3V67A

Periplasmic domain of vibrio parahaemolyticus cpxa
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
132
Chain Sequence
b'PRKARDIPDEHYQRIIETRDAIQNKYSKETDLGRILFRVEGNRAGKHDPRPRVFFSDYNGNVLTTDKRSNFQLRAMQNFVTSIEDYNKPKQRLYGRYMIAGPVPIVLADSELLMYVGFKWNEPPPLLLRLFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein CpxA
molecule tags Signaling protein
source organism Vibrio parahaemolyticus
publication title The crystal structure of the periplasmic domain of Vibrio parahaemolyticus CpxA
pubmed doi rcsb
total genus 29
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16527 CpxA_peri Two-component sensor protein CpxA, periplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.210 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3v67A01
3V67A
chains in the Genus database with same CATH superfamily
3LR0A 5EVEA 1SKOA 4R1GA 5EVIB 4EBNA 4KQDA 4PKYA 3JVVA 3SS4A 3NHQA 1FR6A 5KZHA 2W3DA 3N6IA 3R7WB 4P6ZS 2VV6A 3RJUA 3MZEA 4LRYC 3E4OA 3H7WA 4EEPA 4YOFA 4WYYA 4ARZA 3NBLA 3BLMA 4QY6A 4XUZA 4OPZA 3LR5A 2VV7A 1F98A 3S4XA 3A3IA 4MMNA 4Y0TA 2EX8A 3A0VA 4UHUA 2V8FA 3T4SA 3LI9A 4DJ3A 5DFYA 3B42A 2CC1A 4X68A 2V2FF 1QMEA 4MN5A 2XROA 3GV9A 2ACGA 3I7JA 3PBQA 3RXXA 4CLCB 1STZA 1OT6A 4OPRA 4OVDA 2V1AA 4K91A 5F5YA 3HJIA 3ULFA 1TD5A 1YT4A 4ZBEA 3UNWA 3ICYA 2WAFA 2PYRA 4DXCA 2Y2NA 2BLSA 2EWWA 3IX8A 4R70A 3P98A 1BSGA 4ZAMA 5HDSA 2P74A 3BY8A 3UE3A 1FIKA 4Y15A 2DRWA 3MR0A 2WGIA 1NWZA 2EX9A 1FILA 4JPMA 5GL9A 2Y4AA 4RQ9A 2Y2OA 3HLDA 1GA0A 1NXYA 2I72A 1BLHA 2Y2JA 2G7UA 4Q8IA 5F83A 2Y2LA 1ZTUA 2J80A 4LRXC 2PD8A 4ESPA 2PT7A 2XF3A 3N7WA 2Y2HA 4PKYG 4ZDXA 5TGFA 4BL2A 3IHAA 5HARA 1NYYA 4FUWA 2QJ5A 4O7DA 4GNUA 1DY6A 3OCLA 3RTYA 5DFXA 4N1HA 1TS6A 1P9WA 3PXPA 4CLCC 2UV0E 2W27A 2XFTA 1A0KA 2HDUA 3ZQ5A 4EBPA 4MN6A 4ZJ2A 2HGVA 2HP5A 1NYMA 1H8YA 2ZLYA 4HP4A 3IBRA 1W5DA 2ZM2A 4M4XA 5EVID 1PNEA 4F3LB 4DF6A 1ACFA 5FDSA 4GW9A 3VE4A 3QP1A 2FFYA 4R3AA 2Y59A 5EVIA 3DTMA 4LENA 5E2EA 5AVFA 3T12B 1SHVA 2GX5A 1D1JA 2Y2PA 3PAEA 4X25A 4OOYA 2O99A 4GHIA 3VOZA 2ZL1B 1GHIA 3A0SA 4NXFA 4BMWA 1Y54A 3LIEA 3KSGA 3IQAA 2RCXA 2WZZA 3OBFA 2HV1A 2ZOHA 5DJUA 1ZKJA 1K57C 1OMEA 1Z6FA 4PM7A 4BENA 3O88A 5DTSA 1LSVA 3IT9A 5AVEA 1MKIA 3G4PA 3M6BA 1GSVA 1H3QA 4EBLA 1O07A 2A2LA 3WRZA 1IYQA 3ITBA 3W4OA 1VB6A 4F94A 3H82A 2OWJA 1YAXA 4UAAA 2JKFA 1DJAA 5AQAA 4HJ3A 2JCHA 3LIDA 4HESA 1CI9A 3D3OA 2P04A 3UN7A 2JN7A 4UA7A 3F1OB 2XK1A 1XFNA 2VJWA 2OAP1 4WBGA 1YLPA 1TS8A 3BLSA 4DDYA 4EERA 3HREA 2I9VA 4FTXA 3HUNA 3AGEA 3P01A 3UE0A 5DKKA 3MMHA 4B9OA 1NLZA 2W1TA 3HCYA 4L9GA 3HL9A 4GHIB 1NJ4A 1WYBA 3PBNA 4PAUA 3UE6A 3QNBA 5FASA 1Q2QA 2WKHA 4X1MA 1XA7A 3IWOA 4S2OA 1YMXA 1KE0A 5CXWA 5MC7A 1JVJA 2PDRA 3BQ8A 1IEMA 3CMZA 1J3WA 1PW8A 2Y79A 4KQRA 4KG6A 3OLOA 3D72A 5DF8A 2ZC4B 1KDSA 4OP5A 1KE3A 4MCWA 5EOEA 3DTEA 4BJPA 3TJZC 5DKLA 1BLSA 3CWFA 3BY9A 2W3GA 1EWZA 3W8KA 3NECA 4XT2B 4GZBA 3S1YA 1BT5A 4YFMA 5FAOA 4WF0A 2ZBBA 1CQAA 1OTEA 1T1CA 4R4RA 4S2JA 4JF5A 1TS7A 3BQAA 1G6AA 4I3AA 4BBUA 4WEKA 5FI2A 1YSPA 3B3XA 1D06A 5CTNA 1KGEA 2IA2A 2OSUA 1ERMA 2XRNA 4HQAA 4E6WA 1SKFA 1H8MA 2Z2MB 2A49A 1AXBA 1S1ZA 2PAVP 1YSQA 4KG2A 3IF6B 1Y28A 1G68A 1W63Q 5I94A 3NI9A 2Y2KA 1NZUA 3BWLA 1NRFA 1HTZA 1LT0A 1CI8A 4E3MA 1LL9A 1FQGA 4II7A 4NXBA 4PM5A 1IYOA 4EXOA 3IXDA 1N4OA 4HEFA 2ZMFA 1KVMA 3B47A 3KX0X 5EM1A 3LUQA 4JF6A 2CMNA 3LR3A 3QP5A 4ZJ3A 1Q2PA 3IXHA 4HNBA 2J9OA 1OJGA 1V9ZA 3G6OA 3Q07A 2WK0A 4XXRA 4Y13A 2Y2GA 3N8LA 4KQOA 2ZD8A 5A93A 3C4PA 3EGDC 3VSLA 4JXGA 4HIAA 2D01A 4S2PA 1CK3A 4Y7PA 3UPOA 1XJ2A 3IWIA 1KDWA 3T1XA 3U4LP 1IOUA 1ES3A 1N9LA 5IU1A 4BBVA 3OCNA 2H5SA 1KGFA 4GOGA 1G5UA 3UDXA 4OLGA 2K2NA 1OPXA 5IHVA 1J9MA 1NZOA 3DAVA 3ZYTA 3E4PA 4EQIA 5HWVA 3KYZA 1BUEA 1N9BA 3C38A 3W4PA 1K0KA 2H0TA 3W2ZA 4QY5A 5AQ7A 3MKEA 2W1RA 1P97A 3DTKA 2XD5A 3LR4A 1TVFA 2K31A 3CI6A 4U0XA 1YQSA 3RXWA 2ZQDA 1BLPA 1NY0A 4XT2A 5TJJA 4ZJ1A 2Z6CA 1GCEA 3T4OA 5HX9A 2BG1A 2ZC6B 3ZHHA 5HWWA 2WYXA 4M3KA 1HD8A 5F69A 2ZL1A 4S2NC 3NDEA 5FQIA 3FV7A 3GMWA 1DRMA 4LV3A 4DMZA 1WE4A 1YLTA 3GQZA 3VP3A 1E25A 1K54C 1HVBA 2O9CA 1F5MA 1NLYA 1CF0A 3EGXC 1IELA 3L9KA 2GDNA 4C3QA 5KSCA 4OPYA 2PR6A 4EWFA 3IF6A 2HP6A 4P6BA 1PW1A 1E3UD 3RH8B 3PR6A 1DP6A 3FC7A 4OOLA 2HDRA 4KZ4A 5EM0A 5F1GA 2X02A 3NOUC 5FEFA 2VV8A 5FQMA 5G18A 2R9WA 1XGIA 1IKGA 1L0GA 1U60A 1EI5A 2ZC3B 5DTKA 2HDQA 4E3IA 3F1PA 1OT9A 4X1LA 3V3RA 3BFEA 1XPBA 2QWSA 1UWPX 4IUKA 3PAGA 2XR0A 3R7WA 1G28A 2G2WA 3H9WA 2ZMAA 1WYCA 1KGGA 3CZDA 1YLJA 2VGLS 1L0EA 3KYQA 4N92A 4HH3A 3LIBA 5HWTA 3ZNTA 1EW0A 3LIFA 4KZ3A 3IF6C 3P7NA 1EROA 2OOLA 3FKWA 5IS1A 2J8YA 3GRJA 2IWCA 2VGLM 4WZ4A 3ZG9B 4CLCD 4E3JA 2W3FA 4E3OA 2PU2A 1MC0A 3N4IA 2LB9A 1MBLA 3P09A 4JKTA 4KZ6A 4B4ZA 3EEAA 5M19A 4E6XA 4CLCA 4BBTA 3PBRA 2PD7A 3T4LA 2XFSA 2DMWA 2XSSA 3E2KA 3JYIA 4P0MA 4DE0A 4EEUA 4I3JA 3SH8A 4GN2A 1W7FA 3NOPC 1E3UA 1KVLA 2L0WA 4LRZE 3W4QA 1IYPA 3BECA 5J8XA 3CITA 1FCNA 4QJGA 2MJ6A 2QHKA 1GSXA 2BASA 3QP2A 1TS0A 3IX4A 3DW0A 3CJMA 1YPRA 1FSYA 3QP6A 3MZDA 4JXSA 4NEED 4JXWA 4PHTA 3IHBA 3OPHA 2B18A 1ONGA 1JTGA 3R4KA 4L9FA 3C5AA 2KDKA 1MXOA 2A24B 1K54A 3MFDA 5C5KA 3TOIA 1AWIA 4P6ZM 4NXEA 3OOVA 3MS6A 1GA9A 4BL3A 5M18A 3ZGAB 2JHEA 4HJ4A 5TBMB 5FI7A 2VGKA 2ZC7A 4OPQA 4OLDA 3HJKA 1LI0A 3ITAA 3UY6A 3CHWP 5HD5A 5L8MA 3ISGA 3T1SA 4GDNA 2XA7M 3O3VA 1DP8A 4I38A 3GVBA 2WGWB 3K3CA 1O7EA 3IH9A 1MY8A 4X53A 2XH9A 5AJGA 3SS3A 5HAIA 1DJCA 5J7EA 3F1PB 4R38A 5EFWA 1ES2A 1OTDA 3BEBA 5FDHA 3BW6A 5CRFA 4I39A 2EFXA 4GS9B 2V1BA 1MWSA 4CQHA 2JC7A 3S7PA 4Q0JA 5HW3A 3DWKA 2VX8A 3NY4A 1YM1A 4KZ5A 4K0XA 1N9NA 2XEPA 4EQ1A 2DCFA 1PZPA 2VLGA 4Y2FA 3UB6A 3UDIA 5AQBA 3MF0A 2P08A 4N9LA 3T4KA 4OP8A 5CGSA 1LLBA 4EW7A 4ETXA 4DE2A 2HJ9C 4XUXA 4PM6A 3OPPA 2PBDP 2RL3A 2WAEA 1XA1A 4ARZB 3PYPA 5L09A 3H7WB 4LGWA 1CJFA 4KUOA 1MWTA 1JWZA 4ID4A 3ZG5A 4B88A 5JYPA 2EA9A 3MFXA 1T1BA 2OV5A 3HBRA 2VA0A 3E98A 3OPRA 2FZ0A 4OQGA 3O5YA 1H8ZA 3KSIA 4LPZA 3PHYA 3EOIA 4HP9A 5BOHA 4EETB 5M1AA 1GHMA 5KMWA 3V67A 3VP0A 3IXBA 3EQVA 3AGFA 4HI4A 2UWXA 1NRJA 2GZAA 3LY4A 5FI6A 1I2WA 1VHMA 2XLNA 1K57A 4G3WA 4MNRA 3NJAA 3WS0A 4KUKA 1BYWA 1F2KA 1RCJA 3RFBA 3ZG7B 5CGXA 4G3VA 3QP8A 2QMIA 3MXSA 1K56D 3MQOA 4KZAA 1K55C 3S7OA 1VETB 5FAPA 3G35A 1T1AA 5E2GA 4RYEA 4NXGA 5EPHA 3ZVWA 2QPNA 1V9YA 1H5XA 4Y17A 4D2OA 3VFFA 3DTIA 2ZM8A 1W79A 4IUHA 1I2SA 2QJ7A 3LEZA 3VFHA 2R9XA 3ZVTA 3UB9A 4PM8A 2C6WB 3HLEA 2BTFP 2HJEA 1XJ4A 3V3SA 2IWDA 3VSKA 1OTAA 1FR1A 5U47A 1HZOA 4NKPA 2M7UA 1X0OA 3B33A 3CUEA 2JKRM 2W3HA 3NCKA 2W0NA 1XKZA 4KZ8A 3MJQA 3UDFA 1SDEA 2A24A 4O01A 5HL1A 1K6RA 4GB7A 2A3UA 4IEDA 4GCZA 3G32A 3S22A 4I5SA 4K0WA 5HDDA 2L1MA 2ZJ9A 1P0ZA 2R78A 3G2YA 5L10A 2Z6DA 1MWUA 4X69A 4F3LA 3HLCA 2VGJA 1KOUA 1K6SA 4LCLA 1LI9A 4MLLA 4IHQA 3LY3A 2PYPA 4KZBA 4LLOB 2M7VA 1QMFA 3C7UA 2GNXA 5A92A 4WEJA 1VETA 2OAQ1 3SS5A 5HAQA 5E43A 2B5RA 3BYDA 1ZHHB 4Q0HA 5GLBA 2O0YA 4EU0A 3HLWA 2WADA 2FH5A 5KIZA 5EVIC 3LGOA 5E2HA 4C6YA 2WGVA 5GHXA 3C30A 2Y2QA 2OWHA 1IYSA 3L7HA 4NG2A 2KX6A 5CX7A 2EXBA 1IKIA 5EECA 1CEGA 2NUPC 2V9AA 3MBZA 5CHMA 1P9RA 3LIAA 3MZFA 3BFFA 3DWZA 2WUQA 5EE8A 1XXMA 4WZ5A 2Q9MA 5JYOA 4I3IA 5FATA 3DBAA 4FCFA 4LCMA 4JBFA 1I5QA 3HLBA 4GKUA 2WKIA 4MBHA 5KSHA 3ZDJA 3OC2A 3T1QB 1MWRA 1S67L 2PRFA 2Y2MA 1ZG6A 3HLGA 3TE8A 1LHYA 4DE1A 3NC8A 4WMCD 5DTTA 4B93A 4E3KA 3KYEA 4FOFA 4O8GA 3UB7A 3UPPA 1S4SA 5DF9A 1PIOA 1JWPA 3VE3A 2H28A 4RX2A 5FAQA 4WLAA 1L3LA 2WGWA 3IWQA 3N8SA 1TF1A 2WKEA 5F68A 5L2FA 1N9OA 3D4FA 4EUZA 2ZQ8A 4Z9QA 3NOTC 5HL6A 3WS4A 1OTBA 5DVAA 5FSRA 1SCWA 4KZ9A 4IJGA 3CLOA 4EV4A 2ZC5B 1ESIA 1KE4A 2C5WB 4WN5A 4JGRA 1S66L 4JGPA 1T18A 1TDGA 1SZVA 2HP9A 5EV0A 4P87A 1ALQA 5FQ9A 2JE5A 1SDNA 3V50A 3IS2B 2P7JA 1ESUA 4S2IA 3MXRA 1FOFA 3Q7VA 1PWGA 4DDSA 3EWKA 2WKRA 5CHUA 4IBRA 3KSFA 3T50A 4R0QA 3ZCZA 4HOIA 4X55A 4UEYA 1S0WA 4IBXA 3CG5A 3GR2A 2EX6A 1D7EA 3VP1A 2Q9NA 1LL5A 3A0RA 2ZQ9A 2Y91A 4QHCA 1W8YA 2KLIA 2EWVA 2HF6A 5AQ9A 4NK3A 4OQ0A 4UQIM 4HY8A 2XDMA 1T19A 3OPLA 1PRQA 5HAPA 3PTEA 4ZRRA 5CECA 3GTCA 3LYXA 5F82A 3BRMA 3UO9A 5FQKA 3S7QA 3UE1A 4OKPA 2ZM0A 4JF4A 3UB8A 2M1CA 4JLFA 3HVFA 4MBKA 1GHPA 1PFLA 4DE3A 3MKFA 3C4OA 3WWXA 5CEDA 4O0PA 1WA9A 2Y2IA 4YNRA 4Y0OA 3FPWA 5TFQA 1ES4A 1LSWA 5A8BA 3SH9A 4HH2A 1ONHA 2V20A 5HZHA 3TSGA 3JVUA 1JWVA 2V8CA 3S7NA 4R3BA 5GHZA 1Y4OA 1ERQA 2Y55A 5CGWA 2FFFB 3TG9A 4H6JB 3TW8A 4QPRA 5A91A 3SH7A 5FQJA 1OTIA 3VOLA 4S2KA 2EFUA 3IXGA 3U2AA 3VV4A 4ETZA 4JGOA 2IWBA 4E04A 1DJBA 2J3TD 1OJ5A 3M2JA 5GLDA 3FKVA 4KQQA 4PM9A 2NUTC 1MZUA 1C3BA 1MKMA 2V0UA 4DN0A 3SOIA 1XP4A 1PWCA 5LBRA 3HUMA 1K55A 3LI8A 2PU4A 2WZXA 2ZMVA 3AGDA 3G31A 1RGZA 5F6AA 2EX2A 3MSHA 3UMEA 4DXBA 4S2NA 1PI4A 3ZNYA 4QWOA 3BM6A 1W8QA 5CEBA 1DP9A 3WS5A 1BZAA 3G2ZA 3SZTA 1FCOA 2V0WA 2E8IA 4IVKA 1YLWA 2VK3A 3PBOA 4Y5FA 2OLUA 1CEFA 1YMSA 1ES5A 5J3WA 2PR5A 4YWZA 2E8JA 4KG5A 4EUVA 3OZHA 2PHYA 4U3TA 1L2SA 3LEQA 1XGJA 4R23A 1SKOB 1YLYA 3GECA 3FZCA 5G4ZA 2V1ZA 1LSXA 4Z1WA 3QNCA 4S2LA 4A5RA 4AFIA 4WM9A 3T1RA 1XJ6A 5HFOA 3LICA 1S1YA 3C2WA 2JBFA 2B02A 4GD6A 4R4SA 4YINA 4CJNA 4OH0A 5EOOA 2YKFA 2GJ3A 4U0TA 3C8CA 2HDSA 2Y8HA 2XA7S 5HPIA 4WUJA 3F1OA 2H10A 1BULA 5GLAA 4JGQA 2VEAA 3Q7ZA 5TBMA 3ZG8B 3BFGA 2WKPA 4GJ4A 5D3OA 4UA6A 4WL9A 5GLCA 5HDCA 3IS2A 2W1TB 3FWLA 3H82B 1RP5A 2DNSA 3A3JA 5F1FA 3MXQA 4P85A 3WRTA 3F1NB 1FCMA 4DRTA 2HZ5A 2XQZA 4WELA 3G34A 4NETA 3V39A 5HSQA 1VEUB 3F1NA 5HD3A 1ODVA 1BLCA 2XD1A 4OQHA 4RX3A 3A3FA 4KENB 2WKQA 2JKGA 1GSWA 3BJNA 4GS9A 1YLZA 2EXAA 4DJ2A 2K7SA 4GLQA 4E3NA 3VP2A 3O87A 4EESA 3T4QA 3VP4A 1LL8A 2B95A 5CTMA 1K56A 1MPLA 4QU3A 1S4RA 1M6KA 2ZQ7A 2J3WA 1W63M 2J9PA 2J7VA 1BTLA 2ZQAA 4BD1A 3KO6A 2KOIA 2INWA 5IT5A 3PBTA 4GDBA 4ME4A 4MBFA 3VMAA 3IX3A 1FSWA 4HBUA 3E0YA 4LV0A 2H0YA 2HPBA 3HLFA 4RVAA 3K2NA 2X01A 3D9YA 3FPVA 5I5LA 4QD4A 3VOYA 3Q81A 3IBJA 4L0LA 4FSFA 3LFVA 2JKTM 3EEHA 1XX2A 4UA9A 2JKRI 5J4EA 3LO7A 1K4FA 2PBYA 4H6JA 5DJTA 3Q82A 2QKPA 3E2LA 3G30A 4RA7A 1L0DA 3E4QA 4D60A 2D02A 3K3DA 3M2KA 4BQMA 1YKDA 3FYZA 1VEUA 3GDIA 4PMAA 1PZOA 4Y3IA 4LV1A 4Y0UA 4DKIA 3HUOA 3IF5A 3M6HA 3WS2A 4HBTA 3Q1FA 4HJ6A 3ZG0A 1H0MA 4ZTKA 2ZQCA 5EVLA 2P9VB 2QZ6A 2L4RA 1M40A 4UQIS 2VZWA 1K25A 3CUEC 4N1XA 3O86A 4K08A 1UWNX 4H8RA 4OQIA 3UB5P 5HPFA 2J3TC 4BD0A 3C7VA 4MN7A 2JKTI 3IH8A 2X71A 2OLVA 3QP4A 1K4EA 3WS1A 4BLMA 3A3EA 2LB5A 1ZC2A 1PI5A 3V5MA 2VKSA 3GSGA 4FH4A 1HLUP 3ZFZA 4LFUA 4BWIA 5E2FA 4OOMA 3A3DA 3CPTA 4S2MA 2O9AA 3BFDA 3NIAA 3UPNA 5EUAA 4E3LA 4CLCE 3CPTB 4HHDA 4X6TA 4MEZA 4PPRA 1PYYA 3NULA 5CERA 2Z2LB 5CHJA 4WMCA 1XJ3A 3UMDA 4B4XA 3CAXA 1ZG4A 2QYBA 1Z09A 4FD8A 3LCEA 1JNUA 3TRCA 5GHYA 3MQ0A 2O9BA 1RGYA 2P9VA 2AVXA 5FEGA 3MQQA 4Q0IA 4R6LA 1UGUA 1F9IA 4GD8A 5L07A 3N8RA 2Q0OA 3JPUA 4MDZA 2XGNA 5FA7A 2YKHA 4G3KA 4LV2A 1VM1A 1L0FA 5DF7A 2G2UA 1VQQA 1PWDA 5TR7A 1XFQA 1TDLA 1TEMA 4KZ7A 5A90A 3PBSA 4OONA 5K5BA 4IVIA 1K38A 3KSHA 1G6OA 1S6RA 3FG8A 5G4YA 1IFQA 4R3JA 4L9EA 4WZ5C 3BFCA 2W3EA 1JTDA 5FQQA 3T4TA 4N9KA 3T4JA 5FL3A 3NDGA 4FH2A 3Q7VB 4CPKA 4JXVA 4C75A 3QHYA 3SW1A 4X56A 1E4DA 3EQUA 4QB8A 2ZOIA
chains in the Genus database with same CATH topology
3KX0X 3LR0A 3LUQA 2VA0A 3E98A 2FZ0A 3O5YA 4KQDA 4PKYA 3KSIA 2CMNA 3JVVA 4LPZA 3PHYA 3NHQA 1DP9A 3EOIA 4HP9A 3LR3A 2W3DA 4EETB 2V0WA 3R7WB 3V67A 4P6ZS 2VV6A 3EQVA 4HNBA 4HI4A 1OJGA 1V9ZA 3G6OA 1NRJA 3PBOA 4Y5FA 4LRYC 2GZAA 3E4OA 4KQOA 5J3WA 3H7WA 4EEPA 2PR5A 4YOFA 4YWZA 1VHMA 4G3WA 4ARZA 3EGDC 4HIAA 2D01A 4EUVA 3NJAA 1XJ2A 4KUKA 3LR5A 2VV7A 2PHYA 1IOUA 1F98A 1BYWA 1N9LA 3RFBA 4MMNA 3GECA 3A0VA 5IU1A 4G3VA 4BBVA 3T4SA 3OCNA 5G4ZA 3LI9A 1LSXA 3MQOA 4Z1WA 4DJ3A 5DFYA 3B42A 3S7OA 1T1AA 4AFIA 2K2NA 1OPXA 4MN5A 2XROA 1XJ6A 4NXGA 3PBQA 3LICA 4CLCB 1S1YA 1STZA 3C2WA 2B02A 1OT6A 1V9YA 3ZYTA 3E4PA 5HWVA 3KYZA 2V1AA 3C38A 5F5YA 3HJIA 3W2ZA 3ULFA 1TD5A 2W1RA 3ICYA 4IUHA 2PYRA 1P97A 3LR4A 2YKFA 2QJ7A 2GJ3A 2EWWA 4R70A 2K31A 3CI6A 3C8CA 4XT2A 5HDSA 5TJJA 3UB9A 2Y8HA 2XA7S 2Z6CA 3BY8A 3UE3A 3T4OA 3MR0A 5HPIA 1NWZA 2HJEA 1XJ4A 3F1OA 4WUJA 1OTAA 4JGQA 4NKPA 2VEAA 5HWWA 2M7UA 1X0OA 4RQ9A 3B33A 5TBMA 5F69A 3CUEA 2JKRM 2G7UA 2WKPA 4GJ4A 2W3HA 4WL9A 2W0NA 1DRMA 3MJQA 1ZTUA 2J80A 4LRXC 5HDCA 2PD8A 2A24A 3IS2A 2PT7A 4O01A 4DMZA 2W1TB 4GCZA 4PKYG 3H82B 4I5SA 5HDDA 2L1MA 1P0ZA 2R78A 2O9CA 1F5MA 1NLYA 2QJ5A 2Z6DA 3MXQA 4F3LA 3EGXC 3F1NB 3OCLA 3RTYA 1KOUA 2PR6A 5DFXA 4IHQA 2PYPA 1TS6A 1P9WA 4WELA 3PXPA 4CLCC 4LLOB 2M7VA 5HSQA 3F1NA 5HD3A 1ODVA 2GNXA 2W27A 3RH8B 3PR6A 1DP6A 3FC7A 4WEJA 4OOLA 3ZQ5A 4MN6A 2OAQ1 2WKQA 2HGVA 1GSWA 3BJNA 4GS9A 1ZHHB 4Q0HA 3NOUC 2O0YA 4HP4A 4DJ2A 2K7SA 3IBRA 4GLQA 2VV8A 4EU0A 2FH5A 5KIZA 4EESA 3T4QA 4M4XA 1LL8A 4F3LB 1S4RA 2J3WA 3C30A 1W63M 3F1PA 2OWHA 4GW9A 3VE4A 1OT9A 2KX6A 3KO6A 2KOIA 2INWA 5CX7A 4R3AA 5IT5A 3PBTA 2NUPC 2QWSA 2V9AA 1UWPX 1P9RA 3LIAA 5AVFA 4ME4A 4IUKA 2GX5A 3R7WA 1G28A 3H9WA 2O99A 4GHIA 2VGLS 3E0YA 3K2NA 3KYQA 4I3IA 3A0SA 4NXFA 3FPVA 4BMWA 3DBAA 4HH3A 3LIBA 5HWTA 5I5LA 3LIEA 3KSGA 3IBJA 3OBFA 1EW0A 2HV1A 2ZOHA 3LIFA 4L0LA 4FSFA 5DJUA 5KSHA 3P7NA 3LFVA 2JKTM 3OC2A 3EEHA 2OOLA 1S67L 5IS1A 2JKRI 5J4EA 2VGLM 4CLCD 1LSVA 3TE8A 4H6JA 5DJTA 2W3FA 5AVEA 2QKPA 4B93A 3E4QA 1MC0A 2D02A 3K3DA 4O8GA 4FOFA 3UB7A 1GSVA 2LB9A 1H3QA 1YKDA 1S4SA 3GDIA 2A2LA 5DF9A 3EEAA 4CLCA 4Y3IA 3VE3A 4BBTA 3PBRA 1VB6A 2H28A 2PD7A 3T4LA 2DMWA 2XSSA 3H82A 4WLAA 2OWJA 1YAXA 1TF1A 4HJ3A 4EEUA 4I3JA 3LIDA 5F68A 1N9OA 3NOTC 3NOPC 5HL6A 1OTBA 3D3OA 4HJ6A 2L0WA 4LRZE 2P04A 2JN7A 4IJGA 3CITA 2MJ6A 2L4RA 3CLOA 2QHKA 3F1OB 1GSXA 2VZWA 4UQIS 2BASA 1XFNA 1TS0A 2VJWA 3CUEC 2OAP1 4WN5A 1TS8A 4K08A 4JGRA 1S66L 4JGPA 4EERA 4NEED 1T18A 1UWNX 2I9VA 3P01A 5DKKA 3MMHA 4PHTA 5HPFA 2B18A 4B9OA 2J3TC 1NLZA 2W1TA 3HCYA 3R4KA 4GHIB 4L9GA 4MN7A 2JKTI 4L9FA 2KDKA 2A24B 3IS2B 3PBNA 4PAUA 3UE6A 2P7JA 5C5KA 4P6ZM 4NXEA 3OOVA 2LB5A 5MC7A 2PDRA 3BQ8A 2VKSA 3EWKA 2Y79A 2JHEA 2WKRA 4HJ4A 3OLOA 5TBMB 3D72A 3KSFA 3T50A 4HOIA 4BWIA 4UEYA 4OOMA 1D7EA 3HJKA 5HD5A 5L8MA 2O9AA 3A0RA 4MCWA 4BJPA 2XA7M 2KLIA 2HF6A 2EWVA 3CWFA 5DKLA 3TJZC 4CLCE 4UQIM 3BY9A 4HY8A 1T19A 4HHDA 1DP8A 4I38A 2W3GA 4ZRRA 3K3CA 3LYXA 4XT2B 1XJ3A 3UMDA 3CAXA 5AJGA 2QYBA 3S7QA 4WF0A 5J7EA 2ZBBA 3UB8A 1OTEA 1T1CA 2M1CA 3F1PB 4R38A 5EFWA 1JNUA 1OTDA 3TRCA 1TS7A 3BQAA 4I3AA 3BW6A 3MQ0A 2O9BA 4I39A 4BBUA 4WEKA 5F6AA 4GS9B 2V1BA 3MQQA 1YSPA 4Q0IA 4R6LA 4CQHA 1UGUA 1D06A 4O0PA 1F9IA 1WA9A 4YNRA 3S7PA 4Q0JA 2VX8A 2IA2A 3FPWA 1LSWA 2XRNA 5A8BA 4HH2A 4HQAA 1N9NA 5HZHA 4EQ1A 3JVUA 4MDZA 2VLGA 1H8MA 4Y2FA 2YKHA 4G3KA 3UB6A 3S7NA 1S1ZA 1YSQA 1Y28A 1W63Q 1XFQA 3MF0A 2P08A 4H6JB 3TW8A 3T4KA 4QPRA 1OTIA 3VOLA 4EW7A 3U2AA 3VV4A 3PBSA 4ETZA 4JGOA 4E04A 2J3TD 3BWLA 4ETXA 1OJ5A 5K5BA 2HJ9C 3KSHA 1G6OA 2NUTC 3FG8A 5G4YA 1LT0A 1IFQA 1MZUA 4L9EA 1MKMA 4II7A 4NXBA 2W3EA 2V0UA 4ARZB 4DN0A 3PYPA 3T4TA 3T4JA 3H7WB 5FL3A 4KUOA 4EXOA 5LBRA 3LI8A 2ZMFA 2ZMVA 3SW1A 2EA9A 3B47A 3EQUA 3MFXA 1T1BA 3UMEA 2ZOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V67 A; 
#chains in the Genus database with same CATH topology
 3LR0 A;  5EVE A;  1SKO A;  4R1G A;  5EVI B;  4EBN A;  4KQD A;  4PKY A;  3JVV A;  3SS4 A;  3NHQ A;  1FR6 A;  5KZH A;  2W3D A;  3N6I A;  3R7W B;  4P6Z S;  2VV6 A;  3RJU A;  3MZE A;  4LRY C;  3E4O A;  3H7W A;  4EEP A;  4YOF A;  4WYY A;  4ARZ A;  3NBL A;  3BLM A;  4QY6 A;  4XUZ A;  4OPZ A;  3LR5 A;  2VV7 A;  1F98 A;  3S4X A;  3A3I A;  4MMN A;  4Y0T A;  2EX8 A;  3A0V A;  4UHU A;  2V8F A;  3T4S A;  3LI9 A;  4DJ3 A;  5DFY A;  3B42 A;  2CC1 A;  4X68 A;  2V2F F;  1QME A;  4MN5 A;  2XRO A;  3GV9 A;  2ACG A;  3I7J A;  3PBQ A;  3RXX A;  4CLC B;  1STZ A;  1OT6 A;  4OPR A;  4OVD A;  2V1A A;  4K91 A;  5F5Y A;  3HJI A;  3ULF A;  1TD5 A;  1YT4 A;  4ZBE A;  3UNW A;  3ICY A;  2WAF A;  2PYR A;  4DXC A;  2Y2N A;  2BLS A;  2EWW A;  3IX8 A;  4R70 A;  3P98 A;  1BSG A;  4ZAM A;  5HDS A;  2P74 A;  3BY8 A;  3UE3 A;  1FIK A;  4Y15 A;  2DRW A;  3MR0 A;  2WGI A;  1NWZ A;  2EX9 A;  1FIL A;  4JPM A;  5GL9 A;  2Y4A A;  4RQ9 A;  2Y2O A;  3HLD A;  1GA0 A;  1NXY A;  2I72 A;  1BLH A;  2Y2J A;  2G7U A;  4Q8I A;  5F83 A;  2Y2L A;  1ZTU A;  2J80 A;  4LRX C;  2PD8 A;  4ESP A;  2PT7 A;  2XF3 A;  3N7W A;  2Y2H A;  4PKY G;  4ZDX A;  5TGF A;  4BL2 A;  3IHA A;  5HAR A;  1NYY A;  4FUW A;  2QJ5 A;  4O7D A;  4GNU A;  1DY6 A;  3OCL A;  3RTY A;  5DFX A;  4N1H A;  1TS6 A;  1P9W A;  3PXP A;  4CLC C;  2UV0 E;  2W27 A;  2XFT A;  1A0K A;  2HDU A;  3ZQ5 A;  4EBP A;  4MN6 A;  4ZJ2 A;  2HGV A;  2HP5 A;  1NYM A;  1H8Y A;  2ZLY A;  4HP4 A;  3IBR A;  1W5D A;  2ZM2 A;  4M4X A;  5EVI D;  1PNE A;  4F3L B;  4DF6 A;  1ACF A;  5FDS A;  4GW9 A;  3VE4 A;  3QP1 A;  2FFY A;  4R3A A;  2Y59 A;  5EVI A;  3DTM A;  4LEN A;  5E2E A;  5AVF A;  3T12 B;  1SHV A;  2GX5 A;  1D1J A;  2Y2P A;  3PAE A;  4X25 A;  4OOY A;  2O99 A;  4GHI A;  3VOZ A;  2ZL1 B;  1GHI A;  3A0S A;  4NXF A;  4BMW A;  1Y54 A;  3LIE A;  3KSG A;  3IQA A;  2RCX A;  2WZZ A;  3OBF A;  2HV1 A;  2ZOH A;  5DJU A;  1ZKJ A;  1K57 C;  1OME A;  1Z6F A;  4PM7 A;  4BEN A;  3O88 A;  5DTS A;  1LSV A;  3IT9 A;  5AVE A;  1MKI A;  3G4P A;  3M6B A;  1GSV A;  1H3Q A;  4EBL A;  1O07 A;  2A2L A;  3WRZ A;  1IYQ A;  3ITB A;  3W4O A;  1VB6 A;  4F94 A;  3H82 A;  2OWJ A;  1YAX A;  4UAA A;  2JKF A;  1DJA A;  5AQA A;  4HJ3 A;  2JCH A;  3LID A;  4HES A;  1CI9 A;  3D3O A;  2P04 A;  3UN7 A;  2JN7 A;  4UA7 A;  3F1O B;  2XK1 A;  1XFN A;  2VJW A;  2OAP 1;  4WBG A;  1YLP A;  1TS8 A;  3BLS A;  4DDY A;  4EER A;  3HRE A;  2I9V A;  4FTX A;  3HUN A;  3AGE A;  3P01 A;  3UE0 A;  5DKK A;  3MMH A;  4B9O A;  1NLZ A;  2W1T A;  3HCY A;  4L9G A;  3HL9 A;  4GHI B;  1NJ4 A;  1WYB A;  3PBN A;  4PAU A;  3UE6 A;  3QNB A;  5FAS A;  1Q2Q A;  2WKH A;  4X1M A;  1XA7 A;  3IWO A;  4S2O A;  1YMX A;  1KE0 A;  5CXW A;  5MC7 A;  1JVJ A;  2PDR A;  3BQ8 A;  1IEM A;  3CMZ A;  1J3W A;  1PW8 A;  2Y79 A;  4KQR A;  4KG6 A;  3OLO A;  3D72 A;  5DF8 A;  2ZC4 B;  1KDS A;  4OP5 A;  1KE3 A;  4MCW A;  5EOE A;  3DTE A;  4BJP A;  3TJZ C;  5DKL A;  1BLS A;  3CWF A;  3BY9 A;  2W3G A;  1EWZ A;  3W8K A;  3NEC A;  4XT2 B;  4GZB A;  3S1Y A;  1BT5 A;  4YFM A;  5FAO A;  4WF0 A;  2ZBB A;  1CQA A;  1OTE A;  1T1C A;  4R4R A;  4S2J A;  4JF5 A;  1TS7 A;  3BQA A;  1G6A A;  4I3A A;  4BBU A;  4WEK A;  5FI2 A;  1YSP A;  3B3X A;  1D06 A;  5CTN A;  1KGE A;  2IA2 A;  2OSU A;  1ERM A;  2XRN A;  4HQA A;  4E6W A;  1SKF A;  1H8M A;  2Z2M B;  2A49 A;  1AXB A;  1S1Z A;  2PAV P;  1YSQ A;  4KG2 A;  3IF6 B;  1Y28 A;  1G68 A;  1W63 Q;  5I94 A;  3NI9 A;  2Y2K A;  1NZU A;  3BWL A;  1NRF A;  1HTZ A;  1LT0 A;  1CI8 A;  4E3M A;  1LL9 A;  1FQG A;  4II7 A;  4NXB A;  4PM5 A;  1IYO A;  4EXO A;  3IXD A;  1N4O A;  4HEF A;  2ZMF A;  1KVM A;  3B47 A;  3KX0 X;  5EM1 A;  3LUQ A;  4JF6 A;  2CMN A;  3LR3 A;  3QP5 A;  4ZJ3 A;  1Q2P A;  3IXH A;  4HNB A;  2J9O A;  1OJG A;  1V9Z A;  3G6O A;  3Q07 A;  2WK0 A;  4XXR A;  4Y13 A;  2Y2G A;  3N8L A;  4KQO A;  2ZD8 A;  5A93 A;  3C4P A;  3EGD C;  3VSL A;  4JXG A;  4HIA A;  2D01 A;  4S2P A;  1CK3 A;  4Y7P A;  3UPO A;  1XJ2 A;  3IWI A;  1KDW A;  3T1X A;  3U4L P;  1IOU A;  1ES3 A;  1N9L A;  5IU1 A;  4BBV A;  3OCN A;  2H5S A;  1KGF A;  4GOG A;  1G5U A;  3UDX A;  4OLG A;  2K2N A;  1OPX A;  5IHV A;  1J9M A;  1NZO A;  3DAV A;  3ZYT A;  3E4P A;  4EQI A;  5HWV A;  3KYZ A;  1BUE A;  1N9B A;  3C38 A;  3W4P A;  1K0K A;  2H0T A;  3W2Z A;  4QY5 A;  5AQ7 A;  3MKE A;  2W1R A;  1P97 A;  3DTK A;  2XD5 A;  3LR4 A;  1TVF A;  2K31 A;  3CI6 A;  4U0X A;  1YQS A;  3RXW A;  2ZQD A;  1BLP A;  1NY0 A;  4XT2 A;  5TJJ A;  4ZJ1 A;  2Z6C A;  1GCE A;  3T4O A;  5HX9 A;  2BG1 A;  2ZC6 B;  3ZHH A;  5HWW A;  2WYX A;  4M3K A;  1HD8 A;  5F69 A;  2ZL1 A;  4S2N C;  3NDE A;  5FQI A;  3FV7 A;  3GMW A;  1DRM A;  4LV3 A;  4DMZ A;  1WE4 A;  1YLT A;  3GQZ A;  3VP3 A;  1E25 A;  1K54 C;  1HVB A;  2O9C A;  1F5M A;  1NLY A;  1CF0 A;  3EGX C;  1IEL A;  3L9K A;  2GDN A;  4C3Q A;  5KSC A;  4OPY A;  2PR6 A;  4EWF A;  3IF6 A;  2HP6 A;  4P6B A;  1PW1 A;  1E3U D;  3RH8 B;  3PR6 A;  1DP6 A;  3FC7 A;  4OOL A;  2HDR A;  4KZ4 A;  5EM0 A;  5F1G A;  2X02 A;  3NOU C;  5FEF A;  2VV8 A;  5FQM A;  5G18 A;  2R9W A;  1XGI A;  1IKG A;  1L0G A;  1U60 A;  1EI5 A;  2ZC3 B;  5DTK A;  2HDQ A;  4E3I A;  3F1P A;  1OT9 A;  4X1L A;  3V3R A;  3BFE A;  1XPB A;  2QWS A;  1UWP X;  4IUK A;  3PAG A;  2XR0 A;  3R7W A;  1G28 A;  2G2W A;  3H9W A;  2ZMA A;  1WYC A;  1KGG A;  3CZD A;  1YLJ A;  2VGL S;  1L0E A;  3KYQ A;  4N92 A;  4HH3 A;  3LIB A;  5HWT A;  3ZNT A;  1EW0 A;  3LIF A;  4KZ3 A;  3IF6 C;  3P7N A;  1ERO A;  2OOL A;  3FKW A;  5IS1 A;  2J8Y A;  3GRJ A;  2IWC A;  2VGL M;  4WZ4 A;  3ZG9 B;  4CLC D;  4E3J A;  2W3F A;  4E3O A;  2PU2 A;  1MC0 A;  3N4I A;  2LB9 A;  1MBL A;  3P09 A;  4JKT A;  4KZ6 A;  4B4Z A;  3EEA A;  5M19 A;  4E6X A;  4CLC A;  4BBT A;  3PBR A;  2PD7 A;  3T4L A;  2XFS A;  2DMW A;  2XSS A;  3E2K A;  3JYI A;  4P0M A;  4DE0 A;  4EEU A;  4I3J A;  3SH8 A;  4GN2 A;  1W7F A;  3NOP C;  1E3U A;  1KVL A;  2L0W A;  4LRZ E;  3W4Q A;  1IYP A;  3BEC A;  5J8X A;  3CIT A;  1FCN A;  4QJG A;  2MJ6 A;  2QHK A;  1GSX A;  2BAS A;  3QP2 A;  1TS0 A;  3IX4 A;  3DW0 A;  3CJM A;  1YPR A;  1FSY A;  3QP6 A;  3MZD A;  4JXS A;  4NEE D;  4JXW A;  4PHT A;  3IHB A;  3OPH A;  2B18 A;  1ONG A;  1JTG A;  3R4K A;  4L9F A;  3C5A A;  2KDK A;  1MXO A;  2A24 B;  1K54 A;  3MFD A;  5C5K A;  3TOI A;  1AWI A;  4P6Z M;  4NXE A;  3OOV A;  3MS6 A;  1GA9 A;  4BL3 A;  5M18 A;  3ZGA B;  2JHE A;  4HJ4 A;  5TBM B;  5FI7 A;  2VGK A;  2ZC7 A;  4OPQ A;  4OLD A;  3HJK A;  1LI0 A;  3ITA A;  3UY6 A;  3CHW P;  5HD5 A;  5L8M A;  3ISG A;  3T1S A;  4GDN A;  2XA7 M;  3O3V A;  1DP8 A;  4I38 A;  3GVB A;  2WGW B;  3K3C A;  1O7E A;  3IH9 A;  1MY8 A;  4X53 A;  2XH9 A;  5AJG A;  3SS3 A;  5HAI A;  1DJC A;  5J7E A;  3F1P B;  4R38 A;  5EFW A;  1ES2 A;  1OTD A;  3BEB A;  5FDH A;  3BW6 A;  5CRF A;  4I39 A;  2EFX A;  4GS9 B;  2V1B A;  1MWS A;  4CQH A;  2JC7 A;  3S7P A;  4Q0J A;  5HW3 A;  3DWK A;  2VX8 A;  3NY4 A;  1YM1 A;  4KZ5 A;  4K0X A;  1N9N A;  2XEP A;  4EQ1 A;  2DCF A;  1PZP A;  2VLG A;  4Y2F A;  3UB6 A;  3UDI A;  5AQB A;  3MF0 A;  2P08 A;  4N9L A;  3T4K A;  4OP8 A;  5CGS A;  1LLB A;  4EW7 A;  4ETX A;  4DE2 A;  2HJ9 C;  4XUX A;  4PM6 A;  3OPP A;  2PBD P;  2RL3 A;  2WAE A;  1XA1 A;  4ARZ B;  3PYP A;  5L09 A;  3H7W B;  4LGW A;  1CJF A;  4KUO A;  1MWT A;  1JWZ A;  4ID4 A;  3ZG5 A;  4B88 A;  5JYP A;  2EA9 A;  3MFX A;  1T1B A;  2OV5 A;  3HBR A;  2VA0 A;  3E98 A;  3OPR A;  2FZ0 A;  4OQG A;  3O5Y A;  1H8Z A;  3KSI A;  4LPZ A;  3PHY A;  3EOI A;  4HP9 A;  5BOH A;  4EET B;  5M1A A;  1GHM A;  5KMW A;  3V67 A;  3VP0 A;  3IXB A;  3EQV A;  3AGF A;  4HI4 A;  2UWX A;  1NRJ A;  2GZA A;  3LY4 A;  5FI6 A;  1I2W A;  1VHM A;  2XLN A;  1K57 A;  4G3W A;  4MNR A;  3NJA A;  3WS0 A;  4KUK A;  1BYW A;  1F2K A;  1RCJ A;  3RFB A;  3ZG7 B;  5CGX A;  4G3V A;  3QP8 A;  2QMI A;  3MXS A;  1K56 D;  3MQO A;  4KZA A;  1K55 C;  3S7O A;  1VET B;  5FAP A;  3G35 A;  1T1A A;  5E2G A;  4RYE A;  4NXG A;  5EPH A;  3ZVW A;  2QPN A;  1V9Y A;  1H5X A;  4Y17 A;  4D2O A;  3VFF A;  3DTI A;  2ZM8 A;  1W79 A;  4IUH A;  1I2S A;  2QJ7 A;  3LEZ A;  3VFH A;  2R9X A;  3ZVT A;  3UB9 A;  4PM8 A;  2C6W B;  3HLE A;  2BTF P;  2HJE A;  1XJ4 A;  3V3S A;  2IWD A;  3VSK A;  1OTA A;  1FR1 A;  5U47 A;  1HZO A;  4NKP A;  2M7U A;  1X0O A;  3B33 A;  3CUE A;  2JKR M;  2W3H A;  3NCK A;  2W0N A;  1XKZ A;  4KZ8 A;  3MJQ A;  3UDF A;  1SDE A;  2A24 A;  4O01 A;  5HL1 A;  1K6R A;  4GB7 A;  2A3U A;  4IED A;  4GCZ A;  3G32 A;  3S22 A;  4I5S A;  4K0W A;  5HDD A;  2L1M A;  2ZJ9 A;  1P0Z A;  2R78 A;  3G2Y A;  5L10 A;  2Z6D A;  1MWU A;  4X69 A;  4F3L A;  3HLC A;  2VGJ A;  1KOU A;  1K6S A;  4LCL A;  1LI9 A;  4MLL A;  4IHQ A;  3LY3 A;  2PYP A;  4KZB A;  4LLO B;  2M7V A;  1QMF A;  3C7U A;  2GNX A;  5A92 A;  4WEJ A;  1VET A;  2OAQ 1;  3SS5 A;  5HAQ A;  5E43 A;  2B5R A;  3BYD A;  1ZHH B;  4Q0H A;  5GLB A;  2O0Y A;  4EU0 A;  3HLW A;  2WAD A;  2FH5 A;  5KIZ A;  5EVI C;  3LGO A;  5E2H A;  4C6Y A;  2WGV A;  5GHX A;  3C30 A;  2Y2Q A;  2OWH A;  1IYS A;  3L7H A;  4NG2 A;  2KX6 A;  5CX7 A;  2EXB A;  1IKI A;  5EEC A;  1CEG A;  2NUP C;  2V9A A;  3MBZ A;  5CHM A;  1P9R A;  3LIA A;  3MZF A;  3BFF A;  3DWZ A;  2WUQ A;  5EE8 A;  1XXM A;  4WZ5 A;  2Q9M A;  5JYO A;  4I3I A;  5FAT A;  3DBA A;  4FCF A;  4LCM A;  4JBF A;  1I5Q A;  3HLB A;  4GKU A;  2WKI A;  4MBH A;  5KSH A;  3ZDJ A;  3OC2 A;  3T1Q B;  1MWR A;  1S67 L;  2PRF A;  2Y2M A;  1ZG6 A;  3HLG A;  3TE8 A;  1LHY A;  4DE1 A;  3NC8 A;  4WMC D;  5DTT A;  4B93 A;  4E3K A;  3KYE A;  4FOF A;  4O8G A;  3UB7 A;  3UPP A;  1S4S A;  5DF9 A;  1PIO A;  1JWP A;  3VE3 A;  2H28 A;  4RX2 A;  5FAQ A;  4WLA A;  1L3L A;  2WGW A;  3IWQ A;  3N8S A;  1TF1 A;  2WKE A;  5F68 A;  5L2F A;  1N9O A;  3D4F A;  4EUZ A;  2ZQ8 A;  4Z9Q A;  3NOT C;  5HL6 A;  3WS4 A;  1OTB A;  5DVA A;  5FSR A;  1SCW A;  4KZ9 A;  4IJG A;  3CLO A;  4EV4 A;  2ZC5 B;  1ESI A;  1KE4 A;  2C5W B;  4WN5 A;  4JGR A;  1S66 L;  4JGP A;  1T18 A;  1TDG A;  1SZV A;  2HP9 A;  5EV0 A;  4P87 A;  1ALQ A;  5FQ9 A;  2JE5 A;  1SDN A;  3V50 A;  3IS2 B;  2P7J A;  1ESU A;  4S2I A;  3MXR A;  1FOF A;  3Q7V A;  1PWG A;  4DDS A;  3EWK A;  2WKR A;  5CHU A;  4IBR A;  3KSF A;  3T50 A;  4R0Q A;  3ZCZ A;  4HOI A;  4X55 A;  4UEY A;  1S0W A;  4IBX A;  3CG5 A;  3GR2 A;  2EX6 A;  1D7E A;  3VP1 A;  2Q9N A;  1LL5 A;  3A0R A;  2ZQ9 A;  2Y91 A;  4QHC A;  1W8Y A;  2KLI A;  2EWV A;  2HF6 A;  5AQ9 A;  4NK3 A;  4OQ0 A;  4UQI M;  4HY8 A;  2XDM A;  1T19 A;  3OPL A;  1PRQ A;  5HAP A;  3PTE A;  4ZRR A;  5CEC A;  3GTC A;  3LYX A;  5F82 A;  3BRM A;  3UO9 A;  5FQK A;  3S7Q A;  3UE1 A;  4OKP A;  2ZM0 A;  4JF4 A;  3UB8 A;  2M1C A;  4JLF A;  3HVF A;  4MBK A;  1GHP A;  1PFL A;  4DE3 A;  3MKF A;  3C4O A;  3WWX A;  5CED A;  4O0P A;  1WA9 A;  2Y2I A;  4YNR A;  4Y0O A;  3FPW A;  5TFQ A;  1ES4 A;  1LSW A;  5A8B A;  3SH9 A;  4HH2 A;  1ONH A;  2V20 A;  5HZH A;  3TSG A;  3JVU A;  1JWV A;  2V8C A;  3S7N A;  4R3B A;  5GHZ A;  1Y4O A;  1ERQ A;  2Y55 A;  5CGW A;  2FFF B;  3TG9 A;  4H6J B;  3TW8 A;  4QPR A;  5A91 A;  3SH7 A;  5FQJ A;  1OTI A;  3VOL A;  4S2K A;  2EFU A;  3IXG A;  3U2A A;  3VV4 A;  4ETZ A;  4JGO A;  2IWB A;  4E04 A;  1DJB A;  2J3T D;  1OJ5 A;  3M2J A;  5GLD A;  3FKV A;  4KQQ A;  4PM9 A;  2NUT C;  1MZU A;  1C3B A;  1MKM A;  2V0U A;  4DN0 A;  3SOI A;  1XP4 A;  1PWC A;  5LBR A;  3HUM A;  1K55 A;  3LI8 A;  2PU4 A;  2WZX A;  2ZMV A;  3AGD A;  3G31 A;  1RGZ A;  5F6A A;  2EX2 A;  3MSH A;  3UME A;  4DXB A;  4S2N A;  1PI4 A;  3ZNY A;  4QWO A;  3BM6 A;  1W8Q A;  5CEB A;  1DP9 A;  3WS5 A;  1BZA A;  3G2Z A;  3SZT A;  1FCO A;  2V0W A;  2E8I A;  4IVK A;  1YLW A;  2VK3 A;  3PBO A;  4Y5F A;  2OLU A;  1CEF A;  1YMS A;  1ES5 A;  5J3W A;  2PR5 A;  4YWZ A;  2E8J A;  4KG5 A;  4EUV A;  3OZH A;  2PHY A;  4U3T A;  1L2S A;  3LEQ A;  1XGJ A;  4R23 A;  1SKO B;  1YLY A;  3GEC A;  3FZC A;  5G4Z A;  2V1Z A;  1LSX A;  4Z1W A;  3QNC A;  4S2L A;  4A5R A;  4AFI A;  4WM9 A;  3T1R A;  1XJ6 A;  5HFO A;  3LIC A;  1S1Y A;  3C2W A;  2JBF A;  2B02 A;  4GD6 A;  4R4S A;  4YIN A;  4CJN A;  4OH0 A;  5EOO A;  2YKF A;  2GJ3 A;  4U0T A;  3C8C A;  2HDS A;  2Y8H A;  2XA7 S;  5HPI A;  4WUJ A;  3F1O A;  2H10 A;  1BUL A;  5GLA A;  4JGQ A;  2VEA A;  3Q7Z A;  5TBM A;  3ZG8 B;  3BFG A;  2WKP A;  4GJ4 A;  5D3O A;  4UA6 A;  4WL9 A;  5GLC A;  5HDC A;  3IS2 A;  2W1T B;  3FWL A;  3H82 B;  1RP5 A;  2DNS A;  3A3J A;  5F1F A;  3MXQ A;  4P85 A;  3WRT A;  3F1N B;  1FCM A;  4DRT A;  2HZ5 A;  2XQZ A;  4WEL A;  3G34 A;  4NET A;  3V39 A;  5HSQ A;  1VEU B;  3F1N A;  5HD3 A;  1ODV A;  1BLC A;  2XD1 A;  4OQH A;  4RX3 A;  3A3F A;  4KEN B;  2WKQ A;  2JKG A;  1GSW A;  3BJN A;  4GS9 A;  1YLZ A;  2EXA A;  4DJ2 A;  2K7S A;  4GLQ A;  4E3N A;  3VP2 A;  3O87 A;  4EES A;  3T4Q A;  3VP4 A;  1LL8 A;  2B95 A;  5CTM A;  1K56 A;  1MPL A;  4QU3 A;  1S4R A;  1M6K A;  2ZQ7 A;  2J3W A;  1W63 M;  2J9P A;  2J7V A;  1BTL A;  2ZQA A;  4BD1 A;  3KO6 A;  2KOI A;  2INW A;  5IT5 A;  3PBT A;  4GDB A;  4ME4 A;  4MBF A;  3VMA A;  3IX3 A;  1FSW A;  4HBU A;  3E0Y A;  4LV0 A;  2H0Y A;  2HPB A;  3HLF A;  4RVA A;  3K2N A;  2X01 A;  3D9Y A;  3FPV A;  5I5L A;  4QD4 A;  3VOY A;  3Q81 A;  3IBJ A;  4L0L A;  4FSF A;  3LFV A;  2JKT M;  3EEH A;  1XX2 A;  4UA9 A;  2JKR I;  5J4E A;  3LO7 A;  1K4F A;  2PBY A;  4H6J A;  5DJT A;  3Q82 A;  2QKP A;  3E2L A;  3G30 A;  4RA7 A;  1L0D A;  3E4Q A;  4D60 A;  2D02 A;  3K3D A;  3M2K A;  4BQM A;  1YKD A;  3FYZ A;  1VEU A;  3GDI A;  4PMA A;  1PZO A;  4Y3I A;  4LV1 A;  4Y0U A;  4DKI A;  3HUO A;  3IF5 A;  3M6H A;  3WS2 A;  4HBT A;  3Q1F A;  4HJ6 A;  3ZG0 A;  1H0M A;  4ZTK A;  2ZQC A;  5EVL A;  2P9V B;  2QZ6 A;  2L4R A;  1M40 A;  4UQI S;  2VZW A;  1K25 A;  3CUE C;  4N1X A;  3O86 A;  4K08 A;  1UWN X;  4H8R A;  4OQI A;  3UB5 P;  5HPF A;  2J3T C;  4BD0 A;  3C7V A;  4MN7 A;  2JKT I;  3IH8 A;  2X71 A;  2OLV A;  3QP4 A;  1K4E A;  3WS1 A;  4BLM A;  3A3E A;  2LB5 A;  1ZC2 A;  1PI5 A;  3V5M A;  2VKS A;  3GSG A;  4FH4 A;  1HLU P;  3ZFZ A;  4LFU A;  4BWI A;  5E2F A;  4OOM A;  3A3D A;  3CPT A;  4S2M A;  2O9A A;  3BFD A;  3NIA A;  3UPN A;  5EUA A;  4E3L A;  4CLC E;  3CPT B;  4HHD A;  4X6T A;  4MEZ A;  4PPR A;  1PYY A;  3NUL A;  5CER A;  2Z2L B;  5CHJ A;  4WMC A;  1XJ3 A;  3UMD A;  4B4X A;  3CAX A;  1ZG4 A;  2QYB A;  1Z09 A;  4FD8 A;  3LCE A;  1JNU A;  3TRC A;  5GHY A;  3MQ0 A;  2O9B A;  1RGY A;  2P9V A;  2AVX A;  5FEG A;  3MQQ A;  4Q0I A;  4R6L A;  1UGU A;  1F9I A;  4GD8 A;  5L07 A;  3N8R A;  2Q0O A;  3JPU A;  4MDZ A;  2XGN A;  5FA7 A;  2YKH A;  4G3K A;  4LV2 A;  1VM1 A;  1L0F A;  5DF7 A;  2G2U A;  1VQQ A;  1PWD A;  5TR7 A;  1XFQ A;  1TDL A;  1TEM A;  4KZ7 A;  5A90 A;  3PBS A;  4OON A;  5K5B A;  4IVI A;  1K38 A;  3KSH A;  1G6O A;  1S6R A;  3FG8 A;  5G4Y A;  1IFQ A;  4R3J A;  4L9E A;  4WZ5 C;  3BFC A;  2W3E A;  1JTD A;  5FQQ A;  3T4T A;  4N9K A;  3T4J A;  5FL3 A;  3NDG A;  4FH2 A;  3Q7V B;  4CPK A;  4JXV A;  4C75 A;  3QHY A;  3SW1 A;  4X56 A;  1E4D A;  3EQU A;  4QB8 A;  2ZOI A; 
#chains in the Genus database with same CATH homology
 3KX0 X;  3LR0 A;  3LUQ A;  2VA0 A;  3E98 A;  2FZ0 A;  3O5Y A;  4KQD A;  4PKY A;  3KSI A;  2CMN A;  3JVV A;  4LPZ A;  3PHY A;  3NHQ A;  1DP9 A;  3EOI A;  4HP9 A;  3LR3 A;  2W3D A;  4EET B;  2V0W A;  3R7W B;  3V67 A;  4P6Z S;  2VV6 A;  3EQV A;  4HNB A;  4HI4 A;  1OJG A;  1V9Z A;  3G6O A;  1NRJ A;  3PBO A;  4Y5F A;  4LRY C;  2GZA A;  3E4O A;  4KQO A;  5J3W A;  3H7W A;  4EEP A;  2PR5 A;  4YOF A;  4YWZ A;  1VHM A;  4G3W A;  4ARZ A;  3EGD C;  4HIA A;  2D01 A;  4EUV A;  3NJA A;  1XJ2 A;  4KUK A;  3LR5 A;  2VV7 A;  2PHY A;  1IOU A;  1F98 A;  1BYW A;  1N9L A;  3RFB A;  4MMN A;  3GEC A;  3A0V A;  5IU1 A;  4G3V A;  4BBV A;  3T4S A;  3OCN A;  5G4Z A;  3LI9 A;  1LSX A;  3MQO A;  4Z1W A;  4DJ3 A;  5DFY A;  3B42 A;  3S7O A;  1T1A A;  4AFI A;  2K2N A;  1OPX A;  4MN5 A;  2XRO A;  1XJ6 A;  4NXG A;  3PBQ A;  3LIC A;  4CLC B;  1S1Y A;  1STZ A;  3C2W A;  2B02 A;  1OT6 A;  1V9Y A;  3ZYT A;  3E4P A;  5HWV A;  3KYZ A;  2V1A A;  3C38 A;  5F5Y A;  3HJI A;  3W2Z A;  3ULF A;  1TD5 A;  2W1R A;  3ICY A;  4IUH A;  2PYR A;  1P97 A;  3LR4 A;  2YKF A;  2QJ7 A;  2GJ3 A;  2EWW A;  4R70 A;  2K31 A;  3CI6 A;  3C8C A;  4XT2 A;  5HDS A;  5TJJ A;  3UB9 A;  2Y8H A;  2XA7 S;  2Z6C A;  3BY8 A;  3UE3 A;  3T4O A;  3MR0 A;  5HPI A;  1NWZ A;  2HJE A;  1XJ4 A;  3F1O A;  4WUJ A;  1OTA A;  4JGQ A;  4NKP A;  2VEA A;  5HWW A;  2M7U A;  1X0O A;  4RQ9 A;  3B33 A;  5TBM A;  5F69 A;  3CUE A;  2JKR M;  2G7U A;  2WKP A;  4GJ4 A;  2W3H A;  4WL9 A;  2W0N A;  1DRM A;  3MJQ A;  1ZTU A;  2J80 A;  4LRX C;  5HDC A;  2PD8 A;  2A24 A;  3IS2 A;  2PT7 A;  4O01 A;  4DMZ A;  2W1T B;  4GCZ A;  4PKY G;  3H82 B;  4I5S A;  5HDD A;  2L1M A;  1P0Z A;  2R78 A;  2O9C A;  1F5M A;  1NLY A;  2QJ5 A;  2Z6D A;  3MXQ A;  4F3L A;  3EGX C;  3F1N B;  3OCL A;  3RTY A;  1KOU A;  2PR6 A;  5DFX A;  4IHQ A;  2PYP A;  1TS6 A;  1P9W A;  4WEL A;  3PXP A;  4CLC C;  4LLO B;  2M7V A;  5HSQ A;  3F1N A;  5HD3 A;  1ODV A;  2GNX A;  2W27 A;  3RH8 B;  3PR6 A;  1DP6 A;  3FC7 A;  4WEJ A;  4OOL A;  3ZQ5 A;  4MN6 A;  2OAQ 1;  2WKQ A;  2HGV A;  1GSW A;  3BJN A;  4GS9 A;  1ZHH B;  4Q0H A;  3NOU C;  2O0Y A;  4HP4 A;  4DJ2 A;  2K7S A;  3IBR A;  4GLQ A;  2VV8 A;  4EU0 A;  2FH5 A;  5KIZ A;  4EES A;  3T4Q A;  4M4X A;  1LL8 A;  4F3L B;  1S4R A;  2J3W A;  3C30 A;  1W63 M;  3F1P A;  2OWH A;  4GW9 A;  3VE4 A;  1OT9 A;  2KX6 A;  3KO6 A;  2KOI A;  2INW A;  5CX7 A;  4R3A A;  5IT5 A;  3PBT A;  2NUP C;  2QWS A;  2V9A A;  1UWP X;  1P9R A;  3LIA A;  5AVF A;  4ME4 A;  4IUK A;  2GX5 A;  3R7W A;  1G28 A;  3H9W A;  2O99 A;  4GHI A;  2VGL S;  3E0Y A;  3K2N A;  3KYQ A;  4I3I A;  3A0S A;  4NXF A;  3FPV A;  4BMW A;  3DBA A;  4HH3 A;  3LIB A;  5HWT A;  5I5L A;  3LIE A;  3KSG A;  3IBJ A;  3OBF A;  1EW0 A;  2HV1 A;  2ZOH A;  3LIF A;  4L0L A;  4FSF A;  5DJU A;  5KSH A;  3P7N A;  3LFV A;  2JKT M;  3OC2 A;  3EEH A;  2OOL A;  1S67 L;  5IS1 A;  2JKR I;  5J4E A;  2VGL M;  4CLC D;  1LSV A;  3TE8 A;  4H6J A;  5DJT A;  2W3F A;  5AVE A;  2QKP A;  4B93 A;  3E4Q A;  1MC0 A;  2D02 A;  3K3D A;  4O8G A;  4FOF A;  3UB7 A;  1GSV A;  2LB9 A;  1H3Q A;  1YKD A;  1S4S A;  3GDI A;  2A2L A;  5DF9 A;  3EEA A;  4CLC A;  4Y3I A;  3VE3 A;  4BBT A;  3PBR A;  1VB6 A;  2H28 A;  2PD7 A;  3T4L A;  2DMW A;  2XSS A;  3H82 A;  4WLA A;  2OWJ A;  1YAX A;  1TF1 A;  4HJ3 A;  4EEU A;  4I3J A;  3LID A;  5F68 A;  1N9O A;  3NOT C;  3NOP C;  5HL6 A;  1OTB A;  3D3O A;  4HJ6 A;  2L0W A;  4LRZ E;  2P04 A;  2JN7 A;  4IJG A;  3CIT A;  2MJ6 A;  2L4R A;  3CLO A;  2QHK A;  3F1O B;  1GSX A;  2VZW A;  4UQI S;  2BAS A;  1XFN A;  1TS0 A;  2VJW A;  3CUE C;  2OAP 1;  4WN5 A;  1TS8 A;  4K08 A;  4JGR A;  1S66 L;  4JGP A;  4EER A;  4NEE D;  1T18 A;  1UWN X;  2I9V A;  3P01 A;  5DKK A;  3MMH A;  4PHT A;  5HPF A;  2B18 A;  4B9O A;  2J3T C;  1NLZ A;  2W1T A;  3HCY A;  3R4K A;  4GHI B;  4L9G A;  4MN7 A;  2JKT I;  4L9F A;  2KDK A;  2A24 B;  3IS2 B;  3PBN A;  4PAU A;  3UE6 A;  2P7J A;  5C5K A;  4P6Z M;  4NXE A;  3OOV A;  2LB5 A;  5MC7 A;  2PDR A;  3BQ8 A;  2VKS A;  3EWK A;  2Y79 A;  2JHE A;  2WKR A;  4HJ4 A;  3OLO A;  5TBM B;  3D72 A;  3KSF A;  3T50 A;  4HOI A;  4BWI A;  4UEY A;  4OOM A;  1D7E A;  3HJK A;  5HD5 A;  5L8M A;  2O9A A;  3A0R A;  4MCW A;  4BJP A;  2XA7 M;  2KLI A;  2HF6 A;  2EWV A;  3CWF A;  5DKL A;  3TJZ C;  4CLC E;  4UQI M;  3BY9 A;  4HY8 A;  1T19 A;  4HHD A;  1DP8 A;  4I38 A;  2W3G A;  4ZRR A;  3K3C A;  3LYX A;  4XT2 B;  1XJ3 A;  3UMD A;  3CAX A;  5AJG A;  2QYB A;  3S7Q A;  4WF0 A;  5J7E A;  2ZBB A;  3UB8 A;  1OTE A;  1T1C A;  2M1C A;  3F1P B;  4R38 A;  5EFW A;  1JNU A;  1OTD A;  3TRC A;  1TS7 A;  3BQA A;  4I3A A;  3BW6 A;  3MQ0 A;  2O9B A;  4I39 A;  4BBU A;  4WEK A;  5F6A A;  4GS9 B;  2V1B A;  3MQQ A;  1YSP A;  4Q0I A;  4R6L A;  4CQH A;  1UGU A;  1D06 A;  4O0P A;  1F9I A;  1WA9 A;  4YNR A;  3S7P A;  4Q0J A;  2VX8 A;  2IA2 A;  3FPW A;  1LSW A;  2XRN A;  5A8B A;  4HH2 A;  4HQA A;  1N9N A;  5HZH A;  4EQ1 A;  3JVU A;  4MDZ A;  2VLG A;  1H8M A;  4Y2F A;  2YKH A;  4G3K A;  3UB6 A;  3S7N A;  1S1Z A;  1YSQ A;  1Y28 A;  1W63 Q;  1XFQ A;  3MF0 A;  2P08 A;  4H6J B;  3TW8 A;  3T4K A;  4QPR A;  1OTI A;  3VOL A;  4EW7 A;  3U2A A;  3VV4 A;  3PBS A;  4ETZ A;  4JGO A;  4E04 A;  2J3T D;  3BWL A;  4ETX A;  1OJ5 A;  5K5B A;  2HJ9 C;  3KSH A;  1G6O A;  2NUT C;  3FG8 A;  5G4Y A;  1LT0 A;  1IFQ A;  1MZU A;  4L9E A;  1MKM A;  4II7 A;  4NXB A;  2W3E A;  2V0U A;  4ARZ B;  4DN0 A;  3PYP A;  3T4T A;  3T4J A;  3H7W B;  5FL3 A;  4KUO A;  4EXO A;  5LBR A;  3LI8 A;  2ZMF A;  2ZMV A;  3SW1 A;  2EA9 A;  3B47 A;  3EQU A;  3MFX A;  1T1B A;  3UME A;  2ZOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...