3V67A

Periplasmic domain of vibrio parahaemolyticus cpxa
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
132
Chain Sequence
PRKARDIPDEHYQRIIETRDAIQNKYSKETDLGRILFRVEGNRAGKHDPRPRVFFSDYNGNVLTTDKRSNFQLRAMQNFVTSIEDYNKPKQRLYGRYMIAGPVPIVLADSELLMYVGFKWNEPPPLLLRLFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Sensor protein CpxA
publication title The crystal structure of the periplasmic domain of Vibrio parahaemolyticus CpxA
pubmed doi rcsb
source organism Vibrio parahaemolyticus
total genus 29
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16527 CpxA_peri Two-component sensor protein CpxA, periplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.210 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3v67A01
3V67A
chains in the Genus database with same CATH superfamily
4OKPA 2PD7A 1E3UA 3QNCA 1F5MA 2Z2MB 2L4RA 4Y7PA 3MQOA 2WADA 3UE1A 2HJ9C 4LRXC 4BD0A 3U2AA 2Y2MA 2ZJ9A 1VEUB 1I5QA 3MXRA 3RFBA 3NIAA 3MZDA 5DVAA 1L0FA 3PBOA 4MBKA 3FG8A 1ZTUA 3LIBA 3KSHA 2M1CA 4GNUA 2I9VA 4NXBA 4S2PA 3T4SA 2VV7A 2YKFA 3T4LA 4LV1A 3WRZA 5AJGA 1Z09A 2AVXA 1Q2QA 3SOIA 4QB8A 1N9NA 4H6JA 4EUZA 1P9RA 4X68A 2IWBA 4GD6A 5IU1A 3O3VA 5EVID 3M6BA 4Q0JA 4WMCA 2VGLS 1MXOA 1BT5A 2JKTM 1LLBA 4JGRA 2PYPA 4OOLA 3T1QB 1OT6A 3RH8B 2V0WA 4O0PA 4OPZA 5F1FA 2ZBBA 2Y2NA 3FKVA 2WGWB 5FI6A 2JKRM 2XFTA 3MXSA 3NOPC 2IWCA 4GS9A 2VV8A 1RGZA 1PI5A 1UGUA 4EETB 2WGIA 4I3IA 4GCZA 2R9XA 3NULA 3OPHA 5EVIB 2JN7A 4OP8A 4XT2B 5FQKA 1FILA 4FOFA 4N9LA 3N8SA 4HBTA 1WA9A 4YOFA 1PWGA 2GZAA 3UDIA 2Y4AA 4S2JA 1PW8A 3M2JA 3JVUA 4KG6A 3SZTA 3VP1A 1DY6A 3HJKA 2QMIA 3WS4A 5HAPA 3IX4A 2HDSA 5L10A 3CJMA 4ETZA 2HP9A 3CPTA 5CGWA 5E2HA 2Y2JA 5AQBA 2DNSA 4KZ9A 4S2KA 5GHYA 1SHVA 2C5WB 2GNXA 3TSGA 3NCKA 1TS7A 1JNUA 3ITAA 3MJQA 2D02A 1ACFA 3PAGA 4HP9A 4U0XA 2Y79A 4RVAA 3IF6C 1OTEA 3MKFA 3W4PA 4E6XA 2E8IA 3T1SA 3VP3A 3VOZA 2KDKA 5EM1A 4PM9A 4O7DA 1TS0A 3TW8A 1OTAA 4GHIB 2JC7A 1PZPA 5HARA 4Y3IA 4S2NC 5DTTA 1OMEA 1BLPA 3N8LA 1FIKA 3KSFA 3U4LP 3UO9A 5FQQA 1YLZA 2OWJA 3HLBA 3M6HA 3VP2A 3UDXA 4MN5A 4OQ0A 3HLDA 1MWRA 3EGXC 4NG2A 2ZC7A 3QP4A 3SW1A 1N9LA 1IYQA 3BW6A 1NY0A 4KZAA 1K38A 3PBQA 3UB5P 3C7UA 1YMSA 1BUEA 5FDHA 4F3LB 3ZNTA 3FZCA 3HLCA 3IX8A 4S2IA 5AQ9A 4OPRA 5FEFA 1ODVA 2FFYA 1D1JA 3ISGA 4O8GA 4EBPA 1KVLA 4E3OA 1ESUA 2QJ7A 4LV0A 4BBTA 4Y13A 4H8RA 3A3EA 3K3DA 4EBLA 3K3CA 1G6OA 3D3OA 1DP9A 2ZOIA 5HD5A 1JWZA 2X02A 2ZQ7A 1H8ZA 4JPMA 3LR4A 3DWZA 3IHAA 3IF6A 2KOIA 4OQIA 5BOHA 2R78A 2O9BA 4E3KA 1P97A 5HFOA 2HJEA 2FFFB 3NOTC 4Q0IA 2Y2LA 3T4TA 3BEBA 5AQ7A 4WZ5C 4LGWA 1JWPA 2ZQ9A 4P87A 5GLBA 1XGIA 2ZM8A 4KQOA 4DDYA 1BLCA 1K4EA 4PM5A 4QHCA 4Y0OA 5CGSA 4JF6A 2HZ5A 3CAXA 4LV2A 1NLYA 3VOLA 1GCEA 1CI9A 5IT5A 4X53A 2VZWA 5GLAA 5FQIA 2M7UA 1H8MA 2XQZA 1T1AA 1W79A 1OTIA 4LENA 1YSQA 4R0QA 5F5YA 1W8QA 2A3UA 5CTNA 2B5RA 1DJBA 5HL1A 3EQUA 4OQGA 4IEDA 3UE6A 4NXEA 1FSWA 2PR5A 1H5XA 2XFSA 4FTXA 2E8JA 1MWTA 4WN5A 1YLJA 4ZAMA 4WLAA 4KUKA 3Q07A 4WELA 5TGFA 4G3WA 3PBRA 4IHQA 5KMWA 2XEPA 3OPLA 3BFGA 3P09A 4KZ4A 1KGGA 5E2GA 3BRMA 1ZG4A 1ONHA 1N4OA 1YKDA 1BLHA 1SDEA 2J8YA 3R7WB 1P0ZA 1M40A 2ZC6B 2GJ3A 2XSSA 2A49A 3P7NA 4HH3A 2WGWA 4GB7A 3DW0A 3UPNA 2QKPA 3SH8A 2Q9MA 5FAQA 2G2WA 1CQAA 3IBJA 3QP8A 4WZ4A 4L0LA 5D3OA 4WZ5A 4QY5A 3EEAA 1NZUA 3N4IA 2BLSA 5EVIA 1TEMA 4MLLA 3QP5A 4JGQA 5EECA 1RCJA 2EXBA 4XT2A 3F1NA 1DJAA 5TBMB 4X1LA 3VMAA 2W3EA 1LT0A 2G2UA 1Y28A 4L9GA 1M6KA 1OJGA 3VFHA 3PAEA 1EI5A 2WKIA 4LLOB 3T4QA 3C4OA 2Y2PA 2OV5A 1S0WA 1ONGA 5I5LA 4DRTA 4DJ3A 1I2WA 5F1GA 1KE3A 4OLDA 1MBLA 2EFUA 2PR6A 5F82A 4MBFA 4RYEA 2EX6A 4GDBA 4R3BA 1OJ5A 4IUKA 3ITBA 4JGOA 3T1RA 4LCMA 1DRMA 3ZVTA 1XXMA 3CI6A 3UB8A 3IWQA 1IYPA 4BBUA 1T19A 3T12B 3HUMA 4WEKA 3ZNYA 4X69A 1V9YA 4WEJA 5KSCA 4PM8A 2JHEA 2XF3A 2W3GA 2MJ6A 3K2NA 4GHIA 2WYXA 1Y4OA 3QP1A 4FCFA 2W1TB 2XDMA 1T18A 3DBAA 5HSQA 4KG2A 2Y2KA 3OOVA 2BTFP 1S6RA 3UN7A 1Z6FA 2Z2LB 5E2EA 3H82B 3VFFA 5FEGA 4EBNA 4F94A 3VSLA 2X71A 5EVEA 3S22A 4JXSA 3C38A 4ETXA 3ZCZA 1S4RA 3ZG7B 2JKRI 2VV6A 4F3LA 3F1PB 1IEMA 3UE3A 5MC7A 3H7WA 2OOLA 3IS2B 3MZFA 3MFDA 4N1HA 3O88A 5CEBA 3Q1FA 5DFXA 4Y5FA 1PYYA 2PU4A 2Y2OA 5AVFA 3PHYA 3IBRA 4HQAA 4G3VA 4XUZA 3MS6A 4P85A 3T50A 1GSXA 3OZHA 3G31A 1CEGA 2RCXA 2V8FA 5DKLA 2ZMAA 2O0YA 3ZFZA 1CK3A 2QHKA 3TE8A 3FPWA 1XPBA 3HL9A 3ULFA 3BQAA 3LY4A 4O01A 4EEUA 3PYPA 4Y0UA 2V1ZA 3IXGA 4E3LA 2D01A 2BG1A 3BECA 5HDDA 2H28A 4II7A 3ZGAB 1NLZA 2QZ6A 4DXBA 2HDRA 3C7VA 3V50A 1HLUP 1TDGA 1F2KA 5EOOA 5M18A 4C3QA 3PBTA 3W2ZA 2XK1A 3CZDA 1XA7A 1O7EA 5CGXA 5DFYA 1LHYA 1SKOB 4JXGA 3LYXA 1FOFA 3RXXA 5FQ9A 4Y17A 2VK3A 3BM6A 3UY6A 5F68A 1NWZA 1IKGA 3BWLA 1S67L 4BD1A 3CHWP 1NYYA 2XD5A 1SCWA 1FR1A 1RGYA 5L07A 4DF6A 1V9ZA 2Y2HA 3R7WA 1Q2PA 3OLOA 1CI8A 3MBZA 1H3QA 2EA9A 3G2YA 1NRJA 3HUNA 1GHMA 4LFUA 4XUXA 5E2FA 3HLFA 5FA7A 2OAQ1 2GX5A 3MF0A 4HJ3A 2DMWA 1K6RA 2IWDA 2EX9A 1A0KA 4JF5A 3A0SA 2PRFA 5TBMA 2PBYA 4LV3A 2VJWA 3QNBA 2CC1A 3B33A 3RTYA 4OVDA 4DMZA 3ZG9B 4IUHA 3AGDA 3E2LA 3L7HA 1PWDA 5CHMA 1UWNX 4ZJ3A 3VE3A 3FWLA 4OQHA 3IX3A 2EWVA 4MBHA 1MKIA 4R3AA 4OOYA 1ES4A 3LI8A 3M2KA 1BULA 3WWXA 5CRFA 3MKEA 1TS6A 1BYWA 2ZL1B 3V3RA 3G34A 4IBXA 1S4SA 3JVVA 3C4PA 4BL2A 2XH9A 3Q7ZA 1TF1A 3A0RA 3EWKA 2HP5A 1QMEA 5HPFA 1GA0A 3A3DA 5AVEA 5HAQA 1WE4A 4DDSA 2UV0E 4DXCA 1FCMA 3PBSA 1STZA 2W3HA 4HP4A 1G5UA 4OPQA 3W8KA 2X01A 2KX6A 4QWOA 4KZ3A 4BMWA 2V20A 4XXRA 4BENA 4DE0A 5DTSA 5TR7A 5A93A 3E2KA 4KZ8A 5EVLA 3D9YA 1X0OA 3H82A 1ERMA 4CLCB 1DP6A 2ZC5B 4PM7A 4R3JA 5CERA 4KZ5A 4B9OA 2OLVA 2O9AA 3WS1A 4B4ZA 1EROA 4KQDA 4LRZE 3LY3A 3F1PA 4K91A 2WKEA 2ZQ8A 2PDRA 4N92A 3WRTA 3SS4A 3BYDA 3IS2A 3CLOA 4P0MA 5J3WA 4M3KA 3HLWA 4UQIM 4LCLA 1L3LA 2VGLM 4Q0HA 1SDNA 4LRYC 4NXGA 2WAFA 1YSPA 4HH2A 1XKZA 1OPXA 4JKTA 3Q7VB 1NXYA 3CWFA 4K0WA 4UAAA 2Q0OA 4I5SA 4B88A 1GA9A 1GHIA 4FSFA 4R1GA 5DJUA 5DF7A 1YT4A 2P7JA 4Y0TA 3LIDA 4ME4A 4IBRA 2WKHA 1TDLA 4DN0A 1K55C 3GMWA 1KOUA 2Y91A 4E04A 1SKFA 3PTEA 1K57A 2ZMVA 5EVIC 4N1XA 2HDUA 1Y54A 5FI7A 1KGFA 2J7VA 1W63M 1FQGA 1VEUA 3V67A 3NHQA 3E4PA 2A24B 3C5AA 3JYIA 2KLIA 1K25A 2HPBA 3UNWA 1ZG6A 3I7JA 1SKOA 1MKMA 3SH7A 2WKRA 4Y15A 3UMDA 3MMHA 2PHYA 3B47A 1TVFA 1DJCA 2NUTC 4WUJA 1K54C 5CHJA 5FAOA 2QPNA 4WL9A 3LFVA 2VA0A 4I3JA 2V1AA 4AFIA 5CX7A 1ES5A 4EESA 4QD4A 1GSWA 2V0UA 3NBLA 1ALQA 2ZMFA 3ZVWA 3A0VA 2ZQDA 2W27A 1K56D 4BL3A 3GSGA 2FH5A 1XA1A 4RX3A 2ZQCA 1EWZA 1PFLA 4MN7A 3O87A 3BJNA 1JWVA 2DCFA 5EUAA 4BJPA 3C2WA 1AXBA 1N9BA 1TS8A 3BFCA 1K55A 4IVKA 1VQQA 3LIAA 2P9VB 1VHMA 1BZAA 2PU2A 3FPVA 4MNRA 1OTDA 4C6YA 5L8MA 5GLCA 3ZDJA 3IH9A 2XA7M 4HESA 4I39A 3LIFA 1MY8A 1P9WA 1LSVA 3OC2A 1ZC2A 4QJGA 4CLCE 2XLNA 1IFQA 4E3JA 3PXPA 1XJ3A 3EOIA 1LSWA 2J9PA 2HP6A 1SZVA 1ZKJA 1NRFA 3TOIA 4UA6A 3GV9A 5IS1A 4WM9A 3LUQA 4RA7A 1S1YA 5HWTA 1L0EA 4U3TA 3EQVA 1HVBA 1ZHHB 2Q9NA 3IWIA 3Q81A 1K54A 4I3AA 2ZL1A 2FZ0A 5HDCA 1VETB 2Y8HA 5GHXA 1W7FA 3KSIA 3HCYA 3LR0A 4FH2A 4ZDXA 2K31A 3KYQA 3JPUA 4GJ4A 2EXAA 1I2SA 3OPPA 1G6AA 1UWPX 3WS0A 1FCNA 3D72A 3ZYTA 5G18A 1E4DA 2V9AA 1H0MA 2WKQA 1KE0A 4BQMA 4NETA 2P74A 2A2LA 1IYOA 5I94A 1ESIA 1KE4A 4K0XA 2ZLYA 4IJGA 3W4QA 4ZBEA 2EX2A 1IELA 1VB6A 4R6LA 4G3KA 4C75A 4DE3A 3VV4A 5G4ZA 5EPHA 5DJTA 3EEHA 2W0NA 5JYPA 5FAPA 2JKTI 3G2ZA 2PT7A 4JXWA 3F1OB 3E0YA 2XROA 5FQJA 4MN6A 4E3MA 1IKIA 4OH0A 1D7EA 4D60A 2WAEA 2EX8A 3VSKA 3OPRA 5HWVA 3H9WA 1RP5A 3NY4A 3PR6A 3FYZA 2M7VA 1PNEA 3FV7A 5F69A 5A8BA 5HX9A 4JBFA 1YLPA 5GHZA 1LSXA 3Q7VA 1J9MA 1L2SA 3C30A 5J8XA 3T1XA 3DAVA 1T1CA 1FCOA 4Y2FA 4KZBA 4OP5A 3V39A 1XGJA 4Z9QA 3D4FA 3LEZA 4X25A 4ZJ1A 4YFMA 2CMNA 5HAIA 3MR0A 4L9EA 5U47A 2ZOHA 3LIEA 5CXWA 4UA7A 5CECA 1W8YA 3S7NA 2J9OA 2QWSA 2R9WA 4YNRA 2W3DA 1CJFA 3ICYA 2A24A 3ZHHA 1HD8A 1PW1A 4LPZA 1ES3A 3L9KA 3V5MA 2WZXA 2NUPC 3TJZC 1PI4A 4CQHA 5EOEA 3W4OA 2ZC4B 1MPLA 1XX2A 5HL6A 5GL9A 5HD3A 2B18A 5FATA 3S4XA 3QP6A 5FL3A 5KIZA 3DTIA 2VX8A 1HZOA 3SS5A 4U0TA 4L9FA 5C5KA 4EEPA 3MZEA 3KX0X 2Z6DA 2Y55A 1D06A 5EV0A 1YPRA 1NJ4A 3IXDA 3MQ0A 2PD8A 5DF8A 2LB5A 4RX2A 4X1MA 3LI9A 3BFEA 1YAXA 5TFQA 4E3IA 2OLUA 5GLDA 4R70A 4BLMA 5M1AA 4B4XA 3IF5A 2J80A 4FD8A 4UQIS 3LR3A 1KDSA 4EQ1A 3CUEC 5IHVA 2OSUA 2P9VA 3G35A 2IA2A 2QYBA 1GSVA 4PHTA 2B95A 1K56A 1OT9A 1IOUA 3NDEA 4OPYA 4JGPA 4WBGA 3NECA 4HBUA 4UEYA 4MMNA 3UPPA 3IT9A 4NK3A 1MWUA 1WYCA 3S7OA 5EFWA 3AGFA 1L0DA 4OOMA 4GLQA 3NDGA 3F1NB 4JXVA 4DKIA 2V8CA 5AQAA 4RQ9A 5CTMA 2HV1A 4Z1WA 5FASA 3CG5A 4HI4A 4KG5A 4M4XA 2QJ5A 1LL8A 3ZG0A 4EV4A 3N8RA 4ESPA 1VETA 1F98A 2ACGA 2P04A 2LB9A 3UMEA 1YQSA 4B93A 3QP2A 1YLTA 3BFFA 4P6ZM 2V2FF 4CLCD 3HBRA 3T4OA 1F9IA 2Y59A 3GECA 1KGEA 2H5SA 3KYZA 5A91A 1K57C 1K6SA 2INWA 4HNBA 3DTMA 5JYOA 2O9CA 2W1TA 4PPRA 3N7WA 3V3SA 4HEFA 4GKUA 4KQRA 3UDFA 5L2FA 3CUEA 5DTKA 5HWWA 3C8CA 5L09A 4KQQA 2L1MA 4S2LA 1TD5A 1YLYA 2WKPA 1NZOA 1S66L 3A3JA 4EUVA 1JTDA 5E43A 3FKWA 1LI0A 3E4QA 3F1OA 5FI2A 4PKYA 1N9OA 3BY8A 3BLSA 3VOYA 2OWHA 4PAUA 4Q8IA 3G32A 3IH8A 3UPOA 4S2OA 2XA7S 1XJ2A 3ZG8B 4K08A 4FH4A 3HREA 2RL3A 5HZHA 4X55A 5A90A 5DKKA 4OONA 3NC8A 3IXHA 3G6OA 2J3TD 1E25A 2Y2GA 3GTCA 3NOUC 3TG9A 4YINA 1IYSA 3ZQ5A 2YKHA 2B02A 4KENB 1XP4A 2ZM0A 3H7WB 5J4EA 1FR6A 1WYBA 4MEZA 1E3UD 4E3NA 2BASA 4P6BA 1VM1A 3BFDA 2DRWA 4MDZA 1YMXA 3FC7A 2J3WA 5CEDA 1HTZA 4EW7A 4PKYG 3E98A 3EGDC 5F6AA 3MXQA 1FSYA 1L0GA 2PYRA 1JTGA 3UB6A 4ARZB 3O5YA 2G7UA 3MFXA 1AWIA 3GDIA 4R23A 4PM6A 1OTBA 4BWIA 2VGJA 5A92A 1MWSA 3CITA 1PZOA 1S1ZA 4HJ6A 4S2NA 3P98A 4EXOA 5KZHA 1NYMA 5CHUA 2ZC3B 3TRCA 4BBVA 3DTKA 2K7SA 2ZM2A 1K0KA 1W5DA 4R4RA 5M19A 2ZD8A 3MSHA 1PIOA 2HF6A 2Y2QA 4JF4A 3WS2A 4OLGA 4WMCD 3LR5A 1U60A 1XJ6A 3G30A 3ZG5A 1EW0A 1O07A 2C6WB 3PBNA 4HY8A 2JBFA 4JLFA 4UHUA 3LO7A 5HW3A 1W63Q 4QY6A 4UA9A 4EQIA 4H6JB 3LGOA 3N6IA 4ZJ2A 3OBFA 5HDSA 3R4KA 1J3WA 1LL5A 3B42A 2OAP1 4I38A 3UB7A 4EERA 3RXWA 4KZ7A 4NKPA 3BLMA 5K5BA 4HJ4A 3P01A 4X56A 2L0WA 2PBDP 4CLCC 3GR2A 3OCNA 1BSGA 4GS9B 3KYEA 1KDWA 2JKFA 3VP0A 5LBRA 4GDNA 3VP4A 3HLEA 4EU0A 4S2MA 2W1RA 3HLGA 3IWOA 3A3IA 3CMZA 1DP8A 5TJJA 1G28A 1C3BA 1T1BA 2HDQA 3E4OA 4DE1A 1K4FA 1XFQA 3S7QA 2Z6CA 4R38A 5FSRA 4QPRA 1H8YA 4HIAA 3RJUA 3LEQA 4YWZA 3NJAA 1CF0A 4GW9A 4R4SA 2W3FA 2WK0A 5HPIA 1GHPA 3IQAA 2EFXA 2O99A 3O86A 5J7EA 3CPTB 2JCHA 3IXBA 1LI9A 3GVBA 3HUOA 4N9KA 4GN2A 2PAVP 2XR0A 4GZBA 4PMAA 2JKGA 1LL9A 1ERQA 5F83A 1QMFA 2WZZA 4CPKA 3OCLA 5G4YA 2ZQAA 4WF0A 2J3TC 1G68A 2H0TA 5FQMA 4CJNA 3SS3A 2H10A 1XFNA 3DWKA 3KSGA 2P08A 4GD8A 5EM0A 4CLCA 3HJIA 3UE0A 3G4PA 4X6TA 3KO6A 4DJ2A 4ID4A 1KVMA 4DE2A 1YLWA 1PWCA 4QU3A 4EWFA 3SH9A 4HHDA 3LICA 2WGVA 3WS5A 4WYYA 2VGKA 2XGNA 5FDSA 4ZRRA 4A5RA 2EWWA 3NI9A 5KSHA 3BY9A 2HGVA 3MQQA 2VKSA 3T4JA 3QHYA 5EE8A 2VEAA 2K2NA 3HVFA 4GOGA 2XD1A 4NEED 4KUOA 1JVJA 4KZ6A 2JE5A 4NXFA 3BQ8A 2I72A 4E6WA 3GRJA 2VLGA 4HOIA 1CEFA 1ES2A 4ZTKA 2WUQA 4IVIA 3A3FA 3GQZA 2UWXA 2V1BA 4MCWA 2Y2IA 2GDNA 4FUWA 3IHBA 3UB9A 3AGEA 5DF9A 3Q82A 3B3XA 1XJ4A 4D2OA 2XRNA 1PRQA 1MZUA 3IF6B 3LCEA 1BLSA 2H0YA 1BTLA 3VE4A 3S1YA 3DTEA 4ARZA 1MC0A 3T4KA 1YM1A 3S7PA 4P6ZS
chains in the Genus database with same CATH topology
2PD7A 1F98A 2P04A 1W63M 2LB9A 2PR6A 3UMEA 1F5MA 3V67A 2L4RA 4B93A 3NHQA 1OJ5A 4IUKA 3E4PA 3MQOA 4JGOA 2A24B 2HJ9C 4LRXC 4P6ZM 3U2AA 4CLCD 2KLIA 3T4OA 1F9IA 1DRMA 3GECA 3RFBA 3CI6A 3UB8A 1MKMA 4BBUA 1T19A 3KYZA 4WEKA 2WKRA 3PBOA 1V9YA 4WEJA 3UMDA 3FG8A 1ZTUA 3LIBA 2JHEA 2INWA 2PHYA 3B47A 2O9CA 2W1TA 3KSHA 3MMHA 4HNBA 2M1CA 2W3GA 2I9VA 2MJ6A 2NUTC 3K2NA 4GHIA 4WUJA 4NXBA 3CUEA 3T4SA 5HWWA 2VV7A 3C8CA 4WL9A 3LFVA 2L1MA 2VA0A 2W1TB 2V1AA 2YKFA 4I3JA 3T4LA 4AFIA 1T18A 1TD5A 3DBAA 5CX7A 4EESA 2WKPA 5AJGA 1S66L 1GSWA 5HSQA 4EUVA 2V0UA 3OOVA 2ZMFA 1N9NA 3A0VA 4H6JA 2W27A 1P9RA 3E4QA 3F1OA 4PKYA 1N9OA 5IU1A 3H82B 2FH5A 3BY8A 2OWHA 4Q0JA 4PAUA 4MN7A 2VGLS 2JKTM 3BJNA 4JGRA 2PYPA 4OOLA 4BJPA 1OT6A 3RH8B 2V0WA 3C38A 3C2WA 4O0PA 4ETXA 2ZBBA 1S4RA 2JKRI 2XA7S 1XJ2A 2VV6A 4F3LA 3F1PB 1TS8A 4K08A 3UE3A 5MC7A 5HZHA 2JKRM 3LIAA 3NOPC 3H7WA 5DKKA 4GS9A 1VHMA 2OOLA 3IS2B 3FPVA 1OTDA 2VV8A 5L8MA 3G6OA 5DFXA 2XA7M 2J3TD 1UGUA 4Y5FA 4EETB 3NOUC 3ZQ5A 4I39A 2YKHA 2B02A 3LIFA 4I3IA 3PHYA 4GCZA 5AVFA 3IBRA 1P9WA 3H7WB 1LSVA 4HQAA 5J4EA 3OC2A 4CLCE 2JN7A 4G3VA 1IFQA 2BASA 4XT2B 3T50A 1GSXA 3PXPA 1XJ3A 3EOIA 1LSWA 4FOFA 5DKLA 1WA9A 4YOFA 4MDZA 2GZAA 2O0YA 3FC7A 2J3WA 5IS1A 2QHKA 4EW7A 3JVUA 3TE8A 3FPWA 3LUQA 1S1YA 4PKYG 3ULFA 3BQAA 3E98A 3HJKA 5HWTA 4O01A 3EGDC 5F6AA 4EEUA 3MXQA 3EQVA 1ZHHB 3PYPA 2D01A 2PYRA 3UB6A 4ARZB 4ETZA 3O5YA 5HDDA 2H28A 4II7A 1NLZA 2G7UA 3MFXA 4I3AA 2FZ0A 3GDIA 5HDCA 1OTBA 2Y8HA 4BWIA 3KSIA 3CITA 3HCYA 3LR0A 1S1ZA 4HJ6A 2GNXA 2K31A 3KYQA 4GJ4A 4EXOA 3PBTA 3W2ZA 1TS7A 1JNUA 3MJQA 2D02A 1UWPX 4HP9A 2Y79A 1OTEA 3TRCA 3D72A 3ZYTA 4BBVA 2K7SA 2V9AA 5DFYA 2WKQA 3LYXA 2A2LA 2HF6A 2KDKA 3LR5A 1XJ6A 1TS0A 1EW0A 3TW8A 1OTAA 4GHIB 5F68A 1NWZA 3BWLA 3PBNA 1S67L 4HY8A 4Y3IA 4IJGA 4R6LA 1VB6A 4G3KA 3VV4A 5G4ZA 3KSFA 5DJTA 3EEHA 1V9ZA 2W0NA 1W63Q 2OWJA 2JKTI 3R7WA 4H6JB 2PT7A 3OLOA 3F1OB 1H3QA 2EA9A 3E0YA 3OBFA 2XROA 5HDSA 1NRJA 3R4KA 3B42A 2OAP1 4I38A 4MN5A 3UB7A 4EERA 4MN6A 3EGXC 4NKPA 1D7EA 2OAQ1 3SW1A 1N9LA 3BW6A 5K5BA 4HJ4A 3P01A 3PBQA 2GX5A 3MF0A 2L0WA 4HJ3A 2DMWA 5HWVA 4F3LB 3H9WA 4CLCC 3OCNA 3PR6A 1ODVA 2M7VA 4GS9B 5F69A 5A8BA 4O8GA 3A0SA 1LSXA 5TBMA 3C30A 2QJ7A 4BBTA 1T1CA 5LBRA 3K3DA 4EU0A 2W1RA 2VJWA 4Y2FA 3K3CA 1G6OA 1DP8A 3D3OA 3B33A 1DP9A 5TJJA 2ZOIA 3RTYA 5HD5A 1G28A 4DMZA 3LR4A 1T1BA 3E4OA 2KOIA 4IUHA 1XFQA 3S7QA 1UWNX 2R78A 2O9BA 1P97A 2Z6CA 2CMNA 2HJEA 3VE3A 3MR0A 4R38A 3NOTC 4L9EA 4QPRA 4HIAA 4YWZA 3NJAA 4GW9A 4Q0IA 2EWVA 3T4TA 4R3AA 2ZOHA 2W3FA 3LIEA 5HPIA 3LI8A 3S7NA 2QWSA 4KQOA 2W3DA 4YNRA 3ICYA 2A24A 2O99A 5J7EA 1TS6A 4LPZA 1BYWA 3CAXA 1NLYA 1S4SA 2NUPC 3TJZC 3VOLA 3JVVA 4CQHA 5IT5A 2VZWA 2M7UA 1H8MA 1T1AA 5HL6A 1TF1A 3A0RA 3EWKA 1OTIA 1YSQA 5F5YA 5HD3A 2B18A 3OCLA 5HPFA 5G4YA 5AVEA 5FL3A 5KIZA 4WF0A 2J3TC 3PBSA 1STZA 2W3HA 4HP4A 3EQUA 3UE6A 2VX8A 4NXEA 2PR5A 2KX6A 4L9FA 1XFNA 3KSGA 5C5KA 4BMWA 4WN5A 4WLAA 2P08A 4KUKA 4EEPA 4WELA 4CLCA 3KX0X 3HJIA 4G3WA 3PBRA 4IHQA 2Z6DA 3KO6A 4DJ2A 1D06A 1X0OA 3H82A 4CLCB 1DP6A 3MQ0A 1YKDA 2PD8A 2LB5A 4HHDA 3LICA 3LI9A 3R7WB 4B9OA 1P0ZA 1YAXA 2O9AA 4ZRRA 2GJ3A 2XSSA 4R70A 4KQDA 4LRZE 2EWWA 3P7NA 5KSHA 3BY9A 4HH3A 2HGVA 3MQQA 2VKSA 3T4JA 2J80A 4UQIS 3F1PA 3LR3A 2QKPA 2VEAA 2K2NA 2PDRA 4EQ1A 3CUEC 3IBJA 3IS2A 3CLOA 2IA2A 4NEED 4KUOA 5J3WA 4L0LA 2QYBA 1GSVA 4PHTA 4UQIM 4NXFA 1OT9A 1IOUA 3BQ8A 2VGLM 4Q0HA 3EEAA 4LRYC 2VLGA 4HOIA 4JGPA 4NXGA 1YSPA 4JGQA 4HH2A 4UEYA 4MMNA 4XT2A 3F1NA 1OPXA 5TBMB 3CWFA 3S7OA 2W3EA 4MCWA 5EFWA 2V1BA 1LT0A 1Y28A 4OOMA 4GLQA 4I5SA 3UB9A 4L9GA 1OJGA 3F1NB 4FSFA 5DF9A 1XJ4A 4LLOB 5DJUA 3T4QA 2XRNA 2P7JA 1MZUA 3LIDA 4ME4A 4RQ9A 3VE4A 4DN0A 2HV1A 1KOUA 4Z1WA 4HI4A 4ARZA 4E04A 5I5LA 4DJ3A 1MC0A 4M4XA 2ZMVA 3T4KA 3S7PA 2QJ5A 1LL8A 4P6ZS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V67 A; 
#chains in the Genus database with same CATH topology
 4OKP A;  2PD7 A;  1E3U A;  3QNC A;  1F5M A;  2Z2M B;  2L4R A;  4Y7P A;  3MQO A;  2WAD A;  3UE1 A;  2HJ9 C;  4LRX C;  4BD0 A;  3U2A A;  2Y2M A;  2ZJ9 A;  1VEU B;  1I5Q A;  3MXR A;  3RFB A;  3NIA A;  3MZD A;  5DVA A;  1L0F A;  3PBO A;  4MBK A;  3FG8 A;  1ZTU A;  3LIB A;  3KSH A;  2M1C A;  4GNU A;  2I9V A;  4NXB A;  4S2P A;  3T4S A;  2VV7 A;  2YKF A;  3T4L A;  4LV1 A;  3WRZ A;  5AJG A;  1Z09 A;  2AVX A;  1Q2Q A;  3SOI A;  4QB8 A;  1N9N A;  4H6J A;  4EUZ A;  1P9R A;  4X68 A;  2IWB A;  4GD6 A;  5IU1 A;  3O3V A;  5EVI D;  3M6B A;  4Q0J A;  4WMC A;  2VGL S;  1MXO A;  1BT5 A;  2JKT M;  1LLB A;  4JGR A;  2PYP A;  4OOL A;  3T1Q B;  1OT6 A;  3RH8 B;  2V0W A;  4O0P A;  4OPZ A;  5F1F A;  2ZBB A;  2Y2N A;  3FKV A;  2WGW B;  5FI6 A;  2JKR M;  2XFT A;  3MXS A;  3NOP C;  2IWC A;  4GS9 A;  2VV8 A;  1RGZ A;  1PI5 A;  1UGU A;  4EET B;  2WGI A;  4I3I A;  4GCZ A;  2R9X A;  3NUL A;  3OPH A;  5EVI B;  2JN7 A;  4OP8 A;  4XT2 B;  5FQK A;  1FIL A;  4FOF A;  4N9L A;  3N8S A;  4HBT A;  1WA9 A;  4YOF A;  1PWG A;  2GZA A;  3UDI A;  2Y4A A;  4S2J A;  1PW8 A;  3M2J A;  3JVU A;  4KG6 A;  3SZT A;  3VP1 A;  1DY6 A;  3HJK A;  2QMI A;  3WS4 A;  5HAP A;  3IX4 A;  2HDS A;  5L10 A;  3CJM A;  4ETZ A;  2HP9 A;  3CPT A;  5CGW A;  5E2H A;  2Y2J A;  5AQB A;  2DNS A;  4KZ9 A;  4S2K A;  5GHY A;  1SHV A;  2C5W B;  2GNX A;  3TSG A;  3NCK A;  1TS7 A;  1JNU A;  3ITA A;  3MJQ A;  2D02 A;  1ACF A;  3PAG A;  4HP9 A;  4U0X A;  2Y79 A;  4RVA A;  3IF6 C;  1OTE A;  3MKF A;  3W4P A;  4E6X A;  2E8I A;  3T1S A;  3VP3 A;  3VOZ A;  2KDK A;  5EM1 A;  4PM9 A;  4O7D A;  1TS0 A;  3TW8 A;  1OTA A;  4GHI B;  2JC7 A;  1PZP A;  5HAR A;  4Y3I A;  4S2N C;  5DTT A;  1OME A;  1BLP A;  3N8L A;  1FIK A;  3KSF A;  3U4L P;  3UO9 A;  5FQQ A;  1YLZ A;  2OWJ A;  3HLB A;  3M6H A;  3VP2 A;  3UDX A;  4MN5 A;  4OQ0 A;  3HLD A;  1MWR A;  3EGX C;  4NG2 A;  2ZC7 A;  3QP4 A;  3SW1 A;  1N9L A;  1IYQ A;  3BW6 A;  1NY0 A;  4KZA A;  1K38 A;  3PBQ A;  3UB5 P;  3C7U A;  1YMS A;  1BUE A;  5FDH A;  4F3L B;  3ZNT A;  3FZC A;  3HLC A;  3IX8 A;  4S2I A;  5AQ9 A;  4OPR A;  5FEF A;  1ODV A;  2FFY A;  1D1J A;  3ISG A;  4O8G A;  4EBP A;  1KVL A;  4E3O A;  1ESU A;  2QJ7 A;  4LV0 A;  4BBT A;  4Y13 A;  4H8R A;  3A3E A;  3K3D A;  4EBL A;  3K3C A;  1G6O A;  3D3O A;  1DP9 A;  2ZOI A;  5HD5 A;  1JWZ A;  2X02 A;  2ZQ7 A;  1H8Z A;  4JPM A;  3LR4 A;  3DWZ A;  3IHA A;  3IF6 A;  2KOI A;  4OQI A;  5BOH A;  2R78 A;  2O9B A;  4E3K A;  1P97 A;  5HFO A;  2HJE A;  2FFF B;  3NOT C;  4Q0I A;  2Y2L A;  3T4T A;  3BEB A;  5AQ7 A;  4WZ5 C;  4LGW A;  1JWP A;  2ZQ9 A;  4P87 A;  5GLB A;  1XGI A;  2ZM8 A;  4KQO A;  4DDY A;  1BLC A;  1K4E A;  4PM5 A;  4QHC A;  4Y0O A;  5CGS A;  4JF6 A;  2HZ5 A;  3CAX A;  4LV2 A;  1NLY A;  3VOL A;  1GCE A;  1CI9 A;  5IT5 A;  4X53 A;  2VZW A;  5GLA A;  5FQI A;  2M7U A;  1H8M A;  2XQZ A;  1T1A A;  1W79 A;  1OTI A;  4LEN A;  1YSQ A;  4R0Q A;  5F5Y A;  1W8Q A;  2A3U A;  5CTN A;  2B5R A;  1DJB A;  5HL1 A;  3EQU A;  4OQG A;  4IED A;  3UE6 A;  4NXE A;  1FSW A;  2PR5 A;  1H5X A;  2XFS A;  4FTX A;  2E8J A;  1MWT A;  4WN5 A;  1YLJ A;  4ZAM A;  4WLA A;  4KUK A;  3Q07 A;  4WEL A;  5TGF A;  4G3W A;  3PBR A;  4IHQ A;  5KMW A;  2XEP A;  3OPL A;  3BFG A;  3P09 A;  4KZ4 A;  1KGG A;  5E2G A;  3BRM A;  1ZG4 A;  1ONH A;  1N4O A;  1YKD A;  1BLH A;  1SDE A;  2J8Y A;  3R7W B;  1P0Z A;  1M40 A;  2ZC6 B;  2GJ3 A;  2XSS A;  2A49 A;  3P7N A;  4HH3 A;  2WGW A;  4GB7 A;  3DW0 A;  3UPN A;  2QKP A;  3SH8 A;  2Q9M A;  5FAQ A;  2G2W A;  1CQA A;  3IBJ A;  3QP8 A;  4WZ4 A;  4L0L A;  5D3O A;  4WZ5 A;  4QY5 A;  3EEA A;  1NZU A;  3N4I A;  2BLS A;  5EVI A;  1TEM A;  4MLL A;  3QP5 A;  4JGQ A;  5EEC A;  1RCJ A;  2EXB A;  4XT2 A;  3F1N A;  1DJA A;  5TBM B;  4X1L A;  3VMA A;  2W3E A;  1LT0 A;  2G2U A;  1Y28 A;  4L9G A;  1M6K A;  1OJG A;  3VFH A;  3PAE A;  1EI5 A;  2WKI A;  4LLO B;  3T4Q A;  3C4O A;  2Y2P A;  2OV5 A;  1S0W A;  1ONG A;  5I5L A;  4DRT A;  4DJ3 A;  1I2W A;  5F1G A;  1KE3 A;  4OLD A;  1MBL A;  2EFU A;  2PR6 A;  5F82 A;  4MBF A;  4RYE A;  2EX6 A;  4GDB A;  4R3B A;  1OJ5 A;  4IUK A;  3ITB A;  4JGO A;  3T1R A;  4LCM A;  1DRM A;  3ZVT A;  1XXM A;  3CI6 A;  3UB8 A;  3IWQ A;  1IYP A;  4BBU A;  1T19 A;  3T12 B;  3HUM A;  4WEK A;  3ZNY A;  4X69 A;  1V9Y A;  4WEJ A;  5KSC A;  4PM8 A;  2JHE A;  2XF3 A;  2W3G A;  2MJ6 A;  3K2N A;  4GHI A;  2WYX A;  1Y4O A;  3QP1 A;  4FCF A;  2W1T B;  2XDM A;  1T18 A;  3DBA A;  5HSQ A;  4KG2 A;  2Y2K A;  3OOV A;  2BTF P;  1S6R A;  3UN7 A;  1Z6F A;  2Z2L B;  5E2E A;  3H82 B;  3VFF A;  5FEG A;  4EBN A;  4F94 A;  3VSL A;  2X71 A;  5EVE A;  3S22 A;  4JXS A;  3C38 A;  4ETX A;  3ZCZ A;  1S4R A;  3ZG7 B;  2JKR I;  2VV6 A;  4F3L A;  3F1P B;  1IEM A;  3UE3 A;  5MC7 A;  3H7W A;  2OOL A;  3IS2 B;  3MZF A;  3MFD A;  4N1H A;  3O88 A;  5CEB A;  3Q1F A;  5DFX A;  4Y5F A;  1PYY A;  2PU4 A;  2Y2O A;  5AVF A;  3PHY A;  3IBR A;  4HQA A;  4G3V A;  4XUZ A;  3MS6 A;  4P85 A;  3T50 A;  1GSX A;  3OZH A;  3G31 A;  1CEG A;  2RCX A;  2V8F A;  5DKL A;  2ZMA A;  2O0Y A;  3ZFZ A;  1CK3 A;  2QHK A;  3TE8 A;  3FPW A;  1XPB A;  3HL9 A;  3ULF A;  3BQA A;  3LY4 A;  4O01 A;  4EEU A;  3PYP A;  4Y0U A;  2V1Z A;  3IXG A;  4E3L A;  2D01 A;  2BG1 A;  3BEC A;  5HDD A;  2H28 A;  4II7 A;  3ZGA B;  1NLZ A;  2QZ6 A;  4DXB A;  2HDR A;  3C7V A;  3V50 A;  1HLU P;  1TDG A;  1F2K A;  5EOO A;  5M18 A;  4C3Q A;  3PBT A;  3W2Z A;  2XK1 A;  3CZD A;  1XA7 A;  1O7E A;  5CGX A;  5DFY A;  1LHY A;  1SKO B;  4JXG A;  3LYX A;  1FOF A;  3RXX A;  5FQ9 A;  4Y17 A;  2VK3 A;  3BM6 A;  3UY6 A;  5F68 A;  1NWZ A;  1IKG A;  3BWL A;  1S67 L;  4BD1 A;  3CHW P;  1NYY A;  2XD5 A;  1SCW A;  1FR1 A;  1RGY A;  5L07 A;  4DF6 A;  1V9Z A;  2Y2H A;  3R7W A;  1Q2P A;  3OLO A;  1CI8 A;  3MBZ A;  1H3Q A;  2EA9 A;  3G2Y A;  1NRJ A;  3HUN A;  1GHM A;  4LFU A;  4XUX A;  5E2F A;  3HLF A;  5FA7 A;  2OAQ 1;  2GX5 A;  3MF0 A;  4HJ3 A;  2DMW A;  1K6R A;  2IWD A;  2EX9 A;  1A0K A;  4JF5 A;  3A0S A;  2PRF A;  5TBM A;  2PBY A;  4LV3 A;  2VJW A;  3QNB A;  2CC1 A;  3B33 A;  3RTY A;  4OVD A;  4DMZ A;  3ZG9 B;  4IUH A;  3AGD A;  3E2L A;  3L7H A;  1PWD A;  5CHM A;  1UWN X;  4ZJ3 A;  3VE3 A;  3FWL A;  4OQH A;  3IX3 A;  2EWV A;  4MBH A;  1MKI A;  4R3A A;  4OOY A;  1ES4 A;  3LI8 A;  3M2K A;  1BUL A;  3WWX A;  5CRF A;  3MKE A;  1TS6 A;  1BYW A;  2ZL1 B;  3V3R A;  3G34 A;  4IBX A;  1S4S A;  3JVV A;  3C4P A;  4BL2 A;  2XH9 A;  3Q7Z A;  1TF1 A;  3A0R A;  3EWK A;  2HP5 A;  1QME A;  5HPF A;  1GA0 A;  3A3D A;  5AVE A;  5HAQ A;  1WE4 A;  4DDS A;  2UV0 E;  4DXC A;  1FCM A;  3PBS A;  1STZ A;  2W3H A;  4HP4 A;  1G5U A;  4OPQ A;  3W8K A;  2X01 A;  2KX6 A;  4QWO A;  4KZ3 A;  4BMW A;  2V20 A;  4XXR A;  4BEN A;  4DE0 A;  5DTS A;  5TR7 A;  5A93 A;  3E2K A;  4KZ8 A;  5EVL A;  3D9Y A;  1X0O A;  3H82 A;  1ERM A;  4CLC B;  1DP6 A;  2ZC5 B;  4PM7 A;  4R3J A;  5CER A;  4KZ5 A;  4B9O A;  2OLV A;  2O9A A;  3WS1 A;  4B4Z A;  1ERO A;  4KQD A;  4LRZ E;  3LY3 A;  3F1P A;  4K91 A;  2WKE A;  2ZQ8 A;  2PDR A;  4N92 A;  3WRT A;  3SS4 A;  3BYD A;  3IS2 A;  3CLO A;  4P0M A;  5J3W A;  4M3K A;  3HLW A;  4UQI M;  4LCL A;  1L3L A;  2VGL M;  4Q0H A;  1SDN A;  4LRY C;  4NXG A;  2WAF A;  1YSP A;  4HH2 A;  1XKZ A;  1OPX A;  4JKT A;  3Q7V B;  1NXY A;  3CWF A;  4K0W A;  4UAA A;  2Q0O A;  4I5S A;  4B88 A;  1GA9 A;  1GHI A;  4FSF A;  4R1G A;  5DJU A;  5DF7 A;  1YT4 A;  2P7J A;  4Y0T A;  3LID A;  4ME4 A;  4IBR A;  2WKH A;  1TDL A;  4DN0 A;  1K55 C;  3GMW A;  1KOU A;  2Y91 A;  4E04 A;  1SKF A;  3PTE A;  1K57 A;  2ZMV A;  5EVI C;  4N1X A;  2HDU A;  1Y54 A;  5FI7 A;  1KGF A;  2J7V A;  1W63 M;  1FQG A;  1VEU A;  3V67 A;  3NHQ A;  3E4P A;  2A24 B;  3C5A A;  3JYI A;  2KLI A;  1K25 A;  2HPB A;  3UNW A;  1ZG6 A;  3I7J A;  1SKO A;  1MKM A;  3SH7 A;  2WKR A;  4Y15 A;  3UMD A;  3MMH A;  2PHY A;  3B47 A;  1TVF A;  1DJC A;  2NUT C;  4WUJ A;  1K54 C;  5CHJ A;  5FAO A;  2QPN A;  4WL9 A;  3LFV A;  2VA0 A;  4I3J A;  2V1A A;  4AFI A;  5CX7 A;  1ES5 A;  4EES A;  4QD4 A;  1GSW A;  2V0U A;  3NBL A;  1ALQ A;  2ZMF A;  3ZVW A;  3A0V A;  2ZQD A;  2W27 A;  1K56 D;  4BL3 A;  3GSG A;  2FH5 A;  1XA1 A;  4RX3 A;  2ZQC A;  1EWZ A;  1PFL A;  4MN7 A;  3O87 A;  3BJN A;  1JWV A;  2DCF A;  5EUA A;  4BJP A;  3C2W A;  1AXB A;  1N9B A;  1TS8 A;  3BFC A;  1K55 A;  4IVK A;  1VQQ A;  3LIA A;  2P9V B;  1VHM A;  1BZA A;  2PU2 A;  3FPV A;  4MNR A;  1OTD A;  4C6Y A;  5L8M A;  5GLC A;  3ZDJ A;  3IH9 A;  2XA7 M;  4HES A;  4I39 A;  3LIF A;  1MY8 A;  1P9W A;  1LSV A;  3OC2 A;  1ZC2 A;  4QJG A;  4CLC E;  2XLN A;  1IFQ A;  4E3J A;  3PXP A;  1XJ3 A;  3EOI A;  1LSW A;  2J9P A;  2HP6 A;  1SZV A;  1ZKJ A;  1NRF A;  3TOI A;  4UA6 A;  3GV9 A;  5IS1 A;  4WM9 A;  3LUQ A;  4RA7 A;  1S1Y A;  5HWT A;  1L0E A;  4U3T A;  3EQV A;  1HVB A;  1ZHH B;  2Q9N A;  3IWI A;  3Q81 A;  1K54 A;  4I3A A;  2ZL1 A;  2FZ0 A;  5HDC A;  1VET B;  2Y8H A;  5GHX A;  1W7F A;  3KSI A;  3HCY A;  3LR0 A;  4FH2 A;  4ZDX A;  2K31 A;  3KYQ A;  3JPU A;  4GJ4 A;  2EXA A;  1I2S A;  3OPP A;  1G6A A;  1UWP X;  3WS0 A;  1FCN A;  3D72 A;  3ZYT A;  5G18 A;  1E4D A;  2V9A A;  1H0M A;  2WKQ A;  1KE0 A;  4BQM A;  4NET A;  2P74 A;  2A2L A;  1IYO A;  5I94 A;  1ESI A;  1KE4 A;  4K0X A;  2ZLY A;  4IJG A;  3W4Q A;  4ZBE A;  2EX2 A;  1IEL A;  1VB6 A;  4R6L A;  4G3K A;  4C75 A;  4DE3 A;  3VV4 A;  5G4Z A;  5EPH A;  5DJT A;  3EEH A;  2W0N A;  5JYP A;  5FAP A;  2JKT I;  3G2Z A;  2PT7 A;  4JXW A;  3F1O B;  3E0Y A;  2XRO A;  5FQJ A;  4MN6 A;  4E3M A;  1IKI A;  4OH0 A;  1D7E A;  4D60 A;  2WAE A;  2EX8 A;  3VSK A;  3OPR A;  5HWV A;  3H9W A;  1RP5 A;  3NY4 A;  3PR6 A;  3FYZ A;  2M7V A;  1PNE A;  3FV7 A;  5F69 A;  5A8B A;  5HX9 A;  4JBF A;  1YLP A;  5GHZ A;  1LSX A;  3Q7V A;  1J9M A;  1L2S A;  3C30 A;  5J8X A;  3T1X A;  3DAV A;  1T1C A;  1FCO A;  4Y2F A;  4KZB A;  4OP5 A;  3V39 A;  1XGJ A;  4Z9Q A;  3D4F A;  3LEZ A;  4X25 A;  4ZJ1 A;  4YFM A;  2CMN A;  5HAI A;  3MR0 A;  4L9E A;  5U47 A;  2ZOH A;  3LIE A;  5CXW A;  4UA7 A;  5CEC A;  1W8Y A;  3S7N A;  2J9O A;  2QWS A;  2R9W A;  4YNR A;  2W3D A;  1CJF A;  3ICY A;  2A24 A;  3ZHH A;  1HD8 A;  1PW1 A;  4LPZ A;  1ES3 A;  3L9K A;  3V5M A;  2WZX A;  2NUP C;  3TJZ C;  1PI4 A;  4CQH A;  5EOE A;  3W4O A;  2ZC4 B;  1MPL A;  1XX2 A;  5HL6 A;  5GL9 A;  5HD3 A;  2B18 A;  5FAT A;  3S4X A;  3QP6 A;  5FL3 A;  5KIZ A;  3DTI A;  2VX8 A;  1HZO A;  3SS5 A;  4U0T A;  4L9F A;  5C5K A;  4EEP A;  3MZE A;  3KX0 X;  2Z6D A;  2Y55 A;  1D06 A;  5EV0 A;  1YPR A;  1NJ4 A;  3IXD A;  3MQ0 A;  2PD8 A;  5DF8 A;  2LB5 A;  4RX2 A;  4X1M A;  3LI9 A;  3BFE A;  1YAX A;  5TFQ A;  4E3I A;  2OLU A;  5GLD A;  4R70 A;  4BLM A;  5M1A A;  4B4X A;  3IF5 A;  2J80 A;  4FD8 A;  4UQI S;  3LR3 A;  1KDS A;  4EQ1 A;  3CUE C;  5IHV A;  2OSU A;  2P9V A;  3G35 A;  2IA2 A;  2QYB A;  1GSV A;  4PHT A;  2B95 A;  1K56 A;  1OT9 A;  1IOU A;  3NDE A;  4OPY A;  4JGP A;  4WBG A;  3NEC A;  4HBU A;  4UEY A;  4MMN A;  3UPP A;  3IT9 A;  4NK3 A;  1MWU A;  1WYC A;  3S7O A;  5EFW A;  3AGF A;  1L0D A;  4OOM A;  4GLQ A;  3NDG A;  3F1N B;  4JXV A;  4DKI A;  2V8C A;  5AQA A;  4RQ9 A;  5CTM A;  2HV1 A;  4Z1W A;  5FAS A;  3CG5 A;  4HI4 A;  4KG5 A;  4M4X A;  2QJ5 A;  1LL8 A;  3ZG0 A;  4EV4 A;  3N8R A;  4ESP A;  1VET A;  1F98 A;  2ACG A;  2P04 A;  2LB9 A;  3UME A;  1YQS A;  4B93 A;  3QP2 A;  1YLT A;  3BFF A;  4P6Z M;  2V2F F;  4CLC D;  3HBR A;  3T4O A;  1F9I A;  2Y59 A;  3GEC A;  1KGE A;  2H5S A;  3KYZ A;  5A91 A;  1K57 C;  1K6S A;  2INW A;  4HNB A;  3DTM A;  5JYO A;  2O9C A;  2W1T A;  4PPR A;  3N7W A;  3V3S A;  4HEF A;  4GKU A;  4KQR A;  3UDF A;  5L2F A;  3CUE A;  5DTK A;  5HWW A;  3C8C A;  5L09 A;  4KQQ A;  2L1M A;  4S2L A;  1TD5 A;  1YLY A;  2WKP A;  1NZO A;  1S66 L;  3A3J A;  4EUV A;  1JTD A;  5E43 A;  3FKW A;  1LI0 A;  3E4Q A;  3F1O A;  5FI2 A;  4PKY A;  1N9O A;  3BY8 A;  3BLS A;  3VOY A;  2OWH A;  4PAU A;  4Q8I A;  3G32 A;  3IH8 A;  3UPO A;  4S2O A;  2XA7 S;  1XJ2 A;  3ZG8 B;  4K08 A;  4FH4 A;  3HRE A;  2RL3 A;  5HZH A;  4X55 A;  5A90 A;  5DKK A;  4OON A;  3NC8 A;  3IXH A;  3G6O A;  2J3T D;  1E25 A;  2Y2G A;  3GTC A;  3NOU C;  3TG9 A;  4YIN A;  1IYS A;  3ZQ5 A;  2YKH A;  2B02 A;  4KEN B;  1XP4 A;  2ZM0 A;  3H7W B;  5J4E A;  1FR6 A;  1WYB A;  4MEZ A;  1E3U D;  4E3N A;  2BAS A;  4P6B A;  1VM1 A;  3BFD A;  2DRW A;  4MDZ A;  1YMX A;  3FC7 A;  2J3W A;  5CED A;  1HTZ A;  4EW7 A;  4PKY G;  3E98 A;  3EGD C;  5F6A A;  3MXQ A;  1FSY A;  1L0G A;  2PYR A;  1JTG A;  3UB6 A;  4ARZ B;  3O5Y A;  2G7U A;  3MFX A;  1AWI A;  3GDI A;  4R23 A;  4PM6 A;  1OTB A;  4BWI A;  2VGJ A;  5A92 A;  1MWS A;  3CIT A;  1PZO A;  1S1Z A;  4HJ6 A;  4S2N A;  3P98 A;  4EXO A;  5KZH A;  1NYM A;  5CHU A;  2ZC3 B;  3TRC A;  4BBV A;  3DTK A;  2K7S A;  2ZM2 A;  1K0K A;  1W5D A;  4R4R A;  5M19 A;  2ZD8 A;  3MSH A;  1PIO A;  2HF6 A;  2Y2Q A;  4JF4 A;  3WS2 A;  4OLG A;  4WMC D;  3LR5 A;  1U60 A;  1XJ6 A;  3G30 A;  3ZG5 A;  1EW0 A;  1O07 A;  2C6W B;  3PBN A;  4HY8 A;  2JBF A;  4JLF A;  4UHU A;  3LO7 A;  5HW3 A;  1W63 Q;  4QY6 A;  4UA9 A;  4EQI A;  4H6J B;  3LGO A;  3N6I A;  4ZJ2 A;  3OBF A;  5HDS A;  3R4K A;  1J3W A;  1LL5 A;  3B42 A;  2OAP 1;  4I38 A;  3UB7 A;  4EER A;  3RXW A;  4KZ7 A;  4NKP A;  3BLM A;  5K5B A;  4HJ4 A;  3P01 A;  4X56 A;  2L0W A;  2PBD P;  4CLC C;  3GR2 A;  3OCN A;  1BSG A;  4GS9 B;  3KYE A;  1KDW A;  2JKF A;  3VP0 A;  5LBR A;  4GDN A;  3VP4 A;  3HLE A;  4EU0 A;  4S2M A;  2W1R A;  3HLG A;  3IWO A;  3A3I A;  3CMZ A;  1DP8 A;  5TJJ A;  1G28 A;  1C3B A;  1T1B A;  2HDQ A;  3E4O A;  4DE1 A;  1K4F A;  1XFQ A;  3S7Q A;  2Z6C A;  4R38 A;  5FSR A;  4QPR A;  1H8Y A;  4HIA A;  3RJU A;  3LEQ A;  4YWZ A;  3NJA A;  1CF0 A;  4GW9 A;  4R4S A;  2W3F A;  2WK0 A;  5HPI A;  1GHP A;  3IQA A;  2EFX A;  2O99 A;  3O86 A;  5J7E A;  3CPT B;  2JCH A;  3IXB A;  1LI9 A;  3GVB A;  3HUO A;  4N9K A;  4GN2 A;  2PAV P;  2XR0 A;  4GZB A;  4PMA A;  2JKG A;  1LL9 A;  1ERQ A;  5F83 A;  1QMF A;  2WZZ A;  4CPK A;  3OCL A;  5G4Y A;  2ZQA A;  4WF0 A;  2J3T C;  1G68 A;  2H0T A;  5FQM A;  4CJN A;  3SS3 A;  2H10 A;  1XFN A;  3DWK A;  3KSG A;  2P08 A;  4GD8 A;  5EM0 A;  4CLC A;  3HJI A;  3UE0 A;  3G4P A;  4X6T A;  3KO6 A;  4DJ2 A;  4ID4 A;  1KVM A;  4DE2 A;  1YLW A;  1PWC A;  4QU3 A;  4EWF A;  3SH9 A;  4HHD A;  3LIC A;  2WGV A;  3WS5 A;  4WYY A;  2VGK A;  2XGN A;  5FDS A;  4ZRR A;  4A5R A;  2EWW A;  3NI9 A;  5KSH A;  3BY9 A;  2HGV A;  3MQQ A;  2VKS A;  3T4J A;  3QHY A;  5EE8 A;  2VEA A;  2K2N A;  3HVF A;  4GOG A;  2XD1 A;  4NEE D;  4KUO A;  1JVJ A;  4KZ6 A;  2JE5 A;  4NXF A;  3BQ8 A;  2I72 A;  4E6W A;  3GRJ A;  2VLG A;  4HOI A;  1CEF A;  1ES2 A;  4ZTK A;  2WUQ A;  4IVI A;  3A3F A;  3GQZ A;  2UWX A;  2V1B A;  4MCW A;  2Y2I A;  2GDN A;  4FUW A;  3IHB A;  3UB9 A;  3AGE A;  5DF9 A;  3Q82 A;  3B3X A;  1XJ4 A;  4D2O A;  2XRN A;  1PRQ A;  1MZU A;  3IF6 B;  3LCE A;  1BLS A;  2H0Y A;  1BTL A;  3VE4 A;  3S1Y A;  3DTE A;  4ARZ A;  1MC0 A;  3T4K A;  1YM1 A;  3S7P A;  4P6Z S; 
#chains in the Genus database with same CATH homology
 2PD7 A;  1F98 A;  2P04 A;  1W63 M;  2LB9 A;  2PR6 A;  3UME A;  1F5M A;  3V67 A;  2L4R A;  4B93 A;  3NHQ A;  1OJ5 A;  4IUK A;  3E4P A;  3MQO A;  4JGO A;  2A24 B;  2HJ9 C;  4LRX C;  4P6Z M;  3U2A A;  4CLC D;  2KLI A;  3T4O A;  1F9I A;  1DRM A;  3GEC A;  3RFB A;  3CI6 A;  3UB8 A;  1MKM A;  4BBU A;  1T19 A;  3KYZ A;  4WEK A;  2WKR A;  3PBO A;  1V9Y A;  4WEJ A;  3UMD A;  3FG8 A;  1ZTU A;  3LIB A;  2JHE A;  2INW A;  2PHY A;  3B47 A;  2O9C A;  2W1T A;  3KSH A;  3MMH A;  4HNB A;  2M1C A;  2W3G A;  2I9V A;  2MJ6 A;  2NUT C;  3K2N A;  4GHI A;  4WUJ A;  4NXB A;  3CUE A;  3T4S A;  5HWW A;  2VV7 A;  3C8C A;  4WL9 A;  3LFV A;  2L1M A;  2VA0 A;  2W1T B;  2V1A A;  2YKF A;  4I3J A;  3T4L A;  4AFI A;  1T18 A;  1TD5 A;  3DBA A;  5CX7 A;  4EES A;  2WKP A;  5AJG A;  1S66 L;  1GSW A;  5HSQ A;  4EUV A;  2V0U A;  3OOV A;  2ZMF A;  1N9N A;  3A0V A;  4H6J A;  2W27 A;  1P9R A;  3E4Q A;  3F1O A;  4PKY A;  1N9O A;  5IU1 A;  3H82 B;  2FH5 A;  3BY8 A;  2OWH A;  4Q0J A;  4PAU A;  4MN7 A;  2VGL S;  2JKT M;  3BJN A;  4JGR A;  2PYP A;  4OOL A;  4BJP A;  1OT6 A;  3RH8 B;  2V0W A;  3C38 A;  3C2W A;  4O0P A;  4ETX A;  2ZBB A;  1S4R A;  2JKR I;  2XA7 S;  1XJ2 A;  2VV6 A;  4F3L A;  3F1P B;  1TS8 A;  4K08 A;  3UE3 A;  5MC7 A;  5HZH A;  2JKR M;  3LIA A;  3NOP C;  3H7W A;  5DKK A;  4GS9 A;  1VHM A;  2OOL A;  3IS2 B;  3FPV A;  1OTD A;  2VV8 A;  5L8M A;  3G6O A;  5DFX A;  2XA7 M;  2J3T D;  1UGU A;  4Y5F A;  4EET B;  3NOU C;  3ZQ5 A;  4I39 A;  2YKH A;  2B02 A;  3LIF A;  4I3I A;  3PHY A;  4GCZ A;  5AVF A;  3IBR A;  1P9W A;  3H7W B;  1LSV A;  4HQA A;  5J4E A;  3OC2 A;  4CLC E;  2JN7 A;  4G3V A;  1IFQ A;  2BAS A;  4XT2 B;  3T50 A;  1GSX A;  3PXP A;  1XJ3 A;  3EOI A;  1LSW A;  4FOF A;  5DKL A;  1WA9 A;  4YOF A;  4MDZ A;  2GZA A;  2O0Y A;  3FC7 A;  2J3W A;  5IS1 A;  2QHK A;  4EW7 A;  3JVU A;  3TE8 A;  3FPW A;  3LUQ A;  1S1Y A;  4PKY G;  3ULF A;  3BQA A;  3E98 A;  3HJK A;  5HWT A;  4O01 A;  3EGD C;  5F6A A;  4EEU A;  3MXQ A;  3EQV A;  1ZHH B;  3PYP A;  2D01 A;  2PYR A;  3UB6 A;  4ARZ B;  4ETZ A;  3O5Y A;  5HDD A;  2H28 A;  4II7 A;  1NLZ A;  2G7U A;  3MFX A;  4I3A A;  2FZ0 A;  3GDI A;  5HDC A;  1OTB A;  2Y8H A;  4BWI A;  3KSI A;  3CIT A;  3HCY A;  3LR0 A;  1S1Z A;  4HJ6 A;  2GNX A;  2K31 A;  3KYQ A;  4GJ4 A;  4EXO A;  3PBT A;  3W2Z A;  1TS7 A;  1JNU A;  3MJQ A;  2D02 A;  1UWP X;  4HP9 A;  2Y79 A;  1OTE A;  3TRC A;  3D72 A;  3ZYT A;  4BBV A;  2K7S A;  2V9A A;  5DFY A;  2WKQ A;  3LYX A;  2A2L A;  2HF6 A;  2KDK A;  3LR5 A;  1XJ6 A;  1TS0 A;  1EW0 A;  3TW8 A;  1OTA A;  4GHI B;  5F68 A;  1NWZ A;  3BWL A;  3PBN A;  1S67 L;  4HY8 A;  4Y3I A;  4IJG A;  4R6L A;  1VB6 A;  4G3K A;  3VV4 A;  5G4Z A;  3KSF A;  5DJT A;  3EEH A;  1V9Z A;  2W0N A;  1W63 Q;  2OWJ A;  2JKT I;  3R7W A;  4H6J B;  2PT7 A;  3OLO A;  3F1O B;  1H3Q A;  2EA9 A;  3E0Y A;  3OBF A;  2XRO A;  5HDS A;  1NRJ A;  3R4K A;  3B42 A;  2OAP 1;  4I38 A;  4MN5 A;  3UB7 A;  4EER A;  4MN6 A;  3EGX C;  4NKP A;  1D7E A;  2OAQ 1;  3SW1 A;  1N9L A;  3BW6 A;  5K5B A;  4HJ4 A;  3P01 A;  3PBQ A;  2GX5 A;  3MF0 A;  2L0W A;  4HJ3 A;  2DMW A;  5HWV A;  4F3L B;  3H9W A;  4CLC C;  3OCN A;  3PR6 A;  1ODV A;  2M7V A;  4GS9 B;  5F69 A;  5A8B A;  4O8G A;  3A0S A;  1LSX A;  5TBM A;  3C30 A;  2QJ7 A;  4BBT A;  1T1C A;  5LBR A;  3K3D A;  4EU0 A;  2W1R A;  2VJW A;  4Y2F A;  3K3C A;  1G6O A;  1DP8 A;  3D3O A;  3B33 A;  1DP9 A;  5TJJ A;  2ZOI A;  3RTY A;  5HD5 A;  1G28 A;  4DMZ A;  3LR4 A;  1T1B A;  3E4O A;  2KOI A;  4IUH A;  1XFQ A;  3S7Q A;  1UWN X;  2R78 A;  2O9B A;  1P97 A;  2Z6C A;  2CMN A;  2HJE A;  3VE3 A;  3MR0 A;  4R38 A;  3NOT C;  4L9E A;  4QPR A;  4HIA A;  4YWZ A;  3NJA A;  4GW9 A;  4Q0I A;  2EWV A;  3T4T A;  4R3A A;  2ZOH A;  2W3F A;  3LIE A;  5HPI A;  3LI8 A;  3S7N A;  2QWS A;  4KQO A;  2W3D A;  4YNR A;  3ICY A;  2A24 A;  2O99 A;  5J7E A;  1TS6 A;  4LPZ A;  1BYW A;  3CAX A;  1NLY A;  1S4S A;  2NUP C;  3TJZ C;  3VOL A;  3JVV A;  4CQH A;  5IT5 A;  2VZW A;  2M7U A;  1H8M A;  1T1A A;  5HL6 A;  1TF1 A;  3A0R A;  3EWK A;  1OTI A;  1YSQ A;  5F5Y A;  5HD3 A;  2B18 A;  3OCL A;  5HPF A;  5G4Y A;  5AVE A;  5FL3 A;  5KIZ A;  4WF0 A;  2J3T C;  3PBS A;  1STZ A;  2W3H A;  4HP4 A;  3EQU A;  3UE6 A;  2VX8 A;  4NXE A;  2PR5 A;  2KX6 A;  4L9F A;  1XFN A;  3KSG A;  5C5K A;  4BMW A;  4WN5 A;  4WLA A;  2P08 A;  4KUK A;  4EEP A;  4WEL A;  4CLC A;  3KX0 X;  3HJI A;  4G3W A;  3PBR A;  4IHQ A;  2Z6D A;  3KO6 A;  4DJ2 A;  1D06 A;  1X0O A;  3H82 A;  4CLC B;  1DP6 A;  3MQ0 A;  1YKD A;  2PD8 A;  2LB5 A;  4HHD A;  3LIC A;  3LI9 A;  3R7W B;  4B9O A;  1P0Z A;  1YAX A;  2O9A A;  4ZRR A;  2GJ3 A;  2XSS A;  4R70 A;  4KQD A;  4LRZ E;  2EWW A;  3P7N A;  5KSH A;  3BY9 A;  4HH3 A;  2HGV A;  3MQQ A;  2VKS A;  3T4J A;  2J80 A;  4UQI S;  3F1P A;  3LR3 A;  2QKP A;  2VEA A;  2K2N A;  2PDR A;  4EQ1 A;  3CUE C;  3IBJ A;  3IS2 A;  3CLO A;  2IA2 A;  4NEE D;  4KUO A;  5J3W A;  4L0L A;  2QYB A;  1GSV A;  4PHT A;  4UQI M;  4NXF A;  1OT9 A;  1IOU A;  3BQ8 A;  2VGL M;  4Q0H A;  3EEA A;  4LRY C;  2VLG A;  4HOI A;  4JGP A;  4NXG A;  1YSP A;  4JGQ A;  4HH2 A;  4UEY A;  4MMN A;  4XT2 A;  3F1N A;  1OPX A;  5TBM B;  3CWF A;  3S7O A;  2W3E A;  4MCW A;  5EFW A;  2V1B A;  1LT0 A;  1Y28 A;  4OOM A;  4GLQ A;  4I5S A;  3UB9 A;  4L9G A;  1OJG A;  3F1N B;  4FSF A;  5DF9 A;  1XJ4 A;  4LLO B;  5DJU A;  3T4Q A;  2XRN A;  2P7J A;  1MZU A;  3LID A;  4ME4 A;  4RQ9 A;  3VE4 A;  4DN0 A;  2HV1 A;  1KOU A;  4Z1W A;  4HI4 A;  4ARZ A;  4E04 A;  5I5L A;  4DJ3 A;  1MC0 A;  4M4X A;  2ZMV A;  3T4K A;  3S7P A;  2QJ5 A;  1LL8 A;  4P6Z S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...