1F5MA

Structure of the gaf domain
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
176
structure length
176
Chain Sequence
STGFHHADHVNYSSNLNKEEILEQLLLSYEGLSDGQVNWVCNLSNASSLIWHAYKSLAVDINWAGFYVTQASEENTLILGPFQGKVACQMIQFGKGVCGTAASTKETQIVPDVNKYPGHIACDGETKSEIVVPIISNDGKTLGVIDIDCLDYEGFDHVDKEFLEKLAKLINKSCVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAF
publication title Structure of the GAF domain, a ubiquitous signaling motif and a new class of cyclic GMP receptor.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 57
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2000-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13185 GAF_2 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1f5mA00
2W1TB 1YKDA 4IUKA 5DFYA 4DN0A 3RFBA 4FOFA 5HL6A 2W3GA 4Q0JA 3O5YA 3S7PA 2KLIA 2IA2A 3CITA 2XSSA 4G3KA 3S7OA 3HCYA 2Y79A 3NHQA 5LBRA 3NOUC 5HSQA 1TF1A 5HPFA 2VZWA 3NOPC 3W2ZA 4O0PA 4CQHA 5DFXA 5AJGA 4MDZA 4ME4A 4MN7A 1STZA 2O9BA 1VHMA 4EU0A 4LRZE 3BJNA 2W1TA 4IJGA 3E98A 2O9AA 2VKSA 3CI6A 2W3HA 4LRYC 4Y3IA 2M7VA 3NOTC 4Y2FA 3KSHA 3MMHA 4YNRA 4EUVA 3IBJA 3IBRA 2W3DA 2G7UA 2W3EA 3KO6A 4Q0HA 2GX5A 1MC0A 2LB9A 5TJJA 3S7NA 4GLQA 1TD5A 3MF0A 4PAUA 2O99A 3VV4A 2M7UA 2B18A 4DMZA 2Y8HA 2ZMFA 2W3FA 3K2NA 4Q0IA 4MCWA 4ZRRA 4E04A 3E0YA 5L8MA 2HGVA 5I5LA 4QPRA 3OBFA 4R70A 4GW9A 2O9CA 5C5KA 1YSPA 4MMNA 3DBAA 4RQ9A 3S7QA 1F5MA 4O8GA 4Y5FA 1MKMA 5K5BA 4G3VA 4R6LA 3OOVA 3ZQ5A 4BWIA 2VEAA 3D3OA 4IUHA 4Z1WA 3TRCA 3MQ0A 2VJWA 1YSQA 3C2WA 3KSFA 3KSGA 2XROA 4G3WA 2O0YA 3EEAA 4ETXA 1ZTUA 2XRNA 4YOFA 4LRXC 2QYBA 2W1RA 3KSIA 3R4KA 5HPIA 3G6OA 2K2NA 2K31A 2OOLA 2LB5A 3LFVA 4O01A 4ETZA 2KOIA
chains in the Genus database with same CATH superfamily
2VX8A 5HAIA 5CHMA 3MKEA 2RL3A 3BWLA 4CPKA 4E3LA 3QNBA 5HARA 5DFXA 2Y2OA 1LLBA 4E3OA 1YLZA 5EM1A 4R23A 5DF8A 1BSGA 3GSGA 2W0NA 1UWNX 2H10A 1VETB 3P01A 3UE1A 4GB7A 3QP1A 3DTEA 3LEZA 4BBTA 2ZQAA 3M2JA 2W3DA 4BL2A 1MC0A 2L1MA 4O7DA 1VEUA 3S7NA 3IX8A 4Y0TA 1TD5A 4S2NC 4LFUA 3LR4A 2JE5A 2ZOIA 4BL3A 4F3LB 2ZQCA 3DAVA 5FQQA 2P74A 1TS8A 2PYRA 4UQIM 3SOIA 2WKQA 4RX3A 2PD7A 4IEDA 1EROA 5M18A 3BEBA 4KG5A 5FAQA 1F2KA 2B95A 4NXEA 3VE4A 4DE2A 4R3AA 2VV8A 1RP5A 4AFIA 5K5BA 4JGQA 2WUQA 5L07A 3OPLA 3EQVA 4EQIA 2C6WB 1MZUA 1FIKA 2HDSA 4DDSA 5GL9A 4EV4A 1K0KA 2ZD8A 1IEMA 4X25A 1ZG6A 4YOFA 3G30A 3Q1FA 1G6AA 5A93A 4CLCD 4MBFA 4R3JA 5FQMA 3BECA 4MEZA 1YPRA 3HLFA 4OPRA 2LB5A 4XT2A 3VSLA 1G5UA 4JF4A 3EGDC 4QHCA 1N9BA 1IELA 4S2JA 4B9OA 2HP9A 1S6RA 2ZC7A 2KLIA 3H7WB 5DJTA 4U0TA 4BBUA 4S2MA 3CG5A 2XK1A 4HHDA 1L0DA 4K91A 4CJNA 4I3AA 3A3JA 1CEFA 5AJGA 1OTEA 3AGDA 3VOYA 1F98A 4Y15A 4JXGA 3N7WA 3TG9A 4QJGA 3OPHA 2IWCA 5DTKA 2V0WA 3KSHA 3IXGA 5GHYA 4E6WA 1KDWA 2EFUA 4XUZA 1LL5A 5HWTA 2PHYA 5F82A 2Q9MA 2J9PA 3HUNA 3E4OA 4MCWA 5FQJA 1YLWA 3D4FA 3V5MA 4WYYA 3LIEA 3MBZA 5GLAA 1HTZA 5FI2A 3QHYA 4E3JA 4E6XA 3IF6C 2ZQ9A 3BLSA 2IWBA 3OOVA 1ACFA 1CI9A 2JKRI 3MQ0A 3KX0X 1A0KA 2BLSA 4U0XA 5BOHA 4EWFA 3V67A 4QU3A 3F1NA 2XRNA 1J3WA 1MWUA 2ZM0A 1YMSA 1K4EA 5HDDA 3LY4A 4NETA 5TR7A 4GZBA 3L9KA 3ZHHA 1LL9A 1BLCA 4WUJA 1ONGA 4BD0A 2HJEA 2PU4A 1PRQA 3H9WA 4OOYA 2XA7M 2AVXA 3UO9A 1MWSA 2Y79A 5LBRA 3ZDJA 3C7VA 3BY9A 4IVIA 4NG2A 4WMCD 3WS2A 3HUOA 3UE3A 5HAQA 1NWZA 2C5WB 3IS2B 1KVMA 3KO6A 2EFXA 4GLQA 1Y28A 4KENB 4WZ5A 4GDNA 2P9VA 1VM1A 4DMZA 2Q9NA 1ZKJA 2E8IA 2HGVA 3UPPA 5CTNA 4LCMA 4OPZA 1XKZA 5EVIC 1SDNA 1XFQA 3DTMA 1ES5A 4BBVA 2P7JA 1MKMA 3DWKA 4R4RA 5GHXA 3P09A 4P6ZM 5HWWA 1H5XA 1XPBA 2JCHA 1IYQA 3BW6A 4R4SA 4R3BA 3QP2A 5AQAA 4GN2A 1OTAA 1VEUB 1ESIA 3MZEA 4HJ6A 3FKVA 3GQZA 3UN7A 5CX7A 4HQAA 4FD8A 4Y0UA 3NDGA 2OOLA 3WRZA 3HLDA 3ULFA 4KUOA 4ETZA 2KOIA 2KX6A 4HP9A 1NJ4A 5DFYA 3RFBA 4DXBA 2P08A 2QZ6A 1FR6A 3O5YA 1G28A 3IHAA 2OWJA 2DRWA 3LICA 3S7OA 2Y2GA 1TF1A 4N1XA 2HZ5A 3A0VA 5CGWA 4X1LA 1QMEA 3AGFA 1H8YA 5M19A 2YKFA 1D7EA 3HVFA 4WL9A 4JBFA 4YNRA 5EFWA 1XFNA 2H28A 3DTIA 3OLOA 4HJ3A 3CPTA 2HF6A 1K25A 4OQ0A 2KDKA 2Y2NA 3N6IA 3MF0A 4FTXA 4OKPA 3RTYA 1CI8A 2XFTA 2EX8A 3EOIA 4C3QA 2PRFA 1H0MA 5TBMB 4K08A 4GW9A 5FQIA 5AQ7A 4DDYA 4KZ8A 2FFFB 3PTEA 1F5MA 4WZ4A 4IBRA 5DF7A 4EETB 4Y5FA 5FA7A 3CAXA 1T1CA 3NECA 4GS9A 1PI4A 3HLWA 1NY0A 3BQAA 3RXWA 3FC7A 1CK3A 3E2LA 3ITBA 1ES2A 5EE8A 1N9OA 3ZG9B 3DWZA 2V20A 3LYXA 4HJ4A 2OV5A 3IXHA 4GDBA 3LR5A 5F68A 2A24B 1E25A 3IWOA 3UB8A 5HL6A 3UE0A 1XJ6A 2WADA 4Q0JA 2ZJ9A 3MQQA 5AQ9A 3LGOA 1SKOB 2HV1A 1DJAA 4A5RA 5I94A 4GHIB 4GCZA 5KIZA 3NHQA 2D01A 4WMCA 3SW1A 5HSQA 2VZWA 3C8CA 5TFQA 3JPUA 3HJKA 3KYEA 4MN7A 2JKRM 1RGYA 1S4RA 2BASA 2B02A 3MFXA 1K4FA 1D06A 5E2EA 4EEUA 3A0SA 4Y17A 3F1NB 3ZG5A 3Q7ZA 5J8XA 5KSCA 2WKIA 1K56D 5TJJA 3T50A 3LIBA 1ZC2A 3VP3A 3IXDA 3IWQA 3UDXA 3K2NA 5CGSA 2M1CA 3JVVA 4N9KA 5DJUA 3AGEA 3OBFA 4QY6A 2ZC5B 3VP4A 5FAPA 3ZG8B 1ALQA 4LLOB 4O8GA 1YLTA 2ZM2A 1RGZA 2VLGA 5F1GA 5HD5A 3FPWA 4X6TA 3BLMA 1MKIA 5KMWA 1JVJA 2VGJA 2JHEA 4KG6A 2GJ3A 2UV0E 1T18A 5EVID 4QB8A 5CHUA 2BTFP 3G6OA 2PR6A 2XFSA 1L0GA 3P7NA 4EUZA 1SZVA 2HP6A 4JGPA 5F6AA 4R1GA 3C7UA 4QY5A 2PD8A 3D9YA 2BG1A 3V3SA 2Y2QA 1HZOA 3HREA 3N8LA 5FATA 4UQIS 3S4XA 1FOFA 4KZBA 2DMWA 3A3DA 1OTDA 1F9IA 3PBNA 1V9ZA 2L4RA 1LI9A 3IBRA 3IBJA 3ITAA 2W3EA 3VP1A 3F1OB 1N9NA 3N4IA 1P0ZA 4PAUA 4BQMA 1GHMA 2M7UA 2H0YA 3Q07A 4KZ3A 4L9EA 1P97A 3QP8A 3QP6A 2WYXA 3IH9A 2X02A 4QD4A 3NJAA 5E2FA 1D1JA 3UDIA 4RA7A 5JYOA 2R9XA 1JTDA 3QP5A 3B3XA 5GLDA 3N8RA 1ERMA 4BLMA 3O87A 4WN5A 1NRJA 2JN7A 2ZQ8A 4D60A 2V8CA 4EERA 3EEAA 4KQRA 4LRXC 3IT9A 4H6JB 4S2IA 1FCOA 2MJ6A 3DW0A 2Y2JA 3T1RA 2XLNA 2K2NA 3BQ8A 3VP0A 4EBPA 4UHUA 5HDSA 5AVEA 1QMFA 4ZJ3A 4O01A 3PHYA 4KZ7A 3UPNA 3ZFZA 1LL8A 3E2KA 4LCLA 1SKFA 1AWIA 4B4XA 5G4YA 1PWGA 2GZAA 1DJCA 1XGIA 4WF0A 1XX2A 4G3KA 2HPBA 1BT5A 3QP4A 3CZDA 3Q7VA 1W63M 3BFDA 4XXRA 4PHTA 4OQHA 1BYWA 1STZA 4EU0A 4P87A 1DY6A 2W1TA 3OCLA 3GDIA 3CI6A 3SZTA 4EBLA 4KUKA 4H8RA 5A91A 1JNUA 4JLFA 5AVFA 3EEHA 1YT4A 4C6YA 5CGXA 4MN5A 5DKLA 1L2SA 3OZHA 4ARZA 4QPRA 5HZHA 1LSVA 3LUQA 1DRMA 2XD5A 2EX6A 4P6BA 1S1ZA 3H82A 3TSGA 5E2HA 1PZPA 5IS1A 3OCNA 2EXAA 2XA7S 2Z2MB 2YKHA 4I39A 3KYZA 2ZL1A 3CWFA 1V9YA 3GMWA 3FZCA 3R7WB 5J4EA 5EVIA 5KZHA 4NEED 3OC2A 3KSIA 3WS4A 3E4PA 4HIAA 4UEYA 3CUEC 1KGEA 2ZLYA 4OP5A 5EUAA 3V39A 4KQQA 3C4PA 3C30A 5A90A 4FH4A 1I2SA 2Y2LA 3MFDA 4FOFA 4L9GA 3U2AA 3ZG7B 2W3GA 4JF6A 3LIAA 3O86A 1LSXA 2XSSA 1DP6A 4UAAA 4GJ4A 4KZAA 5HPFA 3NOPC 1MXOA 1K55A 2XF3A 3B33A 2Y2HA 4S2LA 1KGGA 3M6HA 4LRZE 3SH7A 3WS0A 1K54A 2O9AA 3CJMA 3U4LP 2R78A 3SH9A 4ESPA 5HWVA 4HNBA 1ES3A 2G7UA 4P6ZS 4OH0A 4RX2A 4Q0HA 2GX5A 4Q8IA 3BYDA 4X55A 4N1HA 1K57C 5DF9A 3WS5A 1TDLA 1M6KA 3W4PA 3UB6A 3PAGA 4E04A 3T4SA 5L8MA 5I5LA 2W27A 5EOOA 3F1PA 3LIDA 4GD6A 1H3QA 5E2GA 1PFLA 1IOUA 3VFFA 4UA6A 4MN6A 1U60A 5EVLA 2WGWA 3O3VA 1YLJA 3C5AA 4OOMA 3G32A 2X01A 1MPLA 1E3UD 1ES4A 3KSFA 3DTKA 5DTSA 1K38A 3CLOA 4DJ3A 2ZQDA 1H8MA 4OQIA 1GSVA 1LHYA 3VOLA 4PKYA 3T4QA 1OJ5A 2J9OA 5FSRA 1YKDA 1FSWA 2EX9A 5CRFA 3T4TA 5CECA 1P9WA 4R38A 1EWZA 4CLCA 4KQDA 3CITA 5F83A 3M2KA 2G2UA 2XGNA 2V8FA 1KDSA 3HLBA 5L09A 4EW7A 3BFGA 1TEMA 3SS3A 1UGUA 2Z6DA 1Q2QA 4F94A 4UA9A 1XA1A 2JKTM 3VP2A 4NK3A 1L0FA 3Q82A 3MSHA 3QNCA 3UPOA 1TDGA 1OJGA 4M3KA 4ZJ1A 2VGKA 5J3WA 2V9AA 2WAEA 2ZMFA 4N9LA 3PR6A 2WKHA 4EESA 4OLGA 1WE4A 1DP9A 1VQQA 2PR5A 1K6RA 2QKPA 5C5KA 3FG8A 2JKFA 2INWA 5IHVA 3ZYTA 5GHZA 4JXWA 1J9MA 4MNRA 5HDCA 3D72A 3OPPA 4XT2B 3GRJA 4F3LA 1NZOA 2VJWA 3FPVA 4NXBA 3ZNYA 2DCFA 2ZMAA 4Z9QA 3PBSA 4XUXA 4WZ5C 4HOIA 2D02A 3EQUA 3G4PA 1KOUA 3T12B 1FCMA 3T4LA 5FQKA 4II7A 4OOLA 3MXRA 3HLEA 2WKRA 5IT5A 3UB7A 1W5DA 3IHBA 4WM9A 4NKPA 1L0EA 1XP4A 4HBTA 2ZL1B 3G35A 5EM0A 2OLVA 3H7WA 4E3IA 5EV0A 3T1XA 4HY8A 2Z2LB 4JGRA 1WYCA 1SHVA 1ESUA 4I3IA 3S22A 4EQ1A 3TOIA 1BUEA 3A3IA 3BFCA 1W8QA 4PMAA 4X68A 2ZMVA 2GNXA 5A92A 4ZAMA 2O9CA 3MJQA 3ICYA 3B47A 4B4ZA 1YSPA 2ZC4B 4RQ9A 4HEFA 3PAEA 4HH3A 3T4JA 3TW8A 2ZBBA 2Z6CA 4BWIA 1E3UA 5G18A 1L3LA 4B93A 4LV1A 4S2PA 3C2WA 2WGIA 2O0YA 5DTTA 4YINA 2V1ZA 2XD1A 4BMWA 2XQZA 4Y13A 4ETXA 3MS6A 2QYBA 1Y4OA 4S2KA 2HDQA 4R0QA 3UMDA 3G31A 4S2OA 4S2NA 4UA7A 2ZC6B 3G2ZA 3PBOA 1S67L 5HW3A 2VA0A 1O07A 3MXSA 4KQOA 1MWTA 5KSHA 4LPZA 4EBNA 1BULA 2E8JA 1PNEA 3M6BA 5JYPA 4IVKA 1XJ4A 2P9VB 1IYSA 1H8ZA 1MWRA 5FQ9A 5FDHA 1FQGA 3VFHA 3E98A 3KYQA 3UB5P 4Y3IA 4Y7PA 1ONHA 2Y4AA 2ZC3B 5E43A 4EUVA 3O88A 2G2WA 5EECA 2J3TC 1OT6A 2LB9A 3WWXA 1N4OA 3T4KA 4Q0IA 1GSXA 2ZM8A 1ZG4A 3I7JA 1IKGA 1Q2PA 4MBHA 4CLCB 2VGLM 3IS2A 3SS5A 3DBAA 2V1BA 2WKEA 2HDUA 3ZQ5A 4IUHA 4RVAA 3ZCZA 4YFMA 3B42A 3T4OA 1I5QA 3UY6A 2PDRA 5CHJA 3KSGA 2WGVA 3FWLA 4BJPA 5U47A 1XA7A 1ZTUA 3JYIA 3N8SA 1NXYA 3NCKA 1PI5A 2Y59A 1T1BA 3LR0A 2K31A 1S0WA 1BLSA 1PW8A 3GVBA 2EXBA 4DN0A 3HLCA 5F1FA 3NULA 3IQAA 5CEBA 3NIAA 2I9VA 3CPTB 2JKTI 3IF6A 4DE1A 3CUEA 1S1YA 2QMIA 4MDZA 4ME4A 5FL3A 4PM5A 2J3WA 2DNSA 4M4XA 4IJGA 1SDEA 2M7VA 3K3CA 1JWPA 5A8BA 1XJ2A 4DKIA 5GLBA 2WZZA 4K0XA 1YLYA 4K0WA 3MZFA 1IFQA 2I72A 5CEDA 3VV4A 2VV7A 3ZG0A 4GS9B 5GLCA 3TE8A 3LO7A 3IXBA 4DRTA 3C38A 1GHPA 4DE3A 3GECA 3MQOA 3VE3A 2HJ9C 1K56A 1RCJA 1JWZA 5G4ZA 3A3FA 4MMNA 4N92A 4PKYG 2ACGA 1K57A 3V3RA 5FI6A 1YAXA 4I5SA 2VEAA 4Z1WA 1LSWA 1E4DA 3OPRA 3HJIA 1W8YA 2R9WA 3BFFA 3LR3A 4CLCE 5TBMA 2GDNA 4QWOA 4OPQA 4DXCA 5EPHA 3S1YA 5HPIA 1CEGA 2OSUA 1KE3A 4IHQA 1K6SA 1XJ3A 3RXXA 2EX2A 1PZOA 1TVFA 2V0UA 2JKGA 3A0RA 1HVBA 3LEQA 4FH2A 4JXVA 1SCWA 1NYYA 1YLPA 2PBDP 4HESA 2WZXA 2P04A 1O7EA 1NLYA 2QJ7A 4CQHA 2CC1A 5FEGA 4JPMA 5FI7A 2PYPA 2OAQ1 1W7FA 3UNWA 2A24A 2NUTC 3BJNA 3EGXC 2HP5A 4OLDA 2VKSA 2W3HA 4LRYC 4WEKA 1ODVA 1IYPA 1YM1A 1IKIA 4ZBEA 2QWSA 2WKPA 1MY8A 1SKOA 2K7SA 3PBRA 4IBXA 2WAFA 1XXMA 4GHIA 4WEJA 4HI4A 1OPXA 4MBKA 2B18A 2Y8HA 2W3FA 1PWDA 3MR0A 4L9FA 1S66L 1PYYA 1GA0A 1LT0A 1HD8A 2ZQ7A 5DKKA 3BFEA 4FCFA 4OQGA 4KG2A 3S7QA 1NZUA 2J3TD 1KGFA 1OTBA 5HD3A 4JKTA 5D3OA 5HX9A 3LCEA 2B5RA 1YSQA 4P85A 1GCEA 2L0WA 2J7VA 4KZ5A 3ZVTA 4LENA 2A3UA 4WELA 3IX4A 4I38A 3PXPA 1G6OA 4GOGA 4OP8A 2OWHA 2H5SA 4D2OA 2QJ5A 3CHWP 3UB9A 2PAVP 1CJFA 1PIOA 1TS0A 4DF6A 4EXOA 1GA9A 1XGJA 4ZTKA 2UWXA 3HL9A 3C4OA 3NBLA 4LV3A 2QHKA 4X1MA 4KZ9A 4GD8A 3HCYA 2J80A 1N9LA 2XDMA 2XH9A 2O9BA 3FKWA 1UWPX 1JWVA 3LI9A 2XEPA 2A49A 3K3DA 4WLAA 3ZGAB 2PBYA 1T1AA 4KZ4A 4GNUA 5F5YA 3PBTA 3W4QA 5CERA 1TS7A 3GR2A 3VMAA 3ZVWA 4LGWA 3E0YA 4E3NA 3LIFA 1Y54A 5TGFA 4HH2A 5HL1A 4MLLA 2WK0A 5MC7A 1I2WA 3IF6B 3G2YA 3F1OA 1BLHA 2X71A 1K55C 4X69A 1WYBA 1FCNA 4G3VA 3LY3A 4BD1A 3D3OA 1EW0A 2JC7A 4P0MA 3W8KA 1K54C 3E4QA 1Z6FA 1W79A 1CQAA 1VETA 4G3WA 1BZAA 1MBLA 5FDSA 3IWIA 1JTGA 2W1RA 3PBQA 3R4KA 4E3KA 1LI0A 4PPRA 3V50A 3BM6A 3Q7VB 4PM9A 3LFVA 3PYPA 2W1TB 3EWKA 4IUKA 1PWCA 5CTMA 2XR0A 1P9RA 2V2FF 4OVDA 4X53A 3IX3A 3GTCA 3T1QB 3S7PA 2PT7A 3CMZA 4H6JA 3G34A 4JXSA 2Y2KA 5CXWA 2FH5A 3W2ZA 1KE4A 3ZNTA 3JVUA 5HFOA 1EI5A 2QPNA 5DVAA 4ARZB 3LI8A 4PM6A 4C75A 2IWDA 3MMHA 4KZ6A 1NYMA 5EVEA 5EOEA 3HUMA 4FSFA 1FR1A 3H82B 2O99A 1YQSA 3SS4A 5AQBA 3UMEA 1PW1A 4WBGA 1KE0A 3NI9A 1TS6A 4OONA 3MZDA 4CLCC 1ERQA 4JGOA 5EVIB 4NXFA 4U3TA 2ZOHA 2EA9A 1YMXA 4DJ2A 3GV9A 1OTIA 3NC8A 1FILA 3Q81A 5M1AA 2Y91A 4PM8A 3WS1A 3RJUA 1DJBA 3FYZA 3L7HA 2XROA 3HBRA 2CMNA 2Y2IA 1AXBA 1GHIA 4ZJ2A 1S4SA 5J7EA 3NY4A 2OAP1 4DE0A 2J8YA 3BY8A 2HDRA 1ZHHB 4GKUA 1OMEA 4JF5A 2VK3A 1IYOA 3IH8A 4BENA 3HLGA 3ISGA 3R7WA 5F69A 2IA2A 3TJZC 4OPYA 2NUPC 1X0OA 3UDFA 2V1AA 1M40A 3NOUC 4O0PA 2VGLS 3BRMA 1VHMA 5FAOA 4EEPA 2PU2A 1W63Q 5FEFA 1BLPA 4L0LA 1NLZA 4I3JA 1Z09A 3NOTC 4Y2FA 1T19A 3WRTA 2FZ0A 3F1PB 3P98A 4LV0A 4NXGA 1C3BA 1G68A 5HAPA 3T1SA 1FSYA 5L2FA 3IF5A 4X56A 2WGWB 1HLUP 1NRFA 1OT9A 4ZRRA 2H0TA 3VOZA 1CF0A 4ID4A 4E3MA 4R70A 2EWWA 3SH8A 3FV7A 4B88A 2Y2MA 4YWZA 3VSKA 2EWVA 2VV6A 3W4OA 4HBUA 4R6LA 1GSWA 5IU1A 5FASA 1DP8A 3TRCA 2JBFA 4RYEA 3UE6A 3MKFA 4Y0OA 2Y55A 1WA9A 4PM7A 1BTLA 2Y2PA 2RCXA 4FUWA 3NDEA 2Q0OA 1KVLA 2FFYA 2A2LA 1VB6A 5L10A 3MXQA 3RH8B 4LV2A 2OLUA 4HP4A 3A3EA 4ZDXA
chains in the Genus database with same CATH topology
2VX8A 1YKDA 2V0UA 3A0RA 3T4TA 3UB8A 5HL6A 1P9WA 4R38A 1XJ6A 4Q0JA 4CLCA 3MQQA 3CITA 4KQDA 2HV1A 4GHIB 4GCZA 5KIZA 2P04A 3BWLA 3NHQA 2D01A 3SW1A 5HSQA 1NLYA 2VZWA 3C8CA 2QJ7A 4CQHA 5DFXA 3HJKA 4EW7A 4MN7A 2JKRM 2PYPA 1S4RA 2BASA 2OAQ1 2B02A 3MFXA 1UGUA 2A24A 2NUTC 3BJNA 3EGXC 2W0NA 1UWNX 2Z6DA 1D06A 3P01A 2VKSA 4EEUA 2W3HA 3A0SA 4LRYC 4WEKA 1ODVA 3F1NB 4BBTA 2QWSA 2W3DA 2JKTM 2WKPA 3PBRA 2K7SA 1MC0A 2L1MA 5TJJA 4GHIA 4WEJA 3S7NA 3T50A 3LIBA 4HI4A 1OJGA 1OPXA 1TD5A 3LR4A 5J3WA 2B18A 2V9AA 2Y8HA 2ZOIA 2ZMFA 2W3FA 3K2NA 4F3LB 3PR6A 2M1CA 3MR0A 3JVVA 4EESA 4L9FA 1TS8A 5DJUA 2PYRA 1S66L 1DP9A 2PR5A 3OBFA 4UQIM 1LT0A 2QKPA 2WKQA 2PD7A 5C5KA 3FG8A 5DKKA 2INWA 4NXEA 3VE4A 3S7QA 3ZYTA 4LLOB 4O8GA 4R3AA 2VV8A 4AFIA 2J3TD 5K5BA 4JGQA 1OTBA 5HD3A 5HDCA 3EQVA 3D72A 4XT2B 5HD5A 2VLGA 4F3LA 1MZUA 3FPWA 2VJWA 3FPVA 1YSQA 2L0WA 4NXBA 3PBSA 4WELA 4YOFA 4I38A 3PXPA 2JHEA 4CLCD 1G6OA 2GJ3A 1T18A 4HOIA 2OWHA 2D02A 2QJ5A 3EQUA 3G6OA 2PR6A 1KOUA 3UB9A 2LB5A 4XT2A 3T4LA 3EGDC 4II7A 4OOLA 1TS0A 4EXOA 3P7NA 4JGPA 4B9OA 5F6AA 2WKRA 2PD8A 2KLIA 3H7WB 5DJTA 5IT5A 2QHKA 4BBUA 4HHDA 3HCYA 3UB7A 2J80A 4UQIS 1N9LA 4I3AA 5AJGA 1OTEA 1F98A 2DMWA 2O9BA 1OTDA 1UWPX 4NKPA 1F9IA 3PBNA 1V9ZA 2L4RA 2V0WA 3LI9A 3KSHA 3K3DA 3IBJA 3H7WA 3IBRA 2W3EA 4WLAA 1T1AA 5HWTA 3F1OB 1N9NA 5F5YA 2PHYA 4HY8A 3PBTA 1P0ZA 4JGRA 4PAUA 2M7UA 4I3IA 1TS7A 4EQ1A 3E4OA 4MCWA 3E0YA 4L9EA 3LIFA 3LIEA 1P97A 4HH2A 2ZMVA 2GNXA 5MC7A 2O9CA 3MJQA 3ICYA 3B47A 1YSPA 4RQ9A 3F1OA 4HH3A 3NJAA 3T4JA 4G3VA 3TW8A 2ZBBA 3OOVA 2Z6CA 4BWIA 3D3OA 1EW0A 2JKRI 3MQ0A 4B93A 3E4QA 3KX0X 4WN5A 1NRJA 2JN7A 3C2WA 4G3WA 2O0YA 3V67A 4EERA 4BMWA 3F1NA 3EEAA 4ETXA 2XRNA 4LRXC 4H6JB 2QYBA 2MJ6A 2W1RA 3PBQA 3R4KA 5HDDA 3UMDA 2K2NA 3BQ8A 3PBOA 5HDSA 1S67L 5AVEA 3LFVA 4O01A 3PHYA 3PYPA 2W1TB 3EWKA 2VA0A 1LL8A 4IUKA 4KQOA 5KSHA 4LPZA 1P9RA 4WUJA 5G4YA 2GZAA 3S7PA 2PT7A 2HJEA 3H9WA 2XA7M 4WF0A 4H6JA 4G3KA 2Y79A 5LBRA 1XJ4A 2FH5A 3W2ZA 1W63M 3BY9A 4PHTA 1BYWA 1STZA 3JVUA 4EU0A 4ARZB 3UE3A 2W1TA 3OCLA 3LI8A 3E98A 1NWZA 3GDIA 3CI6A 3KYQA 4Y3IA 4KUKA 3MMHA 4EUVA 1JNUA 3IS2B 3KO6A 5AVFA 3EEHA 2J3TC 1OT6A 2LB9A 4FSFA 4GLQA 1Y28A 3H82B 2O99A 4MN5A 3T4KA 4DMZA 5DKLA 4Q0IA 1GSXA 3UMEA 4ARZA 1TS6A 2HGVA 4QPRA 4CLCB 5HZHA 4CLCC 1LSVA 3LUQA 2VGLM 4JGOA 3IS2A 4NXFA 1DRMA 3DBAA 1XFQA 2ZOHA 2EA9A 2V1BA 4BBVA 1S1ZA 2P7JA 3H82A 1MKMA 4DJ2A 3ZQ5A 1OTIA 4IUHA 5IS1A 3OCNA 2XA7S 3B42A 3T4OA 4P6ZM 2YKHA 4I39A 5HWWA 2PDRA 3KSGA 3KYZA 2XROA 3CWFA 3BW6A 4BJPA 2CMNA 1V9YA 3R7WB 1S4SA 5J4EA 1ZTUA 5J7EA 1OTAA 4NEED 2OAP1 3OC2A 4HJ6A 3KSIA 3E4PA 4HIAA 4UEYA 3CUEC 5CX7A 1T1BA 3BY8A 4HQAA 1ZHHB 3LR0A 2K31A 2OOLA 3ULFA 4KUOA 3C30A 4ETZA 2KOIA 2KX6A 4HP9A 4DN0A 5DFYA 3RFBA 4FOFA 4L9GA 2P08A 3U2AA 2W3GA 3O5YA 3R7WA 3LIAA 1G28A 2IA2A 5F69A 2NUPC 3TJZC 2I9VA 1LSXA 1X0OA 2XSSA 2JKTI 2OWJA 3LICA 3S7OA 1DP6A 2V1AA 4GJ4A 3NOUC 1TF1A 3CUEA 1S1YA 5HPFA 3NOPC 3B33A 4O0PA 2VGLS 3A0VA 4MDZA 4ME4A 5FL3A 1VHMA 4EEPA 2J3WA 4LRZE 1W63Q 4M4XA 2YKFA 4IJGA 4L0LA 1NLZA 2O9AA 1D7EA 4WL9A 2M7VA 3K3CA 4I3JA 3NOTC 4Y2FA 5A8BA 1T19A 2R78A 4YNRA 5EFWA 1XJ2A 2FZ0A 5HWVA 1XFNA 2H28A 3F1PB 3OLOA 4HJ3A 4HNBA 2G7UA 4P6ZS 4Q0HA 2HF6A 2GX5A 4NXGA 2KDKA 5DF9A 1IFQA 3MF0A 3VV4A 3RTYA 3UB6A 2VV7A 4GS9B 1OT9A 3EOIA 4ZRRA 4E04A 3TE8A 3T4SA 5L8MA 3C38A 5I5LA 3GECA 3MQOA 5TBMB 2HJ9C 4K08A 4R70A 3VE3A 2EWWA 2W27A 4GW9A 3F1PA 3LIDA 5G4ZA 1H3QA 1IOUA 4MMNA 4YWZA 4PKYG 2EWVA 1F5MA 2VV6A 4EETB 4Y5FA 4R6LA 4MN6A 1GSWA 1YAXA 5IU1A 1DP8A 4I5SA 2VEAA 4Z1WA 1LSWA 3TRCA 3CAXA 1T1CA 4OOMA 3UE6A 4GS9A 3HJIA 1WA9A 3BQAA 3FC7A 3KSFA 3LR3A 4CLCE 5TBMA 3CLOA 1N9OA 4DJ3A 2A2LA 1H8MA 5HPIA 1VB6A 1GSVA 3MXQA 4IHQA 3VOLA 3LYXA 4HJ4A 1XJ3A 4PKYA 3RH8B 3LR5A 3T4QA 1OJ5A 5F68A 4HP4A 2A24B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W1T B;  1YKD A;  4IUK A;  5DFY A;  4DN0 A;  3RFB A;  4FOF A;  5HL6 A;  2W3G A;  4Q0J A;  3O5Y A;  3S7P A;  2KLI A;  2IA2 A;  3CIT A;  2XSS A;  4G3K A;  3S7O A;  3HCY A;  2Y79 A;  3NHQ A;  5LBR A;  3NOU C;  5HSQ A;  1TF1 A;  5HPF A;  2VZW A;  3NOP C;  3W2Z A;  4O0P A;  4CQH A;  5DFX A;  5AJG A;  4MDZ A;  4ME4 A;  4MN7 A;  1STZ A;  2O9B A;  1VHM A;  4EU0 A;  4LRZ E;  3BJN A;  2W1T A;  4IJG A;  3E98 A;  2O9A A;  2VKS A;  3CI6 A;  2W3H A;  4LRY C;  4Y3I A;  2M7V A;  3NOT C;  4Y2F A;  3KSH A;  3MMH A;  4YNR A;  4EUV A;  3IBJ A;  3IBR A;  2W3D A;  2G7U A;  2W3E A;  3KO6 A;  4Q0H A;  2GX5 A;  1MC0 A;  2LB9 A;  5TJJ A;  3S7N A;  4GLQ A;  1TD5 A;  3MF0 A;  4PAU A;  2O99 A;  3VV4 A;  2M7U A;  2B18 A;  4DMZ A;  2Y8H A;  2ZMF A;  2W3F A;  3K2N A;  4Q0I A;  4MCW A;  4ZRR A;  4E04 A;  3E0Y A;  5L8M A;  2HGV A;  5I5L A;  4QPR A;  3OBF A;  4R70 A;  4GW9 A;  2O9C A;  5C5K A;  1YSP A;  4MMN A;  3DBA A;  4RQ9 A;  3S7Q A;  1F5M A;  4O8G A;  4Y5F A;  1MKM A;  5K5B A;  4G3V A;  4R6L A;  3OOV A;  3ZQ5 A;  4BWI A;  2VEA A;  3D3O A;  4IUH A;  4Z1W A;  3TRC A;  3MQ0 A;  2VJW A;  1YSQ A;  3C2W A;  3KSF A;  3KSG A;  2XRO A;  4G3W A;  2O0Y A;  3EEA A;  4ETX A;  1ZTU A;  2XRN A;  4YOF A;  4LRX C;  2QYB A;  2W1R A;  3KSI A;  3R4K A;  5HPI A;  3G6O A;  2K2N A;  2K31 A;  2OOL A;  2LB5 A;  3LFV A;  4O01 A;  4ETZ A;  2KOI A; 
#chains in the Genus database with same CATH topology
 2VX8 A;  5HAI A;  5CHM A;  3MKE A;  2RL3 A;  3BWL A;  4CPK A;  4E3L A;  3QNB A;  5HAR A;  5DFX A;  2Y2O A;  1LLB A;  4E3O A;  1YLZ A;  5EM1 A;  4R23 A;  5DF8 A;  1BSG A;  3GSG A;  2W0N A;  1UWN X;  2H10 A;  1VET B;  3P01 A;  3UE1 A;  4GB7 A;  3QP1 A;  3DTE A;  3LEZ A;  4BBT A;  2ZQA A;  3M2J A;  2W3D A;  4BL2 A;  1MC0 A;  2L1M A;  4O7D A;  1VEU A;  3S7N A;  3IX8 A;  4Y0T A;  1TD5 A;  4S2N C;  4LFU A;  3LR4 A;  2JE5 A;  2ZOI A;  4BL3 A;  4F3L B;  2ZQC A;  3DAV A;  5FQQ A;  2P74 A;  1TS8 A;  2PYR A;  4UQI M;  3SOI A;  2WKQ A;  4RX3 A;  2PD7 A;  4IED A;  1ERO A;  5M18 A;  3BEB A;  4KG5 A;  5FAQ A;  1F2K A;  2B95 A;  4NXE A;  3VE4 A;  4DE2 A;  4R3A A;  2VV8 A;  1RP5 A;  4AFI A;  5K5B A;  4JGQ A;  2WUQ A;  5L07 A;  3OPL A;  3EQV A;  4EQI A;  2C6W B;  1MZU A;  1FIK A;  2HDS A;  4DDS A;  5GL9 A;  4EV4 A;  1K0K A;  2ZD8 A;  1IEM A;  4X25 A;  1ZG6 A;  4YOF A;  3G30 A;  3Q1F A;  1G6A A;  5A93 A;  4CLC D;  4MBF A;  4R3J A;  5FQM A;  3BEC A;  4MEZ A;  1YPR A;  3HLF A;  4OPR A;  2LB5 A;  4XT2 A;  3VSL A;  1G5U A;  4JF4 A;  3EGD C;  4QHC A;  1N9B A;  1IEL A;  4S2J A;  4B9O A;  2HP9 A;  1S6R A;  2ZC7 A;  2KLI A;  3H7W B;  5DJT A;  4U0T A;  4BBU A;  4S2M A;  3CG5 A;  2XK1 A;  4HHD A;  1L0D A;  4K91 A;  4CJN A;  4I3A A;  3A3J A;  1CEF A;  5AJG A;  1OTE A;  3AGD A;  3VOY A;  1F98 A;  4Y15 A;  4JXG A;  3N7W A;  3TG9 A;  4QJG A;  3OPH A;  2IWC A;  5DTK A;  2V0W A;  3KSH A;  3IXG A;  5GHY A;  4E6W A;  1KDW A;  2EFU A;  4XUZ A;  1LL5 A;  5HWT A;  2PHY A;  5F82 A;  2Q9M A;  2J9P A;  3HUN A;  3E4O A;  4MCW A;  5FQJ A;  1YLW A;  3D4F A;  3V5M A;  4WYY A;  3LIE A;  3MBZ A;  5GLA A;  1HTZ A;  5FI2 A;  3QHY A;  4E3J A;  4E6X A;  3IF6 C;  2ZQ9 A;  3BLS A;  2IWB A;  3OOV A;  1ACF A;  1CI9 A;  2JKR I;  3MQ0 A;  3KX0 X;  1A0K A;  2BLS A;  4U0X A;  5BOH A;  4EWF A;  3V67 A;  4QU3 A;  3F1N A;  2XRN A;  1J3W A;  1MWU A;  2ZM0 A;  1YMS A;  1K4E A;  5HDD A;  3LY4 A;  4NET A;  5TR7 A;  4GZB A;  3L9K A;  3ZHH A;  1LL9 A;  1BLC A;  4WUJ A;  1ONG A;  4BD0 A;  2HJE A;  2PU4 A;  1PRQ A;  3H9W A;  4OOY A;  2XA7 M;  2AVX A;  3UO9 A;  1MWS A;  2Y79 A;  5LBR A;  3ZDJ A;  3C7V A;  3BY9 A;  4IVI A;  4NG2 A;  4WMC D;  3WS2 A;  3HUO A;  3UE3 A;  5HAQ A;  1NWZ A;  2C5W B;  3IS2 B;  1KVM A;  3KO6 A;  2EFX A;  4GLQ A;  1Y28 A;  4KEN B;  4WZ5 A;  4GDN A;  2P9V A;  1VM1 A;  4DMZ A;  2Q9N A;  1ZKJ A;  2E8I A;  2HGV A;  3UPP A;  5CTN A;  4LCM A;  4OPZ A;  1XKZ A;  5EVI C;  1SDN A;  1XFQ A;  3DTM A;  1ES5 A;  4BBV A;  2P7J A;  1MKM A;  3DWK A;  4R4R A;  5GHX A;  3P09 A;  4P6Z M;  5HWW A;  1H5X A;  1XPB A;  2JCH A;  1IYQ A;  3BW6 A;  4R4S A;  4R3B A;  3QP2 A;  5AQA A;  4GN2 A;  1OTA A;  1VEU B;  1ESI A;  3MZE A;  4HJ6 A;  3FKV A;  3GQZ A;  3UN7 A;  5CX7 A;  4HQA A;  4FD8 A;  4Y0U A;  3NDG A;  2OOL A;  3WRZ A;  3HLD A;  3ULF A;  4KUO A;  4ETZ A;  2KOI A;  2KX6 A;  4HP9 A;  1NJ4 A;  5DFY A;  3RFB A;  4DXB A;  2P08 A;  2QZ6 A;  1FR6 A;  3O5Y A;  1G28 A;  3IHA A;  2OWJ A;  2DRW A;  3LIC A;  3S7O A;  2Y2G A;  1TF1 A;  4N1X A;  2HZ5 A;  3A0V A;  5CGW A;  4X1L A;  1QME A;  3AGF A;  1H8Y A;  5M19 A;  2YKF A;  1D7E A;  3HVF A;  4WL9 A;  4JBF A;  4YNR A;  5EFW A;  1XFN A;  2H28 A;  3DTI A;  3OLO A;  4HJ3 A;  3CPT A;  2HF6 A;  1K25 A;  4OQ0 A;  2KDK A;  2Y2N A;  3N6I A;  3MF0 A;  4FTX A;  4OKP A;  3RTY A;  1CI8 A;  2XFT A;  2EX8 A;  3EOI A;  4C3Q A;  2PRF A;  1H0M A;  5TBM B;  4K08 A;  4GW9 A;  5FQI A;  5AQ7 A;  4DDY A;  4KZ8 A;  2FFF B;  3PTE A;  1F5M A;  4WZ4 A;  4IBR A;  5DF7 A;  4EET B;  4Y5F A;  5FA7 A;  3CAX A;  1T1C A;  3NEC A;  4GS9 A;  1PI4 A;  3HLW A;  1NY0 A;  3BQA A;  3RXW A;  3FC7 A;  1CK3 A;  3E2L A;  3ITB A;  1ES2 A;  5EE8 A;  1N9O A;  3ZG9 B;  3DWZ A;  2V20 A;  3LYX A;  4HJ4 A;  2OV5 A;  3IXH A;  4GDB A;  3LR5 A;  5F68 A;  2A24 B;  1E25 A;  3IWO A;  3UB8 A;  5HL6 A;  3UE0 A;  1XJ6 A;  2WAD A;  4Q0J A;  2ZJ9 A;  3MQQ A;  5AQ9 A;  3LGO A;  1SKO B;  2HV1 A;  1DJA A;  4A5R A;  5I94 A;  4GHI B;  4GCZ A;  5KIZ A;  3NHQ A;  2D01 A;  4WMC A;  3SW1 A;  5HSQ A;  2VZW A;  3C8C A;  5TFQ A;  3JPU A;  3HJK A;  3KYE A;  4MN7 A;  2JKR M;  1RGY A;  1S4R A;  2BAS A;  2B02 A;  3MFX A;  1K4F A;  1D06 A;  5E2E A;  4EEU A;  3A0S A;  4Y17 A;  3F1N B;  3ZG5 A;  3Q7Z A;  5J8X A;  5KSC A;  2WKI A;  1K56 D;  5TJJ A;  3T50 A;  3LIB A;  1ZC2 A;  3VP3 A;  3IXD A;  3IWQ A;  3UDX A;  3K2N A;  5CGS A;  2M1C A;  3JVV A;  4N9K A;  5DJU A;  3AGE A;  3OBF A;  4QY6 A;  2ZC5 B;  3VP4 A;  5FAP A;  3ZG8 B;  1ALQ A;  4LLO B;  4O8G A;  1YLT A;  2ZM2 A;  1RGZ A;  2VLG A;  5F1G A;  5HD5 A;  3FPW A;  4X6T A;  3BLM A;  1MKI A;  5KMW A;  1JVJ A;  2VGJ A;  2JHE A;  4KG6 A;  2GJ3 A;  2UV0 E;  1T18 A;  5EVI D;  4QB8 A;  5CHU A;  2BTF P;  3G6O A;  2PR6 A;  2XFS A;  1L0G A;  3P7N A;  4EUZ A;  1SZV A;  2HP6 A;  4JGP A;  5F6A A;  4R1G A;  3C7U A;  4QY5 A;  2PD8 A;  3D9Y A;  2BG1 A;  3V3S A;  2Y2Q A;  1HZO A;  3HRE A;  3N8L A;  5FAT A;  4UQI S;  3S4X A;  1FOF A;  4KZB A;  2DMW A;  3A3D A;  1OTD A;  1F9I A;  3PBN A;  1V9Z A;  2L4R A;  1LI9 A;  3IBR A;  3IBJ A;  3ITA A;  2W3E A;  3VP1 A;  3F1O B;  1N9N A;  3N4I A;  1P0Z A;  4PAU A;  4BQM A;  1GHM A;  2M7U A;  2H0Y A;  3Q07 A;  4KZ3 A;  4L9E A;  1P97 A;  3QP8 A;  3QP6 A;  2WYX A;  3IH9 A;  2X02 A;  4QD4 A;  3NJA A;  5E2F A;  1D1J A;  3UDI A;  4RA7 A;  5JYO A;  2R9X A;  1JTD A;  3QP5 A;  3B3X A;  5GLD A;  3N8R A;  1ERM A;  4BLM A;  3O87 A;  4WN5 A;  1NRJ A;  2JN7 A;  2ZQ8 A;  4D60 A;  2V8C A;  4EER A;  3EEA A;  4KQR A;  4LRX C;  3IT9 A;  4H6J B;  4S2I A;  1FCO A;  2MJ6 A;  3DW0 A;  2Y2J A;  3T1R A;  2XLN A;  2K2N A;  3BQ8 A;  3VP0 A;  4EBP A;  4UHU A;  5HDS A;  5AVE A;  1QMF A;  4ZJ3 A;  4O01 A;  3PHY A;  4KZ7 A;  3UPN A;  3ZFZ A;  1LL8 A;  3E2K A;  4LCL A;  1SKF A;  1AWI A;  4B4X A;  5G4Y A;  1PWG A;  2GZA A;  1DJC A;  1XGI A;  4WF0 A;  1XX2 A;  4G3K A;  2HPB A;  1BT5 A;  3QP4 A;  3CZD A;  3Q7V A;  1W63 M;  3BFD A;  4XXR A;  4PHT A;  4OQH A;  1BYW A;  1STZ A;  4EU0 A;  4P87 A;  1DY6 A;  2W1T A;  3OCL A;  3GDI A;  3CI6 A;  3SZT A;  4EBL A;  4KUK A;  4H8R A;  5A91 A;  1JNU A;  4JLF A;  5AVF A;  3EEH A;  1YT4 A;  4C6Y A;  5CGX A;  4MN5 A;  5DKL A;  1L2S A;  3OZH A;  4ARZ A;  4QPR A;  5HZH A;  1LSV A;  3LUQ A;  1DRM A;  2XD5 A;  2EX6 A;  4P6B A;  1S1Z A;  3H82 A;  3TSG A;  5E2H A;  1PZP A;  5IS1 A;  3OCN A;  2EXA A;  2XA7 S;  2Z2M B;  2YKH A;  4I39 A;  3KYZ A;  2ZL1 A;  3CWF A;  1V9Y A;  3GMW A;  3FZC A;  3R7W B;  5J4E A;  5EVI A;  5KZH A;  4NEE D;  3OC2 A;  3KSI A;  3WS4 A;  3E4P A;  4HIA A;  4UEY A;  3CUE C;  1KGE A;  2ZLY A;  4OP5 A;  5EUA A;  3V39 A;  4KQQ A;  3C4P A;  3C30 A;  5A90 A;  4FH4 A;  1I2S A;  2Y2L A;  3MFD A;  4FOF A;  4L9G A;  3U2A A;  3ZG7 B;  2W3G A;  4JF6 A;  3LIA A;  3O86 A;  1LSX A;  2XSS A;  1DP6 A;  4UAA A;  4GJ4 A;  4KZA A;  5HPF A;  3NOP C;  1MXO A;  1K55 A;  2XF3 A;  3B33 A;  2Y2H A;  4S2L A;  1KGG A;  3M6H A;  4LRZ E;  3SH7 A;  3WS0 A;  1K54 A;  2O9A A;  3CJM A;  3U4L P;  2R78 A;  3SH9 A;  4ESP A;  5HWV A;  4HNB A;  1ES3 A;  2G7U A;  4P6Z S;  4OH0 A;  4RX2 A;  4Q0H A;  2GX5 A;  4Q8I A;  3BYD A;  4X55 A;  4N1H A;  1K57 C;  5DF9 A;  3WS5 A;  1TDL A;  1M6K A;  3W4P A;  3UB6 A;  3PAG A;  4E04 A;  3T4S A;  5L8M A;  5I5L A;  2W27 A;  5EOO A;  3F1P A;  3LID A;  4GD6 A;  1H3Q A;  5E2G A;  1PFL A;  1IOU A;  3VFF A;  4UA6 A;  4MN6 A;  1U60 A;  5EVL A;  2WGW A;  3O3V A;  1YLJ A;  3C5A A;  4OOM A;  3G32 A;  2X01 A;  1MPL A;  1E3U D;  1ES4 A;  3KSF A;  3DTK A;  5DTS A;  1K38 A;  3CLO A;  4DJ3 A;  2ZQD A;  1H8M A;  4OQI A;  1GSV A;  1LHY A;  3VOL A;  4PKY A;  3T4Q A;  1OJ5 A;  2J9O A;  5FSR A;  1YKD A;  1FSW A;  2EX9 A;  5CRF A;  3T4T A;  5CEC A;  1P9W A;  4R38 A;  1EWZ A;  4CLC A;  4KQD A;  3CIT A;  5F83 A;  3M2K A;  2G2U A;  2XGN A;  2V8F A;  1KDS A;  3HLB A;  5L09 A;  4EW7 A;  3BFG A;  1TEM A;  3SS3 A;  1UGU A;  2Z6D A;  1Q2Q A;  4F94 A;  4UA9 A;  1XA1 A;  2JKT M;  3VP2 A;  4NK3 A;  1L0F A;  3Q82 A;  3MSH A;  3QNC A;  3UPO A;  1TDG A;  1OJG A;  4M3K A;  4ZJ1 A;  2VGK A;  5J3W A;  2V9A A;  2WAE A;  2ZMF A;  4N9L A;  3PR6 A;  2WKH A;  4EES A;  4OLG A;  1WE4 A;  1DP9 A;  1VQQ A;  2PR5 A;  1K6R A;  2QKP A;  5C5K A;  3FG8 A;  2JKF A;  2INW A;  5IHV A;  3ZYT A;  5GHZ A;  4JXW A;  1J9M A;  4MNR A;  5HDC A;  3D72 A;  3OPP A;  4XT2 B;  3GRJ A;  4F3L A;  1NZO A;  2VJW A;  3FPV A;  4NXB A;  3ZNY A;  2DCF A;  2ZMA A;  4Z9Q A;  3PBS A;  4XUX A;  4WZ5 C;  4HOI A;  2D02 A;  3EQU A;  3G4P A;  1KOU A;  3T12 B;  1FCM A;  3T4L A;  5FQK A;  4II7 A;  4OOL A;  3MXR A;  3HLE A;  2WKR A;  5IT5 A;  3UB7 A;  1W5D A;  3IHB A;  4WM9 A;  4NKP A;  1L0E A;  1XP4 A;  4HBT A;  2ZL1 B;  3G35 A;  5EM0 A;  2OLV A;  3H7W A;  4E3I A;  5EV0 A;  3T1X A;  4HY8 A;  2Z2L B;  4JGR A;  1WYC A;  1SHV A;  1ESU A;  4I3I A;  3S22 A;  4EQ1 A;  3TOI A;  1BUE A;  3A3I A;  3BFC A;  1W8Q A;  4PMA A;  4X68 A;  2ZMV A;  2GNX A;  5A92 A;  4ZAM A;  2O9C A;  3MJQ A;  3ICY A;  3B47 A;  4B4Z A;  1YSP A;  2ZC4 B;  4RQ9 A;  4HEF A;  3PAE A;  4HH3 A;  3T4J A;  3TW8 A;  2ZBB A;  2Z6C A;  4BWI A;  1E3U A;  5G18 A;  1L3L A;  4B93 A;  4LV1 A;  4S2P A;  3C2W A;  2WGI A;  2O0Y A;  5DTT A;  4YIN A;  2V1Z A;  2XD1 A;  4BMW A;  2XQZ A;  4Y13 A;  4ETX A;  3MS6 A;  2QYB A;  1Y4O A;  4S2K A;  2HDQ A;  4R0Q A;  3UMD A;  3G31 A;  4S2O A;  4S2N A;  4UA7 A;  2ZC6 B;  3G2Z A;  3PBO A;  1S67 L;  5HW3 A;  2VA0 A;  1O07 A;  3MXS A;  4KQO A;  1MWT A;  5KSH A;  4LPZ A;  4EBN A;  1BUL A;  2E8J A;  1PNE A;  3M6B A;  5JYP A;  4IVK A;  1XJ4 A;  2P9V B;  1IYS A;  1H8Z A;  1MWR A;  5FQ9 A;  5FDH A;  1FQG A;  3VFH A;  3E98 A;  3KYQ A;  3UB5 P;  4Y3I A;  4Y7P A;  1ONH A;  2Y4A A;  2ZC3 B;  5E43 A;  4EUV A;  3O88 A;  2G2W A;  5EEC A;  2J3T C;  1OT6 A;  2LB9 A;  3WWX A;  1N4O A;  3T4K A;  4Q0I A;  1GSX A;  2ZM8 A;  1ZG4 A;  3I7J A;  1IKG A;  1Q2P A;  4MBH A;  4CLC B;  2VGL M;  3IS2 A;  3SS5 A;  3DBA A;  2V1B A;  2WKE A;  2HDU A;  3ZQ5 A;  4IUH A;  4RVA A;  3ZCZ A;  4YFM A;  3B42 A;  3T4O A;  1I5Q A;  3UY6 A;  2PDR A;  5CHJ A;  3KSG A;  2WGV A;  3FWL A;  4BJP A;  5U47 A;  1XA7 A;  1ZTU A;  3JYI A;  3N8S A;  1NXY A;  3NCK A;  1PI5 A;  2Y59 A;  1T1B A;  3LR0 A;  2K31 A;  1S0W A;  1BLS A;  1PW8 A;  3GVB A;  2EXB A;  4DN0 A;  3HLC A;  5F1F A;  3NUL A;  3IQA A;  5CEB A;  3NIA A;  2I9V A;  3CPT B;  2JKT I;  3IF6 A;  4DE1 A;  3CUE A;  1S1Y A;  2QMI A;  4MDZ A;  4ME4 A;  5FL3 A;  4PM5 A;  2J3W A;  2DNS A;  4M4X A;  4IJG A;  1SDE A;  2M7V A;  3K3C A;  1JWP A;  5A8B A;  1XJ2 A;  4DKI A;  5GLB A;  2WZZ A;  4K0X A;  1YLY A;  4K0W A;  3MZF A;  1IFQ A;  2I72 A;  5CED A;  3VV4 A;  2VV7 A;  3ZG0 A;  4GS9 B;  5GLC A;  3TE8 A;  3LO7 A;  3IXB A;  4DRT A;  3C38 A;  1GHP A;  4DE3 A;  3GEC A;  3MQO A;  3VE3 A;  2HJ9 C;  1K56 A;  1RCJ A;  1JWZ A;  5G4Z A;  3A3F A;  4MMN A;  4N92 A;  4PKY G;  2ACG A;  1K57 A;  3V3R A;  5FI6 A;  1YAX A;  4I5S A;  2VEA A;  4Z1W A;  1LSW A;  1E4D A;  3OPR A;  3HJI A;  1W8Y A;  2R9W A;  3BFF A;  3LR3 A;  4CLC E;  5TBM A;  2GDN A;  4QWO A;  4OPQ A;  4DXC A;  5EPH A;  3S1Y A;  5HPI A;  1CEG A;  2OSU A;  1KE3 A;  4IHQ A;  1K6S A;  1XJ3 A;  3RXX A;  2EX2 A;  1PZO A;  1TVF A;  2V0U A;  2JKG A;  3A0R A;  1HVB A;  3LEQ A;  4FH2 A;  4JXV A;  1SCW A;  1NYY A;  1YLP A;  2PBD P;  4HES A;  2WZX A;  2P04 A;  1O7E A;  1NLY A;  2QJ7 A;  4CQH A;  2CC1 A;  5FEG A;  4JPM A;  5FI7 A;  2PYP A;  2OAQ 1;  1W7F A;  3UNW A;  2A24 A;  2NUT C;  3BJN A;  3EGX C;  2HP5 A;  4OLD A;  2VKS A;  2W3H A;  4LRY C;  4WEK A;  1ODV A;  1IYP A;  1YM1 A;  1IKI A;  4ZBE A;  2QWS A;  2WKP A;  1MY8 A;  1SKO A;  2K7S A;  3PBR A;  4IBX A;  2WAF A;  1XXM A;  4GHI A;  4WEJ A;  4HI4 A;  1OPX A;  4MBK A;  2B18 A;  2Y8H A;  2W3F A;  1PWD A;  3MR0 A;  4L9F A;  1S66 L;  1PYY A;  1GA0 A;  1LT0 A;  1HD8 A;  2ZQ7 A;  5DKK A;  3BFE A;  4FCF A;  4OQG A;  4KG2 A;  3S7Q A;  1NZU A;  2J3T D;  1KGF A;  1OTB A;  5HD3 A;  4JKT A;  5D3O A;  5HX9 A;  3LCE A;  2B5R A;  1YSQ A;  4P85 A;  1GCE A;  2L0W A;  2J7V A;  4KZ5 A;  3ZVT A;  4LEN A;  2A3U A;  4WEL A;  3IX4 A;  4I38 A;  3PXP A;  1G6O A;  4GOG A;  4OP8 A;  2OWH A;  2H5S A;  4D2O A;  2QJ5 A;  3CHW P;  3UB9 A;  2PAV P;  1CJF A;  1PIO A;  1TS0 A;  4DF6 A;  4EXO A;  1GA9 A;  1XGJ A;  4ZTK A;  2UWX A;  3HL9 A;  3C4O A;  3NBL A;  4LV3 A;  2QHK A;  4X1M A;  4KZ9 A;  4GD8 A;  3HCY A;  2J80 A;  1N9L A;  2XDM A;  2XH9 A;  2O9B A;  3FKW A;  1UWP X;  1JWV A;  3LI9 A;  2XEP A;  2A49 A;  3K3D A;  4WLA A;  3ZGA B;  2PBY A;  1T1A A;  4KZ4 A;  4GNU A;  5F5Y A;  3PBT A;  3W4Q A;  5CER A;  1TS7 A;  3GR2 A;  3VMA A;  3ZVW A;  4LGW A;  3E0Y A;  4E3N A;  3LIF A;  1Y54 A;  5TGF A;  4HH2 A;  5HL1 A;  4MLL A;  2WK0 A;  5MC7 A;  1I2W A;  3IF6 B;  3G2Y A;  3F1O A;  1BLH A;  2X71 A;  1K55 C;  4X69 A;  1WYB A;  1FCN A;  4G3V A;  3LY3 A;  4BD1 A;  3D3O A;  1EW0 A;  2JC7 A;  4P0M A;  3W8K A;  1K54 C;  3E4Q A;  1Z6F A;  1W79 A;  1CQA A;  1VET A;  4G3W A;  1BZA A;  1MBL A;  5FDS A;  3IWI A;  1JTG A;  2W1R A;  3PBQ A;  3R4K A;  4E3K A;  1LI0 A;  4PPR A;  3V50 A;  3BM6 A;  3Q7V B;  4PM9 A;  3LFV A;  3PYP A;  2W1T B;  3EWK A;  4IUK A;  1PWC A;  5CTM A;  2XR0 A;  1P9R A;  2V2F F;  4OVD A;  4X53 A;  3IX3 A;  3GTC A;  3T1Q B;  3S7P A;  2PT7 A;  3CMZ A;  4H6J A;  3G34 A;  4JXS A;  2Y2K A;  5CXW A;  2FH5 A;  3W2Z A;  1KE4 A;  3ZNT A;  3JVU A;  5HFO A;  1EI5 A;  2QPN A;  5DVA A;  4ARZ B;  3LI8 A;  4PM6 A;  4C75 A;  2IWD A;  3MMH A;  4KZ6 A;  1NYM A;  5EVE A;  5EOE A;  3HUM A;  4FSF A;  1FR1 A;  3H82 B;  2O99 A;  1YQS A;  3SS4 A;  5AQB A;  3UME A;  1PW1 A;  4WBG A;  1KE0 A;  3NI9 A;  1TS6 A;  4OON A;  3MZD A;  4CLC C;  1ERQ A;  4JGO A;  5EVI B;  4NXF A;  4U3T A;  2ZOH A;  2EA9 A;  1YMX A;  4DJ2 A;  3GV9 A;  1OTI A;  3NC8 A;  1FIL A;  3Q81 A;  5M1A A;  2Y91 A;  4PM8 A;  3WS1 A;  3RJU A;  1DJB A;  3FYZ A;  3L7H A;  2XRO A;  3HBR A;  2CMN A;  2Y2I A;  1AXB A;  1GHI A;  4ZJ2 A;  1S4S A;  5J7E A;  3NY4 A;  2OAP 1;  4DE0 A;  2J8Y A;  3BY8 A;  2HDR A;  1ZHH B;  4GKU A;  1OME A;  4JF5 A;  2VK3 A;  1IYO A;  3IH8 A;  4BEN A;  3HLG A;  3ISG A;  3R7W A;  5F69 A;  2IA2 A;  3TJZ C;  4OPY A;  2NUP C;  1X0O A;  3UDF A;  2V1A A;  1M40 A;  3NOU C;  4O0P A;  2VGL S;  3BRM A;  1VHM A;  5FAO A;  4EEP A;  2PU2 A;  1W63 Q;  5FEF A;  1BLP A;  4L0L A;  1NLZ A;  4I3J A;  1Z09 A;  3NOT C;  4Y2F A;  1T19 A;  3WRT A;  2FZ0 A;  3F1P B;  3P98 A;  4LV0 A;  4NXG A;  1C3B A;  1G68 A;  5HAP A;  3T1S A;  1FSY A;  5L2F A;  3IF5 A;  4X56 A;  2WGW B;  1HLU P;  1NRF A;  1OT9 A;  4ZRR A;  2H0T A;  3VOZ A;  1CF0 A;  4ID4 A;  4E3M A;  4R70 A;  2EWW A;  3SH8 A;  3FV7 A;  4B88 A;  2Y2M A;  4YWZ A;  3VSK A;  2EWV A;  2VV6 A;  3W4O A;  4HBU A;  4R6L A;  1GSW A;  5IU1 A;  5FAS A;  1DP8 A;  3TRC A;  2JBF A;  4RYE A;  3UE6 A;  3MKF A;  4Y0O A;  2Y55 A;  1WA9 A;  4PM7 A;  1BTL A;  2Y2P A;  2RCX A;  4FUW A;  3NDE A;  2Q0O A;  1KVL A;  2FFY A;  2A2L A;  1VB6 A;  5L10 A;  3MXQ A;  3RH8 B;  4LV2 A;  2OLU A;  4HP4 A;  3A3E A;  4ZDX A; 
#chains in the Genus database with same CATH homology
 2VX8 A;  1YKD A;  2V0U A;  3A0R A;  3T4T A;  3UB8 A;  5HL6 A;  1P9W A;  4R38 A;  1XJ6 A;  4Q0J A;  4CLC A;  3MQQ A;  3CIT A;  4KQD A;  2HV1 A;  4GHI B;  4GCZ A;  5KIZ A;  2P04 A;  3BWL A;  3NHQ A;  2D01 A;  3SW1 A;  5HSQ A;  1NLY A;  2VZW A;  3C8C A;  2QJ7 A;  4CQH A;  5DFX A;  3HJK A;  4EW7 A;  4MN7 A;  2JKR M;  2PYP A;  1S4R A;  2BAS A;  2OAQ 1;  2B02 A;  3MFX A;  1UGU A;  2A24 A;  2NUT C;  3BJN A;  3EGX C;  2W0N A;  1UWN X;  2Z6D A;  1D06 A;  3P01 A;  2VKS A;  4EEU A;  2W3H A;  3A0S A;  4LRY C;  4WEK A;  1ODV A;  3F1N B;  4BBT A;  2QWS A;  2W3D A;  2JKT M;  2WKP A;  3PBR A;  2K7S A;  1MC0 A;  2L1M A;  5TJJ A;  4GHI A;  4WEJ A;  3S7N A;  3T50 A;  3LIB A;  4HI4 A;  1OJG A;  1OPX A;  1TD5 A;  3LR4 A;  5J3W A;  2B18 A;  2V9A A;  2Y8H A;  2ZOI A;  2ZMF A;  2W3F A;  3K2N A;  4F3L B;  3PR6 A;  2M1C A;  3MR0 A;  3JVV A;  4EES A;  4L9F A;  1TS8 A;  5DJU A;  2PYR A;  1S66 L;  1DP9 A;  2PR5 A;  3OBF A;  4UQI M;  1LT0 A;  2QKP A;  2WKQ A;  2PD7 A;  5C5K A;  3FG8 A;  5DKK A;  2INW A;  4NXE A;  3VE4 A;  3S7Q A;  3ZYT A;  4LLO B;  4O8G A;  4R3A A;  2VV8 A;  4AFI A;  2J3T D;  5K5B A;  4JGQ A;  1OTB A;  5HD3 A;  5HDC A;  3EQV A;  3D72 A;  4XT2 B;  5HD5 A;  2VLG A;  4F3L A;  1MZU A;  3FPW A;  2VJW A;  3FPV A;  1YSQ A;  2L0W A;  4NXB A;  3PBS A;  4WEL A;  4YOF A;  4I38 A;  3PXP A;  2JHE A;  4CLC D;  1G6O A;  2GJ3 A;  1T18 A;  4HOI A;  2OWH A;  2D02 A;  2QJ5 A;  3EQU A;  3G6O A;  2PR6 A;  1KOU A;  3UB9 A;  2LB5 A;  4XT2 A;  3T4L A;  3EGD C;  4II7 A;  4OOL A;  1TS0 A;  4EXO A;  3P7N A;  4JGP A;  4B9O A;  5F6A A;  2WKR A;  2PD8 A;  2KLI A;  3H7W B;  5DJT A;  5IT5 A;  2QHK A;  4BBU A;  4HHD A;  3HCY A;  3UB7 A;  2J80 A;  4UQI S;  1N9L A;  4I3A A;  5AJG A;  1OTE A;  1F98 A;  2DMW A;  2O9B A;  1OTD A;  1UWP X;  4NKP A;  1F9I A;  3PBN A;  1V9Z A;  2L4R A;  2V0W A;  3LI9 A;  3KSH A;  3K3D A;  3IBJ A;  3H7W A;  3IBR A;  2W3E A;  4WLA A;  1T1A A;  5HWT A;  3F1O B;  1N9N A;  5F5Y A;  2PHY A;  4HY8 A;  3PBT A;  1P0Z A;  4JGR A;  4PAU A;  2M7U A;  4I3I A;  1TS7 A;  4EQ1 A;  3E4O A;  4MCW A;  3E0Y A;  4L9E A;  3LIF A;  3LIE A;  1P97 A;  4HH2 A;  2ZMV A;  2GNX A;  5MC7 A;  2O9C A;  3MJQ A;  3ICY A;  3B47 A;  1YSP A;  4RQ9 A;  3F1O A;  4HH3 A;  3NJA A;  3T4J A;  4G3V A;  3TW8 A;  2ZBB A;  3OOV A;  2Z6C A;  4BWI A;  3D3O A;  1EW0 A;  2JKR I;  3MQ0 A;  4B93 A;  3E4Q A;  3KX0 X;  4WN5 A;  1NRJ A;  2JN7 A;  3C2W A;  4G3W A;  2O0Y A;  3V67 A;  4EER A;  4BMW A;  3F1N A;  3EEA A;  4ETX A;  2XRN A;  4LRX C;  4H6J B;  2QYB A;  2MJ6 A;  2W1R A;  3PBQ A;  3R4K A;  5HDD A;  3UMD A;  2K2N A;  3BQ8 A;  3PBO A;  5HDS A;  1S67 L;  5AVE A;  3LFV A;  4O01 A;  3PHY A;  3PYP A;  2W1T B;  3EWK A;  2VA0 A;  1LL8 A;  4IUK A;  4KQO A;  5KSH A;  4LPZ A;  1P9R A;  4WUJ A;  5G4Y A;  2GZA A;  3S7P A;  2PT7 A;  2HJE A;  3H9W A;  2XA7 M;  4WF0 A;  4H6J A;  4G3K A;  2Y79 A;  5LBR A;  1XJ4 A;  2FH5 A;  3W2Z A;  1W63 M;  3BY9 A;  4PHT A;  1BYW A;  1STZ A;  3JVU A;  4EU0 A;  4ARZ B;  3UE3 A;  2W1T A;  3OCL A;  3LI8 A;  3E98 A;  1NWZ A;  3GDI A;  3CI6 A;  3KYQ A;  4Y3I A;  4KUK A;  3MMH A;  4EUV A;  1JNU A;  3IS2 B;  3KO6 A;  5AVF A;  3EEH A;  2J3T C;  1OT6 A;  2LB9 A;  4FSF A;  4GLQ A;  1Y28 A;  3H82 B;  2O99 A;  4MN5 A;  3T4K A;  4DMZ A;  5DKL A;  4Q0I A;  1GSX A;  3UME A;  4ARZ A;  1TS6 A;  2HGV A;  4QPR A;  4CLC B;  5HZH A;  4CLC C;  1LSV A;  3LUQ A;  2VGL M;  4JGO A;  3IS2 A;  4NXF A;  1DRM A;  3DBA A;  1XFQ A;  2ZOH A;  2EA9 A;  2V1B A;  4BBV A;  1S1Z A;  2P7J A;  3H82 A;  1MKM A;  4DJ2 A;  3ZQ5 A;  1OTI A;  4IUH A;  5IS1 A;  3OCN A;  2XA7 S;  3B42 A;  3T4O A;  4P6Z M;  2YKH A;  4I39 A;  5HWW A;  2PDR A;  3KSG A;  3KYZ A;  2XRO A;  3CWF A;  3BW6 A;  4BJP A;  2CMN A;  1V9Y A;  3R7W B;  1S4S A;  5J4E A;  1ZTU A;  5J7E A;  1OTA A;  4NEE D;  2OAP 1;  3OC2 A;  4HJ6 A;  3KSI A;  3E4P A;  4HIA A;  4UEY A;  3CUE C;  5CX7 A;  1T1B A;  3BY8 A;  4HQA A;  1ZHH B;  3LR0 A;  2K31 A;  2OOL A;  3ULF A;  4KUO A;  3C30 A;  4ETZ A;  2KOI A;  2KX6 A;  4HP9 A;  4DN0 A;  5DFY A;  3RFB A;  4FOF A;  4L9G A;  2P08 A;  3U2A A;  2W3G A;  3O5Y A;  3R7W A;  3LIA A;  1G28 A;  2IA2 A;  5F69 A;  2NUP C;  3TJZ C;  2I9V A;  1LSX A;  1X0O A;  2XSS A;  2JKT I;  2OWJ A;  3LIC A;  3S7O A;  1DP6 A;  2V1A A;  4GJ4 A;  3NOU C;  1TF1 A;  3CUE A;  1S1Y A;  5HPF A;  3NOP C;  3B33 A;  4O0P A;  2VGL S;  3A0V A;  4MDZ A;  4ME4 A;  5FL3 A;  1VHM A;  4EEP A;  2J3W A;  4LRZ E;  1W63 Q;  4M4X A;  2YKF A;  4IJG A;  4L0L A;  1NLZ A;  2O9A A;  1D7E A;  4WL9 A;  2M7V A;  3K3C A;  4I3J A;  3NOT C;  4Y2F A;  5A8B A;  1T19 A;  2R78 A;  4YNR A;  5EFW A;  1XJ2 A;  2FZ0 A;  5HWV A;  1XFN A;  2H28 A;  3F1P B;  3OLO A;  4HJ3 A;  4HNB A;  2G7U A;  4P6Z S;  4Q0H A;  2HF6 A;  2GX5 A;  4NXG A;  2KDK A;  5DF9 A;  1IFQ A;  3MF0 A;  3VV4 A;  3RTY A;  3UB6 A;  2VV7 A;  4GS9 B;  1OT9 A;  3EOI A;  4ZRR A;  4E04 A;  3TE8 A;  3T4S A;  5L8M A;  3C38 A;  5I5L A;  3GEC A;  3MQO A;  5TBM B;  2HJ9 C;  4K08 A;  4R70 A;  3VE3 A;  2EWW A;  2W27 A;  4GW9 A;  3F1P A;  3LID A;  5G4Z A;  1H3Q A;  1IOU A;  4MMN A;  4YWZ A;  4PKY G;  2EWV A;  1F5M A;  2VV6 A;  4EET B;  4Y5F A;  4R6L A;  4MN6 A;  1GSW A;  1YAX A;  5IU1 A;  1DP8 A;  4I5S A;  2VEA A;  4Z1W A;  1LSW A;  3TRC A;  3CAX A;  1T1C A;  4OOM A;  3UE6 A;  4GS9 A;  3HJI A;  1WA9 A;  3BQA A;  3FC7 A;  3KSF A;  3LR3 A;  4CLC E;  5TBM A;  3CLO A;  1N9O A;  4DJ3 A;  2A2L A;  1H8M A;  5HPI A;  1VB6 A;  1GSV A;  3MXQ A;  4IHQ A;  3VOL A;  3LYX A;  4HJ4 A;  1XJ3 A;  4PKY A;  3RH8 B;  3LR5 A;  3T4Q A;  1OJ5 A;  5F68 A;  4HP4 A;  2A24 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...