3Q7ZA

Cbap-acylated blar1 sensor domain from staphylococcus aureus
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
252
structure length
252
Chain Sequence
QSITDYNYKKPLHNDYQILDKSKIFGSNSGSFVMYSMAADAYYIYNEKESRKRYSPNSTYKIYLAMFGLDRHIINDENSRMSWNHKHYPFDAWNKEQDLNTAMQNSVNWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWMEDSLKISNLEQVIVFKNMMEQNNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIVNGKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase regulator/antibiotic
molecule keywords Beta-lactamase regulatory protein BlaR1
publication title Lysine Nzeta-decarboxylation switch and activation of the beta-lactam sensor domain of BlaR1 protein of methicillin-resistant Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 85
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3q7zA00
2DRWA 4RVAA 5FATA 3W4PA 1RP5A 5AQ9A 4WZ4A 4KZAA 2JE5A 1O7EA 1VQQA 4R4RA 4N9KA 4UHUA 4JKTA 4E3NA 3WS2A 5FQ9A 5HX9A 1PWCA 4Z9QA 5CEBA 4XXRA 5EE8A 1ESIA 1ES2A 2WUQA 3C7UA 3AGEA 5DF9A 4WELA 3ZGAB 2G2WA 1KE0A 2ZJ9A 3MBZA 4Y7PA 2J9OA 3M6HA 3PBNA 2EX8A 3HLCA 4DE2A 1CK3A 1HD8A 2EX2A 3IF5A 5KZHA 4R4SA 1HTZA 1MWRA 1SDEA 4GKUA 1YLZA 5EVIA 3E2LA 5KSCA 1L0DA 3IHAA 3UDXA 4E3KA 2Y91A 3G4PA 4DXBA 4X53A 3BRMA 3IWQA 5E2GA 4BD1A 5CXWA 3HLGA 3ITAA 3ZNTA 1K57C 3A3JA 1W5DA 4RX2A 3IWIA 4RA7A 2VGJA 3QNCA 3VSKA 3GQZA 2H5SA 4E3MA 1K54A 3C4PA 1VM1A 3W8KA 2WGVA 1MKIA 3GTCA 4QY6A 4Y0TA 3CMZA 5CECA 1KVLA 1K4FA 3FV7A 2Y2KA 4KQQA 2J8YA 3IF6C 4OP8A 4PPRA 1TEMA 4U0TA 4WZ5C 4GB7A 5F1GA 3UE3A 3ZNYA 4QB8A 5CRFA 1ERQA 1XXMA 1FCNA 4N9LA 5GLBA 1BULA 4BL2A 1H8YA 4GDBA 4S2MA 1SHVA 4KZBA 3NIAA 2Y4AA 2XFSA 3OCNA 2WK0A 3PBTA 1GA9A 1N9BA 3IXHA 4S2NA 3HLWA 2WKEA 3S1YA 4ZTKA 1YMSA 2WKIA 3HLBA 4LCMA 3NCKA 2WYXA 3ZFZA 4GD8A 3UDIA 4U3TA 4OPZA 3UY6A 1LI9A 1PYYA 5GLAA 2HDQA 5HARA 4C6YA 1ES4A 3WRZA 2A49A 3IQAA 5L2FA 5HW3A 3UPPA 4CPKA 1IYSA 2OLVA 1CI9A 2XGNA 3LCEA 4RX3A 3HVFA 5FQMA 4WMCD 3Q7VB 1AXBA 4FH4A 3C4OA 3ZG0A 1MWUA 3O88A 3GMWA 1XGIA 1IKGA 4XUXA 2XD5A 1JTGA 2HDUA 4BD0A 3MXSA 5E2HA 2ZMAA 4PM5A 1LHYA 4JF6A 4YINA 4EV4A 1BSGA 4B4ZA 1NXYA 1XX2A 3Q81A 1K56A 1IELA 2Y2GA 1NZUA 4UA9A 3WS1A 2ZLYA 1FCOA 3NBLA 3HLDA 4N92A 2PU4A 1MY8A 3N7WA 1JWPA 5HAQA 1E4DA 4QJGA 1ONHA 4MBFA 5FASA 4ZDXA 2P9VA 4QY5A 2Y59A 5AQAA 5TFQA 1DJBA 3N8SA 3OC2A 5DF7A 4JF4A 4DE3A 4CJNA 2XLNA 1EROA 2XK1A 2QMIA 4OKPA 4OQHA 2QZ6A 4FH2A 3IH8A 4LCLA 2WGWB 3GVBA 4X6TA 4RYEA 4EQIA 4MEZA 1WYCA 3ITBA 3HREA 3IHBA 1W7FA 1LLBA 1I5QA 3FZCA 5EUAA 3VP1A 1N4OA 3QHYA 3WWXA 5EVIC 1J9MA 4BQMA 4WEKA 4JXGA 2R9WA 3G34A 3HUNA 5F82A 3ZCZA 3P09A 4JXWA 3DTMA 1YLYA 1BZAA 2BG1A 1S0WA 4LV2A 4X69A 2Y2LA 3NY4A 4X55A 4HBTA 4GD6A 5FA7A 1K54C 5FAQA 1L0FA 4E6XA 3EQUA 5AQ7A 3AGDA 3PBOA 5GHXA 2OV5A 1JWZA 4E3IA 3A3FA 1ALQA 3G2YA 5A90A 2P74A 5CERA 4KQRA 4XUZA 2WGIA 4OPRA 2ZM2A 3FWLA 2Y2OA 4X56A 4ZAMA 2C5WB 1E3UD 3ISGA 1FQGA 1FOFA 3PBRA 2EX9A 3VFFA 2J9PA 1NY0A 1U60A 2BLSA 2HP9A 3BFGA 4FD8A 5FQJA 3N8LA 3UE1A 4S2PA 4JXVA 1QMFA 1G68A 5HFOA 3BFEA 1ZC2A 1KGEA 5GHYA 2HP6A 1FR1A 1K38A 4S2NC 4BENA 1K6RA 2V20A 3CJMA 4DXCA 4LV1A 3VFHA 2EX6A 4C3QA 2OLUA 1QMEA 2HPBA 4KZ7A 3V50A 3HUMA 3OZHA 3SS3A 3V39A 4B4XA 1MXOA 3OCLA 3OPLA 2XR0A 1NRFA 4S2LA 2UWXA 2EFXA 1K25A 1SKFA 4LV0A 5EVLA 1TDGA 4Q8IA 1LL9A 3MFDA 5EOEA 5FSRA 5AQBA 3TOIA 3G35A 4R1GA 3SOIA 1M6KA 4MLLA 5EECA 1XA7A 4GNUA 2HDSA 3RXXA 1HVBA 1K4EA 5D3OA 1S6RA 2H0YA 3MKEA 3M2JA 2Y2JA 5CGSA 3M6BA 4B88A 1LI0A 1XGJA 2JBFA 3O87A 1O07A 2WAEA 1YLPA 3IT9A 4IBRA 2ZD8A 4KENB 1FSYA 3JYIA 3A3DA 1RGYA 4M3KA 5EOOA 5FAOA 3UN7A 4OVDA 3VP2A 4S2OA 4F94A 3ZG5A 2B5RA 1BLPA 1KGGA 3LO7A 4KZ9A 4MNRA 2ZQ7A 3CZDA 2Q9MA 1IKIA 1MPLA 3C7VA 3DWZA 4PMAA 3G2ZA 4IEDA 2A3UA 5FAPA 5JYPA 5KSHA 5GLDA 2RCXA 3B3XA 5F1FA 1BLCA 4JXSA 5HAIA 4OOLA 1IEMA 3I7JA 1IYOA 1PI5A 2Y2HA 1PWDA 2EXBA 4Y0UA 5DVAA 2XF3A 3S22A 2ZQ8A 4DRTA 4EBPA 2X71A 1C3BA 5M19A 1GCEA 4MBKA 1SCWA 1Q2PA 4O7DA 1K55A 2ZM0A 5DF8A 2J7VA 5F83A 1BLSA 4YFMA 4LENA 2XD1A 1Q2QA 4N1XA 4EBLA 3DW0A 4X68A 1TDLA 1ES5A 3HLEA 1ERMA 1JTDA 3AGFA 2PU2A 4GZBA 4PM8A 2XQZA 3ZG8B 1NJ4A 4OQIA 5BOHA 4DKIA 4OPYA 5CHUA 4DE1A 1TVFA 5TGFA 5EVID 4KG2A 4U0XA 1PZOA 4PM9A 3UO9A 4PM7A 4C75A 3LY4A 1SDNA 4R3JA 3IXGA 3IF6B 4WYYA 3BFFA 3MZFA 1ZG6A 2ZC4B 1I2WA 3SS5A 3HL9A 1KDWA 3N8RA 4WEJA 1GHPA 2Y2IA 3N4IA 1ZG4A 3A3EA 2CC1A 4OPQA 1ONGA 3SH8A 2WGWA 2GDNA 1FCMA 1PW8A 2ZC7A 4KZ8A 4E3OA 3IXBA 4EWFA 3NI9A 2PBYA 4OH0A 5DTSA 4H8RA 4KZ5A 2JC7A 1EWZA 1MWTA 3GV9A 4UA6A 1K6SA 2JCHA 5FI6A 1E25A 3ZDJA 1L2SA 3BFCA 4K0XA 4PM6A 4ZJ1A 3G30A 4UAAA 4P85A 4P0MA 3VP4A 2Y2QA 1OMEA 3VSLA 5M1AA 2P9VB 5A92A 3N6IA 4KZ4A 4IVIA 1NZOA 1YLTA 2ZQDA 3P98A 1I2SA 2V1ZA 3W4OA 2XFTA 2FFYA 3Q07A 3IWOA 3DWKA 4KG6A 4DE0A 5CGXA 2WAFA 3Q1FA 4OONA 2X02A 4FSFA 1DJCA 1PZPA 5CTMA 1W79A 2ZC5B 3BYDA 1WYBA 2X01A 1BUEA 4IBXA 4FCFA 3ZHHA 4JLFA 4ZBEA 4ID4A 1XKZA 2IWDA 2Q9NA 4ZJ2A 3V3SA 1JVJA 3WS0A 2OSUA 2WKHA 4HEFA 3SS4A 1KE4A 4D2OA 4LV3A 2EFUA 3BFDA 3PTEA 5DTTA 3NDGA 3FKWA 1W8YA 1LL5A 3OPRA 3G32A 3SH9A 1WE4A 5FQKA 4WMCA 1Y54A 1XP4A 1YT4A 4WBGA 2HP5A 1YLJA 3VP3A 3PAGA 4JBFA 4OLDA 2Y2PA 5CEDA 2XH9A 2DCFA 3TG9A 1JWVA 5CHMA 1ZKJA 5IHVA 3BECA 1K56D 4R0QA 2QPNA 3OPPA 2R9XA 4DDSA 5TR7A 4JF5A 4KZ3A 3UPOA 4S2KA 1NYMA 1M40A 3NDEA 4K91A 3HBRA 5GHZA 1H5XA 5EVIB 3NC8A 5A91A 5GLCA 4E6WA 4IVKA 3HUOA 1IYQA 1K55C 4KQOA 4OP5A 4DDYA 1DJAA 1GA0A 4QHCA 2ZC6B 3PBQA 1PI4A 5E2FA 4N1HA 1XA1A 3FKVA 4GDNA 3G31A 3RJUA 3ZVTA 4OOMA 1HZOA 3GSGA 4K0WA 5HL1A 2DNSA 1PIOA 3PBSA 5JYOA 1BLHA 2G2UA 1DY6A 1YM1A 3M2KA 3BLMA 4UA7A 1L0GA 2ZQCA 1YQSA 5CGWA 1KVMA 2Y55A 3UE0A 5U47A 1KE3A 4OQGA 1YLWA 4OLGA 3Q7VA 1PWGA 3GRJA 5FDHA 4P87A 4S2JA 4E3JA 1ESUA 1K57A 2XDMA 2Y2NA 3LEZA 4WM9A 4BLMA 2RL3A 3O86A 1BTLA 4BJPA 1EI5A 4R3BA 5CTNA 3S4XA 2IWCA 1L0EA 3BLSA 1FR6A 1MBLA 4HESA 2Z2LB 4NK3A 3C5AA 5E2EA 5GL9A 2FFFB 4BL3A 2Y2MA 2I72A 1E3UA 4MBHA 3RXWA 1CEFA 4QD4A 3VOYA 3IF6A 1IYPA 4Y0OA 3Q82A 3UNWA 4WZ5A 3WS5A 3HLFA 3E2KA 1MWSA 3Q7ZA 2ZC3B 3GR2A 3ZVWA 4OOYA 3A3IA 3V3RA 3WRTA 1RGZA 3OPHA 3ZG7B 1Z6FA 1G6AA 4EBNA 3FYZA 3MXRA 3MKFA 4NETA 4OQ0A 4GN2A 2ZQAA 1W8QA 1RCJA 2V2FF 5E43A 5FQIA 4R23A 3ZG9B 5EPHA 3BM6A 4JPMA 3SH7A 1NYYA 2ZQ9A 4EUZA 3MZDA 3D4FA 3UPNA 3V5MA 3WS4A 2ZM8A 2WZZA 2HDRA 5DTKA 4QU3A 3UDFA 3IH9A 2EXAA 1H8ZA 4ZJ3A 1BT5A 4KZ6A 5FI2A 3QNBA 2Z2MB 2H0TA 2WZXA 1YMXA 3IXDA 2C6WB 5FI7A 1FSWA 5CHJA 3W4QA 3MZEA 2H10A 4DF6A 4KG5A 3BEBA 5HAPA 2E8IA 1ES3A 2WADA 5KMWA 1KGFA 3PAEA 5I94A 4L0LA 2IWBA 5M18A 3EQVA 4HBUA 1GHIA 1KDSA 3O3VA 2VGKA 4GOGA 5FQQA 3VP0A 4E3LA 3VOZA 4P6BA 1GHMA 3LY3A 3CG5A 3TSGA 3VMAA 5A93A 1XPBA 4S2IA 2XEPA 1CI8A 4A5RA 5G18A 1PW1A 5J8XA 1CEGA
chains in the Genus database with same CATH superfamily
2DRWA 4RVAA 3CUEA 4HH3A 5EV0A 1RP5A 5AQ9A 4WZ4A 3DAVA 2QHKA 4KZAA 1Z09A 3CWFA 3WS2A 5HX9A 5CEBA 1FIKA 2WUQA 5IS1A 1NRJA 1S67L 5DF9A 4EEPA 1KE0A 2ZOIA 3MBZA 3HLCA 4HY8A 1CK3A 1J3WA 2PBDP 5KZHA 4R4SA 2M7UA 5AVFA 4E3KA 3BRMA 3UB5P 3HLGA 3VV4A 1W5DA 2H5SA 1VM1A 2WGVA 3BWLA 4P6ZM 4G3KA 5CECA 2GX5A 2Y2KA 4KQQA 2J8YA 2A24B 2CMNA 1TEMA 4WZ5C 4GB7A 1UWPX 5CRFA 1BYWA 4S2MA 1SHVA 2XFSA 2JHEA 3KSIA 4S2NA 3S1YA 3S7PA 4LCMA 2INWA 2WYXA 5EVEA 3UDIA 4U3TA 3UY6A 1PYYA 5GLAA 2HDQA 3WRZA 5L2FA 5HW3A 2OLVA 4HQAA 3LCEA 1D7EA 1MKMA 2WKPA 2K31A 5FQMA 4H6JB 3O88A 2JKRI 2XROA 3IBRA 2XD5A 1JTGA 2HDUA 5E2HA 4PM5A 1BSGA 3Q81A 1FCOA 1V9YA 1MY8A 3N7WA 4QJGA 5FASA 2PAVP 4ZDXA 2P9VA 3T50A 3OC2A 4JF4A 4DE3A 4CJNA 2XLNA 2QMIA 4LCLA 2WGWB 4RYEA 3EEHA 3ITBA 3HREA 1NWZA 3VP1A 1N4OA 3H7WA 3HJIA 2R78A 4HP4A 3G34A 2J3TC 3T4KA 5F82A 5IT5A 2YKHA 3DTMA 3T1XA 3B47A 4E6XA 3AGDA 5GHXA 3LYXA 5CERA 2W1TB 4XUZA 1UGUA 4CLCA 2ZM2A 2Y2OA 3QP8A 1XJ4A 3OBFA 4GLQA 1U60A 2HP9A 1OTAA 4JXVA 1G68A 3DBAA 5HFOA 1FR1A 3VOLA 4C3QA 1QMEA 1W63M 4NXFA 4BBVA 3V39A 1MXOA 3OPLA 1LSWA 1SKFA 5J7EA 1TDGA 3HCYA 4Z1WA 2JN7A 4MLLA 4GNUA 1K4EA 3UB8A 1TD5A 3LUQA 1ODVA 5CGSA 3FC7A 3M6BA 2L0WA 4EU0A 3A3DA 4M3KA 4XT2A 1KGGA 4F3LB 4MNRA 3CZDA 2V1BA 3C30A 2Q9MA 3D3OA 5FL3A 2PYPA 4L9EA 1BLCA 4O8GA 3S22A 2Y2HA 1GCEA 3OOVA 5F83A 4YFMA 1Q2QA 4RQ9A 1TDLA 1ES5A 1ERMA 1JTDA 1NJ4A 3RTYA 5BOHA 3LIBA 4OPYA 4DE1A 5TGFA 5EVID 4KG2A 3K3DA 4PM9A 4C75A 1SDNA 2DMWA 3IXGA 4WYYA 3BFFA 4WEJA 3P7NA 3E98A 3A3EA 3B42A 4KZ8A 4E3OA 2PRFA 2PBYA 5DTSA 4X1MA 3GV9A 3ZDJA 1K6SA 2JCHA 5FI6A 1E25A 3LGOA 1L2SA 4PM6A 4ZJ1A 2O99A 5HDCA 4NXEA 3LIDA 2P9VB 3N6IA 1NZOA 3F1PB 4UQIS 1I2SA 2ZBBA 3Q1FA 1DJCA 5CTMA 4IBXA 3CITA 4GHIB 4JLFA 5TJJA 4ID4A 4ZJ2A 2HF6A 1JVJA 4HEFA 3BQ8A 3L7HA 3PTEA 2XRNA 3CHWP 5FQKA 1XP4A 2HP5A 3BJNA 4G3WA 4JBFA 2Y2PA 5CEDA 3TG9A 1JWVA 3BECA 3CPTB 2KX6A 3H9WA 5C5KA 1M40A 1VETA 5A91A 5GLCA 4E6WA 4IVKA 3VE4A 3E4PA 5HDSA 5FEGA 1GA0A 2JKRM 4QHCA 3FKVA 3G31A 3RJUA 4K0WA 3LFVA 2DNSA 5JYOA 1BLHA 1L0GA 4DJ3A 2K7SA 5DKLA 1KE3A 5FDHA 5J4EA 1A0KA 4S2JA 1T1CA 2XDMA 1S4RA 1DP6A 4JGOA 3OLOA 3LR5A 4XT2B 3TJZC 4BL3A 1XFNA 5E2EA 2I72A 1PNEA 3VOYA 3E4QA 3Q82A 3E2KA 3Q7ZA 3MQ0A 3CLOA 3GR2A 3DTKA 3ZVWA 3A3IA 3WRTA 1Z6FA 4IJGA 4BBTA 4MN5A 1CF0A 3ZG9B 4E04A 4JGPA 5EPHA 3WS4A 2EXAA 3LR3A 3QNBA 2Z2MB 1YSQA 5I5LA 5FI7A 4IHQA 3MZEA 4DF6A 1DP8A 4KG5A 3BEBA 1ES3A 4R6LA 3EQVA 3O3VA 5FQQA 3VOZA 4P6BA 1GHMA 3VMAA 4S2IA 2XEPA 2K2NA 1PW1A 5G18A 5J8XA 1F98A 4X25A 1SKOB 3UMEA 1O7EA 3T4QA 4R4RA 2M1CA 1YSPA 4JKTA 4ZRRA 1PWCA 4XXRA 5EE8A 1ESIA 3BY9A 4KQDA 4WELA 2G2WA 2PYRA 4AFIA 4Y7PA 4MN6A 3M6HA 3EEAA 2ZL1A 4GKUA 1SDEA 5EVIA 3E2LA 3F1OA 5KSCA 3IHAA 3UDXA 4X53A 3IWQA 5E2GA 3T1QB 1OT6A 5CXWA 4HIAA 4RX2A 3QNCA 3GQZA 3KO6A 1OT9A 1P0ZA 3CMZA 1KVLA 1K4FA 3IF6C 3NULA 4PPRA 3UB7A 1VETB 5F1GA 1XXMA 1FCNA 5HWTA 4GDBA 3MSHA 2Y4AA 2H28A 3VE3A 1GA9A 5DJTA 4O0PA 1STZA 2WKIA 5AVEA 3NCKA 4MDZA 3ZFZA 4OPZA 2W3GA 3T4JA 1LI9A 5HARA 4C6YA 1ES4A 2A49A 3IQAA 4CPKA 1IYSA 2JKTM 3IS2B 2XGNA 1S1YA 4L9GA 1S66L 4YINA 4B4ZA 1XX2A 3HJKA 1IELA 3WS1A 2YKFA 3CUEC 4Y17A 1JWPA 5HAQA 4MBFA 4PHTA 3PHYA 2Y59A 3D72A 5TFQA 1DJBA 3LEQA 1EROA 2XK1A 4OQHA 1TS0A 4X6TA 1WYCA 2O9CA 1W7FA 2XA7M 2W1RA 3LIEA 4BQMA 4BBUA 3HUNA 2OWHA 1BZAA 2BG1A 1S0WA 4LV2A 4PAUA 4X55A 4GD6A 5FA7A 1L0FA 5HZHA 1XJ3A 4E3IA 1ALQA 3G2YA 2FZ0A 2P74A 4KQRA 2WGIA 4X56A 5F6AA 4O01A 4X1LA 1FQGA 1FOFA 3VFFA 2J9PA 3BFGA 4FD8A 3N8LA 1QMFA 3BFEA 1ZC2A 1KGEA 4YOFA 4S2NC 2V20A 3CJMA 5HSQA 2EX6A 3EWKA 2VV7A 4KZ7A 3V50A 4ARZB 4S2LA 4LV0A 3MR0A 1LL9A 3MFDA 5FSRA 1XA7A 2HDSA 1YPRA 5D3OA 2Y2JA 4B88A 3O87A 2JBFA 2WAEA 2ZD8A 3JYIA 3UN7A 3LICA 4OVDA 4JGQA 3ZG5A 3LO7A 2Y8HA 3R7WB 3PR6A 3NOTC 3DWZA 4GJ4A 4Y3IA 3G2ZA 2A3UA 5FAPA 2RCXA 3F1NB 4JXSA 4OOLA 1IYOA 1PI5A 2XF3A 2O9AA 3NECA 1C3BA 2J7VA 4LENA 2XD1A 4EBLA 3DW0A 4EUVA 2XQZA 4DKIA 2D01A 1PZOA 3LY4A 3TRCA 1ACFA 3IF6B 3MZFA 3RH8B 1I2WA 2GZAA 3N8RA 1GHPA 4Y13A 4OPQA 4CLCC 1FCMA 3E0YA 3ZYTA 3IXBA 3BY8A 4EWFA 3NI9A 1SZVA 4UA6A 4K0XA 5L8MA 3G30A 4P85A 1OTDA 3VSLA 5A92A 3ZQ5A 3NHQA 1YLTA 3P98A 2VGLM 2XFTA 1FILA 4R70A 4KG6A 3KSFA 2WAFA 4FSFA 4GS9A 3KSHA 1W79A 2ZC5B 3BYDA 1BUEA 4FCFA 4FTXA 4PKYG 1OTIA 1XKZA 3T4LA 3SS4A 1KE4A 5DTTA 3NDGA 4I39A 4EW7A 3OPRA 3SH9A 1T1AA 4WBGA 1G6OA 1YT4A 1YLJA 1T19A 1TS6A 3PAGA 4OLDA 3LI9A 4R0QA 2QPNA 3OPPA 3HBRA 3HUOA 1S4SA 1IYQA 3JVUA 2P08A 3PBQA 4N1HA 1XA1A 4OOMA 3G6OA 1F9IA 4LRYC 1PIOA 3PBSA 2M7VA 1DY6A 4DJ2A 3BLMA 2ZQCA 1YQSA 5CGWA 2VJWA 2Y55A 4P6ZS 2VV8A 5LBRA 1WA9A 2QKPA 1YLWA 1GSXA 4II7A 2VV6A 1K57A 2Y2NA 4BLMA 2RL3A 4BJPA 5TBMA 3KSGA 1L0EA 1FR6A 4HESA 1NLYA 4NK3A 3C5AA 2FFFB 4PKYA 2Y2MA 4Q0IA 4Y0OA 3K2NA 4EEUA 4WL9A 1VEUA 1Y28A 4OOYA 3ZG7B 3OPHA 3MKFA 4NETA 2ZQAA 2HV1A 2V2FF 4JPMA 2W3EA 1F5MA 2Q0OA 3MZDA 3D4FA 3UB9A 4D60A 2HDRA 2V0WA 4LGWA 1CQAA 3H82A 2Z6DA 2H0TA 3IXDA 1YMXA 1P9WA 2C6WB 5CHJA 3SW1A 3T1SA 5KMWA 3PAEA 5I94A 4HBUA 1GHIA 2VGKA 4GOGA 4E3LA 3H7WB 1XPBA 1V9ZA 2OAQ1 2VZWA 4LLOB 1CEGA 4CLCE 2V1AA 5J3WA 1AWIA 1S1ZA 3W4PA 4I38A 1VQQA 5FQ9A 1ES2A 3C7UA 3AGEA 3ZGAB 2VGLS 2ZJ9A 3FPVA 4CLCB 3PBNA 2EX8A 3S7QA 3T4OA 2EX2A 1G5UA 1MWRA 1YLZA 1L0DA 4BD1A 4HI4A 4HH2A 1GSVA 3ZNTA 3IWIA 5KIZA 2W3DA 4E3MA 1K54A 3LIFA 4NXGA 3GTCA 4LRZE 3FV7A 4LFUA 4QB8A 1UWNX 4N9LA 2A2LA 4B9OA 1BULA 4BL2A 4KZBA 3NIAA 3PBTA 1N9BA 3IXHA 3HLWA 2WKEA 4ZTKA 4Q0JA 1YMSA 3KYQA 1TS8A 2NUTC 5F69A 3EOIA 3UPPA 1CI9A 3QP4A 4RX3A 3HVFA 4FH4A 3ZG0A 1MWUA 3GMWA 3DTIA 3MXSA 3QP2A 2ZMAA 4EV4A 2BASA 4UA9A 3NBLA 4N92A 5L07A 2PU4A 1E4DA 4QY5A 1VEUB 4DN0A 5DJUA 5AQAA 2QJ7A 3T4TA 2QZ6A 3IH8A 4K08A 1I5QA 5EUAA 1W63Q 3MJQA 2ZMVA 3WWXA 5EVIC 4JXGA 2R9WA 3T12B 3ZCZA 5IU1A 3UMDA 3D9YA 4X69A 2Y2LA 5FAQA 3EQUA 5AQ7A 3NOUC 2OV5A 3A3FA 4HHDA 5A90A 1YKDA 1VB6A 3R4KA 4OPRA 2QWSA 3FWLA 5EM1A 4ZAMA 4ETXA 1E3UD 3ISGA 5FEFA 4HOIA 2EX9A 1NY0A 2BLSA 5FQJA 4FUWA 3UE1A 3PXPA 4S2PA 4BENA 3VFHA 1IOUA 5DFXA 2L4RA 4B4XA 3SS3A 3OCLA 1NRFA 4ESPA 1PRQA 2UWXA 2A24A 2IA2A 4Q8IA 5EOEA 4FOFA 3TOIA 4R1GA 1M6KA 3ULFA 3TW8A 1S6RA 2H0YA 3MKEA 3M2JA 4EETB 1LI0A 3NOPC 3MS6A 1O07A 1YLPA 4KENB 1FSYA 2V9AA 1RGYA 5EOOA 5FAOA 3VP2A 2PD8A 5A8BA 4F94A 3BW6A 2B5RA 1BLPA 2ZQ7A 3MXQA 1IKIA 3LR4A 5JYPA 5KSHA 5F1FA 3B3XA 2L1MA 4ME4A 5HAIA 1IEMA 5DVAA 4H6JA 1Q2PA 1K55A 2ZM0A 5DF8A 5HL6A 4N1XA 4X68A 3MF0A 4Y2FA 3AGFA 4EESA 2PHYA 4PM8A 5EFWA 5CHUA 1TVFA 5AJGA 4PM7A 2J3TD 4R3JA 3U2AA 1H3QA 1ZG6A 2ZC4B 3SS5A 3HL9A 1KDWA 2Y2IA 5HDDA 3L9KA 4WUJA 2CC1A 3SH8A 1ONGA 2WGWA 2G7UA 2GDNA 1TF1A 1LSVA 1PW8A 2ZC7A 1PFLA 2ACGA 4GCZA 4KZ5A 2JC7A 3NJAA 3DTEA 2ZMFA 3BFCA 4UAAA 4I5SA 1OMEA 5M1AA 4KZ4A 4IVIA 2ZQDA 2V1ZA 2VA0A 2FFYA 1YAXA 1Y4OA 3IWOA 3DWKA 3JVVA 2X02A 1PZPA 1WYBA 2X01A 2J3WA 4ZBEA 5DFYA 2IWDA 2Q9NA 3V3SA 2WKHA 3IX3A 4D2OA 4LV3A 1D1JA 1W8YA 1G28A 1CJFA 1WE4A 2VKSA 1TS7A 4NKPA 2Z6CA 4EXOA 2D02A 2XH9A 2DCFA 3QP6A 5CHMA 1ZKJA 2O0YA 1K56D 3IBJA 2R9XA 4M4XA 3UPOA 4S2KA 2ZL1B 1NYMA 5GHZA 5EVIB 3NC8A 1XFQA 1KOUA 3F1OB 2HJEA 2KLIA 3MMHA 4DDYA 2EWVA 4Q0HA 1DJAA 2VEAA 2ZC6B 5E2FA 4GDNA 3GSGA 4F3LA 1OPXA 1YM1A 4G3VA 2HZ5A 4UA7A 3C8CA 3UE0A 3TE8A 5U47A 3CAXA 3KX0X 4OLGA 3Q7VA 4IUKA 3T4SA 4E3JA 2I9VA 2Y79A 3O86A 3LI8A 1BTLA 4R3BA 2IWCA 3BLSA 1E3UA 4MBHA 3RXWA 4QD4A 3A0SA 3UNWA 1OTBA 4WZ5A 3WS5A 3HLFA 3MQOA 4HP9A 3MFXA 3V3RA 1RGZA 4B93A 2GNXA 2V8FA 1G6AA 4EBNA 3FYZA 3MXRA 1JNUA 5E43A 4R23A 3EGXC 3SH7A 1D06A 1NYYA 3UPNA 3V5MA 4UQIM 2FH5A 5FDSA 3UDFA 2LB5A 3IH9A 1H8ZA 4ZJ3A 2V0UA 3F1PA 4EERA 1MC0A 5EM0A 1K0KA 2H10A 4NXBA 3KYEA 5HAPA 2E8IA 1KGFA 2IWBA 5M18A 1P97A 4Y5FA 4GHIA 3LY3A 3CG5A 5A93A 2OOLA 4A5RA 1GSWA 2WKRA 5K5BA 4Y15A 2XA7S 5FATA 2HJ9C 2JE5A 4N9KA 4UHUA 4E3NA 4Z9QA 1X0OA 3MQQA 2PR6A 3CPTA 2J9OA 4DE2A 1HD8A 3IF5A 1HTZA 2PDRA 2Y91A 3G4PA 4DXBA 4HNBA 2NUPC 3ITAA 1K57C 3A3JA 5L10A 4RA7A 2VGJA 3VSKA 1T18A 3C4PA 3KYZA 3T1RA 3W8KA 4CQHA 1MKIA 2BTFP 4QY6A 4YNRA 4Y0TA 4R38A 4OP8A 4U0TA 5HPIA 3V67A 3UE3A 3ZNYA 1ERQA 1MZUA 4WF0A 5GLBA 1H8YA 3OCNA 2WK0A 4QPRA 3HLBA 3A0VA 3GDIA 3QP1A 4GD8A 1N9NA 2XSSA 1OJGA 3U4LP 3P01A 4WMCD 3Q7VB 1AXBA 3C4OA 5HWWA 4DMZA 1XGIA 1IKGA 4XUXA 4BD0A 3UB6A 1LHYA 4JF6A 1XJ2A 5HWVA 5MC7A 1NXYA 1K56A 2Y2GA 1NZUA 2ZLYA 3HLDA 1ONHA 5G4ZA 5CX7A 3N8SA 5DF7A 3A0RA 3IX4A 3UE6A 4OKPA 4FH2A 4WLAA 1EW0A 3GVBA 1L3LA 4EQIA 4MEZA 3IHBA 1LLBA 3FZCA 2OWJA 3LR0A 5G4YA 3QHYA 1J9MA 1VHMA 4WEKA 4KUKA 2PT7A 1F2KA 1XJ6A 2AVXA 3P09A 1OTEA 4JXWA 2JKTI 1YLYA 1SKOA 2O9BA 2E8JA 4QWOA 3NY4A 4HBTA 2P04A 1K54C 2PR5A 3PBOA 1JWZA 3K3CA 5HPFA 3LIAA 4GS9B 4HJ3A 2C5WB 2VK3A 5F5YA 3PBRA 4JGRA 4YWZA 5GHYA 3B33A 4I3AA 2HP6A 2W3FA 1K38A 1K6RA 1HLUP 4DXCA 4LV1A 2OLUA 2HPBA 4LRXC 1LSXA 4GW9A 3HUMA 3OZHA 2XR0A 2EFXA 1K25A 4ETZA 5EVLA 4MCWA 5AQBA 3G35A 3SOIA 2ZOHA 5EECA 1NLZA 3RXXA 2VLGA 1HVBA 2MJ6A 1N9OA 4MN7A 2KDKA 1XGJA 4IUHA 3IT9A 4IBRA 4S2OA 4KZ9A 4LPZA 2P7JA 1MPLA 2KOIA 3C7VA 1H0MA 4PMAA 4IEDA 2B18A 3EGDC 5GLDA 3IS2A 3I7JA 4Y0UA 1PWDA 2EXBA 4DRTA 1LT0A 2ZQ8A 4EBPA 3FPWA 2X71A 4MMNA 5M19A 4MBKA 1SCWA 4O7DA 1BLSA 1DRMA 3HLEA 2PU2A 4GZBA 3ZG8B 1T1BA 5TBMB 4OQIA 2EWWA 4U0XA 3UO9A 2LB9A 4R3AA 3N4IA 2GJ3A 1ZG4A 1DP9A 1IFQA 4OH0A 3RFBA 4H8RA 1EWZA 1MWTA 4HJ4A 4P0MA 3VP4A 4KUOA 2Y2QA 3H82B 3W4OA 3Q07A 4NEED 4WN5A 2WKQA 4DE0A 5CGXA 4OONA 2EA9A 3JPUA 3S7OA 2QYBA 3ZHHA 3E4OA 3WS0A 1P9RA 2OSUA 1LL8A 2J80A 2EFUA 3BFDA 3W2ZA 2W3HA 3FKWA 3IX8A 1LL5A 3G32A 4WMCA 1Y54A 2UV0E 3VP3A 4ARZA 2V8CA 5IHVA 2OAP1 4DDSA 5TR7A 4JF5A 4KZ3A 2B02A 3NDEA 4K91A 1H5XA 2QJ5A 1K55C 4KQOA 4OP5A 5HD3A 4I3JA 1PI4A 4I3IA 3SZTA 3ZVTA 5F68A 1HZOA 1OJ5A 3R7WA 3PYPA 5HD5A 5HL1A 3CI6A 2G2UA 3QP5A 3M2KA 4BMWA 4UEYA 3F1NA 1KVMA 5DKKA 2W0NA 4OQGA 2HGVA 1PWGA 3GRJA 2JKGA 4P87A 1ESUA 3LEZA 4WM9A 4HJ6A 4CLCD 1EI5A 5CTNA 3S4XA 2JKFA 1ZTUA 3O5YA 1MBLA 2Z2LB 3ICYA 5L09A 5GL9A 1CEFA 3IF6A 1IYPA 3BQAA 4L9FA 1MWSA 2ZC3B 4OQ0A 4GN2A 1W8QA 4NG2A 1RCJA 1ZHHB 3C38A 5FQIA 3BM6A 2ZQ9A 4EUZA 2ZM8A 3C2WA 2WZZA 1N9LA 4QU3A 5DTKA 1BT5A 4KZ6A 5FI2A 2W27A 2WZXA 4EQ1A 1FSWA 3W4QA 2PD7A 2WADA 4BWIA 4L0LA 2VX8A 1H8MA 1KDSA 2W1TA 3GECA 3VP0A 2B95A 3TSGA 3S7NA 1CI8A 3FG8A
chains in the Genus database with same CATH topology
2DRWA 4RVAA 5FATA 3W4PA 1RP5A 5AQ9A 4WZ4A 4KZAA 2JE5A 1O7EA 1VQQA 4R4RA 4N9KA 4UHUA 4JKTA 4E3NA 3WS2A 5FQ9A 5HX9A 1PWCA 4Z9QA 5CEBA 4XXRA 5EE8A 1ESIA 1ES2A 2WUQA 3C7UA 3AGEA 5DF9A 4WELA 3ZGAB 2G2WA 1KE0A 2ZJ9A 3MBZA 4Y7PA 2J9OA 3M6HA 3PBNA 2EX8A 3HLCA 4DE2A 1CK3A 1HD8A 2EX2A 3IF5A 5KZHA 4R4SA 1HTZA 1MWRA 1SDEA 4GKUA 1YLZA 5EVIA 3E2LA 5KSCA 1L0DA 3IHAA 3UDXA 4E3KA 2Y91A 3G4PA 4DXBA 4X53A 3BRMA 3IWQA 5E2GA 4BD1A 5CXWA 3HLGA 3ITAA 3ZNTA 1K57C 3A3JA 1W5DA 4RX2A 3IWIA 4RA7A 2VGJA 3QNCA 3VSKA 3GQZA 2H5SA 4E3MA 1K54A 3C4PA 1VM1A 3W8KA 2WGVA 1MKIA 3GTCA 4QY6A 4Y0TA 3CMZA 5CECA 1KVLA 1K4FA 3FV7A 2Y2KA 4KQQA 2J8YA 3IF6C 4OP8A 4PPRA 1TEMA 4U0TA 4WZ5C 4GB7A 5F1GA 3UE3A 3ZNYA 4QB8A 5CRFA 1ERQA 1XXMA 1FCNA 4N9LA 5GLBA 1BULA 4BL2A 1H8YA 4GDBA 4S2MA 1SHVA 4KZBA 3NIAA 2Y4AA 2XFSA 3OCNA 2WK0A 3PBTA 1GA9A 1N9BA 3IXHA 4S2NA 3HLWA 2WKEA 3S1YA 4ZTKA 1YMSA 2WKIA 3HLBA 4LCMA 3NCKA 2WYXA 3ZFZA 4GD8A 3UDIA 4U3TA 4OPZA 3UY6A 1LI9A 1PYYA 5GLAA 2HDQA 5HARA 4C6YA 1ES4A 3WRZA 2A49A 3IQAA 5L2FA 5HW3A 3UPPA 4CPKA 1IYSA 2OLVA 1CI9A 2XGNA 3LCEA 4RX3A 3HVFA 5FQMA 4WMCD 3Q7VB 1AXBA 4FH4A 3C4OA 3ZG0A 1MWUA 3O88A 3GMWA 1XGIA 1IKGA 4XUXA 2XD5A 1JTGA 2HDUA 4BD0A 3MXSA 5E2HA 2ZMAA 4PM5A 1LHYA 4JF6A 4YINA 4EV4A 1BSGA 4B4ZA 1NXYA 1XX2A 3Q81A 1K56A 1IELA 2Y2GA 1NZUA 4UA9A 3WS1A 2ZLYA 1FCOA 3NBLA 3HLDA 4N92A 2PU4A 1MY8A 3N7WA 1JWPA 5HAQA 1E4DA 4QJGA 1ONHA 4MBFA 5FASA 4ZDXA 2P9VA 4QY5A 2Y59A 5AQAA 5TFQA 1DJBA 3N8SA 3OC2A 5DF7A 4JF4A 4DE3A 4CJNA 2XLNA 1EROA 2XK1A 2QMIA 4OKPA 4OQHA 2QZ6A 4FH2A 3IH8A 4LCLA 2WGWB 3GVBA 4X6TA 4RYEA 4EQIA 4MEZA 1WYCA 3ITBA 3HREA 3IHBA 1W7FA 1LLBA 1I5QA 3FZCA 5EUAA 3VP1A 1N4OA 3QHYA 3WWXA 5EVIC 1J9MA 4BQMA 4WEKA 4JXGA 2R9WA 3G34A 3HUNA 5F82A 3ZCZA 3P09A 4JXWA 3DTMA 1YLYA 1BZAA 2BG1A 1S0WA 4LV2A 4X69A 2Y2LA 3NY4A 4X55A 4HBTA 4GD6A 5FA7A 1K54C 5FAQA 1L0FA 4E6XA 3EQUA 5AQ7A 3AGDA 3PBOA 5GHXA 2OV5A 1JWZA 4E3IA 3A3FA 1ALQA 3G2YA 5A90A 2P74A 5CERA 4KQRA 4XUZA 2WGIA 4OPRA 2ZM2A 3FWLA 2Y2OA 4X56A 4ZAMA 2C5WB 1E3UD 3ISGA 1FQGA 1FOFA 3PBRA 2EX9A 3VFFA 2J9PA 1NY0A 1U60A 2BLSA 2HP9A 3BFGA 4FD8A 5FQJA 3N8LA 3UE1A 4S2PA 4JXVA 1QMFA 1G68A 5HFOA 3BFEA 1ZC2A 1KGEA 5GHYA 2HP6A 1FR1A 1K38A 4S2NC 4BENA 1K6RA 2V20A 3CJMA 4DXCA 4LV1A 3VFHA 2EX6A 4C3QA 2OLUA 1QMEA 2HPBA 4KZ7A 3V50A 3HUMA 3OZHA 3SS3A 3V39A 4B4XA 1MXOA 3OCLA 3OPLA 2XR0A 1NRFA 4S2LA 2UWXA 2EFXA 1K25A 1SKFA 4LV0A 5EVLA 1TDGA 4Q8IA 1LL9A 3MFDA 5EOEA 5FSRA 5AQBA 3TOIA 3G35A 4R1GA 3SOIA 1M6KA 4MLLA 5EECA 1XA7A 4GNUA 2HDSA 3RXXA 1HVBA 1K4EA 5D3OA 1S6RA 2H0YA 3MKEA 3M2JA 2Y2JA 5CGSA 3M6BA 4B88A 1LI0A 1XGJA 2JBFA 3O87A 1O07A 2WAEA 1YLPA 3IT9A 4IBRA 2ZD8A 4KENB 1FSYA 3JYIA 3A3DA 1RGYA 4M3KA 5EOOA 5FAOA 3UN7A 4OVDA 3VP2A 4S2OA 4F94A 3ZG5A 2B5RA 1BLPA 1KGGA 3LO7A 4KZ9A 4MNRA 2ZQ7A 3CZDA 2Q9MA 1IKIA 1MPLA 3C7VA 3DWZA 4PMAA 3G2ZA 4IEDA 2A3UA 5FAPA 5JYPA 5KSHA 5GLDA 2RCXA 3B3XA 5F1FA 1BLCA 4JXSA 5HAIA 4OOLA 1IEMA 3I7JA 1IYOA 1PI5A 2Y2HA 1PWDA 2EXBA 4Y0UA 5DVAA 2XF3A 3S22A 2ZQ8A 4DRTA 4EBPA 2X71A 1C3BA 5M19A 1GCEA 4MBKA 1SCWA 1Q2PA 4O7DA 1K55A 2ZM0A 5DF8A 2J7VA 5F83A 1BLSA 4YFMA 4LENA 2XD1A 1Q2QA 4N1XA 4EBLA 3DW0A 4X68A 1TDLA 1ES5A 3HLEA 1ERMA 1JTDA 3AGFA 2PU2A 4GZBA 4PM8A 2XQZA 3ZG8B 1NJ4A 4OQIA 5BOHA 4DKIA 4OPYA 5CHUA 4DE1A 1TVFA 5TGFA 5EVID 4KG2A 4U0XA 1PZOA 4PM9A 3UO9A 4PM7A 4C75A 3LY4A 1SDNA 4R3JA 3IXGA 3IF6B 4WYYA 3BFFA 3MZFA 1ZG6A 2ZC4B 1I2WA 3SS5A 3HL9A 1KDWA 3N8RA 4WEJA 1GHPA 2Y2IA 3N4IA 1ZG4A 3A3EA 2CC1A 4OPQA 1ONGA 3SH8A 2WGWA 2GDNA 1FCMA 1PW8A 2ZC7A 4KZ8A 4E3OA 3IXBA 4EWFA 3NI9A 2PBYA 4OH0A 5DTSA 4H8RA 4KZ5A 2JC7A 1EWZA 1MWTA 3GV9A 4UA6A 1K6SA 2JCHA 5FI6A 1E25A 3ZDJA 1L2SA 3BFCA 4K0XA 4PM6A 4ZJ1A 3G30A 4UAAA 4P85A 4P0MA 3VP4A 2Y2QA 1OMEA 3VSLA 5M1AA 2P9VB 5A92A 3N6IA 4KZ4A 4IVIA 1NZOA 1YLTA 2ZQDA 3P98A 1I2SA 2V1ZA 3W4OA 2XFTA 2FFYA 3Q07A 3IWOA 3DWKA 4KG6A 4DE0A 5CGXA 2WAFA 3Q1FA 4OONA 2X02A 4FSFA 1DJCA 1PZPA 5CTMA 1W79A 2ZC5B 3BYDA 1WYBA 2X01A 1BUEA 4IBXA 4FCFA 3ZHHA 4JLFA 4ZBEA 4ID4A 1XKZA 2IWDA 2Q9NA 4ZJ2A 3V3SA 1JVJA 3WS0A 2OSUA 2WKHA 4HEFA 3SS4A 1KE4A 4D2OA 4LV3A 2EFUA 3BFDA 3PTEA 5DTTA 3NDGA 3FKWA 1W8YA 1LL5A 3OPRA 3G32A 3SH9A 1WE4A 5FQKA 4WMCA 1Y54A 1XP4A 1YT4A 4WBGA 2HP5A 1YLJA 3VP3A 3PAGA 4JBFA 4OLDA 2Y2PA 5CEDA 2XH9A 2DCFA 3TG9A 1JWVA 5CHMA 1ZKJA 5IHVA 3BECA 1K56D 4R0QA 2QPNA 3OPPA 2R9XA 4DDSA 5TR7A 4JF5A 4KZ3A 3UPOA 4S2KA 1NYMA 1M40A 3NDEA 4K91A 3HBRA 5GHZA 1H5XA 5EVIB 3NC8A 5A91A 5GLCA 4E6WA 4IVKA 3HUOA 1IYQA 1K55C 4KQOA 4OP5A 4DDYA 1DJAA 1GA0A 4QHCA 2ZC6B 3PBQA 1PI4A 5E2FA 4N1HA 1XA1A 3FKVA 4GDNA 3G31A 3RJUA 3ZVTA 4OOMA 1HZOA 3GSGA 4K0WA 5HL1A 2DNSA 1PIOA 3PBSA 5JYOA 1BLHA 2G2UA 1DY6A 1YM1A 3M2KA 3BLMA 4UA7A 1L0GA 2ZQCA 1YQSA 5CGWA 1KVMA 2Y55A 3UE0A 5U47A 1KE3A 4OQGA 1YLWA 4OLGA 3Q7VA 1PWGA 3GRJA 5FDHA 4P87A 4S2JA 4E3JA 1ESUA 1K57A 2XDMA 2Y2NA 3LEZA 4WM9A 4BLMA 2RL3A 3O86A 1BTLA 4BJPA 1EI5A 4R3BA 5CTNA 3S4XA 2IWCA 1L0EA 3BLSA 1FR6A 1MBLA 4HESA 2Z2LB 4NK3A 3C5AA 5E2EA 5GL9A 2FFFB 4BL3A 2Y2MA 2I72A 1E3UA 4MBHA 3RXWA 1CEFA 4QD4A 3VOYA 3IF6A 1IYPA 4Y0OA 3Q82A 3UNWA 4WZ5A 3WS5A 3HLFA 3E2KA 1MWSA 3Q7ZA 2ZC3B 3GR2A 3ZVWA 4OOYA 3A3IA 3V3RA 3WRTA 1RGZA 3OPHA 3ZG7B 1Z6FA 1G6AA 4EBNA 3FYZA 3MXRA 3MKFA 4NETA 4OQ0A 4GN2A 2ZQAA 1W8QA 1RCJA 2V2FF 5E43A 5FQIA 4R23A 3ZG9B 5EPHA 3BM6A 4JPMA 3SH7A 1NYYA 2ZQ9A 4EUZA 3MZDA 3D4FA 3UPNA 3V5MA 3WS4A 2ZM8A 2WZZA 2HDRA 5DTKA 4QU3A 3UDFA 3IH9A 2EXAA 1H8ZA 4ZJ3A 1BT5A 4KZ6A 5FI2A 3QNBA 2Z2MB 2H0TA 2WZXA 1YMXA 3IXDA 2C6WB 5FI7A 1FSWA 5CHJA 3W4QA 3MZEA 2H10A 4DF6A 4KG5A 3BEBA 5HAPA 2E8IA 1ES3A 2WADA 5KMWA 1KGFA 3PAEA 5I94A 4L0LA 2IWBA 5M18A 3EQVA 4HBUA 1GHIA 1KDSA 3O3VA 2VGKA 4GOGA 5FQQA 3VP0A 4E3LA 3VOZA 4P6BA 1GHMA 3LY3A 3CG5A 3TSGA 3VMAA 5A93A 1XPBA 4S2IA 2XEPA 1CI8A 4A5RA 5G18A 1PW1A 5J8XA 1CEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DRW A;  4RVA A;  5FAT A;  3W4P A;  1RP5 A;  5AQ9 A;  4WZ4 A;  4KZA A;  2JE5 A;  1O7E A;  1VQQ A;  4R4R A;  4N9K A;  4UHU A;  4JKT A;  4E3N A;  3WS2 A;  5FQ9 A;  5HX9 A;  1PWC A;  4Z9Q A;  5CEB A;  4XXR A;  5EE8 A;  1ESI A;  1ES2 A;  2WUQ A;  3C7U A;  3AGE A;  5DF9 A;  4WEL A;  3ZGA B;  2G2W A;  1KE0 A;  2ZJ9 A;  3MBZ A;  4Y7P A;  2J9O A;  3M6H A;  3PBN A;  2EX8 A;  3HLC A;  4DE2 A;  1CK3 A;  1HD8 A;  2EX2 A;  3IF5 A;  5KZH A;  4R4S A;  1HTZ A;  1MWR A;  1SDE A;  4GKU A;  1YLZ A;  5EVI A;  3E2L A;  5KSC A;  1L0D A;  3IHA A;  3UDX A;  4E3K A;  2Y91 A;  3G4P A;  4DXB A;  4X53 A;  3BRM A;  3IWQ A;  5E2G A;  4BD1 A;  5CXW A;  3HLG A;  3ITA A;  3ZNT A;  1K57 C;  3A3J A;  1W5D A;  4RX2 A;  3IWI A;  4RA7 A;  2VGJ A;  3QNC A;  3VSK A;  3GQZ A;  2H5S A;  4E3M A;  1K54 A;  3C4P A;  1VM1 A;  3W8K A;  2WGV A;  1MKI A;  3GTC A;  4QY6 A;  4Y0T A;  3CMZ A;  5CEC A;  1KVL A;  1K4F A;  3FV7 A;  2Y2K A;  4KQQ A;  2J8Y A;  3IF6 C;  4OP8 A;  4PPR A;  1TEM A;  4U0T A;  4WZ5 C;  4GB7 A;  5F1G A;  3UE3 A;  3ZNY A;  4QB8 A;  5CRF A;  1ERQ A;  1XXM A;  1FCN A;  4N9L A;  5GLB A;  1BUL A;  4BL2 A;  1H8Y A;  4GDB A;  4S2M A;  1SHV A;  4KZB A;  3NIA A;  2Y4A A;  2XFS A;  3OCN A;  2WK0 A;  3PBT A;  1GA9 A;  1N9B A;  3IXH A;  4S2N A;  3HLW A;  2WKE A;  3S1Y A;  4ZTK A;  1YMS A;  2WKI A;  3HLB A;  4LCM A;  3NCK A;  2WYX A;  3ZFZ A;  4GD8 A;  3UDI A;  4U3T A;  4OPZ A;  3UY6 A;  1LI9 A;  1PYY A;  5GLA A;  2HDQ A;  5HAR A;  4C6Y A;  1ES4 A;  3WRZ A;  2A49 A;  3IQA A;  5L2F A;  5HW3 A;  3UPP A;  4CPK A;  1IYS A;  2OLV A;  1CI9 A;  2XGN A;  3LCE A;  4RX3 A;  3HVF A;  5FQM A;  4WMC D;  3Q7V B;  1AXB A;  4FH4 A;  3C4O A;  3ZG0 A;  1MWU A;  3O88 A;  3GMW A;  1XGI A;  1IKG A;  4XUX A;  2XD5 A;  1JTG A;  2HDU A;  4BD0 A;  3MXS A;  5E2H A;  2ZMA A;  4PM5 A;  1LHY A;  4JF6 A;  4YIN A;  4EV4 A;  1BSG A;  4B4Z A;  1NXY A;  1XX2 A;  3Q81 A;  1K56 A;  1IEL A;  2Y2G A;  1NZU A;  4UA9 A;  3WS1 A;  2ZLY A;  1FCO A;  3NBL A;  3HLD A;  4N92 A;  2PU4 A;  1MY8 A;  3N7W A;  1JWP A;  5HAQ A;  1E4D A;  4QJG A;  1ONH A;  4MBF A;  5FAS A;  4ZDX A;  2P9V A;  4QY5 A;  2Y59 A;  5AQA A;  5TFQ A;  1DJB A;  3N8S A;  3OC2 A;  5DF7 A;  4JF4 A;  4DE3 A;  4CJN A;  2XLN A;  1ERO A;  2XK1 A;  2QMI A;  4OKP A;  4OQH A;  2QZ6 A;  4FH2 A;  3IH8 A;  4LCL A;  2WGW B;  3GVB A;  4X6T A;  4RYE A;  4EQI A;  4MEZ A;  1WYC A;  3ITB A;  3HRE A;  3IHB A;  1W7F A;  1LLB A;  1I5Q A;  3FZC A;  5EUA A;  3VP1 A;  1N4O A;  3QHY A;  3WWX A;  5EVI C;  1J9M A;  4BQM A;  4WEK A;  4JXG A;  2R9W A;  3G34 A;  3HUN A;  5F82 A;  3ZCZ A;  3P09 A;  4JXW A;  3DTM A;  1YLY A;  1BZA A;  2BG1 A;  1S0W A;  4LV2 A;  4X69 A;  2Y2L A;  3NY4 A;  4X55 A;  4HBT A;  4GD6 A;  5FA7 A;  1K54 C;  5FAQ A;  1L0F A;  4E6X A;  3EQU A;  5AQ7 A;  3AGD A;  3PBO A;  5GHX A;  2OV5 A;  1JWZ A;  4E3I A;  3A3F A;  1ALQ A;  3G2Y A;  5A90 A;  2P74 A;  5CER A;  4KQR A;  4XUZ A;  2WGI A;  4OPR A;  2ZM2 A;  3FWL A;  2Y2O A;  4X56 A;  4ZAM A;  2C5W B;  1E3U D;  3ISG A;  1FQG A;  1FOF A;  3PBR A;  2EX9 A;  3VFF A;  2J9P A;  1NY0 A;  1U60 A;  2BLS A;  2HP9 A;  3BFG A;  4FD8 A;  5FQJ A;  3N8L A;  3UE1 A;  4S2P A;  4JXV A;  1QMF A;  1G68 A;  5HFO A;  3BFE A;  1ZC2 A;  1KGE A;  5GHY A;  2HP6 A;  1FR1 A;  1K38 A;  4S2N C;  4BEN A;  1K6R A;  2V20 A;  3CJM A;  4DXC A;  4LV1 A;  3VFH A;  2EX6 A;  4C3Q A;  2OLU A;  1QME A;  2HPB A;  4KZ7 A;  3V50 A;  3HUM A;  3OZH A;  3SS3 A;  3V39 A;  4B4X A;  1MXO A;  3OCL A;  3OPL A;  2XR0 A;  1NRF A;  4S2L A;  2UWX A;  2EFX A;  1K25 A;  1SKF A;  4LV0 A;  5EVL A;  1TDG A;  4Q8I A;  1LL9 A;  3MFD A;  5EOE A;  5FSR A;  5AQB A;  3TOI A;  3G35 A;  4R1G A;  3SOI A;  1M6K A;  4MLL A;  5EEC A;  1XA7 A;  4GNU A;  2HDS A;  3RXX A;  1HVB A;  1K4E A;  5D3O A;  1S6R A;  2H0Y A;  3MKE A;  3M2J A;  2Y2J A;  5CGS A;  3M6B A;  4B88 A;  1LI0 A;  1XGJ A;  2JBF A;  3O87 A;  1O07 A;  2WAE A;  1YLP A;  3IT9 A;  4IBR A;  2ZD8 A;  4KEN B;  1FSY A;  3JYI A;  3A3D A;  1RGY A;  4M3K A;  5EOO A;  5FAO A;  3UN7 A;  4OVD A;  3VP2 A;  4S2O A;  4F94 A;  3ZG5 A;  2B5R A;  1BLP A;  1KGG A;  3LO7 A;  4KZ9 A;  4MNR A;  2ZQ7 A;  3CZD A;  2Q9M A;  1IKI A;  1MPL A;  3C7V A;  3DWZ A;  4PMA A;  3G2Z A;  4IED A;  2A3U A;  5FAP A;  5JYP A;  5KSH A;  5GLD A;  2RCX A;  3B3X A;  5F1F A;  1BLC A;  4JXS A;  5HAI A;  4OOL A;  1IEM A;  3I7J A;  1IYO A;  1PI5 A;  2Y2H A;  1PWD A;  2EXB A;  4Y0U A;  5DVA A;  2XF3 A;  3S22 A;  2ZQ8 A;  4DRT A;  4EBP A;  2X71 A;  1C3B A;  5M19 A;  1GCE A;  4MBK A;  1SCW A;  1Q2P A;  4O7D A;  1K55 A;  2ZM0 A;  5DF8 A;  2J7V A;  5F83 A;  1BLS A;  4YFM A;  4LEN A;  2XD1 A;  1Q2Q A;  4N1X A;  4EBL A;  3DW0 A;  4X68 A;  1TDL A;  1ES5 A;  3HLE A;  1ERM A;  1JTD A;  3AGF A;  2PU2 A;  4GZB A;  4PM8 A;  2XQZ A;  3ZG8 B;  1NJ4 A;  4OQI A;  5BOH A;  4DKI A;  4OPY A;  5CHU A;  4DE1 A;  1TVF A;  5TGF A;  5EVI D;  4KG2 A;  4U0X A;  1PZO A;  4PM9 A;  3UO9 A;  4PM7 A;  4C75 A;  3LY4 A;  1SDN A;  4R3J A;  3IXG A;  3IF6 B;  4WYY A;  3BFF A;  3MZF A;  1ZG6 A;  2ZC4 B;  1I2W A;  3SS5 A;  3HL9 A;  1KDW A;  3N8R A;  4WEJ A;  1GHP A;  2Y2I A;  3N4I A;  1ZG4 A;  3A3E A;  2CC1 A;  4OPQ A;  1ONG A;  3SH8 A;  2WGW A;  2GDN A;  1FCM A;  1PW8 A;  2ZC7 A;  4KZ8 A;  4E3O A;  3IXB A;  4EWF A;  3NI9 A;  2PBY A;  4OH0 A;  5DTS A;  4H8R A;  4KZ5 A;  2JC7 A;  1EWZ A;  1MWT A;  3GV9 A;  4UA6 A;  1K6S A;  2JCH A;  5FI6 A;  1E25 A;  3ZDJ A;  1L2S A;  3BFC A;  4K0X A;  4PM6 A;  4ZJ1 A;  3G30 A;  4UAA A;  4P85 A;  4P0M A;  3VP4 A;  2Y2Q A;  1OME A;  3VSL A;  5M1A A;  2P9V B;  5A92 A;  3N6I A;  4KZ4 A;  4IVI A;  1NZO A;  1YLT A;  2ZQD A;  3P98 A;  1I2S A;  2V1Z A;  3W4O A;  2XFT A;  2FFY A;  3Q07 A;  3IWO A;  3DWK A;  4KG6 A;  4DE0 A;  5CGX A;  2WAF A;  3Q1F A;  4OON A;  2X02 A;  4FSF A;  1DJC A;  1PZP A;  5CTM A;  1W79 A;  2ZC5 B;  3BYD A;  1WYB A;  2X01 A;  1BUE A;  4IBX A;  4FCF A;  3ZHH A;  4JLF A;  4ZBE A;  4ID4 A;  1XKZ A;  2IWD A;  2Q9N A;  4ZJ2 A;  3V3S A;  1JVJ A;  3WS0 A;  2OSU A;  2WKH A;  4HEF A;  3SS4 A;  1KE4 A;  4D2O A;  4LV3 A;  2EFU A;  3BFD A;  3PTE A;  5DTT A;  3NDG A;  3FKW A;  1W8Y A;  1LL5 A;  3OPR A;  3G32 A;  3SH9 A;  1WE4 A;  5FQK A;  4WMC A;  1Y54 A;  1XP4 A;  1YT4 A;  4WBG A;  2HP5 A;  1YLJ A;  3VP3 A;  3PAG A;  4JBF A;  4OLD A;  2Y2P A;  5CED A;  2XH9 A;  2DCF A;  3TG9 A;  1JWV A;  5CHM A;  1ZKJ A;  5IHV A;  3BEC A;  1K56 D;  4R0Q A;  2QPN A;  3OPP A;  2R9X A;  4DDS A;  5TR7 A;  4JF5 A;  4KZ3 A;  3UPO A;  4S2K A;  1NYM A;  1M40 A;  3NDE A;  4K91 A;  3HBR A;  5GHZ A;  1H5X A;  5EVI B;  3NC8 A;  5A91 A;  5GLC A;  4E6W A;  4IVK A;  3HUO A;  1IYQ A;  1K55 C;  4KQO A;  4OP5 A;  4DDY A;  1DJA A;  1GA0 A;  4QHC A;  2ZC6 B;  3PBQ A;  1PI4 A;  5E2F A;  4N1H A;  1XA1 A;  3FKV A;  4GDN A;  3G31 A;  3RJU A;  3ZVT A;  4OOM A;  1HZO A;  3GSG A;  4K0W A;  5HL1 A;  2DNS A;  1PIO A;  3PBS A;  5JYO A;  1BLH A;  2G2U A;  1DY6 A;  1YM1 A;  3M2K A;  3BLM A;  4UA7 A;  1L0G A;  2ZQC A;  1YQS A;  5CGW A;  1KVM A;  2Y55 A;  3UE0 A;  5U47 A;  1KE3 A;  4OQG A;  1YLW A;  4OLG A;  3Q7V A;  1PWG A;  3GRJ A;  5FDH A;  4P87 A;  4S2J A;  4E3J A;  1ESU A;  1K57 A;  2XDM A;  2Y2N A;  3LEZ A;  4WM9 A;  4BLM A;  2RL3 A;  3O86 A;  1BTL A;  4BJP A;  1EI5 A;  4R3B A;  5CTN A;  3S4X A;  2IWC A;  1L0E A;  3BLS A;  1FR6 A;  1MBL A;  4HES A;  2Z2L B;  4NK3 A;  3C5A A;  5E2E A;  5GL9 A;  2FFF B;  4BL3 A;  2Y2M A;  2I72 A;  1E3U A;  4MBH A;  3RXW A;  1CEF A;  4QD4 A;  3VOY A;  3IF6 A;  1IYP A;  4Y0O A;  3Q82 A;  3UNW A;  4WZ5 A;  3WS5 A;  3HLF A;  3E2K A;  1MWS A;  3Q7Z A;  2ZC3 B;  3GR2 A;  3ZVW A;  4OOY A;  3A3I A;  3V3R A;  3WRT A;  1RGZ A;  3OPH A;  3ZG7 B;  1Z6F A;  1G6A A;  4EBN A;  3FYZ A;  3MXR A;  3MKF A;  4NET A;  4OQ0 A;  4GN2 A;  2ZQA A;  1W8Q A;  1RCJ A;  2V2F F;  5E43 A;  5FQI A;  4R23 A;  3ZG9 B;  5EPH A;  3BM6 A;  4JPM A;  3SH7 A;  1NYY A;  2ZQ9 A;  4EUZ A;  3MZD A;  3D4F A;  3UPN A;  3V5M A;  3WS4 A;  2ZM8 A;  2WZZ A;  2HDR A;  5DTK A;  4QU3 A;  3UDF A;  3IH9 A;  2EXA A;  1H8Z A;  4ZJ3 A;  1BT5 A;  4KZ6 A;  5FI2 A;  3QNB A;  2Z2M B;  2H0T A;  2WZX A;  1YMX A;  3IXD A;  2C6W B;  5FI7 A;  1FSW A;  5CHJ A;  3W4Q A;  3MZE A;  2H10 A;  4DF6 A;  4KG5 A;  3BEB A;  5HAP A;  2E8I A;  1ES3 A;  2WAD A;  5KMW A;  1KGF A;  3PAE A;  5I94 A;  4L0L A;  2IWB A;  5M18 A;  3EQV A;  4HBU A;  1GHI A;  1KDS A;  3O3V A;  2VGK A;  4GOG A;  5FQQ A;  3VP0 A;  4E3L A;  3VOZ A;  4P6B A;  1GHM A;  3LY3 A;  3CG5 A;  3TSG A;  3VMA A;  5A93 A;  1XPB A;  4S2I A;  2XEP A;  1CI8 A;  4A5R A;  5G18 A;  1PW1 A;  5J8X A;  1CEG A; 
#chains in the Genus database with same CATH topology
 2DRW A;  4RVA A;  3CUE A;  4HH3 A;  5EV0 A;  1RP5 A;  5AQ9 A;  4WZ4 A;  3DAV A;  2QHK A;  4KZA A;  1Z09 A;  3CWF A;  3WS2 A;  5HX9 A;  5CEB A;  1FIK A;  2WUQ A;  5IS1 A;  1NRJ A;  1S67 L;  5DF9 A;  4EEP A;  1KE0 A;  2ZOI A;  3MBZ A;  3HLC A;  4HY8 A;  1CK3 A;  1J3W A;  2PBD P;  5KZH A;  4R4S A;  2M7U A;  5AVF A;  4E3K A;  3BRM A;  3UB5 P;  3HLG A;  3VV4 A;  1W5D A;  2H5S A;  1VM1 A;  2WGV A;  3BWL A;  4P6Z M;  4G3K A;  5CEC A;  2GX5 A;  2Y2K A;  4KQQ A;  2J8Y A;  2A24 B;  2CMN A;  1TEM A;  4WZ5 C;  4GB7 A;  1UWP X;  5CRF A;  1BYW A;  4S2M A;  1SHV A;  2XFS A;  2JHE A;  3KSI A;  4S2N A;  3S1Y A;  3S7P A;  4LCM A;  2INW A;  2WYX A;  5EVE A;  3UDI A;  4U3T A;  3UY6 A;  1PYY A;  5GLA A;  2HDQ A;  3WRZ A;  5L2F A;  5HW3 A;  2OLV A;  4HQA A;  3LCE A;  1D7E A;  1MKM A;  2WKP A;  2K31 A;  5FQM A;  4H6J B;  3O88 A;  2JKR I;  2XRO A;  3IBR A;  2XD5 A;  1JTG A;  2HDU A;  5E2H A;  4PM5 A;  1BSG A;  3Q81 A;  1FCO A;  1V9Y A;  1MY8 A;  3N7W A;  4QJG A;  5FAS A;  2PAV P;  4ZDX A;  2P9V A;  3T50 A;  3OC2 A;  4JF4 A;  4DE3 A;  4CJN A;  2XLN A;  2QMI A;  4LCL A;  2WGW B;  4RYE A;  3EEH A;  3ITB A;  3HRE A;  1NWZ A;  3VP1 A;  1N4O A;  3H7W A;  3HJI A;  2R78 A;  4HP4 A;  3G34 A;  2J3T C;  3T4K A;  5F82 A;  5IT5 A;  2YKH A;  3DTM A;  3T1X A;  3B47 A;  4E6X A;  3AGD A;  5GHX A;  3LYX A;  5CER A;  2W1T B;  4XUZ A;  1UGU A;  4CLC A;  2ZM2 A;  2Y2O A;  3QP8 A;  1XJ4 A;  3OBF A;  4GLQ A;  1U60 A;  2HP9 A;  1OTA A;  4JXV A;  1G68 A;  3DBA A;  5HFO A;  1FR1 A;  3VOL A;  4C3Q A;  1QME A;  1W63 M;  4NXF A;  4BBV A;  3V39 A;  1MXO A;  3OPL A;  1LSW A;  1SKF A;  5J7E A;  1TDG A;  3HCY A;  4Z1W A;  2JN7 A;  4MLL A;  4GNU A;  1K4E A;  3UB8 A;  1TD5 A;  3LUQ A;  1ODV A;  5CGS A;  3FC7 A;  3M6B A;  2L0W A;  4EU0 A;  3A3D A;  4M3K A;  4XT2 A;  1KGG A;  4F3L B;  4MNR A;  3CZD A;  2V1B A;  3C30 A;  2Q9M A;  3D3O A;  5FL3 A;  2PYP A;  4L9E A;  1BLC A;  4O8G A;  3S22 A;  2Y2H A;  1GCE A;  3OOV A;  5F83 A;  4YFM A;  1Q2Q A;  4RQ9 A;  1TDL A;  1ES5 A;  1ERM A;  1JTD A;  1NJ4 A;  3RTY A;  5BOH A;  3LIB A;  4OPY A;  4DE1 A;  5TGF A;  5EVI D;  4KG2 A;  3K3D A;  4PM9 A;  4C75 A;  1SDN A;  2DMW A;  3IXG A;  4WYY A;  3BFF A;  4WEJ A;  3P7N A;  3E98 A;  3A3E A;  3B42 A;  4KZ8 A;  4E3O A;  2PRF A;  2PBY A;  5DTS A;  4X1M A;  3GV9 A;  3ZDJ A;  1K6S A;  2JCH A;  5FI6 A;  1E25 A;  3LGO A;  1L2S A;  4PM6 A;  4ZJ1 A;  2O99 A;  5HDC A;  4NXE A;  3LID A;  2P9V B;  3N6I A;  1NZO A;  3F1P B;  4UQI S;  1I2S A;  2ZBB A;  3Q1F A;  1DJC A;  5CTM A;  4IBX A;  3CIT A;  4GHI B;  4JLF A;  5TJJ A;  4ID4 A;  4ZJ2 A;  2HF6 A;  1JVJ A;  4HEF A;  3BQ8 A;  3L7H A;  3PTE A;  2XRN A;  3CHW P;  5FQK A;  1XP4 A;  2HP5 A;  3BJN A;  4G3W A;  4JBF A;  2Y2P A;  5CED A;  3TG9 A;  1JWV A;  3BEC A;  3CPT B;  2KX6 A;  3H9W A;  5C5K A;  1M40 A;  1VET A;  5A91 A;  5GLC A;  4E6W A;  4IVK A;  3VE4 A;  3E4P A;  5HDS A;  5FEG A;  1GA0 A;  2JKR M;  4QHC A;  3FKV A;  3G31 A;  3RJU A;  4K0W A;  3LFV A;  2DNS A;  5JYO A;  1BLH A;  1L0G A;  4DJ3 A;  2K7S A;  5DKL A;  1KE3 A;  5FDH A;  5J4E A;  1A0K A;  4S2J A;  1T1C A;  2XDM A;  1S4R A;  1DP6 A;  4JGO A;  3OLO A;  3LR5 A;  4XT2 B;  3TJZ C;  4BL3 A;  1XFN A;  5E2E A;  2I72 A;  1PNE A;  3VOY A;  3E4Q A;  3Q82 A;  3E2K A;  3Q7Z A;  3MQ0 A;  3CLO A;  3GR2 A;  3DTK A;  3ZVW A;  3A3I A;  3WRT A;  1Z6F A;  4IJG A;  4BBT A;  4MN5 A;  1CF0 A;  3ZG9 B;  4E04 A;  4JGP A;  5EPH A;  3WS4 A;  2EXA A;  3LR3 A;  3QNB A;  2Z2M B;  1YSQ A;  5I5L A;  5FI7 A;  4IHQ A;  3MZE A;  4DF6 A;  1DP8 A;  4KG5 A;  3BEB A;  1ES3 A;  4R6L A;  3EQV A;  3O3V A;  5FQQ A;  3VOZ A;  4P6B A;  1GHM A;  3VMA A;  4S2I A;  2XEP A;  2K2N A;  1PW1 A;  5G18 A;  5J8X A;  1F98 A;  4X25 A;  1SKO B;  3UME A;  1O7E A;  3T4Q A;  4R4R A;  2M1C A;  1YSP A;  4JKT A;  4ZRR A;  1PWC A;  4XXR A;  5EE8 A;  1ESI A;  3BY9 A;  4KQD A;  4WEL A;  2G2W A;  2PYR A;  4AFI A;  4Y7P A;  4MN6 A;  3M6H A;  3EEA A;  2ZL1 A;  4GKU A;  1SDE A;  5EVI A;  3E2L A;  3F1O A;  5KSC A;  3IHA A;  3UDX A;  4X53 A;  3IWQ A;  5E2G A;  3T1Q B;  1OT6 A;  5CXW A;  4HIA A;  4RX2 A;  3QNC A;  3GQZ A;  3KO6 A;  1OT9 A;  1P0Z A;  3CMZ A;  1KVL A;  1K4F A;  3IF6 C;  3NUL A;  4PPR A;  3UB7 A;  1VET B;  5F1G A;  1XXM A;  1FCN A;  5HWT A;  4GDB A;  3MSH A;  2Y4A A;  2H28 A;  3VE3 A;  1GA9 A;  5DJT A;  4O0P A;  1STZ A;  2WKI A;  5AVE A;  3NCK A;  4MDZ A;  3ZFZ A;  4OPZ A;  2W3G A;  3T4J A;  1LI9 A;  5HAR A;  4C6Y A;  1ES4 A;  2A49 A;  3IQA A;  4CPK A;  1IYS A;  2JKT M;  3IS2 B;  2XGN A;  1S1Y A;  4L9G A;  1S66 L;  4YIN A;  4B4Z A;  1XX2 A;  3HJK A;  1IEL A;  3WS1 A;  2YKF A;  3CUE C;  4Y17 A;  1JWP A;  5HAQ A;  4MBF A;  4PHT A;  3PHY A;  2Y59 A;  3D72 A;  5TFQ A;  1DJB A;  3LEQ A;  1ERO A;  2XK1 A;  4OQH A;  1TS0 A;  4X6T A;  1WYC A;  2O9C A;  1W7F A;  2XA7 M;  2W1R A;  3LIE A;  4BQM A;  4BBU A;  3HUN A;  2OWH A;  1BZA A;  2BG1 A;  1S0W A;  4LV2 A;  4PAU A;  4X55 A;  4GD6 A;  5FA7 A;  1L0F A;  5HZH A;  1XJ3 A;  4E3I A;  1ALQ A;  3G2Y A;  2FZ0 A;  2P74 A;  4KQR A;  2WGI A;  4X56 A;  5F6A A;  4O01 A;  4X1L A;  1FQG A;  1FOF A;  3VFF A;  2J9P A;  3BFG A;  4FD8 A;  3N8L A;  1QMF A;  3BFE A;  1ZC2 A;  1KGE A;  4YOF A;  4S2N C;  2V20 A;  3CJM A;  5HSQ A;  2EX6 A;  3EWK A;  2VV7 A;  4KZ7 A;  3V50 A;  4ARZ B;  4S2L A;  4LV0 A;  3MR0 A;  1LL9 A;  3MFD A;  5FSR A;  1XA7 A;  2HDS A;  1YPR A;  5D3O A;  2Y2J A;  4B88 A;  3O87 A;  2JBF A;  2WAE A;  2ZD8 A;  3JYI A;  3UN7 A;  3LIC A;  4OVD A;  4JGQ A;  3ZG5 A;  3LO7 A;  2Y8H A;  3R7W B;  3PR6 A;  3NOT C;  3DWZ A;  4GJ4 A;  4Y3I A;  3G2Z A;  2A3U A;  5FAP A;  2RCX A;  3F1N B;  4JXS A;  4OOL A;  1IYO A;  1PI5 A;  2XF3 A;  2O9A A;  3NEC A;  1C3B A;  2J7V A;  4LEN A;  2XD1 A;  4EBL A;  3DW0 A;  4EUV A;  2XQZ A;  4DKI A;  2D01 A;  1PZO A;  3LY4 A;  3TRC A;  1ACF A;  3IF6 B;  3MZF A;  3RH8 B;  1I2W A;  2GZA A;  3N8R A;  1GHP A;  4Y13 A;  4OPQ A;  4CLC C;  1FCM A;  3E0Y A;  3ZYT A;  3IXB A;  3BY8 A;  4EWF A;  3NI9 A;  1SZV A;  4UA6 A;  4K0X A;  5L8M A;  3G30 A;  4P85 A;  1OTD A;  3VSL A;  5A92 A;  3ZQ5 A;  3NHQ A;  1YLT A;  3P98 A;  2VGL M;  2XFT A;  1FIL A;  4R70 A;  4KG6 A;  3KSF A;  2WAF A;  4FSF A;  4GS9 A;  3KSH A;  1W79 A;  2ZC5 B;  3BYD A;  1BUE A;  4FCF A;  4FTX A;  4PKY G;  1OTI A;  1XKZ A;  3T4L A;  3SS4 A;  1KE4 A;  5DTT A;  3NDG A;  4I39 A;  4EW7 A;  3OPR A;  3SH9 A;  1T1A A;  4WBG A;  1G6O A;  1YT4 A;  1YLJ A;  1T19 A;  1TS6 A;  3PAG A;  4OLD A;  3LI9 A;  4R0Q A;  2QPN A;  3OPP A;  3HBR A;  3HUO A;  1S4S A;  1IYQ A;  3JVU A;  2P08 A;  3PBQ A;  4N1H A;  1XA1 A;  4OOM A;  3G6O A;  1F9I A;  4LRY C;  1PIO A;  3PBS A;  2M7V A;  1DY6 A;  4DJ2 A;  3BLM A;  2ZQC A;  1YQS A;  5CGW A;  2VJW A;  2Y55 A;  4P6Z S;  2VV8 A;  5LBR A;  1WA9 A;  2QKP A;  1YLW A;  1GSX A;  4II7 A;  2VV6 A;  1K57 A;  2Y2N A;  4BLM A;  2RL3 A;  4BJP A;  5TBM A;  3KSG A;  1L0E A;  1FR6 A;  4HES A;  1NLY A;  4NK3 A;  3C5A A;  2FFF B;  4PKY A;  2Y2M A;  4Q0I A;  4Y0O A;  3K2N A;  4EEU A;  4WL9 A;  1VEU A;  1Y28 A;  4OOY A;  3ZG7 B;  3OPH A;  3MKF A;  4NET A;  2ZQA A;  2HV1 A;  2V2F F;  4JPM A;  2W3E A;  1F5M A;  2Q0O A;  3MZD A;  3D4F A;  3UB9 A;  4D60 A;  2HDR A;  2V0W A;  4LGW A;  1CQA A;  3H82 A;  2Z6D A;  2H0T A;  3IXD A;  1YMX A;  1P9W A;  2C6W B;  5CHJ A;  3SW1 A;  3T1S A;  5KMW A;  3PAE A;  5I94 A;  4HBU A;  1GHI A;  2VGK A;  4GOG A;  4E3L A;  3H7W B;  1XPB A;  1V9Z A;  2OAQ 1;  2VZW A;  4LLO B;  1CEG A;  4CLC E;  2V1A A;  5J3W A;  1AWI A;  1S1Z A;  3W4P A;  4I38 A;  1VQQ A;  5FQ9 A;  1ES2 A;  3C7U A;  3AGE A;  3ZGA B;  2VGL S;  2ZJ9 A;  3FPV A;  4CLC B;  3PBN A;  2EX8 A;  3S7Q A;  3T4O A;  2EX2 A;  1G5U A;  1MWR A;  1YLZ A;  1L0D A;  4BD1 A;  4HI4 A;  4HH2 A;  1GSV A;  3ZNT A;  3IWI A;  5KIZ A;  2W3D A;  4E3M A;  1K54 A;  3LIF A;  4NXG A;  3GTC A;  4LRZ E;  3FV7 A;  4LFU A;  4QB8 A;  1UWN X;  4N9L A;  2A2L A;  4B9O A;  1BUL A;  4BL2 A;  4KZB A;  3NIA A;  3PBT A;  1N9B A;  3IXH A;  3HLW A;  2WKE A;  4ZTK A;  4Q0J A;  1YMS A;  3KYQ A;  1TS8 A;  2NUT C;  5F69 A;  3EOI A;  3UPP A;  1CI9 A;  3QP4 A;  4RX3 A;  3HVF A;  4FH4 A;  3ZG0 A;  1MWU A;  3GMW A;  3DTI A;  3MXS A;  3QP2 A;  2ZMA A;  4EV4 A;  2BAS A;  4UA9 A;  3NBL A;  4N92 A;  5L07 A;  2PU4 A;  1E4D A;  4QY5 A;  1VEU B;  4DN0 A;  5DJU A;  5AQA A;  2QJ7 A;  3T4T A;  2QZ6 A;  3IH8 A;  4K08 A;  1I5Q A;  5EUA A;  1W63 Q;  3MJQ A;  2ZMV A;  3WWX A;  5EVI C;  4JXG A;  2R9W A;  3T12 B;  3ZCZ A;  5IU1 A;  3UMD A;  3D9Y A;  4X69 A;  2Y2L A;  5FAQ A;  3EQU A;  5AQ7 A;  3NOU C;  2OV5 A;  3A3F A;  4HHD A;  5A90 A;  1YKD A;  1VB6 A;  3R4K A;  4OPR A;  2QWS A;  3FWL A;  5EM1 A;  4ZAM A;  4ETX A;  1E3U D;  3ISG A;  5FEF A;  4HOI A;  2EX9 A;  1NY0 A;  2BLS A;  5FQJ A;  4FUW A;  3UE1 A;  3PXP A;  4S2P A;  4BEN A;  3VFH A;  1IOU A;  5DFX A;  2L4R A;  4B4X A;  3SS3 A;  3OCL A;  1NRF A;  4ESP A;  1PRQ A;  2UWX A;  2A24 A;  2IA2 A;  4Q8I A;  5EOE A;  4FOF A;  3TOI A;  4R1G A;  1M6K A;  3ULF A;  3TW8 A;  1S6R A;  2H0Y A;  3MKE A;  3M2J A;  4EET B;  1LI0 A;  3NOP C;  3MS6 A;  1O07 A;  1YLP A;  4KEN B;  1FSY A;  2V9A A;  1RGY A;  5EOO A;  5FAO A;  3VP2 A;  2PD8 A;  5A8B A;  4F94 A;  3BW6 A;  2B5R A;  1BLP A;  2ZQ7 A;  3MXQ A;  1IKI A;  3LR4 A;  5JYP A;  5KSH A;  5F1F A;  3B3X A;  2L1M A;  4ME4 A;  5HAI A;  1IEM A;  5DVA A;  4H6J A;  1Q2P A;  1K55 A;  2ZM0 A;  5DF8 A;  5HL6 A;  4N1X A;  4X68 A;  3MF0 A;  4Y2F A;  3AGF A;  4EES A;  2PHY A;  4PM8 A;  5EFW A;  5CHU A;  1TVF A;  5AJG A;  4PM7 A;  2J3T D;  4R3J A;  3U2A A;  1H3Q A;  1ZG6 A;  2ZC4 B;  3SS5 A;  3HL9 A;  1KDW A;  2Y2I A;  5HDD A;  3L9K A;  4WUJ A;  2CC1 A;  3SH8 A;  1ONG A;  2WGW A;  2G7U A;  2GDN A;  1TF1 A;  1LSV A;  1PW8 A;  2ZC7 A;  1PFL A;  2ACG A;  4GCZ A;  4KZ5 A;  2JC7 A;  3NJA A;  3DTE A;  2ZMF A;  3BFC A;  4UAA A;  4I5S A;  1OME A;  5M1A A;  4KZ4 A;  4IVI A;  2ZQD A;  2V1Z A;  2VA0 A;  2FFY A;  1YAX A;  1Y4O A;  3IWO A;  3DWK A;  3JVV A;  2X02 A;  1PZP A;  1WYB A;  2X01 A;  2J3W A;  4ZBE A;  5DFY A;  2IWD A;  2Q9N A;  3V3S A;  2WKH A;  3IX3 A;  4D2O A;  4LV3 A;  1D1J A;  1W8Y A;  1G28 A;  1CJF A;  1WE4 A;  2VKS A;  1TS7 A;  4NKP A;  2Z6C A;  4EXO A;  2D02 A;  2XH9 A;  2DCF A;  3QP6 A;  5CHM A;  1ZKJ A;  2O0Y A;  1K56 D;  3IBJ A;  2R9X A;  4M4X A;  3UPO A;  4S2K A;  2ZL1 B;  1NYM A;  5GHZ A;  5EVI B;  3NC8 A;  1XFQ A;  1KOU A;  3F1O B;  2HJE A;  2KLI A;  3MMH A;  4DDY A;  2EWV A;  4Q0H A;  1DJA A;  2VEA A;  2ZC6 B;  5E2F A;  4GDN A;  3GSG A;  4F3L A;  1OPX A;  1YM1 A;  4G3V A;  2HZ5 A;  4UA7 A;  3C8C A;  3UE0 A;  3TE8 A;  5U47 A;  3CAX A;  3KX0 X;  4OLG A;  3Q7V A;  4IUK A;  3T4S A;  4E3J A;  2I9V A;  2Y79 A;  3O86 A;  3LI8 A;  1BTL A;  4R3B A;  2IWC A;  3BLS A;  1E3U A;  4MBH A;  3RXW A;  4QD4 A;  3A0S A;  3UNW A;  1OTB A;  4WZ5 A;  3WS5 A;  3HLF A;  3MQO A;  4HP9 A;  3MFX A;  3V3R A;  1RGZ A;  4B93 A;  2GNX A;  2V8F A;  1G6A A;  4EBN A;  3FYZ A;  3MXR A;  1JNU A;  5E43 A;  4R23 A;  3EGX C;  3SH7 A;  1D06 A;  1NYY A;  3UPN A;  3V5M A;  4UQI M;  2FH5 A;  5FDS A;  3UDF A;  2LB5 A;  3IH9 A;  1H8Z A;  4ZJ3 A;  2V0U A;  3F1P A;  4EER A;  1MC0 A;  5EM0 A;  1K0K A;  2H10 A;  4NXB A;  3KYE A;  5HAP A;  2E8I A;  1KGF A;  2IWB A;  5M18 A;  1P97 A;  4Y5F A;  4GHI A;  3LY3 A;  3CG5 A;  5A93 A;  2OOL A;  4A5R A;  1GSW A;  2WKR A;  5K5B A;  4Y15 A;  2XA7 S;  5FAT A;  2HJ9 C;  2JE5 A;  4N9K A;  4UHU A;  4E3N A;  4Z9Q A;  1X0O A;  3MQQ A;  2PR6 A;  3CPT A;  2J9O A;  4DE2 A;  1HD8 A;  3IF5 A;  1HTZ A;  2PDR A;  2Y91 A;  3G4P A;  4DXB A;  4HNB A;  2NUP C;  3ITA A;  1K57 C;  3A3J A;  5L10 A;  4RA7 A;  2VGJ A;  3VSK A;  1T18 A;  3C4P A;  3KYZ A;  3T1R A;  3W8K A;  4CQH A;  1MKI A;  2BTF P;  4QY6 A;  4YNR A;  4Y0T A;  4R38 A;  4OP8 A;  4U0T A;  5HPI A;  3V67 A;  3UE3 A;  3ZNY A;  1ERQ A;  1MZU A;  4WF0 A;  5GLB A;  1H8Y A;  3OCN A;  2WK0 A;  4QPR A;  3HLB A;  3A0V A;  3GDI A;  3QP1 A;  4GD8 A;  1N9N A;  2XSS A;  1OJG A;  3U4L P;  3P01 A;  4WMC D;  3Q7V B;  1AXB A;  3C4O A;  5HWW A;  4DMZ A;  1XGI A;  1IKG A;  4XUX A;  4BD0 A;  3UB6 A;  1LHY A;  4JF6 A;  1XJ2 A;  5HWV A;  5MC7 A;  1NXY A;  1K56 A;  2Y2G A;  1NZU A;  2ZLY A;  3HLD A;  1ONH A;  5G4Z A;  5CX7 A;  3N8S A;  5DF7 A;  3A0R A;  3IX4 A;  3UE6 A;  4OKP A;  4FH2 A;  4WLA A;  1EW0 A;  3GVB A;  1L3L A;  4EQI A;  4MEZ A;  3IHB A;  1LLB A;  3FZC A;  2OWJ A;  3LR0 A;  5G4Y A;  3QHY A;  1J9M A;  1VHM A;  4WEK A;  4KUK A;  2PT7 A;  1F2K A;  1XJ6 A;  2AVX A;  3P09 A;  1OTE A;  4JXW A;  2JKT I;  1YLY A;  1SKO A;  2O9B A;  2E8J A;  4QWO A;  3NY4 A;  4HBT A;  2P04 A;  1K54 C;  2PR5 A;  3PBO A;  1JWZ A;  3K3C A;  5HPF A;  3LIA A;  4GS9 B;  4HJ3 A;  2C5W B;  2VK3 A;  5F5Y A;  3PBR A;  4JGR A;  4YWZ A;  5GHY A;  3B33 A;  4I3A A;  2HP6 A;  2W3F A;  1K38 A;  1K6R A;  1HLU P;  4DXC A;  4LV1 A;  2OLU A;  2HPB A;  4LRX C;  1LSX A;  4GW9 A;  3HUM A;  3OZH A;  2XR0 A;  2EFX A;  1K25 A;  4ETZ A;  5EVL A;  4MCW A;  5AQB A;  3G35 A;  3SOI A;  2ZOH A;  5EEC A;  1NLZ A;  3RXX A;  2VLG A;  1HVB A;  2MJ6 A;  1N9O A;  4MN7 A;  2KDK A;  1XGJ A;  4IUH A;  3IT9 A;  4IBR A;  4S2O A;  4KZ9 A;  4LPZ A;  2P7J A;  1MPL A;  2KOI A;  3C7V A;  1H0M A;  4PMA A;  4IED A;  2B18 A;  3EGD C;  5GLD A;  3IS2 A;  3I7J A;  4Y0U A;  1PWD A;  2EXB A;  4DRT A;  1LT0 A;  2ZQ8 A;  4EBP A;  3FPW A;  2X71 A;  4MMN A;  5M19 A;  4MBK A;  1SCW A;  4O7D A;  1BLS A;  1DRM A;  3HLE A;  2PU2 A;  4GZB A;  3ZG8 B;  1T1B A;  5TBM B;  4OQI A;  2EWW A;  4U0X A;  3UO9 A;  2LB9 A;  4R3A A;  3N4I A;  2GJ3 A;  1ZG4 A;  1DP9 A;  1IFQ A;  4OH0 A;  3RFB A;  4H8R A;  1EWZ A;  1MWT A;  4HJ4 A;  4P0M A;  3VP4 A;  4KUO A;  2Y2Q A;  3H82 B;  3W4O A;  3Q07 A;  4NEE D;  4WN5 A;  2WKQ A;  4DE0 A;  5CGX A;  4OON A;  2EA9 A;  3JPU A;  3S7O A;  2QYB A;  3ZHH A;  3E4O A;  3WS0 A;  1P9R A;  2OSU A;  1LL8 A;  2J80 A;  2EFU A;  3BFD A;  3W2Z A;  2W3H A;  3FKW A;  3IX8 A;  1LL5 A;  3G32 A;  4WMC A;  1Y54 A;  2UV0 E;  3VP3 A;  4ARZ A;  2V8C A;  5IHV A;  2OAP 1;  4DDS A;  5TR7 A;  4JF5 A;  4KZ3 A;  2B02 A;  3NDE A;  4K91 A;  1H5X A;  2QJ5 A;  1K55 C;  4KQO A;  4OP5 A;  5HD3 A;  4I3J A;  1PI4 A;  4I3I A;  3SZT A;  3ZVT A;  5F68 A;  1HZO A;  1OJ5 A;  3R7W A;  3PYP A;  5HD5 A;  5HL1 A;  3CI6 A;  2G2U A;  3QP5 A;  3M2K A;  4BMW A;  4UEY A;  3F1N A;  1KVM A;  5DKK A;  2W0N A;  4OQG A;  2HGV A;  1PWG A;  3GRJ A;  2JKG A;  4P87 A;  1ESU A;  3LEZ A;  4WM9 A;  4HJ6 A;  4CLC D;  1EI5 A;  5CTN A;  3S4X A;  2JKF A;  1ZTU A;  3O5Y A;  1MBL A;  2Z2L B;  3ICY A;  5L09 A;  5GL9 A;  1CEF A;  3IF6 A;  1IYP A;  3BQA A;  4L9F A;  1MWS A;  2ZC3 B;  4OQ0 A;  4GN2 A;  1W8Q A;  4NG2 A;  1RCJ A;  1ZHH B;  3C38 A;  5FQI A;  3BM6 A;  2ZQ9 A;  4EUZ A;  2ZM8 A;  3C2W A;  2WZZ A;  1N9L A;  4QU3 A;  5DTK A;  1BT5 A;  4KZ6 A;  5FI2 A;  2W27 A;  2WZX A;  4EQ1 A;  1FSW A;  3W4Q A;  2PD7 A;  2WAD A;  4BWI A;  4L0L A;  2VX8 A;  1H8M A;  1KDS A;  2W1T A;  3GEC A;  3VP0 A;  2B95 A;  3TSG A;  3S7N A;  1CI8 A;  3FG8 A; 
#chains in the Genus database with same CATH homology
 2DRW A;  4RVA A;  5FAT A;  3W4P A;  1RP5 A;  5AQ9 A;  4WZ4 A;  4KZA A;  2JE5 A;  1O7E A;  1VQQ A;  4R4R A;  4N9K A;  4UHU A;  4JKT A;  4E3N A;  3WS2 A;  5FQ9 A;  5HX9 A;  1PWC A;  4Z9Q A;  5CEB A;  4XXR A;  5EE8 A;  1ESI A;  1ES2 A;  2WUQ A;  3C7U A;  3AGE A;  5DF9 A;  4WEL A;  3ZGA B;  2G2W A;  1KE0 A;  2ZJ9 A;  3MBZ A;  4Y7P A;  2J9O A;  3M6H A;  3PBN A;  2EX8 A;  3HLC A;  4DE2 A;  1CK3 A;  1HD8 A;  2EX2 A;  3IF5 A;  5KZH A;  4R4S A;  1HTZ A;  1MWR A;  1SDE A;  4GKU A;  1YLZ A;  5EVI A;  3E2L A;  5KSC A;  1L0D A;  3IHA A;  3UDX A;  4E3K A;  2Y91 A;  3G4P A;  4DXB A;  4X53 A;  3BRM A;  3IWQ A;  5E2G A;  4BD1 A;  5CXW A;  3HLG A;  3ITA A;  3ZNT A;  1K57 C;  3A3J A;  1W5D A;  4RX2 A;  3IWI A;  4RA7 A;  2VGJ A;  3QNC A;  3VSK A;  3GQZ A;  2H5S A;  4E3M A;  1K54 A;  3C4P A;  1VM1 A;  3W8K A;  2WGV A;  1MKI A;  3GTC A;  4QY6 A;  4Y0T A;  3CMZ A;  5CEC A;  1KVL A;  1K4F A;  3FV7 A;  2Y2K A;  4KQQ A;  2J8Y A;  3IF6 C;  4OP8 A;  4PPR A;  1TEM A;  4U0T A;  4WZ5 C;  4GB7 A;  5F1G A;  3UE3 A;  3ZNY A;  4QB8 A;  5CRF A;  1ERQ A;  1XXM A;  1FCN A;  4N9L A;  5GLB A;  1BUL A;  4BL2 A;  1H8Y A;  4GDB A;  4S2M A;  1SHV A;  4KZB A;  3NIA A;  2Y4A A;  2XFS A;  3OCN A;  2WK0 A;  3PBT A;  1GA9 A;  1N9B A;  3IXH A;  4S2N A;  3HLW A;  2WKE A;  3S1Y A;  4ZTK A;  1YMS A;  2WKI A;  3HLB A;  4LCM A;  3NCK A;  2WYX A;  3ZFZ A;  4GD8 A;  3UDI A;  4U3T A;  4OPZ A;  3UY6 A;  1LI9 A;  1PYY A;  5GLA A;  2HDQ A;  5HAR A;  4C6Y A;  1ES4 A;  3WRZ A;  2A49 A;  3IQA A;  5L2F A;  5HW3 A;  3UPP A;  4CPK A;  1IYS A;  2OLV A;  1CI9 A;  2XGN A;  3LCE A;  4RX3 A;  3HVF A;  5FQM A;  4WMC D;  3Q7V B;  1AXB A;  4FH4 A;  3C4O A;  3ZG0 A;  1MWU A;  3O88 A;  3GMW A;  1XGI A;  1IKG A;  4XUX A;  2XD5 A;  1JTG A;  2HDU A;  4BD0 A;  3MXS A;  5E2H A;  2ZMA A;  4PM5 A;  1LHY A;  4JF6 A;  4YIN A;  4EV4 A;  1BSG A;  4B4Z A;  1NXY A;  1XX2 A;  3Q81 A;  1K56 A;  1IEL A;  2Y2G A;  1NZU A;  4UA9 A;  3WS1 A;  2ZLY A;  1FCO A;  3NBL A;  3HLD A;  4N92 A;  2PU4 A;  1MY8 A;  3N7W A;  1JWP A;  5HAQ A;  1E4D A;  4QJG A;  1ONH A;  4MBF A;  5FAS A;  4ZDX A;  2P9V A;  4QY5 A;  2Y59 A;  5AQA A;  5TFQ A;  1DJB A;  3N8S A;  3OC2 A;  5DF7 A;  4JF4 A;  4DE3 A;  4CJN A;  2XLN A;  1ERO A;  2XK1 A;  2QMI A;  4OKP A;  4OQH A;  2QZ6 A;  4FH2 A;  3IH8 A;  4LCL A;  2WGW B;  3GVB A;  4X6T A;  4RYE A;  4EQI A;  4MEZ A;  1WYC A;  3ITB A;  3HRE A;  3IHB A;  1W7F A;  1LLB A;  1I5Q A;  3FZC A;  5EUA A;  3VP1 A;  1N4O A;  3QHY A;  3WWX A;  5EVI C;  1J9M A;  4BQM A;  4WEK A;  4JXG A;  2R9W A;  3G34 A;  3HUN A;  5F82 A;  3ZCZ A;  3P09 A;  4JXW A;  3DTM A;  1YLY A;  1BZA A;  2BG1 A;  1S0W A;  4LV2 A;  4X69 A;  2Y2L A;  3NY4 A;  4X55 A;  4HBT A;  4GD6 A;  5FA7 A;  1K54 C;  5FAQ A;  1L0F A;  4E6X A;  3EQU A;  5AQ7 A;  3AGD A;  3PBO A;  5GHX A;  2OV5 A;  1JWZ A;  4E3I A;  3A3F A;  1ALQ A;  3G2Y A;  5A90 A;  2P74 A;  5CER A;  4KQR A;  4XUZ A;  2WGI A;  4OPR A;  2ZM2 A;  3FWL A;  2Y2O A;  4X56 A;  4ZAM A;  2C5W B;  1E3U D;  3ISG A;  1FQG A;  1FOF A;  3PBR A;  2EX9 A;  3VFF A;  2J9P A;  1NY0 A;  1U60 A;  2BLS A;  2HP9 A;  3BFG A;  4FD8 A;  5FQJ A;  3N8L A;  3UE1 A;  4S2P A;  4JXV A;  1QMF A;  1G68 A;  5HFO A;  3BFE A;  1ZC2 A;  1KGE A;  5GHY A;  2HP6 A;  1FR1 A;  1K38 A;  4S2N C;  4BEN A;  1K6R A;  2V20 A;  3CJM A;  4DXC A;  4LV1 A;  3VFH A;  2EX6 A;  4C3Q A;  2OLU A;  1QME A;  2HPB A;  4KZ7 A;  3V50 A;  3HUM A;  3OZH A;  3SS3 A;  3V39 A;  4B4X A;  1MXO A;  3OCL A;  3OPL A;  2XR0 A;  1NRF A;  4S2L A;  2UWX A;  2EFX A;  1K25 A;  1SKF A;  4LV0 A;  5EVL A;  1TDG A;  4Q8I A;  1LL9 A;  3MFD A;  5EOE A;  5FSR A;  5AQB A;  3TOI A;  3G35 A;  4R1G A;  3SOI A;  1M6K A;  4MLL A;  5EEC A;  1XA7 A;  4GNU A;  2HDS A;  3RXX A;  1HVB A;  1K4E A;  5D3O A;  1S6R A;  2H0Y A;  3MKE A;  3M2J A;  2Y2J A;  5CGS A;  3M6B A;  4B88 A;  1LI0 A;  1XGJ A;  2JBF A;  3O87 A;  1O07 A;  2WAE A;  1YLP A;  3IT9 A;  4IBR A;  2ZD8 A;  4KEN B;  1FSY A;  3JYI A;  3A3D A;  1RGY A;  4M3K A;  5EOO A;  5FAO A;  3UN7 A;  4OVD A;  3VP2 A;  4S2O A;  4F94 A;  3ZG5 A;  2B5R A;  1BLP A;  1KGG A;  3LO7 A;  4KZ9 A;  4MNR A;  2ZQ7 A;  3CZD A;  2Q9M A;  1IKI A;  1MPL A;  3C7V A;  3DWZ A;  4PMA A;  3G2Z A;  4IED A;  2A3U A;  5FAP A;  5JYP A;  5KSH A;  5GLD A;  2RCX A;  3B3X A;  5F1F A;  1BLC A;  4JXS A;  5HAI A;  4OOL A;  1IEM A;  3I7J A;  1IYO A;  1PI5 A;  2Y2H A;  1PWD A;  2EXB A;  4Y0U A;  5DVA A;  2XF3 A;  3S22 A;  2ZQ8 A;  4DRT A;  4EBP A;  2X71 A;  1C3B A;  5M19 A;  1GCE A;  4MBK A;  1SCW A;  1Q2P A;  4O7D A;  1K55 A;  2ZM0 A;  5DF8 A;  2J7V A;  5F83 A;  1BLS A;  4YFM A;  4LEN A;  2XD1 A;  1Q2Q A;  4N1X A;  4EBL A;  3DW0 A;  4X68 A;  1TDL A;  1ES5 A;  3HLE A;  1ERM A;  1JTD A;  3AGF A;  2PU2 A;  4GZB A;  4PM8 A;  2XQZ A;  3ZG8 B;  1NJ4 A;  4OQI A;  5BOH A;  4DKI A;  4OPY A;  5CHU A;  4DE1 A;  1TVF A;  5TGF A;  5EVI D;  4KG2 A;  4U0X A;  1PZO A;  4PM9 A;  3UO9 A;  4PM7 A;  4C75 A;  3LY4 A;  1SDN A;  4R3J A;  3IXG A;  3IF6 B;  4WYY A;  3BFF A;  3MZF A;  1ZG6 A;  2ZC4 B;  1I2W A;  3SS5 A;  3HL9 A;  1KDW A;  3N8R A;  4WEJ A;  1GHP A;  2Y2I A;  3N4I A;  1ZG4 A;  3A3E A;  2CC1 A;  4OPQ A;  1ONG A;  3SH8 A;  2WGW A;  2GDN A;  1FCM A;  1PW8 A;  2ZC7 A;  4KZ8 A;  4E3O A;  3IXB A;  4EWF A;  3NI9 A;  2PBY A;  4OH0 A;  5DTS A;  4H8R A;  4KZ5 A;  2JC7 A;  1EWZ A;  1MWT A;  3GV9 A;  4UA6 A;  1K6S A;  2JCH A;  5FI6 A;  1E25 A;  3ZDJ A;  1L2S A;  3BFC A;  4K0X A;  4PM6 A;  4ZJ1 A;  3G30 A;  4UAA A;  4P85 A;  4P0M A;  3VP4 A;  2Y2Q A;  1OME A;  3VSL A;  5M1A A;  2P9V B;  5A92 A;  3N6I A;  4KZ4 A;  4IVI A;  1NZO A;  1YLT A;  2ZQD A;  3P98 A;  1I2S A;  2V1Z A;  3W4O A;  2XFT A;  2FFY A;  3Q07 A;  3IWO A;  3DWK A;  4KG6 A;  4DE0 A;  5CGX A;  2WAF A;  3Q1F A;  4OON A;  2X02 A;  4FSF A;  1DJC A;  1PZP A;  5CTM A;  1W79 A;  2ZC5 B;  3BYD A;  1WYB A;  2X01 A;  1BUE A;  4IBX A;  4FCF A;  3ZHH A;  4JLF A;  4ZBE A;  4ID4 A;  1XKZ A;  2IWD A;  2Q9N A;  4ZJ2 A;  3V3S A;  1JVJ A;  3WS0 A;  2OSU A;  2WKH A;  4HEF A;  3SS4 A;  1KE4 A;  4D2O A;  4LV3 A;  2EFU A;  3BFD A;  3PTE A;  5DTT A;  3NDG A;  3FKW A;  1W8Y A;  1LL5 A;  3OPR A;  3G32 A;  3SH9 A;  1WE4 A;  5FQK A;  4WMC A;  1Y54 A;  1XP4 A;  1YT4 A;  4WBG A;  2HP5 A;  1YLJ A;  3VP3 A;  3PAG A;  4JBF A;  4OLD A;  2Y2P A;  5CED A;  2XH9 A;  2DCF A;  3TG9 A;  1JWV A;  5CHM A;  1ZKJ A;  5IHV A;  3BEC A;  1K56 D;  4R0Q A;  2QPN A;  3OPP A;  2R9X A;  4DDS A;  5TR7 A;  4JF5 A;  4KZ3 A;  3UPO A;  4S2K A;  1NYM A;  1M40 A;  3NDE A;  4K91 A;  3HBR A;  5GHZ A;  1H5X A;  5EVI B;  3NC8 A;  5A91 A;  5GLC A;  4E6W A;  4IVK A;  3HUO A;  1IYQ A;  1K55 C;  4KQO A;  4OP5 A;  4DDY A;  1DJA A;  1GA0 A;  4QHC A;  2ZC6 B;  3PBQ A;  1PI4 A;  5E2F A;  4N1H A;  1XA1 A;  3FKV A;  4GDN A;  3G31 A;  3RJU A;  3ZVT A;  4OOM A;  1HZO A;  3GSG A;  4K0W A;  5HL1 A;  2DNS A;  1PIO A;  3PBS A;  5JYO A;  1BLH A;  2G2U A;  1DY6 A;  1YM1 A;  3M2K A;  3BLM A;  4UA7 A;  1L0G A;  2ZQC A;  1YQS A;  5CGW A;  1KVM A;  2Y55 A;  3UE0 A;  5U47 A;  1KE3 A;  4OQG A;  1YLW A;  4OLG A;  3Q7V A;  1PWG A;  3GRJ A;  5FDH A;  4P87 A;  4S2J A;  4E3J A;  1ESU A;  1K57 A;  2XDM A;  2Y2N A;  3LEZ A;  4WM9 A;  4BLM A;  2RL3 A;  3O86 A;  1BTL A;  4BJP A;  1EI5 A;  4R3B A;  5CTN A;  3S4X A;  2IWC A;  1L0E A;  3BLS A;  1FR6 A;  1MBL A;  4HES A;  2Z2L B;  4NK3 A;  3C5A A;  5E2E A;  5GL9 A;  2FFF B;  4BL3 A;  2Y2M A;  2I72 A;  1E3U A;  4MBH A;  3RXW A;  1CEF A;  4QD4 A;  3VOY A;  3IF6 A;  1IYP A;  4Y0O A;  3Q82 A;  3UNW A;  4WZ5 A;  3WS5 A;  3HLF A;  3E2K A;  1MWS A;  3Q7Z A;  2ZC3 B;  3GR2 A;  3ZVW A;  4OOY A;  3A3I A;  3V3R A;  3WRT A;  1RGZ A;  3OPH A;  3ZG7 B;  1Z6F A;  1G6A A;  4EBN A;  3FYZ A;  3MXR A;  3MKF A;  4NET A;  4OQ0 A;  4GN2 A;  2ZQA A;  1W8Q A;  1RCJ A;  2V2F F;  5E43 A;  5FQI A;  4R23 A;  3ZG9 B;  5EPH A;  3BM6 A;  4JPM A;  3SH7 A;  1NYY A;  2ZQ9 A;  4EUZ A;  3MZD A;  3D4F A;  3UPN A;  3V5M A;  3WS4 A;  2ZM8 A;  2WZZ A;  2HDR A;  5DTK A;  4QU3 A;  3UDF A;  3IH9 A;  2EXA A;  1H8Z A;  4ZJ3 A;  1BT5 A;  4KZ6 A;  5FI2 A;  3QNB A;  2Z2M B;  2H0T A;  2WZX A;  1YMX A;  3IXD A;  2C6W B;  5FI7 A;  1FSW A;  5CHJ A;  3W4Q A;  3MZE A;  2H10 A;  4DF6 A;  4KG5 A;  3BEB A;  5HAP A;  2E8I A;  1ES3 A;  2WAD A;  5KMW A;  1KGF A;  3PAE A;  5I94 A;  4L0L A;  2IWB A;  5M18 A;  3EQV A;  4HBU A;  1GHI A;  1KDS A;  3O3V A;  2VGK A;  4GOG A;  5FQQ A;  3VP0 A;  4E3L A;  3VOZ A;  4P6B A;  1GHM A;  3LY3 A;  3CG5 A;  3TSG A;  3VMA A;  5A93 A;  1XPB A;  4S2I A;  2XEP A;  1CI8 A;  4A5R A;  5G18 A;  1PW1 A;  5J8X A;  1CEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...