3CPTA

Mp1-p14 scaffolding complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
DDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular dynamics-solvated interaction energy studies of protein-protein interactions: the MP1-p14 scaffolding complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Mitogen-activated protein kinase kinase 1-interacting protei
total genus 36
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08923 MAPKK1_Int Mitogen-activated protein kinase kinase 1 interacting
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3cptA00
1FILA 4ESPA 3NULA 3L7HA 1VETA 2JKGA 1PFLA 2PBDP 2PRFA 3LEQA 4FTXA 3T1RA 4FUWA 1G5UA 5EV0A 5FEGA 1CJFA 1YPRA 3U4LP 1VEUB 3UB5P 1Z09A 2ZL1A 4D60A 4X1MA 2HZ5A 5EM0A 5FDSA 3CPTA 2VK3A 5EM1A 5EVEA 4X1LA 3T1XA 1J3WA 1VETB 2PAVP 2JKFA 3DAVA 3NECA 2E8JA 1SZVA 3LGOA 3KYEA 1SKOB 1K0KA 2ACGA 2ZL1B 3MS6A 3MSHA 4X25A 1CF0A 1PRQA 1FIKA 1AWIA 2B95A 3CPTB 1Y4OA 2V8FA 3L9KA 5FEFA 1F2KA 1PNEA 1A0KA 1CQAA 1VEUA 2V8CA 1ACFA 1D1JA 3CHWP 3T12B 4QWOA 1HLUP 3T1QB 2BTFP 1SKOA 3D9YA 3T1SA
chains in the Genus database with same CATH superfamily
3G30A 1L2SA 5HAPA 4MBFA 1KOUA 3OLOA 1XJ2A 4PHTA 2D02A 2P74A 3UDXA 2VZWA 1STZA 5DFXA 4F94A 3FYZA 1PW8A 4XUXA 1H3QA 2PR6A 4EBLA 5DJTA 2HDQA 3DWKA 3C8CA 3NY4A 5F83A 4PM6A 5J8XA 1XX2A 2VEAA 3BW6A 2IWCA 3ITAA 5JYOA 3P09A 2Y59A 5JYPA 1NYMA 3DAVA 4EV4A 3UB7A 4S2PA 1LHYA 2K7SA 1PWDA 2PU2A 3ZVTA 3SS4A 2WGWA 1HZOA 3LR0A 4DDSA 4NKPA 3N8SA 2OLUA 1S67L 5F68A 2O9CA 4PKYA 5DTSA 1E4DA 4CQHA 3UPNA 1K25A 3TG9A 2Y2QA 3E4PA 2WGWB 4IHQA 4XT2A 4BQMA 1E25A 2ZC5B 2VGLS 4GOGA 5CTMA 3LUQA 1L0DA 3S22A 5EOOA 4MLLA 2M1CA 2ZQAA 1CI9A 5EFWA 3LY3A 3U4LP 3IH9A 3TW8A 1ZHHB 4EBNA 1XGIA 2Y2LA 2B02A 2J3TD 3Q82A 5F1FA 2VV8A 5CERA 4OLGA 3GMWA 1HTZA 4S2KA 3LEZA 1F98A 5CHUA 1ONHA 2H5SA 1F2KA 4L9EA 5DTTA 3UE6A 3ZG0A 5HWVA 1NZUA 5CRFA 3SW1A 3OCNA 4OQIA 5G4YA 1YLZA 2ZM8A 2K31A 2CMNA 1ESIA 5FDSA 1N9OA 4XUZA 3MR0A 1X0OA 1HD8A 2Y2PA 3BY9A 4I3JA 5AVFA 3DTIA 3OC2A 4U0TA 2WYXA 3EWKA 1F5MA 2RCXA 4EETB 3KSGA 3QP5A 2V1ZA 3SS3A 4S2LA 5KMWA 2IA2A 3LIDA 4HI4A 3HUOA 3HLGA 2Y2HA 1GHMA 5CGWA 3IH8A 2G2WA 3IS2A 3IBRA 4M3KA 3CHWP 3FWLA 4ARZA 5CEDA 1LSXA 3HVFA 4IVIA 1MPLA 2ZM0A 3UB5P 2J80A 3WRZA 1H8MA 1KGEA 5FQKA 3MQQA 3T4TA 4Y3IA 1DJBA 3ZG8B 4E3MA 4JXWA 2WZZA 3HUNA 4DXBA 1W79A 4EESA 2ZOIA 4A5RA 2I72A 2Y4AA 1DRMA 3RH8B 1GSVA 3EEAA 1YPRA 3IF6B 5EM0A 2XD5A 1D06A 3M2KA 4BWIA 3G34A 1IOUA 3S4XA 3F1PA 2W1TA 1TEMA 3UE1A 4O7DA 2ZQ7A 1KDSA 3ZG5A 4NK3A 2OV5A 3F1PB 2VX8A 3T4KA 4S2JA 1OTDA 1NY0A 3T4OA 3IX8A 4D2OA 1ALQA 2XSSA 1BYWA 4MN6A 4Y13A 4E3JA 2Y2MA 3VP4A 3NOPC 2L0WA 3T4LA 3FZCA 3RTYA 4MNRA 3T50A 3C4OA 4OOMA 2O99A 2C6WB 2P9VB 3HLDA 1YKDA 3VOZA 2WKEA 4LLOB 3BLMA 4E6XA 5HSQA 3LEQA 1TF1A 3EQUA 3PBSA 3CLOA 5EVIB 4EEUA 4RQ9A 2R9WA 4WF0A 4LENA 1UWPX 5FA7A 2Y2OA 2JCHA 2Z2MB 2V1AA 2A24A 3IWOA 3PHYA 5FQ9A 4DMZA 4PM8A 1MZUA 2VJWA 5DKKA 1YMXA 4BBVA 3VFFA 1WE4A 5KIZA 1BT5A 5FI6A 3BEBA 5GLAA 2B95A 4LRXC 4K0XA 3C5AA 1IELA 2JBFA 5G18A 3ZFZA 2NUPC 4KZ3A 2KDKA 1NZOA 4IVKA 2NUTC 2HP6A 4QY6A 1O7EA 5DVAA 3BRMA 2ACGA 3G31A 2QKPA 3UY6A 1YT4A 3LI9A 4R23A 4NG2A 4L9GA 3T1QB 1ONGA 4LFUA 5GHXA 1OTIA 2A49A 3F1OB 1I2SA 4PKYG 4II7A 1VM1A 2Y91A 3QNBA 5FQIA 4I3AA 3B33A 1XJ4A 1LL8A 3IF5A 3NOUC 5FEFA 4BENA 2UV0E 3S7QA 2LB9A 3MZEA 3VSLA 2EX6A 4GDNA 1KVMA 3UB8A 3H9WA 3GQZA 4DE2A 2EX2A 2PAVP 2PD8A 1C3BA 2A2LA 4S2NC 4CLCC 3K3DA 3FKWA 2LB5A 4I5SA 5L8MA 4I38A 3ZCZA 2L4RA 5EE8A 2XA7S 4WELA 1OJ5A 5EECA 2V1BA 4DF6A 3IF6C 1S4RA 5EOEA 3W4PA 5HDDA 3TE8A 2J9OA 3V3RA 1H8YA 3FG8A 1UWNX 4OOYA 2QZ6A 1MKIA 2WAFA 4BBTA 3KO6A 2PD7A 4X6TA 1D1JA 4NETA 3A3DA 3ZG7B 3RFBA 4MEZA 1JWVA 4I3IA 2QMIA 3G2ZA 1Q2QA 2XROA 3CI6A 3Q7VA 2VV7A 1XA1A 2ZM2A 5M18A 3DW0A 3MFXA 4FTXA 4KG5A 3KX0X 3M6HA 4NXGA 4IUHA 4GN2A 1TDGA 3MJQA 4WEKA 3MXQA 3PBTA 2H0TA 1BULA 4IJGA 1K54A 3V50A 3S7PA 3TRCA 3ZVWA 3ICYA 2ZQDA 4JPMA 2PU4A 2DNSA 1BLCA 2G7UA 2HPBA 4HOIA 1YQSA 4Q0HA 3W4OA 5D3OA 4YWZA 4YNRA 5HAQA 4X1LA 4GHIA 4JBFA 4R3BA 3ZG9B 4EUVA 5TBMB 3IQAA 1S6RA 2EX9A 2H0YA 5EVLA 5FQJA 3G4PA 1ES2A 1PNEA 3GR2A 4WYYA 3T4SA 3T12B 1DJCA 4F3LB 3EGXC 3E4QA 3T1RA 4WEJA 3SH7A 3HLWA 2OAP1 4X1MA 1ESUA 2YKHA 3A0SA 5DF9A 3WS0A 5E2FA 5FAOA 1NXYA 1FSWA 4AFIA 3S1YA 2W3FA 2OWHA 1MWSA 5GHZA 3BECA 5EPHA 2DRWA 3V3SA 3F1NB 5FL3A 1JVJA 3RXWA 4E6WA 2W3GA 4DXCA 4B9OA 4P0MA 2Z2LB 1YMSA 3KSHA 3OPPA 1K4EA 4P87A 2VGKA 3LIEA 4QY5A 1GSWA 1W8YA 1XP4A 4EQ1A 2A3UA 1EWZA 5GL9A 4KQOA 1FILA 5HD3A 1OJGA 5AJGA 3NIAA 2QPNA 3GECA 2XFSA 5AQ9A 5U47A 3FC7A 4WMCD 4X68A 3KSFA 2O9BA 2PT7A 3IWQA 4QPRA 1H5XA 4KZ4A 5HPIA 1OT6A 2BLSA 1LSVA 5J4EA 1K38A 1PIOA 5EVIC 5GLCA 4Y17A 3OPLA 3GDIA 4LV1A 2O9AA 4I39A 5AVEA 2ZMVA 2FH5A 4KENB 5FI7A 5HW3A 5HWTA 4OP5A 3H82A 3AGFA 1S66L 1T18A 4ME4A 3O5YA 1M6KA 2OSUA 1SCWA 4HEFA 4QB8A 3D4FA 2PBYA 3HJKA 4K08A 3CWFA 3NDGA 2JKFA 3UN7A 1XJ3A 5BOHA 1JWZA 4NXEA 1DJAA 3G32A 3K2NA 2QHKA 1E3UD 3WWXA 1SKFA 4UQIS 1ERQA 4UA9A 2OOLA 4GS9B 1RCJA 4B4ZA 2HDSA 1PI4A 4HP9A 4ZTKA 2A24B 2J8YA 1NLYA 1BLSA 3N8RA 1RGZA 3Q1FA 4K0WA 5A90A 1YSPA 2R9XA 1FCNA 3HREA 2EWWA 2WGIA 3LR4A 3UE0A 3TSGA 4JF5A 3E4OA 2C5WB 5HL6A 4O8GA 5FDHA 5DF8A 5GLDA 5EVID 5KZHA 5FAPA 4WN5A 4BD0A 5FI2A 4GLQA 3D3OA 1P9WA 3WS2A 2HDRA 5HD5A 1KE4A 3AGDA 5HX9A 3NJAA 1KGFA 4O01A 3U2AA 2JN7A 3Q7ZA 3IX4A 5TJJA 1ZKJA 3MKFA 1RP5A 3GV9A 3LIAA 3UO9A 1J9MA 1W8QA 1Q2PA 3N4IA 3IHBA 5HARA 3IWIA 2ZMFA 4LPZA 1ES5A 3VP1A 1SKOA 4E3NA 2EWVA 4HH2A 4BMWA 1TDLA 1CJFA 4E3OA 2W3HA 4R1GA 2ZOHA 2XK1A 4S2OA 4Z1WA 3LO7A 1TS8A 4FOFA 1NJ4A 4DJ2A 3NI9A 5FQQA 3LICA 4C75A 1F9IA 2P7JA 5IHVA 3SZTA 3IXHA 4WUJA 3M2JA 2AVXA 4GZBA 4R0QA 4UA7A 3VP3A 5DFYA 5HDSA 2Y2JA 3R7WA 5EVIA 1PRQA 3CPTB 4LV2A 3BJNA 4E04A 1TVFA 3ZNYA 3W8KA 3E2KA 4QHCA 3HLFA 1EI5A 1UGUA 4R3JA 1L0GA 1W7FA 3CPTA 1VETB 4JLFA 3PBOA 1GHIA 1IKGA 2EXAA 4LRZE 1MC0A 4OP8A 4HHDA 1QMEA 5M1AA 4S2NA 1QMFA 4CLCA 1LL9A 3L7HA 4WZ5C 3P7NA 4FUWA 3G2YA 4C6YA 4GW9A 3BM6A 2CC1A 4YINA 5CXWA 3JYIA 2XFTA 3NHQA 3HUMA 1P97A 2GNXA 2Y2NA 3ZYTA 4N1HA 4RVAA 4LCLA 1MWUA 2V8FA 2Q9MA 2EX8A 1JWPA 2PRFA 4NEED 3C4PA 3TOIA 1G28A 3QP2A 2Y2GA 4LCMA 1K6RA 4WM9A 3W2ZA 4UEYA 3CG5A 3Q07A 1YLPA 3C7VA 2ZC7A 3UNWA 3SH8A 1ACFA 4U3TA 1BLHA 1IYQA 1ES4A 1KE3A 3V5MA 4GHIB 4Y2FA 4E3LA 1K56D 3BFFA 2BG1A 4OKPA 1VB6A 1XGJA 4GD8A 2XH9A 4DN0A 2V8CA 4XT2B 2M7UA 3C2WA 4BL3A 2ZD8A 5EV0A 2HDUA 4X69A 2HP5A 1OTEA 2VKSA 3V39A 2PDRA 2HGVA 1V9YA 2ZL1B 4DDYA 3L9KA 4RX2A 2JKTM 4DKIA 2HJEA 3QP8A 4C3QA 1HVBA 1G6AA 4CLCE 4MBKA 5EVEA 1XFQA 4JGOA 3ZNTA 3BYDA 3D72A 1CQAA 1L0EA 5TR7A 5K5BA 4Y0TA 4B93A 4EQIA 3EQVA 3A3IA 5A8BA 4HQAA 4LV0A 4X55A 4N92A 3FPVA 3C38A 4FH2A 2VK3A 3CITA 5CHMA 3OPRA 3VE4A 4ZBEA 2W3EA 4KZAA 2XLNA 1FR6A 4OQ0A 2EFXA 4IBRA 1IKIA 4U0XA 5CGXA 5G4ZA 3H7WB 4OPZA 2ZC3B 1I2WA 3UMDA 2RL3A 5E2EA 1T1AA 2VGLM 3TJZC 1BZAA 1EW0A 3HL9A 2Q9NA 1FIKA 5HFOA 4B88A 2X01A 4M4XA 3F1OA 3MF0A 5DTKA 2WAEA 2GX5A 3A3EA 2X71A 2Y55A 2KOIA 2GZAA 1T19A 1VQQA 4QD4A 3VV4A 3HLEA 3ZQ5A 2E8IA 2VGJA 3OBFA 5L10A 1XJ6A 1U60A 4JXSA 5FQMA 4PMAA 4H6JB 1P9RA 2XDMA 3LFVA 2J3TC 1LT0A 4R4RA 3WS4A 4YOFA 5CX7A 1GHPA 1FSYA 2YKFA 3HCYA 5FAQA 1FQGA 3NBLA 1V9ZA 2B18A 1YLJA 4R70A 3PXPA 2XF3A 3BQAA 3QP6A 5IT5A 2M7VA 5CEBA 4GJ4A 4QU3A 3MMHA 4MN7A 3QP4A 2XQZA 1OT9A 4LRYC 5EM1A 3KYQA 4WBGA 3C7UA 4KZ7A 5F82A 2HF6A 5AQBA 1ZG4A 4R38A 2HP9A 2OAQ1 5KSCA 4KG6A 2FFYA 2P9VA 2V20A 3D9YA 1NRFA 1YLTA 2V9AA 3H82B 3NECA 1DP6A 2W0NA 4PM7A 1XA7A 1SHVA 4KZ8A 3PR6A 1BUEA 3DWZA 5GHYA 3ZGAB 3MKEA 2OWJA 3PBRA 4H8RA 1XXMA 3NULA 1FOFA 1IYSA 5I5LA 3A3JA 4NXFA 5TGFA 4HJ6A 4RYEA 2G2UA 4ZJ2A 3W4QA 3B42A 2XD1A 3BFCA 1MKMA 1LSWA 1SZVA 2Y2IA 2QJ5A 2ZJ9A 1MWRA 2VV6A 2ZQCA 4HJ4A 1VEUA 4JGRA 5CECA 1M40A 1DP9A 2QWSA 3T1SA 2Y2KA 3UDIA 1BSGA 1WYCA 2WZXA 4ZRRA 1S1ZA 1ES3A 2ZQ9A 3NCKA 3IX3A 4WMCA 4XXRA 1K57A 2E8JA 1PWGA 3BFEA 4DE0A 1DP8A 4Y15A 1HLUP 3ZHHA 4G3VA 1ERMA 3BLSA 5E2HA 1NLZA 1TS0A 4PM9A 2ZC4B 4KUKA 1DY6A 2HJ9C 4F3LA 1WA9A 3IHAA 3LGOA 4DRTA 5HL1A 4ZAMA 3VOYA 4HH3A 3GTCA 2VA0A 4Q0JA 4MN5A 5M19A 5DJUA 3CUEC 3BFGA 3E2LA 3A3FA 4GNUA 3CZDA 4UA6A 3VMAA 3MQ0A 3UB9A 3LIBA 1GA0A 1D7EA 2Q0OA 1PW1A 1JTDA 4OQHA 1CI8A 2X02A 3MBZA 4EEPA 1XFNA 1N9LA 2JC7A 4UQIM 4EBPA 3ULFA 4WZ5A 3R4KA 1MBLA 4GB7A 1SKOB 3T4JA 2XA7M 5A91A 5HDCA 5KSHA 1LL5A 5E2GA 4KZ6A 1TS6A 4ZDXA 1KVLA 1T1BA 4LV3A 4OOLA 4P85A 1Z09A 4WL9A 3E0YA 5F6AA 1J3WA 2ZMAA 3PBQA 3JPUA 3UPPA 1LI0A 3MSHA 4RX3A 2IWBA 5I94A 2W27A 1FCOA 4K91A 4NXBA 3OZHA 4BL2A 2IWDA 4B4XA 1JTGA 3T4QA 3NOTC 1ZC2A 4CLCB 3MZDA 2DCFA 4FCFA 4BJPA 3PBNA 3LI8A 1YM1A 4ETXA 2R78A 1L0FA 4MBHA 1SDEA 4P6ZS 5E43A 5AQAA 2XRNA 3IS2B 4JKTA 1BTLA 3IXBA 2WGVA 2HV1A 4DE3A 1KE0A 1BLPA 2ZBBA 3H7WA 3MS6A 2PHYA 4DE1A 1CK3A 5DF7A 1YLYA 2KX6A 4LGWA 4HBTA 3G6OA 4MCWA 1VHMA 3SOIA 4OPQA 2W1RA 1ZG6A 4KQQA 2PR5A 4HNBA 1LLBA 2DMWA 5MC7A 1TD5A 1TS7A 2WKRA 4GCZA 2W3DA 1OTBA 3HJIA 4KZ9A 4KZBA 4ARZB 1K56A 3WRTA 5J3WA 1K0KA 3N6IA 1PZPA 3JVUA 4OVDA 4DJ3A 2UWXA 3MZFA 4Y0OA 3FKVA 4ESPA 3IXDA 4KQRA 4N1XA 4E3IA 4JGPA 3MXSA 4JF4A 1S4SA 3F1NA 5J7EA 1CEGA 3KSIA 3HLBA 2INWA 2EA9A 5EUAA 2JKTI 3UMEA 2J3WA 2WKQA 5FSRA 4EWFA 3ITBA 3WS1A 3PYPA 1SDNA 4HY8A 4MMNA 1IYOA 3VP2A 4FH4A 3LR5A 4R6LA 5L09A 5TFQA 2GJ3A 2XR0A 3BY8A 2WK0A 3BFDA 4L9FA 3GRJA 4KG2A 1YLWA 1OTAA 1NYYA 3M6BA 4CPKA 1K55C 1AWIA 2B5RA 1I5QA 5HPFA 5F1GA 3CAXA 1ODVA 1N9BA 2XGNA 4QWOA 5DKLA 2BTFP 4G3WA 3V67A 3G35A 1PZOA 2J7VA 2GDNA 3N8LA 3UE3A 2ZL1A 2VLGA 1K55A 3K3CA 4O0PA 4FSFA 2V2FF 4E3KA 3OCLA 5L07A 3RXXA 4WZ4A 4X25A 2OLVA 2H28A 5GLBA 3LYXA 4ID4A 3A0VA 4BD1A 3O88A 4YFMA 3P98A 3N7WA 2PBDP 1Z6FA 2MJ6A 3CMZA 3VOLA 4FD8A 4JGQA 1FR1A 1NRJA 3IXGA 3UB6A 5AQ7A 4Y5FA 3DTKA 3O86A 3NDEA 1IYPA 3MFDA 2L1MA 1S0WA 1GCEA 3EOIA 4UAAA 1WYBA 4JF6A 1PFLA 1LI9A 4P6ZM 2QYBA 1K4FA 3JVVA 1CEFA 1T1CA 4JXGA 3S7OA 4ZJ1A 2ZLYA 3Q81A 4HJ3A 3BQ8A 4CJNA 2WKHA 4L0LA 2BASA 4GDBA 4PM5A 1PYYA 3MXRA 4S2IA 1KGGA 2WUQA 3DTMA 4GKUA 2WKPA 5CTNA 3R7WB 2WADA 5F69A 3SS5A 3T1XA 3EEHA 2P08A 1MXOA 4GS9A 4Q8IA 1EROA 1GA9A 4EU0A 1ZTUA 2J9PA 1VETA 3IT9A 3VP0A 3VFHA 2JHEA 3B47A 5F5YA 1P0ZA 3VE3A 3PAGA 3LY4A 2EFUA 4ETZA 3NC8A 2FFFB 4H6JA 3GVBA 4OONA 4JXVA 4BLMA 1RGYA 2JKRM 1G68A 3HLCA 3IF6A 4MDZA 1K57C 1W63Q 2JE5A 4X53A 2KLIA 2V0WA 1E3UA 3ISGA 1YAXA 3WS5A 4KUOA 2O0YA 4IEDA 1OMEA 2ZQ8A 3IBJA 1Y4OA 1L3LA 1N4OA 1W5DA 1O07A 4N9LA 3P01A 4N9KA 2JKGA 5FEGA 3C30A 5C5KA 1GSXA 1H8ZA 3AGEA 4D60A 2PYPA 1Y54A 4GD6A 5LBRA 4RA7A 1JNUA 1YSQA 4WLAA 2Z6DA 3UDFA 3O87A 2V0UA 4Y0UA 2FZ0A 3QHYA 4IUKA 1N9NA 3LIFA 3FV7A 4HIAA 3EGDC 1IFQA 4HBUA 4UHUA 2Y8HA 2K2NA 2HZ5A 5FASA 2W1TB 4EW7A 1H0MA 4CLCD 3B3XA 3HBRA 3KYEA 4R3AA 2Z6CA 2D01A 5A92A 2JKRI 5IS1A 4OPRA 4IBXA 1A0KA 4KZ5A 4ZJ3A 4EUZA 5L2FA 3LR3A 1IEMA 3A0RA 4OLDA 3MQOA 1MWTA 1PWCA 3OOVA 3Q7VB 3O3VA 4OPYA 4R4SA 1MY8A 2QJ7A 4KQDA 1K6SA 3QNCA 1AXBA 2ZC6B 4QJGA 2H10A 2PYRA 4Y7PA 2P04A 3GSGA 3PTEA 5HZHA 3RJUA 4BBUA 4EERA 1XKZA 4P6BA 1PI5A 4EXOA 5IU1A 1G6OA 4G3KA 1K54C 1VEUB 2EXBA 3E98A 2I9VA 5CHJA 3VSKA 3DBAA 2XEPA 3DTEA 4OH0A 3FPWA 5CGSA 4HESA 4PPRA 1NWZA 1Y28A 4Z9QA 1FCMA 1KDWA 5A93A 4X56A 3CUEA 4HP4A 1G5UA 2WKIA 3QP1A 5FATA 4Q0IA 3OPHA 3ZDJA 4S2MA 1S1YA 1OPXA 1W63M 3CJMA 5HAIA 3SH9A 3I7JA 1CF0A 3PAEA 3KYZA 1XPBA 5HWWA 3BWLA 4OQGA 3LCEA 4PAUA 5TBMA 2Y79A 3UPOA 3S7NA
chains in the Genus database with same CATH topology
1FILA 4ESPA 3NULA 3L7HA 1VETA 2JKGA 1PFLA 2PBDP 2PRFA 3LEQA 4FTXA 3T1RA 4FUWA 1G5UA 5EV0A 5FEGA 1CJFA 1YPRA 3U4LP 1VEUB 3UB5P 1Z09A 2ZL1A 4D60A 4X1MA 2HZ5A 5EM0A 5FDSA 3CPTA 2VK3A 5EM1A 5EVEA 4X1LA 3T1XA 1J3WA 1VETB 2PAVP 2JKFA 3DAVA 3NECA 2E8JA 1SZVA 3LGOA 3KYEA 1SKOB 1K0KA 2ACGA 2ZL1B 3MS6A 3MSHA 4X25A 1CF0A 1PRQA 1FIKA 1AWIA 2B95A 3CPTB 1Y4OA 2V8FA 3L9KA 5FEFA 1F2KA 1PNEA 1A0KA 1CQAA 1VEUA 2V8CA 1ACFA 1D1JA 3CHWP 3T12B 4QWOA 1HLUP 3T1QB 2BTFP 1SKOA 3D9YA 3T1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIL A;  4ESP A;  3NUL A;  3L7H A;  1VET A;  2JKG A;  1PFL A;  2PBD P;  2PRF A;  3LEQ A;  4FTX A;  3T1R A;  4FUW A;  1G5U A;  5EV0 A;  5FEG A;  1CJF A;  1YPR A;  3U4L P;  1VEU B;  3UB5 P;  1Z09 A;  2ZL1 A;  4D60 A;  4X1M A;  2HZ5 A;  5EM0 A;  5FDS A;  3CPT A;  2VK3 A;  5EM1 A;  5EVE A;  4X1L A;  3T1X A;  1J3W A;  1VET B;  2PAV P;  2JKF A;  3DAV A;  3NEC A;  2E8J A;  1SZV A;  3LGO A;  3KYE A;  1SKO B;  1K0K A;  2ACG A;  2ZL1 B;  3MS6 A;  3MSH A;  4X25 A;  1CF0 A;  1PRQ A;  1FIK A;  1AWI A;  2B95 A;  3CPT B;  1Y4O A;  2V8F A;  3L9K A;  5FEF A;  1F2K A;  1PNE A;  1A0K A;  1CQA A;  1VEU A;  2V8C A;  1ACF A;  1D1J A;  3CHW P;  3T12 B;  4QWO A;  1HLU P;  3T1Q B;  2BTF P;  1SKO A;  3D9Y A;  3T1S A; 
#chains in the Genus database with same CATH topology
 3G30 A;  1L2S A;  5HAP A;  4MBF A;  1KOU A;  3OLO A;  1XJ2 A;  4PHT A;  2D02 A;  2P74 A;  3UDX A;  2VZW A;  1STZ A;  5DFX A;  4F94 A;  3FYZ A;  1PW8 A;  4XUX A;  1H3Q A;  2PR6 A;  4EBL A;  5DJT A;  2HDQ A;  3DWK A;  3C8C A;  3NY4 A;  5F83 A;  4PM6 A;  5J8X A;  1XX2 A;  2VEA A;  3BW6 A;  2IWC A;  3ITA A;  5JYO A;  3P09 A;  2Y59 A;  5JYP A;  1NYM A;  3DAV A;  4EV4 A;  3UB7 A;  4S2P A;  1LHY A;  2K7S A;  1PWD A;  2PU2 A;  3ZVT A;  3SS4 A;  2WGW A;  1HZO A;  3LR0 A;  4DDS A;  4NKP A;  3N8S A;  2OLU A;  1S67 L;  5F68 A;  2O9C A;  4PKY A;  5DTS A;  1E4D A;  4CQH A;  3UPN A;  1K25 A;  3TG9 A;  2Y2Q A;  3E4P A;  2WGW B;  4IHQ A;  4XT2 A;  4BQM A;  1E25 A;  2ZC5 B;  2VGL S;  4GOG A;  5CTM A;  3LUQ A;  1L0D A;  3S22 A;  5EOO A;  4MLL A;  2M1C A;  2ZQA A;  1CI9 A;  5EFW A;  3LY3 A;  3U4L P;  3IH9 A;  3TW8 A;  1ZHH B;  4EBN A;  1XGI A;  2Y2L A;  2B02 A;  2J3T D;  3Q82 A;  5F1F A;  2VV8 A;  5CER A;  4OLG A;  3GMW A;  1HTZ A;  4S2K A;  3LEZ A;  1F98 A;  5CHU A;  1ONH A;  2H5S A;  1F2K A;  4L9E A;  5DTT A;  3UE6 A;  3ZG0 A;  5HWV A;  1NZU A;  5CRF A;  3SW1 A;  3OCN A;  4OQI A;  5G4Y A;  1YLZ A;  2ZM8 A;  2K31 A;  2CMN A;  1ESI A;  5FDS A;  1N9O A;  4XUZ A;  3MR0 A;  1X0O A;  1HD8 A;  2Y2P A;  3BY9 A;  4I3J A;  5AVF A;  3DTI A;  3OC2 A;  4U0T A;  2WYX A;  3EWK A;  1F5M A;  2RCX A;  4EET B;  3KSG A;  3QP5 A;  2V1Z A;  3SS3 A;  4S2L A;  5KMW A;  2IA2 A;  3LID A;  4HI4 A;  3HUO A;  3HLG A;  2Y2H A;  1GHM A;  5CGW A;  3IH8 A;  2G2W A;  3IS2 A;  3IBR A;  4M3K A;  3CHW P;  3FWL A;  4ARZ A;  5CED A;  1LSX A;  3HVF A;  4IVI A;  1MPL A;  2ZM0 A;  3UB5 P;  2J80 A;  3WRZ A;  1H8M A;  1KGE A;  5FQK A;  3MQQ A;  3T4T A;  4Y3I A;  1DJB A;  3ZG8 B;  4E3M A;  4JXW A;  2WZZ A;  3HUN A;  4DXB A;  1W79 A;  4EES A;  2ZOI A;  4A5R A;  2I72 A;  2Y4A A;  1DRM A;  3RH8 B;  1GSV A;  3EEA A;  1YPR A;  3IF6 B;  5EM0 A;  2XD5 A;  1D06 A;  3M2K A;  4BWI A;  3G34 A;  1IOU A;  3S4X A;  3F1P A;  2W1T A;  1TEM A;  3UE1 A;  4O7D A;  2ZQ7 A;  1KDS A;  3ZG5 A;  4NK3 A;  2OV5 A;  3F1P B;  2VX8 A;  3T4K A;  4S2J A;  1OTD A;  1NY0 A;  3T4O A;  3IX8 A;  4D2O A;  1ALQ A;  2XSS A;  1BYW A;  4MN6 A;  4Y13 A;  4E3J A;  2Y2M A;  3VP4 A;  3NOP C;  2L0W A;  3T4L A;  3FZC A;  3RTY A;  4MNR A;  3T50 A;  3C4O A;  4OOM A;  2O99 A;  2C6W B;  2P9V B;  3HLD A;  1YKD A;  3VOZ A;  2WKE A;  4LLO B;  3BLM A;  4E6X A;  5HSQ A;  3LEQ A;  1TF1 A;  3EQU A;  3PBS A;  3CLO A;  5EVI B;  4EEU A;  4RQ9 A;  2R9W A;  4WF0 A;  4LEN A;  1UWP X;  5FA7 A;  2Y2O A;  2JCH A;  2Z2M B;  2V1A A;  2A24 A;  3IWO A;  3PHY A;  5FQ9 A;  4DMZ A;  4PM8 A;  1MZU A;  2VJW A;  5DKK A;  1YMX A;  4BBV A;  3VFF A;  1WE4 A;  5KIZ A;  1BT5 A;  5FI6 A;  3BEB A;  5GLA A;  2B95 A;  4LRX C;  4K0X A;  3C5A A;  1IEL A;  2JBF A;  5G18 A;  3ZFZ A;  2NUP C;  4KZ3 A;  2KDK A;  1NZO A;  4IVK A;  2NUT C;  2HP6 A;  4QY6 A;  1O7E A;  5DVA A;  3BRM A;  2ACG A;  3G31 A;  2QKP A;  3UY6 A;  1YT4 A;  3LI9 A;  4R23 A;  4NG2 A;  4L9G A;  3T1Q B;  1ONG A;  4LFU A;  5GHX A;  1OTI A;  2A49 A;  3F1O B;  1I2S A;  4PKY G;  4II7 A;  1VM1 A;  2Y91 A;  3QNB A;  5FQI A;  4I3A A;  3B33 A;  1XJ4 A;  1LL8 A;  3IF5 A;  3NOU C;  5FEF A;  4BEN A;  2UV0 E;  3S7Q A;  2LB9 A;  3MZE A;  3VSL A;  2EX6 A;  4GDN A;  1KVM A;  3UB8 A;  3H9W A;  3GQZ A;  4DE2 A;  2EX2 A;  2PAV P;  2PD8 A;  1C3B A;  2A2L A;  4S2N C;  4CLC C;  3K3D A;  3FKW A;  2LB5 A;  4I5S A;  5L8M A;  4I38 A;  3ZCZ A;  2L4R A;  5EE8 A;  2XA7 S;  4WEL A;  1OJ5 A;  5EEC A;  2V1B A;  4DF6 A;  3IF6 C;  1S4R A;  5EOE A;  3W4P A;  5HDD A;  3TE8 A;  2J9O A;  3V3R A;  1H8Y A;  3FG8 A;  1UWN X;  4OOY A;  2QZ6 A;  1MKI A;  2WAF A;  4BBT A;  3KO6 A;  2PD7 A;  4X6T A;  1D1J A;  4NET A;  3A3D A;  3ZG7 B;  3RFB A;  4MEZ A;  1JWV A;  4I3I A;  2QMI A;  3G2Z A;  1Q2Q A;  2XRO A;  3CI6 A;  3Q7V A;  2VV7 A;  1XA1 A;  2ZM2 A;  5M18 A;  3DW0 A;  3MFX A;  4FTX A;  4KG5 A;  3KX0 X;  3M6H A;  4NXG A;  4IUH A;  4GN2 A;  1TDG A;  3MJQ A;  4WEK A;  3MXQ A;  3PBT A;  2H0T A;  1BUL A;  4IJG A;  1K54 A;  3V50 A;  3S7P A;  3TRC A;  3ZVW A;  3ICY A;  2ZQD A;  4JPM A;  2PU4 A;  2DNS A;  1BLC A;  2G7U A;  2HPB A;  4HOI A;  1YQS A;  4Q0H A;  3W4O A;  5D3O A;  4YWZ A;  4YNR A;  5HAQ A;  4X1L A;  4GHI A;  4JBF A;  4R3B A;  3ZG9 B;  4EUV A;  5TBM B;  3IQA A;  1S6R A;  2EX9 A;  2H0Y A;  5EVL A;  5FQJ A;  3G4P A;  1ES2 A;  1PNE A;  3GR2 A;  4WYY A;  3T4S A;  3T12 B;  1DJC A;  4F3L B;  3EGX C;  3E4Q A;  3T1R A;  4WEJ A;  3SH7 A;  3HLW A;  2OAP 1;  4X1M A;  1ESU A;  2YKH A;  3A0S A;  5DF9 A;  3WS0 A;  5E2F A;  5FAO A;  1NXY A;  1FSW A;  4AFI A;  3S1Y A;  2W3F A;  2OWH A;  1MWS A;  5GHZ A;  3BEC A;  5EPH A;  2DRW A;  3V3S A;  3F1N B;  5FL3 A;  1JVJ A;  3RXW A;  4E6W A;  2W3G A;  4DXC A;  4B9O A;  4P0M A;  2Z2L B;  1YMS A;  3KSH A;  3OPP A;  1K4E A;  4P87 A;  2VGK A;  3LIE A;  4QY5 A;  1GSW A;  1W8Y A;  1XP4 A;  4EQ1 A;  2A3U A;  1EWZ A;  5GL9 A;  4KQO A;  1FIL A;  5HD3 A;  1OJG A;  5AJG A;  3NIA A;  2QPN A;  3GEC A;  2XFS A;  5AQ9 A;  5U47 A;  3FC7 A;  4WMC D;  4X68 A;  3KSF A;  2O9B A;  2PT7 A;  3IWQ A;  4QPR A;  1H5X A;  4KZ4 A;  5HPI A;  1OT6 A;  2BLS A;  1LSV A;  5J4E A;  1K38 A;  1PIO A;  5EVI C;  5GLC A;  4Y17 A;  3OPL A;  3GDI A;  4LV1 A;  2O9A A;  4I39 A;  5AVE A;  2ZMV A;  2FH5 A;  4KEN B;  5FI7 A;  5HW3 A;  5HWT A;  4OP5 A;  3H82 A;  3AGF A;  1S66 L;  1T18 A;  4ME4 A;  3O5Y A;  1M6K A;  2OSU A;  1SCW A;  4HEF A;  4QB8 A;  3D4F A;  2PBY A;  3HJK A;  4K08 A;  3CWF A;  3NDG A;  2JKF A;  3UN7 A;  1XJ3 A;  5BOH A;  1JWZ A;  4NXE A;  1DJA A;  3G32 A;  3K2N A;  2QHK A;  1E3U D;  3WWX A;  1SKF A;  4UQI S;  1ERQ A;  4UA9 A;  2OOL A;  4GS9 B;  1RCJ A;  4B4Z A;  2HDS A;  1PI4 A;  4HP9 A;  4ZTK A;  2A24 B;  2J8Y A;  1NLY A;  1BLS A;  3N8R A;  1RGZ A;  3Q1F A;  4K0W A;  5A90 A;  1YSP A;  2R9X A;  1FCN A;  3HRE A;  2EWW A;  2WGI A;  3LR4 A;  3UE0 A;  3TSG A;  4JF5 A;  3E4O A;  2C5W B;  5HL6 A;  4O8G A;  5FDH A;  5DF8 A;  5GLD A;  5EVI D;  5KZH A;  5FAP A;  4WN5 A;  4BD0 A;  5FI2 A;  4GLQ A;  3D3O A;  1P9W A;  3WS2 A;  2HDR A;  5HD5 A;  1KE4 A;  3AGD A;  5HX9 A;  3NJA A;  1KGF A;  4O01 A;  3U2A A;  2JN7 A;  3Q7Z A;  3IX4 A;  5TJJ A;  1ZKJ A;  3MKF A;  1RP5 A;  3GV9 A;  3LIA A;  3UO9 A;  1J9M A;  1W8Q A;  1Q2P A;  3N4I A;  3IHB A;  5HAR A;  3IWI A;  2ZMF A;  4LPZ A;  1ES5 A;  3VP1 A;  1SKO A;  4E3N A;  2EWV A;  4HH2 A;  4BMW A;  1TDL A;  1CJF A;  4E3O A;  2W3H A;  4R1G A;  2ZOH A;  2XK1 A;  4S2O A;  4Z1W A;  3LO7 A;  1TS8 A;  4FOF A;  1NJ4 A;  4DJ2 A;  3NI9 A;  5FQQ A;  3LIC A;  4C75 A;  1F9I A;  2P7J A;  5IHV A;  3SZT A;  3IXH A;  4WUJ A;  3M2J A;  2AVX A;  4GZB A;  4R0Q A;  4UA7 A;  3VP3 A;  5DFY A;  5HDS A;  2Y2J A;  3R7W A;  5EVI A;  1PRQ A;  3CPT B;  4LV2 A;  3BJN A;  4E04 A;  1TVF A;  3ZNY A;  3W8K A;  3E2K A;  4QHC A;  3HLF A;  1EI5 A;  1UGU A;  4R3J A;  1L0G A;  1W7F A;  3CPT A;  1VET B;  4JLF A;  3PBO A;  1GHI A;  1IKG A;  2EXA A;  4LRZ E;  1MC0 A;  4OP8 A;  4HHD A;  1QME A;  5M1A A;  4S2N A;  1QMF A;  4CLC A;  1LL9 A;  3L7H A;  4WZ5 C;  3P7N A;  4FUW A;  3G2Y A;  4C6Y A;  4GW9 A;  3BM6 A;  2CC1 A;  4YIN A;  5CXW A;  3JYI A;  2XFT A;  3NHQ A;  3HUM A;  1P97 A;  2GNX A;  2Y2N A;  3ZYT A;  4N1H A;  4RVA A;  4LCL A;  1MWU A;  2V8F A;  2Q9M A;  2EX8 A;  1JWP A;  2PRF A;  4NEE D;  3C4P A;  3TOI A;  1G28 A;  3QP2 A;  2Y2G A;  4LCM A;  1K6R A;  4WM9 A;  3W2Z A;  4UEY A;  3CG5 A;  3Q07 A;  1YLP A;  3C7V A;  2ZC7 A;  3UNW A;  3SH8 A;  1ACF A;  4U3T A;  1BLH A;  1IYQ A;  1ES4 A;  1KE3 A;  3V5M A;  4GHI B;  4Y2F A;  4E3L A;  1K56 D;  3BFF A;  2BG1 A;  4OKP A;  1VB6 A;  1XGJ A;  4GD8 A;  2XH9 A;  4DN0 A;  2V8C A;  4XT2 B;  2M7U A;  3C2W A;  4BL3 A;  2ZD8 A;  5EV0 A;  2HDU A;  4X69 A;  2HP5 A;  1OTE A;  2VKS A;  3V39 A;  2PDR A;  2HGV A;  1V9Y A;  2ZL1 B;  4DDY A;  3L9K A;  4RX2 A;  2JKT M;  4DKI A;  2HJE A;  3QP8 A;  4C3Q A;  1HVB A;  1G6A A;  4CLC E;  4MBK A;  5EVE A;  1XFQ A;  4JGO A;  3ZNT A;  3BYD A;  3D72 A;  1CQA A;  1L0E A;  5TR7 A;  5K5B A;  4Y0T A;  4B93 A;  4EQI A;  3EQV A;  3A3I A;  5A8B A;  4HQA A;  4LV0 A;  4X55 A;  4N92 A;  3FPV A;  3C38 A;  4FH2 A;  2VK3 A;  3CIT A;  5CHM A;  3OPR A;  3VE4 A;  4ZBE A;  2W3E A;  4KZA A;  2XLN A;  1FR6 A;  4OQ0 A;  2EFX A;  4IBR A;  1IKI A;  4U0X A;  5CGX A;  5G4Z A;  3H7W B;  4OPZ A;  2ZC3 B;  1I2W A;  3UMD A;  2RL3 A;  5E2E A;  1T1A A;  2VGL M;  3TJZ C;  1BZA A;  1EW0 A;  3HL9 A;  2Q9N A;  1FIK A;  5HFO A;  4B88 A;  2X01 A;  4M4X A;  3F1O A;  3MF0 A;  5DTK A;  2WAE A;  2GX5 A;  3A3E A;  2X71 A;  2Y55 A;  2KOI A;  2GZA A;  1T19 A;  1VQQ A;  4QD4 A;  3VV4 A;  3HLE A;  3ZQ5 A;  2E8I A;  2VGJ A;  3OBF A;  5L10 A;  1XJ6 A;  1U60 A;  4JXS A;  5FQM A;  4PMA A;  4H6J B;  1P9R A;  2XDM A;  3LFV A;  2J3T C;  1LT0 A;  4R4R A;  3WS4 A;  4YOF A;  5CX7 A;  1GHP A;  1FSY A;  2YKF A;  3HCY A;  5FAQ A;  1FQG A;  3NBL A;  1V9Z A;  2B18 A;  1YLJ A;  4R70 A;  3PXP A;  2XF3 A;  3BQA A;  3QP6 A;  5IT5 A;  2M7V A;  5CEB A;  4GJ4 A;  4QU3 A;  3MMH A;  4MN7 A;  3QP4 A;  2XQZ A;  1OT9 A;  4LRY C;  5EM1 A;  3KYQ A;  4WBG A;  3C7U A;  4KZ7 A;  5F82 A;  2HF6 A;  5AQB A;  1ZG4 A;  4R38 A;  2HP9 A;  2OAQ 1;  5KSC A;  4KG6 A;  2FFY A;  2P9V A;  2V20 A;  3D9Y A;  1NRF A;  1YLT A;  2V9A A;  3H82 B;  3NEC A;  1DP6 A;  2W0N A;  4PM7 A;  1XA7 A;  1SHV A;  4KZ8 A;  3PR6 A;  1BUE A;  3DWZ A;  5GHY A;  3ZGA B;  3MKE A;  2OWJ A;  3PBR A;  4H8R A;  1XXM A;  3NUL A;  1FOF A;  1IYS A;  5I5L A;  3A3J A;  4NXF A;  5TGF A;  4HJ6 A;  4RYE A;  2G2U A;  4ZJ2 A;  3W4Q A;  3B42 A;  2XD1 A;  3BFC A;  1MKM A;  1LSW A;  1SZV A;  2Y2I A;  2QJ5 A;  2ZJ9 A;  1MWR A;  2VV6 A;  2ZQC A;  4HJ4 A;  1VEU A;  4JGR A;  5CEC A;  1M40 A;  1DP9 A;  2QWS A;  3T1S A;  2Y2K A;  3UDI A;  1BSG A;  1WYC A;  2WZX A;  4ZRR A;  1S1Z A;  1ES3 A;  2ZQ9 A;  3NCK A;  3IX3 A;  4WMC A;  4XXR A;  1K57 A;  2E8J A;  1PWG A;  3BFE A;  4DE0 A;  1DP8 A;  4Y15 A;  1HLU P;  3ZHH A;  4G3V A;  1ERM A;  3BLS A;  5E2H A;  1NLZ A;  1TS0 A;  4PM9 A;  2ZC4 B;  4KUK A;  1DY6 A;  2HJ9 C;  4F3L A;  1WA9 A;  3IHA A;  3LGO A;  4DRT A;  5HL1 A;  4ZAM A;  3VOY A;  4HH3 A;  3GTC A;  2VA0 A;  4Q0J A;  4MN5 A;  5M19 A;  5DJU A;  3CUE C;  3BFG A;  3E2L A;  3A3F A;  4GNU A;  3CZD A;  4UA6 A;  3VMA A;  3MQ0 A;  3UB9 A;  3LIB A;  1GA0 A;  1D7E A;  2Q0O A;  1PW1 A;  1JTD A;  4OQH A;  1CI8 A;  2X02 A;  3MBZ A;  4EEP A;  1XFN A;  1N9L A;  2JC7 A;  4UQI M;  4EBP A;  3ULF A;  4WZ5 A;  3R4K A;  1MBL A;  4GB7 A;  1SKO B;  3T4J A;  2XA7 M;  5A91 A;  5HDC A;  5KSH A;  1LL5 A;  5E2G A;  4KZ6 A;  1TS6 A;  4ZDX A;  1KVL A;  1T1B A;  4LV3 A;  4OOL A;  4P85 A;  1Z09 A;  4WL9 A;  3E0Y A;  5F6A A;  1J3W A;  2ZMA A;  3PBQ A;  3JPU A;  3UPP A;  1LI0 A;  3MSH A;  4RX3 A;  2IWB A;  5I94 A;  2W27 A;  1FCO A;  4K91 A;  4NXB A;  3OZH A;  4BL2 A;  2IWD A;  4B4X A;  1JTG A;  3T4Q A;  3NOT C;  1ZC2 A;  4CLC B;  3MZD A;  2DCF A;  4FCF A;  4BJP A;  3PBN A;  3LI8 A;  1YM1 A;  4ETX A;  2R78 A;  1L0F A;  4MBH A;  1SDE A;  4P6Z S;  5E43 A;  5AQA A;  2XRN A;  3IS2 B;  4JKT A;  1BTL A;  3IXB A;  2WGV A;  2HV1 A;  4DE3 A;  1KE0 A;  1BLP A;  2ZBB A;  3H7W A;  3MS6 A;  2PHY A;  4DE1 A;  1CK3 A;  5DF7 A;  1YLY A;  2KX6 A;  4LGW A;  4HBT A;  3G6O A;  4MCW A;  1VHM A;  3SOI A;  4OPQ A;  2W1R A;  1ZG6 A;  4KQQ A;  2PR5 A;  4HNB A;  1LLB A;  2DMW A;  5MC7 A;  1TD5 A;  1TS7 A;  2WKR A;  4GCZ A;  2W3D A;  1OTB A;  3HJI A;  4KZ9 A;  4KZB A;  4ARZ B;  1K56 A;  3WRT A;  5J3W A;  1K0K A;  3N6I A;  1PZP A;  3JVU A;  4OVD A;  4DJ3 A;  2UWX A;  3MZF A;  4Y0O A;  3FKV A;  4ESP A;  3IXD A;  4KQR A;  4N1X A;  4E3I A;  4JGP A;  3MXS A;  4JF4 A;  1S4S A;  3F1N A;  5J7E A;  1CEG A;  3KSI A;  3HLB A;  2INW A;  2EA9 A;  5EUA A;  2JKT I;  3UME A;  2J3W A;  2WKQ A;  5FSR A;  4EWF A;  3ITB A;  3WS1 A;  3PYP A;  1SDN A;  4HY8 A;  4MMN A;  1IYO A;  3VP2 A;  4FH4 A;  3LR5 A;  4R6L A;  5L09 A;  5TFQ A;  2GJ3 A;  2XR0 A;  3BY8 A;  2WK0 A;  3BFD A;  4L9F A;  3GRJ A;  4KG2 A;  1YLW A;  1OTA A;  1NYY A;  3M6B A;  4CPK A;  1K55 C;  1AWI A;  2B5R A;  1I5Q A;  5HPF A;  5F1G A;  3CAX A;  1ODV A;  1N9B A;  2XGN A;  4QWO A;  5DKL A;  2BTF P;  4G3W A;  3V67 A;  3G35 A;  1PZO A;  2J7V A;  2GDN A;  3N8L A;  3UE3 A;  2ZL1 A;  2VLG A;  1K55 A;  3K3C A;  4O0P A;  4FSF A;  2V2F F;  4E3K A;  3OCL A;  5L07 A;  3RXX A;  4WZ4 A;  4X25 A;  2OLV A;  2H28 A;  5GLB A;  3LYX A;  4ID4 A;  3A0V A;  4BD1 A;  3O88 A;  4YFM A;  3P98 A;  3N7W A;  2PBD P;  1Z6F A;  2MJ6 A;  3CMZ A;  3VOL A;  4FD8 A;  4JGQ A;  1FR1 A;  1NRJ A;  3IXG A;  3UB6 A;  5AQ7 A;  4Y5F A;  3DTK A;  3O86 A;  3NDE A;  1IYP A;  3MFD A;  2L1M A;  1S0W A;  1GCE A;  3EOI A;  4UAA A;  1WYB A;  4JF6 A;  1PFL A;  1LI9 A;  4P6Z M;  2QYB A;  1K4F A;  3JVV A;  1CEF A;  1T1C A;  4JXG A;  3S7O A;  4ZJ1 A;  2ZLY A;  3Q81 A;  4HJ3 A;  3BQ8 A;  4CJN A;  2WKH A;  4L0L A;  2BAS A;  4GDB A;  4PM5 A;  1PYY A;  3MXR A;  4S2I A;  1KGG A;  2WUQ A;  3DTM A;  4GKU A;  2WKP A;  5CTN A;  3R7W B;  2WAD A;  5F69 A;  3SS5 A;  3T1X A;  3EEH A;  2P08 A;  1MXO A;  4GS9 A;  4Q8I A;  1ERO A;  1GA9 A;  4EU0 A;  1ZTU A;  2J9P A;  1VET A;  3IT9 A;  3VP0 A;  3VFH A;  2JHE A;  3B47 A;  5F5Y A;  1P0Z A;  3VE3 A;  3PAG A;  3LY4 A;  2EFU A;  4ETZ A;  3NC8 A;  2FFF B;  4H6J A;  3GVB A;  4OON A;  4JXV A;  4BLM A;  1RGY A;  2JKR M;  1G68 A;  3HLC A;  3IF6 A;  4MDZ A;  1K57 C;  1W63 Q;  2JE5 A;  4X53 A;  2KLI A;  2V0W A;  1E3U A;  3ISG A;  1YAX A;  3WS5 A;  4KUO A;  2O0Y A;  4IED A;  1OME A;  2ZQ8 A;  3IBJ A;  1Y4O A;  1L3L A;  1N4O A;  1W5D A;  1O07 A;  4N9L A;  3P01 A;  4N9K A;  2JKG A;  5FEG A;  3C30 A;  5C5K A;  1GSX A;  1H8Z A;  3AGE A;  4D60 A;  2PYP A;  1Y54 A;  4GD6 A;  5LBR A;  4RA7 A;  1JNU A;  1YSQ A;  4WLA A;  2Z6D A;  3UDF A;  3O87 A;  2V0U A;  4Y0U A;  2FZ0 A;  3QHY A;  4IUK A;  1N9N A;  3LIF A;  3FV7 A;  4HIA A;  3EGD C;  1IFQ A;  4HBU A;  4UHU A;  2Y8H A;  2K2N A;  2HZ5 A;  5FAS A;  2W1T B;  4EW7 A;  1H0M A;  4CLC D;  3B3X A;  3HBR A;  3KYE A;  4R3A A;  2Z6C A;  2D01 A;  5A92 A;  2JKR I;  5IS1 A;  4OPR A;  4IBX A;  1A0K A;  4KZ5 A;  4ZJ3 A;  4EUZ A;  5L2F A;  3LR3 A;  1IEM A;  3A0R A;  4OLD A;  3MQO A;  1MWT A;  1PWC A;  3OOV A;  3Q7V B;  3O3V A;  4OPY A;  4R4S A;  1MY8 A;  2QJ7 A;  4KQD A;  1K6S A;  3QNC A;  1AXB A;  2ZC6 B;  4QJG A;  2H10 A;  2PYR A;  4Y7P A;  2P04 A;  3GSG A;  3PTE A;  5HZH A;  3RJU A;  4BBU A;  4EER A;  1XKZ A;  4P6B A;  1PI5 A;  4EXO A;  5IU1 A;  1G6O A;  4G3K A;  1K54 C;  1VEU B;  2EXB A;  3E98 A;  2I9V A;  5CHJ A;  3VSK A;  3DBA A;  2XEP A;  3DTE A;  4OH0 A;  3FPW A;  5CGS A;  4HES A;  4PPR A;  1NWZ A;  1Y28 A;  4Z9Q A;  1FCM A;  1KDW A;  5A93 A;  4X56 A;  3CUE A;  4HP4 A;  1G5U A;  2WKI A;  3QP1 A;  5FAT A;  4Q0I A;  3OPH A;  3ZDJ A;  4S2M A;  1S1Y A;  1OPX A;  1W63 M;  3CJM A;  5HAI A;  3SH9 A;  3I7J A;  1CF0 A;  3PAE A;  3KYZ A;  1XPB A;  5HWW A;  3BWL A;  4OQG A;  3LCE A;  4PAU A;  5TBM A;  2Y79 A;  3UPO A;  3S7N A; 
#chains in the Genus database with same CATH homology
 1FIL A;  4ESP A;  3NUL A;  3L7H A;  1VET A;  2JKG A;  1PFL A;  2PBD P;  2PRF A;  3LEQ A;  4FTX A;  3T1R A;  4FUW A;  1G5U A;  5EV0 A;  5FEG A;  1CJF A;  1YPR A;  3U4L P;  1VEU B;  3UB5 P;  1Z09 A;  2ZL1 A;  4D60 A;  4X1M A;  2HZ5 A;  5EM0 A;  5FDS A;  3CPT A;  2VK3 A;  5EM1 A;  5EVE A;  4X1L A;  3T1X A;  1J3W A;  1VET B;  2PAV P;  2JKF A;  3DAV A;  3NEC A;  2E8J A;  1SZV A;  3LGO A;  3KYE A;  1SKO B;  1K0K A;  2ACG A;  2ZL1 B;  3MS6 A;  3MSH A;  4X25 A;  1CF0 A;  1PRQ A;  1FIK A;  1AWI A;  2B95 A;  3CPT B;  1Y4O A;  2V8F A;  3L9K A;  5FEF A;  1F2K A;  1PNE A;  1A0K A;  1CQA A;  1VEU A;  2V8C A;  1ACF A;  1D1J A;  3CHW P;  3T12 B;  4QWO A;  1HLU P;  3T1Q B;  2BTF P;  1SKO A;  3D9Y A;  3T1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...