HLWA 4GJ4A 1CEFA 3B42A 3GQZA 3A0VA 2Y2LA 2XD5A 4OOLA 1CJFA 2VA0A 4DJ2A 1M40A 4LCLA 4R70A 4IBXA 2W3EA 3VMAA 3A0SA 3OOVA 3M6HA 3DAVA 1T19A 4GLQA 4IUHA 4N9KA 5DF7A 2HGVA 3FKVA 1Z6FA 3BM6A 1IKIA 4JBFA 5D3OA 2EWVA 4DN0A 1ZG4A 4OOMA 3T4LA 2I9VA 4GDNA 3GR2A 3LR4A 2H10A 4RX2A 2CMNA 3H82B 2ZOHA 4EU0A 5FDHA 4Y13A 3A3FA 1KDWA 4DRTA 5A92A 1JTGA 4DF6A 3E0YA 4MBFA 1Y4OA 2VGLS 5G4YA 2WUQA 2JKRI 3CAXA 1YLJA 2FFFB 1FSWA 4IVKA 3R7WB 4R1GA 2ZQ9A 3G31A 3RFBA 2M7VA 3NBLA 3JYIA 4OOYA 2RL3A 3PBSA 3KO6A 1IEMA 3SOIA 1JVJA 3NOTC 4RYEA 5HWVA 4KG2A 3WRZA 1QMFA 1ONGA 2EX8A 1D06A 5J8XA 1OT9A 4OONA 4P85A 4P6BA 1S1YA 1XGIA 3M2JA 4JKTA 3H82A 1E3UD 1GA0A 4DXBA 3P01A 5EOOA 3EOIA 3OPHA 3DTEA 5HAIA 3Q82A 2L4RA 3A3IA 4ETZA 2G2UA 1LT0A 1YKDA 4GD6A 1PW1A 2BLSA 2HZ5A 5E43A 2WKRA 2VK3A 2YKFA 3C5AA 1FR6A 3IHBA 4B9OA 4GW9A 4JGOA 2PRFA 4S2NA 4OH0A 4E3KA 2V1ZA 3KSFA 3MKEA 3PAEA 3UB8A 4PKYG 2WKPA 4JF6A 3UE1A 4KZBA 2VGLM 2DNSA 1WE4A 4HEFA 5HAPA 4L9FA 4ZDXA 4MDZA 3ZG7B 4O8GA 1J9MA 5BOHA 2EA9A 2ZC5B 2EFXA 2ZQ8A 5M1AA 1K25A 1NWZA 1TVFA 2K7SA 5KSHA 4X1MA 3V67A 3LICA 3LIFA 5I5LA 3FG8A 1K55A 3CLOA 4B4XA 2JKFA 5FAPA 3LI9A 5TGFA 4KG5A 4QB8A 3BLMA 3BY9A 3LIEA 5DKLA 1MPLA 2J3TC 5FAQA 2E8IA 1P97A 3UMDA 2L1MA 4K91A 1RGZA 3GECA 3CUEC 4UQIS 2WK0A 3D9YA 2ZBBA 4NEED 3ZG0A 4S2KA 3AGFA 5F69A 1L2SA 1UWNX 4DE1A 1FSYA 1W8QA 2PBYA 2ZMFA 3IX4A 3IX3A 5DKKA 1PRQA 2J3WA 5I94A 3FPVA 1PZOA 2ZD8A 1XP4A 3HUOA 3C7UA 1STZA 5MC7A 4QWOA 1IELA 3IS2B 3PAGA 5HX9A 2PHYA 5L8MA 4OLDA 4RQ9A 2Y59A 2Z2LB 2X71A 3ISGA 3VFFA 3P09A 5E2GA 1OTDA 4WZ4A 3P7NA 5EOEA 4HHDA 5CTNA 2FFYA 3CPTB 2WZXA 1XJ2A 3IF6B 3O3VA 3SZTA 5HPIA 1YMSA 4QY5A 2VJWA 3KSHA 1ESIA 3IWOA 3WS5A 2VV7A 4G3WA 3UB9A 1LL5A 4LV3A 3GV9A 3MXRA 4F3LB 3S7QA 1S66L 5DTKA 3UPPA 4HJ6A 1RGYA 2V1AA 3IS2A 4IHQA 3MFXA 2IA2A 1SHVA 2EWWA 1MXOA 4HH3A 5CXWA 5AQ9A 3VOZA 3K2NA 1KVMA 1AXBA 1UWPX 2PU2A 1F2KA 1ACFA 4ARZB 4WBGA 1S67L 1DJBA 2WGVA 3BQ8A 1OTBA 2OWJA 4UQIM 4KZ3A 3UE0A 3CPTA 3IF6A 5HZHA 3VOLA 4B93A 1MC0A 5CEBA 3RJUA 2ZQAA 2X02A 3M2KA 4HESA 3V39A 4F3LA 1LL9A 1P9WA 3T50A 3Q7ZA 2J8YA 4S2OA 1BULA 4ME4A 4R23A 2O0YA 3E4PA 2XFTA 4K0WA 2OAP1 4PM7A 4O7DA 1PWDA 3W2ZA 1T1BA 3ICYA 3O5YA 4X55A 5AQ7A 3MF0A 3M6BA 1XJ6A 1G6OA 4ARZA 1NYYA 3NY4A 3LGOA 1JWVA 3RXWA 1KE3A 2VKSA 1SKFA 1VM1A 1BUEA 2HV1A 4QPRA 1YPRA 1IYPA 2JHEA 2QMIA 1K6RA 2IWBA 3PBTA 4BLMA 1MWUA 2ZM0A 2OLUA 2ACGA 2WKEA 1GHMA 3Q7VB 3LY4A 3JVVA 3BFEA 1XFNA 3SH7A 3QNBA 4EERA 4O0PA 4H6JB 2W3GA 1OJGA 2W3FA 4BBVA 2Z2MB 4DXCA 1YSQA 5G18A 5EVEA 3W4OA 4WN5A 3DWKA 4EESA 5HD5A 3UMEA 3NOPC 2WZZA 2ZLYA 3UO9A 1Q2PA 3NCKA 2UV0E 1H3QA 4CLCE 2ZM8A 2GNXA 1G28A 5A90A 3Q7VA 3VE3A 1PZPA 2HDQA 2EX9A 3UPOA 3B33A 3CITA 4ZBEA 2PU4A 3JPUA 1PI5A 4PMAA 3NULA 4EWFA 5KMWA 3GSGA 4H6JA 4MEZA 2VGJA 5GHYA 4E04A 4OP5A 3E4OA 4UEYA 3FKWA 3I7JA 3OZHA 5F5YA 3LR0A 1HVBA 3QP5A 2H5SA 4MLLA 4D60A 5E2EA 3ZNTA 3JVUA 3Q1FA 2V0UA 2JBFA 2ZL1B 4WZ5A 2V8CA 2GDNA 3Q81A 4Y0OA 3T4SA 3MQOA 1PYYA 1SKOB 1YLPA 3OCNA 3A0RA 5KZHA 5F1GA 1CEGA 4YOFA 1FCNA 3WS4A 1ES5A 4KG6A 5F1FA 1NYMA 2WKQA 2EXAA 3L7HA 2HF6A 2PD8A 4PM9A 1YLWA 2XLNA 4OPYA 1OTEA 4CLCC 1SCWA 1XGJA 2Y2MA 1LSWA 3H9WA 3MSHA 2ZOIA 3PBOA 4HNBA 3G2ZA 1N9LA 2JKRM 3CI6A 3IT9A 3MBZA 3O86A 3IXDA 3O87A 1MKIA 4WMCD 4HP9A 3EQUA 4I3JA 3VP3A 3ZG9B 4YINA 2GX5A 1IFQA 5L07A 3ZNYA 3F1PB 4OP8A 1SKOA 2ZQDA 3QP6A 5A8BA 1T1CA 2NUPC 1G68A 1FCMA 2Y2GA 4HY8A 4LV2A 5GHXA 3PR6A 2GZAA 2Y2HA 2LB9A 1PW8A 3ZVWA 3LUQA 4E3OA 4BL2A 3G32A 4WEJA 5GHZA 2B95A 2ZC3B 1K56D 2VGKA 4DMZA 3NDEA 5CX7A 2VV6A 5L10A 3GRJA 1OPXA 1YLTA 3HUMA 4L0LA 4I3AA 1CQAA 2V0WA 3D3OA 1VETB 4JF4A 4JXWA 5CHJA 3F1PA 2WGWB 2EX2A 3F1OB 3PHYA 3FZCA 3HLFA 2OV5A 3VSLA 2HDSA 5TJJA 3BFGA 4Y3IA 3U4LP 2W27A 3BFDA 1TS0A 3BQAA 2L0WA 3NOUC 4N9LA 4HP4A 4P6ZS 3UDFA 1QMEA 2OOLA 2Y8HA 1KVLA 3N6IA 1NLZA 4GD8A 4MBHA 3LFVA 4XT2B 4E3JA 1K54C 3ZDJA 4AFIA 5A93A 2Z6DA 3UB7A 4II7A 3G2YA 3P98A 3VOYA 1TDGA 4PHTA 2YKHA 2M1CA 4B4ZA 1VETA 3PBNA 2WYXA 3R7WA 2WGWA 3N8RA 5EPHA 3NDGA 3F1OA 3AGEA 3UPNA 4KQRA 1ESUA 3NC8A 5EVIC 3RXXA 4CJNA 3AGDA 3ZGAB 5HDSA 4Q0IA 2E8JA 2PDRA 2XDMA 5LBRA 2NUTC 4KZ8A 1YLYA 1VB6A 3C4PA 5GLAA 1MZUA 5EE8A 3KYZA 4IJGA 4XT2A 5K5BA 1K57A 4Y17A 1S1ZA 2XR0A 4M4XA 2A3UA 3LCEA 1TS6A 4PM6A 4DJ3A 1VHMA 2V1BA 1KGEA 2HP9A 3LYXA 2MJ6A 2XF3A 1J3WA 5G4ZA 4N92A 2W0NA 4JGPA 3S7OA 1IYQA 4GHIB 2A2LA 4GKUA 4HI4A 4CLCB 5FEFA 4GS9B 3TOIA 4X6TA 1FIKA 2JC7A 3IBRA 3WS1A 1DRMA 5CECA 2EX6A 4NG2A 4B88A 3VSKA 1CK3A 1N9OA 1YQSA 4BMWA 2BTFP 4WF0A 1N9BA 5FQJA 1JWZA 3IHAA 3ZHHA 3MZFA 4N1HA 3BEBA 1MY8A 2EXBA 2P7JA 5DTTA 2DMWA 4BENA 3NIAA 1ES3A 4HBUA 3C8CA 4UA6A 3MZDA 4KUKA 5DFXA 5J3WA 2GJ3A 5FDSA 4Y15A 1OJ5A 2QJ5A 3BFCA 2J80A 2DCFA 2BASA 4GN2A 1GHIA 4DKIA 4YFMA 4GHIA 2JN7A 1H5XA 4CLCA 4GS9A 3VV4A 3BYDA 4C6YA 2OSUA 4R3AA 3C4OA 3HBRA 1L0FA 3UY6A 3ZFZA 1V9ZA 2LB5A 4BD1A 2XROA 3C38A 4KENB 5CHMA 4IEDA 2Y4AA 4KQOA 4OQIA 4PKYA 3LIDA 5HDCA 1GSWA 4EV4A 1GHPA 4G3KA 2Q9MA 2KX6A 2XK1A 4HQAA 3MZEA 2HP5A 1S0WA 4PAUA 3V50A 2HJ9C 2ZC6B 4WM9A 1KDSA 4R0QA 3C2WA 5TBMB 3HJKA 3W4PA 1RCJA 1F98A 3DTMA 2ZMVA 2ZM2A 3MR0A 3VFHA 3R4KA 4XUZA 5HFOA 4EETB 5FI2A 2W1TB 4R38A 5JYOA 2A49A 3LIAA 3S7PA 3ULFA 4MN5A 4K08A 2Q9NA 5HDDA 4WLAA 1NZUA 1K38A 4BL3A 2V9AA 4KZ6A 4LPZA 4GCZA 5A91A 3UNWA 2XSSA 1A0KA 5CHUA 4H8RA 5AVEA 3G6OA 1EI5A 4LCMA 3A3JA 2K2NA 2QJ7A 3T4JA 3H7WB 3LY3A 1K0KA 5TBMA 1MWTA 4UA9A 5EVIB 5JYPA 3WS2A 3WRTA 1MWRA 4S2PA 4NETA 5L2FA 1H8MA 1ODVA 2PBDP 1XPBA 3HREA 4KZ4A 5C5KA 1L0GA 2W1TA 4FH2A 1O07A 3T1RA 4MBKA 2IWCA 2WAEA 2J9OA 4Q0JA 4NXEA 4Y0UA 4NXGA 3HJIA 5FSRA 1NRJA 3HLEA 3BW6A 4R4RA 2IWDA 1W7FA 3CHWP 4OPZA 2VLGA 3MXSA 2ZJ9A 3DBAA 1V9YA 3PBRA 3TG9A 1BLSA 3GDIA 3LEQA 1WYCA 3LR3A 5AVFA 5AJGA 1LLBA 3H7WA 5EVIA 5CRFA 1ZTUA 4BBUA 5J4EA 3CMZA 5FQMA 4Q8IA 4PPRA 3A3DA 1TS8A 4FUWA 3UDIA 2PYPA 1KGFA 4WELA 1K4FA 1GSVA 2Y2KA 4X1LA 4ZTKA 2OLVA 3QP1A 4EEPA 1XA1A 2B18A 2Y79A 5E2HA 3IF5A 4Z1WA 3QP2A 4KZ9A 2JKTI 5HAQA 1W8YA 2KLIA 4FH4A 3HCYA 3O88A 1ALQA 3V3RA 5AQAA 1BLCA 3DTIA 4KUOA 4NXBA 1ERMA 4ZJ2A 1C3BA 1EROA 3T1QB 2XFSA 3T4QA 4F94A 1I2SA 3RTYA 4K0XA 1LSVA 1BYWA 3MJQA 4BBTA 2D01A 3T12B 5GLDA 3Q07A 4N1XA 3KYQA 1NLYA 1ZG6A 1UGUA 1H8ZA 2QHKA 3NI9A 2KDKA 2PR5A 2WKHA 2XGNA 2Z6CA 5F6AA 1FCOA 1LHYA 3QHYA 3VP0A 3HLCA 1LI9A 3CUEA 5F82A 5F83A 3UB5P 3E98A 4D2OA 3G4PA 5CEDA 3W4QA 4X25A 1OMEA 4EW7A 4GZBA 2XRNA 3OC2A 3D4FA 5CGWA 4G3VA 1DJCA 2R9WA 1K4EA 1XFQA 2HPBA 1ES4A 2VV8A 3KSIA 2JCHA 2PD7A 4RX3A 2H28A 4UA7A 3N4IA 4Z9QA 4R4SA 3OCLA 4DE2A 4LLOB 3PYPA 4MCWA 5FQIA 2V8FA 4KQDA 4I3IA 1DJAA 3LEZA 4OVDA 5CGXA 2W3HA 1X0OA 1XX2A 3GVBA 3G35A 3QP4A 3SW1A
chains in the Genus database with same CATH topology
1LI0A 3ZG8B 2WGWA 3N8RA 1YM1A 2Y2NA 3NDGA 5EPHA 1I5QA 1N4OA 4OLDA 5CERA 3AGEA 3V3SA 3UPNA 2UWXA 4GB7A 4KQRA 5DTSA 2Y59A 5FAOA 2Z2LB 2X71A 3ISGA 3VFFA 3P09A 1Y54A 5E2GA 1ESUA 3NC8A 5FATA 4WZ4A 2WADA 5EVIC 2Y2IA 5EOEA 3RXXA 5CTNA 3W8KA 3AGDA 2P9VA 4CJNA 2FFYA 3ZGAB 1IKGA 2ZQCA 3N8LA 4ID4A 2WZXA 3IF6B 2XDMA 1SDNA 3O3VA 1YMSA 4KZ8A 4QY5A 1YLYA 1ESIA 3C4PA 4PM5A 3IWOA 1GCEA 4X53A 3WS5A 4GOGA 5GLAA 4KZAA 5E2FA 5EE8A 1VQQA 1K57A 1LL5A 4KZ5A 3FYZA 4LV3A 1ZKJA 1TDLA 2XH9A 3GV9A 3MXRA 3HLDA 3IXHA 2XR0A 3IWIA 1PWGA 4JLFA 4R3JA 5TR7A 1E3UA 4OQ0A 5DTKA 2A3UA 3UPPA 4JPMA 3GMWA 3LCEA 4PM6A 4DE0A 1RGYA 1KGEA 2HP9A 4E3NA 2H0YA 5FASA 1SHVA 1MXOA 3IH9A 3DW0A 5CXWA 3FV7A 1L0EA 4EBLA 5AQ9A 3VOZA 5GLBA 2XF3A 1KVMA 5FQQA 1AXBA 2PU2A 4P87A 1PI4A 4N92A 2Y55A 1ES2A 1IYQA 2Y2OA 1CI9A 3CZDA 4GKUA 4BJPA 4C75A 5HW3A 1K57C 4WBGA 3ZCZA 4QJGA 3TOIA 4S2NC 1DJBA 2WGVA 3HLGA 4X6TA 5HL1A 2JC7A 3WS1A 5CECA 2EX6A 4B88A 3VSKA 1CK3A 1CI8A 1YQSA 4JF5A 4DDSA 4KZ3A 3UE0A 3BLSA 5M18A 1KE0A 1N9BA 5FQJA 1JWZA 3IHAA 2CC1A 2WAFA 2V2FF 3ZHHA 3MZFA 3IF6A 5EECA 5EVID 3BRMA 4LENA 4WMCA 4E3MA 4N1HA 3BEBA 5CEBA 3VP1A 1MY8A 1NRFA 3ITBA 4NK3A 5GL9A 2EXBA 4GNUA 3RJUA 1HZOA 3HL9A 2C5WB 1PWCA 2ZQAA 2XD1A 5DTTA 5FI6A 2X02A 3M2KA 4HESA 4BENA 3SH8A 3V39A 3NIAA 1ES3A 4HBUA 1ZC2A 4E3LA 3BECA 1LL9A 3MKFA 3Q7ZA 2J8YA 4S2OA 1BULA 2R9XA 4R23A 4UA6A 3MZDA 1FR1A 2Y2PA 4K0WA 2XFTA 4R3BA 1BLHA 4PM7A 4O7DA 1HTZA 1PWDA 4ZAMA 1GA9A 2QPNA 2G2WA 4S2MA 1KGGA 3BFFA 4X55A 1MWSA 1K55C 4PM8A 4S2IA 4FSFA 5AQ7A 3IF6C 3BFCA 2DCFA 4GN2A 3M6BA 1GHIA 4DKIA 4YFMA 5M19A 3HUNA 1H5XA 4M3KA 3IWQA 1NYYA 3NY4A 4MNRA 3E2KA 4BQMA 1JWVA 1YT4A 1K56A 3BYDA 2HP6A 3SS5A 4C6YA 2XEPA 1ERQA 2OSUA 3RXWA 4E6WA 4CPKA 3UE3A 4X69A 2J9PA 3FWLA 4QU3A 3TSGA 3C4OA 1KE3A 3HBRA 4X68A 1L0FA 1S6RA 3UY6A 1SKFA 4JXVA 3ZFZA 1VM1A 1BUEA 3HLBA 3VP4A 2B5RA 5TFQA 4BD1A 4EUZA 3EQVA 1IYPA 4KENB 2X01A 3S1YA 5CHMA 4IEDA 1BTLA 4UHUA 2QMIA 2Y4AA 4KQOA 4OQIA 5DF9A 4ZJ1A 3IH8A 1K6RA 2IWBA 3PBTA 5FI7A 4BLMA 4EV4A 1NY0A 3IXGA 2ZC7A 1MWUA 1NJ4A 1GHPA 3QNCA 4JXGA 3OPPA 2Q9MA 2ZM0A 3HLWA 4XUXA 2OLUA 2WKEA 2Y2JA 2XK1A 1GHMA 3Q7VB 1CEFA 3LY4A 3MZEA 3GTCA 2HDUA 3GQZA 2H0TA 2HP5A 1S0WA 3BFEA 5FQKA 3V50A 3SH7A 2Y2LA 2JE5A 2ZC6B 1KDSA 4WM9A 4R0QA 2XD5A 4JXSA 4OLGA 4OOLA 3QNBA 3W4PA 4WYYA 1RCJA 1M40A 3G34A 4LCLA 1L0DA 3DTMA 2ZM2A 3ITAA 4IBXA 3VFHA 2C6WB 4OQGA 4XUZA 3VMAA 4KZ7A 5HFOA 2Z2MB 3S4XA 1JWPA 4XXRA 5FI2A 4DDYA 4DXCA 2HDRA 3M6HA 5G18A 5JYOA 1U60A 3W4OA 4N9KA 5DF7A 2A49A 3DWKA 4EBNA 1G6AA 3FKVA 4FCFA 1Z6FA 2Q9NA 3BM6A 1IKIA 4JBFA 3ZVTA 5D3OA 2WZZA 5FA7A 1NZUA 1ZG4A 2ZLYA 3UO9A 4OOMA 1K38A 4BL3A 4E3IA 1Q2PA 2ZQ7A 4KZ6A 3NCKA 5FQ9A 5A91A 3UNWA 1FQGA 2ZM8A 3OPLA 4GDNA 3GR2A 5CHUA 4H8RA 2H10A 1JTDA 4RX2A 5A90A 1EI5A 2ZMAA 3A3JA 4LCMA 1EWZA 3Q7VA 1H8YA 1PZPA 3LY3A 2HDQA 2EX9A 2Y2QA 5CGSA 5FDHA 2WGIA 4QD4A 3UPOA 1MWTA 4UA9A 5EVIB 5JYPA 4ZBEA 3A3FA 2PU4A 1KDWA 4DRTA 5A92A 3WWXA 1PI5A 4PMAA 1JTGA 4EWFA 4DF6A 2J7VA 5KMWA 3GSGA 4MBFA 3WS2A 3WRTA 1MWRA 1I2WA 1IYOA 2WUQA 4S2PA 4NETA 4MEZA 1YLJA 2VGJA 2FFFB 5GHYA 5L2FA 1FSWA 4S2JA 1BSGA 1BT5A 4IVKA 3SS3A 3VP2A 1XPBA 3HREA 4KZ4A 4C3QA 4OP5A 4R1GA 1L0GA 3FKWA 3I7JA 2ZQ9A 1O07A 1K6SA 3OZHA 4FH2A 3MFDA 4MBKA 3G31A 1HVBA 2IWCA 2WAEA 2J9OA 4Y0UA 5FSRA 3NBLA 1KE4A 5DF8A 2H5SA 3JYIA 4MLLA 1HD8A 4EQIA 4OOYA 2RL3A 3PBSA 5E2EA 3ZNTA 1IEMA 1XA7A 3HLEA 4IBRA 1JVJA 3SOIA 4R4RA 2ZC4B 3Q1FA 5EVLA 2JBFA 2IWDA 1SDEA 1W7FA 4OPZA 4RYEA 4WZ5A 3MXSA 4KG2A 1E25A 2GDNA 3WRZA 2ZJ9A 1IYSA 1NXYA 3Q81A 1QMFA 3PBRA 4Y0OA 3TG9A 3V5MA 1BLSA 1ONGA 1PYYA 2EX8A 1YLPA 5J8XA 1WYCA 3OCNA 4OONA 4P85A 3WS0A 4P6BA 4OKPA 5KZHA 1XGIA 1CEGA 5F1GA 3IQAA 3M2JA 1FCNA 4JKTA 1LLBA 1E3UD 3WS4A 1GA0A 4X56A 1ES5A 3N7WA 1ONHA 3G30A 4DXBA 4KG6A 5F1FA 1MBLA 1NYMA 5EOOA 5EVIA 2EXAA 3OPHA 5CRFA 4LV0A 3CMZA 4QY6A 5FQMA 4Q8IA 4FD8A 4PM9A 3S22A 1YLWA 2XLNA 4PPRA 4OPYA 3Q82A 5HAIA 3A3DA 3A3IA 1SCWA 1WYBA 5CTMA 4WZ5C 1XGJA 2Y2MA 3UDIA 1KGFA 1PIOA 4WELA 1K4FA 3PBOA 3B3XA 1Q2QA 3G2ZA 2Y2KA 1E4DA 4ZTKA 4U0TA 2G2UA 2OLVA 2P74A 4QHCA 1XXMA 3MBZA 4GD6A 3IT9A 1PW1A 3O86A 1XA1A 1YLZA 2BLSA 4P0MA 3IXDA 5E43A 5E2HA 5KSCA 4EBPA 3IF5A 3CG5A 3O87A 1MKIA 4WMCD 3EQUA 4KZ9A 3VP3A 1BLPA 1W8YA 3ZG9B 4E6XA 4YINA 4FH4A 5HAQA 3O88A 1ALQA 3V3RA 5AQAA 3ZNYA 1BLCA 4OP8A 5AQBA 1W5DA 2ZQDA 3C5AA 4RA7A 1FR6A 3IHBA 1ERMA 4ZJ2A 5DVAA 1G68A 1C3BA 1EROA 1FCMA 2Y2GA 4A5RA 2XFSA 4S2NA 4OH0A 1YMXA 4E3KA 4F94A 1I2SA 1RP5A 4LV2A 5GHXA 4K0XA 2V1ZA 3IXBA 2Y2HA 3MKEA 3PAEA 5IHVA 3DWZA 1NZOA 4KQQA 5GLDA 4JF6A 3UE1A 3Q07A 1PW8A 4KZBA 4N1XA 3ZVWA 2DNSA 1WE4A 1ZG6A 4E3OA 4WEKA 4BL2A 3G32A 1H8ZA 4HEFA 5HAPA 4ZDXA 3E2LA 3NI9A 3ZG7B 1J9MA 2WKHA 2ZC5B 4OQHA 4RVAA 5BOHA 2EFXA 2XGNA 4WEJA 2ZQ8A 5M1AA 1M6KA 2V20A 5GHZA 1K25A 2WKIA 2ZC3B 3PBQA 1TVFA 1K56D 5EUAA 1FCOA 2VGKA 1LHYA 3QHYA 5KSHA 4U3TA 3VP0A 3HLCA 1LI9A 3UN7A 3NDEA 3C7VA 5F82A 3GRJA 4OPRA 1YLTA 2Y91A 5F83A 3HUMA 4L0LA 1FOFA 4D2OA 4S2LA 3N8SA 3OPRA 3PTEA 4U0XA 2I72A 2XQZA 3G4PA 4OPQA 1K55A 2QZ6A 5CEDA 3W4QA 4JF4A 1OMEA 4JXWA 5CHJA 2WGWB 1K54A 2EX2A 3UDXA 4GZBA 4B4XA 3FZCA 3HLFA 3OC2A 5FAPA 3D4FA 5CGWA 5TGFA 2OV5A 4KG5A 4QB8A 3VSLA 3BLMA 2HDSA 1DJCA 2R9WA 3BFGA 1MPLA 3A3EA 1TEMA 1K4EA 1DY6A 5FAQA 2HPBA 1ES4A 2E8IA 3BFDA 4N9LA 4K91A 2JCHA 1RGZA 2RCXA 2P9VB 4RX3A 3CJMA 4LV1A 1QMEA 3UDFA 4Y7PA 2WK0A 4DE3A 4UA7A 1KVLA 3N4IA 3N6IA 4Z9QA 3ZG0A 4R4SA 3AGFA 4S2KA 5HX9A 4GDBA 5HARA 3SS4A 1L2SA 4GD8A 4MBHA 3OCLA 4DE2A 1XKZA 4HBTA 4BD0A 1BZAA 4DE1A 1FSYA 5U47A 2PBYA 1W8QA 5FQIA 4E3JA 2BG1A 1K54C 3ZDJA 5A93A 4ZJ3A 5I94A 1O7EA 1DJAA 3LEZA 3G2YA 1PZOA 4OVDA 2ZD8A 5CGXA 5GLCA 3P98A 3VOYA 1TDGA 3HVFA 1XP4A 3HUOA 3C7UA 2DRWA 1W79A 4Y0TA 2EFUA 3LO7A 1IELA 1XX2A 3GVBA 3PAGA 3G35A 4IVIA 4B4ZA 3SH9A 3ZG5A 4UAAA 3PBNA 2WYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LI0 A;  3ZG8 B;  2WGW A;  3N8R A;  1YM1 A;  2Y2N A;  3NDG A;  5EPH A;  1I5Q A;  1N4O A;  4OLD A;  5CER A;  3AGE A;  3V3S A;  3UPN A;  2UWX A;  4GB7 A;  4KQR A;  5DTS A;  2Y59 A;  5FAO A;  2Z2L B;  2X71 A;  3ISG A;  3VFF A;  3P09 A;  1Y54 A;  5E2G A;  1ESU A;  3NC8 A;  5FAT A;  4WZ4 A;  2WAD A;  5EVI C;  2Y2I A;  5EOE A;  3RXX A;  5CTN A;  3W8K A;  3AGD A;  2P9V A;  4CJN A;  2FFY A;  3ZGA B;  1IKG A;  2ZQC A;  3N8L A;  4ID4 A;  2WZX A;  3IF6 B;  2XDM A;  1SDN A;  3O3V A;  1YMS A;  4KZ8 A;  4QY5 A;  1YLY A;  1ESI A;  3C4P A;  4PM5 A;  3IWO A;  1GCE A;  4X53 A;  3WS5 A;  4GOG A;  5GLA A;  4KZA A;  5E2F A;  5EE8 A;  1VQQ A;  1K57 A;  1LL5 A;  4KZ5 A;  3FYZ A;  4LV3 A;  1ZKJ A;  1TDL A;  2XH9 A;  3GV9 A;  3MXR A;  3HLD A;  3IXH A;  2XR0 A;  3IWI A;  1PWG A;  4JLF A;  4R3J A;  5TR7 A;  1E3U A;  4OQ0 A;  5DTK A;  2A3U A;  3UPP A;  4JPM A;  3GMW A;  3LCE A;  4PM6 A;  4DE0 A;  1RGY A;  1KGE A;  2HP9 A;  4E3N A;  2H0Y A;  5FAS A;  1SHV A;  1MXO A;  3IH9 A;  3DW0 A;  5CXW A;  3FV7 A;  1L0E A;  4EBL A;  5AQ9 A;  3VOZ A;  5GLB A;  2XF3 A;  1KVM A;  5FQQ A;  1AXB A;  2PU2 A;  4P87 A;  1PI4 A;  4N92 A;  2Y55 A;  1ES2 A;  1IYQ A;  2Y2O A;  1CI9 A;  3CZD A;  4GKU A;  4BJP A;  4C75 A;  5HW3 A;  1K57 C;  4WBG A;  3ZCZ A;  4QJG A;  3TOI A;  4S2N C;  1DJB A;  2WGV A;  3HLG A;  4X6T A;  5HL1 A;  2JC7 A;  3WS1 A;  5CEC A;  2EX6 A;  4B88 A;  3VSK A;  1CK3 A;  1CI8 A;  1YQS A;  4JF5 A;  4DDS A;  4KZ3 A;  3UE0 A;  3BLS A;  5M18 A;  1KE0 A;  1N9B A;  5FQJ A;  1JWZ A;  3IHA A;  2CC1 A;  2WAF A;  2V2F F;  3ZHH A;  3MZF A;  3IF6 A;  5EEC A;  5EVI D;  3BRM A;  4LEN A;  4WMC A;  4E3M A;  4N1H A;  3BEB A;  5CEB A;  3VP1 A;  1MY8 A;  1NRF A;  3ITB A;  4NK3 A;  5GL9 A;  2EXB A;  4GNU A;  3RJU A;  1HZO A;  3HL9 A;  2C5W B;  1PWC A;  2ZQA A;  2XD1 A;  5DTT A;  5FI6 A;  2X02 A;  3M2K A;  4HES A;  4BEN A;  3SH8 A;  3V39 A;  3NIA A;  1ES3 A;  4HBU A;  1ZC2 A;  4E3L A;  3BEC A;  1LL9 A;  3MKF A;  3Q7Z A;  2J8Y A;  4S2O A;  1BUL A;  2R9X A;  4R23 A;  4UA6 A;  3MZD A;  1FR1 A;  2Y2P A;  4K0W A;  2XFT A;  4R3B A;  1BLH A;  4PM7 A;  4O7D A;  1HTZ A;  1PWD A;  4ZAM A;  1GA9 A;  2QPN A;  2G2W A;  4S2M A;  1KGG A;  3BFF A;  4X55 A;  1MWS A;  1K55 C;  4PM8 A;  4S2I A;  4FSF A;  5AQ7 A;  3IF6 C;  3BFC A;  2DCF A;  4GN2 A;  3M6B A;  1GHI A;  4DKI A;  4YFM A;  5M19 A;  3HUN A;  1H5X A;  4M3K A;  3IWQ A;  1NYY A;  3NY4 A;  4MNR A;  3E2K A;  4BQM A;  1JWV A;  1YT4 A;  1K56 A;  3BYD A;  2HP6 A;  3SS5 A;  4C6Y A;  2XEP A;  1ERQ A;  2OSU A;  3RXW A;  4E6W A;  4CPK A;  3UE3 A;  4X69 A;  2J9P A;  3FWL A;  4QU3 A;  3TSG A;  3C4O A;  1KE3 A;  3HBR A;  4X68 A;  1L0F A;  1S6R A;  3UY6 A;  1SKF A;  4JXV A;  3ZFZ A;  1VM1 A;  1BUE A;  3HLB A;  3VP4 A;  2B5R A;  5TFQ A;  4BD1 A;  4EUZ A;  3EQV A;  1IYP A;  4KEN B;  2X01 A;  3S1Y A;  5CHM A;  4IED A;  1BTL A;  4UHU A;  2QMI A;  2Y4A A;  4KQO A;  4OQI A;  5DF9 A;  4ZJ1 A;  3IH8 A;  1K6R A;  2IWB A;  3PBT A;  5FI7 A;  4BLM A;  4EV4 A;  1NY0 A;  3IXG A;  2ZC7 A;  1MWU A;  1NJ4 A;  1GHP A;  3QNC A;  4JXG A;  3OPP A;  2Q9M A;  2ZM0 A;  3HLW A;  4XUX A;  2OLU A;  2WKE A;  2Y2J A;  2XK1 A;  1GHM A;  3Q7V B;  1CEF A;  3LY4 A;  3MZE A;  3GTC A;  2HDU A;  3GQZ A;  2H0T A;  2HP5 A;  1S0W A;  3BFE A;  5FQK A;  3V50 A;  3SH7 A;  2Y2L A;  2JE5 A;  2ZC6 B;  1KDS A;  4WM9 A;  4R0Q A;  2XD5 A;  4JXS A;  4OLG A;  4OOL A;  3QNB A;  3W4P A;  4WYY A;  1RCJ A;  1M40 A;  3G34 A;  4LCL A;  1L0D A;  3DTM A;  2ZM2 A;  3ITA A;  4IBX A;  3VFH A;  2C6W B;  4OQG A;  4XUZ A;  3VMA A;  4KZ7 A;  5HFO A;  2Z2M B;  3S4X A;  1JWP A;  4XXR A;  5FI2 A;  4DDY A;  4DXC A;  2HDR A;  3M6H A;  5G18 A;  5JYO A;  1U60 A;  3W4O A;  4N9K A;  5DF7 A;  2A49 A;  3DWK A;  4EBN A;  1G6A A;  3FKV A;  4FCF A;  1Z6F A;  2Q9N A;  3BM6 A;  1IKI A;  4JBF A;  3ZVT A;  5D3O A;  2WZZ A;  5FA7 A;  1NZU A;  1ZG4 A;  2ZLY A;  3UO9 A;  4OOM A;  1K38 A;  4BL3 A;  4E3I A;  1Q2P A;  2ZQ7 A;  4KZ6 A;  3NCK A;  5FQ9 A;  5A91 A;  3UNW A;  1FQG A;  2ZM8 A;  3OPL A;  4GDN A;  3GR2 A;  5CHU A;  4H8R A;  2H10 A;  1JTD A;  4RX2 A;  5A90 A;  1EI5 A;  2ZMA A;  3A3J A;  4LCM A;  1EWZ A;  3Q7V A;  1H8Y A;  1PZP A;  3LY3 A;  2HDQ A;  2EX9 A;  2Y2Q A;  5CGS A;  5FDH A;  2WGI A;  4QD4 A;  3UPO A;  1MWT A;  4UA9 A;  5EVI B;  5JYP A;  4ZBE A;  3A3F A;  2PU4 A;  1KDW A;  4DRT A;  5A92 A;  3WWX A;  1PI5 A;  4PMA A;  1JTG A;  4EWF A;  4DF6 A;  2J7V A;  5KMW A;  3GSG A;  4MBF A;  3WS2 A;  3WRT A;  1MWR A;  1I2W A;  1IYO A;  2WUQ A;  4S2P A;  4NET A;  4MEZ A;  1YLJ A;  2VGJ A;  2FFF B;  5GHY A;  5L2F A;  1FSW A;  4S2J A;  1BSG A;  1BT5 A;  4IVK A;  3SS3 A;  3VP2 A;  1XPB A;  3HRE A;  4KZ4 A;  4C3Q A;  4OP5 A;  4R1G A;  1L0G A;  3FKW A;  3I7J A;  2ZQ9 A;  1O07 A;  1K6S A;  3OZH A;  4FH2 A;  3MFD A;  4MBK A;  3G31 A;  1HVB A;  2IWC A;  2WAE A;  2J9O A;  4Y0U A;  5FSR A;  3NBL A;  1KE4 A;  5DF8 A;  2H5S A;  3JYI A;  4MLL A;  1HD8 A;  4EQI A;  4OOY A;  2RL3 A;  3PBS A;  5E2E A;  3ZNT A;  1IEM A;  1XA7 A;  3HLE A;  4IBR A;  1JVJ A;  3SOI A;  4R4R A;  2ZC4 B;  3Q1F A;  5EVL A;  2JBF A;  2IWD A;  1SDE A;  1W7F A;  4OPZ A;  4RYE A;  4WZ5 A;  3MXS A;  4KG2 A;  1E25 A;  2GDN A;  3WRZ A;  2ZJ9 A;  1IYS A;  1NXY A;  3Q81 A;  1QMF A;  3PBR A;  4Y0O A;  3TG9 A;  3V5M A;  1BLS A;  1ONG A;  1PYY A;  2EX8 A;  1YLP A;  5J8X A;  1WYC A;  3OCN A;  4OON A;  4P85 A;  3WS0 A;  4P6B A;  4OKP A;  5KZH A;  1XGI A;  1CEG A;  5F1G A;  3IQA A;  3M2J A;  1FCN A;  4JKT A;  1LLB A;  1E3U D;  3WS4 A;  1GA0 A;  4X56 A;  1ES5 A;  3N7W A;  1ONH A;  3G30 A;  4DXB A;  4KG6 A;  5F1F A;  1MBL A;  1NYM A;  5EOO A;  5EVI A;  2EXA A;  3OPH A;  5CRF A;  4LV0 A;  3CMZ A;  4QY6 A;  5FQM A;  4Q8I A;  4FD8 A;  4PM9 A;  3S22 A;  1YLW A;  2XLN A;  4PPR A;  4OPY A;  3Q82 A;  5HAI A;  3A3D A;  3A3I A;  1SCW A;  1WYB A;  5CTM A;  4WZ5 C;  1XGJ A;  2Y2M A;  3UDI A;  1KGF A;  1PIO A;  4WEL A;  1K4F A;  3PBO A;  3B3X A;  1Q2Q A;  3G2Z A;  2Y2K A;  1E4D A;  4ZTK A;  4U0T A;  2G2U A;  2OLV A;  2P74 A;  4QHC A;  1XXM A;  3MBZ A;  4GD6 A;  3IT9 A;  1PW1 A;  3O86 A;  1XA1 A;  1YLZ A;  2BLS A;  4P0M A;  3IXD A;  5E43 A;  5E2H A;  5KSC A;  4EBP A;  3IF5 A;  3CG5 A;  3O87 A;  1MKI A;  4WMC D;  3EQU A;  4KZ9 A;  3VP3 A;  1BLP A;  1W8Y A;  3ZG9 B;  4E6X A;  4YIN A;  4FH4 A;  5HAQ A;  3O88 A;  1ALQ A;  3V3R A;  5AQA A;  3ZNY A;  1BLC A;  4OP8 A;  5AQB A;  1W5D A;  2ZQD A;  3C5A A;  4RA7 A;  1FR6 A;  3IHB A;  1ERM A;  4ZJ2 A;  5DVA A;  1G68 A;  1C3B A;  1ERO A;  1FCM A;  2Y2G A;  4A5R A;  2XFS A;  4S2N A;  4OH0 A;  1YMX A;  4E3K A;  4F94 A;  1I2S A;  1RP5 A;  4LV2 A;  5GHX A;  4K0X A;  2V1Z A;  3IXB A;  2Y2H A;  3MKE A;  3PAE A;  5IHV A;  3DWZ A;  1NZO A;  4KQQ A;  5GLD A;  4JF6 A;  3UE1 A;  3Q07 A;  1PW8 A;  4KZB A;  4N1X A;  3ZVW A;  2DNS A;  1WE4 A;  1ZG6 A;  4E3O A;  4WEK A;  4BL2 A;  3G32 A;  1H8Z A;  4HEF A;  5HAP A;  4ZDX A;  3E2L A;  3NI9 A;  3ZG7 B;  1J9M A;  2WKH A;  2ZC5 B;  4OQH A;  4RVA A;  5BOH A;  2EFX A;  2XGN A;  4WEJ A;  2ZQ8 A;  5M1A A;  1M6K A;  2V20 A;  5GHZ A;  1K25 A;  2WKI A;  2ZC3 B;  3PBQ A;  1TVF A;  1K56 D;  5EUA A;  1FCO A;  2VGK A;  1LHY A;  3QHY A;  5KSH A;  4U3T A;  3VP0 A;  3HLC A;  1LI9 A;  3UN7 A;  3NDE A;  3C7V A;  5F82 A;  3GRJ A;  4OPR A;  1YLT A;  2Y91 A;  5F83 A;  3HUM A;  4L0L A;  1FOF A;  4D2O A;  4S2L A;  3N8S A;  3OPR A;  3PTE A;  4U0X A;  2I72 A;  2XQZ A;  3G4P A;  4OPQ A;  1K55 A;  2QZ6 A;  5CED A;  3W4Q A;  4JF4 A;  1OME A;  4JXW A;  5CHJ A;  2WGW B;  1K54 A;  2EX2 A;  3UDX A;  4GZB A;  4B4X A;  3FZC A;  3HLF A;  3OC2 A;  5FAP A;  3D4F A;  5CGW A;  5TGF A;  2OV5 A;  4KG5 A;  4QB8 A;  3VSL A;  3BLM A;  2HDS A;  1DJC A;  2R9W A;  3BFG A;  1MPL A;  3A3E A;  1TEM A;  1K4E A;  1DY6 A;  5FAQ A;  2HPB A;  1ES4 A;  2E8I A;  3BFD A;  4N9L A;  4K91 A;  2JCH A;  1RGZ A;  2RCX A;  2P9V B;  4RX3 A;  3CJM A;  4LV1 A;  1QME A;  3UDF A;  4Y7P A;  2WK0 A;  4DE3 A;  4UA7 A;  1KVL A;  3N4I A;  3N6I A;  4Z9Q A;  3ZG0 A;  4R4S A;  3AGF A;  4S2K A;  5HX9 A;  4GDB A;  5HAR A;  3SS4 A;  1L2S A;  4GD8 A;  4MBH A;  3OCL A;  4DE2 A;  1XKZ A;  4HBT A;  4BD0 A;  1BZA A;  4DE1 A;  1FSY A;  5U47 A;  2PBY A;  1W8Q A;  5FQI A;  4E3J A;  2BG1 A;  1K54 C;  3ZDJ A;  5A93 A;  4ZJ3 A;  5I94 A;  1O7E A;  1DJA A;  3LEZ A;  3G2Y A;  1PZO A;  4OVD A;  2ZD8 A;  5CGX A;  5GLC A;  3P98 A;  3VOY A;  1TDG A;  3HVF A;  1XP4 A;  3HUO A;  3C7U A;  2DRW A;  1W79 A;  4Y0T A;  2EFU A;  3LO7 A;  1IEL A;  1XX2 A;  3GVB A;  3PAG A;  3G35 A;  4IVI A;  4B4Z A;  3SH9 A;  3ZG5 A;  4UAA A;  3PBN A;  2WYX A; 
#chains in the Genus database with same CATH topology
 5F68 A;  3ZG8 B;  1YM1 A;  3PXP A;  1GSX A;  4GB7 A;  5DTS A;  1SZV A;  2JKG A;  1Y54 A;  4R6L A;  5FAT A;  4BWI A;  3S7N A;  2P08 A;  5HD3 A;  2ZL1 A;  2Y2I A;  2J3T D;  2W3D A;  1IKG A;  2ZQC A;  3N8L A;  3EEH A;  1SDN A;  1YSP A;  1F9I A;  4PM5 A;  5FL3 A;  3FYZ A;  1TDL A;  4JGQ A;  3HLD A;  1D7E A;  3IWI A;  1PWG A;  5IU1 A;  4FTX A;  1DP9 A;  4R3J A;  5TR7 A;  1E3U A;  4OQ0 A;  4MN6 A;  4JPM A;  1L3L A;  2FH5 A;  2XA7 S;  4E3N A;  3DW0 A;  3FV7 A;  4EBL A;  5FQQ A;  1PI4 A;  3DTK A;  4C75 A;  3T4O A;  3ZCZ A;  3K3D A;  4QJG A;  5HL1 A;  3TRC A;  4ZRR A;  3HLG A;  1PNE A;  2O9C A;  4L9G A;  4LGW A;  4DDS A;  3BLS A;  1KE0 A;  5EV0 A;  2V2F F;  1F5M A;  5EEC A;  4E3M A;  2O99 A;  3MMH A;  3VP1 A;  5EM1 A;  1NRF A;  3ITB A;  4NK3 A;  5GL9 A;  4GNU A;  1HZO A;  5FI6 A;  1PWC A;  2XD1 A;  3SH8 A;  1ZC2 A;  4E3L A;  3BEC A;  5EM0 A;  2M7U A;  3T4K A;  2R9X A;  3QP8 A;  4R3B A;  1FR1 A;  3BY8 A;  1GA9 A;  2QPN A;  2G2W A;  1KGG A;  4EEU A;  1MWS A;  4HJ4 A;  3IF6 C;  3NJA A;  5M19 A;  3HUN A;  4M3K A;  2FZ0 A;  4MNR A;  3E2K A;  4BQM A;  2HP6 A;  2XEP A;  4ETX A;  1ERQ A;  2QKP A;  4E6W A;  4CPK A;  5HWW A;  3UE3 A;  4X69 A;  2J9P A;  1EW0 A;  3FWL A;  1D1J A;  4QU3 A;  4X68 A;  1H0M A;  2VX8 A;  3VP4 A;  2B5R A;  3EQV A;  2X01 A;  3IX8 A;  4UHU A;  1FIL A;  4ZJ1 A;  2INW A;  3IH8 A;  2A24 B;  3EWK A;  3TE8 A;  1T1A A;  2ZC7 A;  3QNC A;  3OPP A;  4XUX A;  2Y2J A;  3F1N B;  3GTC A;  2HDU A;  2H0T A;  2XA7 M;  2PYR A;  3NEC A;  5FQK A;  4CQH A;  3BJN A;  2JE5 A;  2G7U A;  3L9K A;  4JXS A;  4OLG A;  1MKM A;  4WYY A;  3G34 A;  3MS6 A;  1L0D A;  3ITA A;  3T4T A;  2C6W B;  4OQG A;  3EGX C;  4KZ7 A;  1OTI A;  3T1S A;  3LIB A;  3S4X A;  1JWP A;  4XXR A;  3TJZ C;  4DDY A;  2HDR A;  1U60 A;  4EBN A;  5J7E A;  2QWS A;  1G6A A;  4FCF A;  3ZVT A;  3CWF A;  3VE4 A;  5FA7 A;  4I39 A;  3KSG A;  4E3I A;  2ZQ7 A;  2A24 A;  5FQ9 A;  1FQG A;  5HL6 A;  4P6Z M;  3OPL A;  5HPF A;  1JTD A;  2ZMA A;  3F1N A;  1EWZ A;  4Q0H A;  1H8Y A;  3LI8 A;  2Y2Q A;  5CGS A;  2WGI A;  4QD4 A;  4HH2 A;  3WWX A;  1OT6 A;  2J7V A;  1I2W A;  1IYO A;  1Z09 A;  5FEG A;  3EGD C;  4LRZ E;  4S2J A;  1BSG A;  1BT5 A;  3SS3 A;  3VP2 A;  4C3Q A;  1VEU B;  1JNU A;  1K6S A;  3MFD A;  1KE4 A;  5DF8 A;  1HD8 A;  4EQI A;  2VZW A;  3OLO A;  1XA7 A;  4IBR A;  3U2A A;  4MN7 A;  2ZC4 B;  5EVL A;  1SDE A;  4I38 A;  1G5U A;  1E25 A;  1IYS A;  1NXY A;  3LR5 A;  3V5M A;  3UB6 A;  3WS0 A;  4OKP A;  3IQA A;  4MMN A;  4X56 A;  3N7W A;  1ONH A;  3G30 A;  1MBL A;  1YAX A;  2O9A A;  3TW8 A;  4LV0 A;  4QY6 A;  4FD8 A;  3S22 A;  5HWT A;  3ZQ5 A;  1KOU A;  1W63 M;  2VEA A;  1WYB A;  5CTM A;  4WZ5 C;  3BWL A;  4ESP A;  1WA9 A;  1PIO A;  3B3X A;  1Q2Q A;  1LSX A;  1VEU A;  2P04 A;  1E4D A;  4U0T A;  2P74 A;  4LRY C;  4QHC A;  2KOI A;  1XXM A;  1YLZ A;  4P0M A;  5KSC A;  1P0Z A;  4EBP A;  3MXQ A;  3CG5 A;  3NHQ A;  1BLP A;  4E6X A;  4HJ3 A;  3E4Q A;  1DP8 A;  5AQB A;  1W5D A;  4RA7 A;  5DVA A;  4A5R A;  3B47 A;  4HIA A;  1YMX A;  1TD5 A;  1RP5 A;  3IXB A;  4O01 A;  4EQ1 A;  3C30 A;  4LRX C;  4Y5F A;  5IHV A;  1P9R A;  4EUV A;  3DWZ A;  1NZO A;  4KQQ A;  3K3C A;  4LFU A;  4WEK A;  5DJT A;  3E2L A;  4OQH A;  4RVA A;  3RH8 B;  4CLC D;  4YWZ A;  1M6K A;  2V20 A;  2WKI A;  3PBQ A;  5IT5 A;  5EUA A;  4YNR A;  3FC7 A;  4U3T A;  1DP6 A;  4IUK A;  3MQ0 A;  3UN7 A;  5IS1 A;  3C7V A;  4OPR A;  2Y91 A;  1FOF A;  4S2L A;  3N8S A;  3OPR A;  3PTE A;  4U0X A;  2I72 A;  2XQZ A;  4OPQ A;  2QZ6 A;  3MQQ A;  3UDX A;  1K54 A;  1S4S A;  4I5S A;  2JKT M;  3A3E A;  1TEM A;  1DY6 A;  4JGR A;  2OWH A;  2RCX A;  2P9V B;  3CJM A;  4LV1 A;  4Y7P A;  3UE6 A;  4DE3 A;  5KIZ A;  2Q0O A;  4GDB A;  5HAR A;  3SS4 A;  3FPW A;  1XKZ A;  4HBT A;  4BD0 A;  1BZA A;  5U47 A;  4WUJ A;  2BG1 A;  1ZHH B;  4ZJ3 A;  1T18 A;  1O7E A;  5GLC A;  3HVF A;  1Y28 A;  2DRW A;  1IOU A;  4NXF A;  1AWI A;  1W79 A;  4Y0T A;  2EFU A;  3LO7 A;  4IVI A;  3SH9 A;  3ZG5 A;  4UAA A;  1LI0 A;  2HJE A;  2Y2N A;  5CER A;  1I5Q A;  1N4O A;  1N9N A;  3V3S A;  5L09 A;  2UWX A;  5FAO A;  4HOI A;  1TF1 A;  4FOF A;  2WAD A;  3W8K A;  2P9V A;  2OAQ 1;  4ID4 A;  3D72 A;  4L9E A;  1GCE A;  4X53 A;  4GOG A;  4KZA A;  5E2F A;  1VQQ A;  2B02 A;  2D02 A;  3OBF A;  4KZ5 A;  2AVX A;  2W1R A;  1ZKJ A;  2XH9 A;  3EEA A;  2O9B A;  3IXH A;  2PAV P;  4JLF A;  3GMW A;  4DE0 A;  3ZYT A;  1TS7 A;  2H0Y A;  5FAS A;  3IH9 A;  1L0E A;  5GLB A;  5EFW A;  4P87 A;  2QYB A;  2Y55 A;  1ES2 A;  3IBJ A;  3CZD A;  2Y2O A;  1CI9 A;  4BJP A;  5HW3 A;  1K57 C;  4S2N C;  1CF0 A;  1XJ3 A;  1HLU P;  1CI8 A;  4JF5 A;  5M18 A;  1PFL A;  2CC1 A;  2WAF A;  3KYE A;  5EVI D;  3BRM A;  4LEN A;  4WMC A;  3HL9 A;  2C5W B;  2K31 A;  2PR6 A;  3T1X A;  3MKF A;  5DJU A;  4Y2F A;  2Y2P A;  1BLH A;  1HTZ A;  4ZAM A;  4S2M A;  3BFF A;  5HSQ A;  3KX0 X;  1K55 C;  4WL9 A;  4PM8 A;  4S2I A;  4FSF A;  2PT7 A;  4NKP A;  3IWQ A;  1S4R A;  3SS5 A;  1YT4 A;  1K56 A;  1LL8 A;  3TSG A;  1S6R A;  4JXV A;  3HLB A;  5TFQ A;  2R78 A;  1XJ4 A;  4EUZ A;  3S1Y A;  1BTL A;  5DFY A;  4EXO A;  5DF9 A;  1W63 Q;  5FI7 A;  1NY0 A;  1OTA A;  3IXG A;  1NJ4 A;  4JXG A;  3HLW A;  4GJ4 A;  1CEF A;  3B42 A;  3GQZ A;  3A0V A;  2Y2L A;  2XD5 A;  4OOL A;  1CJF A;  2VA0 A;  4DJ2 A;  1M40 A;  4LCL A;  4R70 A;  4IBX A;  2W3E A;  3VMA A;  3A0S A;  3OOV A;  3M6H A;  3DAV A;  1T19 A;  4GLQ A;  4IUH A;  4N9K A;  5DF7 A;  2HGV A;  3FKV A;  1Z6F A;  3BM6 A;  1IKI A;  4JBF A;  5D3O A;  2EWV A;  4DN0 A;  1ZG4 A;  4OOM A;  3T4L A;  2I9V A;  4GDN A;  3GR2 A;  3LR4 A;  2H10 A;  4RX2 A;  2CMN A;  3H82 B;  2ZOH A;  4EU0 A;  5FDH A;  4Y13 A;  3A3F A;  1KDW A;  4DRT A;  5A92 A;  1JTG A;  4DF6 A;  3E0Y A;  4MBF A;  1Y4O A;  2VGL S;  5G4Y A;  2WUQ A;  2JKR I;  3CAX A;  1YLJ A;  2FFF B;  1FSW A;  4IVK A;  3R7W B;  4R1G A;  2ZQ9 A;  3G31 A;  3RFB A;  2M7V A;  3NBL A;  3JYI A;  4OOY A;  2RL3 A;  3PBS A;  3KO6 A;  1IEM A;  3SOI A;  1JVJ A;  3NOT C;  4RYE A;  5HWV A;  4KG2 A;  3WRZ A;  1QMF A;  1ONG A;  2EX8 A;  1D06 A;  5J8X A;  1OT9 A;  4OON A;  4P85 A;  4P6B A;  1S1Y A;  1XGI A;  3M2J A;  4JKT A;  3H82 A;  1E3U D;  1GA0 A;  4DXB A;  3P01 A;  5EOO A;  3EOI A;  3OPH A;  3DTE A;  5HAI A;  3Q82 A;  2L4R A;  3A3I A;  4ETZ A;  2G2U A;  1LT0 A;  1YKD A;  4GD6 A;  1PW1 A;  2BLS A;  2HZ5 A;  5E43 A;  2WKR A;  2VK3 A;  2YKF A;  3C5A A;  1FR6 A;  3IHB A;  4B9O A;  4GW9 A;  4JGO A;  2PRF A;  4S2N A;  4OH0 A;  4E3K A;  2V1Z A;  3KSF A;  3MKE A;  3PAE A;  3UB8 A;  4PKY G;  2WKP A;  4JF6 A;  3UE1 A;  4KZB A;  2VGL M;  2DNS A;  1WE4 A;  4HEF A;  5HAP A;  4L9F A;  4ZDX A;  4MDZ A;  3ZG7 B;  4O8G A;  1J9M A;  5BOH A;  2EA9 A;  2ZC5 B;  2EFX A;  2ZQ8 A;  5M1A A;  1K25 A;  1NWZ A;  1TVF A;  2K7S A;  5KSH A;  4X1M A;  3V67 A;  3LIC A;  3LIF A;  5I5L A;  3FG8 A;  1K55 A;  3CLO A;  4B4X A;  2JKF A;  5FAP A;  3LI9 A;  5TGF A;  4KG5 A;  4QB8 A;  3BLM A;  3BY9 A;  3LIE A;  5DKL A;  1MPL A;  2J3T C;  5FAQ A;  2E8I A;  1P97 A;  3UMD A;  2L1M A;  4K91 A;  1RGZ A;  3GEC A;  3CUE C;  4UQI S;  2WK0 A;  3D9Y A;  2ZBB A;  4NEE D;  3ZG0 A;  4S2K A;  3AGF A;  5F69 A;  1L2S A;  1UWN X;  4DE1 A;  1FSY A;  1W8Q A;  2PBY A;  2ZMF A;  3IX4 A;  3IX3 A;  5DKK A;  1PRQ A;  2J3W A;  5I94 A;  3FPV A;  1PZO A;  2ZD8 A;  1XP4 A;  3HUO A;  3C7U A;  1STZ A;  5MC7 A;  4QWO A;  1IEL A;  3IS2 B;  3PAG A;  5HX9 A;  2PHY A;  5L8M A;  4OLD A;  4RQ9 A;  2Y59 A;  2Z2L B;  2X71 A;  3ISG A;  3VFF A;  3P09 A;  5E2G A;  1OTD A;  4WZ4 A;  3P7N A;  5EOE A;  4HHD A;  5CTN A;  2FFY A;  3CPT B;  2WZX A;  1XJ2 A;  3IF6 B;  3O3V A;  3SZT A;  5HPI A;  1YMS A;  4QY5 A;  2VJW A;  3KSH A;  1ESI A;  3IWO A;  3WS5 A;  2VV7 A;  4G3W A;  3UB9 A;  1LL5 A;  4LV3 A;  3GV9 A;  3MXR A;  4F3L B;  3S7Q A;  1S66 L;  5DTK A;  3UPP A;  4HJ6 A;  1RGY A;  2V1A A;  3IS2 A;  4IHQ A;  3MFX A;  2IA2 A;  1SHV A;  2EWW A;  1MXO A;  4HH3 A;  5CXW A;  5AQ9 A;  3VOZ A;  3K2N A;  1KVM A;  1AXB A;  1UWP X;  2PU2 A;  1F2K A;  1ACF A;  4ARZ B;  4WBG A;  1S67 L;  1DJB A;  2WGV A;  3BQ8 A;  1OTB A;  2OWJ A;  4UQI M;  4KZ3 A;  3UE0 A;  3CPT A;  3IF6 A;  5HZH A;  3VOL A;  4B93 A;  1MC0 A;  5CEB A;  3RJU A;  2ZQA A;  2X02 A;  3M2K A;  4HES A;  3V39 A;  4F3L A;  1LL9 A;  1P9W A;  3T50 A;  3Q7Z A;  2J8Y A;  4S2O A;  1BUL A;  4ME4 A;  4R23 A;  2O0Y A;  3E4P A;  2XFT A;  4K0W A;  2OAP 1;  4PM7 A;  4O7D A;  1PWD A;  3W2Z A;  1T1B A;  3ICY A;  3O5Y A;  4X55 A;  5AQ7 A;  3MF0 A;  3M6B A;  1XJ6 A;  1G6O A;  4ARZ A;  1NYY A;  3NY4 A;  3LGO A;  1JWV A;  3RXW A;  1KE3 A;  2VKS A;  1SKF A;  1VM1 A;  1BUE A;  2HV1 A;  4QPR A;  1YPR A;  1IYP A;  2JHE A;  2QMI A;  1K6R A;  2IWB A;  3PBT A;  4BLM A;  1MWU A;  2ZM0 A;  2OLU A;  2ACG A;  2WKE A;  1GHM A;  3Q7V B;  3LY4 A;  3JVV A;  3BFE A;  1XFN A;  3SH7 A;  3QNB A;  4EER A;  4O0P A;  4H6J B;  2W3G A;  1OJG A;  2W3F A;  4BBV A;  2Z2M B;  4DXC A;  1YSQ A;  5G18 A;  5EVE A;  3W4O A;  4WN5 A;  3DWK A;  4EES A;  5HD5 A;  3UME A;  3NOP C;  2WZZ A;  2ZLY A;  3UO9 A;  1Q2P A;  3NCK A;  2UV0 E;  1H3Q A;  4CLC E;  2ZM8 A;  2GNX A;  1G28 A;  5A90 A;  3Q7V A;  3VE3 A;  1PZP A;  2HDQ A;  2EX9 A;  3UPO A;  3B33 A;  3CIT A;  4ZBE A;  2PU4 A;  3JPU A;  1PI5 A;  4PMA A;  3NUL A;  4EWF A;  5KMW A;  3GSG A;  4H6J A;  4MEZ A;  2VGJ A;  5GHY A;  4E04 A;  4OP5 A;  3E4O A;  4UEY A;  3FKW A;  3I7J A;  3OZH A;  5F5Y A;  3LR0 A;  1HVB A;  3QP5 A;  2H5S A;  4MLL A;  4D60 A;  5E2E A;  3ZNT A;  3JVU A;  3Q1F A;  2V0U A;  2JBF A;  2ZL1 B;  4WZ5 A;  2V8C A;  2GDN A;  3Q81 A;  4Y0O A;  3T4S A;  3MQO A;  1PYY A;  1SKO B;  1YLP A;  3OCN A;  3A0R A;  5KZH A;  5F1G A;  1CEG A;  4YOF A;  1FCN A;  3WS4 A;  1ES5 A;  4KG6 A;  5F1F A;  1NYM A;  2WKQ A;  2EXA A;  3L7H A;  2HF6 A;  2PD8 A;  4PM9 A;  1YLW A;  2XLN A;  4OPY A;  1OTE A;  4CLC C;  1SCW A;  1XGJ A;  2Y2M A;  1LSW A;  3H9W A;  3MSH A;  2ZOI A;  3PBO A;  4HNB A;  3G2Z A;  1N9L A;  2JKR M;  3CI6 A;  3IT9 A;  3MBZ A;  3O86 A;  3IXD A;  3O87 A;  1MKI A;  4WMC D;  4HP9 A;  3EQU A;  4I3J A;  3VP3 A;  3ZG9 B;  4YIN A;  2GX5 A;  1IFQ A;  5L07 A;  3ZNY A;  3F1P B;  4OP8 A;  1SKO A;  2ZQD A;  3QP6 A;  5A8B A;  1T1C A;  2NUP C;  1G68 A;  1FCM A;  2Y2G A;  4HY8 A;  4LV2 A;  5GHX A;  3PR6 A;  2GZA A;  2Y2H A;  2LB9 A;  1PW8 A;  3ZVW A;  3LUQ A;  4E3O A;  4BL2 A;  3G32 A;  4WEJ A;  5GHZ A;  2B95 A;  2ZC3 B;  1K56 D;  2VGK A;  4DMZ A;  3NDE A;  5CX7 A;  2VV6 A;  5L10 A;  3GRJ A;  1OPX A;  1YLT A;  3HUM A;  4L0L A;  4I3A A;  1CQA A;  2V0W A;  3D3O A;  1VET B;  4JF4 A;  4JXW A;  5CHJ A;  3F1P A;  2WGW B;  2EX2 A;  3F1O B;  3PHY A;  3FZC A;  3HLF A;  2OV5 A;  3VSL A;  2HDS A;  5TJJ A;  3BFG A;  4Y3I A;  3U4L P;  2W27 A;  3BFD A;  1TS0 A;  3BQA A;  2L0W A;  3NOU C;  4N9L A;  4HP4 A;  4P6Z S;  3UDF A;  1QME A;  2OOL A;  2Y8H A;  1KVL A;  3N6I A;  1NLZ A;  4GD8 A;  4MBH A;  3LFV A;  4XT2 B;  4E3J A;  1K54 C;  3ZDJ A;  4AFI A;  5A93 A;  2Z6D A;  3UB7 A;  4II7 A;  3G2Y A;  3P98 A;  3VOY A;  1TDG A;  4PHT A;  2YKH A;  2M1C A;  4B4Z A;  1VET A;  3PBN A;  2WYX A;  3R7W A;  2WGW A;  3N8R A;  5EPH A;  3NDG A;  3F1O A;  3AGE A;  3UPN A;  4KQR A;  1ESU A;  3NC8 A;  5EVI C;  3RXX A;  4CJN A;  3AGD A;  3ZGA B;  5HDS A;  4Q0I A;  2E8J A;  2PDR A;  2XDM A;  5LBR A;  2NUT C;  4KZ8 A;  1YLY A;  1VB6 A;  3C4P A;  5GLA A;  1MZU A;  5EE8 A;  3KYZ A;  4IJG A;  4XT2 A;  5K5B A;  1K57 A;  4Y17 A;  1S1Z A;  2XR0 A;  4M4X A;  2A3U A;  3LCE A;  1TS6 A;  4PM6 A;  4DJ3 A;  1VHM A;  2V1B A;  1KGE A;  2HP9 A;  3LYX A;  2MJ6 A;  2XF3 A;  1J3W A;  5G4Z A;  4N92 A;  2W0N A;  4JGP A;  3S7O A;  1IYQ A;  4GHI B;  2A2L A;  4GKU A;  4HI4 A;  4CLC B;  5FEF A;  4GS9 B;  3TOI A;  4X6T A;  1FIK A;  2JC7 A;  3IBR A;  3WS1 A;  1DRM A;  5CEC A;  2EX6 A;  4NG2 A;  4B88 A;  3VSK A;  1CK3 A;  1N9O A;  1YQS A;  4BMW A;  2BTF P;  4WF0 A;  1N9B A;  5FQJ A;  1JWZ A;  3IHA A;  3ZHH A;  3MZF A;  4N1H A;  3BEB A;  1MY8 A;  2EXB A;  2P7J A;  5DTT A;  2DMW A;  4BEN A;  3NIA A;  1ES3 A;  4HBU A;  3C8C A;  4UA6 A;  3MZD A;  4KUK A;  5DFX A;  5J3W A;  2GJ3 A;  5FDS A;  4Y15 A;  1OJ5 A;  2QJ5 A;  3BFC A;  2J80 A;  2DCF A;  2BAS A;  4GN2 A;  1GHI A;  4DKI A;  4YFM A;  4GHI A;  2JN7 A;  1H5X A;  4CLC A;  4GS9 A;  3VV4 A;  3BYD A;  4C6Y A;  2OSU A;  4R3A A;  3C4O A;  3HBR A;  1L0F A;  3UY6 A;  3ZFZ A;  1V9Z A;  2LB5 A;  4BD1 A;  2XRO A;  3C38 A;  4KEN B;  5CHM A;  4IED A;  2Y4A A;  4KQO A;  4OQI A;  4PKY A;  3LID A;  5HDC A;  1GSW A;  4EV4 A;  1GHP A;  4G3K A;  2Q9M A;  2KX6 A;  2XK1 A;  4HQA A;  3MZE A;  2HP5 A;  1S0W A;  4PAU A;  3V50 A;  2HJ9 C;  2ZC6 B;  4WM9 A;  1KDS A;  4R0Q A;  3C2W A;  5TBM B;  3HJK A;  3W4P A;  1RCJ A;  1F98 A;  3DTM A;  2ZMV A;  2ZM2 A;  3MR0 A;  3VFH A;  3R4K A;  4XUZ A;  5HFO A;  4EET B;  5FI2 A;  2W1T B;  4R38 A;  5JYO A;  2A49 A;  3LIA A;  3S7P A;  3ULF A;  4MN5 A;  4K08 A;  2Q9N A;  5HDD A;  4WLA A;  1NZU A;  1K38 A;  4BL3 A;  2V9A A;  4KZ6 A;  4LPZ A;  4GCZ A;  5A91 A;  3UNW A;  2XSS A;  1A0K A;  5CHU A;  4H8R A;  5AVE A;  3G6O A;  1EI5 A;  4LCM A;  3A3J A;  2K2N A;  2QJ7 A;  3T4J A;  3H7W B;  3LY3 A;  1K0K A;  5TBM A;  1MWT A;  4UA9 A;  5EVI B;  5JYP A;  3WS2 A;  3WRT A;  1MWR A;  4S2P A;  4NET A;  5L2F A;  1H8M A;  1ODV A;  2PBD P;  1XPB A;  3HRE A;  4KZ4 A;  5C5K A;  1L0G A;  2W1T A;  4FH2 A;  1O07 A;  3T1R A;  4MBK A;  2IWC A;  2WAE A;  2J9O A;  4Q0J A;  4NXE A;  4Y0U A;  4NXG A;  3HJI A;  5FSR A;  1NRJ A;  3HLE A;  3BW6 A;  4R4R A;  2IWD A;  1W7F A;  3CHW P;  4OPZ A;  2VLG A;  3MXS A;  2ZJ9 A;  3DBA A;  1V9Y A;  3PBR A;  3TG9 A;  1BLS A;  3GDI A;  3LEQ A;  1WYC A;  3LR3 A;  5AVF A;  5AJG A;  1LLB A;  3H7W A;  5EVI A;  5CRF A;  1ZTU A;  4BBU A;  5J4E A;  3CMZ A;  5FQM A;  4Q8I A;  4PPR A;  3A3D A;  1TS8 A;  4FUW A;  3UDI A;  2PYP A;  1KGF A;  4WEL A;  1K4F A;  1GSV A;  2Y2K A;  4X1L A;  4ZTK A;  2OLV A;  3QP1 A;  4EEP A;  1XA1 A;  2B18 A;  2Y79 A;  5E2H A;  3IF5 A;  4Z1W A;  3QP2 A;  4KZ9 A;  2JKT I;  5HAQ A;  1W8Y A;  2KLI A;  4FH4 A;  3HCY A;  3O88 A;  1ALQ A;  3V3R A;  5AQA A;  1BLC A;  3DTI A;  4KUO A;  4NXB A;  1ERM A;  4ZJ2 A;  1C3B A;  1ERO A;  3T1Q B;  2XFS A;  3T4Q A;  4F94 A;  1I2S A;  3RTY A;  4K0X A;  1LSV A;  1BYW A;  3MJQ A;  4BBT A;  2D01 A;  3T12 B;  5GLD A;  3Q07 A;  4N1X A;  3KYQ A;  1NLY A;  1ZG6 A;  1UGU A;  1H8Z A;  2QHK A;  3NI9 A;  2KDK A;  2PR5 A;  2WKH A;  2XGN A;  2Z6C A;  5F6A A;  1FCO A;  1LHY A;  3QHY A;  3VP0 A;  3HLC A;  1LI9 A;  3CUE A;  5F82 A;  5F83 A;  3UB5 P;  3E98 A;  4D2O A;  3G4P A;  5CED A;  3W4Q A;  4X25 A;  1OME A;  4EW7 A;  4GZB A;  2XRN A;  3OC2 A;  3D4F A;  5CGW A;  4G3V A;  1DJC A;  2R9W A;  1K4E A;  1XFQ A;  2HPB A;  1ES4 A;  2VV8 A;  3KSI A;  2JCH A;  2PD7 A;  4RX3 A;  2H28 A;  4UA7 A;  3N4I A;  4Z9Q A;  4R4S A;  3OCL A;  4DE2 A;  4LLO B;  3PYP A;  4MCW A;  5FQI A;  2V8F A;  4KQD A;  4I3I A;  1DJA A;  3LEZ A;  4OVD A;  5CGX A;  2W3H A;  1X0O A;  1XX2 A;  3GVB A;  3G35 A;  3QP4 A;  3SW1 A; 
#chains in the Genus database with same CATH homology
 1LI0 A;  3ZG8 B;  2WGW A;  3N8R A;  1YM1 A;  2Y2N A;  3NDG A;  5EPH A;  1I5Q A;  1N4O A;  4OLD A;  5CER A;  3AGE A;  3V3S A;  3UPN A;  2UWX A;  4GB7 A;  4KQR A;  5DTS A;  2Y59 A;  5FAO A;  2Z2L B;  2X71 A;  3ISG A;  3VFF A;  3P09 A;  1Y54 A;  5E2G A;  1ESU A;  3NC8 A;  5FAT A;  4WZ4 A;  2WAD A;  5EVI C;  2Y2I A;  5EOE A;  3RXX A;  5CTN A;  3W8K A;  3AGD A;  2P9V A;  4CJN A;  2FFY A;  3ZGA B;  1IKG A;  2ZQC A;  3N8L A;  4ID4 A;  2WZX A;  3IF6 B;  2XDM A;  1SDN A;  3O3V A;  1YMS A;  4KZ8 A;  4QY5 A;  1YLY A;  1ESI A;  3C4P A;  4PM5 A;  3IWO A;  1GCE A;  4X53 A;  3WS5 A;  4GOG A;  5GLA A;  4KZA A;  5E2F A;  5EE8 A;  1VQQ A;  1K57 A;  1LL5 A;  4KZ5 A;  3FYZ A;  4LV3 A;  1ZKJ A;  1TDL A;  2XH9 A;  3GV9 A;  3MXR A;  3HLD A;  3IXH A;  2XR0 A;  3IWI A;  1PWG A;  4JLF A;  4R3J A;  5TR7 A;  1E3U A;  4OQ0 A;  5DTK A;  2A3U A;  3UPP A;  4JPM A;  3GMW A;  3LCE A;  4PM6 A;  4DE0 A;  1RGY A;  1KGE A;  2HP9 A;  4E3N A;  2H0Y A;  5FAS A;  1SHV A;  1MXO A;  3IH9 A;  3DW0 A;  5CXW A;  3FV7 A;  1L0E A;  4EBL A;  5AQ9 A;  3VOZ A;  5GLB A;  2XF3 A;  1KVM A;  5FQQ A;  1AXB A;  2PU2 A;  4P87 A;  1PI4 A;  4N92 A;  2Y55 A;  1ES2 A;  1IYQ A;  2Y2O A;  1CI9 A;  3CZD A;  4GKU A;  4BJP A;  4C75 A;  5HW3 A;  1K57 C;  4WBG A;  3ZCZ A;  4QJG A;  3TOI A;  4S2N C;  1DJB A;  2WGV A;  3HLG A;  4X6T A;  5HL1 A;  2JC7 A;  3WS1 A;  5CEC A;  2EX6 A;  4B88 A;  3VSK A;  1CK3 A;  1CI8 A;  1YQS A;  4JF5 A;  4DDS A;  4KZ3 A;  3UE0 A;  3BLS A;  5M18 A;  1KE0 A;  1N9B A;  5FQJ A;  1JWZ A;  3IHA A;  2CC1 A;  2WAF A;  2V2F F;  3ZHH A;  3MZF A;  3IF6 A;  5EEC A;  5EVI D;  3BRM A;  4LEN A;  4WMC A;  4E3M A;  4N1H A;  3BEB A;  5CEB A;  3VP1 A;  1MY8 A;  1NRF A;  3ITB A;  4NK3 A;  5GL9 A;  2EXB A;  4GNU A;  3RJU A;  1HZO A;  3HL9 A;  2C5W B;  1PWC A;  2ZQA A;  2XD1 A;  5DTT A;  5FI6 A;  2X02 A;  3M2K A;  4HES A;  4BEN A;  3SH8 A;  3V39 A;  3NIA A;  1ES3 A;  4HBU A;  1ZC2 A;  4E3L A;  3BEC A;  1LL9 A;  3MKF A;  3Q7Z A;  2J8Y A;  4S2O A;  1BUL A;  2R9X A;  4R23 A;  4UA6 A;  3MZD A;  1FR1 A;  2Y2P A;  4K0W A;  2XFT A;  4R3B A;  1BLH A;  4PM7 A;  4O7D A;  1HTZ A;  1PWD A;  4ZAM A;  1GA9 A;  2QPN A;  2G2W A;  4S2M A;  1KGG A;  3BFF A;  4X55 A;  1MWS A;  1K55 C;  4PM8 A;  4S2I A;  4FSF A;  5AQ7 A;  3IF6 C;  3BFC A;  2DCF A;  4GN2 A;  3M6B A;  1GHI A;  4DKI A;  4YFM A;  5M19 A;  3HUN A;  1H5X A;  4M3K A;  3IWQ A;  1NYY A;  3NY4 A;  4MNR A;  3E2K A;  4BQM A;  1JWV A;  1YT4 A;  1K56 A;  3BYD A;  2HP6 A;  3SS5 A;  4C6Y A;  2XEP A;  1ERQ A;  2OSU A;  3RXW A;  4E6W A;  4CPK A;  3UE3 A;  4X69 A;  2J9P A;  3FWL A;  4QU3 A;  3TSG A;  3C4O A;  1KE3 A;  3HBR A;  4X68 A;  1L0F A;  1S6R A;  3UY6 A;  1SKF A;  4JXV A;  3ZFZ A;  1VM1 A;  1BUE A;  3HLB A;  3VP4 A;  2B5R A;  5TFQ A;  4BD1 A;  4EUZ A;  3EQV A;  1IYP A;  4KEN B;  2X01 A;  3S1Y A;  5CHM A;  4IED A;  1BTL A;  4UHU A;  2QMI A;  2Y4A A;  4KQO A;  4OQI A;  5DF9 A;  4ZJ1 A;  3IH8 A;  1K6R A;  2IWB A;  3PBT A;  5FI7 A;  4BLM A;  4EV4 A;  1NY0 A;  3IXG A;  2ZC7 A;  1MWU A;  1NJ4 A;  1GHP A;  3QNC A;  4JXG A;  3OPP A;  2Q9M A;  2ZM0 A;  3HLW A;  4XUX A;  2OLU A;  2WKE A;  2Y2J A;  2XK1 A;  1GHM A;  3Q7V B;  1CEF A;  3LY4 A;  3MZE A;  3GTC A;  2HDU A;  3GQZ A;  2H0T A;  2HP5 A;  1S0W A;  3BFE A;  5FQK A;  3V50 A;  3SH7 A;  2Y2L A;  2JE5 A;  2ZC6 B;  1KDS A;  4WM9 A;  4R0Q A;  2XD5 A;  4JXS A;  4OLG A;  4OOL A;  3QNB A;  3W4P A;  4WYY A;  1RCJ A;  1M40 A;  3G34 A;  4LCL A;  1L0D A;  3DTM A;  2ZM2 A;  3ITA A;  4IBX A;  3VFH A;  2C6W B;  4OQG A;  4XUZ A;  3VMA A;  4KZ7 A;  5HFO A;  2Z2M B;  3S4X A;  1JWP A;  4XXR A;  5FI2 A;  4DDY A;  4DXC A;  2HDR A;  3M6H A;  5G18 A;  5JYO A;  1U60 A;  3W4O A;  4N9K A;  5DF7 A;  2A49 A;  3DWK A;  4EBN A;  1G6A A;  3FKV A;  4FCF A;  1Z6F A;  2Q9N A;  3BM6 A;  1IKI A;  4JBF A;  3ZVT A;  5D3O A;  2WZZ A;  5FA7 A;  1NZU A;  1ZG4 A;  2ZLY A;  3UO9 A;  4OOM A;  1K38 A;  4BL3 A;  4E3I A;  1Q2P A;  2ZQ7 A;  4KZ6 A;  3NCK A;  5FQ9 A;  5A91 A;  3UNW A;  1FQG A;  2ZM8 A;  3OPL A;  4GDN A;  3GR2 A;  5CHU A;  4H8R A;  2H10 A;  1JTD A;  4RX2 A;  5A90 A;  1EI5 A;  2ZMA A;  3A3J A;  4LCM A;  1EWZ A;  3Q7V A;  1H8Y A;  1PZP A;  3LY3 A;  2HDQ A;  2EX9 A;  2Y2Q A;  5CGS A;  5FDH A;  2WGI A;  4QD4 A;  3UPO A;  1MWT A;  4UA9 A;  5EVI B;  5JYP A;  4ZBE A;  3A3F A;  2PU4 A;  1KDW A;  4DRT A;  5A92 A;  3WWX A;  1PI5 A;  4PMA A;  1JTG A;  4EWF A;  4DF6 A;  2J7V A;  5KMW A;  3GSG A;  4MBF A;  3WS2 A;  3WRT A;  1MWR A;  1I2W A;  1IYO A;  2WUQ A;  4S2P A;  4NET A;  4MEZ A;  1YLJ A;  2VGJ A;  2FFF B;  5GHY A;  5L2F A;  1FSW A;  4S2J A;  1BSG A;  1BT5 A;  4IVK A;  3SS3 A;  3VP2 A;  1XPB A;  3HRE A;  4KZ4 A;  4C3Q A;  4OP5 A;  4R1G A;  1L0G A;  3FKW A;  3I7J A;  2ZQ9 A;  1O07 A;  1K6S A;  3OZH A;  4FH2 A;  3MFD A;  4MBK A;  3G31 A;  1HVB A;  2IWC A;  2WAE A;  2J9O A;  4Y0U A;  5FSR A;  3NBL A;  1KE4 A;  5DF8 A;  2H5S A;  3JYI A;  4MLL A;  1HD8 A;  4EQI A;  4OOY A;  2RL3 A;  3PBS A;  5E2E A;  3ZNT A;  1IEM A;  1XA7 A;  3HLE A;  4IBR A;  1JVJ A;  3SOI A;  4R4R A;  2ZC4 B;  3Q1F A;  5EVL A;  2JBF A;  2IWD A;  1SDE A;  1W7F A;  4OPZ A;  4RYE A;  4WZ5 A;  3MXS A;  4KG2 A;  1E25 A;  2GDN A;  3WRZ A;  2ZJ9 A;  1IYS A;  1NXY A;  3Q81 A;  1QMF A;  3PBR A;  4Y0O A;  3TG9 A;  3V5M A;  1BLS A;  1ONG A;  1PYY A;  2EX8 A;  1YLP A;  5J8X A;  1WYC A;  3OCN A;  4OON A;  4P85 A;  3WS0 A;  4P6B A;  4OKP A;  5KZH A;  1XGI A;  1CEG A;  5F1G A;  3IQA A;  3M2J A;  1FCN A;  4JKT A;  1LLB A;  1E3U D;  3WS4 A;  1GA0 A;  4X56 A;  1ES5 A;  3N7W A;  1ONH A;  3G30 A;  4DXB A;  4KG6 A;  5F1F A;  1MBL A;  1NYM A;  5EOO A;  5EVI A;  2EXA A;  3OPH A;  5CRF A;  4LV0 A;  3CMZ A;  4QY6 A;  5FQM A;  4Q8I A;  4FD8 A;  4PM9 A;  3S22 A;  1YLW A;  2XLN A;  4PPR A;  4OPY A;  3Q82 A;  5HAI A;  3A3D A;  3A3I A;  1SCW A;  1WYB A;  5CTM A;  4WZ5 C;  1XGJ A;  2Y2M A;  3UDI A;  1KGF A;  1PIO A;  4WEL A;  1K4F A;  3PBO A;  3B3X A;  1Q2Q A;  3G2Z A;  2Y2K A;  1E4D A;  4ZTK A;  4U0T A;  2G2U A;  2OLV A;  2P74 A;  4QHC A;  1XXM A;  3MBZ A;  4GD6 A;  3IT9 A;  1PW1 A;  3O86 A;  1XA1 A;  1YLZ A;  2BLS A;  4P0M A;  3IXD A;  5E43 A;  5E2H A;  5KSC A;  4EBP A;  3IF5 A;  3CG5 A;  3O87 A;  1MKI A;  4WMC D;  3EQU A;  4KZ9 A;  3VP3 A;  1BLP A;  1W8Y A;  3ZG9 B;  4E6X A;  4YIN A;  4FH4 A;  5HAQ A;  3O88 A;  1ALQ A;  3V3R A;  5AQA A;  3ZNY A;  1BLC A;  4OP8 A;  5AQB A;  1W5D A;  2ZQD A;  3C5A A;  4RA7 A;  1FR6 A;  3IHB A;  1ERM A;  4ZJ2 A;  5DVA A;  1G68 A;  1C3B A;  1ERO A;  1FCM A;  2Y2G A;  4A5R A;  2XFS A;  4S2N A;  4OH0 A;  1YMX A;  4E3K A;  4F94 A;  1I2S A;  1RP5 A;  4LV2 A;  5GHX A;  4K0X A;  2V1Z A;  3IXB A;  2Y2H A;  3MKE A;  3PAE A;  5IHV A;  3DWZ A;  1NZO A;  4KQQ A;  5GLD A;  4JF6 A;  3UE1 A;  3Q07 A;  1PW8 A;  4KZB A;  4N1X A;  3ZVW A;  2DNS A;  1WE4 A;  1ZG6 A;  4E3O A;  4WEK A;  4BL2 A;  3G32 A;  1H8Z A;  4HEF A;  5HAP A;  4ZDX A;  3E2L A;  3NI9 A;  3ZG7 B;  1J9M A;  2WKH A;  2ZC5 B;  4OQH A;  4RVA A;  5BOH A;  2EFX A;  2XGN A;  4WEJ A;  2ZQ8 A;  5M1A A;  1M6K A;  2V20 A;  5GHZ A;  1K25 A;  2WKI A;  2ZC3 B;  3PBQ A;  1TVF A;  1K56 D;  5EUA A;  1FCO A;  2VGK A;  1LHY A;  3QHY A;  5KSH A;  4U3T A;  3VP0 A;  3HLC A;  1LI9 A;  3UN7 A;  3NDE A;  3C7V A;  5F82 A;  3GRJ A;  4OPR A;  1YLT A;  2Y91 A;  5F83 A;  3HUM A;  4L0L A;  1FOF A;  4D2O A;  4S2L A;  3N8S A;  3OPR A;  3PTE A;  4U0X A;  2I72 A;  2XQZ A;  3G4P A;  4OPQ A;  1K55 A;  2QZ6 A;  5CED A;  3W4Q A;  4JF4 A;  1OME A;  4JXW A;  5CHJ A;  2WGW B;  1K54 A;  2EX2 A;  3UDX A;  4GZB A;  4B4X A;  3FZC A;  3HLF A;  3OC2 A;  5FAP A;  3D4F A;  5CGW A;  5TGF A;  2OV5 A;  4KG5 A;  4QB8 A;  3VSL A;  3BLM A;  2HDS A;  1DJC A;  2R9W A;  3BFG A;  1MPL A;  3A3E A;  1TEM A;  1K4E A;  1DY6 A;  5FAQ A;  2HPB A;  1ES4 A;  2E8I A;  3BFD A;  4N9L A;  4K91 A;  2JCH A;  1RGZ A;  2RCX A;  2P9V B;  4RX3 A;  3CJM A;  4LV1 A;  1QME A;  3UDF A;  4Y7P A;  2WK0 A;  4DE3 A;  4UA7 A;  1KVL A;  3N4I A;  3N6I A;  4Z9Q A;  3ZG0 A;  4R4S A;  3AGF A;  4S2K A;  5HX9 A;  4GDB A;  5HAR A;  3SS4 A;  1L2S A;  4GD8 A;  4MBH A;  3OCL A;  4DE2 A;  1XKZ A;  4HBT A;  4BD0 A;  1BZA A;  4DE1 A;  1FSY A;  5U47 A;  2PBY A;  1W8Q A;  5FQI A;  4E3J A;  2BG1 A;  1K54 C;  3ZDJ A;  5A93 A;  4ZJ3 A;  5I94 A;  1O7E A;  1DJA A;  3LEZ A;  3G2Y A;  1PZO A;  4OVD A;  2ZD8 A;  5CGX A;  5GLC A;  3P98 A;  3VOY A;  1TDG A;  3HVF A;  1XP4 A;  3HUO A;  3C7U A;  2DRW A;  1W79 A;  4Y0T A;  2EFU A;  3LO7 A;  1IEL A;  1XX2 A;  3GVB A;  3PAG A;  3G35 A;  4IVI A;  4B4Z A;  3SH9 A;  3ZG5 A;  4UAA A;  3PBN A;  2WYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...