3Q7ZA

Cbap-acylated blar1 sensor domain from staphylococcus aureus
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
252
structure length
252
Chain Sequence
QSITDYNYKKPLHNDYQILDKSKIFGSNSGSFVMYSMAADAYYIYNEKESRKRYSPNSTYKIYLAMFGLDRHIINDENSRMSWNHKHYPFDAWNKEQDLNTAMQNSVNWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWMEDSLKISNLEQVIVFKNMMEQNNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIVNGKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Beta-lactamase regulatory protein BlaR1
publication title Lysine Nzeta-decarboxylation switch and activation of the beta-lactam sensor domain of BlaR1 protein of methicillin-resistant Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase regulator/antibiotic
total genus 85
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3q7zA00
4QHCA 2XR0A 5EOEA 3IQAA 4BD1A 4PM5A 3VFFA 4DXCA 4GKUA 1MWSA 4OPYA 4KZ9A 5DTTA 4BL2A 3VP3A 1PWDA 2H5SA 5GLAA 4S2MA 1ONGA 3MXRA 2JE5A 4K0WA 5E2EA 4C6YA 4S2OA 3G32A 2QPNA 2Y2MA 3IWQA 3C4PA 2B5RA 3QNCA 3IH8A 1ZG4A 4PM8A 4YINA 2BLSA 4BD0A 1SCWA 1GHPA 1MY8A 2QZ6A 3JYIA 2WGVA 1XKZA 4KZBA 4U0XA 1FSYA 3HLEA 1K25A 3ITBA 4ID4A 3N8LA 3NDEA 4KQRA 4BENA 1KE3A 4HBUA 5KSHA 1DJBA 3WWXA 1CEGA 1HD8A 3HLCA 1GA9A 2WAFA 1JWVA 2EX9A 3OPHA 3PBOA 4FCFA 3BM6A 2XFSA 4GN2A 4GOGA 4S2NC 4R1GA 5FQ9A 3SOIA 3IHBA 1ERMA 2J9OA 4KENB 2OV5A 5CRFA 3NI9A 2ZLYA 3ZG0A 3DWKA 2OSUA 2GDNA 1YLJA 4WYYA 4OP5A 2XK1A 5EVIC 3HUMA 3ZCZA 3LCEA 5TR7A 1H8YA 3BLMA 4S2PA 1TVFA 4X55A 1JWZA 1U60A 3SH9A 1W8YA 3O86A 3S1YA 2XEPA 4X69A 1ONHA 3LY3A 5E43A 3W4OA 1PWGA 4N92A 4X56A 3ZG7B 4PMAA 2ZQDA 3TSGA 3GV9A 5BOHA 1MBLA 2HPBA 1ES5A 1M40A 1SDNA 3GQZA 1BSGA 1K57A 2Y2JA 5IHVA 1MXOA 1DJCA 4E3JA 5L2FA 5AQBA 2Y2PA 3MKEA 4XUZA 4R3BA 2P9VA 1NZUA 1LL5A 3B3XA 3IXHA 1NRFA 2HDSA 3W4PA 1MWRA 1K4EA 2DNSA 4Z9QA 5TFQA 3DTMA 1YMXA 2Y55A 3GMWA 1EWZA 4B88A 3V3SA 4DE1A 2XQZA 1BZAA 3MFDA 1YLTA 3UE0A 3A3IA 5EUAA 5FQMA 5M1AA 1PW1A 1MPLA 1YLYA 4C3QA 1FCNA 1FOFA 3UN7A 2XLNA 1PW8A 4N9LA 4DRTA 4LV1A 5DTKA 1E3UA 4OPQA 1HZOA 4HESA 3ISGA 1ZG6A 1JTGA 4OONA 3FV7A 4P6BA 5A93A 2WK0A 4MBKA 4WBGA 5HAIA 1XP4A 2EFXA 3LY4A 4DE0A 1FQGA 1W5DA 2H0YA 4LV2A 2XGNA 1IYPA 3FKWA 1QMFA 3HLDA 1I2WA 4JPMA 3OZHA 5A92A 3IT9A 1PYYA 1K38A 1K6RA 1W8QA 3G35A 3GSGA 4UA9A 1KDSA 3DW0A 3Q7VB 3V5MA 4PM6A 3IHAA 5AQ9A 3O88A 1HVBA 1GHIA 3IXDA 3IWOA 4GB7A 5CHUA 3G4PA 3NY4A 3UE1A 2WKEA 1RGZA 5HFOA 1L0DA 3O87A 4KZ8A 1K57C 3NC8A 1RCJA 2J7VA 3GTCA 2ZQ9A 4B4ZA 3HBRA 3HUOA 4WM9A 5FI2A 1L0GA 1NJ4A 3NIAA 4LCLA 5JYPA 3M6HA 4JBFA 3TG9A 2WUQA 3NBLA 5F82A 4FH4A 3RXXA 1W7FA 1S0WA 5AQ7A 2Q9NA 5CTNA 3ZFZA 3PAGA 3VP1A 1FR6A 2H10A 2I72A 4RX3A 3UDFA 1XGIA 4U3TA 3SS4A 3V50A 1HTZA 1E3UD 4JXGA 4EBNA 5HL1A 3MXSA 3WS4A 4Y0UA 1NYYA 3TOIA 2BG1A 3A3DA 1XA1A 5FATA 4ZJ2A 4WEJA 1S6RA 3Q82A 2XDMA 5D3OA 1L0FA 1FSWA 3BLSA 5M18A 1KVLA 4UA6A 3HVFA 4S2KA 3FYZA 2EXBA 2ZC3B 1JVJA 2Y2HA 3P98A 2WKHA 5FQIA 2ZM2A 1ES4A 2ZC5B 1ESUA 3BFDA 4CJNA 2HP5A 1Q2PA 5F83A 1K4FA 1GA0A 2XD5A 1KVMA 4NETA 5GHZA 4OOMA 5GLDA 3EQUA 1Q2QA 2IWDA 4PM9A 4DKIA 4E3IA 5GLBA 1KE0A 2UWXA 4KQOA 4KZ7A 3SH7A 3WRTA 3S22A 4R4SA 5EE8A 3AGDA 2CC1A 1Y54A 1LI0A 2RCXA 1ZKJA 2Y4AA 3IXGA 4KZ6A 2Y2IA 3C7UA 1LI9A 4OH0A 5DF9A 4ZJ3A 1OMEA 3UNWA 3VSLA 4N1XA 1ALQA 1PZPA 1SDEA 1TDGA 3UDIA 1IEMA 3Q07A 4GD6A 1K55A 1WYBA 5EOOA 5CGWA 4EQIA 3M2KA 3BFEA 3ZNYA 2OLUA 4BQMA 3HLGA 3PBSA 4KZ5A 3E2LA 3GRJA 4YFMA 3MKFA 3BFFA 1XA7A 3G2YA 1IYOA 2Y2GA 3LO7A 3IH9A 1L2SA 4JKTA 1BULA 1G6AA 3AGFA 2EX2A 5AQAA 4E6WA 4S2LA 2R9XA 1MWTA 2C5WB 3BFGA 1XX2A 4KZAA 4LV0A 2ZQ7A 1K56D 3IXBA 2P9VB 4JF6A 4JXSA 4JXWA 2X02A 2XH9A 5FAPA 3M6BA 2Y2LA 4UAAA 1IELA 5CHMA 4A5RA 4JXVA 4OOLA 1CI9A 1BLCA 1O07A 4MBFA 2Y59A 1CI8A 4OPZA 5GLCA 4P85A 3Q81A 1TEMA 2FFFB 4LENA 1IKIA 3O3VA 3QNBA 4P87A 1K6SA 3UDXA 4MLLA 5DF7A 1L0EA 3E2KA 4EUZA 3FWLA 1ES2A 1ZC2A 3AGEA 1NY0A 2DCFA 2VGJA 1RGYA 1EROA 4IVIA 1IYQA 4CPKA 5HARA 2ZD8A 3OC2A 3G34A 3UY6A 3IF6A 4DDSA 3G2ZA 1XGJA 3HLFA 2EFUA 1ERQA 4EBLA 3IF6B 4GDBA 2HDQA 4OQIA 1VM1A 4N9KA 1WE4A 5E2FA 3MZFA 4DE3A 1NYMA 1K55C 3VOZA 5CEDA 3N8RA 1CK3A 3BYDA 4GD8A 4RA7A 3QHYA 1YMSA 4HBTA 1PWCA 3VOYA 3NCKA 1O7EA 3UE3A 3OPRA 4LV3A 1KGGA 4X68A 4UHUA 4GNUA 4PM7A 5DF8A 3PBRA 2G2WA 3W8KA 4NK3A 5FI7A 4E3MA 4ZJ1A 3PBQA 4OQGA 1N9BA 2EX6A 5KSCA 1C3BA 1EI5A 4DE2A 1QMEA 1K54A 3ZG5A 3BEBA 2ZMAA 4JF5A 2WADA 4ZBEA 4XXRA 4R23A 2XFTA 4KQQA 3Q1FA 4L0LA 1BLSA 2WGIA 1AXBA 3HL9A 2XD1A 4BLMA 3N6IA 1GCEA 1GHMA 2V2FF 4PPRA 5GHXA 3CZDA 1E4DA 3FZCA 4OQ0A 2IWCA 4EWFA 3WS5A 5FQKA 2JBFA 1ESIA 3V39A 1H8ZA 5GHYA 2HDUA 4DDYA 5J8XA 3CJMA 4IBXA 4MNRA 4OQHA 1IKGA 5CGXA 1YM1A 3A3FA 4E3LA 1XPBA 1N4OA 3WS0A 2ZC4B 4B4XA 5KZHA 1DY6A 5FAQA 3EQVA 4GZBA 4MBHA 4X53A 2E8IA 1BLHA 1ES3A 2G2UA 4P0MA 4OKPA 2EX8A 3DWZA 3N4IA 1E25A 3RJUA 4E3OA 2HP6A 3IF6C 3UO9A 3G30A 3OCNA 4WELA 1YLWA 4R3JA 4Y7PA 4IBRA 3LEZA 1K56A 4JF4A 4QD4A 4KG5A 2WKIA 3A3JA 1NXYA 3VP2A 4DXBA 1H5XA 4QU3A 3OPLA 1FR1A 2HDRA 1PI4A 5CGSA 1PZOA 3V3RA 1MWUA 3D4FA 4H8RA 3C4OA 4JLFA 4FSFA 1I5QA 2Q9MA 3UPOA 3PBTA 1XXMA 4OP8A 4ZDXA 2ZQAA 3P09A 3GR2A 3VMAA 3S4XA 4F94A 1K54C 1KGEA 5F1GA 3CMZA 2WGWA 5GL9A 4DF6A 2WGWB 4X6TA 1M6KA 4S2IA 4LCMA 2ZJ9A 5FI6A 3ZVTA 5CECA 1YT4A 3ZVWA 5M19A 3A3EA 2VGKA 2ZM0A 4C75A 2PU2A 5EVLA 3IF5A 3CG5A 2IWBA 3C7VA 4WMCD 4S2JA 2ZC6B 2Y91A 3C5AA 5EVID 4R4RA 1WYCA 4E6XA 1FCOA 2X71A 4K91A 4OVDA 4K0XA 4ZAMA 2H0TA 3ITAA 5G18A 1LHYA 4QY6A 4Q8IA 1KGFA 5FAOA 1G68A 3ZHHA 1CEFA 4U0TA 1Z6FA 5A90A 4WZ4A 3OPPA 4OPRA 1DJAA 3G31A 2C6WB 4N1HA 5KMWA 1BTLA 3ZDJA 3BRMA 3SS5A 5FSRA 4OOYA 2WZZA 3VP4A 3BECA 1NZOA 2OLVA 3UPNA 3VFHA 3N7WA 4OLGA 2WYXA 1MKIA 3Q7ZA 3UPPA 3HREA 1YLZA 4WZ5A 4KG2A 4FH2A 1RP5A 3RXWA 4E3KA 3OCLA 1SHVA 2ZQCA 4MEZA 5FASA 5I94A 2Y2NA 3PBNA 3M2JA 4O7DA 1KE4A 4ZTKA 3PTEA 2EXAA 4EV4A 4FD8A 3W4QA 4XUXA 2XF3A 4KZ4A 3ZG8B 1JTDA 4QY5A 4RX2A 5E2HA 2Y2QA 3SH8A 5HAQA 2A49A 5U47A 3N8SA 2A3UA 3VSKA 3HLBA 1BUEA 2DRWA 3VP0A 1YQSA 2V20A 2ZC7A 3MZEA 1LL9A 2X01A 4QB8A 5CHJA 2WAEA 4RYEA 2R9WA 4D2OA 4Y0TA 1PI5A 5CXWA 5DTSA 3WS2A 1PIOA 4KZ3A 4QJGA 4KG6A 1J9MA 2ZQ8A 3HUNA 3NDGA 5FQJA 2QMIA 1LLBA 2P74A 2V1ZA 3Q7VA 1BT5A 3GVBA 2RL3A 4IVKA 2ZM8A 3BFCA 2JC7A 2FFYA 4E3NA 5FQQA 5TGFA 4RVAA 3IWIA 3WS1A 3MBZA 4EBPA 1BLPA 2Y2KA 5JYOA 4Y0OA 1FCMA 4S2NA 5FA7A 3SS3A 5CERA 4WEKA 2WZXA 4BJPA 1JWPA 1TDLA 4BL3A 3HLWA 3ZG9B 5HAPA 2Y2OA 1VQQA 3FKVA 4WZ5C 4UA7A 4GDNA 4WMCA 5HW3A 5E2GA 5CTMA 5EVIA 4R0QA 1IYSA 5EECA 3ZNTA 5F1FA 3I7JA 1I2SA 4HEFA 4M3KA 5EVIB 5CEBA 2PU4A 1SKFA 2JCHA 3ZGAB 2Z2MB 2Z2LB 5DVAA 3WRZA 2PBYA 5A91A 4IEDA 2HP9A 5FDHA 1KDWA 5HX9A 2J8YA 1W79A 5EPHA 3PAEA 1YLPA 4OLDA 3MZDA 2J9PA
chains in the Genus database with same CATH superfamily
4QHCA 4RQ9A 2XR0A 4I38A 5EOEA 4GKUA 4OPYA 3FG8A 4S2MA 2M7VA 3G32A 2B5RA 3QNCA 3IH8A 4YINA 4BD0A 1GHPA 4KZBA 2KOIA 2WKQA 3HLEA 3B42A 4CLCC 2G7UA 1SKOB 5DJUA 3LIEA 3OPHA 3PBOA 3LICA 3NJAA 3MF0A 2HGVA 3W2ZA 2J9OA 5CRFA 2K31A 2VK3A 4WYYA 2GDNA 4MN6A 3ZCZA 3LCEA 4H6JB 1TVFA 1U60A 1W8YA 3S1YA 5HPFA 3ZG7B 4PMAA 3GQZA 1BSGA 2Y2JA 5IHVA 4EXOA 5L2FA 4I39A 4R3BA 2PDRA 3W4PA 5TFQA 3NOPC 3R7WB 1YMXA 3GMWA 1EWZA 2XQZA 3MFDA 4YNRA 2NUTC 3RFBA 3F1NA 5M1AA 1MPLA 4LV1A 3S7QA 1OJGA 3K2NA 3KSIA 2W3EA 4WBGA 1XP4A 3CUEA 2EFXA 1FQGA 1LSXA 2H0YA 5G4YA 3FKWA 1I2WA 4JPMA 2GJ3A 3DW0A 4PM6A 3IHAA 3JVVA 1L3LA 2LB9A 3G4PA 1XJ4A 5HFOA 4R6LA 2MJ6A 3NC8A 3GTCA 2ZQ9A 3KSFA 4JGRA 5CTNA 3VP1A 1FR6A 2GZAA 3SS4A 3TOIA 2BG1A 1S6RA 1A0KA 1PRQA 5M18A 1YSPA 5DFXA 3LR4A 2Y2HA 2WKHA 1OT6A 1Y28A 1ES4A 3NHQA 3BFDA 2HP5A 3BQ8A 4NETA 4F3LB 4ARZA 2UWXA 1OJ5A 3TE8A 5EE8A 1Y54A 1OMEA 3UNWA 4N1XA 3UMDA 1T19A 5FEGA 5CGWA 4EQIA 1XJ3A 4YFMA 3G2YA 4JKTA 3T4SA 2EX2A 5AQAA 4E6WA 4S2LA 1IOUA 2C5WB 1XX2A 4JF6A 4JXSA 5L07A 4UAAA 3KO6A 2Y59A 1CI8A 4OPZA 4LENA 3E0YA 4BMWA 4P87A 3E2KA 4E04A 1ES2A 1ZC2A 1RGYA 2R78A 4IVIA 1IYQA 2EFUA 3IF6B 2HDQA 2HV1A 1NYMA 5HL6A 3QHYA 5HDCA 3UE3A 4LV3A 1KGGA 3HJKA 5FI7A 3LR0A 5KSCA 1C3BA 1EI5A 5DJTA 4DE2A 1LSVA 3S7PA 3JPUA 3BEBA 3F1PB 2WADA 4KQQA 3Q1FA 4BLMA 3LEQA 1GSWA 4NXFA 3F1OA 4R70A 3ICYA 2QHKA 1P9WA 2KLIA 2HDUA 3LI8A 4IBXA 3QP4A 1Z09A 4DMZA 3A3FA 1XPBA 5K5BA 1YSQA 4GJ4A 4GS9A 3LGOA 2G2UA 1ACFA 4E3OA 2HP6A 3MSHA 5HPIA 2V8CA 2WKIA 4DXBA 4QU3A 2HDRA 4QWOA 3NULA 1VETB 4JLFA 2HZ5A 3T12B 3GR2A 1K54C 3CPTB 3ZVTA 3ZVWA 3EGXC 3MFXA 3EEAA 3IF5A 4Q0IA 3CG5A 5AVEA 4HP9A 4S2JA 2Y91A 1WYCA 3RH8B 1FCOA 4K91A 4OVDA 5G18A 4Q8IA 1OTDA 4QY6A 3LIBA 2VV8A 1G68A 5A90A 3LR3A 4L9EA 3OPPA 4OPRA 2C6WB 4N1HA 1BTLA 3ZDJA 3BRMA 2WZZA 1NWZA 2OLVA 3N7WA 3HREA 3E4QA 3RXWA 5AJGA 1IFQA 3OCLA 4E3KA 4MEZA 5FASA 4LPZA 2Y79A 5I94A 2Y2NA 2W1TA 5EV0A 3PTEA 2EXAA 5F6AA 3W4QA 1S67L 3ZG8B 4X1MA 5U47A 3S7OA 5C5KA 4LRZE 2D02A 4QB8A 5CHJA 3LUQA 2R9WA 3OOVA 4KZ3A 4XT2A 1S4SA 5FQJA 3L9KA 2V1ZA 1BT5A 3GVBA 3FPVA 4IVKA 3BFCA 2QKPA 2JC7A 2VA0A 4CLCA 4E3NA 3IWIA 3WS1A 5AVFA 5FA7A 5CERA 3T1SA 3IS2A 5HAPA 2Y2OA 2PD8A 2K7SA 1W63M 4UA7A 4GDNA 4R3AA 4HEFA 1I2SA 4M3KA 5EVIB 1SKFA 2JCHA 1DP8A 2Z2MB 3H7WB 5DVAA 3LIFA 2J8YA 3GDIA 3DBAA 4BD1A 2OWJA 2XA7M 4KZ9A 4HOIA 4M4XA 5EM1A 1PWDA 5GLAA 1ONGA 4C6YA 2KDKA 4GLQA 4L9GA 2Y2MA 4EUVA 3C4PA 3JYIA 4EEPA 4U0XA 1XKZA 1FSYA 1K25A 3NDEA 4DJ2A 1KE3A 5KSHA 3WWXA 4MN7A 3HJIA 1HD8A 2WAFA 2EX9A 4S2NC 5DTTA 4GN2A 3SW1A 1T1CA 3BM6A 3KYZA 4R1GA 1ERMA 1OT9A 2OSUA 3QP6A 2V1BA 5TR7A 3SH9A 1ONHA 2J3TC 3W4OA 1DP6A 3LR5A 2Z6CA 1TS7A 5EM0A 4LGWA 3CITA 3HCYA 2Y2PA 3MKEA 1NRJA 3B3XA 1NRFA 2HDSA 5EVEA 1K4EA 2Y55A 3V3SA 5EUAA 1PW1A 1FCNA 1FOFA 1PW8A 3T4JA 1HZOA 4B93A 1JTGA 5A93A 1T1BA 4MBKA 5HAIA 2QWSA 1N9NA 4DE0A 1W5DA 4LV2A 3K3CA 3T4OA 1KDSA 3LI9A 3IWOA 1SZVA 2OWHA 4GB7A 3NY4A 2WKEA 1L0DA 4KZ8A 1K57C 1RCJA 1D06A 3NIAA 5JYPA 2JKTI 3M6HA 5F82A 2M7UA 1K0KA 1W7FA 5AQ7A 2GX5A 3PAGA 1TS6A 1HTZA 4EBNA 4Y0UA 4ZJ2A 2Q0OA 4WEJA 2XDMA 3KYQA 1FSWA 1S1YA 1KVLA 2EXBA 2ZC3B 3P98A 3EEHA 3C2WA 1X0OA 4I3IA 4CJNA 2B02A 4OOMA 4DN0A 5GLDA 2P08A 2VV7A 1KE0A 2W3GA 1OPXA 3PR6A 4KZ7A 5J7EA 3D72A 3AGDA 4JGOA 1LI0A 4OH0A 2Y4AA 4DXCA 3CPTA 2XA7S 3H82A 1PZPA 1TDGA 4GD6A 2NUPC 1WYBA 4Y2FA 4D60A 3T50A 3PYPA 3BFEA 3IX3A 2LB5A 3HLGA 3E2LA 1XA7A 2Y2GA 4ME4A 3LO7A 3IH9A 1BULA 1G6AA 5F5YA 2KX6A 1K56D 2ZQ7A 4G3VA 4JXWA 2XH9A 2Y2LA 1IELA 4OOLA 1BLCA 1STZA 2V9AA 4MBFA 2FH5A 5GLCA 4P85A 1H0MA 3QNBA 3UDXA 5DF7A 4EUZA 3FWLA 2JKFA 1EROA 5HARA 2ZD8A 3OC2A 3HLFA 4EBLA 1WE4A 5L09A 4HHDA 3VOZA 4Y3IA 3BYDA 4L9FA 3OLOA 4HBTA 1PWCA 1S4RA 5TJJA 1YAXA 3T4TA 5DF8A 3W8KA 1VB6A 3MXQA 4ZJ1A 3PBQA 4WN5A 1K54A 2EWVA 3ZG5A 4JF5A 2ZMAA 2XRNA 4XXRA 5L8MA 1AXBA 3R4KA 3BQAA 5DFYA 1GHMA 2V2FF 4PPRA 4HH3A 3CZDA 4EWFA 1ESIA 5J8XA 3NOTC 4IUKA 1VEUB 4MNRA 1IKGA 5CGXA 1DP9A 4LRXC 5KZHA 3T1QB 2QJ5A 4GZBA 1YKDA 1BLHA 2W3DA 4OKPA 4BBUA 3B33A 3DWZA 1E25A 3N4IA 4Y5FA 3RJUA 2ACGA 3T1RA 3IF6C 3T4LA 4WELA 4YWZA 4JF4A 4QD4A 2E8JA 3OPLA 1FR1A 2OOLA 3BW6A 4H8RA 3UPOA 1XFNA 3VMAA 2YKFA 1KGEA 3NECA 1V9YA 5F1GA 2WGWA 1UGUA 4UEYA 4X6TA 4LCMA 2Y8HA 5CECA 1YT4A 5EVLA 2IWBA 1XJ6A 4LRYC 4WMCD 3C5AA 2PT7A 4HIAA 5EVID 3UB9A 3C8CA 1KGFA 5HD5A 1CEFA 3QP8A 4U0TA 1Z6FA 3FPWA 5FEFA 4WZ4A 3A0VA 2PD7A 2VV6A 1DJAA 5FDSA 5J4EA 4OOYA 1NZOA 4OLGA 3QP1A 3Q7ZA 4Y13A 4FH2A 4GCZA 2ZQCA 1AWIA 2ZL1B 4ZTKA 4EV4A 4XUXA 4QPRA 4QY5A 2Y2QA 2WKRA 3N8SA 2QJ7A 2V20A 2ZC7A 4HJ3A 3C30A 2WAEA 4Y0TA 4BBVA 1T18A 4QJGA 2ZQ8A 3MJQA 1LLBA 2P74A 1CJFA 2ZM8A 2A24B 5HSQA 4RVAA 1TD5A 1UWNX 2QYBA 2Y2KA 4G3WA 4S2NA 4GHIA 2ZOHA 4HQAA 3ZQ5A 1VQQA 4WZ5C 3QP2A 5E2GA 4BBTA 4R0QA 1IYSA 3ZNTA 3I7JA 2PU4A 3ZGAB 2Z2LB 5CX7A 5A91A 2O0YA 5FDHA 5EPHA 4EESA 3MZDA 2J9PA 4PM5A 1MWSA 2VLGA 4BL2A 1P9RA 2H5SA 1YPRA 4K0WA 3KSHA 1G6OA 4S2OA 5TBMB 2QPNA 2W3HA 3IWQA 2L1MA 1ZG4A 2BLSA 1SCWA 1MY8A 2QZ6A 2WGVA 4ID4A 2EWWA 3N8LA 1SKOA 4KQRA 4BENA 5EFWA 4HBUA 1DJBA 1CEGA 3HLCA 4GOGA 3SOIA 2BASA 3IHBA 3MMHA 2OV5A 4O0PA 3A0RA 3NI9A 2ZLYA 3ZG0A 3DWKA 2J3TD 4OP5A 2XK1A 4H6JA 3HUMA 1VHMA 5EVIC 4S2PA 1JWZA 3O86A 5E43A 1ODVA 2ZQDA 4IJGA 5BOHA 1MBLA 2HPBA 4IHQA 1M40A 1SDNA 1K57A 5HDDA 1MXOA 4HI4A 5AQBA 1PFLA 1H3QA 4XUZA 1NZUA 3R7WA 1MWRA 2DNSA 3DTMA 4Y15A 3MQ0A 4DE1A 1BZAA 1YLTA 4EU0A 3GECA 1YLYA 3UN7A 2XLNA 4N9LA 1FIKA 3H9WA 4KUKA 3E4PA 2J3WA 4WLAA 4HESA 3ISGA 1ZG6A 2JKGA 3FV7A 4P6BA 4EETB 3LY4A 3VOLA 3BJNA 5A92A 3KYEA 4EQ1A 1K6RA 1W8QA 4UA9A 3Q7VB 3V5MA 4I3JA 5AQ9A 3UE1A 3LIAA 2O9CA 4MDZA 1F2KA 2J7VA 4B4ZA 3HBRA 3HUOA 4WM9A 1S66L 1L0GA 1NJ4A 3TG9A 2WUQA 3NBLA 2W1RA 1S0WA 3VE4A 2H10A 3UDFA 3UMEA 1GSVA 3V50A 3MXSA 1NLZA 3A3DA 1XA1A 5FATA 3Q82A 2W27A 3BLSA 4S2KA 3FYZA 2VX8A 2JKRI 4NXGA 4LLOB 5FQIA 3MQQA 2ZC5B 5LBRA 1KOUA 5F83A 1K4FA 4ETZA 4F3LA 2A2LA 2VKSA 5HD3A 1KVMA 5GHZA 4PM9A 5GLBA 4Q0JA 4KQOA 3SH7A 3EGDC 3S22A 2CC1A 1FILA 4KZ6A 5DF9A 4ZJ3A 2Y2IA 3C7UA 1LI9A 5IT5A 1ALQA 1SDEA 4ETXA 3UDIA 1IEMA 3M2KA 1T1AA 5DKLA 2OLUA 3PBSA 3MKFA 3BFFA 1G28A 3CI6A 3TW8A 2R9XA 3BFGA 4KZAA 2P9VB 2O9AA 3ZFZA 4FTXA 5FAPA 4A5RA 5CHMA 4O01A 1CI9A 1O07A 3ZYTA 4K08A 4PHTA 1D7EA 3VE3A 3CWFA 4MLLA 1L0EA 2D01A 1NY0A 2DCFA 2YKHA 2P7JA 3UY6A 3IF6A 3G2ZA 4GDBA 1LT0A 4HY8A 2OAP1 3C38A 3U2AA 3UB8A 5CEDA 1K55C 1CK3A 4RA7A 1YMSA 3VOYA 4FOFA 4UHUA 4PM7A 4E3MA 4NK3A 1UWPX 5DKKA 3F1PA 2XFTA 2W0NA 3G6OA 2WGIA 3N6IA 2Z6DA 2A24A 1GCEA 4NEED 3F1OB 3WS5A 4DDYA 1H8ZA 5GHYA 2J80A 3CJMA 4OQHA 3UB6A 1F9IA 4E3LA 1N4OA 1DY6A 5FAQA 3EQVA 4MBHA 4P0MA 4GS9B 2JKTM 3UO9A 2PR5A 3OCNA 3D3OA 4R3JA 4DJ3A 5HZHA 1K56A 2AVXA 4KG5A 2OAQ1 1H5XA 2V0WA 1VETA 3EWKA 3PXPA 3V3RA 4EEUA 3PBTA 1OTBA 4WF0A 4ZDXA 4F94A 5TBMA 4PKYA 5GL9A 4HNBA 1M6KA 4S2IA 1TF1A 5FI6A 3L7HA 5M19A 2M1CA 1EW0A 3A3EA 2ZM0A 5HWTA 2P04A 2PU2A 3PHYA 4II7A 4BWIA 4E6XA 3A0SA 2X71A 4EW7A 4K0XA 2H0TA 3ITAA 2B18A 4PAUA 3ULFA 3G31A 5HDSA 4MN5A 3SS5A 3UPNA 3VFHA 2V1AA 4YOFA 1MKIA 3UPPA 4WZ5A 1P97A 1YLZA 4KG2A 4AFIA 2PRFA 4HJ6A 1SHVA 4O7DA 1KE4A 2W1TB 4FD8A 4CLCE 1JTDA 4RX2A 3SH8A 2A49A 1MZUA 2A3UA 3VSKA 1BUEA 2DRWA 2VGLM 3VP0A 3BY9A 4LFUA 1LL9A 4NKPA 3IX8A 5DTSA 1PIOA 3HUNA 3NDGA 2QMIA 4XT2B 3Q7VA 1BYWA 2RL3A 5FQQA 5IS1A 3MR0A 4CLCB 3RTYA 3MBZA 1FCMA 4WEKA 3KSGA 4BJPA 1TDLA 5HWVA 3HLWA 3IS2B 3FKVA 3MQOA 4EERA 4GW9A 4WMCA 5HW3A 5EVIA 4O8GA 5EECA 1W63Q 3H7WA 5CEBA 5F68A 3WRZA 2PBYA 3B47A 2HP9A 1WA9A 3P7NA 2O9BA 3O5YA 4R23A 3KX0X 1YLJA 3DTIA 3IQAA 3VFFA 2EA9A 2UV0E 2V8FA 3VP3A 2INWA 1TS8A 3MXRA 2JE5A 5E2EA 3EOIA 4PM8A 3ITBA 2VEAA 1GA9A 1JWVA 4FCFA 5FQ9A 2XFSA 3CHWP 4KENB 3T4KA 3IBRA 3DTEA 2W3FA 2L4RA 3TRCA 2GNXA 1H8YA 3BLMA 4X55A 1GSXA 2XEPA 4X69A 3LY3A 1PWGA 4N92A 4X56A 3TSGA 3GV9A 4JGQA 3JVUA 1ES5A 1DJCA 4E3JA 3LFVA 2P9VA 1LL5A 3IXHA 2PR6A 4Z9QA 4B88A 2PAVP 1MKMA 3UE0A 3CAXA 3A3IA 5FQMA 5I5LA 4C3QA 4DRTA 5DTKA 3UB7A 1E3UA 4HH2A 3T1XA 4OPQA 4OONA 2WK0A 1J3WA 1V9ZA 1G5UA 4KUOA 2XGNA 1IYPA 1QMFA 3HLDA 3OZHA 3IT9A 1PYYA 1K38A 3G35A 3GSGA 4ESPA 3IBJA 3O88A 1HVBA 1GHIA 3IXDA 5CHUA 1RGZA 1OTEA 3O87A 2VGLS 1LSWA 5FI2A 3E98A 4LCLA 3T4QA 4JBFA 1CF0A 4Q0HA 2IA2A 4FH4A 2I9VA 4HP4A 3RXXA 3V67A 3LIDA 2O99A 2Q9NA 3S7NA 1OTIA 4UQIM 3CLOA 2I72A 3MS6A 4RX3A 1XGIA 4U3TA 1E3UD 4JXGA 5HL1A 3WS4A 3D9YA 1NYYA 1NLYA 1LL8A 5D3OA 1L0FA 4UA6A 2PYPA 3HVFA 5F69A 4B9OA 1JVJA 2V0UA 3CUEC 2ZM2A 1ESUA 1Q2PA 4G3KA 1GA0A 1OTAA 2XD5A 1CQAA 1H8MA 2CMNA 1XFQA 3EQUA 1Q2QA 2IWDA 4DKIA 4E3IA 4X25A 1JNUA 3OBFA 3WRTA 4R4SA 5KIZA 2FZ0A 1ZKJA 2RCXA 3IXGA 2WKPA 3VSLA 3BWLA 3Q07A 1K55A 3H82B 5EOOA 1F98A 3ZNYA 4BQMA 4KZ5A 3GRJA 4JGPA 4NG2A 1IYOA 2ZBBA 4NXEA 2HF6A 4Y17A 1L2SA 5L10A 3AGFA 4P6ZM 1MWTA 4LV0A 3FC7A 2ZOIA 3IXBA 2X02A 3M6BA 4JXVA 3Q81A 4PKYG 1TEMA 2FFFB 1IKIA 3O3VA 3F1NB 1K6SA 3AGEA 1Y4OA 2VGJA 4CPKA 1P0ZA 3G34A 2JHEA 4DDSA 1XGJA 1ERQA 4OQIA 3K3DA 1VM1A 4N9KA 5E2FA 3MZFA 4DE3A 4CQHA 3N8RA 4GD8A 4WUJA 3NCKA 1O7EA 2H28A 4MMNA 3OPRA 4X68A 2XROA 3NOUC 4GNUA 3PBRA 2G2WA 4OQGA 1N9BA 2EX6A 2ZMFA 2BTFP 5J3WA 1QMEA 4ZBEA 2HJEA 1D1JA 4L0LA 1BLSA 2DMWA 3HL9A 4IUHA 2XD1A 3UE6A 2B95A 5GHXA 1E4DA 3FZCA 4OQ0A 3UB5P 2IWCA 1VEUA 5FQKA 3P01A 2JBFA 3V39A 1YM1A 3WS0A 2ZC4B 4B4XA 4X53A 2E8IA 1ES3A 2EX8A 4FUWA 3G30A 5MC7A 1YLWA 4Y7PA 4IBRA 3LEZA 4KQDA 4UQIS 3A3JA 2K2NA 1N9LA 1NXYA 3BY8A 3VP2A 2ZMVA 1PI4A 5CGSA 1PZOA 1MWUA 3D4FA 4ARZB 3C4OA 1N9OA 4FSFA 1I5QA 2Q9MA 3LYXA 3IX4A 1XXMA 4OP8A 2ZQAA 3P09A 3S4XA 2JKRM 3CMZA 4CLCD 4DF6A 2WGWB 2ZJ9A 1XJ2A 3U4LP 4X1LA 2PBDP 2XSSA 2VGKA 4C75A 3TJZC 3E4OA 2HJ9C 3C7VA 2ZC6B 4R4RA 4ZAMA 1LHYA 5FAOA 3ZHHA 1F5MA 2PHYA 3VV4A 1S1ZA 1PNEA 2VZWA 5G4ZA 5KMWA 5FSRA 4I5SA 1MC0A 3VP4A 3BECA 2VJWA 2WYXA 1RP5A 2ZL1A 4P6ZS 3PBNA 3M2JA 5FL3A 2XF3A 3DTKA 4KZ4A 1HLUP 5E2HA 1ZHHB 5HWWA 5HAQA 2JN7A 2PYRA 3HLBA 1DRMA 4HJ4A 1YQSA 5A8BA 3MZEA 2X01A 4RYEA 4D2OA 1PI5A 4I3AA 5CXWA 3WS2A 3QP5A 4KG6A 1J9MA 2L0WA 2FFYA 4WL9A 5TGFA 4EBPA 1BLPA 3SZTA 5JYOA 4Y0OA 5IU1A 3SS3A 1TS0A 2WZXA 1JWPA 4R38A 4BL3A 4GHIB 3ZG9B 4NXBA 5CTMA 3DAVA 5F1FA 4Z1WA 1ZTUA 4IEDA 4ZRRA 4MCWA 1KDWA 5HX9A 1W79A 3PAEA 1YLPA 4OLDA
chains in the Genus database with same CATH topology
4QHCA 2XR0A 5EOEA 3IQAA 4BD1A 4PM5A 3VFFA 4DXCA 4GKUA 1MWSA 4OPYA 4KZ9A 5DTTA 4BL2A 3VP3A 1PWDA 2H5SA 5GLAA 4S2MA 1ONGA 3MXRA 2JE5A 4K0WA 5E2EA 4C6YA 4S2OA 3G32A 2QPNA 2Y2MA 3IWQA 3C4PA 2B5RA 3QNCA 3IH8A 1ZG4A 4PM8A 4YINA 2BLSA 4BD0A 1SCWA 1GHPA 1MY8A 2QZ6A 3JYIA 2WGVA 1XKZA 4KZBA 4U0XA 1FSYA 3HLEA 1K25A 3ITBA 4ID4A 3N8LA 3NDEA 4KQRA 4BENA 1KE3A 4HBUA 5KSHA 1DJBA 3WWXA 1CEGA 1HD8A 3HLCA 1GA9A 2WAFA 1JWVA 2EX9A 3OPHA 3PBOA 4FCFA 3BM6A 2XFSA 4GN2A 4GOGA 4S2NC 4R1GA 5FQ9A 3SOIA 3IHBA 1ERMA 2J9OA 4KENB 2OV5A 5CRFA 3NI9A 2ZLYA 3ZG0A 3DWKA 2OSUA 2GDNA 1YLJA 4WYYA 4OP5A 2XK1A 5EVIC 3HUMA 3ZCZA 3LCEA 5TR7A 1H8YA 3BLMA 4S2PA 1TVFA 4X55A 1JWZA 1U60A 3SH9A 1W8YA 3O86A 3S1YA 2XEPA 4X69A 1ONHA 3LY3A 5E43A 3W4OA 1PWGA 4N92A 4X56A 3ZG7B 4PMAA 2ZQDA 3TSGA 3GV9A 5BOHA 1MBLA 2HPBA 1ES5A 1M40A 1SDNA 3GQZA 1BSGA 1K57A 2Y2JA 5IHVA 1MXOA 1DJCA 4E3JA 5L2FA 5AQBA 2Y2PA 3MKEA 4XUZA 4R3BA 2P9VA 1NZUA 1LL5A 3B3XA 3IXHA 1NRFA 2HDSA 3W4PA 1MWRA 1K4EA 2DNSA 4Z9QA 5TFQA 3DTMA 1YMXA 2Y55A 3GMWA 1EWZA 4B88A 3V3SA 4DE1A 2XQZA 1BZAA 3MFDA 1YLTA 3UE0A 3A3IA 5EUAA 5FQMA 5M1AA 1PW1A 1MPLA 1YLYA 4C3QA 1FCNA 1FOFA 3UN7A 2XLNA 1PW8A 4N9LA 4DRTA 4LV1A 5DTKA 1E3UA 4OPQA 1HZOA 4HESA 3ISGA 1ZG6A 1JTGA 4OONA 3FV7A 4P6BA 5A93A 2WK0A 4MBKA 4WBGA 5HAIA 1XP4A 2EFXA 3LY4A 4DE0A 1FQGA 1W5DA 2H0YA 4LV2A 2XGNA 1IYPA 3FKWA 1QMFA 3HLDA 1I2WA 4JPMA 3OZHA 5A92A 3IT9A 1PYYA 1K38A 1K6RA 1W8QA 3G35A 3GSGA 4UA9A 1KDSA 3DW0A 3Q7VB 3V5MA 4PM6A 3IHAA 5AQ9A 3O88A 1HVBA 1GHIA 3IXDA 3IWOA 4GB7A 5CHUA 3G4PA 3NY4A 3UE1A 2WKEA 1RGZA 5HFOA 1L0DA 3O87A 4KZ8A 1K57C 3NC8A 1RCJA 2J7VA 3GTCA 2ZQ9A 4B4ZA 3HBRA 3HUOA 4WM9A 5FI2A 1L0GA 1NJ4A 3NIAA 4LCLA 5JYPA 3M6HA 4JBFA 3TG9A 2WUQA 3NBLA 5F82A 4FH4A 3RXXA 1W7FA 1S0WA 5AQ7A 2Q9NA 5CTNA 3ZFZA 3PAGA 3VP1A 1FR6A 2H10A 2I72A 4RX3A 3UDFA 1XGIA 4U3TA 3SS4A 3V50A 1HTZA 1E3UD 4JXGA 4EBNA 5HL1A 3MXSA 3WS4A 4Y0UA 1NYYA 3TOIA 2BG1A 3A3DA 1XA1A 5FATA 4ZJ2A 4WEJA 1S6RA 3Q82A 2XDMA 5D3OA 1L0FA 1FSWA 3BLSA 5M18A 1KVLA 4UA6A 3HVFA 4S2KA 3FYZA 2EXBA 2ZC3B 1JVJA 2Y2HA 3P98A 2WKHA 5FQIA 2ZM2A 1ES4A 2ZC5B 1ESUA 3BFDA 4CJNA 2HP5A 1Q2PA 5F83A 1K4FA 1GA0A 2XD5A 1KVMA 4NETA 5GHZA 4OOMA 5GLDA 3EQUA 1Q2QA 2IWDA 4PM9A 4DKIA 4E3IA 5GLBA 1KE0A 2UWXA 4KQOA 4KZ7A 3SH7A 3WRTA 3S22A 4R4SA 5EE8A 3AGDA 2CC1A 1Y54A 1LI0A 2RCXA 1ZKJA 2Y4AA 3IXGA 4KZ6A 2Y2IA 3C7UA 1LI9A 4OH0A 5DF9A 4ZJ3A 1OMEA 3UNWA 3VSLA 4N1XA 1ALQA 1PZPA 1SDEA 1TDGA 3UDIA 1IEMA 3Q07A 4GD6A 1K55A 1WYBA 5EOOA 5CGWA 4EQIA 3M2KA 3BFEA 3ZNYA 2OLUA 4BQMA 3HLGA 3PBSA 4KZ5A 3E2LA 3GRJA 4YFMA 3MKFA 3BFFA 1XA7A 3G2YA 1IYOA 2Y2GA 3LO7A 3IH9A 1L2SA 4JKTA 1BULA 1G6AA 3AGFA 2EX2A 5AQAA 4E6WA 4S2LA 2R9XA 1MWTA 2C5WB 3BFGA 1XX2A 4KZAA 4LV0A 2ZQ7A 1K56D 3IXBA 2P9VB 4JF6A 4JXSA 4JXWA 2X02A 2XH9A 5FAPA 3M6BA 2Y2LA 4UAAA 1IELA 5CHMA 4A5RA 4JXVA 4OOLA 1CI9A 1BLCA 1O07A 4MBFA 2Y59A 1CI8A 4OPZA 5GLCA 4P85A 3Q81A 1TEMA 2FFFB 4LENA 1IKIA 3O3VA 3QNBA 4P87A 1K6SA 3UDXA 4MLLA 5DF7A 1L0EA 3E2KA 4EUZA 3FWLA 1ES2A 1ZC2A 3AGEA 1NY0A 2DCFA 2VGJA 1RGYA 1EROA 4IVIA 1IYQA 4CPKA 5HARA 2ZD8A 3OC2A 3G34A 3UY6A 3IF6A 4DDSA 3G2ZA 1XGJA 3HLFA 2EFUA 1ERQA 4EBLA 3IF6B 4GDBA 2HDQA 4OQIA 1VM1A 4N9KA 1WE4A 5E2FA 3MZFA 4DE3A 1NYMA 1K55C 3VOZA 5CEDA 3N8RA 1CK3A 3BYDA 4GD8A 4RA7A 3QHYA 1YMSA 4HBTA 1PWCA 3VOYA 3NCKA 1O7EA 3UE3A 3OPRA 4LV3A 1KGGA 4X68A 4UHUA 4GNUA 4PM7A 5DF8A 3PBRA 2G2WA 3W8KA 4NK3A 5FI7A 4E3MA 4ZJ1A 3PBQA 4OQGA 1N9BA 2EX6A 5KSCA 1C3BA 1EI5A 4DE2A 1QMEA 1K54A 3ZG5A 3BEBA 2ZMAA 4JF5A 2WADA 4ZBEA 4XXRA 4R23A 2XFTA 4KQQA 3Q1FA 4L0LA 1BLSA 2WGIA 1AXBA 3HL9A 2XD1A 4BLMA 3N6IA 1GCEA 1GHMA 2V2FF 4PPRA 5GHXA 3CZDA 1E4DA 3FZCA 4OQ0A 2IWCA 4EWFA 3WS5A 5FQKA 2JBFA 1ESIA 3V39A 1H8ZA 5GHYA 2HDUA 4DDYA 5J8XA 3CJMA 4IBXA 4MNRA 4OQHA 1IKGA 5CGXA 1YM1A 3A3FA 4E3LA 1XPBA 1N4OA 3WS0A 2ZC4B 4B4XA 5KZHA 1DY6A 5FAQA 3EQVA 4GZBA 4MBHA 4X53A 2E8IA 1BLHA 1ES3A 2G2UA 4P0MA 4OKPA 2EX8A 3DWZA 3N4IA 1E25A 3RJUA 4E3OA 2HP6A 3IF6C 3UO9A 3G30A 3OCNA 4WELA 1YLWA 4R3JA 4Y7PA 4IBRA 3LEZA 1K56A 4JF4A 4QD4A 4KG5A 2WKIA 3A3JA 1NXYA 3VP2A 4DXBA 1H5XA 4QU3A 3OPLA 1FR1A 2HDRA 1PI4A 5CGSA 1PZOA 3V3RA 1MWUA 3D4FA 4H8RA 3C4OA 4JLFA 4FSFA 1I5QA 2Q9MA 3UPOA 3PBTA 1XXMA 4OP8A 4ZDXA 2ZQAA 3P09A 3GR2A 3VMAA 3S4XA 4F94A 1K54C 1KGEA 5F1GA 3CMZA 2WGWA 5GL9A 4DF6A 2WGWB 4X6TA 1M6KA 4S2IA 4LCMA 2ZJ9A 5FI6A 3ZVTA 5CECA 1YT4A 3ZVWA 5M19A 3A3EA 2VGKA 2ZM0A 4C75A 2PU2A 5EVLA 3IF5A 3CG5A 2IWBA 3C7VA 4WMCD 4S2JA 2ZC6B 2Y91A 3C5AA 5EVID 4R4RA 1WYCA 4E6XA 1FCOA 2X71A 4K91A 4OVDA 4K0XA 4ZAMA 2H0TA 3ITAA 5G18A 1LHYA 4QY6A 4Q8IA 1KGFA 5FAOA 1G68A 3ZHHA 1CEFA 4U0TA 1Z6FA 5A90A 4WZ4A 3OPPA 4OPRA 1DJAA 3G31A 2C6WB 4N1HA 5KMWA 1BTLA 3ZDJA 3BRMA 3SS5A 5FSRA 4OOYA 2WZZA 3VP4A 3BECA 1NZOA 2OLVA 3UPNA 3VFHA 3N7WA 4OLGA 2WYXA 1MKIA 3Q7ZA 3UPPA 3HREA 1YLZA 4WZ5A 4KG2A 4FH2A 1RP5A 3RXWA 4E3KA 3OCLA 1SHVA 2ZQCA 4MEZA 5FASA 5I94A 2Y2NA 3PBNA 3M2JA 4O7DA 1KE4A 4ZTKA 3PTEA 2EXAA 4EV4A 4FD8A 3W4QA 4XUXA 2XF3A 4KZ4A 3ZG8B 1JTDA 4QY5A 4RX2A 5E2HA 2Y2QA 3SH8A 5HAQA 2A49A 5U47A 3N8SA 2A3UA 3VSKA 3HLBA 1BUEA 2DRWA 3VP0A 1YQSA 2V20A 2ZC7A 3MZEA 1LL9A 2X01A 4QB8A 5CHJA 2WAEA 4RYEA 2R9WA 4D2OA 4Y0TA 1PI5A 5CXWA 5DTSA 3WS2A 1PIOA 4KZ3A 4QJGA 4KG6A 1J9MA 2ZQ8A 3HUNA 3NDGA 5FQJA 2QMIA 1LLBA 2P74A 2V1ZA 3Q7VA 1BT5A 3GVBA 2RL3A 4IVKA 2ZM8A 3BFCA 2JC7A 2FFYA 4E3NA 5FQQA 5TGFA 4RVAA 3IWIA 3WS1A 3MBZA 4EBPA 1BLPA 2Y2KA 5JYOA 4Y0OA 1FCMA 4S2NA 5FA7A 3SS3A 5CERA 4WEKA 2WZXA 4BJPA 1JWPA 1TDLA 4BL3A 3HLWA 3ZG9B 5HAPA 2Y2OA 1VQQA 3FKVA 4WZ5C 4UA7A 4GDNA 4WMCA 5HW3A 5E2GA 5CTMA 5EVIA 4R0QA 1IYSA 5EECA 3ZNTA 5F1FA 3I7JA 1I2SA 4HEFA 4M3KA 5EVIB 5CEBA 2PU4A 1SKFA 2JCHA 3ZGAB 2Z2MB 2Z2LB 5DVAA 3WRZA 2PBYA 5A91A 4IEDA 2HP9A 5FDHA 1KDWA 5HX9A 2J8YA 1W79A 5EPHA 3PAEA 1YLPA 4OLDA 3MZDA 2J9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QHC A;  2XR0 A;  5EOE A;  3IQA A;  4BD1 A;  4PM5 A;  3VFF A;  4DXC A;  4GKU A;  1MWS A;  4OPY A;  4KZ9 A;  5DTT A;  4BL2 A;  3VP3 A;  1PWD A;  2H5S A;  5GLA A;  4S2M A;  1ONG A;  3MXR A;  2JE5 A;  4K0W A;  5E2E A;  4C6Y A;  4S2O A;  3G32 A;  2QPN A;  2Y2M A;  3IWQ A;  3C4P A;  2B5R A;  3QNC A;  3IH8 A;  1ZG4 A;  4PM8 A;  4YIN A;  2BLS A;  4BD0 A;  1SCW A;  1GHP A;  1MY8 A;  2QZ6 A;  3JYI A;  2WGV A;  1XKZ A;  4KZB A;  4U0X A;  1FSY A;  3HLE A;  1K25 A;  3ITB A;  4ID4 A;  3N8L A;  3NDE A;  4KQR A;  4BEN A;  1KE3 A;  4HBU A;  5KSH A;  1DJB A;  3WWX A;  1CEG A;  1HD8 A;  3HLC A;  1GA9 A;  2WAF A;  1JWV A;  2EX9 A;  3OPH A;  3PBO A;  4FCF A;  3BM6 A;  2XFS A;  4GN2 A;  4GOG A;  4S2N C;  4R1G A;  5FQ9 A;  3SOI A;  3IHB A;  1ERM A;  2J9O A;  4KEN B;  2OV5 A;  5CRF A;  3NI9 A;  2ZLY A;  3ZG0 A;  3DWK A;  2OSU A;  2GDN A;  1YLJ A;  4WYY A;  4OP5 A;  2XK1 A;  5EVI C;  3HUM A;  3ZCZ A;  3LCE A;  5TR7 A;  1H8Y A;  3BLM A;  4S2P A;  1TVF A;  4X55 A;  1JWZ A;  1U60 A;  3SH9 A;  1W8Y A;  3O86 A;  3S1Y A;  2XEP A;  4X69 A;  1ONH A;  3LY3 A;  5E43 A;  3W4O A;  1PWG A;  4N92 A;  4X56 A;  3ZG7 B;  4PMA A;  2ZQD A;  3TSG A;  3GV9 A;  5BOH A;  1MBL A;  2HPB A;  1ES5 A;  1M40 A;  1SDN A;  3GQZ A;  1BSG A;  1K57 A;  2Y2J A;  5IHV A;  1MXO A;  1DJC A;  4E3J A;  5L2F A;  5AQB A;  2Y2P A;  3MKE A;  4XUZ A;  4R3B A;  2P9V A;  1NZU A;  1LL5 A;  3B3X A;  3IXH A;  1NRF A;  2HDS A;  3W4P A;  1MWR A;  1K4E A;  2DNS A;  4Z9Q A;  5TFQ A;  3DTM A;  1YMX A;  2Y55 A;  3GMW A;  1EWZ A;  4B88 A;  3V3S A;  4DE1 A;  2XQZ A;  1BZA A;  3MFD A;  1YLT A;  3UE0 A;  3A3I A;  5EUA A;  5FQM A;  5M1A A;  1PW1 A;  1MPL A;  1YLY A;  4C3Q A;  1FCN A;  1FOF A;  3UN7 A;  2XLN A;  1PW8 A;  4N9L A;  4DRT A;  4LV1 A;  5DTK A;  1E3U A;  4OPQ A;  1HZO A;  4HES A;  3ISG A;  1ZG6 A;  1JTG A;  4OON A;  3FV7 A;  4P6B A;  5A93 A;  2WK0 A;  4MBK A;  4WBG A;  5HAI A;  1XP4 A;  2EFX A;  3LY4 A;  4DE0 A;  1FQG A;  1W5D A;  2H0Y A;  4LV2 A;  2XGN A;  1IYP A;  3FKW A;  1QMF A;  3HLD A;  1I2W A;  4JPM A;  3OZH A;  5A92 A;  3IT9 A;  1PYY A;  1K38 A;  1K6R A;  1W8Q A;  3G35 A;  3GSG A;  4UA9 A;  1KDS A;  3DW0 A;  3Q7V B;  3V5M A;  4PM6 A;  3IHA A;  5AQ9 A;  3O88 A;  1HVB A;  1GHI A;  3IXD A;  3IWO A;  4GB7 A;  5CHU A;  3G4P A;  3NY4 A;  3UE1 A;  2WKE A;  1RGZ A;  5HFO A;  1L0D A;  3O87 A;  4KZ8 A;  1K57 C;  3NC8 A;  1RCJ A;  2J7V A;  3GTC A;  2ZQ9 A;  4B4Z A;  3HBR A;  3HUO A;  4WM9 A;  5FI2 A;  1L0G A;  1NJ4 A;  3NIA A;  4LCL A;  5JYP A;  3M6H A;  4JBF A;  3TG9 A;  2WUQ A;  3NBL A;  5F82 A;  4FH4 A;  3RXX A;  1W7F A;  1S0W A;  5AQ7 A;  2Q9N A;  5CTN A;  3ZFZ A;  3PAG A;  3VP1 A;  1FR6 A;  2H10 A;  2I72 A;  4RX3 A;  3UDF A;  1XGI A;  4U3T A;  3SS4 A;  3V50 A;  1HTZ A;  1E3U D;  4JXG A;  4EBN A;  5HL1 A;  3MXS A;  3WS4 A;  4Y0U A;  1NYY A;  3TOI A;  2BG1 A;  3A3D A;  1XA1 A;  5FAT A;  4ZJ2 A;  4WEJ A;  1S6R A;  3Q82 A;  2XDM A;  5D3O A;  1L0F A;  1FSW A;  3BLS A;  5M18 A;  1KVL A;  4UA6 A;  3HVF A;  4S2K A;  3FYZ A;  2EXB A;  2ZC3 B;  1JVJ A;  2Y2H A;  3P98 A;  2WKH A;  5FQI A;  2ZM2 A;  1ES4 A;  2ZC5 B;  1ESU A;  3BFD A;  4CJN A;  2HP5 A;  1Q2P A;  5F83 A;  1K4F A;  1GA0 A;  2XD5 A;  1KVM A;  4NET A;  5GHZ A;  4OOM A;  5GLD A;  3EQU A;  1Q2Q A;  2IWD A;  4PM9 A;  4DKI A;  4E3I A;  5GLB A;  1KE0 A;  2UWX A;  4KQO A;  4KZ7 A;  3SH7 A;  3WRT A;  3S22 A;  4R4S A;  5EE8 A;  3AGD A;  2CC1 A;  1Y54 A;  1LI0 A;  2RCX A;  1ZKJ A;  2Y4A A;  3IXG A;  4KZ6 A;  2Y2I A;  3C7U A;  1LI9 A;  4OH0 A;  5DF9 A;  4ZJ3 A;  1OME A;  3UNW A;  3VSL A;  4N1X A;  1ALQ A;  1PZP A;  1SDE A;  1TDG A;  3UDI A;  1IEM A;  3Q07 A;  4GD6 A;  1K55 A;  1WYB A;  5EOO A;  5CGW A;  4EQI A;  3M2K A;  3BFE A;  3ZNY A;  2OLU A;  4BQM A;  3HLG A;  3PBS A;  4KZ5 A;  3E2L A;  3GRJ A;  4YFM A;  3MKF A;  3BFF A;  1XA7 A;  3G2Y A;  1IYO A;  2Y2G A;  3LO7 A;  3IH9 A;  1L2S A;  4JKT A;  1BUL A;  1G6A A;  3AGF A;  2EX2 A;  5AQA A;  4E6W A;  4S2L A;  2R9X A;  1MWT A;  2C5W B;  3BFG A;  1XX2 A;  4KZA A;  4LV0 A;  2ZQ7 A;  1K56 D;  3IXB A;  2P9V B;  4JF6 A;  4JXS A;  4JXW A;  2X02 A;  2XH9 A;  5FAP A;  3M6B A;  2Y2L A;  4UAA A;  1IEL A;  5CHM A;  4A5R A;  4JXV A;  4OOL A;  1CI9 A;  1BLC A;  1O07 A;  4MBF A;  2Y59 A;  1CI8 A;  4OPZ A;  5GLC A;  4P85 A;  3Q81 A;  1TEM A;  2FFF B;  4LEN A;  1IKI A;  3O3V A;  3QNB A;  4P87 A;  1K6S A;  3UDX A;  4MLL A;  5DF7 A;  1L0E A;  3E2K A;  4EUZ A;  3FWL A;  1ES2 A;  1ZC2 A;  3AGE A;  1NY0 A;  2DCF A;  2VGJ A;  1RGY A;  1ERO A;  4IVI A;  1IYQ A;  4CPK A;  5HAR A;  2ZD8 A;  3OC2 A;  3G34 A;  3UY6 A;  3IF6 A;  4DDS A;  3G2Z A;  1XGJ A;  3HLF A;  2EFU A;  1ERQ A;  4EBL A;  3IF6 B;  4GDB A;  2HDQ A;  4OQI A;  1VM1 A;  4N9K A;  1WE4 A;  5E2F A;  3MZF A;  4DE3 A;  1NYM A;  1K55 C;  3VOZ A;  5CED A;  3N8R A;  1CK3 A;  3BYD A;  4GD8 A;  4RA7 A;  3QHY A;  1YMS A;  4HBT A;  1PWC A;  3VOY A;  3NCK A;  1O7E A;  3UE3 A;  3OPR A;  4LV3 A;  1KGG A;  4X68 A;  4UHU A;  4GNU A;  4PM7 A;  5DF8 A;  3PBR A;  2G2W A;  3W8K A;  4NK3 A;  5FI7 A;  4E3M A;  4ZJ1 A;  3PBQ A;  4OQG A;  1N9B A;  2EX6 A;  5KSC A;  1C3B A;  1EI5 A;  4DE2 A;  1QME A;  1K54 A;  3ZG5 A;  3BEB A;  2ZMA A;  4JF5 A;  2WAD A;  4ZBE A;  4XXR A;  4R23 A;  2XFT A;  4KQQ A;  3Q1F A;  4L0L A;  1BLS A;  2WGI A;  1AXB A;  3HL9 A;  2XD1 A;  4BLM A;  3N6I A;  1GCE A;  1GHM A;  2V2F F;  4PPR A;  5GHX A;  3CZD A;  1E4D A;  3FZC A;  4OQ0 A;  2IWC A;  4EWF A;  3WS5 A;  5FQK A;  2JBF A;  1ESI A;  3V39 A;  1H8Z A;  5GHY A;  2HDU A;  4DDY A;  5J8X A;  3CJM A;  4IBX A;  4MNR A;  4OQH A;  1IKG A;  5CGX A;  1YM1 A;  3A3F A;  4E3L A;  1XPB A;  1N4O A;  3WS0 A;  2ZC4 B;  4B4X A;  5KZH A;  1DY6 A;  5FAQ A;  3EQV A;  4GZB A;  4MBH A;  4X53 A;  2E8I A;  1BLH A;  1ES3 A;  2G2U A;  4P0M A;  4OKP A;  2EX8 A;  3DWZ A;  3N4I A;  1E25 A;  3RJU A;  4E3O A;  2HP6 A;  3IF6 C;  3UO9 A;  3G30 A;  3OCN A;  4WEL A;  1YLW A;  4R3J A;  4Y7P A;  4IBR A;  3LEZ A;  1K56 A;  4JF4 A;  4QD4 A;  4KG5 A;  2WKI A;  3A3J A;  1NXY A;  3VP2 A;  4DXB A;  1H5X A;  4QU3 A;  3OPL A;  1FR1 A;  2HDR A;  1PI4 A;  5CGS A;  1PZO A;  3V3R A;  1MWU A;  3D4F A;  4H8R A;  3C4O A;  4JLF A;  4FSF A;  1I5Q A;  2Q9M A;  3UPO A;  3PBT A;  1XXM A;  4OP8 A;  4ZDX A;  2ZQA A;  3P09 A;  3GR2 A;  3VMA A;  3S4X A;  4F94 A;  1K54 C;  1KGE A;  5F1G A;  3CMZ A;  2WGW A;  5GL9 A;  4DF6 A;  2WGW B;  4X6T A;  1M6K A;  4S2I A;  4LCM A;  2ZJ9 A;  5FI6 A;  3ZVT A;  5CEC A;  1YT4 A;  3ZVW A;  5M19 A;  3A3E A;  2VGK A;  2ZM0 A;  4C75 A;  2PU2 A;  5EVL A;  3IF5 A;  3CG5 A;  2IWB A;  3C7V A;  4WMC D;  4S2J A;  2ZC6 B;  2Y91 A;  3C5A A;  5EVI D;  4R4R A;  1WYC A;  4E6X A;  1FCO A;  2X71 A;  4K91 A;  4OVD A;  4K0X A;  4ZAM A;  2H0T A;  3ITA A;  5G18 A;  1LHY A;  4QY6 A;  4Q8I A;  1KGF A;  5FAO A;  1G68 A;  3ZHH A;  1CEF A;  4U0T A;  1Z6F A;  5A90 A;  4WZ4 A;  3OPP A;  4OPR A;  1DJA A;  3G31 A;  2C6W B;  4N1H A;  5KMW A;  1BTL A;  3ZDJ A;  3BRM A;  3SS5 A;  5FSR A;  4OOY A;  2WZZ A;  3VP4 A;  3BEC A;  1NZO A;  2OLV A;  3UPN A;  3VFH A;  3N7W A;  4OLG A;  2WYX A;  1MKI A;  3Q7Z A;  3UPP A;  3HRE A;  1YLZ A;  4WZ5 A;  4KG2 A;  4FH2 A;  1RP5 A;  3RXW A;  4E3K A;  3OCL A;  1SHV A;  2ZQC A;  4MEZ A;  5FAS A;  5I94 A;  2Y2N A;  3PBN A;  3M2J A;  4O7D A;  1KE4 A;  4ZTK A;  3PTE A;  2EXA A;  4EV4 A;  4FD8 A;  3W4Q A;  4XUX A;  2XF3 A;  4KZ4 A;  3ZG8 B;  1JTD A;  4QY5 A;  4RX2 A;  5E2H A;  2Y2Q A;  3SH8 A;  5HAQ A;  2A49 A;  5U47 A;  3N8S A;  2A3U A;  3VSK A;  3HLB A;  1BUE A;  2DRW A;  3VP0 A;  1YQS A;  2V20 A;  2ZC7 A;  3MZE A;  1LL9 A;  2X01 A;  4QB8 A;  5CHJ A;  2WAE A;  4RYE A;  2R9W A;  4D2O A;  4Y0T A;  1PI5 A;  5CXW A;  5DTS A;  3WS2 A;  1PIO A;  4KZ3 A;  4QJG A;  4KG6 A;  1J9M A;  2ZQ8 A;  3HUN A;  3NDG A;  5FQJ A;  2QMI A;  1LLB A;  2P74 A;  2V1Z A;  3Q7V A;  1BT5 A;  3GVB A;  2RL3 A;  4IVK A;  2ZM8 A;  3BFC A;  2JC7 A;  2FFY A;  4E3N A;  5FQQ A;  5TGF A;  4RVA A;  3IWI A;  3WS1 A;  3MBZ A;  4EBP A;  1BLP A;  2Y2K A;  5JYO A;  4Y0O A;  1FCM A;  4S2N A;  5FA7 A;  3SS3 A;  5CER A;  4WEK A;  2WZX A;  4BJP A;  1JWP A;  1TDL A;  4BL3 A;  3HLW A;  3ZG9 B;  5HAP A;  2Y2O A;  1VQQ A;  3FKV A;  4WZ5 C;  4UA7 A;  4GDN A;  4WMC A;  5HW3 A;  5E2G A;  5CTM A;  5EVI A;  4R0Q A;  1IYS A;  5EEC A;  3ZNT A;  5F1F A;  3I7J A;  1I2S A;  4HEF A;  4M3K A;  5EVI B;  5CEB A;  2PU4 A;  1SKF A;  2JCH A;  3ZGA B;  2Z2M B;  2Z2L B;  5DVA A;  3WRZ A;  2PBY A;  5A91 A;  4IED A;  2HP9 A;  5FDH A;  1KDW A;  5HX9 A;  2J8Y A;  1W79 A;  5EPH A;  3PAE A;  1YLP A;  4OLD A;  3MZD A;  2J9P A; 
#chains in the Genus database with same CATH topology
 4QHC A;  4RQ9 A;  2XR0 A;  4I38 A;  5EOE A;  4GKU A;  4OPY A;  3FG8 A;  4S2M A;  2M7V A;  3G32 A;  2B5R A;  3QNC A;  3IH8 A;  4YIN A;  4BD0 A;  1GHP A;  4KZB A;  2KOI A;  2WKQ A;  3HLE A;  3B42 A;  4CLC C;  2G7U A;  1SKO B;  5DJU A;  3LIE A;  3OPH A;  3PBO A;  3LIC A;  3NJA A;  3MF0 A;  2HGV A;  3W2Z A;  2J9O A;  5CRF A;  2K31 A;  2VK3 A;  4WYY A;  2GDN A;  4MN6 A;  3ZCZ A;  3LCE A;  4H6J B;  1TVF A;  1U60 A;  1W8Y A;  3S1Y A;  5HPF A;  3ZG7 B;  4PMA A;  3GQZ A;  1BSG A;  2Y2J A;  5IHV A;  4EXO A;  5L2F A;  4I39 A;  4R3B A;  2PDR A;  3W4P A;  5TFQ A;  3NOP C;  3R7W B;  1YMX A;  3GMW A;  1EWZ A;  2XQZ A;  3MFD A;  4YNR A;  2NUT C;  3RFB A;  3F1N A;  5M1A A;  1MPL A;  4LV1 A;  3S7Q A;  1OJG A;  3K2N A;  3KSI A;  2W3E A;  4WBG A;  1XP4 A;  3CUE A;  2EFX A;  1FQG A;  1LSX A;  2H0Y A;  5G4Y A;  3FKW A;  1I2W A;  4JPM A;  2GJ3 A;  3DW0 A;  4PM6 A;  3IHA A;  3JVV A;  1L3L A;  2LB9 A;  3G4P A;  1XJ4 A;  5HFO A;  4R6L A;  2MJ6 A;  3NC8 A;  3GTC A;  2ZQ9 A;  3KSF A;  4JGR A;  5CTN A;  3VP1 A;  1FR6 A;  2GZA A;  3SS4 A;  3TOI A;  2BG1 A;  1S6R A;  1A0K A;  1PRQ A;  5M18 A;  1YSP A;  5DFX A;  3LR4 A;  2Y2H A;  2WKH A;  1OT6 A;  1Y28 A;  1ES4 A;  3NHQ A;  3BFD A;  2HP5 A;  3BQ8 A;  4NET A;  4F3L B;  4ARZ A;  2UWX A;  1OJ5 A;  3TE8 A;  5EE8 A;  1Y54 A;  1OME A;  3UNW A;  4N1X A;  3UMD A;  1T19 A;  5FEG A;  5CGW A;  4EQI A;  1XJ3 A;  4YFM A;  3G2Y A;  4JKT A;  3T4S A;  2EX2 A;  5AQA A;  4E6W A;  4S2L A;  1IOU A;  2C5W B;  1XX2 A;  4JF6 A;  4JXS A;  5L07 A;  4UAA A;  3KO6 A;  2Y59 A;  1CI8 A;  4OPZ A;  4LEN A;  3E0Y A;  4BMW A;  4P87 A;  3E2K A;  4E04 A;  1ES2 A;  1ZC2 A;  1RGY A;  2R78 A;  4IVI A;  1IYQ A;  2EFU A;  3IF6 B;  2HDQ A;  2HV1 A;  1NYM A;  5HL6 A;  3QHY A;  5HDC A;  3UE3 A;  4LV3 A;  1KGG A;  3HJK A;  5FI7 A;  3LR0 A;  5KSC A;  1C3B A;  1EI5 A;  5DJT A;  4DE2 A;  1LSV A;  3S7P A;  3JPU A;  3BEB A;  3F1P B;  2WAD A;  4KQQ A;  3Q1F A;  4BLM A;  3LEQ A;  1GSW A;  4NXF A;  3F1O A;  4R70 A;  3ICY A;  2QHK A;  1P9W A;  2KLI A;  2HDU A;  3LI8 A;  4IBX A;  3QP4 A;  1Z09 A;  4DMZ A;  3A3F A;  1XPB A;  5K5B A;  1YSQ A;  4GJ4 A;  4GS9 A;  3LGO A;  2G2U A;  1ACF A;  4E3O A;  2HP6 A;  3MSH A;  5HPI A;  2V8C A;  2WKI A;  4DXB A;  4QU3 A;  2HDR A;  4QWO A;  3NUL A;  1VET B;  4JLF A;  2HZ5 A;  3T12 B;  3GR2 A;  1K54 C;  3CPT B;  3ZVT A;  3ZVW A;  3EGX C;  3MFX A;  3EEA A;  3IF5 A;  4Q0I A;  3CG5 A;  5AVE A;  4HP9 A;  4S2J A;  2Y91 A;  1WYC A;  3RH8 B;  1FCO A;  4K91 A;  4OVD A;  5G18 A;  4Q8I A;  1OTD A;  4QY6 A;  3LIB A;  2VV8 A;  1G68 A;  5A90 A;  3LR3 A;  4L9E A;  3OPP A;  4OPR A;  2C6W B;  4N1H A;  1BTL A;  3ZDJ A;  3BRM A;  2WZZ A;  1NWZ A;  2OLV A;  3N7W A;  3HRE A;  3E4Q A;  3RXW A;  5AJG A;  1IFQ A;  3OCL A;  4E3K A;  4MEZ A;  5FAS A;  4LPZ A;  2Y79 A;  5I94 A;  2Y2N A;  2W1T A;  5EV0 A;  3PTE A;  2EXA A;  5F6A A;  3W4Q A;  1S67 L;  3ZG8 B;  4X1M A;  5U47 A;  3S7O A;  5C5K A;  4LRZ E;  2D02 A;  4QB8 A;  5CHJ A;  3LUQ A;  2R9W A;  3OOV A;  4KZ3 A;  4XT2 A;  1S4S A;  5FQJ A;  3L9K A;  2V1Z A;  1BT5 A;  3GVB A;  3FPV A;  4IVK A;  3BFC A;  2QKP A;  2JC7 A;  2VA0 A;  4CLC A;  4E3N A;  3IWI A;  3WS1 A;  5AVF A;  5FA7 A;  5CER A;  3T1S A;  3IS2 A;  5HAP A;  2Y2O A;  2PD8 A;  2K7S A;  1W63 M;  4UA7 A;  4GDN A;  4R3A A;  4HEF A;  1I2S A;  4M3K A;  5EVI B;  1SKF A;  2JCH A;  1DP8 A;  2Z2M B;  3H7W B;  5DVA A;  3LIF A;  2J8Y A;  3GDI A;  3DBA A;  4BD1 A;  2OWJ A;  2XA7 M;  4KZ9 A;  4HOI A;  4M4X A;  5EM1 A;  1PWD A;  5GLA A;  1ONG A;  4C6Y A;  2KDK A;  4GLQ A;  4L9G A;  2Y2M A;  4EUV A;  3C4P A;  3JYI A;  4EEP A;  4U0X A;  1XKZ A;  1FSY A;  1K25 A;  3NDE A;  4DJ2 A;  1KE3 A;  5KSH A;  3WWX A;  4MN7 A;  3HJI A;  1HD8 A;  2WAF A;  2EX9 A;  4S2N C;  5DTT A;  4GN2 A;  3SW1 A;  1T1C A;  3BM6 A;  3KYZ A;  4R1G A;  1ERM A;  1OT9 A;  2OSU A;  3QP6 A;  2V1B A;  5TR7 A;  3SH9 A;  1ONH A;  2J3T C;  3W4O A;  1DP6 A;  3LR5 A;  2Z6C A;  1TS7 A;  5EM0 A;  4LGW A;  3CIT A;  3HCY A;  2Y2P A;  3MKE A;  1NRJ A;  3B3X A;  1NRF A;  2HDS A;  5EVE A;  1K4E A;  2Y55 A;  3V3S A;  5EUA A;  1PW1 A;  1FCN A;  1FOF A;  1PW8 A;  3T4J A;  1HZO A;  4B93 A;  1JTG A;  5A93 A;  1T1B A;  4MBK A;  5HAI A;  2QWS A;  1N9N A;  4DE0 A;  1W5D A;  4LV2 A;  3K3C A;  3T4O A;  1KDS A;  3LI9 A;  3IWO A;  1SZV A;  2OWH A;  4GB7 A;  3NY4 A;  2WKE A;  1L0D A;  4KZ8 A;  1K57 C;  1RCJ A;  1D06 A;  3NIA A;  5JYP A;  2JKT I;  3M6H A;  5F82 A;  2M7U A;  1K0K A;  1W7F A;  5AQ7 A;  2GX5 A;  3PAG A;  1TS6 A;  1HTZ A;  4EBN A;  4Y0U A;  4ZJ2 A;  2Q0O A;  4WEJ A;  2XDM A;  3KYQ A;  1FSW A;  1S1Y A;  1KVL A;  2EXB A;  2ZC3 B;  3P98 A;  3EEH A;  3C2W A;  1X0O A;  4I3I A;  4CJN A;  2B02 A;  4OOM A;  4DN0 A;  5GLD A;  2P08 A;  2VV7 A;  1KE0 A;  2W3G A;  1OPX A;  3PR6 A;  4KZ7 A;  5J7E A;  3D72 A;  3AGD A;  4JGO A;  1LI0 A;  4OH0 A;  2Y4A A;  4DXC A;  3CPT A;  2XA7 S;  3H82 A;  1PZP A;  1TDG A;  4GD6 A;  2NUP C;  1WYB A;  4Y2F A;  4D60 A;  3T50 A;  3PYP A;  3BFE A;  3IX3 A;  2LB5 A;  3HLG A;  3E2L A;  1XA7 A;  2Y2G A;  4ME4 A;  3LO7 A;  3IH9 A;  1BUL A;  1G6A A;  5F5Y A;  2KX6 A;  1K56 D;  2ZQ7 A;  4G3V A;  4JXW A;  2XH9 A;  2Y2L A;  1IEL A;  4OOL A;  1BLC A;  1STZ A;  2V9A A;  4MBF A;  2FH5 A;  5GLC A;  4P85 A;  1H0M A;  3QNB A;  3UDX A;  5DF7 A;  4EUZ A;  3FWL A;  2JKF A;  1ERO A;  5HAR A;  2ZD8 A;  3OC2 A;  3HLF A;  4EBL A;  1WE4 A;  5L09 A;  4HHD A;  3VOZ A;  4Y3I A;  3BYD A;  4L9F A;  3OLO A;  4HBT A;  1PWC A;  1S4R A;  5TJJ A;  1YAX A;  3T4T A;  5DF8 A;  3W8K A;  1VB6 A;  3MXQ A;  4ZJ1 A;  3PBQ A;  4WN5 A;  1K54 A;  2EWV A;  3ZG5 A;  4JF5 A;  2ZMA A;  2XRN A;  4XXR A;  5L8M A;  1AXB A;  3R4K A;  3BQA A;  5DFY A;  1GHM A;  2V2F F;  4PPR A;  4HH3 A;  3CZD A;  4EWF A;  1ESI A;  5J8X A;  3NOT C;  4IUK A;  1VEU B;  4MNR A;  1IKG A;  5CGX A;  1DP9 A;  4LRX C;  5KZH A;  3T1Q B;  2QJ5 A;  4GZB A;  1YKD A;  1BLH A;  2W3D A;  4OKP A;  4BBU A;  3B33 A;  3DWZ A;  1E25 A;  3N4I A;  4Y5F A;  3RJU A;  2ACG A;  3T1R A;  3IF6 C;  3T4L A;  4WEL A;  4YWZ A;  4JF4 A;  4QD4 A;  2E8J A;  3OPL A;  1FR1 A;  2OOL A;  3BW6 A;  4H8R A;  3UPO A;  1XFN A;  3VMA A;  2YKF A;  1KGE A;  3NEC A;  1V9Y A;  5F1G A;  2WGW A;  1UGU A;  4UEY A;  4X6T A;  4LCM A;  2Y8H A;  5CEC A;  1YT4 A;  5EVL A;  2IWB A;  1XJ6 A;  4LRY C;  4WMC D;  3C5A A;  2PT7 A;  4HIA A;  5EVI D;  3UB9 A;  3C8C A;  1KGF A;  5HD5 A;  1CEF A;  3QP8 A;  4U0T A;  1Z6F A;  3FPW A;  5FEF A;  4WZ4 A;  3A0V A;  2PD7 A;  2VV6 A;  1DJA A;  5FDS A;  5J4E A;  4OOY A;  1NZO A;  4OLG A;  3QP1 A;  3Q7Z A;  4Y13 A;  4FH2 A;  4GCZ A;  2ZQC A;  1AWI A;  2ZL1 B;  4ZTK A;  4EV4 A;  4XUX A;  4QPR A;  4QY5 A;  2Y2Q A;  2WKR A;  3N8S A;  2QJ7 A;  2V20 A;  2ZC7 A;  4HJ3 A;  3C30 A;  2WAE A;  4Y0T A;  4BBV A;  1T18 A;  4QJG A;  2ZQ8 A;  3MJQ A;  1LLB A;  2P74 A;  1CJF A;  2ZM8 A;  2A24 B;  5HSQ A;  4RVA A;  1TD5 A;  1UWN X;  2QYB A;  2Y2K A;  4G3W A;  4S2N A;  4GHI A;  2ZOH A;  4HQA A;  3ZQ5 A;  1VQQ A;  4WZ5 C;  3QP2 A;  5E2G A;  4BBT A;  4R0Q A;  1IYS A;  3ZNT A;  3I7J A;  2PU4 A;  3ZGA B;  2Z2L B;  5CX7 A;  5A91 A;  2O0Y A;  5FDH A;  5EPH A;  4EES A;  3MZD A;  2J9P A;  4PM5 A;  1MWS A;  2VLG A;  4BL2 A;  1P9R A;  2H5S A;  1YPR A;  4K0W A;  3KSH A;  1G6O A;  4S2O A;  5TBM B;  2QPN A;  2W3H A;  3IWQ A;  2L1M A;  1ZG4 A;  2BLS A;  1SCW A;  1MY8 A;  2QZ6 A;  2WGV A;  4ID4 A;  2EWW A;  3N8L A;  1SKO A;  4KQR A;  4BEN A;  5EFW A;  4HBU A;  1DJB A;  1CEG A;  3HLC A;  4GOG A;  3SOI A;  2BAS A;  3IHB A;  3MMH A;  2OV5 A;  4O0P A;  3A0R A;  3NI9 A;  2ZLY A;  3ZG0 A;  3DWK A;  2J3T D;  4OP5 A;  2XK1 A;  4H6J A;  3HUM A;  1VHM A;  5EVI C;  4S2P A;  1JWZ A;  3O86 A;  5E43 A;  1ODV A;  2ZQD A;  4IJG A;  5BOH A;  1MBL A;  2HPB A;  4IHQ A;  1M40 A;  1SDN A;  1K57 A;  5HDD A;  1MXO A;  4HI4 A;  5AQB A;  1PFL A;  1H3Q A;  4XUZ A;  1NZU A;  3R7W A;  1MWR A;  2DNS A;  3DTM A;  4Y15 A;  3MQ0 A;  4DE1 A;  1BZA A;  1YLT A;  4EU0 A;  3GEC A;  1YLY A;  3UN7 A;  2XLN A;  4N9L A;  1FIK A;  3H9W A;  4KUK A;  3E4P A;  2J3W A;  4WLA A;  4HES A;  3ISG A;  1ZG6 A;  2JKG A;  3FV7 A;  4P6B A;  4EET B;  3LY4 A;  3VOL A;  3BJN A;  5A92 A;  3KYE A;  4EQ1 A;  1K6R A;  1W8Q A;  4UA9 A;  3Q7V B;  3V5M A;  4I3J A;  5AQ9 A;  3UE1 A;  3LIA A;  2O9C A;  4MDZ A;  1F2K A;  2J7V A;  4B4Z A;  3HBR A;  3HUO A;  4WM9 A;  1S66 L;  1L0G A;  1NJ4 A;  3TG9 A;  2WUQ A;  3NBL A;  2W1R A;  1S0W A;  3VE4 A;  2H10 A;  3UDF A;  3UME A;  1GSV A;  3V50 A;  3MXS A;  1NLZ A;  3A3D A;  1XA1 A;  5FAT A;  3Q82 A;  2W27 A;  3BLS A;  4S2K A;  3FYZ A;  2VX8 A;  2JKR I;  4NXG A;  4LLO B;  5FQI A;  3MQQ A;  2ZC5 B;  5LBR A;  1KOU A;  5F83 A;  1K4F A;  4ETZ A;  4F3L A;  2A2L A;  2VKS A;  5HD3 A;  1KVM A;  5GHZ A;  4PM9 A;  5GLB A;  4Q0J A;  4KQO A;  3SH7 A;  3EGD C;  3S22 A;  2CC1 A;  1FIL A;  4KZ6 A;  5DF9 A;  4ZJ3 A;  2Y2I A;  3C7U A;  1LI9 A;  5IT5 A;  1ALQ A;  1SDE A;  4ETX A;  3UDI A;  1IEM A;  3M2K A;  1T1A A;  5DKL A;  2OLU A;  3PBS A;  3MKF A;  3BFF A;  1G28 A;  3CI6 A;  3TW8 A;  2R9X A;  3BFG A;  4KZA A;  2P9V B;  2O9A A;  3ZFZ A;  4FTX A;  5FAP A;  4A5R A;  5CHM A;  4O01 A;  1CI9 A;  1O07 A;  3ZYT A;  4K08 A;  4PHT A;  1D7E A;  3VE3 A;  3CWF A;  4MLL A;  1L0E A;  2D01 A;  1NY0 A;  2DCF A;  2YKH A;  2P7J A;  3UY6 A;  3IF6 A;  3G2Z A;  4GDB A;  1LT0 A;  4HY8 A;  2OAP 1;  3C38 A;  3U2A A;  3UB8 A;  5CED A;  1K55 C;  1CK3 A;  4RA7 A;  1YMS A;  3VOY A;  4FOF A;  4UHU A;  4PM7 A;  4E3M A;  4NK3 A;  1UWP X;  5DKK A;  3F1P A;  2XFT A;  2W0N A;  3G6O A;  2WGI A;  3N6I A;  2Z6D A;  2A24 A;  1GCE A;  4NEE D;  3F1O B;  3WS5 A;  4DDY A;  1H8Z A;  5GHY A;  2J80 A;  3CJM A;  4OQH A;  3UB6 A;  1F9I A;  4E3L A;  1N4O A;  1DY6 A;  5FAQ A;  3EQV A;  4MBH A;  4P0M A;  4GS9 B;  2JKT M;  3UO9 A;  2PR5 A;  3OCN A;  3D3O A;  4R3J A;  4DJ3 A;  5HZH A;  1K56 A;  2AVX A;  4KG5 A;  2OAQ 1;  1H5X A;  2V0W A;  1VET A;  3EWK A;  3PXP A;  3V3R A;  4EEU A;  3PBT A;  1OTB A;  4WF0 A;  4ZDX A;  4F94 A;  5TBM A;  4PKY A;  5GL9 A;  4HNB A;  1M6K A;  4S2I A;  1TF1 A;  5FI6 A;  3L7H A;  5M19 A;  2M1C A;  1EW0 A;  3A3E A;  2ZM0 A;  5HWT A;  2P04 A;  2PU2 A;  3PHY A;  4II7 A;  4BWI A;  4E6X A;  3A0S A;  2X71 A;  4EW7 A;  4K0X A;  2H0T A;  3ITA A;  2B18 A;  4PAU A;  3ULF A;  3G31 A;  5HDS A;  4MN5 A;  3SS5 A;  3UPN A;  3VFH A;  2V1A A;  4YOF A;  1MKI A;  3UPP A;  4WZ5 A;  1P97 A;  1YLZ A;  4KG2 A;  4AFI A;  2PRF A;  4HJ6 A;  1SHV A;  4O7D A;  1KE4 A;  2W1T B;  4FD8 A;  4CLC E;  1JTD A;  4RX2 A;  3SH8 A;  2A49 A;  1MZU A;  2A3U A;  3VSK A;  1BUE A;  2DRW A;  2VGL M;  3VP0 A;  3BY9 A;  4LFU A;  1LL9 A;  4NKP A;  3IX8 A;  5DTS A;  1PIO A;  3HUN A;  3NDG A;  2QMI A;  4XT2 B;  3Q7V A;  1BYW A;  2RL3 A;  5FQQ A;  5IS1 A;  3MR0 A;  4CLC B;  3RTY A;  3MBZ A;  1FCM A;  4WEK A;  3KSG A;  4BJP A;  1TDL A;  5HWV A;  3HLW A;  3IS2 B;  3FKV A;  3MQO A;  4EER A;  4GW9 A;  4WMC A;  5HW3 A;  5EVI A;  4O8G A;  5EEC A;  1W63 Q;  3H7W A;  5CEB A;  5F68 A;  3WRZ A;  2PBY A;  3B47 A;  2HP9 A;  1WA9 A;  3P7N A;  2O9B A;  3O5Y A;  4R23 A;  3KX0 X;  1YLJ A;  3DTI A;  3IQA A;  3VFF A;  2EA9 A;  2UV0 E;  2V8F A;  3VP3 A;  2INW A;  1TS8 A;  3MXR A;  2JE5 A;  5E2E A;  3EOI A;  4PM8 A;  3ITB A;  2VEA A;  1GA9 A;  1JWV A;  4FCF A;  5FQ9 A;  2XFS A;  3CHW P;  4KEN B;  3T4K A;  3IBR A;  3DTE A;  2W3F A;  2L4R A;  3TRC A;  2GNX A;  1H8Y A;  3BLM A;  4X55 A;  1GSX A;  2XEP A;  4X69 A;  3LY3 A;  1PWG A;  4N92 A;  4X56 A;  3TSG A;  3GV9 A;  4JGQ A;  3JVU A;  1ES5 A;  1DJC A;  4E3J A;  3LFV A;  2P9V A;  1LL5 A;  3IXH A;  2PR6 A;  4Z9Q A;  4B88 A;  2PAV P;  1MKM A;  3UE0 A;  3CAX A;  3A3I A;  5FQM A;  5I5L A;  4C3Q A;  4DRT A;  5DTK A;  3UB7 A;  1E3U A;  4HH2 A;  3T1X A;  4OPQ A;  4OON A;  2WK0 A;  1J3W A;  1V9Z A;  1G5U A;  4KUO A;  2XGN A;  1IYP A;  1QMF A;  3HLD A;  3OZH A;  3IT9 A;  1PYY A;  1K38 A;  3G35 A;  3GSG A;  4ESP A;  3IBJ A;  3O88 A;  1HVB A;  1GHI A;  3IXD A;  5CHU A;  1RGZ A;  1OTE A;  3O87 A;  2VGL S;  1LSW A;  5FI2 A;  3E98 A;  4LCL A;  3T4Q A;  4JBF A;  1CF0 A;  4Q0H A;  2IA2 A;  4FH4 A;  2I9V A;  4HP4 A;  3RXX A;  3V67 A;  3LID A;  2O99 A;  2Q9N A;  3S7N A;  1OTI A;  4UQI M;  3CLO A;  2I72 A;  3MS6 A;  4RX3 A;  1XGI A;  4U3T A;  1E3U D;  4JXG A;  5HL1 A;  3WS4 A;  3D9Y A;  1NYY A;  1NLY A;  1LL8 A;  5D3O A;  1L0F A;  4UA6 A;  2PYP A;  3HVF A;  5F69 A;  4B9O A;  1JVJ A;  2V0U A;  3CUE C;  2ZM2 A;  1ESU A;  1Q2P A;  4G3K A;  1GA0 A;  1OTA A;  2XD5 A;  1CQA A;  1H8M A;  2CMN A;  1XFQ A;  3EQU A;  1Q2Q A;  2IWD A;  4DKI A;  4E3I A;  4X25 A;  1JNU A;  3OBF A;  3WRT A;  4R4S A;  5KIZ A;  2FZ0 A;  1ZKJ A;  2RCX A;  3IXG A;  2WKP A;  3VSL A;  3BWL A;  3Q07 A;  1K55 A;  3H82 B;  5EOO A;  1F98 A;  3ZNY A;  4BQM A;  4KZ5 A;  3GRJ A;  4JGP A;  4NG2 A;  1IYO A;  2ZBB A;  4NXE A;  2HF6 A;  4Y17 A;  1L2S A;  5L10 A;  3AGF A;  4P6Z M;  1MWT A;  4LV0 A;  3FC7 A;  2ZOI A;  3IXB A;  2X02 A;  3M6B A;  4JXV A;  3Q81 A;  4PKY G;  1TEM A;  2FFF B;  1IKI A;  3O3V A;  3F1N B;  1K6S A;  3AGE A;  1Y4O A;  2VGJ A;  4CPK A;  1P0Z A;  3G34 A;  2JHE A;  4DDS A;  1XGJ A;  1ERQ A;  4OQI A;  3K3D A;  1VM1 A;  4N9K A;  5E2F A;  3MZF A;  4DE3 A;  4CQH A;  3N8R A;  4GD8 A;  4WUJ A;  3NCK A;  1O7E A;  2H28 A;  4MMN A;  3OPR A;  4X68 A;  2XRO A;  3NOU C;  4GNU A;  3PBR A;  2G2W A;  4OQG A;  1N9B A;  2EX6 A;  2ZMF A;  2BTF P;  5J3W A;  1QME A;  4ZBE A;  2HJE A;  1D1J A;  4L0L A;  1BLS A;  2DMW A;  3HL9 A;  4IUH A;  2XD1 A;  3UE6 A;  2B95 A;  5GHX A;  1E4D A;  3FZC A;  4OQ0 A;  3UB5 P;  2IWC A;  1VEU A;  5FQK A;  3P01 A;  2JBF A;  3V39 A;  1YM1 A;  3WS0 A;  2ZC4 B;  4B4X A;  4X53 A;  2E8I A;  1ES3 A;  2EX8 A;  4FUW A;  3G30 A;  5MC7 A;  1YLW A;  4Y7P A;  4IBR A;  3LEZ A;  4KQD A;  4UQI S;  3A3J A;  2K2N A;  1N9L A;  1NXY A;  3BY8 A;  3VP2 A;  2ZMV A;  1PI4 A;  5CGS A;  1PZO A;  1MWU A;  3D4F A;  4ARZ B;  3C4O A;  1N9O A;  4FSF A;  1I5Q A;  2Q9M A;  3LYX A;  3IX4 A;  1XXM A;  4OP8 A;  2ZQA A;  3P09 A;  3S4X A;  2JKR M;  3CMZ A;  4CLC D;  4DF6 A;  2WGW B;  2ZJ9 A;  1XJ2 A;  3U4L P;  4X1L A;  2PBD P;  2XSS A;  2VGK A;  4C75 A;  3TJZ C;  3E4O A;  2HJ9 C;  3C7V A;  2ZC6 B;  4R4R A;  4ZAM A;  1LHY A;  5FAO A;  3ZHH A;  1F5M A;  2PHY A;  3VV4 A;  1S1Z A;  1PNE A;  2VZW A;  5G4Z A;  5KMW A;  5FSR A;  4I5S A;  1MC0 A;  3VP4 A;  3BEC A;  2VJW A;  2WYX A;  1RP5 A;  2ZL1 A;  4P6Z S;  3PBN A;  3M2J A;  5FL3 A;  2XF3 A;  3DTK A;  4KZ4 A;  1HLU P;  5E2H A;  1ZHH B;  5HWW A;  5HAQ A;  2JN7 A;  2PYR A;  3HLB A;  1DRM A;  4HJ4 A;  1YQS A;  5A8B A;  3MZE A;  2X01 A;  4RYE A;  4D2O A;  1PI5 A;  4I3A A;  5CXW A;  3WS2 A;  3QP5 A;  4KG6 A;  1J9M A;  2L0W A;  2FFY A;  4WL9 A;  5TGF A;  4EBP A;  1BLP A;  3SZT A;  5JYO A;  4Y0O A;  5IU1 A;  3SS3 A;  1TS0 A;  2WZX A;  1JWP A;  4R38 A;  4BL3 A;  4GHI B;  3ZG9 B;  4NXB A;  5CTM A;  3DAV A;  5F1F A;  4Z1W A;  1ZTU A;  4IED A;  4ZRR A;  4MCW A;  1KDW A;  5HX9 A;  1W79 A;  3PAE A;  1YLP A;  4OLD A; 
#chains in the Genus database with same CATH homology
 4QHC A;  2XR0 A;  5EOE A;  3IQA A;  4BD1 A;  4PM5 A;  3VFF A;  4DXC A;  4GKU A;  1MWS A;  4OPY A;  4KZ9 A;  5DTT A;  4BL2 A;  3VP3 A;  1PWD A;  2H5S A;  5GLA A;  4S2M A;  1ONG A;  3MXR A;  2JE5 A;  4K0W A;  5E2E A;  4C6Y A;  4S2O A;  3G32 A;  2QPN A;  2Y2M A;  3IWQ A;  3C4P A;  2B5R A;  3QNC A;  3IH8 A;  1ZG4 A;  4PM8 A;  4YIN A;  2BLS A;  4BD0 A;  1SCW A;  1GHP A;  1MY8 A;  2QZ6 A;  3JYI A;  2WGV A;  1XKZ A;  4KZB A;  4U0X A;  1FSY A;  3HLE A;  1K25 A;  3ITB A;  4ID4 A;  3N8L A;  3NDE A;  4KQR A;  4BEN A;  1KE3 A;  4HBU A;  5KSH A;  1DJB A;  3WWX A;  1CEG A;  1HD8 A;  3HLC A;  1GA9 A;  2WAF A;  1JWV A;  2EX9 A;  3OPH A;  3PBO A;  4FCF A;  3BM6 A;  2XFS A;  4GN2 A;  4GOG A;  4S2N C;  4R1G A;  5FQ9 A;  3SOI A;  3IHB A;  1ERM A;  2J9O A;  4KEN B;  2OV5 A;  5CRF A;  3NI9 A;  2ZLY A;  3ZG0 A;  3DWK A;  2OSU A;  2GDN A;  1YLJ A;  4WYY A;  4OP5 A;  2XK1 A;  5EVI C;  3HUM A;  3ZCZ A;  3LCE A;  5TR7 A;  1H8Y A;  3BLM A;  4S2P A;  1TVF A;  4X55 A;  1JWZ A;  1U60 A;  3SH9 A;  1W8Y A;  3O86 A;  3S1Y A;  2XEP A;  4X69 A;  1ONH A;  3LY3 A;  5E43 A;  3W4O A;  1PWG A;  4N92 A;  4X56 A;  3ZG7 B;  4PMA A;  2ZQD A;  3TSG A;  3GV9 A;  5BOH A;  1MBL A;  2HPB A;  1ES5 A;  1M40 A;  1SDN A;  3GQZ A;  1BSG A;  1K57 A;  2Y2J A;  5IHV A;  1MXO A;  1DJC A;  4E3J A;  5L2F A;  5AQB A;  2Y2P A;  3MKE A;  4XUZ A;  4R3B A;  2P9V A;  1NZU A;  1LL5 A;  3B3X A;  3IXH A;  1NRF A;  2HDS A;  3W4P A;  1MWR A;  1K4E A;  2DNS A;  4Z9Q A;  5TFQ A;  3DTM A;  1YMX A;  2Y55 A;  3GMW A;  1EWZ A;  4B88 A;  3V3S A;  4DE1 A;  2XQZ A;  1BZA A;  3MFD A;  1YLT A;  3UE0 A;  3A3I A;  5EUA A;  5FQM A;  5M1A A;  1PW1 A;  1MPL A;  1YLY A;  4C3Q A;  1FCN A;  1FOF A;  3UN7 A;  2XLN A;  1PW8 A;  4N9L A;  4DRT A;  4LV1 A;  5DTK A;  1E3U A;  4OPQ A;  1HZO A;  4HES A;  3ISG A;  1ZG6 A;  1JTG A;  4OON A;  3FV7 A;  4P6B A;  5A93 A;  2WK0 A;  4MBK A;  4WBG A;  5HAI A;  1XP4 A;  2EFX A;  3LY4 A;  4DE0 A;  1FQG A;  1W5D A;  2H0Y A;  4LV2 A;  2XGN A;  1IYP A;  3FKW A;  1QMF A;  3HLD A;  1I2W A;  4JPM A;  3OZH A;  5A92 A;  3IT9 A;  1PYY A;  1K38 A;  1K6R A;  1W8Q A;  3G35 A;  3GSG A;  4UA9 A;  1KDS A;  3DW0 A;  3Q7V B;  3V5M A;  4PM6 A;  3IHA A;  5AQ9 A;  3O88 A;  1HVB A;  1GHI A;  3IXD A;  3IWO A;  4GB7 A;  5CHU A;  3G4P A;  3NY4 A;  3UE1 A;  2WKE A;  1RGZ A;  5HFO A;  1L0D A;  3O87 A;  4KZ8 A;  1K57 C;  3NC8 A;  1RCJ A;  2J7V A;  3GTC A;  2ZQ9 A;  4B4Z A;  3HBR A;  3HUO A;  4WM9 A;  5FI2 A;  1L0G A;  1NJ4 A;  3NIA A;  4LCL A;  5JYP A;  3M6H A;  4JBF A;  3TG9 A;  2WUQ A;  3NBL A;  5F82 A;  4FH4 A;  3RXX A;  1W7F A;  1S0W A;  5AQ7 A;  2Q9N A;  5CTN A;  3ZFZ A;  3PAG A;  3VP1 A;  1FR6 A;  2H10 A;  2I72 A;  4RX3 A;  3UDF A;  1XGI A;  4U3T A;  3SS4 A;  3V50 A;  1HTZ A;  1E3U D;  4JXG A;  4EBN A;  5HL1 A;  3MXS A;  3WS4 A;  4Y0U A;  1NYY A;  3TOI A;  2BG1 A;  3A3D A;  1XA1 A;  5FAT A;  4ZJ2 A;  4WEJ A;  1S6R A;  3Q82 A;  2XDM A;  5D3O A;  1L0F A;  1FSW A;  3BLS A;  5M18 A;  1KVL A;  4UA6 A;  3HVF A;  4S2K A;  3FYZ A;  2EXB A;  2ZC3 B;  1JVJ A;  2Y2H A;  3P98 A;  2WKH A;  5FQI A;  2ZM2 A;  1ES4 A;  2ZC5 B;  1ESU A;  3BFD A;  4CJN A;  2HP5 A;  1Q2P A;  5F83 A;  1K4F A;  1GA0 A;  2XD5 A;  1KVM A;  4NET A;  5GHZ A;  4OOM A;  5GLD A;  3EQU A;  1Q2Q A;  2IWD A;  4PM9 A;  4DKI A;  4E3I A;  5GLB A;  1KE0 A;  2UWX A;  4KQO A;  4KZ7 A;  3SH7 A;  3WRT A;  3S22 A;  4R4S A;  5EE8 A;  3AGD A;  2CC1 A;  1Y54 A;  1LI0 A;  2RCX A;  1ZKJ A;  2Y4A A;  3IXG A;  4KZ6 A;  2Y2I A;  3C7U A;  1LI9 A;  4OH0 A;  5DF9 A;  4ZJ3 A;  1OME A;  3UNW A;  3VSL A;  4N1X A;  1ALQ A;  1PZP A;  1SDE A;  1TDG A;  3UDI A;  1IEM A;  3Q07 A;  4GD6 A;  1K55 A;  1WYB A;  5EOO A;  5CGW A;  4EQI A;  3M2K A;  3BFE A;  3ZNY A;  2OLU A;  4BQM A;  3HLG A;  3PBS A;  4KZ5 A;  3E2L A;  3GRJ A;  4YFM A;  3MKF A;  3BFF A;  1XA7 A;  3G2Y A;  1IYO A;  2Y2G A;  3LO7 A;  3IH9 A;  1L2S A;  4JKT A;  1BUL A;  1G6A A;  3AGF A;  2EX2 A;  5AQA A;  4E6W A;  4S2L A;  2R9X A;  1MWT A;  2C5W B;  3BFG A;  1XX2 A;  4KZA A;  4LV0 A;  2ZQ7 A;  1K56 D;  3IXB A;  2P9V B;  4JF6 A;  4JXS A;  4JXW A;  2X02 A;  2XH9 A;  5FAP A;  3M6B A;  2Y2L A;  4UAA A;  1IEL A;  5CHM A;  4A5R A;  4JXV A;  4OOL A;  1CI9 A;  1BLC A;  1O07 A;  4MBF A;  2Y59 A;  1CI8 A;  4OPZ A;  5GLC A;  4P85 A;  3Q81 A;  1TEM A;  2FFF B;  4LEN A;  1IKI A;  3O3V A;  3QNB A;  4P87 A;  1K6S A;  3UDX A;  4MLL A;  5DF7 A;  1L0E A;  3E2K A;  4EUZ A;  3FWL A;  1ES2 A;  1ZC2 A;  3AGE A;  1NY0 A;  2DCF A;  2VGJ A;  1RGY A;  1ERO A;  4IVI A;  1IYQ A;  4CPK A;  5HAR A;  2ZD8 A;  3OC2 A;  3G34 A;  3UY6 A;  3IF6 A;  4DDS A;  3G2Z A;  1XGJ A;  3HLF A;  2EFU A;  1ERQ A;  4EBL A;  3IF6 B;  4GDB A;  2HDQ A;  4OQI A;  1VM1 A;  4N9K A;  1WE4 A;  5E2F A;  3MZF A;  4DE3 A;  1NYM A;  1K55 C;  3VOZ A;  5CED A;  3N8R A;  1CK3 A;  3BYD A;  4GD8 A;  4RA7 A;  3QHY A;  1YMS A;  4HBT A;  1PWC A;  3VOY A;  3NCK A;  1O7E A;  3UE3 A;  3OPR A;  4LV3 A;  1KGG A;  4X68 A;  4UHU A;  4GNU A;  4PM7 A;  5DF8 A;  3PBR A;  2G2W A;  3W8K A;  4NK3 A;  5FI7 A;  4E3M A;  4ZJ1 A;  3PBQ A;  4OQG A;  1N9B A;  2EX6 A;  5KSC A;  1C3B A;  1EI5 A;  4DE2 A;  1QME A;  1K54 A;  3ZG5 A;  3BEB A;  2ZMA A;  4JF5 A;  2WAD A;  4ZBE A;  4XXR A;  4R23 A;  2XFT A;  4KQQ A;  3Q1F A;  4L0L A;  1BLS A;  2WGI A;  1AXB A;  3HL9 A;  2XD1 A;  4BLM A;  3N6I A;  1GCE A;  1GHM A;  2V2F F;  4PPR A;  5GHX A;  3CZD A;  1E4D A;  3FZC A;  4OQ0 A;  2IWC A;  4EWF A;  3WS5 A;  5FQK A;  2JBF A;  1ESI A;  3V39 A;  1H8Z A;  5GHY A;  2HDU A;  4DDY A;  5J8X A;  3CJM A;  4IBX A;  4MNR A;  4OQH A;  1IKG A;  5CGX A;  1YM1 A;  3A3F A;  4E3L A;  1XPB A;  1N4O A;  3WS0 A;  2ZC4 B;  4B4X A;  5KZH A;  1DY6 A;  5FAQ A;  3EQV A;  4GZB A;  4MBH A;  4X53 A;  2E8I A;  1BLH A;  1ES3 A;  2G2U A;  4P0M A;  4OKP A;  2EX8 A;  3DWZ A;  3N4I A;  1E25 A;  3RJU A;  4E3O A;  2HP6 A;  3IF6 C;  3UO9 A;  3G30 A;  3OCN A;  4WEL A;  1YLW A;  4R3J A;  4Y7P A;  4IBR A;  3LEZ A;  1K56 A;  4JF4 A;  4QD4 A;  4KG5 A;  2WKI A;  3A3J A;  1NXY A;  3VP2 A;  4DXB A;  1H5X A;  4QU3 A;  3OPL A;  1FR1 A;  2HDR A;  1PI4 A;  5CGS A;  1PZO A;  3V3R A;  1MWU A;  3D4F A;  4H8R A;  3C4O A;  4JLF A;  4FSF A;  1I5Q A;  2Q9M A;  3UPO A;  3PBT A;  1XXM A;  4OP8 A;  4ZDX A;  2ZQA A;  3P09 A;  3GR2 A;  3VMA A;  3S4X A;  4F94 A;  1K54 C;  1KGE A;  5F1G A;  3CMZ A;  2WGW A;  5GL9 A;  4DF6 A;  2WGW B;  4X6T A;  1M6K A;  4S2I A;  4LCM A;  2ZJ9 A;  5FI6 A;  3ZVT A;  5CEC A;  1YT4 A;  3ZVW A;  5M19 A;  3A3E A;  2VGK A;  2ZM0 A;  4C75 A;  2PU2 A;  5EVL A;  3IF5 A;  3CG5 A;  2IWB A;  3C7V A;  4WMC D;  4S2J A;  2ZC6 B;  2Y91 A;  3C5A A;  5EVI D;  4R4R A;  1WYC A;  4E6X A;  1FCO A;  2X71 A;  4K91 A;  4OVD A;  4K0X A;  4ZAM A;  2H0T A;  3ITA A;  5G18 A;  1LHY A;  4QY6 A;  4Q8I A;  1KGF A;  5FAO A;  1G68 A;  3ZHH A;  1CEF A;  4U0T A;  1Z6F A;  5A90 A;  4WZ4 A;  3OPP A;  4OPR A;  1DJA A;  3G31 A;  2C6W B;  4N1H A;  5KMW A;  1BTL A;  3ZDJ A;  3BRM A;  3SS5 A;  5FSR A;  4OOY A;  2WZZ A;  3VP4 A;  3BEC A;  1NZO A;  2OLV A;  3UPN A;  3VFH A;  3N7W A;  4OLG A;  2WYX A;  1MKI A;  3Q7Z A;  3UPP A;  3HRE A;  1YLZ A;  4WZ5 A;  4KG2 A;  4FH2 A;  1RP5 A;  3RXW A;  4E3K A;  3OCL A;  1SHV A;  2ZQC A;  4MEZ A;  5FAS A;  5I94 A;  2Y2N A;  3PBN A;  3M2J A;  4O7D A;  1KE4 A;  4ZTK A;  3PTE A;  2EXA A;  4EV4 A;  4FD8 A;  3W4Q A;  4XUX A;  2XF3 A;  4KZ4 A;  3ZG8 B;  1JTD A;  4QY5 A;  4RX2 A;  5E2H A;  2Y2Q A;  3SH8 A;  5HAQ A;  2A49 A;  5U47 A;  3N8S A;  2A3U A;  3VSK A;  3HLB A;  1BUE A;  2DRW A;  3VP0 A;  1YQS A;  2V20 A;  2ZC7 A;  3MZE A;  1LL9 A;  2X01 A;  4QB8 A;  5CHJ A;  2WAE A;  4RYE A;  2R9W A;  4D2O A;  4Y0T A;  1PI5 A;  5CXW A;  5DTS A;  3WS2 A;  1PIO A;  4KZ3 A;  4QJG A;  4KG6 A;  1J9M A;  2ZQ8 A;  3HUN A;  3NDG A;  5FQJ A;  2QMI A;  1LLB A;  2P74 A;  2V1Z A;  3Q7V A;  1BT5 A;  3GVB A;  2RL3 A;  4IVK A;  2ZM8 A;  3BFC A;  2JC7 A;  2FFY A;  4E3N A;  5FQQ A;  5TGF A;  4RVA A;  3IWI A;  3WS1 A;  3MBZ A;  4EBP A;  1BLP A;  2Y2K A;  5JYO A;  4Y0O A;  1FCM A;  4S2N A;  5FA7 A;  3SS3 A;  5CER A;  4WEK A;  2WZX A;  4BJP A;  1JWP A;  1TDL A;  4BL3 A;  3HLW A;  3ZG9 B;  5HAP A;  2Y2O A;  1VQQ A;  3FKV A;  4WZ5 C;  4UA7 A;  4GDN A;  4WMC A;  5HW3 A;  5E2G A;  5CTM A;  5EVI A;  4R0Q A;  1IYS A;  5EEC A;  3ZNT A;  5F1F A;  3I7J A;  1I2S A;  4HEF A;  4M3K A;  5EVI B;  5CEB A;  2PU4 A;  1SKF A;  2JCH A;  3ZGA B;  2Z2M B;  2Z2L B;  5DVA A;  3WRZ A;  2PBY A;  5A91 A;  4IED A;  2HP9 A;  5FDH A;  1KDW A;  5HX9 A;  2J8Y A;  1W79 A;  5EPH A;  3PAE A;  1YLP A;  4OLD A;  3MZD A;  2J9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...