3CPTA

Mp1-p14 scaffolding complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
b'DDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase 1-interacting protei
publication title Molecular dynamics-solvated interaction energy studies of protein-protein interactions: the MP1-p14 scaffolding complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 36
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08923 MAPKK1_Int Mitogen-activated protein kinase kinase 1 interacting
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3cptA00
3T1RA 1AWIA 3MSHA 1A0KA 5EM1A 5FEFA 5EM0A 1VEUB 1Z09A 4ESPA 1G5UA 2PBDP 1FIKA 3NULA 4X25A 5EV0A 2BTFP 3DAVA 1SKOA 3T1SA 2V8FA 4X1LA 3L9KA 3T1XA 2HZ5A 1CJFA 1SKOB 1HLUP 1YPRA 2ZL1A 3T12B 3U4LP 2ZL1B 1K0KA 5EVEA 4X1MA 3NECA 1SZVA 2E8JA 3LGOA 2JKGA 3UB5P 3D9YA 2VK3A 3T1QB 3KYEA 3L7HA 1F2KA 2ACGA 5FEGA 1ACFA 4FUWA 1FILA 1D1JA 1VEUA 2JKFA 3CHWP 2B95A 1J3WA 2PAVP 3LEQA 1VETA 3CPTA 2V8CA 1CF0A 1PRQA 1VETB 3CPTB 4QWOA 1PFLA 1Y4OA 4D60A 2PRFA 1PNEA 4FTXA 5FDSA 3MS6A 1CQAA
chains in the Genus database with same CATH superfamily
3JPUA 4ARZB 4CLCB 4Y3IA 5EM0A 3PYPA 5HL6A 3G35A 3MKEA 4DXCA 4HBUA 4O8GA 1PW8A 1T1BA 4ETZA 4HP4A 1PI5A 3DW0A 1SKOA 3KO6A 1TS8A 2I72A 4X1LA 1SKFA 3T1XA 4RX2A 2HDRA 5FQKA 1G28A 4FCFA 1YLJA 2XEPA 4NXGA 5HDDA 4F3LB 1CI8A 2B18A 5GHXA 5EVLA 1YSPA 5CX7A 2K2NA 3F1PA 2ZQ8A 1GHMA 1LL9A 1DP9A 2VGJA 3D4FA 5CGXA 2WGWA 5HD3A 4BL2A 3ZVTA 3PR6A 3FWLA 4GOGA 1SDEA 2DMWA 3IXDA 3M6BA 2ZM8A 3F1NB 4IEDA 3V3RA 1PYYA 1ZG6A 2R9WA 2Z6CA 4Y0TA 4HJ6A 4EUVA 3PAGA 1E25A 4AFIA 1RGZA 1E3UD 4LRYC 3OLOA 1X0OA 1KVLA 1HD8A 3NC8A 1S1ZA 2R9XA 3IS2B 3QNCA 2W0NA 2H0YA 1K55A 5DJTA 1PWDA 1CEGA 3PBSA 2JE5A 3RFBA 1IOUA 4HY8A 1DP8A 5E2EA 2X02A 5EUAA 1VHMA 2HP9A 3T1RA 2OWJA 1FOFA 3ISGA 3IHBA 4OPRA 4ESPA 4R38A 3IF5A 2PBDP 4UA7A 4ID4A 3BJNA 1DJAA 5CHJA 4ME4A 5EV0A 1L2SA 2Y8HA 4DRTA 2BTFP 4E3JA 4R4RA 1ZG4A 2IWDA 2WKHA 4KZAA 2HPBA 4K0XA 3T1SA 4R23A 4BLMA 2IWCA 1LSXA 2W3DA 4HP9A 3TJZC 2LB9A 3ZG9B 1NJ4A 1K54A 2OWHA 1P9RA 1XPBA 4QU3A 1BLPA 2MJ6A 3VP4A 1PW1A 3BY9A 3MZFA 1IEMA 2PYRA 3A3IA 3S7NA 3UB5P 5M18A 3SOIA 3QP4A 2PU2A 3L7HA 4X55A 4ZAMA 4JF5A 2KDKA 2WKEA 4HQAA 2HDSA 3IH8A 3N8RA 3BWLA 3EEAA 2EX9A 5CERA 2M1CA 1IKIA 5EVIC 5HSQA 1MWRA 4HJ3A 4WN5A 4OP5A 5F82A 1ERQA 3QP5A 1K38A 1K6RA 2ZM2A 1NY0A 3SW1A 5DTSA 5FQIA 3HVFA 1YMXA 1FQGA 1LI0A 1GHIA 5DFYA 3ZG7B 3B3XA 2PD8A 1LHYA 2K7SA 1FSWA 1TD5A 5HW3A 1VEUB 3G32A 3F1OB 4IJGA 4BQMA 5HWWA 3RTYA 2ZMAA 3O5YA 4GB7A 3ZDJA 4R3BA 1Q2QA 2CMNA 5TJJA 5JYPA 4WYYA 1ESUA 1N9BA 1Y54A 1MWSA 4WBGA 1T18A 4GDBA 3EEHA 3WS5A 5L10A 5A8BA 5KZHA 4EETB 4C75A 2WZXA 3MZDA 1IYPA 3T4JA 4WM9A 5GL9A 1PZPA 1OT6A 1W79A 3NOPC 1SDNA 3DBAA 4P87A 1T19A 3UPNA 3H82B 1UWNX 1SZVA 3CAXA 3LGOA 5G4ZA 2G7UA 4EERA 4E6WA 2VV6A 2O99A 3EGDC 3GVBA 4FH2A 4CLCE 4C6YA 4WL9A 1YLWA 3E4OA 4S2OA 1BULA 4YFMA 1L0EA 4Y2FA 3F1PB 4I39A 2DCFA 2OAQ1 5HARA 1BT5A 2WGWB 3BW6A 3DTKA 1XP4A 3MKFA 2V1AA 1L3LA 3DTEA 3SH7A 3VP2A 3BLMA 1OT9A 3ZG8B 4FSFA 3RH8B 3IBJA 3T4QA 3V3SA 1CQAA 3A3EA 2HJ9C 3HLCA 5FAOA 5AQBA 1NZUA 4WELA 2ZOIA 2Y4AA 4GS9A 4LV0A 1KE0A 2WYXA 1S6RA 1ESIA 1DJCA 4DE3A 4UAAA 3IBRA 3PBOA 2W3HA 4F3LA 4S2IA 1S67L 4IUHA 4S2NC 1CJFA 4X6TA 2QJ7A 2GDNA 4B88A 2R78A 3M2KA 1YPRA 4DJ2A 2QZ6A 4E04A 1MKIA 2VZWA 2VEAA 3D3OA 1L0GA 3WS4A 2NUTC 4MBHA 3CUEA 5EVEA 3VMAA 3C7VA 5IT5A 1YLZA 2B02A 3T4SA 3AGEA 1SHVA 3OPHA 4OP8A 2VV8A 4R4SA 4CPKA 1XFQA 4IVKA 3HJKA 1MZUA 1FCOA 4JGQA 2XRNA 3ZCZA 4LENA 4Q0JA 3VOLA 2L4RA 3QP1A 2QJ5A 2Q9MA 2QMIA 3IQAA 3S4XA 3BY8A 2PBYA 3C8CA 4UEYA 4QWOA 1FCMA 1XGJA 4QY5A 4D60A 5EPHA 3T4LA 1EROA 4PM7A 2WK0A 1TS0A 1GHPA 1O07A 4R6LA 4CJNA 4U3TA 2BG1A 3HJIA 4MMNA 1XFNA 1MPLA 2HDUA 2J3TC 1YLYA 1NWZA 2ZQAA 4BBVA 1OPXA 1YLPA 5CECA 2V1ZA 4E3LA 5J4EA 3HCYA 3FZCA 1JNUA 2ZD8A 2Y91A 1DRMA 5EOOA 4ZRRA 4MBFA 1HZOA 2KLIA 4C3QA 3VV4A 2JN7A 3ZNYA 5E43A 2V0UA 3PBQA 2DRWA 1BTLA 1ODVA 5DTKA 4KZ5A 3P01A 2ZL1B 4X1MA 4WEKA 3EWKA 4IHQA 2VGKA 4XUXA 2Z2MB 4JLFA 2J9PA 3IF6C 3DWZA 3LY3A 4OPYA 5FQ9A 4HJ4A 5FEGA 5U47A 2QKPA 3IX4A 1EW0A 3FKVA 4KQRA 3VP3A 3C30A 3D72A 3B42A 3BEBA 3BFDA 3BFFA 2D01A 2V8CA 3OPPA 1QMEA 4GW9A 1WYBA 5E2HA 3BFCA 4WZ5C 4JF4A 1K57C 1N9OA 1WYCA 5KSHA 3MS6A 4WLAA 4GZBA 4YNRA 4OOYA 1P9WA 4N1XA 1KE3A 3H9WA 3OCLA 4OKPA 4RQ9A 2E8IA 5FAPA 3N6IA 1TS7A 3N8SA 3TE8A 2Y2NA 2Q9NA 2V8FA 2ZC3B 4GDNA 4CLCC 3KYQA 4JXWA 1HLUP 2WGIA 4ZJ3A 3UB8A 4E3IA 2Y2OA 3KSHA 3C7UA 4KZ7A 3LR4A 3HREA 1L0FA 5AQ7A 4G3KA 1G6OA 1OJ5A 2KOIA 1E3UA 1FCNA 3H82A 3S7QA 5MC7A 3U4LP 4OQGA 2ZLYA 3T50A 4GS9B 4WMCA 1YMSA 3ZHHA 2V9AA 4GD8A 3NECA 1GCEA 4EESA 2W3EA 4DE2A 2VGLS 4MDZA 2GZAA 1K6SA 4II7A 5F5YA 1TDGA 2EX2A 1ACFA 2A2LA 5FDHA 2XA7M 2PT7A 3UB9A 4FD8A 4BWIA 1D06A 5L2FA 3GRJA 4NG2A 4JGRA 3G34A 1V9ZA 4Q0IA 3BQAA 4DN0A 1YKDA 3NDGA 3LICA 1NLYA 4IBXA 2JBFA 2PHYA 4DDSA 2HV1A 3AGFA 2PRFA 1NYYA 4EWFA 3HUMA 3UO9A 3V39A 1IYOA 2P04A 5A91A 3P98A 5TFQA 4PM5A 5BOHA 2EA9A 3BLSA 4WMCD 4LCMA 4G3WA 3ZVWA 4OQHA 5D3OA 5F69A 4DMZA 4JKTA 2Q0OA 1OTDA 3MR0A 1W5DA 2J3WA 2FFFB 3VP1A 3IT9A 2PD7A 5DKKA 2ZQ7A 1I2WA 5A92A 4H6JB 3RXXA 4LV1A 1P97A 1XA1A 2X71A 3E2KA 3PAEA 4PKYA 5DF7A 4S2NA 1ES5A 2H10A 3JVUA 3MMHA 4P6ZS 4A5RA 1BUEA 2VKSA 4ZBEA 4JBFA 3PXPA 3T1QB 5HDSA 1LLBA 3WS1A 4UQIM 5HWVA 5AQAA 2ACGA 3CWFA 3CI6A 4Q8IA 1YSQA 1ES2A 2WAFA 1KGEA 3FG8A 4U0TA 2Y2MA 5TR7A 3Q81A 5HWTA 4OLDA 2PU4A 1FR6A 1D7EA 3GV9A 2OSUA 3K2NA 5CRFA 1H3QA 3ZG0A 4JPMA 1GA0A 3E2LA 3FPWA 4WUJA 2WKQA 4IUKA 3W4PA 1K4EA 5LBRA 3KSGA 3O87A 4WZ4A 3MSHA 1TDLA 2O0YA 1A0KA 3GTCA 3UMEA 1S1YA 2INWA 3MZEA 2H28A 1KVMA 1Z09A 4FOFA 4PM9A 5HAQA 4DF6A 1Y28A 2OV5A 3TRCA 4EV4A 1PZOA 5CEBA 4OH0A 5EECA 1MXOA 4RA7A 3LFVA 1ZTUA 4OOLA 4EUZA 1K56A 2LB5A 2HJEA 3HLDA 4GCZA 1N9NA 4JGPA 2ZL1A 4EW7A 1ALQA 2W1TA 3GMWA 1IELA 2YKFA 4JXSA 4HEFA 3V5MA 1KOUA 2XLNA 5DF8A 1XA7A 4S2JA 4EEPA 3IXGA 4MN7A 4GLQA 3EGXC 1IYSA 4DE1A 2ZMVA 3O3VA 1H8YA 3ITBA 3UE1A 4DKIA 3E98A 3ZG5A 5E2GA 1LSVA 3CHWP 5L8MA 3PBRA 4BL3A 3BRMA 3WRZA 5HDCA 2XFSA 3FYZA 3VSLA 2XROA 5FATA 4EBLA 3BYDA 3UDIA 5F6AA 2EXAA 4G3VA 3GDIA 1K56D 4QY6A 3ITAA 3IXBA 2WADA 5TBMA 4GD6A 4PHTA 3EQUA 4IBRA 2XA7S 1K25A 3JYIA 1G6AA 4MLLA 1BSGA 1JWPA 5AQ9A 3MJQA 3GR2A 4JGOA 4M4XA 2OAP1 5FAQA 5A93A 1KGGA 1BLCA 3LR3A 1HVBA 2FH5A 1AXBA 1GSVA 5CTMA 4XT2A 4KZ3A 4NEED 3TSGA 4OONA 2V2FF 5CTNA 4Y15A 4BJPA 4Z9QA 3WRTA 2Y2KA 4GKUA 4BBTA 3C5AA 4B4XA 1PIOA 3R7WA 3K3CA 3SH8A 2XK1A 2XR0A 1K55C 2VV7A 1DJBA 4MN6A 2JKRI 1Z6FA 4EEUA 3CZDA 4Y7PA 1I2SA 3OBFA 2XD1A 2XQZA 3NBLA 1F2KA 4ETXA 2VX8A 3UNWA 3VE3A 3QP6A 4LLOB 3LIAA 1LL5A 1F98A 3A0VA 4KENB 4DXBA 3ZNTA 3MF0A 2W3FA 2XSSA 1UGUA 3A3DA 2PAVP 3MFDA 4KUOA 5KSCA 3T4TA 2ZC5B 4E3KA 4UQIS 3N4IA 4Y13A 2H5SA 3UB7A 1PFLA 3NIAA 3DTMA 2P9VA 3QHYA 3LIFA 1RP5A 4FTXA 3OPRA 3QP2A 4CLCD 1V9YA 4UA9A 4BD1A 4LCLA 2EFXA 1OTIA 1S0WA 1TEMA 1FIKA 4M3KA 3RXWA 1H0MA 5F1GA 4OQIA 2ZOHA 2WKIA 4KQQA 4WEJA 5DVAA 4KG5A 2WKPA 4H6JA 3BQ8A 2Y2QA 2Y2GA 3GSGA 4X68A 4OLGA 5HFOA 2Y59A 5HL1A 2QHKA 4I3AA 4P6BA 2OOLA 1P0ZA 4KZ4A 4NKPA 2WZZA 2ZM0A 1W7FA 2A3UA 5KMWA 2Z6DA 4MN5A 3H7WA 3I7JA 3D9YA 1XGIA 3A3JA 1H5XA 4LFUA 3N7WA 4GHIB 3HLWA 1C3BA 3Q7VB 2EXBA 4B93A 1JTDA 2Y79A 1D1JA 2KX6A 3MQ0A 5IHVA 3LCEA 5G18A 2P08A 1OTEA 1S4RA 2W1TB 3WS2A 4O0PA 1XX2A 1MWUA 3Q7ZA 5HAIA 3C4OA 3UDFA 3CPTB 1Y4OA 2CC1A 3PTEA 1OTBA 2FFYA 2GNXA 3NJAA 1N9LA 3G2YA 1LL8A 5J8XA 3KSFA 5DJUA 1MY8A 3IF6B 4ZTKA 2GX5A 2QPNA 1W8YA 3N8LA 5EVIA 4QB8A 5FL3A 4HIAA 1CEFA 3V67A 2BLSA 1JVJA 2DNSA 5FI6A 5DTTA 5I94A 5TBMB 3SH9A 4DDYA 5K5BA 3FPVA 2P74A 4I3JA 3G2ZA 2G2WA 4F94A 3BFGA 3M6HA 4RX3A 2D02A 5FI2A 1YLTA 2JKRM 1DY6A 4N9KA 1KE4A 2AVXA 3FV7A 3MXSA 2ZC6B 3TOIA 4XT2B 1Q2PA 2E8JA 3M2JA 2G2UA 3OCNA 1MKMA 3S1YA 4X69A 3LUQA 2VA0A 1FILA 3UN7A 1BLHA 3IWQA 5EVID 5CGSA 3C2WA 5FA7A 1LSWA 2YKHA 3R7WB 5EOEA 1J3WA 4QPRA 3UDXA 3HLBA 2I9VA 5GHYA 2P7JA 3OPLA 5IS1A 5CEDA 3MFXA 2QWSA 4S2KA 5L09A 4LGWA 5TGFA 3G31A 3HL9A 3ULFA 1JWVA 1PNEA 1XXMA 4UHUA 1HTZA 4EQ1A 4I3IA 3ZGAB 4HH2A 5GHZA 4D2OA 3O88A 2JKTI 5M1AA 1NRFA 2C5WB 4HESA 3LR5A 2Y55A 3CUEC 4I5SA 4OPZA 3SZTA 1KGFA 3ZFZA 4RVAA 5CGWA 1MWTA 5GLDA 5HD5A 3UY6A 4PM8A 1J9MA 2M7VA 3LY4A 1QMFA 2W27A 3FC7A 3L9KA 1OJGA 4OPQA 4LV2A 3W8KA 2P9VB 2EX8A 1XJ4A 1YT4A 1IFQA 3TG9A 4GN2A 1U60A 5F83A 2UWXA 5M19A 4BD0A 1UWPX 1EI5A 3UE3A 3LYXA 1YAXA 4Y0OA 4BBUA 2JHEA 4S2MA 5FASA 5G4YA 2HDQA 3ZYTA 2NUPC 3SS5A 4R1GA 4O7DA 1YM1A 5GLAA 3K3DA 2VK3A 4PMAA 5HX9A 1ZC2A 5DFXA 5FQMA 1CI9A 3NCKA 3G30A 3C38A 1BZAA 4PPRA 2VJWA 3MBZA 1TVFA 2PR6A 5C5KA 3WWXA 5HPFA 2A24B 4N9LA 1NZOA 3QP8A 3MQOA 5EFWA 1TS6A 3S22A 2FZ0A 3H7WB 4KZ6A 3PBNA 1RGYA 3V50A 2JC7A 4QHCA 3S7OA 3UB6A 1ES4A 1AWIA 4E3MA 5JYOA 2B5RA 4E3NA 3LI8A 4Q0HA 2HF6A 1ERMA 4HI4A 4PAUA 2J9OA 4NXFA 1O7EA 4UA6A 1LI9A 2WGVA 1K4FA 3LIBA 2ZBBA 5FI7A 3AGDA 1NYMA 3PBTA 4B4ZA 4EU0A 1WA9A 4KZ8A 4OOMA 3VOYA 4KQOA 3IWOA 1BYWA 2HZ5A 3NY4A 2L1MA 3G6OA 2W1RA 2ZJ9A 3W2ZA 1ONHA 5IU1A 4PM6A 1PI4A 3TW8A 4KG2A 2W3GA 3Q82A 3G4PA 4KG6A 1I5QA 3LR0A 2OLUA 4K91A 5CXWA 2QYBA 1LT0A 2Z2LB 2PYPA 3NI9A 4EXOA 5EVIB 1E4DA 1F9IA 4RYEA 4GHIA 1JTGA 3BECA 3A0SA 1TF1A 3Q7VA 1H8ZA 1GSXA 2IA2A 4NXEA 3HUNA 1GA9A 4KQDA 3CG5A 3VSKA 1H8MA 3EOIA 5AVFA 3T4OA 3IWIA 5J3WA 5DF9A 3HBRA 3VP0A 2JKFA 4KZ9A 5FSRA 1JWZA 2H0TA 2IWBA 1NLZA 4FH4A 2V20A 1VQQA 3CPTA 4P85A 3NOTC 5CHMA 3IHAA 3CLOA 1VETB 3LIEA 2Y2LA 3VE4A 4O01A 3DTIA 2XD5A 3IF6A 2JKTM 3MXQA 2EWVA 5EM1A 5GLBA 4ZJ1A 2J3TD 4DJ3A 1ES3A 4XXRA 4Y0UA 1G5UA 4L9EA 3CITA 2K31A 4DE0A 3Q07A 3MXRA 2HP5A 2OLVA 1T1AA 4LRXC 5KIZA 1RCJA 4WZ5A 1M6KA 4S2LA 1FSYA 1K57A 1SKOB 5FQQA 1XJ2A 3PHYA 4L0LA 4X56A 4L9GA 1YQSA 2EX6A 3HLFA 1XJ3A 3E4QA 2EWWA 4HH3A 3NDEA 2X01A 3P09A 2PDRA 3HLGA 3NHQA 3B47A 2VLGA 4WF0A 1M40A 1BLSA 1NRJA 4GJ4A 5I5LA 3UE6A 2J7VA 2ZC4B 3A0RA 3HLEA 4K0WA 2ZMFA 1SCWA 4BENA 3UPOA 1ZHHB 3ZQ5A 4JXGA 5F1FA 2Y2JA 2XGNA 1F5MA 3IX3A 1MBLA 1WE4A 3VFHA 4ARZA 4MCWA 4CLCA 4MNRA 4ZJ2A 4NK3A 1DP6A 2WUQA 3CJMA 1CK3A 2J8YA 3LEQA 4S2PA 4R0QA 4N1HA 3SS3A 4MEZA 5HZHA 1OMEA 3GECA 3OOVA 2EFUA 3KSIA 5F68A 2C6WB 4Y17A 2Y2IA 4OQ0A 2RCXA 5FEFA 2XFTA 2VGLM 1IYQA 3UMDA 3IH9A 4N92A 4H8RA 3JVVA 3NULA 4X25A 3SS4A 4BMWA 4EBPA 1PWGA 3LEZA 5GLCA 1K54C 3F1NA 5J7EA 5EE8A 1W8QA 3E0YA 4U0XA 3C4PA 3Q1FA 4E3OA 3UPPA 3IX8A 3QNBA 3NOUC 1W63M 2XH9A 4JF6A 3P7NA 4Y5FA 1K0KA 3A3FA 3IS2A 1G68A 3ICYA 2ZQDA 2WKRA 4YINA 1IKGA 3VOZA 2Y2PA 4L9FA 2JKGA 2O9CA 3O86A 4PKYG 3BFEA 3HUOA 1GSWA 4ZDXA 4NXBA 1ONGA 1KDWA 1VM1A 4B9OA 1S4SA 2A24A 1KDSA 5A90A 5E2FA 1OTAA 1PWCA 3E4PA 1VB6A 4YOFA 4R3AA 3LO7A 3KX0X 3VFFA 3WS0A 2BASA 4HBTA 5FDSA 3T4KA 4HNBA 3MQQA 4KUKA 4KZBA 1T1CA 4P6ZM 3BM6A 5HAPA 2ZQCA 4LPZA 2M7UA 4QJGA 4R3JA 2O9BA 5FQJA 1ZKJA 2GJ3A 3R4KA 1W63Q 2J80A 5AVEA 3DAVA 2WAEA 5L07A 1STZA 5AJGA 4HOIA 1S66L 4MBKA 2O9AA 4XUZA 1XJ6A 4R70A 2UV0E 3GQZA 1L0DA 3W4QA 3EQVA 3LIDA 2V0WA 4OVDA 5DKLA 2L0WA 2XDMA 2ZC7A 4YWZA 3RJUA 4CQHA 4K08A 3CMZA 1XKZA 1NXYA 4P0MA 3KYEA 2V1BA 4EQIA 4EBNA 4FUWA 3DWKA 2XF3A 4Z1WA 4I38A 4NETA 2A49A 1MC0A 1VEUA 3LI9A 3F1OA 2RL3A 3UE0A 4GNUA 2B95A 2PR5A 2JCHA 5HPIA 2ZQ9A 1VETA 4JXVA 4QD4A 1CF0A 2HGVA 2HP6A 1PRQA 4HHDA 3KYZA 1EWZA 3OZHA 3IXHA 3OC2A 4E6XA 1N4OA 3U2AA 3FKWA 2Y2HA 4LRZE 5CHUA 3S7PA 4X53A 3B33A 3W4OA 1FR1A 4IVIA 3T12B 4LV3A
chains in the Genus database with same CATH topology
3T1RA 1AWIA 3MSHA 1A0KA 5EM1A 5FEFA 5EM0A 1VEUB 1Z09A 4ESPA 1G5UA 2PBDP 1FIKA 3NULA 4X25A 5EV0A 2BTFP 3DAVA 1SKOA 3T1SA 2V8FA 4X1LA 3L9KA 3T1XA 2HZ5A 1CJFA 1SKOB 1HLUP 1YPRA 2ZL1A 3T12B 3U4LP 2ZL1B 1K0KA 5EVEA 4X1MA 3NECA 1SZVA 2E8JA 3LGOA 2JKGA 3UB5P 3D9YA 2VK3A 3T1QB 3KYEA 3L7HA 1F2KA 2ACGA 5FEGA 1ACFA 4FUWA 1FILA 1D1JA 1VEUA 2JKFA 3CHWP 2B95A 1J3WA 2PAVP 3LEQA 1VETA 3CPTA 2V8CA 1CF0A 1PRQA 1VETB 3CPTB 4QWOA 1PFLA 1Y4OA 4D60A 2PRFA 1PNEA 4FTXA 5FDSA 3MS6A 1CQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1R A;  1AWI A;  3MSH A;  1A0K A;  5EM1 A;  5FEF A;  5EM0 A;  1VEU B;  1Z09 A;  4ESP A;  1G5U A;  2PBD P;  1FIK A;  3NUL A;  4X25 A;  5EV0 A;  2BTF P;  3DAV A;  1SKO A;  3T1S A;  2V8F A;  4X1L A;  3L9K A;  3T1X A;  2HZ5 A;  1CJF A;  1SKO B;  1HLU P;  1YPR A;  2ZL1 A;  3T12 B;  3U4L P;  2ZL1 B;  1K0K A;  5EVE A;  4X1M A;  3NEC A;  1SZV A;  2E8J A;  3LGO A;  2JKG A;  3UB5 P;  3D9Y A;  2VK3 A;  3T1Q B;  3KYE A;  3L7H A;  1F2K A;  2ACG A;  5FEG A;  1ACF A;  4FUW A;  1FIL A;  1D1J A;  1VEU A;  2JKF A;  3CHW P;  2B95 A;  1J3W A;  2PAV P;  3LEQ A;  1VET A;  3CPT A;  2V8C A;  1CF0 A;  1PRQ A;  1VET B;  3CPT B;  4QWO A;  1PFL A;  1Y4O A;  4D60 A;  2PRF A;  1PNE A;  4FTX A;  5FDS A;  3MS6 A;  1CQA A; 
#chains in the Genus database with same CATH topology
 3JPU A;  4ARZ B;  4CLC B;  4Y3I A;  5EM0 A;  3PYP A;  5HL6 A;  3G35 A;  3MKE A;  4DXC A;  4HBU A;  4O8G A;  1PW8 A;  1T1B A;  4ETZ A;  4HP4 A;  1PI5 A;  3DW0 A;  1SKO A;  3KO6 A;  1TS8 A;  2I72 A;  4X1L A;  1SKF A;  3T1X A;  4RX2 A;  2HDR A;  5FQK A;  1G28 A;  4FCF A;  1YLJ A;  2XEP A;  4NXG A;  5HDD A;  4F3L B;  1CI8 A;  2B18 A;  5GHX A;  5EVL A;  1YSP A;  5CX7 A;  2K2N A;  3F1P A;  2ZQ8 A;  1GHM A;  1LL9 A;  1DP9 A;  2VGJ A;  3D4F A;  5CGX A;  2WGW A;  5HD3 A;  4BL2 A;  3ZVT A;  3PR6 A;  3FWL A;  4GOG A;  1SDE A;  2DMW A;  3IXD A;  3M6B A;  2ZM8 A;  3F1N B;  4IED A;  3V3R A;  1PYY A;  1ZG6 A;  2R9W A;  2Z6C A;  4Y0T A;  4HJ6 A;  4EUV A;  3PAG A;  1E25 A;  4AFI A;  1RGZ A;  1E3U D;  4LRY C;  3OLO A;  1X0O A;  1KVL A;  1HD8 A;  3NC8 A;  1S1Z A;  2R9X A;  3IS2 B;  3QNC A;  2W0N A;  2H0Y A;  1K55 A;  5DJT A;  1PWD A;  1CEG A;  3PBS A;  2JE5 A;  3RFB A;  1IOU A;  4HY8 A;  1DP8 A;  5E2E A;  2X02 A;  5EUA A;  1VHM A;  2HP9 A;  3T1R A;  2OWJ A;  1FOF A;  3ISG A;  3IHB A;  4OPR A;  4ESP A;  4R38 A;  3IF5 A;  2PBD P;  4UA7 A;  4ID4 A;  3BJN A;  1DJA A;  5CHJ A;  4ME4 A;  5EV0 A;  1L2S A;  2Y8H A;  4DRT A;  2BTF P;  4E3J A;  4R4R A;  1ZG4 A;  2IWD A;  2WKH A;  4KZA A;  2HPB A;  4K0X A;  3T1S A;  4R23 A;  4BLM A;  2IWC A;  1LSX A;  2W3D A;  4HP9 A;  3TJZ C;  2LB9 A;  3ZG9 B;  1NJ4 A;  1K54 A;  2OWH A;  1P9R A;  1XPB A;  4QU3 A;  1BLP A;  2MJ6 A;  3VP4 A;  1PW1 A;  3BY9 A;  3MZF A;  1IEM A;  2PYR A;  3A3I A;  3S7N A;  3UB5 P;  5M18 A;  3SOI A;  3QP4 A;  2PU2 A;  3L7H A;  4X55 A;  4ZAM A;  4JF5 A;  2KDK A;  2WKE A;  4HQA A;  2HDS A;  3IH8 A;  3N8R A;  3BWL A;  3EEA A;  2EX9 A;  5CER A;  2M1C A;  1IKI A;  5EVI C;  5HSQ A;  1MWR A;  4HJ3 A;  4WN5 A;  4OP5 A;  5F82 A;  1ERQ A;  3QP5 A;  1K38 A;  1K6R A;  2ZM2 A;  1NY0 A;  3SW1 A;  5DTS A;  5FQI A;  3HVF A;  1YMX A;  1FQG A;  1LI0 A;  1GHI A;  5DFY A;  3ZG7 B;  3B3X A;  2PD8 A;  1LHY A;  2K7S A;  1FSW A;  1TD5 A;  5HW3 A;  1VEU B;  3G32 A;  3F1O B;  4IJG A;  4BQM A;  5HWW A;  3RTY A;  2ZMA A;  3O5Y A;  4GB7 A;  3ZDJ A;  4R3B A;  1Q2Q A;  2CMN A;  5TJJ A;  5JYP A;  4WYY A;  1ESU A;  1N9B A;  1Y54 A;  1MWS A;  4WBG A;  1T18 A;  4GDB A;  3EEH A;  3WS5 A;  5L10 A;  5A8B A;  5KZH A;  4EET B;  4C75 A;  2WZX A;  3MZD A;  1IYP A;  3T4J A;  4WM9 A;  5GL9 A;  1PZP A;  1OT6 A;  1W79 A;  3NOP C;  1SDN A;  3DBA A;  4P87 A;  1T19 A;  3UPN A;  3H82 B;  1UWN X;  1SZV A;  3CAX A;  3LGO A;  5G4Z A;  2G7U A;  4EER A;  4E6W A;  2VV6 A;  2O99 A;  3EGD C;  3GVB A;  4FH2 A;  4CLC E;  4C6Y A;  4WL9 A;  1YLW A;  3E4O A;  4S2O A;  1BUL A;  4YFM A;  1L0E A;  4Y2F A;  3F1P B;  4I39 A;  2DCF A;  2OAQ 1;  5HAR A;  1BT5 A;  2WGW B;  3BW6 A;  3DTK A;  1XP4 A;  3MKF A;  2V1A A;  1L3L A;  3DTE A;  3SH7 A;  3VP2 A;  3BLM A;  1OT9 A;  3ZG8 B;  4FSF A;  3RH8 B;  3IBJ A;  3T4Q A;  3V3S A;  1CQA A;  3A3E A;  2HJ9 C;  3HLC A;  5FAO A;  5AQB A;  1NZU A;  4WEL A;  2ZOI A;  2Y4A A;  4GS9 A;  4LV0 A;  1KE0 A;  2WYX A;  1S6R A;  1ESI A;  1DJC A;  4DE3 A;  4UAA A;  3IBR A;  3PBO A;  2W3H A;  4F3L A;  4S2I A;  1S67 L;  4IUH A;  4S2N C;  1CJF A;  4X6T A;  2QJ7 A;  2GDN A;  4B88 A;  2R78 A;  3M2K A;  1YPR A;  4DJ2 A;  2QZ6 A;  4E04 A;  1MKI A;  2VZW A;  2VEA A;  3D3O A;  1L0G A;  3WS4 A;  2NUT C;  4MBH A;  3CUE A;  5EVE A;  3VMA A;  3C7V A;  5IT5 A;  1YLZ A;  2B02 A;  3T4S A;  3AGE A;  1SHV A;  3OPH A;  4OP8 A;  2VV8 A;  4R4S A;  4CPK A;  1XFQ A;  4IVK A;  3HJK A;  1MZU A;  1FCO A;  4JGQ A;  2XRN A;  3ZCZ A;  4LEN A;  4Q0J A;  3VOL A;  2L4R A;  3QP1 A;  2QJ5 A;  2Q9M A;  2QMI A;  3IQA A;  3S4X A;  3BY8 A;  2PBY A;  3C8C A;  4UEY A;  4QWO A;  1FCM A;  1XGJ A;  4QY5 A;  4D60 A;  5EPH A;  3T4L A;  1ERO A;  4PM7 A;  2WK0 A;  1TS0 A;  1GHP A;  1O07 A;  4R6L A;  4CJN A;  4U3T A;  2BG1 A;  3HJI A;  4MMN A;  1XFN A;  1MPL A;  2HDU A;  2J3T C;  1YLY A;  1NWZ A;  2ZQA A;  4BBV A;  1OPX A;  1YLP A;  5CEC A;  2V1Z A;  4E3L A;  5J4E A;  3HCY A;  3FZC A;  1JNU A;  2ZD8 A;  2Y91 A;  1DRM A;  5EOO A;  4ZRR A;  4MBF A;  1HZO A;  2KLI A;  4C3Q A;  3VV4 A;  2JN7 A;  3ZNY A;  5E43 A;  2V0U A;  3PBQ A;  2DRW A;  1BTL A;  1ODV A;  5DTK A;  4KZ5 A;  3P01 A;  2ZL1 B;  4X1M A;  4WEK A;  3EWK A;  4IHQ A;  2VGK A;  4XUX A;  2Z2M B;  4JLF A;  2J9P A;  3IF6 C;  3DWZ A;  3LY3 A;  4OPY A;  5FQ9 A;  4HJ4 A;  5FEG A;  5U47 A;  2QKP A;  3IX4 A;  1EW0 A;  3FKV A;  4KQR A;  3VP3 A;  3C30 A;  3D72 A;  3B42 A;  3BEB A;  3BFD A;  3BFF A;  2D01 A;  2V8C A;  3OPP A;  1QME A;  4GW9 A;  1WYB A;  5E2H A;  3BFC A;  4WZ5 C;  4JF4 A;  1K57 C;  1N9O A;  1WYC A;  5KSH A;  3MS6 A;  4WLA A;  4GZB A;  4YNR A;  4OOY A;  1P9W A;  4N1X A;  1KE3 A;  3H9W A;  3OCL A;  4OKP A;  4RQ9 A;  2E8I A;  5FAP A;  3N6I A;  1TS7 A;  3N8S A;  3TE8 A;  2Y2N A;  2Q9N A;  2V8F A;  2ZC3 B;  4GDN A;  4CLC C;  3KYQ A;  4JXW A;  1HLU P;  2WGI A;  4ZJ3 A;  3UB8 A;  4E3I A;  2Y2O A;  3KSH A;  3C7U A;  4KZ7 A;  3LR4 A;  3HRE A;  1L0F A;  5AQ7 A;  4G3K A;  1G6O A;  1OJ5 A;  2KOI A;  1E3U A;  1FCN A;  3H82 A;  3S7Q A;  5MC7 A;  3U4L P;  4OQG A;  2ZLY A;  3T50 A;  4GS9 B;  4WMC A;  1YMS A;  3ZHH A;  2V9A A;  4GD8 A;  3NEC A;  1GCE A;  4EES A;  2W3E A;  4DE2 A;  2VGL S;  4MDZ A;  2GZA A;  1K6S A;  4II7 A;  5F5Y A;  1TDG A;  2EX2 A;  1ACF A;  2A2L A;  5FDH A;  2XA7 M;  2PT7 A;  3UB9 A;  4FD8 A;  4BWI A;  1D06 A;  5L2F A;  3GRJ A;  4NG2 A;  4JGR A;  3G34 A;  1V9Z A;  4Q0I A;  3BQA A;  4DN0 A;  1YKD A;  3NDG A;  3LIC A;  1NLY A;  4IBX A;  2JBF A;  2PHY A;  4DDS A;  2HV1 A;  3AGF A;  2PRF A;  1NYY A;  4EWF A;  3HUM A;  3UO9 A;  3V39 A;  1IYO A;  2P04 A;  5A91 A;  3P98 A;  5TFQ A;  4PM5 A;  5BOH A;  2EA9 A;  3BLS A;  4WMC D;  4LCM A;  4G3W A;  3ZVW A;  4OQH A;  5D3O A;  5F69 A;  4DMZ A;  4JKT A;  2Q0O A;  1OTD A;  3MR0 A;  1W5D A;  2J3W A;  2FFF B;  3VP1 A;  3IT9 A;  2PD7 A;  5DKK A;  2ZQ7 A;  1I2W A;  5A92 A;  4H6J B;  3RXX A;  4LV1 A;  1P97 A;  1XA1 A;  2X71 A;  3E2K A;  3PAE A;  4PKY A;  5DF7 A;  4S2N A;  1ES5 A;  2H10 A;  3JVU A;  3MMH A;  4P6Z S;  4A5R A;  1BUE A;  2VKS A;  4ZBE A;  4JBF A;  3PXP A;  3T1Q B;  5HDS A;  1LLB A;  3WS1 A;  4UQI M;  5HWV A;  5AQA A;  2ACG A;  3CWF A;  3CI6 A;  4Q8I A;  1YSQ A;  1ES2 A;  2WAF A;  1KGE A;  3FG8 A;  4U0T A;  2Y2M A;  5TR7 A;  3Q81 A;  5HWT A;  4OLD A;  2PU4 A;  1FR6 A;  1D7E A;  3GV9 A;  2OSU A;  3K2N A;  5CRF A;  1H3Q A;  3ZG0 A;  4JPM A;  1GA0 A;  3E2L A;  3FPW A;  4WUJ A;  2WKQ A;  4IUK A;  3W4P A;  1K4E A;  5LBR A;  3KSG A;  3O87 A;  4WZ4 A;  3MSH A;  1TDL A;  2O0Y A;  1A0K A;  3GTC A;  3UME A;  1S1Y A;  2INW A;  3MZE A;  2H28 A;  1KVM A;  1Z09 A;  4FOF A;  4PM9 A;  5HAQ A;  4DF6 A;  1Y28 A;  2OV5 A;  3TRC A;  4EV4 A;  1PZO A;  5CEB A;  4OH0 A;  5EEC A;  1MXO A;  4RA7 A;  3LFV A;  1ZTU A;  4OOL A;  4EUZ A;  1K56 A;  2LB5 A;  2HJE A;  3HLD A;  4GCZ A;  1N9N A;  4JGP A;  2ZL1 A;  4EW7 A;  1ALQ A;  2W1T A;  3GMW A;  1IEL A;  2YKF A;  4JXS A;  4HEF A;  3V5M A;  1KOU A;  2XLN A;  5DF8 A;  1XA7 A;  4S2J A;  4EEP A;  3IXG A;  4MN7 A;  4GLQ A;  3EGX C;  1IYS A;  4DE1 A;  2ZMV A;  3O3V A;  1H8Y A;  3ITB A;  3UE1 A;  4DKI A;  3E98 A;  3ZG5 A;  5E2G A;  1LSV A;  3CHW P;  5L8M A;  3PBR A;  4BL3 A;  3BRM A;  3WRZ A;  5HDC A;  2XFS A;  3FYZ A;  3VSL A;  2XRO A;  5FAT A;  4EBL A;  3BYD A;  3UDI A;  5F6A A;  2EXA A;  4G3V A;  3GDI A;  1K56 D;  4QY6 A;  3ITA A;  3IXB A;  2WAD A;  5TBM A;  4GD6 A;  4PHT A;  3EQU A;  4IBR A;  2XA7 S;  1K25 A;  3JYI A;  1G6A A;  4MLL A;  1BSG A;  1JWP A;  5AQ9 A;  3MJQ A;  3GR2 A;  4JGO A;  4M4X A;  2OAP 1;  5FAQ A;  5A93 A;  1KGG A;  1BLC A;  3LR3 A;  1HVB A;  2FH5 A;  1AXB A;  1GSV A;  5CTM A;  4XT2 A;  4KZ3 A;  4NEE D;  3TSG A;  4OON A;  2V2F F;  5CTN A;  4Y15 A;  4BJP A;  4Z9Q A;  3WRT A;  2Y2K A;  4GKU A;  4BBT A;  3C5A A;  4B4X A;  1PIO A;  3R7W A;  3K3C A;  3SH8 A;  2XK1 A;  2XR0 A;  1K55 C;  2VV7 A;  1DJB A;  4MN6 A;  2JKR I;  1Z6F A;  4EEU A;  3CZD A;  4Y7P A;  1I2S A;  3OBF A;  2XD1 A;  2XQZ A;  3NBL A;  1F2K A;  4ETX A;  2VX8 A;  3UNW A;  3VE3 A;  3QP6 A;  4LLO B;  3LIA A;  1LL5 A;  1F98 A;  3A0V A;  4KEN B;  4DXB A;  3ZNT A;  3MF0 A;  2W3F A;  2XSS A;  1UGU A;  3A3D A;  2PAV P;  3MFD A;  4KUO A;  5KSC A;  3T4T A;  2ZC5 B;  4E3K A;  4UQI S;  3N4I A;  4Y13 A;  2H5S A;  3UB7 A;  1PFL A;  3NIA A;  3DTM A;  2P9V A;  3QHY A;  3LIF A;  1RP5 A;  4FTX A;  3OPR A;  3QP2 A;  4CLC D;  1V9Y A;  4UA9 A;  4BD1 A;  4LCL A;  2EFX A;  1OTI A;  1S0W A;  1TEM A;  1FIK A;  4M3K A;  3RXW A;  1H0M A;  5F1G A;  4OQI A;  2ZOH A;  2WKI A;  4KQQ A;  4WEJ A;  5DVA A;  4KG5 A;  2WKP A;  4H6J A;  3BQ8 A;  2Y2Q A;  2Y2G A;  3GSG A;  4X68 A;  4OLG A;  5HFO A;  2Y59 A;  5HL1 A;  2QHK A;  4I3A A;  4P6B A;  2OOL A;  1P0Z A;  4KZ4 A;  4NKP A;  2WZZ A;  2ZM0 A;  1W7F A;  2A3U A;  5KMW A;  2Z6D A;  4MN5 A;  3H7W A;  3I7J A;  3D9Y A;  1XGI A;  3A3J A;  1H5X A;  4LFU A;  3N7W A;  4GHI B;  3HLW A;  1C3B A;  3Q7V B;  2EXB A;  4B93 A;  1JTD A;  2Y79 A;  1D1J A;  2KX6 A;  3MQ0 A;  5IHV A;  3LCE A;  5G18 A;  2P08 A;  1OTE A;  1S4R A;  2W1T B;  3WS2 A;  4O0P A;  1XX2 A;  1MWU A;  3Q7Z A;  5HAI A;  3C4O A;  3UDF A;  3CPT B;  1Y4O A;  2CC1 A;  3PTE A;  1OTB A;  2FFY A;  2GNX A;  3NJA A;  1N9L A;  3G2Y A;  1LL8 A;  5J8X A;  3KSF A;  5DJU A;  1MY8 A;  3IF6 B;  4ZTK A;  2GX5 A;  2QPN A;  1W8Y A;  3N8L A;  5EVI A;  4QB8 A;  5FL3 A;  4HIA A;  1CEF A;  3V67 A;  2BLS A;  1JVJ A;  2DNS A;  5FI6 A;  5DTT A;  5I94 A;  5TBM B;  3SH9 A;  4DDY A;  5K5B A;  3FPV A;  2P74 A;  4I3J A;  3G2Z A;  2G2W A;  4F94 A;  3BFG A;  3M6H A;  4RX3 A;  2D02 A;  5FI2 A;  1YLT A;  2JKR M;  1DY6 A;  4N9K A;  1KE4 A;  2AVX A;  3FV7 A;  3MXS A;  2ZC6 B;  3TOI A;  4XT2 B;  1Q2P A;  2E8J A;  3M2J A;  2G2U A;  3OCN A;  1MKM A;  3S1Y A;  4X69 A;  3LUQ A;  2VA0 A;  1FIL A;  3UN7 A;  1BLH A;  3IWQ A;  5EVI D;  5CGS A;  3C2W A;  5FA7 A;  1LSW A;  2YKH A;  3R7W B;  5EOE A;  1J3W A;  4QPR A;  3UDX A;  3HLB A;  2I9V A;  5GHY A;  2P7J A;  3OPL A;  5IS1 A;  5CED A;  3MFX A;  2QWS A;  4S2K A;  5L09 A;  4LGW A;  5TGF A;  3G31 A;  3HL9 A;  3ULF A;  1JWV A;  1PNE A;  1XXM A;  4UHU A;  1HTZ A;  4EQ1 A;  4I3I A;  3ZGA B;  4HH2 A;  5GHZ A;  4D2O A;  3O88 A;  2JKT I;  5M1A A;  1NRF A;  2C5W B;  4HES A;  3LR5 A;  2Y55 A;  3CUE C;  4I5S A;  4OPZ A;  3SZT A;  1KGF A;  3ZFZ A;  4RVA A;  5CGW A;  1MWT A;  5GLD A;  5HD5 A;  3UY6 A;  4PM8 A;  1J9M A;  2M7V A;  3LY4 A;  1QMF A;  2W27 A;  3FC7 A;  3L9K A;  1OJG A;  4OPQ A;  4LV2 A;  3W8K A;  2P9V B;  2EX8 A;  1XJ4 A;  1YT4 A;  1IFQ A;  3TG9 A;  4GN2 A;  1U60 A;  5F83 A;  2UWX A;  5M19 A;  4BD0 A;  1UWP X;  1EI5 A;  3UE3 A;  3LYX A;  1YAX A;  4Y0O A;  4BBU A;  2JHE A;  4S2M A;  5FAS A;  5G4Y A;  2HDQ A;  3ZYT A;  2NUP C;  3SS5 A;  4R1G A;  4O7D A;  1YM1 A;  5GLA A;  3K3D A;  2VK3 A;  4PMA A;  5HX9 A;  1ZC2 A;  5DFX A;  5FQM A;  1CI9 A;  3NCK A;  3G30 A;  3C38 A;  1BZA A;  4PPR A;  2VJW A;  3MBZ A;  1TVF A;  2PR6 A;  5C5K A;  3WWX A;  5HPF A;  2A24 B;  4N9L A;  1NZO A;  3QP8 A;  3MQO A;  5EFW A;  1TS6 A;  3S22 A;  2FZ0 A;  3H7W B;  4KZ6 A;  3PBN A;  1RGY A;  3V50 A;  2JC7 A;  4QHC A;  3S7O A;  3UB6 A;  1ES4 A;  1AWI A;  4E3M A;  5JYO A;  2B5R A;  4E3N A;  3LI8 A;  4Q0H A;  2HF6 A;  1ERM A;  4HI4 A;  4PAU A;  2J9O A;  4NXF A;  1O7E A;  4UA6 A;  1LI9 A;  2WGV A;  1K4F A;  3LIB A;  2ZBB A;  5FI7 A;  3AGD A;  1NYM A;  3PBT A;  4B4Z A;  4EU0 A;  1WA9 A;  4KZ8 A;  4OOM A;  3VOY A;  4KQO A;  3IWO A;  1BYW A;  2HZ5 A;  3NY4 A;  2L1M A;  3G6O A;  2W1R A;  2ZJ9 A;  3W2Z A;  1ONH A;  5IU1 A;  4PM6 A;  1PI4 A;  3TW8 A;  4KG2 A;  2W3G A;  3Q82 A;  3G4P A;  4KG6 A;  1I5Q A;  3LR0 A;  2OLU A;  4K91 A;  5CXW A;  2QYB A;  1LT0 A;  2Z2L B;  2PYP A;  3NI9 A;  4EXO A;  5EVI B;  1E4D A;  1F9I A;  4RYE A;  4GHI A;  1JTG A;  3BEC A;  3A0S A;  1TF1 A;  3Q7V A;  1H8Z A;  1GSX A;  2IA2 A;  4NXE A;  3HUN A;  1GA9 A;  4KQD A;  3CG5 A;  3VSK A;  1H8M A;  3EOI A;  5AVF A;  3T4O A;  3IWI A;  5J3W A;  5DF9 A;  3HBR A;  3VP0 A;  2JKF A;  4KZ9 A;  5FSR A;  1JWZ A;  2H0T A;  2IWB A;  1NLZ A;  4FH4 A;  2V20 A;  1VQQ A;  3CPT A;  4P85 A;  3NOT C;  5CHM A;  3IHA A;  3CLO A;  1VET B;  3LIE A;  2Y2L A;  3VE4 A;  4O01 A;  3DTI A;  2XD5 A;  3IF6 A;  2JKT M;  3MXQ A;  2EWV A;  5EM1 A;  5GLB A;  4ZJ1 A;  2J3T D;  4DJ3 A;  1ES3 A;  4XXR A;  4Y0U A;  1G5U A;  4L9E A;  3CIT A;  2K31 A;  4DE0 A;  3Q07 A;  3MXR A;  2HP5 A;  2OLV A;  1T1A A;  4LRX C;  5KIZ A;  1RCJ A;  4WZ5 A;  1M6K A;  4S2L A;  1FSY A;  1K57 A;  1SKO B;  5FQQ A;  1XJ2 A;  3PHY A;  4L0L A;  4X56 A;  4L9G A;  1YQS A;  2EX6 A;  3HLF A;  1XJ3 A;  3E4Q A;  2EWW A;  4HH3 A;  3NDE A;  2X01 A;  3P09 A;  2PDR A;  3HLG A;  3NHQ A;  3B47 A;  2VLG A;  4WF0 A;  1M40 A;  1BLS A;  1NRJ A;  4GJ4 A;  5I5L A;  3UE6 A;  2J7V A;  2ZC4 B;  3A0R A;  3HLE A;  4K0W A;  2ZMF A;  1SCW A;  4BEN A;  3UPO A;  1ZHH B;  3ZQ5 A;  4JXG A;  5F1F A;  2Y2J A;  2XGN A;  1F5M A;  3IX3 A;  1MBL A;  1WE4 A;  3VFH A;  4ARZ A;  4MCW A;  4CLC A;  4MNR A;  4ZJ2 A;  4NK3 A;  1DP6 A;  2WUQ A;  3CJM A;  1CK3 A;  2J8Y A;  3LEQ A;  4S2P A;  4R0Q A;  4N1H A;  3SS3 A;  4MEZ A;  5HZH A;  1OME A;  3GEC A;  3OOV A;  2EFU A;  3KSI A;  5F68 A;  2C6W B;  4Y17 A;  2Y2I A;  4OQ0 A;  2RCX A;  5FEF A;  2XFT A;  2VGL M;  1IYQ A;  3UMD A;  3IH9 A;  4N92 A;  4H8R A;  3JVV A;  3NUL A;  4X25 A;  3SS4 A;  4BMW A;  4EBP A;  1PWG A;  3LEZ A;  5GLC A;  1K54 C;  3F1N A;  5J7E A;  5EE8 A;  1W8Q A;  3E0Y A;  4U0X A;  3C4P A;  3Q1F A;  4E3O A;  3UPP A;  3IX8 A;  3QNB A;  3NOU C;  1W63 M;  2XH9 A;  4JF6 A;  3P7N A;  4Y5F A;  1K0K A;  3A3F A;  3IS2 A;  1G68 A;  3ICY A;  2ZQD A;  2WKR A;  4YIN A;  1IKG A;  3VOZ A;  2Y2P A;  4L9F A;  2JKG A;  2O9C A;  3O86 A;  4PKY G;  3BFE A;  3HUO A;  1GSW A;  4ZDX A;  4NXB A;  1ONG A;  1KDW A;  1VM1 A;  4B9O A;  1S4S A;  2A24 A;  1KDS A;  5A90 A;  5E2F A;  1OTA A;  1PWC A;  3E4P A;  1VB6 A;  4YOF A;  4R3A A;  3LO7 A;  3KX0 X;  3VFF A;  3WS0 A;  2BAS A;  4HBT A;  5FDS A;  3T4K A;  4HNB A;  3MQQ A;  4KUK A;  4KZB A;  1T1C A;  4P6Z M;  3BM6 A;  5HAP A;  2ZQC A;  4LPZ A;  2M7U A;  4QJG A;  4R3J A;  2O9B A;  5FQJ A;  1ZKJ A;  2GJ3 A;  3R4K A;  1W63 Q;  2J80 A;  5AVE A;  3DAV A;  2WAE A;  5L07 A;  1STZ A;  5AJG A;  4HOI A;  1S66 L;  4MBK A;  2O9A A;  4XUZ A;  1XJ6 A;  4R70 A;  2UV0 E;  3GQZ A;  1L0D A;  3W4Q A;  3EQV A;  3LID A;  2V0W A;  4OVD A;  5DKL A;  2L0W A;  2XDM A;  2ZC7 A;  4YWZ A;  3RJU A;  4CQH A;  4K08 A;  3CMZ A;  1XKZ A;  1NXY A;  4P0M A;  3KYE A;  2V1B A;  4EQI A;  4EBN A;  4FUW A;  3DWK A;  2XF3 A;  4Z1W A;  4I38 A;  4NET A;  2A49 A;  1MC0 A;  1VEU A;  3LI9 A;  3F1O A;  2RL3 A;  3UE0 A;  4GNU A;  2B95 A;  2PR5 A;  2JCH A;  5HPI A;  2ZQ9 A;  1VET A;  4JXV A;  4QD4 A;  1CF0 A;  2HGV A;  2HP6 A;  1PRQ A;  4HHD A;  3KYZ A;  1EWZ A;  3OZH A;  3IXH A;  3OC2 A;  4E6X A;  1N4O A;  3U2A A;  3FKW A;  2Y2H A;  4LRZ E;  5CHU A;  3S7P A;  4X53 A;  3B33 A;  3W4O A;  1FR1 A;  4IVI A;  3T12 B;  4LV3 A; 
#chains in the Genus database with same CATH homology
 3T1R A;  1AWI A;  3MSH A;  1A0K A;  5EM1 A;  5FEF A;  5EM0 A;  1VEU B;  1Z09 A;  4ESP A;  1G5U A;  2PBD P;  1FIK A;  3NUL A;  4X25 A;  5EV0 A;  2BTF P;  3DAV A;  1SKO A;  3T1S A;  2V8F A;  4X1L A;  3L9K A;  3T1X A;  2HZ5 A;  1CJF A;  1SKO B;  1HLU P;  1YPR A;  2ZL1 A;  3T12 B;  3U4L P;  2ZL1 B;  1K0K A;  5EVE A;  4X1M A;  3NEC A;  1SZV A;  2E8J A;  3LGO A;  2JKG A;  3UB5 P;  3D9Y A;  2VK3 A;  3T1Q B;  3KYE A;  3L7H A;  1F2K A;  2ACG A;  5FEG A;  1ACF A;  4FUW A;  1FIL A;  1D1J A;  1VEU A;  2JKF A;  3CHW P;  2B95 A;  1J3W A;  2PAV P;  3LEQ A;  1VET A;  3CPT A;  2V8C A;  1CF0 A;  1PRQ A;  1VET B;  3CPT B;  4QWO A;  1PFL A;  1Y4O A;  4D60 A;  2PRF A;  1PNE A;  4FTX A;  5FDS A;  3MS6 A;  1CQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...