1F5MA

Structure of the gaf domain
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
176
Chain Sequence
b'STGFHHADHVNYSSNLNKEEILEQLLLSYEGLSDGQVNWVCNLSNASSLIWHAYKSLAVDINWAGFYVTQASEENTLILGPFQGKVACQMIQFGKGVCGTAASTKETQIVPDVNKYPGHIACDGETKSEIVVPIISNDGKTLGVIDIDCLDYEGFDHVDKEFLEKLAKLINKSCVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAF
publication title Structure of the GAF domain, a ubiquitous signaling motif and a new class of cyclic GMP receptor.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 57
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2000-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1f5mA00
4RQ9A 2W1TB 1YKDA 1MC0A 2K31A 4PAUA 3S7OA 3RFBA 3D3OA 3CI6A 3S7NA 3ZQ5A 4O8GA 4Q0HA 3NOUC 4IUHA 2VEAA 2ZMFA 2GX5A 3E0YA 3TRCA 4LRYC 4ETXA 4R70A 4O01A 3MMHA 4R6LA 3HCYA 2QYBA 1TD5A 2XSSA 1TF1A 2B18A 5C5KA 3OBFA 5LBRA 2LB9A 4IUKA 5HPIA 5DFYA 4Q0IA 3S7QA 2Y79A 4ME4A 1ZTUA 3KSHA 3NOPC 3O5YA 4G3VA 2O9AA 4ZRRA 4Q0JA 2W3GA 2IA2A 3KSIA 4DN0A 4MDZA 3E98A 4GW9A 1STZA 2G7UA 3W2ZA 5HL6A 2W3HA 2M7UA 3BJNA 4DMZA 4LRZE 4Y2FA 5HPFA 1YSPA 4YNRA 4LRXC 4G3KA 4CQHA 3LFVA 3NOTC 4QPRA 2VZWA 3KSFA 3S7PA 4FOFA 1YSQA 2W1TA 2OOLA 3G6OA 2W3FA 4G3WA 4Y3IA 4EU0A 2W3DA 4MCWA 3KO6A 4ETZA 2Y8HA 5I5LA 3VV4A 4IJGA 4BWIA 4MN7A 2XROA 2KOIA 2O0YA 1MKMA 2W3EA 1VHMA 3K2NA 2K2NA 3KSGA 2XRNA 2KLIA 4O0PA 3R4KA 3IBJA 2O99A 4EUVA 4Z1WA 2VJWA 2M7VA 3IBRA 4YOFA 4GLQA 5HSQA 3MF0A 3CITA 3C2WA 5K5BA 2O9CA 4Y5FA 3MQ0A 5TJJA 3EEAA 3DBAA 3NHQA 1F5MA 5L8MA 3OOVA 2VKSA 2W1RA 4MMNA 2O9BA 5AJGA 2LB5A 4E04A 2HGVA 5DFXA
chains in the Genus database with same CATH superfamily
5E2EA 2C5WB 1K55A 1ES4A 3S7OA 4Y13A 5J4EA 4QY5A 1CI8A 2FH5A 1CF0A 1O7EA 2VEAA 4DJ2A 3P7NA 4BD1A 4S2LA 3MMHA 4D60A 3QP5A 4R3JA 4EETB 2ZL1B 1UWNX 1L3LA 4QHCA 4P0MA 4GDBA 2ZM2A 1LSWA 3GTCA 2Y2LA 1OTEA 4FH4A 2HP6A 3NY4A 3MXQA 5FL3A 3Q07A 4PM5A 3L9KA 1YM1A 4UQIM 4JPMA 3MS6A 1G68A 3ULFA 1IELA 3UNWA 1G6OA 3IT9A 4EV4A 1YMXA 3NDGA 1XGIA 3T4TA 1YSQA 2KX6A 3CMZA 3MKEA 3LIFA 5G4YA 1OT6A 1MZUA 2V1BA 4ZDXA 1F2KA 2WAEA 4HNBA 1IKIA 1GA0A 3MQQA 2WKRA 1G6AA 2J80A 4S2JA 3RH8B 3BYDA 4Y5FA 2R9WA 1K0KA 2P9VB 5J3WA 2XFTA 4WBGA 2HP5A 5DF7A 5EVLA 1OTDA 1FSYA 3T4OA 1DJBA 3LEZA 5EUAA 5EVIA 3TRCA 2EFXA 4KUOA 4B4XA 1T1CA 3QP2A 4FSFA 1LL9A 1MWSA 4HJ4A 4E3IA 3NULA 1GHMA 1TD5A 1FILA 4BBVA 2P9VA 3IH8A 3EQVA 4WUJA 1HD8A 1PRQA 4KENB 5F82A 3FG8A 4R3BA 1UWPX 2JKRI 1K4FA 5HDDA 4E3KA 1OTBA 3A3JA 2GZAA 4GS9A 4CLCC 3O3VA 4KZAA 5FAQA 1N9LA 3NOTC 5HX9A 4KG6A 4E3LA 3AGEA 2OOLA 4I3AA 3AGDA 3LIEA 4E3NA 4DXBA 1FCOA 2VX8A 1EW0A 4Z9QA 4IJGA 4BWIA 2KDKA 3QP4A 5EV0A 4UHUA 2ZOIA 2Z6DA 3DTMA 3U2AA 5L07A 2XFSA 2QJ5A 4X68A 1OMEA 2M7VA 3HVFA 2IWBA 2L0WA 4HH3A 4X25A 3CITA 1IEMA 5CERA 3ZYTA 3VP1A 1MXOA 4LGWA 4HHDA 2V8CA 4L9GA 3LYXA 4MLLA 2JBFA 4I38A 5A90A 5E43A 1Q2PA 3LR4A 2R9XA 3OCNA 3QP8A 4Y7PA 4YFMA 3DTKA 3NOUC 4K0WA 3FYZA 1PW1A 4UA6A 2WAFA 4E6WA 2WKHA 2Y4AA 5CGWA 4BQMA 3ITBA 2UV0E 4N92A 4PM8A 4IVKA 1MWRA 4HBUA 3LR0A 3BWLA 3A3IA 5DTSA 1FCMA 4PPRA 2O9AA 3LEQA 4ZRRA 4L9FA 5CHJA 5FEGA 2PYRA 3IX8A 4OKPA 1FR1A 3BECA 1TS6A 1SHVA 4KZ8A 3IX3A 4NXBA 2BG1A 3LR5A 2J9PA 2HZ5A 3NJAA 3VSKA 3VOYA 5FAPA 1OJGA 1S1ZA 3LGOA 4NETA 2PBDP 3PBTA 5FQMA 4X1MA 3DW0A 4QPRA 1EI5A 1PZOA 2W1TA 3CHWP 1ONGA 3UDIA 3BFCA 3BM6A 2B5RA 2EWVA 2O0YA 3PAGA 4HI4A 1VHMA 2Y2JA 4PM6A 3UB5P 4L9EA 1HTZA 4Y0TA 1LHYA 4DF6A 4QB8A 2H10A 4H6JB 3MQ0A 3HLWA 3DBAA 3Q7ZA 3RTYA 3E4QA 2O9BA 2XLNA 3ISGA 4GDNA 3ZNTA 1S0WA 2GJ3A 1JWZA 4CLCB 4XUXA 1I2SA 2E8IA 4KUKA 5HL1A 5HFOA 2A24B 1P0ZA 3AGFA 3H7WB 1XFNA 4OOLA 4JXWA 2QPNA 2ACGA 5G4ZA 4H6JA 4N9KA 5C5KA 1UGUA 4IUKA 2PT7A 1DP8A 2AVXA 3HREA 2FFYA 3OLOA 1K4EA 4LLOB 2ZC3B 4CLCA 1Z6FA 4D2OA 2J7VA 5HWWA 3B47A 1KDSA 4OLGA 2ZM8A 1W8YA 4LFUA 4WLAA 2WKPA 3PR6A 3UPNA 1KGGA 5DJUA 3PTEA 4HQAA 2V0WA 1AXBA 2VZWA 3T12B 3BFGA 2EFUA 2OLVA 5FDHA 3HLDA 1H8MA 2Y8HA 3A0VA 3T1SA 3VE4A 3EQUA 1TDGA 4B4ZA 2VGKA 2K2NA 5DVAA 5CTMA 3ZG8B 4EUVA 1V9YA 3LY4A 3WS0A 4MNRA 1RP5A 5E2GA 2B02A 4P85A 2BASA 2W1RA 1L0EA 1E3UA 3IHBA 1NRFA 1TVFA 2JKTI 5DJTA 3RFBA 2WGIA 4WEJA 1YPRA 3L7HA 4HESA 4S2NA 4OOYA 3UB7A 4NKPA 3S4XA 1HLUP 5F68A 3RXXA 2RCXA 1ZG4A 5JYOA 2H28A 1M40A 3MJQA 4S2MA 3VMAA 1S6RA 1MWTA 3ZDJA 3FWLA 3T4QA 1SDNA 3SS5A 2Q9MA 1KDWA 1XJ3A 3ZG5A 3P98A 3ICYA 2W3HA 4R4SA 4CLCD 3T1XA 1SKOB 2PR5A 3EEHA 3H82B 1K6RA 2QMIA 2Y2IA 4HBTA 2ZBBA 3VP0A 3NBLA 4ZTKA 1MBLA 2Y55A 3GECA 5EFWA 1BLHA 3PXPA 1L2SA 3NCKA 1ES5A 2VGLM 2X02A 2OLUA 4X56A 2HP9A 4RYEA 3JVVA 2W0NA 3IWIA 4UEYA 3WS5A 5CECA 4O0PA 4NK3A 2VK3A 3H82A 1PWCA 2DMWA 1NYMA 2Y91A 4NXEA 1E4DA 3D9YA 1SKFA 3K3CA 4BL2A 5IU1A 1K56A 1XKZA 3LIDA 5FDSA 3WWXA 1N9BA 1F5MA 3V5MA 2IWCA 1IYOA 3ZCZA 1ERQA 3WS2A 2WYXA 3O86A 4WM9A 1KOUA 3G2ZA 2BLSA 1E3UD 3QHYA 5FAOA 1GSVA 1T19A 3C7VA 4IBRA 4LV0A 3R7WB 5L2FA 2FFFB 4EERA 4ZAMA 1FOFA 1LL5A 3SH7A 1O07A 2Y2MA 3IX4A 4R70A 3MZDA 4II7A 1NZOA 3Q82A 4R4RA 4WZ5C 1T1BA 1GCEA 2ZC4B 3S7QA 1SZVA 4BJPA 3UDXA 4UA7A 2WADA 2HJEA 3CZDA 3E4PA 4Q0JA 5HDCA 2JE5A 4M3KA 3BEBA 1JWPA 3W4OA 1JWVA 3OPPA 3R7WA 1TEMA 1EWZA 1KGFA 3ZHHA 2L1MA 2GDNA 4QU3A 1XJ6A 4HEFA 2QJ7A 2H0TA 5EOEA 4EQ1A 3OZHA 2ZMVA 2XR0A 4GD8A 3IQAA 2PU4A 5DKKA 4C3QA 3E2KA 1XX2A 2J8YA 5JYPA 3ZG7B 1K57C 3KO6A 1V9ZA 3IXHA 3A0SA 3HLBA 3NIAA 3VV4A 4B9OA 2Y2PA 2V1ZA 5HD5A 1P9WA 4OH0A 4R1GA 2XK1A 2OSUA 4DXCA 5GLBA 2ZL1A 2BTFP 5GLAA 4YOFA 5AQ9A 4X1LA 5GHYA 3MF0A 3UDFA 1ACFA 3VFHA 3NC8A 4KQQA 1NLZA 1GHPA 1K56D 2Y2NA 2PR6A 3SZTA 1NLYA 3GMWA 4WMCD 1F98A 4RQ9A 1YKDA 3BLMA 5F1GA 3F1NB 3FKVA 4OOMA 1PIOA 1BUEA 3FC7A 1QMFA 3ZGAB 1DJCA 3QP1A 3QP6A 5G18A 4UQIS 1J9MA 4ZJ1A 4BBUA 2QKPA 3PAEA 3PYPA 1TF1A 3C30A 4XXRA 2LB9A 3EGDC 2XDMA 4Q0IA 5GL9A 4KQRA 1WE4A 5U47A 1W63M 3KSIA 2IA2A 2XD5A 3F1NA 1STZA 5CGSA 3CG5A 2J3TC 1SDEA 1NYYA 1S67L 1L0GA 4EW7A 2Z2MB 1SCWA 5CXWA 2XEPA 5DKLA 3HL9A 1K38A 4ZBEA 3PBOA 1NJ4A 1BT5A 4PMAA 4GOGA 4S2KA 5I5LA 5D3OA 1DP6A 2VV8A 1MKMA 2HDUA 2EX2A 1S4SA 2RL3A 3NDEA 4OQIA 3T4SA 2C6WB 3N8LA 2OWHA 2O9CA 4JKTA 3DWKA 2OWJA 4ZJ2A 4RX3A 4BLMA 3NHQA 2ZQ7A 4CJNA 1KE4A 4YINA 4Q8IA 3HUOA 4Y17A 2PD8A 5TFQA 1BTLA 1FCNA 5GLDA 1ZG6A 4O7DA 2Q9NA 3HLEA 3N7WA 4Y15A 4IBXA 4OLDA 3ZQ5A 4O8GA 4Q0HA 5F6AA 5HWVA 4ETXA 3FPWA 3TW8A 1S4RA 5FQKA 1JNUA 5KSCA 1YT4A 1KVLA 3FPVA 3LO7A 5GHZA 3C4PA 5HPIA 4IHQA 5HWTA 1IOUA 2Y79A 1D1JA 1K54C 1ZHHB 1XGJA 1D7EA 4DN0A 4MDZA 4DKIA 3GRJA 4GW9A 3GV9A 1S66L 3E4OA 2M7UA 3LI8A 3HBRA 2I9VA 3HLFA 3IHAA 3BQAA 1ESUA 3GVBA 2J9OA 3G4PA 3MZFA 5FI6A 3HUNA 2ZQCA 3ZFZA 3ZVWA 1MPLA 4HOIA 3TG9A 4BMWA 2OV5A 5FATA 1VQQA 2W3EA 1JTDA 5TBMB 4OP8A 1NWZA 4FH2A 4ID4A 1DY6A 3G30A 1H5XA 3F1PB 2Y2HA 4ESPA 4IEDA 4K0XA 4GLQA 1VM1A 3WRZA 5TJJA 4FCFA 4GKUA 5F5YA 5L8MA 3OOVA 3FZCA 3UE0A 5AJGA 2JKFA 2ZC6B 2WGVA 2NUTC 1PW8A 1H3QA 5FQQA 1PI5A 3LIBA 1MC0A 4EUZA 3D3OA 1P97A 3F1PA 2EXBA 2Z6CA 1T1AA 4QD4A 4MN5A 4PM7A 2QYBA 5EOOA 5HDSA 3CPTB 4NXFA 3WS4A 4LV1A 3T1RA 4X6TA 4S2OA 3V3RA 5LBRA 5EECA 1DRMA 5IT5A 4H8RA 4CPKA 2W3GA 4DE3A 4NG2A 3SOIA 3VOZA 5CX7A 3N6IA 3MFXA 1EROA 3BY8A 2ZJ9A 2V0UA 5A92A 4JXVA 3HUMA 3CPTA 4CLCE 5KZHA 3LY3A 5FQIA 3G31A 2JC7A 4FOFA 5F83A 1I5QA 2EWWA 1H0MA 3UB9A 4I5SA 4ETZA 3E2LA 2A24A 4K91A 2XQZA 1WYCA 3H7WA 3BY9A 1LL8A 3SW1A 4B88A 3MKFA 3D4FA 3IBJA 1I2WA 4E6XA 3UO9A 2DCFA 1JTGA 4F3LB 3EEAA 1K55C 5A91A 1E25A 1LSVA 2YKFA 5HAIA 1YLZA 5I94A 3JVUA 3QNCA 4P6ZS 3B3XA 3Q81A 2WKEA 2K31A 4E3MA 3C4OA 3VOLA 2Y2KA 3A3FA 2Y2QA 2VLGA 4OQ0A 4DJ3A 3KYZA 4GJ4A 3T4LA 5KIZA 1K54A 1Y4OA 2K7SA 4EWFA 5HAQA 4F3LA 5CEBA 3UE1A 3UB8A 1PFLA 3ZG0A 4U0TA 2ZLYA 1GSWA 2HDRA 5DTKA 5M18A 5CGXA 3VP3A 4KZ5A 2J3TD 1GHIA 3P01A 1NRJA 3UE6A 3N8SA 5KSHA 4OQGA 4A5RA 4U0XA 5HL6A 4C75A 4OPYA 4KQOA 2XH9A 4QWOA 3T50A 3CJMA 1FQGA 2XGNA 3LI9A 3VP2A 4CQHA 3BFFA 3B42A 4UAAA 5M1AA 4WELA 2P04A 3A3EA 3S22A 1TS0A 4EU0A 3A0RA 1TS8A 5J8XA 3RJUA 5EVEA 4KG5A 4DDSA 2DNSA 4OONA 3R4KA 1W7FA 4WZ4A 1G5UA 3T4JA 3DAVA 1Y28A 3IH9A 3MQOA 4L0LA 3C2WA 4JF4A 1X0OA 4R0QA 4GD6A 1KE0A 2VKSA 1LI0A 1MKIA 5CEDA 2WKIA 3UN7A 1J3WA 3Q1FA 1YMSA 3TJZC 2A49A 4OPZA 5EVIC 3IWOA 5AVFA 4R38A 1OPXA 1SKOA 5CRFA 3CI6A 2XA7S 1XP4A 2ZMFA 3CLOA 2VV6A 3E0YA 3F1OB 3W8KA 3WS1A 1CK3A 4WMCA 3DWZA 1KGEA 4P6BA 1BYWA 1BZAA 2XSSA 1VETB 3H9WA 4X55A 4Y0UA 2WUQA 5HAPA 5DFYA 4KZ3A 1ZTUA 2M1CA 2G7UA 3C7UA 2Z2LB 1JVJA 2PU2A 2V9AA 2E8JA 2D02A 1OTIA 3OPHA 3F1OA 4NXGA 3CAXA 3B33A 4HP9A 4DMZA 2CMNA 4LRZE 4FUWA 5E2HA 4OP5A 1N9NA 1OT9A 2V1AA 4EBLA 4Y3IA 4WEKA 4ARZB 5AQBA 3QNBA 3SH8A 4R3AA 1NZUA 5L09A 4GB7A 2V20A 1CQAA 5HARA 3MR0A 3KSGA 2XRNA 1OTAA 1H8YA 2XF3A 3UMDA 4JGOA 4Y0OA 1HVBA 2JCHA 2JKRM 2J3WA 4KZBA 1IKGA 5KMWA 2WGWB 1K6SA 2JHEA 4E3JA 4ARZA 4MMNA 1ONHA 2LB5A 3BQ8A 3BRMA 4HJ6A 5AQ7A 4MBFA 1YLJA 4JXGA 5FQ9A 4DDYA 4OVDA 1W5DA 4BENA 1N4OA 1MWUA 5DF8A 4O01A 2EA9A 4HIAA 3BLSA 4KQDA 3HCYA 2PD7A 3EWKA 2WGWA 4X53A 1L0DA 1W63Q 1ZKJA 2WZXA 5FASA 4AFIA 3CUEC 3O5YA 4G3VA 1XA1A 4JGQA 2OAQ1 4DE1A 2PRFA 2CC1A 2HF6A 1CEFA 1LLBA 4OQHA 3C5AA 2PBYA 4EBPA 4LENA 1M6KA 4KZ9A 1NY0A 4YNRA 5EVIB 4S2PA 2H5SA 2HPBA 4MN6A 3D72A 1LI9A 2DRWA 4G3WA 2ZQ8A 3IXGA 5F69A 3BFDA 3KYQA 1F9IA 4EBNA 3G35A 2XROA 5FEFA 3VE3A 5M19A 2VV7A 2WK0A 2HV1A 1MY8A 3MFDA 5DF9A 3NI9A 4I3JA 4LCLA 1PWDA 2HDQA 5HSQA 1A0KA 3ZVTA 2ZQAA 3IF6C 2EX9A 2PAVP 4BBTA 4JXSA 4GS9B 3VSLA 1KVMA 3HLCA 4WL9A 2B95A 3LICA 4LCMA 5EE8A 5EM0A 5TGFA 2R78A 1D06A 3V67A 2P08A 3MXRA 4EQIA 1TDLA 3EGXC 1IFQA 1P9RA 2OAP1 2WZZA 4PKYG 1LSXA 1DP9A 2X71A 3CWFA 3ZG9B 2X01A 3LR3A 3FV7A 2I72A 5AQAA 3VFFA 3LIAA 5GLCA 4I3IA 3KSHA 3O87A 3GQZA 3NOPC 2EX8A 4M4XA 4WZ5A 3E98A 3UPOA 1YLTA 4GZBA 3W2ZA 5IS1A 3GDIA 3BJNA 4PM9A 4S2IA 4EESA 1H8ZA 3M2KA 3ITAA 5HPFA 1GA9A 2VGJA 4XT2B 4IVIA 3IWQA 5A93A 3OPRA 4WN5A 4GN2A 4HP4A 2L4RA 3TOIA 1ODVA 3V39A 1K25A 3S1YA 3T4KA 2KOIA 3JYIA 3K2NA 4R23A 1K57A 3SS4A 3UPPA 3IXBA 4MBKA 3UB6A 2PHYA 3TE8A 3K3DA 1YLYA 1ES3A 1PWGA 4XT2A 5K5BA 4JF5A 5EVID 3G32A 4N1XA 2G2UA 1ES2A 2XD1A 5DFXA 1PI4A 5MC7A 4I39A 2W1TB 3PBNA 4KG2A 1BLSA 4S2NC 3S7NA 2IWDA 1N9OA 4DE0A 5EM1A 3M2JA 3MSHA 4EXOA 3CUEA 5CTNA 2QWSA 3GR2A 3IXDA 3MZEA 4HJ3A 5GHXA 2B18A 3OBFA 5EPHA 4YWZA 4JLFA 2ZOHA 5TBMA 3O88A 1WA9A 4RVAA 1NXYA 2JKGA 2V2FF 3IF6B 1FSWA 2UWXA 5CHMA 1XPBA 2JKTM 4GNUA 4RX2A 4FTXA 2WKQA 2INWA 4EEUA 3SS3A 4JGRA 1S1YA 4LRXC 3LFVA 5J7EA 2ZM0A 4OPRA 3S7PA 4KZ4A 2ZC7A 2W3DA 2Y59A 4LV2A 4N1HA 3U4LP 3C38A 1ESIA 4MCWA 3PBRA 2VA0A 3KX0X 2EXAA 4PKYA 1YAXA 4GHIB 1XFQA 1CI9A 1XXMA 3W4PA 3IF6A 2HDSA 2V8FA 1DJAA 1TS7A 5IHVA 2QZ6A 1HZOA 1YQSA 1AWIA 2ZMAA 1Z09A 1ZC2A 4NEED 4X69A 4HY8A 1U60A 4GCZA 4LPZA 3PBSA 2GNXA 4E3OA 4P6ZM 3LUQA 1PYYA 3G2YA 4GHIA 3UE3A 4PAUA 3DTEA 4JF6A 1CEGA 3ZNYA 4IUHA 4MBHA 3JPUA 1Q2QA 2GX5A 4WF0A 5F1FA 4DRTA 4EEPA 5HW3A 4RA7A 3PBQA 2G2WA 2Q0OA 2MJ6A 3SH9A 5AVEA 5HD3A 4B93A 1BULA 3W4QA 1VB6A 2QHKA 2PDRA 5FA7A 2HJ9C 4U3TA 4BD0A 4DE2A 1XJ2A 4KZ7A 3A3DA 2ZC5B 3HLGA 1ERMA 3Q7VB 3LCEA 5E2FA 1BLPA 4UA9A 1GSXA 1FR6A 4PHTA 3NECA 3IF5A 3KSFA 4OPQA 3G6OA 5BOHA 4HH2A 1ALQA 1PNEA 5TR7A 3G34A 5L10A 3FKWA 2YKHA 3WRTA 1BLCA 3KYEA 4BL3A 3Q7VA 4FD8A 2ZQ9A 5FQJA 5FSRA 5A8BA 3P09A 1C3BA 3HJIA 2Y2GA 3M6BA 4JGPA 5FI2A 1XA7A 3GSGA 3TSGA 1QMEA 1RGYA 4F94A 2A2LA 2ZQDA 1G28A 1L0FA 1VEUB 4ZJ3A 2NUPC 4MEZA 2XA7M 3IS2B 1RCJA 1W8QA 1CJFA 4LRYC 2ZD8A 3PHYA 3VP4A 4R6LA 1W79A 1PZPA 2P7JA 3DTIA 4P87A 1T18A 4JBFA 2A3UA 1XJ4A 4XUZA 4KZ6A 5HZHA 3I7JA 4ME4A 3HJKA 1VEUA 1YLWA 2JN7A 1FIKA 4WYYA 1LT0A 3BFEA 2Y2OA 4QJGA 3IS2A 1OJ5A 3V3SA 4C6YA 3V50A 2EX6A 4Y2FA 3EOIA 5DTTA 1YSPA 1YLPA 4G3KA 3N8RA 3OPLA 3C8CA 2W3FA 2FZ0A 3RXWA 1WYBA 3T1QB 4QY6A 2W27A 3OC2A 4MN7A 2PYPA 2VGLS 1IYQA 1RGZA 4N9LA 2D01A 2KLIA 5FI7A 2O99A 4LV3A 2P74A 4Z1WA 2VJWA 3IBRA 3MBZA 3UMEA 1VETA 3M6HA 3BW6A 1Y54A 4K08A 1BSGA 5CHUA 3N4IA 1IYPA 1IYSA 2H0YA 3MXSA 3UY6A 1KE3A 4E04A 2HGVA 3OCLA
chains in the Genus database with same CATH topology
3LICA 2JKTI 2R78A 1D06A 1MC0A 3LIBA 5DJTA 3S7OA 3RFBA 3V67A 5J4EA 3D3OA 2P08A 1P97A 3F1PA 2FH5A 2VEAA 1IFQA 3EGXC 4DJ2A 4WEJA 1P9RA 2Z6CA 1T1AA 3P7NA 2OAP1 4MN5A 3MMHA 4PKYG 2QYBA 1LSXA 5HDSA 1DP9A 4EETB 3UB7A 4NKPA 1UWNX 4NXFA 3CWFA 5F68A 5LBRA 3LR3A 2H28A 3LIAA 1LSWA 1DRMA 5IT5A 3MJQA 4I3IA 3KSHA 1OTEA 3NOPC 3MXQA 2W3GA 4M4XA 5FL3A 3T4QA 3E98A 1XJ3A 5CX7A 5IS1A 3W2ZA 3ICYA 2W3HA 3GDIA 4UQIM 4CLCD 3MFXA 3BY8A 3BJNA 3ULFA 2PR5A 3EEHA 2V0UA 4EESA 3H82B 1G6OA 2ZBBA 5HPFA 4XT2B 4CLCE 3T4TA 4FOFA 1YSQA 2KX6A 2EWWA 3GECA 5EFWA 3UB9A 3PXPA 4HP4A 4I5SA 2L4RA 3LIFA 4WN5A 5G4YA 1ODVA 4ETZA 1OT6A 2VGLM 2A24A 3T4KA 1MZUA 2KOIA 2V1BA 3H7WA 3JVVA 4HNBA 3K2NA 2W0NA 4UEYA 3BY9A 1LL8A 4O0PA 3MQQA 3SW1A 3UB6A 2PHYA 3IBJA 3K3DA 3TE8A 2WKRA 3H82A 2DMWA 2J80A 3RH8B 4NXEA 4XT2A 5K5BA 4Y5FA 4F3LB 3K3CA 5IU1A 3EEAA 3LIDA 1F5MA 1LSVA 5J3WA 2YKFA 5DFXA 5MC7A 4I39A 1KOUA 2W1TB 3JVUA 4P6ZS 1OTDA 3T4OA 2K31A 1GSVA 1T19A 3PBNA 3VOLA 3R7WB 2VLGA 3S7NA 4EERA 4DJ3A 1N9OA 3KYZA 4GJ4A 3T4LA 5KIZA 4EXOA 3TRCA 4KUOA 4R70A 3CUEA 2K7SA 4II7A 1T1CA 4F3LA 2QWSA 4FSFA 3UB8A 4HJ3A 4HJ4A 1GSWA 1TD5A 2B18A 4BBVA 3OBFA 1T1BA 3EQVA 4WUJA 3S7QA 4YWZA 4BJPA 2ZOHA 5TBMA 1WA9A 2HJEA 2J3TD 3E4PA 4Q0JA 5HDCA 3P01A 1NRJA 3UE6A 5KSHA 3R7WA 3FG8A 5HL6A 2L1MA 4KQOA 1UWPX 2JKTM 2JKRI 3T50A 1XJ6A 5HDDA 1OTBA 2GZAA 2QJ7A 2INWA 2WKQA 4GS9A 4EEUA 3LI9A 4EQ1A 4JGRA 1S1YA 4CLCC 2ZMVA 4LRXC 4CQHA 3LFVA 1N9LA 3NOTC 3B42A 5J7EA 3S7PA 4WELA 2OOLA 2P04A 4I3AA 5DKKA 1TS0A 2W3DA 4EU0A 3A0RA 3LIEA 3C38A 4MCWA 3KO6A 2VA0A 3KX0X 3PBRA 1V9ZA 4PKYA 2VX8A 1TS8A 1YAXA 1EW0A 3A0SA 3VV4A 4GHIB 1XFQA 4B9OA 4IJGA 4BWIA 5HD5A 1P9WA 1TS7A 2KDKA 3R4KA 2ZOIA 2Z6DA 3U2AA 3T4JA 2QJ5A 4NEED 2M7VA 1Y28A 3MQOA 4YOFA 4HY8A 4L0LA 2L0WA 4HH3A 4GCZA 4LPZA 3MF0A 3CITA 3C2WA 1X0OA 3PBSA 3ZYTA 2GNXA 1NLZA 2VKSA 2PR6A 1NLYA 4HHDA 1F98A 4L9GA 4P6ZM 4RQ9A 3TJZC 3LUQA 3LYXA 4GHIA 1YKDA 3UE3A 4I38A 5AVFA 4R38A 4PAUA 1OPXA 3F1NB 4OOMA 3LR4A 3CI6A 3FC7A 3OCNA 2XA7S 3NOUC 4IUHA 2ZMFA 3CLOA 2VV6A 2GX5A 3E0YA 3F1OB 4WF0A 4EEPA 3PBQA 4UQIS 2MJ6A 1BYWA 4BBUA 2QKPA 3PYPA 2XSSA 1TF1A 3C30A 3H9WA 5AVEA 2LB9A 3LR0A 5HD3A 3EGDC 5DFYA 4Q0IA 3BWLA 4B93A 1ZTUA 2O9AA 4ZRRA 1W63M 4L9FA 1VB6A 2QHKA 3KSIA 2IA2A 2PDRA 2HJ9C 2PYRA 3F1NA 1TS6A 1XJ2A 2M1CA 1STZA 2G7UA 2V9AA 4NXBA 2D02A 1OTIA 3LR5A 2J3TC 3NJAA 3F1OA 4NXGA 3CAXA 3OCLA 1OJGA 1S1ZA 3B33A 1S67L 4HP9A 4DMZA 2CMNA 4LRZE 4EW7A 1N9NA 1GSXA 3PBTA 4PHTA 1OT9A 4QPRA 3KSFA 5DKLA 2V1AA 3G6OA 2W1TA 3PBOA 4Y3IA 4HH2A 4WEKA 4ARZB 4R3AA 5I5LA 1DP6A 2VV8A 2EWVA 2O0YA 2YKHA 1MKMA 4HI4A 1VHMA 3MR0A 3KSGA 2XRNA 1OTAA 3UMDA 4L9EA 1S4SA 4JGOA 3T4SA 5A8BA 2OWHA 2JKRM 2J3WA 2O9CA 3HJIA 4H6JB 3MQ0A 4JGPA 2OWJA 3DBAA 2JHEA 3NHQA 3RTYA 3E4QA 4ARZA 2A2LA 4MMNA 2O9BA 2LB5A 1G28A 3BQ8A 2PD8A 4HJ6A 2NUPC 2GJ3A 4CLCB 2XA7M 4KUKA 3ZQ5A 2A24B 1P0ZA 3IS2B 4O8GA 4Q0HA 5F6AA 3H7WB 5HWVA 4LRYC 1XFNA 4OOLA 3FPWA 4ETXA 4O01A 3PHYA 3TW8A 2EA9A 4R6LA 4HIAA 5G4ZA 4KQDA 3HCYA 1S4RA 2P7JA 2PD7A 3EWKA 4H6JA 1JNUA 1T18A 1W63Q 3FPVA 5C5KA 1XJ4A 1UGUA 4IUKA 2PT7A 5HPIA 4IHQA 5HWTA 5HZHA 1IOUA 1DP8A 2Y79A 4ME4A 4AFIA 3HJKA 3CUEC 3O5YA 4G3VA 3OLOA 1ZHHB 4JGQA 2OAQ1 1D7EA 4LLOB 4DN0A 4MDZA 2JN7A 4CLCA 2HF6A 1LT0A 4GW9A 5HWWA 3B47A 1S66L 3E4OA 3IS2A 1OJ5A 2M7UA 3LI8A 2I9VA 3BQAA 4WLAA 2WKPA 4Y2FA 3EOIA 3PR6A 1YSPA 4YNRA 5DJUA 4HQAA 4G3KA 2V0WA 4MN6A 3D72A 2VZWA 3C8CA 4G3WA 2W3FA 2FZ0A 4HOIA 2W27A 5F69A 4BMWA 1H8MA 2Y8HA 3OC2A 3A0VA 3KYQA 1F9IA 4MN7A 2XROA 2PYPA 3VE3A 3VE4A 3EQUA 2VGLS 2VV7A 2W3EA 2K2NA 5TBMB 1NWZA 2D01A 2KLIA 2HV1A 3F1PB 5DF9A 2O99A 4I3JA 4EUVA 4Z1WA 1V9YA 2VJWA 3IBRA 3UMEA 4GLQA 5HSQA 2B02A 3BW6A 4K08A 5TJJA 4BBTA 4GS9B 5F5YA 2BASA 5L8MA 3OOVA 2W1RA 5AJGA 2NUTC 4WL9A 4E04A 2HGVA 1H3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RQ9 A;  2W1T B;  1YKD A;  1MC0 A;  2K31 A;  4PAU A;  3S7O A;  3RFB A;  3D3O A;  3CI6 A;  3S7N A;  3ZQ5 A;  4O8G A;  4Q0H A;  3NOU C;  4IUH A;  2VEA A;  2ZMF A;  2GX5 A;  3E0Y A;  3TRC A;  4LRY C;  4ETX A;  4R70 A;  4O01 A;  3MMH A;  4R6L A;  3HCY A;  2QYB A;  1TD5 A;  2XSS A;  1TF1 A;  2B18 A;  5C5K A;  3OBF A;  5LBR A;  2LB9 A;  4IUK A;  5HPI A;  5DFY A;  4Q0I A;  3S7Q A;  2Y79 A;  4ME4 A;  1ZTU A;  3KSH A;  3NOP C;  3O5Y A;  4G3V A;  2O9A A;  4ZRR A;  4Q0J A;  2W3G A;  2IA2 A;  3KSI A;  4DN0 A;  4MDZ A;  3E98 A;  4GW9 A;  1STZ A;  2G7U A;  3W2Z A;  5HL6 A;  2W3H A;  2M7U A;  3BJN A;  4DMZ A;  4LRZ E;  4Y2F A;  5HPF A;  1YSP A;  4YNR A;  4LRX C;  4G3K A;  4CQH A;  3LFV A;  3NOT C;  4QPR A;  2VZW A;  3KSF A;  3S7P A;  4FOF A;  1YSQ A;  2W1T A;  2OOL A;  3G6O A;  2W3F A;  4G3W A;  4Y3I A;  4EU0 A;  2W3D A;  4MCW A;  3KO6 A;  4ETZ A;  2Y8H A;  5I5L A;  3VV4 A;  4IJG A;  4BWI A;  4MN7 A;  2XRO A;  2KOI A;  2O0Y A;  1MKM A;  2W3E A;  1VHM A;  3K2N A;  2K2N A;  3KSG A;  2XRN A;  2KLI A;  4O0P A;  3R4K A;  3IBJ A;  2O99 A;  4EUV A;  4Z1W A;  2VJW A;  2M7V A;  3IBR A;  4YOF A;  4GLQ A;  5HSQ A;  3MF0 A;  3CIT A;  3C2W A;  5K5B A;  2O9C A;  4Y5F A;  3MQ0 A;  5TJJ A;  3EEA A;  3DBA A;  3NHQ A;  1F5M A;  5L8M A;  3OOV A;  2VKS A;  2W1R A;  4MMN A;  2O9B A;  5AJG A;  2LB5 A;  4E04 A;  2HGV A;  5DFX A; 
#chains in the Genus database with same CATH topology
 5E2E A;  2C5W B;  1K55 A;  1ES4 A;  3S7O A;  4Y13 A;  5J4E A;  4QY5 A;  1CI8 A;  2FH5 A;  1CF0 A;  1O7E A;  2VEA A;  4DJ2 A;  3P7N A;  4BD1 A;  4S2L A;  3MMH A;  4D60 A;  3QP5 A;  4R3J A;  4EET B;  2ZL1 B;  1UWN X;  1L3L A;  4QHC A;  4P0M A;  4GDB A;  2ZM2 A;  1LSW A;  3GTC A;  2Y2L A;  1OTE A;  4FH4 A;  2HP6 A;  3NY4 A;  3MXQ A;  5FL3 A;  3Q07 A;  4PM5 A;  3L9K A;  1YM1 A;  4UQI M;  4JPM A;  3MS6 A;  1G68 A;  3ULF A;  1IEL A;  3UNW A;  1G6O A;  3IT9 A;  4EV4 A;  1YMX A;  3NDG A;  1XGI A;  3T4T A;  1YSQ A;  2KX6 A;  3CMZ A;  3MKE A;  3LIF A;  5G4Y A;  1OT6 A;  1MZU A;  2V1B A;  4ZDX A;  1F2K A;  2WAE A;  4HNB A;  1IKI A;  1GA0 A;  3MQQ A;  2WKR A;  1G6A A;  2J80 A;  4S2J A;  3RH8 B;  3BYD A;  4Y5F A;  2R9W A;  1K0K A;  2P9V B;  5J3W A;  2XFT A;  4WBG A;  2HP5 A;  5DF7 A;  5EVL A;  1OTD A;  1FSY A;  3T4O A;  1DJB A;  3LEZ A;  5EUA A;  5EVI A;  3TRC A;  2EFX A;  4KUO A;  4B4X A;  1T1C A;  3QP2 A;  4FSF A;  1LL9 A;  1MWS A;  4HJ4 A;  4E3I A;  3NUL A;  1GHM A;  1TD5 A;  1FIL A;  4BBV A;  2P9V A;  3IH8 A;  3EQV A;  4WUJ A;  1HD8 A;  1PRQ A;  4KEN B;  5F82 A;  3FG8 A;  4R3B A;  1UWP X;  2JKR I;  1K4F A;  5HDD A;  4E3K A;  1OTB A;  3A3J A;  2GZA A;  4GS9 A;  4CLC C;  3O3V A;  4KZA A;  5FAQ A;  1N9L A;  3NOT C;  5HX9 A;  4KG6 A;  4E3L A;  3AGE A;  2OOL A;  4I3A A;  3AGD A;  3LIE A;  4E3N A;  4DXB A;  1FCO A;  2VX8 A;  1EW0 A;  4Z9Q A;  4IJG A;  4BWI A;  2KDK A;  3QP4 A;  5EV0 A;  4UHU A;  2ZOI A;  2Z6D A;  3DTM A;  3U2A A;  5L07 A;  2XFS A;  2QJ5 A;  4X68 A;  1OME A;  2M7V A;  3HVF A;  2IWB A;  2L0W A;  4HH3 A;  4X25 A;  3CIT A;  1IEM A;  5CER A;  3ZYT A;  3VP1 A;  1MXO A;  4LGW A;  4HHD A;  2V8C A;  4L9G A;  3LYX A;  4MLL A;  2JBF A;  4I38 A;  5A90 A;  5E43 A;  1Q2P A;  3LR4 A;  2R9X A;  3OCN A;  3QP8 A;  4Y7P A;  4YFM A;  3DTK A;  3NOU C;  4K0W A;  3FYZ A;  1PW1 A;  4UA6 A;  2WAF A;  4E6W A;  2WKH A;  2Y4A A;  5CGW A;  4BQM A;  3ITB A;  2UV0 E;  4N92 A;  4PM8 A;  4IVK A;  1MWR A;  4HBU A;  3LR0 A;  3BWL A;  3A3I A;  5DTS A;  1FCM A;  4PPR A;  2O9A A;  3LEQ A;  4ZRR A;  4L9F A;  5CHJ A;  5FEG A;  2PYR A;  3IX8 A;  4OKP A;  1FR1 A;  3BEC A;  1TS6 A;  1SHV A;  4KZ8 A;  3IX3 A;  4NXB A;  2BG1 A;  3LR5 A;  2J9P A;  2HZ5 A;  3NJA A;  3VSK A;  3VOY A;  5FAP A;  1OJG A;  1S1Z A;  3LGO A;  4NET A;  2PBD P;  3PBT A;  5FQM A;  4X1M A;  3DW0 A;  4QPR A;  1EI5 A;  1PZO A;  2W1T A;  3CHW P;  1ONG A;  3UDI A;  3BFC A;  3BM6 A;  2B5R A;  2EWV A;  2O0Y A;  3PAG A;  4HI4 A;  1VHM A;  2Y2J A;  4PM6 A;  3UB5 P;  4L9E A;  1HTZ A;  4Y0T A;  1LHY A;  4DF6 A;  4QB8 A;  2H10 A;  4H6J B;  3MQ0 A;  3HLW A;  3DBA A;  3Q7Z A;  3RTY A;  3E4Q A;  2O9B A;  2XLN A;  3ISG A;  4GDN A;  3ZNT A;  1S0W A;  2GJ3 A;  1JWZ A;  4CLC B;  4XUX A;  1I2S A;  2E8I A;  4KUK A;  5HL1 A;  5HFO A;  2A24 B;  1P0Z A;  3AGF A;  3H7W B;  1XFN A;  4OOL A;  4JXW A;  2QPN A;  2ACG A;  5G4Z A;  4H6J A;  4N9K A;  5C5K A;  1UGU A;  4IUK A;  2PT7 A;  1DP8 A;  2AVX A;  3HRE A;  2FFY A;  3OLO A;  1K4E A;  4LLO B;  2ZC3 B;  4CLC A;  1Z6F A;  4D2O A;  2J7V A;  5HWW A;  3B47 A;  1KDS A;  4OLG A;  2ZM8 A;  1W8Y A;  4LFU A;  4WLA A;  2WKP A;  3PR6 A;  3UPN A;  1KGG A;  5DJU A;  3PTE A;  4HQA A;  2V0W A;  1AXB A;  2VZW A;  3T12 B;  3BFG A;  2EFU A;  2OLV A;  5FDH A;  3HLD A;  1H8M A;  2Y8H A;  3A0V A;  3T1S A;  3VE4 A;  3EQU A;  1TDG A;  4B4Z A;  2VGK A;  2K2N A;  5DVA A;  5CTM A;  3ZG8 B;  4EUV A;  1V9Y A;  3LY4 A;  3WS0 A;  4MNR A;  1RP5 A;  5E2G A;  2B02 A;  4P85 A;  2BAS A;  2W1R A;  1L0E A;  1E3U A;  3IHB A;  1NRF A;  1TVF A;  2JKT I;  5DJT A;  3RFB A;  2WGI A;  4WEJ A;  1YPR A;  3L7H A;  4HES A;  4S2N A;  4OOY A;  3UB7 A;  4NKP A;  3S4X A;  1HLU P;  5F68 A;  3RXX A;  2RCX A;  1ZG4 A;  5JYO A;  2H28 A;  1M40 A;  3MJQ A;  4S2M A;  3VMA A;  1S6R A;  1MWT A;  3ZDJ A;  3FWL A;  3T4Q A;  1SDN A;  3SS5 A;  2Q9M A;  1KDW A;  1XJ3 A;  3ZG5 A;  3P98 A;  3ICY A;  2W3H A;  4R4S A;  4CLC D;  3T1X A;  1SKO B;  2PR5 A;  3EEH A;  3H82 B;  1K6R A;  2QMI A;  2Y2I A;  4HBT A;  2ZBB A;  3VP0 A;  3NBL A;  4ZTK A;  1MBL A;  2Y55 A;  3GEC A;  5EFW A;  1BLH A;  3PXP A;  1L2S A;  3NCK A;  1ES5 A;  2VGL M;  2X02 A;  2OLU A;  4X56 A;  2HP9 A;  4RYE A;  3JVV A;  2W0N A;  3IWI A;  4UEY A;  3WS5 A;  5CEC A;  4O0P A;  4NK3 A;  2VK3 A;  3H82 A;  1PWC A;  2DMW A;  1NYM A;  2Y91 A;  4NXE A;  1E4D A;  3D9Y A;  1SKF A;  3K3C A;  4BL2 A;  5IU1 A;  1K56 A;  1XKZ A;  3LID A;  5FDS A;  3WWX A;  1N9B A;  1F5M A;  3V5M A;  2IWC A;  1IYO A;  3ZCZ A;  1ERQ A;  3WS2 A;  2WYX A;  3O86 A;  4WM9 A;  1KOU A;  3G2Z A;  2BLS A;  1E3U D;  3QHY A;  5FAO A;  1GSV A;  1T19 A;  3C7V A;  4IBR A;  4LV0 A;  3R7W B;  5L2F A;  2FFF B;  4EER A;  4ZAM A;  1FOF A;  1LL5 A;  3SH7 A;  1O07 A;  2Y2M A;  3IX4 A;  4R70 A;  3MZD A;  4II7 A;  1NZO A;  3Q82 A;  4R4R A;  4WZ5 C;  1T1B A;  1GCE A;  2ZC4 B;  3S7Q A;  1SZV A;  4BJP A;  3UDX A;  4UA7 A;  2WAD A;  2HJE A;  3CZD A;  3E4P A;  4Q0J A;  5HDC A;  2JE5 A;  4M3K A;  3BEB A;  1JWP A;  3W4O A;  1JWV A;  3OPP A;  3R7W A;  1TEM A;  1EWZ A;  1KGF A;  3ZHH A;  2L1M A;  2GDN A;  4QU3 A;  1XJ6 A;  4HEF A;  2QJ7 A;  2H0T A;  5EOE A;  4EQ1 A;  3OZH A;  2ZMV A;  2XR0 A;  4GD8 A;  3IQA A;  2PU4 A;  5DKK A;  4C3Q A;  3E2K A;  1XX2 A;  2J8Y A;  5JYP A;  3ZG7 B;  1K57 C;  3KO6 A;  1V9Z A;  3IXH A;  3A0S A;  3HLB A;  3NIA A;  3VV4 A;  4B9O A;  2Y2P A;  2V1Z A;  5HD5 A;  1P9W A;  4OH0 A;  4R1G A;  2XK1 A;  2OSU A;  4DXC A;  5GLB A;  2ZL1 A;  2BTF P;  5GLA A;  4YOF A;  5AQ9 A;  4X1L A;  5GHY A;  3MF0 A;  3UDF A;  1ACF A;  3VFH A;  3NC8 A;  4KQQ A;  1NLZ A;  1GHP A;  1K56 D;  2Y2N A;  2PR6 A;  3SZT A;  1NLY A;  3GMW A;  4WMC D;  1F98 A;  4RQ9 A;  1YKD A;  3BLM A;  5F1G A;  3F1N B;  3FKV A;  4OOM A;  1PIO A;  1BUE A;  3FC7 A;  1QMF A;  3ZGA B;  1DJC A;  3QP1 A;  3QP6 A;  5G18 A;  4UQI S;  1J9M A;  4ZJ1 A;  4BBU A;  2QKP A;  3PAE A;  3PYP A;  1TF1 A;  3C30 A;  4XXR A;  2LB9 A;  3EGD C;  2XDM A;  4Q0I A;  5GL9 A;  4KQR A;  1WE4 A;  5U47 A;  1W63 M;  3KSI A;  2IA2 A;  2XD5 A;  3F1N A;  1STZ A;  5CGS A;  3CG5 A;  2J3T C;  1SDE A;  1NYY A;  1S67 L;  1L0G A;  4EW7 A;  2Z2M B;  1SCW A;  5CXW A;  2XEP A;  5DKL A;  3HL9 A;  1K38 A;  4ZBE A;  3PBO A;  1NJ4 A;  1BT5 A;  4PMA A;  4GOG A;  4S2K A;  5I5L A;  5D3O A;  1DP6 A;  2VV8 A;  1MKM A;  2HDU A;  2EX2 A;  1S4S A;  2RL3 A;  3NDE A;  4OQI A;  3T4S A;  2C6W B;  3N8L A;  2OWH A;  2O9C A;  4JKT A;  3DWK A;  2OWJ A;  4ZJ2 A;  4RX3 A;  4BLM A;  3NHQ A;  2ZQ7 A;  4CJN A;  1KE4 A;  4YIN A;  4Q8I A;  3HUO A;  4Y17 A;  2PD8 A;  5TFQ A;  1BTL A;  1FCN A;  5GLD A;  1ZG6 A;  4O7D A;  2Q9N A;  3HLE A;  3N7W A;  4Y15 A;  4IBX A;  4OLD A;  3ZQ5 A;  4O8G A;  4Q0H A;  5F6A A;  5HWV A;  4ETX A;  3FPW A;  3TW8 A;  1S4R A;  5FQK A;  1JNU A;  5KSC A;  1YT4 A;  1KVL A;  3FPV A;  3LO7 A;  5GHZ A;  3C4P A;  5HPI A;  4IHQ A;  5HWT A;  1IOU A;  2Y79 A;  1D1J A;  1K54 C;  1ZHH B;  1XGJ A;  1D7E A;  4DN0 A;  4MDZ A;  4DKI A;  3GRJ A;  4GW9 A;  3GV9 A;  1S66 L;  3E4O A;  2M7U A;  3LI8 A;  3HBR A;  2I9V A;  3HLF A;  3IHA A;  3BQA A;  1ESU A;  3GVB A;  2J9O A;  3G4P A;  3MZF A;  5FI6 A;  3HUN A;  2ZQC A;  3ZFZ A;  3ZVW A;  1MPL A;  4HOI A;  3TG9 A;  4BMW A;  2OV5 A;  5FAT A;  1VQQ A;  2W3E A;  1JTD A;  5TBM B;  4OP8 A;  1NWZ A;  4FH2 A;  4ID4 A;  1DY6 A;  3G30 A;  1H5X A;  3F1P B;  2Y2H A;  4ESP A;  4IED A;  4K0X A;  4GLQ A;  1VM1 A;  3WRZ A;  5TJJ A;  4FCF A;  4GKU A;  5F5Y A;  5L8M A;  3OOV A;  3FZC A;  3UE0 A;  5AJG A;  2JKF A;  2ZC6 B;  2WGV A;  2NUT C;  1PW8 A;  1H3Q A;  5FQQ A;  1PI5 A;  3LIB A;  1MC0 A;  4EUZ A;  3D3O A;  1P97 A;  3F1P A;  2EXB A;  2Z6C A;  1T1A A;  4QD4 A;  4MN5 A;  4PM7 A;  2QYB A;  5EOO A;  5HDS A;  3CPT B;  4NXF A;  3WS4 A;  4LV1 A;  3T1R A;  4X6T A;  4S2O A;  3V3R A;  5LBR A;  5EEC A;  1DRM A;  5IT5 A;  4H8R A;  4CPK A;  2W3G A;  4DE3 A;  4NG2 A;  3SOI A;  3VOZ A;  5CX7 A;  3N6I A;  3MFX A;  1ERO A;  3BY8 A;  2ZJ9 A;  2V0U A;  5A92 A;  4JXV A;  3HUM A;  3CPT A;  4CLC E;  5KZH A;  3LY3 A;  5FQI A;  3G31 A;  2JC7 A;  4FOF A;  5F83 A;  1I5Q A;  2EWW A;  1H0M A;  3UB9 A;  4I5S A;  4ETZ A;  3E2L A;  2A24 A;  4K91 A;  2XQZ A;  1WYC A;  3H7W A;  3BY9 A;  1LL8 A;  3SW1 A;  4B88 A;  3MKF A;  3D4F A;  3IBJ A;  1I2W A;  4E6X A;  3UO9 A;  2DCF A;  1JTG A;  4F3L B;  3EEA A;  1K55 C;  5A91 A;  1E25 A;  1LSV A;  2YKF A;  5HAI A;  1YLZ A;  5I94 A;  3JVU A;  3QNC A;  4P6Z S;  3B3X A;  3Q81 A;  2WKE A;  2K31 A;  4E3M A;  3C4O A;  3VOL A;  2Y2K A;  3A3F A;  2Y2Q A;  2VLG A;  4OQ0 A;  4DJ3 A;  3KYZ A;  4GJ4 A;  3T4L A;  5KIZ A;  1K54 A;  1Y4O A;  2K7S A;  4EWF A;  5HAQ A;  4F3L A;  5CEB A;  3UE1 A;  3UB8 A;  1PFL A;  3ZG0 A;  4U0T A;  2ZLY A;  1GSW A;  2HDR A;  5DTK A;  5M18 A;  5CGX A;  3VP3 A;  4KZ5 A;  2J3T D;  1GHI A;  3P01 A;  1NRJ A;  3UE6 A;  3N8S A;  5KSH A;  4OQG A;  4A5R A;  4U0X A;  5HL6 A;  4C75 A;  4OPY A;  4KQO A;  2XH9 A;  4QWO A;  3T50 A;  3CJM A;  1FQG A;  2XGN A;  3LI9 A;  3VP2 A;  4CQH A;  3BFF A;  3B42 A;  4UAA A;  5M1A A;  4WEL A;  2P04 A;  3A3E A;  3S22 A;  1TS0 A;  4EU0 A;  3A0R A;  1TS8 A;  5J8X A;  3RJU A;  5EVE A;  4KG5 A;  4DDS A;  2DNS A;  4OON A;  3R4K A;  1W7F A;  4WZ4 A;  1G5U A;  3T4J A;  3DAV A;  1Y28 A;  3IH9 A;  3MQO A;  4L0L A;  3C2W A;  4JF4 A;  1X0O A;  4R0Q A;  4GD6 A;  1KE0 A;  2VKS A;  1LI0 A;  1MKI A;  5CED A;  2WKI A;  3UN7 A;  1J3W A;  3Q1F A;  1YMS A;  3TJZ C;  2A49 A;  4OPZ A;  5EVI C;  3IWO A;  5AVF A;  4R38 A;  1OPX A;  1SKO A;  5CRF A;  3CI6 A;  2XA7 S;  1XP4 A;  2ZMF A;  3CLO A;  2VV6 A;  3E0Y A;  3F1O B;  3W8K A;  3WS1 A;  1CK3 A;  4WMC A;  3DWZ A;  1KGE A;  4P6B A;  1BYW A;  1BZA A;  2XSS A;  1VET B;  3H9W A;  4X55 A;  4Y0U A;  2WUQ A;  5HAP A;  5DFY A;  4KZ3 A;  1ZTU A;  2M1C A;  2G7U A;  3C7U A;  2Z2L B;  1JVJ A;  2PU2 A;  2V9A A;  2E8J A;  2D02 A;  1OTI A;  3OPH A;  3F1O A;  4NXG A;  3CAX A;  3B33 A;  4HP9 A;  4DMZ A;  2CMN A;  4LRZ E;  4FUW A;  5E2H A;  4OP5 A;  1N9N A;  1OT9 A;  2V1A A;  4EBL A;  4Y3I A;  4WEK A;  4ARZ B;  5AQB A;  3QNB A;  3SH8 A;  4R3A A;  1NZU A;  5L09 A;  4GB7 A;  2V20 A;  1CQA A;  5HAR A;  3MR0 A;  3KSG A;  2XRN A;  1OTA A;  1H8Y A;  2XF3 A;  3UMD A;  4JGO A;  4Y0O A;  1HVB A;  2JCH A;  2JKR M;  2J3W A;  4KZB A;  1IKG A;  5KMW A;  2WGW B;  1K6S A;  2JHE A;  4E3J A;  4ARZ A;  4MMN A;  1ONH A;  2LB5 A;  3BQ8 A;  3BRM A;  4HJ6 A;  5AQ7 A;  4MBF A;  1YLJ A;  4JXG A;  5FQ9 A;  4DDY A;  4OVD A;  1W5D A;  4BEN A;  1N4O A;  1MWU A;  5DF8 A;  4O01 A;  2EA9 A;  4HIA A;  3BLS A;  4KQD A;  3HCY A;  2PD7 A;  3EWK A;  2WGW A;  4X53 A;  1L0D A;  1W63 Q;  1ZKJ A;  2WZX A;  5FAS A;  4AFI A;  3CUE C;  3O5Y A;  4G3V A;  1XA1 A;  4JGQ A;  2OAQ 1;  4DE1 A;  2PRF A;  2CC1 A;  2HF6 A;  1CEF A;  1LLB A;  4OQH A;  3C5A A;  2PBY A;  4EBP A;  4LEN A;  1M6K A;  4KZ9 A;  1NY0 A;  4YNR A;  5EVI B;  4S2P A;  2H5S A;  2HPB A;  4MN6 A;  3D72 A;  1LI9 A;  2DRW A;  4G3W A;  2ZQ8 A;  3IXG A;  5F69 A;  3BFD A;  3KYQ A;  1F9I A;  4EBN A;  3G35 A;  2XRO A;  5FEF A;  3VE3 A;  5M19 A;  2VV7 A;  2WK0 A;  2HV1 A;  1MY8 A;  3MFD A;  5DF9 A;  3NI9 A;  4I3J A;  4LCL A;  1PWD A;  2HDQ A;  5HSQ A;  1A0K A;  3ZVT A;  2ZQA A;  3IF6 C;  2EX9 A;  2PAV P;  4BBT A;  4JXS A;  4GS9 B;  3VSL A;  1KVM A;  3HLC A;  4WL9 A;  2B95 A;  3LIC A;  4LCM A;  5EE8 A;  5EM0 A;  5TGF A;  2R78 A;  1D06 A;  3V67 A;  2P08 A;  3MXR A;  4EQI A;  1TDL A;  3EGX C;  1IFQ A;  1P9R A;  2OAP 1;  2WZZ A;  4PKY G;  1LSX A;  1DP9 A;  2X71 A;  3CWF A;  3ZG9 B;  2X01 A;  3LR3 A;  3FV7 A;  2I72 A;  5AQA A;  3VFF A;  3LIA A;  5GLC A;  4I3I A;  3KSH A;  3O87 A;  3GQZ A;  3NOP C;  2EX8 A;  4M4X A;  4WZ5 A;  3E98 A;  3UPO A;  1YLT A;  4GZB A;  3W2Z A;  5IS1 A;  3GDI A;  3BJN A;  4PM9 A;  4S2I A;  4EES A;  1H8Z A;  3M2K A;  3ITA A;  5HPF A;  1GA9 A;  2VGJ A;  4XT2 B;  4IVI A;  3IWQ A;  5A93 A;  3OPR A;  4WN5 A;  4GN2 A;  4HP4 A;  2L4R A;  3TOI A;  1ODV A;  3V39 A;  1K25 A;  3S1Y A;  3T4K A;  2KOI A;  3JYI A;  3K2N A;  4R23 A;  1K57 A;  3SS4 A;  3UPP A;  3IXB A;  4MBK A;  3UB6 A;  2PHY A;  3TE8 A;  3K3D A;  1YLY A;  1ES3 A;  1PWG A;  4XT2 A;  5K5B A;  4JF5 A;  5EVI D;  3G32 A;  4N1X A;  2G2U A;  1ES2 A;  2XD1 A;  5DFX A;  1PI4 A;  5MC7 A;  4I39 A;  2W1T B;  3PBN A;  4KG2 A;  1BLS A;  4S2N C;  3S7N A;  2IWD A;  1N9O A;  4DE0 A;  5EM1 A;  3M2J A;  3MSH A;  4EXO A;  3CUE A;  5CTN A;  2QWS A;  3GR2 A;  3IXD A;  3MZE A;  4HJ3 A;  5GHX A;  2B18 A;  3OBF A;  5EPH A;  4YWZ A;  4JLF A;  2ZOH A;  5TBM A;  3O88 A;  1WA9 A;  4RVA A;  1NXY A;  2JKG A;  2V2F F;  3IF6 B;  1FSW A;  2UWX A;  5CHM A;  1XPB A;  2JKT M;  4GNU A;  4RX2 A;  4FTX A;  2WKQ A;  2INW A;  4EEU A;  3SS3 A;  4JGR A;  1S1Y A;  4LRX C;  3LFV A;  5J7E A;  2ZM0 A;  4OPR A;  3S7P A;  4KZ4 A;  2ZC7 A;  2W3D A;  2Y59 A;  4LV2 A;  4N1H A;  3U4L P;  3C38 A;  1ESI A;  4MCW A;  3PBR A;  2VA0 A;  3KX0 X;  2EXA A;  4PKY A;  1YAX A;  4GHI B;  1XFQ A;  1CI9 A;  1XXM A;  3W4P A;  3IF6 A;  2HDS A;  2V8F A;  1DJA A;  1TS7 A;  5IHV A;  2QZ6 A;  1HZO A;  1YQS A;  1AWI A;  2ZMA A;  1Z09 A;  1ZC2 A;  4NEE D;  4X69 A;  4HY8 A;  1U60 A;  4GCZ A;  4LPZ A;  3PBS A;  2GNX A;  4E3O A;  4P6Z M;  3LUQ A;  1PYY A;  3G2Y A;  4GHI A;  3UE3 A;  4PAU A;  3DTE A;  4JF6 A;  1CEG A;  3ZNY A;  4IUH A;  4MBH A;  3JPU A;  1Q2Q A;  2GX5 A;  4WF0 A;  5F1F A;  4DRT A;  4EEP A;  5HW3 A;  4RA7 A;  3PBQ A;  2G2W A;  2Q0O A;  2MJ6 A;  3SH9 A;  5AVE A;  5HD3 A;  4B93 A;  1BUL A;  3W4Q A;  1VB6 A;  2QHK A;  2PDR A;  5FA7 A;  2HJ9 C;  4U3T A;  4BD0 A;  4DE2 A;  1XJ2 A;  4KZ7 A;  3A3D A;  2ZC5 B;  3HLG A;  1ERM A;  3Q7V B;  3LCE A;  5E2F A;  1BLP A;  4UA9 A;  1GSX A;  1FR6 A;  4PHT A;  3NEC A;  3IF5 A;  3KSF A;  4OPQ A;  3G6O A;  5BOH A;  4HH2 A;  1ALQ A;  1PNE A;  5TR7 A;  3G34 A;  5L10 A;  3FKW A;  2YKH A;  3WRT A;  1BLC A;  3KYE A;  4BL3 A;  3Q7V A;  4FD8 A;  2ZQ9 A;  5FQJ A;  5FSR A;  5A8B A;  3P09 A;  1C3B A;  3HJI A;  2Y2G A;  3M6B A;  4JGP A;  5FI2 A;  1XA7 A;  3GSG A;  3TSG A;  1QME A;  1RGY A;  4F94 A;  2A2L A;  2ZQD A;  1G28 A;  1L0F A;  1VEU B;  4ZJ3 A;  2NUP C;  4MEZ A;  2XA7 M;  3IS2 B;  1RCJ A;  1W8Q A;  1CJF A;  4LRY C;  2ZD8 A;  3PHY A;  3VP4 A;  4R6L A;  1W79 A;  1PZP A;  2P7J A;  3DTI A;  4P87 A;  1T18 A;  4JBF A;  2A3U A;  1XJ4 A;  4XUZ A;  4KZ6 A;  5HZH A;  3I7J A;  4ME4 A;  3HJK A;  1VEU A;  1YLW A;  2JN7 A;  1FIK A;  4WYY A;  1LT0 A;  3BFE A;  2Y2O A;  4QJG A;  3IS2 A;  1OJ5 A;  3V3S A;  4C6Y A;  3V50 A;  2EX6 A;  4Y2F A;  3EOI A;  5DTT A;  1YSP A;  1YLP A;  4G3K A;  3N8R A;  3OPL A;  3C8C A;  2W3F A;  2FZ0 A;  3RXW A;  1WYB A;  3T1Q B;  4QY6 A;  2W27 A;  3OC2 A;  4MN7 A;  2PYP A;  2VGL S;  1IYQ A;  1RGZ A;  4N9L A;  2D01 A;  2KLI A;  5FI7 A;  2O99 A;  4LV3 A;  2P74 A;  4Z1W A;  2VJW A;  3IBR A;  3MBZ A;  3UME A;  1VET A;  3M6H A;  3BW6 A;  1Y54 A;  4K08 A;  1BSG A;  5CHU A;  3N4I A;  1IYP A;  1IYS A;  2H0Y A;  3MXS A;  3UY6 A;  1KE3 A;  4E04 A;  2HGV A;  3OCL A; 
#chains in the Genus database with same CATH homology
 3LIC A;  2JKT I;  2R78 A;  1D06 A;  1MC0 A;  3LIB A;  5DJT A;  3S7O A;  3RFB A;  3V67 A;  5J4E A;  3D3O A;  2P08 A;  1P97 A;  3F1P A;  2FH5 A;  2VEA A;  1IFQ A;  3EGX C;  4DJ2 A;  4WEJ A;  1P9R A;  2Z6C A;  1T1A A;  3P7N A;  2OAP 1;  4MN5 A;  3MMH A;  4PKY G;  2QYB A;  1LSX A;  5HDS A;  1DP9 A;  4EET B;  3UB7 A;  4NKP A;  1UWN X;  4NXF A;  3CWF A;  5F68 A;  5LBR A;  3LR3 A;  2H28 A;  3LIA A;  1LSW A;  1DRM A;  5IT5 A;  3MJQ A;  4I3I A;  3KSH A;  1OTE A;  3NOP C;  3MXQ A;  2W3G A;  4M4X A;  5FL3 A;  3T4Q A;  3E98 A;  1XJ3 A;  5CX7 A;  5IS1 A;  3W2Z A;  3ICY A;  2W3H A;  3GDI A;  4UQI M;  4CLC D;  3MFX A;  3BY8 A;  3BJN A;  3ULF A;  2PR5 A;  3EEH A;  2V0U A;  4EES A;  3H82 B;  1G6O A;  2ZBB A;  5HPF A;  4XT2 B;  4CLC E;  3T4T A;  4FOF A;  1YSQ A;  2KX6 A;  2EWW A;  3GEC A;  5EFW A;  3UB9 A;  3PXP A;  4HP4 A;  4I5S A;  2L4R A;  3LIF A;  4WN5 A;  5G4Y A;  1ODV A;  4ETZ A;  1OT6 A;  2VGL M;  2A24 A;  3T4K A;  1MZU A;  2KOI A;  2V1B A;  3H7W A;  3JVV A;  4HNB A;  3K2N A;  2W0N A;  4UEY A;  3BY9 A;  1LL8 A;  4O0P A;  3MQQ A;  3SW1 A;  3UB6 A;  2PHY A;  3IBJ A;  3K3D A;  3TE8 A;  2WKR A;  3H82 A;  2DMW A;  2J80 A;  3RH8 B;  4NXE A;  4XT2 A;  5K5B A;  4Y5F A;  4F3L B;  3K3C A;  5IU1 A;  3EEA A;  3LID A;  1F5M A;  1LSV A;  5J3W A;  2YKF A;  5DFX A;  5MC7 A;  4I39 A;  1KOU A;  2W1T B;  3JVU A;  4P6Z S;  1OTD A;  3T4O A;  2K31 A;  1GSV A;  1T19 A;  3PBN A;  3VOL A;  3R7W B;  2VLG A;  3S7N A;  4EER A;  4DJ3 A;  1N9O A;  3KYZ A;  4GJ4 A;  3T4L A;  5KIZ A;  4EXO A;  3TRC A;  4KUO A;  4R70 A;  3CUE A;  2K7S A;  4II7 A;  1T1C A;  4F3L A;  2QWS A;  4FSF A;  3UB8 A;  4HJ3 A;  4HJ4 A;  1GSW A;  1TD5 A;  2B18 A;  4BBV A;  3OBF A;  1T1B A;  3EQV A;  4WUJ A;  3S7Q A;  4YWZ A;  4BJP A;  2ZOH A;  5TBM A;  1WA9 A;  2HJE A;  2J3T D;  3E4P A;  4Q0J A;  5HDC A;  3P01 A;  1NRJ A;  3UE6 A;  5KSH A;  3R7W A;  3FG8 A;  5HL6 A;  2L1M A;  4KQO A;  1UWP X;  2JKT M;  2JKR I;  3T50 A;  1XJ6 A;  5HDD A;  1OTB A;  2GZA A;  2QJ7 A;  2INW A;  2WKQ A;  4GS9 A;  4EEU A;  3LI9 A;  4EQ1 A;  4JGR A;  1S1Y A;  4CLC C;  2ZMV A;  4LRX C;  4CQH A;  3LFV A;  1N9L A;  3NOT C;  3B42 A;  5J7E A;  3S7P A;  4WEL A;  2OOL A;  2P04 A;  4I3A A;  5DKK A;  1TS0 A;  2W3D A;  4EU0 A;  3A0R A;  3LIE A;  3C38 A;  4MCW A;  3KO6 A;  2VA0 A;  3KX0 X;  3PBR A;  1V9Z A;  4PKY A;  2VX8 A;  1TS8 A;  1YAX A;  1EW0 A;  3A0S A;  3VV4 A;  4GHI B;  1XFQ A;  4B9O A;  4IJG A;  4BWI A;  5HD5 A;  1P9W A;  1TS7 A;  2KDK A;  3R4K A;  2ZOI A;  2Z6D A;  3U2A A;  3T4J A;  2QJ5 A;  4NEE D;  2M7V A;  1Y28 A;  3MQO A;  4YOF A;  4HY8 A;  4L0L A;  2L0W A;  4HH3 A;  4GCZ A;  4LPZ A;  3MF0 A;  3CIT A;  3C2W A;  1X0O A;  3PBS A;  3ZYT A;  2GNX A;  1NLZ A;  2VKS A;  2PR6 A;  1NLY A;  4HHD A;  1F98 A;  4L9G A;  4P6Z M;  4RQ9 A;  3TJZ C;  3LUQ A;  3LYX A;  4GHI A;  1YKD A;  3UE3 A;  4I38 A;  5AVF A;  4R38 A;  4PAU A;  1OPX A;  3F1N B;  4OOM A;  3LR4 A;  3CI6 A;  3FC7 A;  3OCN A;  2XA7 S;  3NOU C;  4IUH A;  2ZMF A;  3CLO A;  2VV6 A;  2GX5 A;  3E0Y A;  3F1O B;  4WF0 A;  4EEP A;  3PBQ A;  4UQI S;  2MJ6 A;  1BYW A;  4BBU A;  2QKP A;  3PYP A;  2XSS A;  1TF1 A;  3C30 A;  3H9W A;  5AVE A;  2LB9 A;  3LR0 A;  5HD3 A;  3EGD C;  5DFY A;  4Q0I A;  3BWL A;  4B93 A;  1ZTU A;  2O9A A;  4ZRR A;  1W63 M;  4L9F A;  1VB6 A;  2QHK A;  3KSI A;  2IA2 A;  2PDR A;  2HJ9 C;  2PYR A;  3F1N A;  1TS6 A;  1XJ2 A;  2M1C A;  1STZ A;  2G7U A;  2V9A A;  4NXB A;  2D02 A;  1OTI A;  3LR5 A;  2J3T C;  3NJA A;  3F1O A;  4NXG A;  3CAX A;  3OCL A;  1OJG A;  1S1Z A;  3B33 A;  1S67 L;  4HP9 A;  4DMZ A;  2CMN A;  4LRZ E;  4EW7 A;  1N9N A;  1GSX A;  3PBT A;  4PHT A;  1OT9 A;  4QPR A;  3KSF A;  5DKL A;  2V1A A;  3G6O A;  2W1T A;  3PBO A;  4Y3I A;  4HH2 A;  4WEK A;  4ARZ B;  4R3A A;  5I5L A;  1DP6 A;  2VV8 A;  2EWV A;  2O0Y A;  2YKH A;  1MKM A;  4HI4 A;  1VHM A;  3MR0 A;  3KSG A;  2XRN A;  1OTA A;  3UMD A;  4L9E A;  1S4S A;  4JGO A;  3T4S A;  5A8B A;  2OWH A;  2JKR M;  2J3W A;  2O9C A;  3HJI A;  4H6J B;  3MQ0 A;  4JGP A;  2OWJ A;  3DBA A;  2JHE A;  3NHQ A;  3RTY A;  3E4Q A;  4ARZ A;  2A2L A;  4MMN A;  2O9B A;  2LB5 A;  1G28 A;  3BQ8 A;  2PD8 A;  4HJ6 A;  2NUP C;  2GJ3 A;  4CLC B;  2XA7 M;  4KUK A;  3ZQ5 A;  2A24 B;  1P0Z A;  3IS2 B;  4O8G A;  4Q0H A;  5F6A A;  3H7W B;  5HWV A;  4LRY C;  1XFN A;  4OOL A;  3FPW A;  4ETX A;  4O01 A;  3PHY A;  3TW8 A;  2EA9 A;  4R6L A;  4HIA A;  5G4Z A;  4KQD A;  3HCY A;  1S4R A;  2P7J A;  2PD7 A;  3EWK A;  4H6J A;  1JNU A;  1T18 A;  1W63 Q;  3FPV A;  5C5K A;  1XJ4 A;  1UGU A;  4IUK A;  2PT7 A;  5HPI A;  4IHQ A;  5HWT A;  5HZH A;  1IOU A;  1DP8 A;  2Y79 A;  4ME4 A;  4AFI A;  3HJK A;  3CUE C;  3O5Y A;  4G3V A;  3OLO A;  1ZHH B;  4JGQ A;  2OAQ 1;  1D7E A;  4LLO B;  4DN0 A;  4MDZ A;  2JN7 A;  4CLC A;  2HF6 A;  1LT0 A;  4GW9 A;  5HWW A;  3B47 A;  1S66 L;  3E4O A;  3IS2 A;  1OJ5 A;  2M7U A;  3LI8 A;  2I9V A;  3BQA A;  4WLA A;  2WKP A;  4Y2F A;  3EOI A;  3PR6 A;  1YSP A;  4YNR A;  5DJU A;  4HQA A;  4G3K A;  2V0W A;  4MN6 A;  3D72 A;  2VZW A;  3C8C A;  4G3W A;  2W3F A;  2FZ0 A;  4HOI A;  2W27 A;  5F69 A;  4BMW A;  1H8M A;  2Y8H A;  3OC2 A;  3A0V A;  3KYQ A;  1F9I A;  4MN7 A;  2XRO A;  2PYP A;  3VE3 A;  3VE4 A;  3EQU A;  2VGL S;  2VV7 A;  2W3E A;  2K2N A;  5TBM B;  1NWZ A;  2D01 A;  2KLI A;  2HV1 A;  3F1P B;  5DF9 A;  2O99 A;  4I3J A;  4EUV A;  4Z1W A;  1V9Y A;  2VJW A;  3IBR A;  3UME A;  4GLQ A;  5HSQ A;  2B02 A;  3BW6 A;  4K08 A;  5TJJ A;  4BBT A;  4GS9 B;  5F5Y A;  2BAS A;  5L8M A;  3OOV A;  2W1R A;  5AJG A;  2NUT C;  4WL9 A;  4E04 A;  2HGV A;  1H3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...