3V67A

Periplasmic domain of vibrio parahaemolyticus cpxa
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
132
structure length
132
Chain Sequence
b'PRKARDIPDEHYQRIIETRDAIQNKYSKETDLGRILFRVEGNRAGKHDPRPRVFFSDYNGNVLTTDKRSNFQLRAMQNFVTSIEDYNKPKQRLYGRYMIAGPVPIVLADSELLMYVGFKWNEPPPLLLRLFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein CpxA
publication title The crystal structure of the periplasmic domain of Vibrio parahaemolyticus CpxA
pubmed doi rcsb
source organism Vibrio parahaemolyticus
molecule tags Signaling protein
total genus 29
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16527 CpxA_peri Two-component sensor protein CpxA, periplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.210 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3v67A01
3V67A
chains in the Genus database with same CATH superfamily
1C3BA 1HTZA 1IFQA 1H8MA 5HDDA 5F83A 3JYIA 4EBPA 3VP3A 4HP4A 1LSXA 4X6TA 3NECA 3F1NA 2PHYA 2PYRA 1ERQA 5FQIA 3QP8A 4DMZA 4OP8A 5F68A 3VP4A 1XXMA 3Q1FA 4I39A 3PBOA 4HHDA 2UWXA 1N9LA 4Z1WA 1GSVA 4OOLA 3T4KA 2HV1A 3LY4A 3UE6A 5MC7A 4HY8A 2VEAA 1WYCA 4PMAA 1E25A 3DTIA 2WKRA 4IVIA 4LV2A 1MWRA 2WKQA 4HH3A 3FYZA 4E04A 2FZ0A 2V0UA 3DWKA 2A49A 1PYYA 1FIKA 5FDHA 3IF5A 3HVFA 4Y2FA 2BASA 3UE0A 1EWZA 2NUTC 4E3KA 2QPNA 1CI8A 3JPUA 3HLWA 1L0EA 4OLGA 2VKSA 4KG2A 2H10A 3LEQA 2EXBA 2ZOHA 4MCWA 1I2WA 2Y2HA 4BMWA 3GSGA 3F1PB 3UB5P 2A2LA 5GLDA 5FEFA 2OOLA 3MZDA 3IS2B 1TEMA 2EFXA 4K0WA 1CI9A 2W3DA 4GDBA 2H0YA 4S2NA 5AQ9A 3JVUA 4WEJA 3F1PA 3KSGA 4S2OA 2HP5A 1MKIA 4WN5A 4R3BA 5CGXA 4PM9A 3ZYTA 1XJ4A 3E4OA 4HOIA 4KZ6A 5HDCA 3QNBA 4L9FA 3CITA 5IS1A 5G18A 3OOVA 3LIEA 4L9GA 5CHUA 2EXAA 1BULA 3G30A 4O7DA 4UA7A 2HF6A 5EVIC 2VLGA 3GR2A 1RP5A 5HFOA 2J3WA 4KZAA 4UHUA 2B95A 3RXWA 2XROA 2W3GA 1VHMA 2M7UA 5TR7A 4OPZA 3MZEA 3BYDA 3BQAA 3ZDJA 1YKDA 3A3DA 5EOEA 1OTBA 2ZQDA 2V20A 1ES3A 5FI6A 3SH8A 4MNRA 1W8YA 1KE3A 2ZC4B 4H8RA 1KDSA 3QP4A 3A0VA 3MZFA 2WKEA 3EEAA 5AQBA 1QMFA 1HZOA 2ZQ9A 3C2WA 3CG5A 4N1XA 1PW8A 4GD8A 4FTXA 5F82A 4C3QA 1K56A 2C5WB 3QHYA 3VSKA 2Y2PA 4MN6A 4NETA 4JF5A 3MQ0A 5J4EA 1IYPA 5F1FA 3VSLA 3RFBA 3KSIA 3BQ8A 5TGFA 5TFQA 4DDSA 1YPRA 1FILA 5EECA 1L3LA 2ZM0A 4Q0HA 4KZ9A 2FFYA 1H5XA 4GS9B 3CUEC 1BSGA 4ESPA 2B5RA 4JGOA 3ZFZA 1NYMA 1T1CA 3FC7A 4DF6A 4BJPA 2W0NA 3D3OA 1Y54A 4QU3A 1KVMA 1YM1A 4G3KA 3S7NA 4G3WA 3S7QA 5L2FA 5FI7A 4RA7A 4GS9A 1PNEA 3E2KA 1OTAA 3O5YA 1FCNA 2O0YA 4GZBA 4MBKA 2HJEA 1KVLA 2HDUA 5FQMA 4JF4A 5F6AA 3LR5A 3N6IA 1TF1A 3IHBA 1NWZA 2WGIA 2XFTA 3GDIA 3UPOA 2XR0A 4KQDA 1SCWA 3OC2A 3L7HA 1K54A 4BD0A 2Z6DA 1K55A 3ITBA 3UO9A 5HAQA 3BW6A 4ZBEA 2OWHA 2DMWA 4S2MA 4PPRA 2Y59A 5HDSA 2IA2A 2J9PA 2EWWA 3E2LA 1FR6A 4DXBA 3MXSA 5DF8A 4PM6A 3T1SA 2Y55A 1UWNX 3VOZA 4X68A 4JKTA 4R3JA 3LR0A 5CTNA 1K38A 4YINA 2NUPC 3LY3A 3C8CA 4OQ0A 1OPXA 4XUXA 1BT5A 1T1BA 5GLBA 4K08A 1K6RA 3HLFA 5AVEA 4EUZA 3VMAA 2QYBA 1DY6A 5IHVA 4WF0A 4MN7A 3GRJA 4Y15A 4QJGA 5FEGA 4ZJ1A 3PTEA 1W8QA 4E3IA 4K91A 4PKYA 2VGLM 1CEGA 4E3NA 1PZOA 1YLWA 3BRMA 2XD5A 5E2HA 1ZTUA 3FWLA 4MMNA 4BL3A 3LIAA 2ZBBA 4MN5A 4S2JA 3ULFA 3K3CA 1T1AA 1NYYA 2W3FA 3NJAA 3AGDA 2LB9A 3PAGA 1D1JA 1ALQA 4NXEA 3QP6A 4I5SA 5FATA 3ZG9B 1FR1A 1LSVA 2W3EA 4D2OA 2Y2KA 4EW7A 5E2GA 4D60A 4KENB 3VFHA 2KOIA 1TDGA 3EOIA 4HQAA 4IVKA 5FSRA 4WUJA 2V0WA 3K3DA 1ZHHB 2ZC3B 2H0TA 1PWGA 1PZPA 2AVXA 4YWZA 4Y5FA 3FG8A 2QKPA 3PBRA 1XJ3A 2BTFP 2X71A 2JKTM 4GKUA 4IBRA 5FQQA 2QJ5A 2VJWA 4UA9A 3IF6C 4NG2A 2PD7A 4OOMA 1TDLA 3DBAA 1GA0A 1I5QA 3FZCA 4BWIA 5KIZA 3H7WA 5CX7A 4BBTA 1A0KA 1ACFA 3BM6A 1S4RA 4QHCA 4GNUA 3KYZA 4DE3A 2X01A 3IX8A 1WA9A 1OJGA 1BLHA 1XPBA 3TSGA 1P97A 2ZC6B 1W63M 4GHIA 2H5SA 3FV7A 5CGWA 3P7NA 3NDGA 3BEBA 3OBFA 4Q0IA 2EX2A 4DE1A 1CF0A 3UDXA 2YKHA 3RJUA 3A0SA 4GCZA 3EGXC 1LL9A 3MKFA 4BL2A 3LO7A 1W5DA 2P9VB 4IUKA 5J3WA 3TG9A 3MBZA 4WZ5C 1OT9A 3NI9A 3Q82A 3O3VA 5FASA 2I9VA 1M40A 2ZC5B 4PAUA 1S66L 3N4IA 1M6KA 4DRTA 1N9BA 3HUMA 4GOGA 2P9VA 2OWJA 4Q8IA 1PI5A 1SDEA 4WYYA 3OPPA 3CPTB 4ID4A 2ZL1B 4N1HA 1E4DA 2QWSA 4PM7A 4PM8A 4NEED 3BFFA 3HJIA 2W1TB 4MLLA 4U0TA 1YLYA 2A3UA 3IHAA 4BLMA 4HP9A 4HJ3A 1U60A 4OH0A 2V1AA 5M18A 3MR0A 1IYSA 4IBXA 3UN7A 3CPTA 2ZL1A 3GV9A 4JGQA 2J9OA 5KSCA 3G32A 4GB7A 2W1TA 2QMIA 2HGVA 4JF6A 3FKVA 2WUQA 4C75A 1LT0A 2IWCA 1ESUA 2UV0E 4P6ZS 2CMNA 1J9MA 2EFUA 4DDYA 4UQIS 5CXWA 3HJKA 2K7SA 3G31A 2Y2LA 2P74A 2JN7A 3LR3A 1EROA 4PHTA 3IXGA 2XGNA 3WS2A 2Y2GA 4R1GA 2XQZA 3G4PA 5CEDA 1LSWA 2XD1A 4QY5A 2PAVP 2JE5A 2VV7A 3S7PA 3GECA 1F9IA 1S0WA 3GTCA 2M1CA 3T4OA 4UEYA 4RX2A 4A5RA 3E98A 2Q9NA 3EQUA 4B4XA 4OP5A 4EXOA 4OPRA 3B3XA 4AFIA 1NXYA 1G6AA 5GL9A 1XFNA 1ZG4A 2PR5A 5HPIA 1IELA 4JGRA 3T4SA 3DTKA 2XH9A 4R23A 3WS5A 3DWZA 4LCMA 4WL9A 2J80A 5AQ7A 1S1ZA 3QNCA 5F5YA 4RQ9A 4HIAA 2L4RA 2XFSA 4DXCA 4EUVA 3MSHA 3UMEA 1YSPA 2KX6A 4WM9A 4Y3IA 1GHPA 4DKIA 1YSQA 5HX9A 3PXPA 1STZA 3V3RA 3IS2A 2DNSA 4CLCB 2JKRM 1H8ZA 1GCEA 5FAOA 5FQJA 1OTEA 1KGFA 5CRFA 3NY4A 1DJAA 2XA7S 5IT5A 1BZAA 4EERA 1BYWA 3BFCA 2FFFB 4HI4A 4CLCA 3UNWA 2ZMAA 1G28A 3OPLA 2VX8A 2M7VA 5FL3A 2PDRA 3OCNA 1HD8A 3GQZA 1JNUA 4JPMA 1PWDA 2OLVA 5EVLA 5HL1A 3A3JA 5GLAA 4R3AA 3O86A 4XT2B 3AGFA 2HP9A 4EWFA 3PBSA 1FOFA 5IU1A 1OMEA 1ZKJA 4EESA 1F98A 3C5AA 2Y4AA 5TBMB 2ZOIA 3WS4A 4XXRA 1NY0A 2Y2QA 1S6RA 4S2NC 4DE0A 1W63Q 2K2NA 2ZLYA 2XSSA 1KE4A 1NLYA 4X1MA 1ODVA 4CLCD 3A3FA 4E6XA 5TBMA 4ZDXA 5DF9A 2PYPA 4OQGA 1IKGA 3LI9A 3FPVA 1XA7A 3DW0A 2KLIA 3VE4A 1GSWA 5HL6A 5HW3A 3DTEA 1MZUA 3VP1A 1GSXA 3P98A 5CECA 4BD1A 5I5LA 3LIBA 3NBLA 3IWOA 3WS0A 4Y7PA 1O7EA 4LPZA 2W1RA 5GLCA 4DJ2A 3HCYA 1YMSA 5LBRA 5GHYA 4JXSA 5CGSA 4HEFA 3BFDA 1N9NA 2ZM2A 1MWSA 3SS3A 3T4TA 3SS5A 1D7EA 3IWIA 4O0PA 4X53A 1XA1A 1OT6A 1HLUP 3IT9A 4KQOA 2B18A 3L9KA 3NHQA 4UAAA 2C6WB 4G3VA 5HWTA 2W27A 2RCXA 2ZM8A 3RH8B 3KSFA 4I3IA 3NULA 4F3LB 1S4SA 1ONGA 3A0RA 3HLDA 2LB5A 5G4ZA 2Y79A 4BBVA 4S2LA 4FH4A 4EQIA 5L07A 4ETZA 3LICA 3CI6A 1DP8A 4CPKA 4Y13A 1SZVA 2XLNA 3CZDA 4EEPA 2Z2LB 2OAP1 4F3LA 2OLUA 1IYQA 1NRFA 3E0YA 1NZUA 5AJGA 2QZ6A 1TS6A 3H82B 5BOHA 3KO6A 3JVVA 3IXHA 3MS6A 3LR4A 1YLJA 5EE8A 2Z2MB 1VETB 2V9AA 4HJ6A 4DJ3A 1ONHA 2VA0A 4QY6A 2IWBA 2OV5A 1CEFA 3HUOA 4EETB 4OPQA 4B93A 2VZWA 3CLOA 2V8FA 5E2EA 1TS0A 1VETA 3G2YA 3LCEA 2D02A 5CHMA 1FSWA 3PBNA 5HWWA 2Q0OA 2EX6A 3Q7VB 4HH2A 1IKIA 1K54C 1Q2PA 3SW1A 4GN2A 1K55C 4EU0A 2WAFA 1ES4A 3SH9A 5DTSA 1BUEA 1XJ6A 3P01A 1Q2QA 3PBTA 2YKFA 3GVBA 2GNXA 5FI2A 3WRZA 5EVEA 4OVDA 4KUKA 2Y91A 3OPHA 1ZC2A 3Q7VA 2XRNA 5A8BA 1L0DA 3UMDA 4NXFA 1SHVA 4JBFA 4WEKA 2GX5A 1OTIA 3D72A 3M2KA 3IXBA 5HWVA 2PR6A 3ZHHA 4BBUA 3UY6A 1MPLA 4KZ8A 4F94A 1YLZA 1P0ZA 3LUQA 3A3IA 4E3MA 3HREA 4M3KA 4E3OA 5FAPA 4CJNA 2XA7M 2XF3A 4QD4A 1MWUA 3WRTA 4QB8A 3UDIA 2V8CA 1FSYA 4EQ1A 1KDWA 3NOUC 3Q81A 1BLSA 3P09A 1E3UA 2V1BA 2HPBA 5KSHA 4R4SA 4KG5A 4KQRA 2GDNA 4P85A 5U47A 4L0LA 4R4RA 3MKEA 1GA9A 1T18A 3T4JA 3MF0A 1KOUA 4Z9QA 1WYBA 4M4XA 1YLTA 3HLBA 3IX3A 2ZC7A 4Q0JA 1K57A 2L0WA 4C6YA 4FD8A 4NXGA 2J3TD 2EWVA 4KUOA 2O9AA 4KG6A 3U4LP 4II7A 2OSUA 1QMEA 5L09A 2JKFA 5DKLA 5FA7A 4K0XA 2PBDP 3W4QA 2L1MA 4GD6A 2OAQ1 4R70A 3D4FA 4X25A 4S2IA 3UB7A 3Q7ZA 3KSHA 1H3QA 3G2ZA 3ZG5A 2WKIA 3R4KA 1CK3A 2BLSA 2VGKA 5FDSA 1BLCA 1NLZA 5J8XA 1E3UD 2Q9MA 3DTMA 4O01A 1W7FA 1Y4OA 2R9WA 4JXGA 2A24B 1RCJA 1ZG6A 4MEZA 2EA9A 3ZVTA 3UE3A 5HD3A 5DFXA 1PWCA 2KDKA 2GZAA 1L2SA 4JXWA 4U0XA 3IBRA 5FQKA 2A24A 2JCHA 4OQIA 4WBGA 3WWXA 4ZJ2A 2G7UA 3VV4A 2HDQA 2WKPA 3E4PA 1TVFA 5A90A 4HJ4A 2H28A 3TE8A 4OLDA 2P7JA 1VM1A 4CLCE 4FUWA 1LLBA 1BTLA 2Y8HA 3CJMA 3H9WA 3HLGA 4OQHA 5DTKA 3VP2A 4QWOA 1SKFA 4X69A 1VQQA 1GHIA 2R9XA 1ES5A 4B4ZA 1Y28A 4LRYC 4EBLA 4DE2A 2FH5A 2JKGA 5EVIB 3UB9A 5F1GA 1CQAA 4L9EA 3ZG0A 4IUHA 4ETXA 3LEZA 3PR6A 5FQ9A 4LV0A 4KZ5A 1PRQA 2ACGA 1O07A 2PU2A 5EV0A 2ZD8A 5EVIA 1LI0A 4I38A 3MFDA 3VFFA 1F2KA 4OOYA 4N9KA 2VGLS 1RGZA 4B88A 3K2NA 3IBJA 3T1RA 1JTGA 5HD5A 3PHYA 2Y2IA 4LRZE 5AVFA 2Y2OA 3VE3A 5E43A 1MKMA 3MQQA 3GMWA 3M6BA 3EGDC 1K4FA 3OCLA 4OKPA 4LGWA 4I3JA 1K0KA 2WK0A 3MFXA 4GDNA 5DVAA 4Y0TA 1L0FA 5CEBA 3NC8A 3QP2A 1YT4A 3KX0X 1XP4A 2V2FF 1X0OA 1NRJA 3QP5A 5DKKA 2Y2JA 3M6HA 2GJ3A 4ME4A 3VOYA 1CJFA 1NJ4A 4IHQA 3C4OA 3N8RA 1F5MA 2PBYA 2XEPA 3IH9A 3IWQA 3O87A 4X55A 5A93A 3T50A 1GHMA 5A91A 1OJ5A 5JYPA 1JTDA 3CUEA 3SS4A 5EVID 3BLSA 5CHJA 2O9BA 2JKTI 4HNBA 3OZHA 5DJUA 3EQVA 2R78A 3LI8A 2ZJ9A 1G5UA 1LL8A 2HDSA 3BFEA 2WKHA 3UE1A 1SDNA 3HUNA 4KZ7A 5C5KA 3QP1A 3EEHA 4OONA 5DJTA 2Y2MA 1V9YA 3AGEA 4WELA 2VGJA 5KMWA 1MBLA 1MC0A 2EX9A 3LYXA 4CQHA 1AWIA 1ESIA 4XT2A 4N9LA 5CTMA 3BFGA 1NZOA 3CMZA 3HLEA 3LFVA 4X56A 3VP0A 4NKPA 1YLPA 4FOFA 3IH8A 2INWA 4UA6A 1KGGA 4LV1A 2QHKA 3NCKA 3FKWA 3G6OA 5G4YA 1J3WA 1JWPA 3W8KA 2HP6A 3ICYA 5DF7A 2W3HA 5TJJA 5HZHA 3ZG7B 4KZ3A 2VV6A 5DTTA 5FAQA 2V1ZA 3CAXA 3NDEA 4KZ4A 5HSQA 4CLCC 4PM5A 3C7VA 4LENA 2K31A 1AXBA 2ZMVA 3UB8A 4N92A 3C7UA 4GJ4A 5L10A 1K25A 3RXXA 4XUZA 2PD8A 5DFYA 3ISGA 2X02A 5HAIA 3OPRA 1PI4A 5CERA 5HPFA 5I94A 1G6OA 4EBNA 2J8YA 2O99A 1MWTA 1TS8A 1N9OA 1Z6FA 2WADA 3E4QA 3N8LA 4LLOB 1TS7A 3T1XA 5EUAA 4YOFA 1S67L 3B42A 3MMHA 3V50A 3BLMA 4I3AA 3BECA 2I72A 3CWFA 4HBTA 4WLAA 1OTDA 4BENA 5EPHA 1P9WA 1EW0A 4JXVA 1DP9A 1PW1A 2JHEA 4P6BA 5L8MA 4BQMA 1SKOB 2ZMFA 1VB6A 2P04A 1K56D 3BWLA 4Y0UA 2DCFA 3A3EA 2XK1A 3G34A 4P6ZM 3SZTA 4WMCA 3MJQA 2XDMA 5HAPA 4UQIM 2HZ5A 2WGVA 1G68A 1DP6A 3ZNTA 4R38A 3UPPA 3Q07A 1YAXA 1SKOA 4JGPA 1DJBA 3ZG8B 3N8SA 3HBRA 3IF6B 1KE0A 1LI9A 3ITAA 3MXQA 4U3TA 2WZZA 4ZJ3A 4R6LA 1LL5A 1XGIA 1V9ZA 4HBUA 2G2UA 3N7WA 4LRXC 5D3OA 3H82A 4S2PA 3FPWA 3W2ZA 2JBFA 3S4XA 1FQGA 3IF6A 5J7EA 2WAEA 5JYOA 4OPYA 1TD5A 4IJGA 4P87A 3HLCA 2WYXA 3R7WB 3T12B 3IXDA 5HARA 4QPRA 3C38A 1ERMA 1YQSA 2ZQCA 3B33A 3V5MA 1N4OA 2Z6CA 4HESA 1PIOA 4DN0A 4MBFA 3NOTC 3PAEA 1BLPA 4YNRA 2P08A 2J7VA 1IYOA 5M1AA 3OLOA 3C30A 1MXOA 3R7WA 2HJ9C 4WMCD 2Y2NA 4LFUA 1UGUA 2JKRI 4R0QA 4B9OA 3G35A 2ZQ7A 3DAVA 3SH7A 4ZAMA 4FH2A 3W4PA 1LHYA 1ES2A 1XX2A 4GLQA 1XJ2A 5M19A 3PBQA 2RL3A 4NK3A 2IWDA 4P0MA 3PYPA 4WZ5A 5KZHA 5K5BA 4MDZA 2E8JA 1H8YA 3NIAA 4X1LA 3BY8A 1KGEA 3W4OA 4IEDA 1UWPX 4E3LA 2G2WA 4E6WA 3T4LA 3MQOA 3BJNA 3UB6A 1XKZA 3H7WB 3I7JA 4S2KA 3VOLA 2D01A 1FCOA 3TRCA 1JWZA 3SOIA 3V67A 5F69A 1W79A 1DJCA 4EV4A 5EFWA 4RYEA 3RTYA 5A92A 1Z09A 3UPNA 3S22A 4FCFA 1EI5A 4ARZB 3O88A 1L0GA 2E8IA 3CHWP 4WZ4A 5AQAA 2JC7A 1XGJA 2PU4A 4RX3A 5EM1A 4GHIB 1D06A 3UDFA 3ZVWA 4JLFA 4Y17A 4H6JB 5GHZA 3LIFA 3U2AA 4O8GA 3S7OA 1HVBA 3C4PA 1PFLA 1K4EA 4LCLA 2DRWA 3TOIA 1H0MA 4Y0OA 1P9RA 4ZTKA 3IQAA 4ARZA 3TJZC 4KZBA 2EX8A 5E2FA 3M2JA 5EM0A 2WZXA 3KYEA 1JWVA 2J3TC 4H6JA 4KQQA 2ZQ8A 2PT7A 3B47A 3KYQA 1MY8A 2CC1A 1RGYA 1FCMA 2BG1A 3IX4A 3D9YA 3LGOA 1K6SA 3ZGAB 4LV3A 2B02A 1YMXA 3NOPC 2ZQAA 3MXRA 3HL9A 3EWKA 4ZRRA 1WE4A 2WGWB 4E3JA 4RVAA 3V3SA 4YFMA 2MJ6A 3ZNYA 5GHXA 2VK3A 3BY9A 1IEMA 2VV8A 1VEUB 2PRFA 4GW9A 3F1OB 3TW8A 1IOUA 2WGWA 5EOOA 1XFQA 3ZQ5A 3ZCZA 1T19A 4MBHA 1S1YA 4PKYG 1I2SA 1JVJA 2O9CA 4EEUA 1VEUA 4NXBA 3F1OA 2QJ7A 1K57C 3S1YA 4FSFA 3WS1A 3F1NB 3LIDA 3V39A 3T1QB 3T4QA 2HDRA 1DRMA
chains in the Genus database with same CATH topology
2O9BA 2W27A 4YWZA 4Y5FA 3FG8A 2JKTI 4HNBA 2QKPA 3PBRA 5DJUA 3RH8B 3EQVA 1XJ3A 2R78A 3LI8A 1IFQA 3KSFA 2JKTM 4I3IA 1H8MA 2QJ5A 2VJWA 5HDDA 4F3LB 1S4SA 2PD7A 1LL8A 4OOMA 3A0RA 3DBAA 2LB5A 5G4ZA 4HP4A 1LSXA 2Y79A 3F1NA 2PHYA 2PYRA 4BBVA 5C5KA 3EEHA 5DJTA 4BWIA 5KIZA 4ETZA 4DMZA 3LICA 3CI6A 5F68A 3H7WA 1DP8A 1V9YA 4I39A 5CX7A 3PBOA 4HHDA 4BBTA 1N9LA 4Z1WA 1GSVA 4EEPA 4WELA 1S4RA 4OOLA 2OAP1 3T4KA 3KYZA 4F3LA 1MC0A 2HV1A 3E0YA 3UE6A 5MC7A 1WA9A 4HY8A 5AJGA 2VEAA 3LYXA 4CQHA 1TS6A 1OJGA 3H82B 4XT2A 3KO6A 1P97A 2WKRA 1W63M 3JVVA 4GHIA 2WKQA 4HH3A 4E04A 3P7NA 2FZ0A 3LFVA 2V0UA 3LR4A 3OBFA 4Q0IA 4NKPA 2V9AA 4HJ6A 4FOFA 2INWA 4DJ3A 2VA0A 2YKHA 3A0SA 2QHKA 4GCZA 4Y2FA 3G6OA 4EETB 5G4YA 3EGXC 2BASA 4B93A 2NUTC 2VZWA 3ICYA 5TJJA 2W3HA 3CLOA 5HZHA 5J3WA 4IUKA 1TS0A 2VKSA 2VV6A 2ZOHA 4MCWA 3CAXA 1OT9A 2D02A 5HSQA 4CLCC 4BMWA 3PBNA 2I9VA 5HWWA 3F1PB 2K31A 2ZMVA 4HH2A 3UB8A 4PAUA 3SW1A 2A2LA 4EU0A 1S66L 2OOLA 3IS2B 4GJ4A 2OWJA 1XJ6A 3P01A 2PD8A 5DFYA 3PBTA 2YKFA 2W3DA 2GNXA 5HPFA 1G6OA 3JVUA 4WEJA 3F1PA 4KUKA 2QWSA 2O99A 3KSGA 2XRNA 5A8BA 1TS8A 1N9OA 4NEED 3UMDA 4NXFA 3HJIA 3E4QA 4WEKA 2W1TB 2GX5A 1OTIA 3D72A 1TS7A 4LLOB 4WN5A 4HP9A 4HJ3A 3ZYTA 5HWVA 1XJ4A 2PR6A 3E4OA 4YOFA 2V1AA 1S67L 3B42A 3MR0A 4HOIA 4BBUA 3MMHA 5HDCA 4JGQA 4I3AA 4L9FA 1P0ZA 3LUQA 3CWFA 3CITA 4WLAA 1OTDA 5IS1A 2XA7M 1P9WA 2W1TA 1EW0A 1DP9A 2HGVA 3OOVA 3LIEA 4L9GA 2JHEA 5L8MA 4EQ1A 2HF6A 3NOUC 1LT0A 2VLGA 2ZMFA 1VB6A 4P6ZS 2CMNA 2P04A 3BWLA 2V1BA 2J3WA 2XROA 4UQIS 2W3GA 3HJKA 2K7SA 5KSHA 1VHMA 2M7UA 2JN7A 3LR3A 4P6ZM 4PHTA 3MJQA 3BQAA 4UQIM 1YKDA 1DP6A 4L0LA 4R38A 1OTBA 1T18A 3T4JA 1YAXA 3MF0A 1KOUA 1LSWA 4JGPA 2VV7A 4M4XA 3S7PA 3GECA 1F9IA 3MXQA 2M1CA 3T4OA 4Q0JA 4UEYA 2L0WA 3E98A 4NXGA 2J3TD 4R6LA 2EWVA 4KUOA 2O9AA 3A0VA 1V9ZA 3EEAA 3EQUA 4II7A 4LRXC 4EXOA 3C2WA 3H82A 3FPWA 3W2ZA 5DKLA 4AFIA 1XFNA 5J7EA 2PR5A 4MN6A 5HPIA 1TD5A 3MQ0A 2L1MA 4JGRA 3T4SA 5J4EA 4IJGA 2OAQ1 4R70A 3R7WB 3RFBA 3KSIA 3BQ8A 4QPRA 4WL9A 2J80A 3UB7A 1S1ZA 3C38A 5F5YA 3KSHA 1H3QA 4RQ9A 4Q0HA 4HIAA 3R4KA 3B33A 4GS9B 3CUEC 2Z6CA 2L4RA 4JGOA 4DN0A 1NLZA 3NOTC 4YNRA 2P08A 4EUVA 4O01A 1T1CA 3UMEA 3FC7A 2A24B 1YSPA 3C30A 3OLOA 3R7WA 2HJ9C 2KX6A 4BJPA 2W0NA 2EA9A 4Y3IA 3UE3A 5HD3A 3D3OA 5DFXA 1YSQA 4G3KA 3S7NA 4G3WA 3S7QA 1UGUA 2JKRI 3PXPA 1STZA 2KDKA 2GZAA 4B9OA 3IS2A 4GS9A 4CLCB 2JKRM 1OTAA 3O5YA 3IBRA 2O0YA 2HJEA 1OTEA 2A24A 4GLQA 3LR5A 5F6AA 2XA7S 1TF1A 1XJ2A 5IT5A 1NWZA 3PBQA 4EERA 2G7UA 3VV4A 1BYWA 2WKPA 3E4PA 3PYPA 4HI4A 3GDIA 4KQDA 3OC2A 5K5BA 4CLCA 4HJ4A 2H28A 4MDZA 3TE8A 1G28A 2P7JA 2VX8A 4CLCE 2M7VA 3BY8A 2Z6DA 5FL3A 1UWPX 2PDRA 3T4LA 2Y8HA 3OCNA 3MQOA 3BJNA 3H9WA 3BW6A 3UB6A 3H7WB 1JNUA 3VOLA 2D01A 2OWHA 3TRCA 3V67A 2DMWA 5F69A 5EFWA 3RTYA 5HDSA 2IA2A 4R3AA 4ARZB 4XT2B 2EWWA 1Y28A 4GHIB 4LRYC 1D06A 2FH5A 3PBSA 4H6JB 3UB9A 3LIFA 5IU1A 3U2AA 4L9EA 1UWNX 4O8GA 3S7OA 4EESA 3LR0A 1F98A 2NUPC 1P9RA 4IUHA 3C8CA 1OPXA 4ARZA 3TJZC 3PR6A 4ETXA 5TBMB 1T1BA 2ZOIA 4K08A 1W63Q 2J3TC 4H6JA 2K2NA 5AVEA 2XSSA 4I38A 1NLYA 2QYBA 2PT7A 3B47A 3KYQA 4WF0A 4MN7A 2VGLS 3K2NA 3IBJA 1ODVA 4CLCD 5TBMA 5DF9A 5HD5A 3PHYA 4PKYA 2VGLM 4LRZE 2PYPA 5AVFA 3VE3A 1MKMA 3LI9A 3FPVA 3MQQA 3EGDC 2B02A 2KLIA 3VE4A 3OCLA 1GSWA 1ZTUA 3NOPC 5HL6A 3EWKA 4ZRRA 4MMNA 4I3JA 1MZUA 3LIAA 2ZBBA 4MN5A 3ULFA 1GSXA 3K3CA 1T1AA 2MJ6A 3MFXA 2W3FA 5I5LA 3LIBA 3BY9A 3NJAA 2LB9A 2VV8A 3KX0X 4GW9A 3F1OB 4LPZA 2W1RA 4NXEA 3TW8A 1X0OA 4I5SA 1IOUA 4DJ2A 3HCYA 1NRJA 5LBRA 5DKKA 1XFQA 3ZQ5A 1T19A 1LSVA 2GJ3A 2W3EA 1N9NA 1S1YA 4ME4A 4PKYG 3T4TA 4EW7A 4IHQA 1F5MA 2O9CA 1D7EA 2KOIA 3EOIA 4HQAA 4EEUA 4O0PA 3T50A 1OT6A 4NXBA 3F1OA 2QJ7A 4WUJA 4FSFA 1OJ5A 2V0WA 3F1NB 2B18A 3LIDA 4KQOA 3K3DA 3CUEA 1ZHHB 3NHQA 3T4QA 4G3VA 5HWTA 1DRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V67 A; 
#chains in the Genus database with same CATH topology
 1C3B A;  1HTZ A;  1IFQ A;  1H8M A;  5HDD A;  5F83 A;  3JYI A;  4EBP A;  3VP3 A;  4HP4 A;  1LSX A;  4X6T A;  3NEC A;  3F1N A;  2PHY A;  2PYR A;  1ERQ A;  5FQI A;  3QP8 A;  4DMZ A;  4OP8 A;  5F68 A;  3VP4 A;  1XXM A;  3Q1F A;  4I39 A;  3PBO A;  4HHD A;  2UWX A;  1N9L A;  4Z1W A;  1GSV A;  4OOL A;  3T4K A;  2HV1 A;  3LY4 A;  3UE6 A;  5MC7 A;  4HY8 A;  2VEA A;  1WYC A;  4PMA A;  1E25 A;  3DTI A;  2WKR A;  4IVI A;  4LV2 A;  1MWR A;  2WKQ A;  4HH3 A;  3FYZ A;  4E04 A;  2FZ0 A;  2V0U A;  3DWK A;  2A49 A;  1PYY A;  1FIK A;  5FDH A;  3IF5 A;  3HVF A;  4Y2F A;  2BAS A;  3UE0 A;  1EWZ A;  2NUT C;  4E3K A;  2QPN A;  1CI8 A;  3JPU A;  3HLW A;  1L0E A;  4OLG A;  2VKS A;  4KG2 A;  2H10 A;  3LEQ A;  2EXB A;  2ZOH A;  4MCW A;  1I2W A;  2Y2H A;  4BMW A;  3GSG A;  3F1P B;  3UB5 P;  2A2L A;  5GLD A;  5FEF A;  2OOL A;  3MZD A;  3IS2 B;  1TEM A;  2EFX A;  4K0W A;  1CI9 A;  2W3D A;  4GDB A;  2H0Y A;  4S2N A;  5AQ9 A;  3JVU A;  4WEJ A;  3F1P A;  3KSG A;  4S2O A;  2HP5 A;  1MKI A;  4WN5 A;  4R3B A;  5CGX A;  4PM9 A;  3ZYT A;  1XJ4 A;  3E4O A;  4HOI A;  4KZ6 A;  5HDC A;  3QNB A;  4L9F A;  3CIT A;  5IS1 A;  5G18 A;  3OOV A;  3LIE A;  4L9G A;  5CHU A;  2EXA A;  1BUL A;  3G30 A;  4O7D A;  4UA7 A;  2HF6 A;  5EVI C;  2VLG A;  3GR2 A;  1RP5 A;  5HFO A;  2J3W A;  4KZA A;  4UHU A;  2B95 A;  3RXW A;  2XRO A;  2W3G A;  1VHM A;  2M7U A;  5TR7 A;  4OPZ A;  3MZE A;  3BYD A;  3BQA A;  3ZDJ A;  1YKD A;  3A3D A;  5EOE A;  1OTB A;  2ZQD A;  2V20 A;  1ES3 A;  5FI6 A;  3SH8 A;  4MNR A;  1W8Y A;  1KE3 A;  2ZC4 B;  4H8R A;  1KDS A;  3QP4 A;  3A0V A;  3MZF A;  2WKE A;  3EEA A;  5AQB A;  1QMF A;  1HZO A;  2ZQ9 A;  3C2W A;  3CG5 A;  4N1X A;  1PW8 A;  4GD8 A;  4FTX A;  5F82 A;  4C3Q A;  1K56 A;  2C5W B;  3QHY A;  3VSK A;  2Y2P A;  4MN6 A;  4NET A;  4JF5 A;  3MQ0 A;  5J4E A;  1IYP A;  5F1F A;  3VSL A;  3RFB A;  3KSI A;  3BQ8 A;  5TGF A;  5TFQ A;  4DDS A;  1YPR A;  1FIL A;  5EEC A;  1L3L A;  2ZM0 A;  4Q0H A;  4KZ9 A;  2FFY A;  1H5X A;  4GS9 B;  3CUE C;  1BSG A;  4ESP A;  2B5R A;  4JGO A;  3ZFZ A;  1NYM A;  1T1C A;  3FC7 A;  4DF6 A;  4BJP A;  2W0N A;  3D3O A;  1Y54 A;  4QU3 A;  1KVM A;  1YM1 A;  4G3K A;  3S7N A;  4G3W A;  3S7Q A;  5L2F A;  5FI7 A;  4RA7 A;  4GS9 A;  1PNE A;  3E2K A;  1OTA A;  3O5Y A;  1FCN A;  2O0Y A;  4GZB A;  4MBK A;  2HJE A;  1KVL A;  2HDU A;  5FQM A;  4JF4 A;  5F6A A;  3LR5 A;  3N6I A;  1TF1 A;  3IHB A;  1NWZ A;  2WGI A;  2XFT A;  3GDI A;  3UPO A;  2XR0 A;  4KQD A;  1SCW A;  3OC2 A;  3L7H A;  1K54 A;  4BD0 A;  2Z6D A;  1K55 A;  3ITB A;  3UO9 A;  5HAQ A;  3BW6 A;  4ZBE A;  2OWH A;  2DMW A;  4S2M A;  4PPR A;  2Y59 A;  5HDS A;  2IA2 A;  2J9P A;  2EWW A;  3E2L A;  1FR6 A;  4DXB A;  3MXS A;  5DF8 A;  4PM6 A;  3T1S A;  2Y55 A;  1UWN X;  3VOZ A;  4X68 A;  4JKT A;  4R3J A;  3LR0 A;  5CTN A;  1K38 A;  4YIN A;  2NUP C;  3LY3 A;  3C8C A;  4OQ0 A;  1OPX A;  4XUX A;  1BT5 A;  1T1B A;  5GLB A;  4K08 A;  1K6R A;  3HLF A;  5AVE A;  4EUZ A;  3VMA A;  2QYB A;  1DY6 A;  5IHV A;  4WF0 A;  4MN7 A;  3GRJ A;  4Y15 A;  4QJG A;  5FEG A;  4ZJ1 A;  3PTE A;  1W8Q A;  4E3I A;  4K91 A;  4PKY A;  2VGL M;  1CEG A;  4E3N A;  1PZO A;  1YLW A;  3BRM A;  2XD5 A;  5E2H A;  1ZTU A;  3FWL A;  4MMN A;  4BL3 A;  3LIA A;  2ZBB A;  4MN5 A;  4S2J A;  3ULF A;  3K3C A;  1T1A A;  1NYY A;  2W3F A;  3NJA A;  3AGD A;  2LB9 A;  3PAG A;  1D1J A;  1ALQ A;  4NXE A;  3QP6 A;  4I5S A;  5FAT A;  3ZG9 B;  1FR1 A;  1LSV A;  2W3E A;  4D2O A;  2Y2K A;  4EW7 A;  5E2G A;  4D60 A;  4KEN B;  3VFH A;  2KOI A;  1TDG A;  3EOI A;  4HQA A;  4IVK A;  5FSR A;  4WUJ A;  2V0W A;  3K3D A;  1ZHH B;  2ZC3 B;  2H0T A;  1PWG A;  1PZP A;  2AVX A;  4YWZ A;  4Y5F A;  3FG8 A;  2QKP A;  3PBR A;  1XJ3 A;  2BTF P;  2X71 A;  2JKT M;  4GKU A;  4IBR A;  5FQQ A;  2QJ5 A;  2VJW A;  4UA9 A;  3IF6 C;  4NG2 A;  2PD7 A;  4OOM A;  1TDL A;  3DBA A;  1GA0 A;  1I5Q A;  3FZC A;  4BWI A;  5KIZ A;  3H7W A;  5CX7 A;  4BBT A;  1A0K A;  1ACF A;  3BM6 A;  1S4R A;  4QHC A;  4GNU A;  3KYZ A;  4DE3 A;  2X01 A;  3IX8 A;  1WA9 A;  1OJG A;  1BLH A;  1XPB A;  3TSG A;  1P97 A;  2ZC6 B;  1W63 M;  4GHI A;  2H5S A;  3FV7 A;  5CGW A;  3P7N A;  3NDG A;  3BEB A;  3OBF A;  4Q0I A;  2EX2 A;  4DE1 A;  1CF0 A;  3UDX A;  2YKH A;  3RJU A;  3A0S A;  4GCZ A;  3EGX C;  1LL9 A;  3MKF A;  4BL2 A;  3LO7 A;  1W5D A;  2P9V B;  4IUK A;  5J3W A;  3TG9 A;  3MBZ A;  4WZ5 C;  1OT9 A;  3NI9 A;  3Q82 A;  3O3V A;  5FAS A;  2I9V A;  1M40 A;  2ZC5 B;  4PAU A;  1S66 L;  3N4I A;  1M6K A;  4DRT A;  1N9B A;  3HUM A;  4GOG A;  2P9V A;  2OWJ A;  4Q8I A;  1PI5 A;  1SDE A;  4WYY A;  3OPP A;  3CPT B;  4ID4 A;  2ZL1 B;  4N1H A;  1E4D A;  2QWS A;  4PM7 A;  4PM8 A;  4NEE D;  3BFF A;  3HJI A;  2W1T B;  4MLL A;  4U0T A;  1YLY A;  2A3U A;  3IHA A;  4BLM A;  4HP9 A;  4HJ3 A;  1U60 A;  4OH0 A;  2V1A A;  5M18 A;  3MR0 A;  1IYS A;  4IBX A;  3UN7 A;  3CPT A;  2ZL1 A;  3GV9 A;  4JGQ A;  2J9O A;  5KSC A;  3G32 A;  4GB7 A;  2W1T A;  2QMI A;  2HGV A;  4JF6 A;  3FKV A;  2WUQ A;  4C75 A;  1LT0 A;  2IWC A;  1ESU A;  2UV0 E;  4P6Z S;  2CMN A;  1J9M A;  2EFU A;  4DDY A;  4UQI S;  5CXW A;  3HJK A;  2K7S A;  3G31 A;  2Y2L A;  2P74 A;  2JN7 A;  3LR3 A;  1ERO A;  4PHT A;  3IXG A;  2XGN A;  3WS2 A;  2Y2G A;  4R1G A;  2XQZ A;  3G4P A;  5CED A;  1LSW A;  2XD1 A;  4QY5 A;  2PAV P;  2JE5 A;  2VV7 A;  3S7P A;  3GEC A;  1F9I A;  1S0W A;  3GTC A;  2M1C A;  3T4O A;  4UEY A;  4RX2 A;  4A5R A;  3E98 A;  2Q9N A;  3EQU A;  4B4X A;  4OP5 A;  4EXO A;  4OPR A;  3B3X A;  4AFI A;  1NXY A;  1G6A A;  5GL9 A;  1XFN A;  1ZG4 A;  2PR5 A;  5HPI A;  1IEL A;  4JGR A;  3T4S A;  3DTK A;  2XH9 A;  4R23 A;  3WS5 A;  3DWZ A;  4LCM A;  4WL9 A;  2J80 A;  5AQ7 A;  1S1Z A;  3QNC A;  5F5Y A;  4RQ9 A;  4HIA A;  2L4R A;  2XFS A;  4DXC A;  4EUV A;  3MSH A;  3UME A;  1YSP A;  2KX6 A;  4WM9 A;  4Y3I A;  1GHP A;  4DKI A;  1YSQ A;  5HX9 A;  3PXP A;  1STZ A;  3V3R A;  3IS2 A;  2DNS A;  4CLC B;  2JKR M;  1H8Z A;  1GCE A;  5FAO A;  5FQJ A;  1OTE A;  1KGF A;  5CRF A;  3NY4 A;  1DJA A;  2XA7 S;  5IT5 A;  1BZA A;  4EER A;  1BYW A;  3BFC A;  2FFF B;  4HI4 A;  4CLC A;  3UNW A;  2ZMA A;  1G28 A;  3OPL A;  2VX8 A;  2M7V A;  5FL3 A;  2PDR A;  3OCN A;  1HD8 A;  3GQZ A;  1JNU A;  4JPM A;  1PWD A;  2OLV A;  5EVL A;  5HL1 A;  3A3J A;  5GLA A;  4R3A A;  3O86 A;  4XT2 B;  3AGF A;  2HP9 A;  4EWF A;  3PBS A;  1FOF A;  5IU1 A;  1OME A;  1ZKJ A;  4EES A;  1F98 A;  3C5A A;  2Y4A A;  5TBM B;  2ZOI A;  3WS4 A;  4XXR A;  1NY0 A;  2Y2Q A;  1S6R A;  4S2N C;  4DE0 A;  1W63 Q;  2K2N A;  2ZLY A;  2XSS A;  1KE4 A;  1NLY A;  4X1M A;  1ODV A;  4CLC D;  3A3F A;  4E6X A;  5TBM A;  4ZDX A;  5DF9 A;  2PYP A;  4OQG A;  1IKG A;  3LI9 A;  3FPV A;  1XA7 A;  3DW0 A;  2KLI A;  3VE4 A;  1GSW A;  5HL6 A;  5HW3 A;  3DTE A;  1MZU A;  3VP1 A;  1GSX A;  3P98 A;  5CEC A;  4BD1 A;  5I5L A;  3LIB A;  3NBL A;  3IWO A;  3WS0 A;  4Y7P A;  1O7E A;  4LPZ A;  2W1R A;  5GLC A;  4DJ2 A;  3HCY A;  1YMS A;  5LBR A;  5GHY A;  4JXS A;  5CGS A;  4HEF A;  3BFD A;  1N9N A;  2ZM2 A;  1MWS A;  3SS3 A;  3T4T A;  3SS5 A;  1D7E A;  3IWI A;  4O0P A;  4X53 A;  1XA1 A;  1OT6 A;  1HLU P;  3IT9 A;  4KQO A;  2B18 A;  3L9K A;  3NHQ A;  4UAA A;  2C6W B;  4G3V A;  5HWT A;  2W27 A;  2RCX A;  2ZM8 A;  3RH8 B;  3KSF A;  4I3I A;  3NUL A;  4F3L B;  1S4S A;  1ONG A;  3A0R A;  3HLD A;  2LB5 A;  5G4Z A;  2Y79 A;  4BBV A;  4S2L A;  4FH4 A;  4EQI A;  5L07 A;  4ETZ A;  3LIC A;  3CI6 A;  1DP8 A;  4CPK A;  4Y13 A;  1SZV A;  2XLN A;  3CZD A;  4EEP A;  2Z2L B;  2OAP 1;  4F3L A;  2OLU A;  1IYQ A;  1NRF A;  3E0Y A;  1NZU A;  5AJG A;  2QZ6 A;  1TS6 A;  3H82 B;  5BOH A;  3KO6 A;  3JVV A;  3IXH A;  3MS6 A;  3LR4 A;  1YLJ A;  5EE8 A;  2Z2M B;  1VET B;  2V9A A;  4HJ6 A;  4DJ3 A;  1ONH A;  2VA0 A;  4QY6 A;  2IWB A;  2OV5 A;  1CEF A;  3HUO A;  4EET B;  4OPQ A;  4B93 A;  2VZW A;  3CLO A;  2V8F A;  5E2E A;  1TS0 A;  1VET A;  3G2Y A;  3LCE A;  2D02 A;  5CHM A;  1FSW A;  3PBN A;  5HWW A;  2Q0O A;  2EX6 A;  3Q7V B;  4HH2 A;  1IKI A;  1K54 C;  1Q2P A;  3SW1 A;  4GN2 A;  1K55 C;  4EU0 A;  2WAF A;  1ES4 A;  3SH9 A;  5DTS A;  1BUE A;  1XJ6 A;  3P01 A;  1Q2Q A;  3PBT A;  2YKF A;  3GVB A;  2GNX A;  5FI2 A;  3WRZ A;  5EVE A;  4OVD A;  4KUK A;  2Y91 A;  3OPH A;  1ZC2 A;  3Q7V A;  2XRN A;  5A8B A;  1L0D A;  3UMD A;  4NXF A;  1SHV A;  4JBF A;  4WEK A;  2GX5 A;  1OTI A;  3D72 A;  3M2K A;  3IXB A;  5HWV A;  2PR6 A;  3ZHH A;  4BBU A;  3UY6 A;  1MPL A;  4KZ8 A;  4F94 A;  1YLZ A;  1P0Z A;  3LUQ A;  3A3I A;  4E3M A;  3HRE A;  4M3K A;  4E3O A;  5FAP A;  4CJN A;  2XA7 M;  2XF3 A;  4QD4 A;  1MWU A;  3WRT A;  4QB8 A;  3UDI A;  2V8C A;  1FSY A;  4EQ1 A;  1KDW A;  3NOU C;  3Q81 A;  1BLS A;  3P09 A;  1E3U A;  2V1B A;  2HPB A;  5KSH A;  4R4S A;  4KG5 A;  4KQR A;  2GDN A;  4P85 A;  5U47 A;  4L0L A;  4R4R A;  3MKE A;  1GA9 A;  1T18 A;  3T4J A;  3MF0 A;  1KOU A;  4Z9Q A;  1WYB A;  4M4X A;  1YLT A;  3HLB A;  3IX3 A;  2ZC7 A;  4Q0J A;  1K57 A;  2L0W A;  4C6Y A;  4FD8 A;  4NXG A;  2J3T D;  2EWV A;  4KUO A;  2O9A A;  4KG6 A;  3U4L P;  4II7 A;  2OSU A;  1QME A;  5L09 A;  2JKF A;  5DKL A;  5FA7 A;  4K0X A;  2PBD P;  3W4Q A;  2L1M A;  4GD6 A;  2OAQ 1;  4R70 A;  3D4F A;  4X25 A;  4S2I A;  3UB7 A;  3Q7Z A;  3KSH A;  1H3Q A;  3G2Z A;  3ZG5 A;  2WKI A;  3R4K A;  1CK3 A;  2BLS A;  2VGK A;  5FDS A;  1BLC A;  1NLZ A;  5J8X A;  1E3U D;  2Q9M A;  3DTM A;  4O01 A;  1W7F A;  1Y4O A;  2R9W A;  4JXG A;  2A24 B;  1RCJ A;  1ZG6 A;  4MEZ A;  2EA9 A;  3ZVT A;  3UE3 A;  5HD3 A;  5DFX A;  1PWC A;  2KDK A;  2GZA A;  1L2S A;  4JXW A;  4U0X A;  3IBR A;  5FQK A;  2A24 A;  2JCH A;  4OQI A;  4WBG A;  3WWX A;  4ZJ2 A;  2G7U A;  3VV4 A;  2HDQ A;  2WKP A;  3E4P A;  1TVF A;  5A90 A;  4HJ4 A;  2H28 A;  3TE8 A;  4OLD A;  2P7J A;  1VM1 A;  4CLC E;  4FUW A;  1LLB A;  1BTL A;  2Y8H A;  3CJM A;  3H9W A;  3HLG A;  4OQH A;  5DTK A;  3VP2 A;  4QWO A;  1SKF A;  4X69 A;  1VQQ A;  1GHI A;  2R9X A;  1ES5 A;  4B4Z A;  1Y28 A;  4LRY C;  4EBL A;  4DE2 A;  2FH5 A;  2JKG A;  5EVI B;  3UB9 A;  5F1G A;  1CQA A;  4L9E A;  3ZG0 A;  4IUH A;  4ETX A;  3LEZ A;  3PR6 A;  5FQ9 A;  4LV0 A;  4KZ5 A;  1PRQ A;  2ACG A;  1O07 A;  2PU2 A;  5EV0 A;  2ZD8 A;  5EVI A;  1LI0 A;  4I38 A;  3MFD A;  3VFF A;  1F2K A;  4OOY A;  4N9K A;  2VGL S;  1RGZ A;  4B88 A;  3K2N A;  3IBJ A;  3T1R A;  1JTG A;  5HD5 A;  3PHY A;  2Y2I A;  4LRZ E;  5AVF A;  2Y2O A;  3VE3 A;  5E43 A;  1MKM A;  3MQQ A;  3GMW A;  3M6B A;  3EGD C;  1K4F A;  3OCL A;  4OKP A;  4LGW A;  4I3J A;  1K0K A;  2WK0 A;  3MFX A;  4GDN A;  5DVA A;  4Y0T A;  1L0F A;  5CEB A;  3NC8 A;  3QP2 A;  1YT4 A;  3KX0 X;  1XP4 A;  2V2F F;  1X0O A;  1NRJ A;  3QP5 A;  5DKK A;  2Y2J A;  3M6H A;  2GJ3 A;  4ME4 A;  3VOY A;  1CJF A;  1NJ4 A;  4IHQ A;  3C4O A;  3N8R A;  1F5M A;  2PBY A;  2XEP A;  3IH9 A;  3IWQ A;  3O87 A;  4X55 A;  5A93 A;  3T50 A;  1GHM A;  5A91 A;  1OJ5 A;  5JYP A;  1JTD A;  3CUE A;  3SS4 A;  5EVI D;  3BLS A;  5CHJ A;  2O9B A;  2JKT I;  4HNB A;  3OZH A;  5DJU A;  3EQV A;  2R78 A;  3LI8 A;  2ZJ9 A;  1G5U A;  1LL8 A;  2HDS A;  3BFE A;  2WKH A;  3UE1 A;  1SDN A;  3HUN A;  4KZ7 A;  5C5K A;  3QP1 A;  3EEH A;  4OON A;  5DJT A;  2Y2M A;  1V9Y A;  3AGE A;  4WEL A;  2VGJ A;  5KMW A;  1MBL A;  1MC0 A;  2EX9 A;  3LYX A;  4CQH A;  1AWI A;  1ESI A;  4XT2 A;  4N9L A;  5CTM A;  3BFG A;  1NZO A;  3CMZ A;  3HLE A;  3LFV A;  4X56 A;  3VP0 A;  4NKP A;  1YLP A;  4FOF A;  3IH8 A;  2INW A;  4UA6 A;  1KGG A;  4LV1 A;  2QHK A;  3NCK A;  3FKW A;  3G6O A;  5G4Y A;  1J3W A;  1JWP A;  3W8K A;  2HP6 A;  3ICY A;  5DF7 A;  2W3H A;  5TJJ A;  5HZH A;  3ZG7 B;  4KZ3 A;  2VV6 A;  5DTT A;  5FAQ A;  2V1Z A;  3CAX A;  3NDE A;  4KZ4 A;  5HSQ A;  4CLC C;  4PM5 A;  3C7V A;  4LEN A;  2K31 A;  1AXB A;  2ZMV A;  3UB8 A;  4N92 A;  3C7U A;  4GJ4 A;  5L10 A;  1K25 A;  3RXX A;  4XUZ A;  2PD8 A;  5DFY A;  3ISG A;  2X02 A;  5HAI A;  3OPR A;  1PI4 A;  5CER A;  5HPF A;  5I94 A;  1G6O A;  4EBN A;  2J8Y A;  2O99 A;  1MWT A;  1TS8 A;  1N9O A;  1Z6F A;  2WAD A;  3E4Q A;  3N8L A;  4LLO B;  1TS7 A;  3T1X A;  5EUA A;  4YOF A;  1S67 L;  3B42 A;  3MMH A;  3V50 A;  3BLM A;  4I3A A;  3BEC A;  2I72 A;  3CWF A;  4HBT A;  4WLA A;  1OTD A;  4BEN A;  5EPH A;  1P9W A;  1EW0 A;  4JXV A;  1DP9 A;  1PW1 A;  2JHE A;  4P6B A;  5L8M A;  4BQM A;  1SKO B;  2ZMF A;  1VB6 A;  2P04 A;  1K56 D;  3BWL A;  4Y0U A;  2DCF A;  3A3E A;  2XK1 A;  3G34 A;  4P6Z M;  3SZT A;  4WMC A;  3MJQ A;  2XDM A;  5HAP A;  4UQI M;  2HZ5 A;  2WGV A;  1G68 A;  1DP6 A;  3ZNT A;  4R38 A;  3UPP A;  3Q07 A;  1YAX A;  1SKO A;  4JGP A;  1DJB A;  3ZG8 B;  3N8S A;  3HBR A;  3IF6 B;  1KE0 A;  1LI9 A;  3ITA A;  3MXQ A;  4U3T A;  2WZZ A;  4ZJ3 A;  4R6L A;  1LL5 A;  1XGI A;  1V9Z A;  4HBU A;  2G2U A;  3N7W A;  4LRX C;  5D3O A;  3H82 A;  4S2P A;  3FPW A;  3W2Z A;  2JBF A;  3S4X A;  1FQG A;  3IF6 A;  5J7E A;  2WAE A;  5JYO A;  4OPY A;  1TD5 A;  4IJG A;  4P87 A;  3HLC A;  2WYX A;  3R7W B;  3T12 B;  3IXD A;  5HAR A;  4QPR A;  3C38 A;  1ERM A;  1YQS A;  2ZQC A;  3B33 A;  3V5M A;  1N4O A;  2Z6C A;  4HES A;  1PIO A;  4DN0 A;  4MBF A;  3NOT C;  3PAE A;  1BLP A;  4YNR A;  2P08 A;  2J7V A;  1IYO A;  5M1A A;  3OLO A;  3C30 A;  1MXO A;  3R7W A;  2HJ9 C;  4WMC D;  2Y2N A;  4LFU A;  1UGU A;  2JKR I;  4R0Q A;  4B9O A;  3G35 A;  2ZQ7 A;  3DAV A;  3SH7 A;  4ZAM A;  4FH2 A;  3W4P A;  1LHY A;  1ES2 A;  1XX2 A;  4GLQ A;  1XJ2 A;  5M19 A;  3PBQ A;  2RL3 A;  4NK3 A;  2IWD A;  4P0M A;  3PYP A;  4WZ5 A;  5KZH A;  5K5B A;  4MDZ A;  2E8J A;  1H8Y A;  3NIA A;  4X1L A;  3BY8 A;  1KGE A;  3W4O A;  4IED A;  1UWP X;  4E3L A;  2G2W A;  4E6W A;  3T4L A;  3MQO A;  3BJN A;  3UB6 A;  1XKZ A;  3H7W B;  3I7J A;  4S2K A;  3VOL A;  2D01 A;  1FCO A;  3TRC A;  1JWZ A;  3SOI A;  3V67 A;  5F69 A;  1W79 A;  1DJC A;  4EV4 A;  5EFW A;  4RYE A;  3RTY A;  5A92 A;  1Z09 A;  3UPN A;  3S22 A;  4FCF A;  1EI5 A;  4ARZ B;  3O88 A;  1L0G A;  2E8I A;  3CHW P;  4WZ4 A;  5AQA A;  2JC7 A;  1XGJ A;  2PU4 A;  4RX3 A;  5EM1 A;  4GHI B;  1D06 A;  3UDF A;  3ZVW A;  4JLF A;  4Y17 A;  4H6J B;  5GHZ A;  3LIF A;  3U2A A;  4O8G A;  3S7O A;  1HVB A;  3C4P A;  1PFL A;  1K4E A;  4LCL A;  2DRW A;  3TOI A;  1H0M A;  4Y0O A;  1P9R A;  4ZTK A;  3IQA A;  4ARZ A;  3TJZ C;  4KZB A;  2EX8 A;  5E2F A;  3M2J A;  5EM0 A;  2WZX A;  3KYE A;  1JWV A;  2J3T C;  4H6J A;  4KQQ A;  2ZQ8 A;  2PT7 A;  3B47 A;  3KYQ A;  1MY8 A;  2CC1 A;  1RGY A;  1FCM A;  2BG1 A;  3IX4 A;  3D9Y A;  3LGO A;  1K6S A;  3ZGA B;  4LV3 A;  2B02 A;  1YMX A;  3NOP C;  2ZQA A;  3MXR A;  3HL9 A;  3EWK A;  4ZRR A;  1WE4 A;  2WGW B;  4E3J A;  4RVA A;  3V3S A;  4YFM A;  2MJ6 A;  3ZNY A;  5GHX A;  2VK3 A;  3BY9 A;  1IEM A;  2VV8 A;  1VEU B;  2PRF A;  4GW9 A;  3F1O B;  3TW8 A;  1IOU A;  2WGW A;  5EOO A;  1XFQ A;  3ZQ5 A;  3ZCZ A;  1T19 A;  4MBH A;  1S1Y A;  4PKY G;  1I2S A;  1JVJ A;  2O9C A;  4EEU A;  1VEU A;  4NXB A;  3F1O A;  2QJ7 A;  1K57 C;  3S1Y A;  4FSF A;  3WS1 A;  3F1N B;  3LID A;  3V39 A;  3T1Q B;  3T4Q A;  2HDR A;  1DRM A; 
#chains in the Genus database with same CATH homology
 2O9B A;  2W27 A;  4YWZ A;  4Y5F A;  3FG8 A;  2JKT I;  4HNB A;  2QKP A;  3PBR A;  5DJU A;  3RH8 B;  3EQV A;  1XJ3 A;  2R78 A;  3LI8 A;  1IFQ A;  3KSF A;  2JKT M;  4I3I A;  1H8M A;  2QJ5 A;  2VJW A;  5HDD A;  4F3L B;  1S4S A;  2PD7 A;  1LL8 A;  4OOM A;  3A0R A;  3DBA A;  2LB5 A;  5G4Z A;  4HP4 A;  1LSX A;  2Y79 A;  3F1N A;  2PHY A;  2PYR A;  4BBV A;  5C5K A;  3EEH A;  5DJT A;  4BWI A;  5KIZ A;  4ETZ A;  4DMZ A;  3LIC A;  3CI6 A;  5F68 A;  3H7W A;  1DP8 A;  1V9Y A;  4I39 A;  5CX7 A;  3PBO A;  4HHD A;  4BBT A;  1N9L A;  4Z1W A;  1GSV A;  4EEP A;  4WEL A;  1S4R A;  4OOL A;  2OAP 1;  3T4K A;  3KYZ A;  4F3L A;  1MC0 A;  2HV1 A;  3E0Y A;  3UE6 A;  5MC7 A;  1WA9 A;  4HY8 A;  5AJG A;  2VEA A;  3LYX A;  4CQH A;  1TS6 A;  1OJG A;  3H82 B;  4XT2 A;  3KO6 A;  1P97 A;  2WKR A;  1W63 M;  3JVV A;  4GHI A;  2WKQ A;  4HH3 A;  4E04 A;  3P7N A;  2FZ0 A;  3LFV A;  2V0U A;  3LR4 A;  3OBF A;  4Q0I A;  4NKP A;  2V9A A;  4HJ6 A;  4FOF A;  2INW A;  4DJ3 A;  2VA0 A;  2YKH A;  3A0S A;  2QHK A;  4GCZ A;  4Y2F A;  3G6O A;  4EET B;  5G4Y A;  3EGX C;  2BAS A;  4B93 A;  2NUT C;  2VZW A;  3ICY A;  5TJJ A;  2W3H A;  3CLO A;  5HZH A;  5J3W A;  4IUK A;  1TS0 A;  2VKS A;  2VV6 A;  2ZOH A;  4MCW A;  3CAX A;  1OT9 A;  2D02 A;  5HSQ A;  4CLC C;  4BMW A;  3PBN A;  2I9V A;  5HWW A;  3F1P B;  2K31 A;  2ZMV A;  4HH2 A;  3UB8 A;  4PAU A;  3SW1 A;  2A2L A;  4EU0 A;  1S66 L;  2OOL A;  3IS2 B;  4GJ4 A;  2OWJ A;  1XJ6 A;  3P01 A;  2PD8 A;  5DFY A;  3PBT A;  2YKF A;  2W3D A;  2GNX A;  5HPF A;  1G6O A;  3JVU A;  4WEJ A;  3F1P A;  4KUK A;  2QWS A;  2O99 A;  3KSG A;  2XRN A;  5A8B A;  1TS8 A;  1N9O A;  4NEE D;  3UMD A;  4NXF A;  3HJI A;  3E4Q A;  4WEK A;  2W1T B;  2GX5 A;  1OTI A;  3D72 A;  1TS7 A;  4LLO B;  4WN5 A;  4HP9 A;  4HJ3 A;  3ZYT A;  5HWV A;  1XJ4 A;  2PR6 A;  3E4O A;  4YOF A;  2V1A A;  1S67 L;  3B42 A;  3MR0 A;  4HOI A;  4BBU A;  3MMH A;  5HDC A;  4JGQ A;  4I3A A;  4L9F A;  1P0Z A;  3LUQ A;  3CWF A;  3CIT A;  4WLA A;  1OTD A;  5IS1 A;  2XA7 M;  1P9W A;  2W1T A;  1EW0 A;  1DP9 A;  2HGV A;  3OOV A;  3LIE A;  4L9G A;  2JHE A;  5L8M A;  4EQ1 A;  2HF6 A;  3NOU C;  1LT0 A;  2VLG A;  2ZMF A;  1VB6 A;  4P6Z S;  2CMN A;  2P04 A;  3BWL A;  2V1B A;  2J3W A;  2XRO A;  4UQI S;  2W3G A;  3HJK A;  2K7S A;  5KSH A;  1VHM A;  2M7U A;  2JN7 A;  3LR3 A;  4P6Z M;  4PHT A;  3MJQ A;  3BQA A;  4UQI M;  1YKD A;  1DP6 A;  4L0L A;  4R38 A;  1OTB A;  1T18 A;  3T4J A;  1YAX A;  3MF0 A;  1KOU A;  1LSW A;  4JGP A;  2VV7 A;  4M4X A;  3S7P A;  3GEC A;  1F9I A;  3MXQ A;  2M1C A;  3T4O A;  4Q0J A;  4UEY A;  2L0W A;  3E98 A;  4NXG A;  2J3T D;  4R6L A;  2EWV A;  4KUO A;  2O9A A;  3A0V A;  1V9Z A;  3EEA A;  3EQU A;  4II7 A;  4LRX C;  4EXO A;  3C2W A;  3H82 A;  3FPW A;  3W2Z A;  5DKL A;  4AFI A;  1XFN A;  5J7E A;  2PR5 A;  4MN6 A;  5HPI A;  1TD5 A;  3MQ0 A;  2L1M A;  4JGR A;  3T4S A;  5J4E A;  4IJG A;  2OAQ 1;  4R70 A;  3R7W B;  3RFB A;  3KSI A;  3BQ8 A;  4QPR A;  4WL9 A;  2J80 A;  3UB7 A;  1S1Z A;  3C38 A;  5F5Y A;  3KSH A;  1H3Q A;  4RQ9 A;  4Q0H A;  4HIA A;  3R4K A;  3B33 A;  4GS9 B;  3CUE C;  2Z6C A;  2L4R A;  4JGO A;  4DN0 A;  1NLZ A;  3NOT C;  4YNR A;  2P08 A;  4EUV A;  4O01 A;  1T1C A;  3UME A;  3FC7 A;  2A24 B;  1YSP A;  3C30 A;  3OLO A;  3R7W A;  2HJ9 C;  2KX6 A;  4BJP A;  2W0N A;  2EA9 A;  4Y3I A;  3UE3 A;  5HD3 A;  3D3O A;  5DFX A;  1YSQ A;  4G3K A;  3S7N A;  4G3W A;  3S7Q A;  1UGU A;  2JKR I;  3PXP A;  1STZ A;  2KDK A;  2GZA A;  4B9O A;  3IS2 A;  4GS9 A;  4CLC B;  2JKR M;  1OTA A;  3O5Y A;  3IBR A;  2O0Y A;  2HJE A;  1OTE A;  2A24 A;  4GLQ A;  3LR5 A;  5F6A A;  2XA7 S;  1TF1 A;  1XJ2 A;  5IT5 A;  1NWZ A;  3PBQ A;  4EER A;  2G7U A;  3VV4 A;  1BYW A;  2WKP A;  3E4P A;  3PYP A;  4HI4 A;  3GDI A;  4KQD A;  3OC2 A;  5K5B A;  4CLC A;  4HJ4 A;  2H28 A;  4MDZ A;  3TE8 A;  1G28 A;  2P7J A;  2VX8 A;  4CLC E;  2M7V A;  3BY8 A;  2Z6D A;  5FL3 A;  1UWP X;  2PDR A;  3T4L A;  2Y8H A;  3OCN A;  3MQO A;  3BJN A;  3H9W A;  3BW6 A;  3UB6 A;  3H7W B;  1JNU A;  3VOL A;  2D01 A;  2OWH A;  3TRC A;  3V67 A;  2DMW A;  5F69 A;  5EFW A;  3RTY A;  5HDS A;  2IA2 A;  4R3A A;  4ARZ B;  4XT2 B;  2EWW A;  1Y28 A;  4GHI B;  4LRY C;  1D06 A;  2FH5 A;  3PBS A;  4H6J B;  3UB9 A;  3LIF A;  5IU1 A;  3U2A A;  4L9E A;  1UWN X;  4O8G A;  3S7O A;  4EES A;  3LR0 A;  1F98 A;  2NUP C;  1P9R A;  4IUH A;  3C8C A;  1OPX A;  4ARZ A;  3TJZ C;  3PR6 A;  4ETX A;  5TBM B;  1T1B A;  2ZOI A;  4K08 A;  1W63 Q;  2J3T C;  4H6J A;  2K2N A;  5AVE A;  2XSS A;  4I38 A;  1NLY A;  2QYB A;  2PT7 A;  3B47 A;  3KYQ A;  4WF0 A;  4MN7 A;  2VGL S;  3K2N A;  3IBJ A;  1ODV A;  4CLC D;  5TBM A;  5DF9 A;  5HD5 A;  3PHY A;  4PKY A;  2VGL M;  4LRZ E;  2PYP A;  5AVF A;  3VE3 A;  1MKM A;  3LI9 A;  3FPV A;  3MQQ A;  3EGD C;  2B02 A;  2KLI A;  3VE4 A;  3OCL A;  1GSW A;  1ZTU A;  3NOP C;  5HL6 A;  3EWK A;  4ZRR A;  4MMN A;  4I3J A;  1MZU A;  3LIA A;  2ZBB A;  4MN5 A;  3ULF A;  1GSX A;  3K3C A;  1T1A A;  2MJ6 A;  3MFX A;  2W3F A;  5I5L A;  3LIB A;  3BY9 A;  3NJA A;  2LB9 A;  2VV8 A;  3KX0 X;  4GW9 A;  3F1O B;  4LPZ A;  2W1R A;  4NXE A;  3TW8 A;  1X0O A;  4I5S A;  1IOU A;  4DJ2 A;  3HCY A;  1NRJ A;  5LBR A;  5DKK A;  1XFQ A;  3ZQ5 A;  1T19 A;  1LSV A;  2GJ3 A;  2W3E A;  1N9N A;  1S1Y A;  4ME4 A;  4PKY G;  3T4T A;  4EW7 A;  4IHQ A;  1F5M A;  2O9C A;  1D7E A;  2KOI A;  3EOI A;  4HQA A;  4EEU A;  4O0P A;  3T50 A;  1OT6 A;  4NXB A;  3F1O A;  2QJ7 A;  4WUJ A;  4FSF A;  1OJ5 A;  2V0W A;  3F1N B;  2B18 A;  3LID A;  4KQO A;  3K3D A;  3CUE A;  1ZHH B;  3NHQ A;  3T4Q A;  4G3V A;  5HWT A;  1DRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...