3CPTA

Mp1-p14 scaffolding complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
DDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Mitogen-activated protein kinase kinase 1-interacting protei
publication title Molecular dynamics-solvated interaction energy studies of protein-protein interactions: the MP1-p14 scaffolding complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08923 MAPKK1_Int Mitogen-activated protein kinase kinase 1 interacting
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3cptA00
1A0KA 3CPTB 1FILA 1PFLA 2V8FA 2B95A 5EVEA 5EM0A 2VK3A 5FEFA 5FDSA 2JKGA 4X1MA 1SKOA 1D1JA 4X1LA 1VETB 1AWIA 3U4LP 3T1RA 2ZL1A 1F2KA 2HZ5A 5EV0A 5EM1A 2BTFP 3D9YA 3T1QB 2PAVP 3KYEA 1ACFA 4FUWA 1K0KA 1Y4OA 1J3WA 2PBDP 1SZVA 5FEGA 1Z09A 1SKOB 2PRFA 3L7HA 4D60A 1PRQA 1VEUA 1CQAA 3NECA 3CPTA 3L9KA 1G5UA 3T12B 1CF0A 2ZL1B 2JKFA 3T1XA 4FTXA 3UB5P 3MSHA 3NULA 3CHWP 2V8CA 3MS6A 1VETA 3LGOA 1FIKA 4QWOA 3DAVA 1YPRA 1PNEA 3T1SA 3LEQA 1HLUP 1VEUB 2ACGA 2E8JA 4X25A 4ESPA 1CJFA
chains in the Genus database with same CATH superfamily
1OPXA 3HLBA 2M7UA 2B95A 4DXCA 2Y2IA 4KENB 4NKPA 2EX9A 1QMFA 3IXDA 2H0YA 4WEJA 2XD1A 3LCEA 2JKRI 5EE8A 3KSFA 4UQIM 1I5QA 3EGDC 4RX3A 1TS6A 5CGWA 1TD5A 2W1TB 3D9YA 4F94A 4C6YA 4P6BA 2FZ0A 3F1PB 5DKLA 5J4EA 1RCJA 1GA9A 5HDSA 3BFFA 2PD7A 5F82A 4N9LA 1PWGA 1G28A 5D3OA 1GHIA 1EI5A 4JGQA 3ZQ5A 1T19A 3F1OA 3LY4A 3BQAA 4ZRRA 5KZHA 4IVIA 2VGLS 1UWNX 3EEAA 2ZJ9A 3BRMA 1N9NA 1CF0A 1HTZA 2Y2PA 4PM8A 5EVIB 3VP2A 1ZG6A 1K54A 4Q0HA 4EUVA 5DF7A 4UA7A 4MNRA 3GTCA 3UB5P 3N8SA 5IU1A 4KZ5A 4I3IA 2FH5A 4O0PA 4EBNA 4E3LA 3FKWA 4UA6A 2V0UA 1K57C 3NOTC 4X55A 1G6OA 3S7OA 3MF0A 1QMEA 3BY9A 4JPMA 3VFFA 4H8RA 4CLCB 1IFQA 2QHKA 4ZDXA 4R70A 3QHYA 1LL5A 2QZ6A 3V3SA 3C38A 3AGDA 4NG2A 3VSKA 1OTBA 1NZUA 5HDDA 1S1YA 1SDNA 2XRNA 3FG8A 1PW8A 1VB6A 4XT2B 4X69A 1Y28A 3LIFA 2ZL1A 4WMCA 3ZFZA 5EV0A 4ZTKA 2BTFP 1ESIA 3IX8A 2J9OA 5EVIC 4B93A 3UB9A 1LT0A 5L07A 1IKIA 1E3UD 1M40A 2XF3A 3ITAA 4Y2FA 4B88A 2QMIA 2WUQA 1GSWA 5DFYA 1YLZA 4H6JA 2XDMA 1IYQA 1XJ2A 5F1GA 3F1NB 2DNSA 2Q9MA 4C3QA 4CLCC 2VGJA 3G31A 4U3TA 3A3JA 5A92A 1TS8A 4GD6A 3IH9A 2W3EA 4I38A 3FPWA 2V1ZA 3MS6A 1LI0A 2D02A 5CGXA 3DAVA 4IBXA 5KSCA 3O86A 3MZEA 1PZOA 1MKIA 2R9XA 3FWLA 3CZDA 1TDLA 1IOUA 4L9GA 2XEPA 5E43A 2ZLYA 4EESA 3CI6A 3BJNA 5EVEA 3SH9A 1C3BA 2J9PA 2JKGA 3UDIA 4WL9A 1KGEA 1I2SA 2WAFA 3IX3A 3LO7A 5CGSA 2Z2MB 4L9FA 5HZHA 5M19A 2WKQA 3O5YA 3NHQA 4O7DA 4R3AA 4UAAA 1DJBA 2O9AA 1JWVA 3CWFA 2WKHA 4HHDA 5LBRA 2KX6A 2VZWA 3G4PA 3AGEA 2PU4A 3ITBA 3QNCA 4PM7A 4JGRA 2JC7A 1JNUA 1SZVA 3G2ZA 4X53A 5I94A 4LCMA 3CUEC 1NLZA 1LSVA 3O87A 1VEUA 5HWTA 5DF8A 3W8KA 1W7FA 1K55A 1P0ZA 3FKVA 4FH2A 1ES2A 4OOMA 1LL8A 3HVFA 5GLAA 2JKFA 1F9IA 4OQGA 4N1HA 5DF9A 4E3MA 2QPNA 2Z6CA 2J8YA 4YWZA 3LIDA 3GDIA 4FH4A 4HH2A 2ZD8A 3TE8A 1OTDA 3HJKA 4G3KA 5CX7A 2J3TD 4GW9A 2A2LA 1TDGA 4NXFA 1ONHA 5HWWA 1E4DA 1F98A 3ZHHA 2ZMFA 2G7UA 3UNWA 3C30A 3ZNTA 1CJFA 2OAP1 3H7WA 4N92A 3P09A 1PYYA 1P9WA 3LR3A 4GN2A 4MDZA 3KSGA 5FEFA 4X1MA 1GCEA 3A3FA 3DTEA 1YLTA 1IELA 2HP5A 3BEBA 3UPNA 4ARZB 4X68A 1AWIA 1NXYA 4CLCE 3QP2A 4G3VA 5EFWA 3ZNYA 3BQ8A 3RJUA 1LLBA 1CEFA 1Z6FA 4FSFA 2GJ3A 4L9EA 1BUEA 3GV9A 3E4PA 3WWXA 3BYDA 3PAGA 2P9VA 1MXOA 2RL3A 3IWOA 1YSQA 2IWCA 1JTGA 1HD8A 3MZDA 4QHCA 1AXBA 4D60A 3W4OA 3S4XA 1ODVA 1MWSA 4R1GA 4GLQA 1PRQA 5CTMA 5F83A 3NECA 5TGFA 3V67A 3D3OA 3R7WA 2W1RA 4RYEA 1EROA 4MN5A 1W5DA 1SCWA 1XJ3A 1TF1A 1BLSA 2WADA 3CG5A 2DCFA 2W27A 3OLOA 3A3DA 2WKPA 5MC7A 1N9LA 2MJ6A 3M6HA 5HPIA 1YMXA 2ZMAA 4LRXC 2PHYA 4U0XA 3Q7VB 3WS0A 4DDSA 2M7VA 5L09A 1FILA 3A0SA 4JGOA 4LCLA 3D4FA 4R23A 2PT7A 3VOLA 1H8MA 5AQAA 5EPHA 5TR7A 3ZG0A 1OT6A 2ZC5B 1NYYA 5DTSA 1VETB 3TJZC 2W3FA 2CMNA 4M4XA 3UB8A 1OMEA 3S22A 1YAXA 4ZAMA 5A90A 5EVID 2Y2OA 3VP0A 1ZTUA 2Y59A 3E2LA 3CJMA 3FYZA 2JE5A 2ZM0A 3LY3A 5FQ9A 4OQHA 3W4PA 1K56D 5HARA 5HL6A 3PYPA 2XSSA 3WS5A 1T1BA 3SOIA 4Y3IA 2VV6A 1ES3A 2ZM2A 1FOFA 4OONA 2EA9A 3IX4A 1S4SA 5AQBA 4CLCD 3ZG7B 3CPTA 2PYRA 4MN7A 2XK1A 4RA7A 4NXBA 1GSVA 4ETXA 5G4YA 3BM6A 5FQIA 1W8YA 3A3EA 5FQMA 3V39A 3TRCA 3T1XA 3PBOA 2EXAA 3OOVA 1ES5A 2I9VA 1FSWA 3M2JA 4GOGA 5F69A 3HLDA 3LIAA 4IVKA 5HWVA 2BLSA 3LGOA 4OQIA 1L0GA 2D01A 4BLMA 4OPRA 2W0NA 4Q0JA 4OH0A 3VV4A 2WK0A 1ALQA 2A24B 1SHVA 1L0EA 3LUQA 5J3WA 4E04A 3DTKA 1PFLA 3UMEA 2DRWA 2KOIA 4QU3A 5HPFA 5FDSA 1LSWA 5IT5A 4NETA 2HDQA 4GJ4A 4X1LA 4LPZA 5JYPA 3E4OA 4EU0A 1N4OA 1FCOA 3IS2A 2EX8A 4OLGA 3N4IA 5EECA 2Y2KA 2O0YA 3IBJA 4EW7A 5J8XA 4ZJ3A 3ZVTA 3BFCA 3HUOA 4KQRA 4HI4A 2Y2LA 3JVVA 1Y54A 4DDYA 4GDBA 2K7SA 3VE3A 1TVFA 3DWKA 1LHYA 4Y13A 4BBTA 2PRFA 3HLCA 4WN5A 4S2LA 4EXOA 4BENA 3LFVA 4KQOA 3I7JA 3WS2A 3C8CA 4KZBA 1Q2QA 2JCHA 3SS5A 4E3OA 5EVLA 5HSQA 4NK3A 2ZL1B 3MQOA 3SH8A 4WF0A 3G2YA 4JBFA 1K54C 2VKSA 5AQ7A 3B33A 4HBUA 3ZYTA 2A24A 2V8CA 2Z2LB 4OOLA 1SDEA 2CC1A 4H6JB 4BL2A 2GX5A 3T4QA 1L0FA 3PHYA 1KOUA 4D2OA 2Y2MA 4EETB 4MEZA 2WZXA 3ZGAB 3ZG8B 4YINA 3C2WA 5CXWA 1Q2PA 4Z1WA 3BWLA 2WZZA 2ZC7A 2H5SA 2GNXA 1UWPX 2HP6A 3UY6A 5FAQA 1IYOA 3MJQA 2H0TA 3NIAA 4CPKA 1ERMA 2ZC4B 1XFNA 2VJWA 1PI5A 5EM1A 3WRTA 1WA9A 3G30A 1XA1A 4IJGA 3NOPC 2PU2A 1NYMA 3OCLA 4PM6A 4Y17A 4KZ7A 4F3LA 3RXXA 1ZG4A 3MXQA 4JF4A 2OOLA 3QP6A 3IHAA 4S2NA 1J3WA 4EEPA 4B4XA 3BY8A 3MMHA 4S2OA 3OPRA 4MBHA 2XA7M 4EV4A 3O3VA 4Y0TA 4HOIA 3HUNA 1O7EA 1MY8A 3EQVA 2VEAA 4Y0OA 4B9OA 4KZ8A 1XP4A 3GRJA 2OV5A 3V50A 4Z9QA 2ZOIA 4QJGA 3P7NA 1FCNA 1YSPA 3OPHA 2L0WA 4KZ3A 4K91A 2R78A 1YLYA 1BSGA 1V9ZA 3ULFA 3IWIA 2WGIA 1ERQA 1YQSA 3QP1A 1W63Q 1YPRA 2EX2A 3NDEA 3RTYA 5DVAA 3N8LA 1VEUB 2ACGA 3BFEA 5GL9A 2E8JA 2W3DA 1K6RA 3TW8A 3G32A 2ZOHA 4R4SA 4OVDA 3SZTA 4KG5A 3UDFA 4O01A 1NZOA 4ZJ1A 1MWTA 2XROA 5GHZA 4IBRA 2ZBBA 5U47A 2EWVA 2O9BA 2EX6A 3BLSA 3JPUA 4E3KA 2EFUA 2Q0OA 1KGFA 3IF5A 4PMAA 4XXRA 5HDCA 2G2WA 5FQQA 5BOHA 4MBFA 3Q7ZA 2Y55A 1LSXA 5CHMA 5F1FA 2YKFA 3SW1A 3H7WB 4K08A 1K0KA 4OOYA 2VA0A 3OZHA 3NOUC 2V0WA 1OTEA 1CI9A 3E2KA 3UMDA 3UO9A 1CQAA 5EOEA 1K55C 1BULA 1NWZA 1VM1A 1G5UA 2HGVA 3T12B 4R38A 3C5AA 5KIZA 4JLFA 5CECA 1FR6A 3OBFA 1OTAA 5HW3A 2PD8A 4EERA 3S7PA 4R0QA 2HP9A 1YLPA 4LLOB 2JBFA 4EEUA 2P9VB 1FIKA 3OPLA 1W79A 3Q82A 1DP9A 3DBAA 4WZ5A 5TFQA 2EXBA 3UE1A 1S67L 4DMZA 1SKFA 1MC0A 5E2FA 3R7WB 1MWUA 2W3HA 2RCXA 5EM0A 1I2WA 3K3CA 4HH3A 2FFFB 3SH7A 1XX2A 4P6ZM 2R9WA 3OPPA 3M2KA 3CUEA 3HLGA 4PM5A 4WEKA 3CAXA 3ZG9B 3VMAA 2BASA 2HDRA 2QJ5A 3PR6A 3IXHA 3V3RA 2AVXA 3DTMA 1H8YA 1ACFA 3NBLA 3BLMA 4FUWA 3FPVA 4BJPA 2X71A 2PBDP 4GHIA 1Z09A 4GNUA 4LFUA 1K6SA 4OKPA 3JYIA 3PTEA 4DE1A 5L2FA 5A93A 1VHMA 2PDRA 4ME4A 1D06A 5HAPA 2V1BA 4EBPA 2LB5A 4KUKA 3L9KA 3BW6A 5CTNA 4M3KA 2JN7A 2K31A 2HJ9C 1KGGA 1L3LA 4QD4A 1V9YA 1XGJA 4FTXA 2X02A 4HJ4A 4GD8A 3NY4A 2ZMVA 4IHQA 3Q07A 2J7VA 3EEHA 3T1SA 4Y0UA 4KZ6A 4Y7PA 4UHUA 3CPTB 4DJ2A 4HJ6A 3ZCZA 1W63M 4DN0A 2LB9A 3PBNA 2Y2QA 5KMWA 1MWRA 1BZAA 4CJNA 1S6RA 3LIBA 5FAPA 1WYBA 2OLVA 1FCMA 4GDNA 5FSRA 4UQIS 4HBTA 5E2GA 1M6KA 3MXSA 3QP8A 1D7EA 1H5XA 2XQZA 3T4SA 3IXBA 3GVBA 5DFXA 3S7QA 2OWHA 3GMWA 3GSGA 4WMCD 2BG1A 1GA0A 4EQIA 1S4RA 5DJUA 5CEDA 3B3XA 4AFIA 1STZA 2PAVP 2Y2JA 4LV1A 5TJJA 1E3UA 2JKTM 5GHXA 4WLAA 4RQ9A 2KDKA 2KLIA 4P87A 1YMSA 4BQMA 3U2AA 1OJGA 1MBLA 3C4PA 2P74A 2O9CA 3PBTA 4R4RA 4GKUA 2VX8A 1XGIA 4WYYA 2XR0A 4C75A 3IS2B 3KX0X 1VQQA 3NC8A 3E98A 4I3AA 2DMWA 1PZPA 4GB7A 4P85A 4HJ3A 4PHTA 5HL1A 3ICYA 3KYQA 4JXSA 4NEED 1LI9A 2M1CA 2JKRM 1YKDA 5DTTA 3BFGA 1O07A 4MBKA 2INWA 3TG9A 4HEFA 4OPZA 5GLBA 2HJEA 1HLUP 4X56A 4RX2A 2XFTA 3BFDA 1N9OA 3AGFA 1BLHA 3FC7A 5A8BA 4E6WA 3T4TA 1W8QA 2V8FA 4JXGA 4Y15A 4MLLA 1G68A 1TEMA 2VK3A 3QP4A 4G3WA 3HREA 3Q1FA 4P0MA 1SKOA 1DP6A 4HP9A 3B42A 3RXWA 5K5BA 1NLYA 3N6IA 4DRTA 5TBMA 3CITA 1GHPA 4BBUA 4HIAA 2Y8HA 3NDGA 3VSLA 1KDSA 1X0OA 3T1RA 4UEYA 2ZQ8A 1LL9A 5HAQA 3T4JA 3UPPA 1JWPA 4YNRA 1H0MA 1IKGA 1CEGA 4HQAA 2IA2A 3MBZA 3WRZA 4ETZA 3P98A 4GS9A 2NUPC 1P9RA 3IF6A 3DTIA 5G4ZA 3A0VA 3KSHA 2JHEA 2GDNA 4UA9A 2WGWA 3G35A 3EOIA 4LV3A 1FSYA 2WYXA 3MQQA 5FAOA 3HL9A 4EQ1A 4DE0A 5JYOA 5AJGA 1BYWA 1IYPA 2W3GA 1GSXA 4PAUA 4GCZA 3H9WA 2G2UA 2WKIA 3SS3A 3LEZA 5L10A 4F3LB 2YKHA 2GZAA 1FR1A 1S66L 2Z6DA 4ZJ2A 1KVMA 4KG6A 2VGKA 4FCFA 1GHMA 1KE3A 3G34A 5E2HA 1ZKJA 3H82A 3LI8A 3W4QA 2HDUA 5C5KA 4N1XA 3K2NA 4Q0IA 4XUZA 4I39A 3VFHA 2VV8A 4CQHA 2EFXA 1DY6A 1BLPA 4R3JA 2J80A 4IEDA 4MCWA 3GR2A 3MR0A 3KYEA 1IYSA 1XKZA 4L0LA 3QP5A 4S2NC 1Y4OA 3MQ0A 3VE4A 2NUTC 3IWQA 4YOFA 4DKIA 4DXBA 5FATA 5FQKA 2V1AA 4FD8A 1ZC2A 4Y5FA 2VLGA 3HLFA 1XJ6A 5AQ9A 2O99A 4O8GA 4HY8A 3E0YA 4DJ3A 3D72A 3NJAA 3WS1A 1K4FA 4WZ4A 4NXGA 4OPYA 1ONGA 4IUKA 4I5SA 1T1CA 3CHWP 4IUHA 4KZAA 4LRZE 4P6ZS 2A3UA 1K57A 3LEQA 3UE3A 4E3IA 3MFDA 4OPQA 2W1TA 3RFBA 3UB6A 2QWSA 2PYPA 2P7JA 2ZQDA 2H28A 1A0KA 3UN7A 4LV0A 1CK3A 4DE3A 3F1PA 3EGXC 3LR0A 4JF6A 4DF6A 1F5MA 3R4KA 3SS4A 2UWXA 3VOZA 4N9KA 1K38A 5GLDA 2A49A 2FFYA 5KSHA 5EOOA 3GECA 4WBGA 3HJIA 3C7UA 3ZG5A 1N9BA 5AVEA 5AVFA 4S2MA 3MXRA 3MZFA 2WGVA 1PWCA 3MFXA 1F2KA 5EVIA 5EUAA 1S1ZA 4KZ9A 1KE0A 3BECA 1T1AA 3PBSA 3HBRA 1K56A 2Y4AA 4YFMA 1IEMA 3TOIA 4E3NA 4S2IA 3W2ZA 4JXWA 3PXPA 4DE2A 4S2KA 1E25A 2WAEA 4CLCA 4BMWA 2QYBA 3ZDJA 1NY0A 1EW0A 2L1MA 3T4OA 2V20A 3N8RA 1BTLA 4ZBEA 5FASA 1PWDA 5F68A 1ES4A 2IWDA 3Q81A 1NJ4A 1L0DA 2ZC6B 2P08A 5GLCA 4BD0A 1HVBA 4GHIB 4EUZA 1JVJA 4QWOA 3C4OA 4R3BA 3LYXA 4XT2A 2VGLM 5M18A 3OCNA 1PNEA 4JKTA 2QJ7A 4WZ5C 4PPRA 4EBLA 3MKFA 4OP5A 3RH8B 1FQGA 2HPBA 4OQ0A 4OLDA 1XA7A 1KDWA 2OSUA 1P97A 4JGPA 2XLNA 5FI2A 1S0WA 3UE0A 3M6BA 3V5MA 2PR5A 4KG2A 3N7WA 1DJAA 4I3JA 2XD5A 3PAEA 3F1NA 3LIEA 2ZQAA 5I5LA 3P01A 2PR6A 4B4ZA 5G18A 4K0XA 1U60A 2QKPA 5F5YA 4WM9A 2ZM8A 4BD1A 1BLCA 1PIOA 4WUJA 4PKYG 4Q8IA 1YT4A 1K4EA 2J3WA 3PBQA 3UDXA 4LV2A 3O88A 3T50A 3EQUA 3TSGA 1K25A 1NRJA 1XPBA 3QNBA 5HX9A 3NI9A 1RGZA 2VV7A 4ID4A 5CHJA 1BT5A 2Q9NA 2K2NA 4JXVA 2OAQ1 3IBRA 1TS0A 1PI4A 2B18A 1JTDA 2EWWA 3E4QA 4S2JA 1UGUA 3T4LA 3IH8A 5L8MA 5DTKA 4XUXA 3IXGA 1OTIA 1DJCA 3CLOA 1YLJA 1OJ5A 4ESPA 3G6OA 1DRMA 3ZVWA 2Y2NA 2HV1A 5IHVA 5F6AA 3UPOA 2IWBA 5DKKA 3VP4A 1ESUA 1RGYA 3HUMA 2UV0E 5CERA 4S2PA 3GQZA 3VOYA 4A5RA 1XXMA 2ZQ9A 4KZ4A 2X01A 3VP1A 2Y79A 1EWZA 1WE4A 2HDSA 5CHUA 2HZ5A 2E8IA 1YM1A 3S7NA 5CEBA 5CRFA 1L2SA 3UE6A 4HESA 4II7A 1MKMA 2WKRA 4HNBA 4QY6A 4FOFA 3IT9A 3ISGA 4LGWA 2V2FF 4KQDA 2XGNA 5HD5A 1SKOB 3DWZA 5FL3A 1G6AA 2B02A 4MMNA 4QB8A 4QPRA 5TBMB 2OLUA 1WYCA 3KYZA 2OWJA 3DW0A 4U0TA 5HAIA 4JF5A 1YLWA 4LRYC 4X6TA 1T18A 4NXEA 2Y2HA 5IS1A 1J9MA 2PBYA 2L4RA 5A91A 1PW1A 3NCKA 1H3QA 4ARZA 4EWFA 4GS9B 5FI6A 3IF6B 3EWKA 1CI8A 3LICA 3IQAA 2XFSA 5E2EA 4PKYA 4BBVA 2WGWB 2HF6A 5FQJA 5J7EA 5FI7A 4KUOA 3HCYA 3FV7A 3B47A 4K0WA 4E3JA 5DJTA 3HLEA 4WELA 4BL3A 1D1JA 1KVLA 3K3DA 3VP3A 3KO6A 3A3IA 3U4LP 3CMZA 2V9AA 1XFQA 4HP4A 4R6LA 2ZQCA 2P04A 2ZQ7A 2WKEA 1HZOA 4OP8A 2ZC3B 3T1QB 4E6XA 4GZBA 5GHYA 3KSIA 2C6WB 1MPLA 4KQQA 3S1YA 3T4KA 3UB7A 3FZCA 3HLWA 3IF6C 3H82B 5FEGA 3A0RA 2I72A 3LR4A 1ZHHB 2XA7S 2B5RA 3L7HA 3MKEA 2H10A 3OC2A 4QY5A 3WS4A 3Q7VA 1H8ZA 1NRFA 3JVUA 3C7VA 1MZUA 1RP5A 2XH9A 3F1OB 4PM9A 1TS7A 5HD3A 1XJ4A 3IHBA 4BWIA 5M1AA 2JKTI 2Y91A 1KE4A 3LI9A 3LR5A 1OT9A 3MSHA 3NULA 1DP8A 1VETA 2J3TC 3PBRA 2Y2GA 5FA7A 4RVAA 5HFOA 2C5WB 4LENA 1JWZA 4X25A 5FDHA 4MN6A
chains in the Genus database with same CATH topology
1A0KA 3CPTB 1FILA 1PFLA 2V8FA 2B95A 5EVEA 5EM0A 2VK3A 5FEFA 5FDSA 2JKGA 4X1MA 1SKOA 1D1JA 4X1LA 1VETB 1AWIA 3U4LP 3T1RA 2ZL1A 1F2KA 2HZ5A 5EV0A 5EM1A 2BTFP 3D9YA 3T1QB 2PAVP 3KYEA 1ACFA 4FUWA 1K0KA 1Y4OA 1J3WA 2PBDP 1SZVA 5FEGA 1Z09A 1SKOB 2PRFA 3L7HA 4D60A 1PRQA 1VEUA 1CQAA 3NECA 3CPTA 3L9KA 1G5UA 3T12B 1CF0A 2ZL1B 2JKFA 3T1XA 4FTXA 3UB5P 3MSHA 3NULA 3CHWP 2V8CA 3MS6A 1VETA 3LGOA 1FIKA 4QWOA 3DAVA 1YPRA 1PNEA 3T1SA 3LEQA 1HLUP 1VEUB 2ACGA 2E8JA 4X25A 4ESPA 1CJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A0K A;  3CPT B;  1FIL A;  1PFL A;  2V8F A;  2B95 A;  5EVE A;  5EM0 A;  2VK3 A;  5FEF A;  5FDS A;  2JKG A;  4X1M A;  1SKO A;  1D1J A;  4X1L A;  1VET B;  1AWI A;  3U4L P;  3T1R A;  2ZL1 A;  1F2K A;  2HZ5 A;  5EV0 A;  5EM1 A;  2BTF P;  3D9Y A;  3T1Q B;  2PAV P;  3KYE A;  1ACF A;  4FUW A;  1K0K A;  1Y4O A;  1J3W A;  2PBD P;  1SZV A;  5FEG A;  1Z09 A;  1SKO B;  2PRF A;  3L7H A;  4D60 A;  1PRQ A;  1VEU A;  1CQA A;  3NEC A;  3CPT A;  3L9K A;  1G5U A;  3T12 B;  1CF0 A;  2ZL1 B;  2JKF A;  3T1X A;  4FTX A;  3UB5 P;  3MSH A;  3NUL A;  3CHW P;  2V8C A;  3MS6 A;  1VET A;  3LGO A;  1FIK A;  4QWO A;  3DAV A;  1YPR A;  1PNE A;  3T1S A;  3LEQ A;  1HLU P;  1VEU B;  2ACG A;  2E8J A;  4X25 A;  4ESP A;  1CJF A; 
#chains in the Genus database with same CATH topology
 1OPX A;  3HLB A;  2M7U A;  2B95 A;  4DXC A;  2Y2I A;  4KEN B;  4NKP A;  2EX9 A;  1QMF A;  3IXD A;  2H0Y A;  4WEJ A;  2XD1 A;  3LCE A;  2JKR I;  5EE8 A;  3KSF A;  4UQI M;  1I5Q A;  3EGD C;  4RX3 A;  1TS6 A;  5CGW A;  1TD5 A;  2W1T B;  3D9Y A;  4F94 A;  4C6Y A;  4P6B A;  2FZ0 A;  3F1P B;  5DKL A;  5J4E A;  1RCJ A;  1GA9 A;  5HDS A;  3BFF A;  2PD7 A;  5F82 A;  4N9L A;  1PWG A;  1G28 A;  5D3O A;  1GHI A;  1EI5 A;  4JGQ A;  3ZQ5 A;  1T19 A;  3F1O A;  3LY4 A;  3BQA A;  4ZRR A;  5KZH A;  4IVI A;  2VGL S;  1UWN X;  3EEA A;  2ZJ9 A;  3BRM A;  1N9N A;  1CF0 A;  1HTZ A;  2Y2P A;  4PM8 A;  5EVI B;  3VP2 A;  1ZG6 A;  1K54 A;  4Q0H A;  4EUV A;  5DF7 A;  4UA7 A;  4MNR A;  3GTC A;  3UB5 P;  3N8S A;  5IU1 A;  4KZ5 A;  4I3I A;  2FH5 A;  4O0P A;  4EBN A;  4E3L A;  3FKW A;  4UA6 A;  2V0U A;  1K57 C;  3NOT C;  4X55 A;  1G6O A;  3S7O A;  3MF0 A;  1QME A;  3BY9 A;  4JPM A;  3VFF A;  4H8R A;  4CLC B;  1IFQ A;  2QHK A;  4ZDX A;  4R70 A;  3QHY A;  1LL5 A;  2QZ6 A;  3V3S A;  3C38 A;  3AGD A;  4NG2 A;  3VSK A;  1OTB A;  1NZU A;  5HDD A;  1S1Y A;  1SDN A;  2XRN A;  3FG8 A;  1PW8 A;  1VB6 A;  4XT2 B;  4X69 A;  1Y28 A;  3LIF A;  2ZL1 A;  4WMC A;  3ZFZ A;  5EV0 A;  4ZTK A;  2BTF P;  1ESI A;  3IX8 A;  2J9O A;  5EVI C;  4B93 A;  3UB9 A;  1LT0 A;  5L07 A;  1IKI A;  1E3U D;  1M40 A;  2XF3 A;  3ITA A;  4Y2F A;  4B88 A;  2QMI A;  2WUQ A;  1GSW A;  5DFY A;  1YLZ A;  4H6J A;  2XDM A;  1IYQ A;  1XJ2 A;  5F1G A;  3F1N B;  2DNS A;  2Q9M A;  4C3Q A;  4CLC C;  2VGJ A;  3G31 A;  4U3T A;  3A3J A;  5A92 A;  1TS8 A;  4GD6 A;  3IH9 A;  2W3E A;  4I38 A;  3FPW A;  2V1Z A;  3MS6 A;  1LI0 A;  2D02 A;  5CGX A;  3DAV A;  4IBX A;  5KSC A;  3O86 A;  3MZE A;  1PZO A;  1MKI A;  2R9X A;  3FWL A;  3CZD A;  1TDL A;  1IOU A;  4L9G A;  2XEP A;  5E43 A;  2ZLY A;  4EES A;  3CI6 A;  3BJN A;  5EVE A;  3SH9 A;  1C3B A;  2J9P A;  2JKG A;  3UDI A;  4WL9 A;  1KGE A;  1I2S A;  2WAF A;  3IX3 A;  3LO7 A;  5CGS A;  2Z2M B;  4L9F A;  5HZH A;  5M19 A;  2WKQ A;  3O5Y A;  3NHQ A;  4O7D A;  4R3A A;  4UAA A;  1DJB A;  2O9A A;  1JWV A;  3CWF A;  2WKH A;  4HHD A;  5LBR A;  2KX6 A;  2VZW A;  3G4P A;  3AGE A;  2PU4 A;  3ITB A;  3QNC A;  4PM7 A;  4JGR A;  2JC7 A;  1JNU A;  1SZV A;  3G2Z A;  4X53 A;  5I94 A;  4LCM A;  3CUE C;  1NLZ A;  1LSV A;  3O87 A;  1VEU A;  5HWT A;  5DF8 A;  3W8K A;  1W7F A;  1K55 A;  1P0Z A;  3FKV A;  4FH2 A;  1ES2 A;  4OOM A;  1LL8 A;  3HVF A;  5GLA A;  2JKF A;  1F9I A;  4OQG A;  4N1H A;  5DF9 A;  4E3M A;  2QPN A;  2Z6C A;  2J8Y A;  4YWZ A;  3LID A;  3GDI A;  4FH4 A;  4HH2 A;  2ZD8 A;  3TE8 A;  1OTD A;  3HJK A;  4G3K A;  5CX7 A;  2J3T D;  4GW9 A;  2A2L A;  1TDG A;  4NXF A;  1ONH A;  5HWW A;  1E4D A;  1F98 A;  3ZHH A;  2ZMF A;  2G7U A;  3UNW A;  3C30 A;  3ZNT A;  1CJF A;  2OAP 1;  3H7W A;  4N92 A;  3P09 A;  1PYY A;  1P9W A;  3LR3 A;  4GN2 A;  4MDZ A;  3KSG A;  5FEF A;  4X1M A;  1GCE A;  3A3F A;  3DTE A;  1YLT A;  1IEL A;  2HP5 A;  3BEB A;  3UPN A;  4ARZ B;  4X68 A;  1AWI A;  1NXY A;  4CLC E;  3QP2 A;  4G3V A;  5EFW A;  3ZNY A;  3BQ8 A;  3RJU A;  1LLB A;  1CEF A;  1Z6F A;  4FSF A;  2GJ3 A;  4L9E A;  1BUE A;  3GV9 A;  3E4P A;  3WWX A;  3BYD A;  3PAG A;  2P9V A;  1MXO A;  2RL3 A;  3IWO A;  1YSQ A;  2IWC A;  1JTG A;  1HD8 A;  3MZD A;  4QHC A;  1AXB A;  4D60 A;  3W4O A;  3S4X A;  1ODV A;  1MWS A;  4R1G A;  4GLQ A;  1PRQ A;  5CTM A;  5F83 A;  3NEC A;  5TGF A;  3V67 A;  3D3O A;  3R7W A;  2W1R A;  4RYE A;  1ERO A;  4MN5 A;  1W5D A;  1SCW A;  1XJ3 A;  1TF1 A;  1BLS A;  2WAD A;  3CG5 A;  2DCF A;  2W27 A;  3OLO A;  3A3D A;  2WKP A;  5MC7 A;  1N9L A;  2MJ6 A;  3M6H A;  5HPI A;  1YMX A;  2ZMA A;  4LRX C;  2PHY A;  4U0X A;  3Q7V B;  3WS0 A;  4DDS A;  2M7V A;  5L09 A;  1FIL A;  3A0S A;  4JGO A;  4LCL A;  3D4F A;  4R23 A;  2PT7 A;  3VOL A;  1H8M A;  5AQA A;  5EPH A;  5TR7 A;  3ZG0 A;  1OT6 A;  2ZC5 B;  1NYY A;  5DTS A;  1VET B;  3TJZ C;  2W3F A;  2CMN A;  4M4X A;  3UB8 A;  1OME A;  3S22 A;  1YAX A;  4ZAM A;  5A90 A;  5EVI D;  2Y2O A;  3VP0 A;  1ZTU A;  2Y59 A;  3E2L A;  3CJM A;  3FYZ A;  2JE5 A;  2ZM0 A;  3LY3 A;  5FQ9 A;  4OQH A;  3W4P A;  1K56 D;  5HAR A;  5HL6 A;  3PYP A;  2XSS A;  3WS5 A;  1T1B A;  3SOI A;  4Y3I A;  2VV6 A;  1ES3 A;  2ZM2 A;  1FOF A;  4OON A;  2EA9 A;  3IX4 A;  1S4S A;  5AQB A;  4CLC D;  3ZG7 B;  3CPT A;  2PYR A;  4MN7 A;  2XK1 A;  4RA7 A;  4NXB A;  1GSV A;  4ETX A;  5G4Y A;  3BM6 A;  5FQI A;  1W8Y A;  3A3E A;  5FQM A;  3V39 A;  3TRC A;  3T1X A;  3PBO A;  2EXA A;  3OOV A;  1ES5 A;  2I9V A;  1FSW A;  3M2J A;  4GOG A;  5F69 A;  3HLD A;  3LIA A;  4IVK A;  5HWV A;  2BLS A;  3LGO A;  4OQI A;  1L0G A;  2D01 A;  4BLM A;  4OPR A;  2W0N A;  4Q0J A;  4OH0 A;  3VV4 A;  2WK0 A;  1ALQ A;  2A24 B;  1SHV A;  1L0E A;  3LUQ A;  5J3W A;  4E04 A;  3DTK A;  1PFL A;  3UME A;  2DRW A;  2KOI A;  4QU3 A;  5HPF A;  5FDS A;  1LSW A;  5IT5 A;  4NET A;  2HDQ A;  4GJ4 A;  4X1L A;  4LPZ A;  5JYP A;  3E4O A;  4EU0 A;  1N4O A;  1FCO A;  3IS2 A;  2EX8 A;  4OLG A;  3N4I A;  5EEC A;  2Y2K A;  2O0Y A;  3IBJ A;  4EW7 A;  5J8X A;  4ZJ3 A;  3ZVT A;  3BFC A;  3HUO A;  4KQR A;  4HI4 A;  2Y2L A;  3JVV A;  1Y54 A;  4DDY A;  4GDB A;  2K7S A;  3VE3 A;  1TVF A;  3DWK A;  1LHY A;  4Y13 A;  4BBT A;  2PRF A;  3HLC A;  4WN5 A;  4S2L A;  4EXO A;  4BEN A;  3LFV A;  4KQO A;  3I7J A;  3WS2 A;  3C8C A;  4KZB A;  1Q2Q A;  2JCH A;  3SS5 A;  4E3O A;  5EVL A;  5HSQ A;  4NK3 A;  2ZL1 B;  3MQO A;  3SH8 A;  4WF0 A;  3G2Y A;  4JBF A;  1K54 C;  2VKS A;  5AQ7 A;  3B33 A;  4HBU A;  3ZYT A;  2A24 A;  2V8C A;  2Z2L B;  4OOL A;  1SDE A;  2CC1 A;  4H6J B;  4BL2 A;  2GX5 A;  3T4Q A;  1L0F A;  3PHY A;  1KOU A;  4D2O A;  2Y2M A;  4EET B;  4MEZ A;  2WZX A;  3ZGA B;  3ZG8 B;  4YIN A;  3C2W A;  5CXW A;  1Q2P A;  4Z1W A;  3BWL A;  2WZZ A;  2ZC7 A;  2H5S A;  2GNX A;  1UWP X;  2HP6 A;  3UY6 A;  5FAQ A;  1IYO A;  3MJQ A;  2H0T A;  3NIA A;  4CPK A;  1ERM A;  2ZC4 B;  1XFN A;  2VJW A;  1PI5 A;  5EM1 A;  3WRT A;  1WA9 A;  3G30 A;  1XA1 A;  4IJG A;  3NOP C;  2PU2 A;  1NYM A;  3OCL A;  4PM6 A;  4Y17 A;  4KZ7 A;  4F3L A;  3RXX A;  1ZG4 A;  3MXQ A;  4JF4 A;  2OOL A;  3QP6 A;  3IHA A;  4S2N A;  1J3W A;  4EEP A;  4B4X A;  3BY8 A;  3MMH A;  4S2O A;  3OPR A;  4MBH A;  2XA7 M;  4EV4 A;  3O3V A;  4Y0T A;  4HOI A;  3HUN A;  1O7E A;  1MY8 A;  3EQV A;  2VEA A;  4Y0O A;  4B9O A;  4KZ8 A;  1XP4 A;  3GRJ A;  2OV5 A;  3V50 A;  4Z9Q A;  2ZOI A;  4QJG A;  3P7N A;  1FCN A;  1YSP A;  3OPH A;  2L0W A;  4KZ3 A;  4K91 A;  2R78 A;  1YLY A;  1BSG A;  1V9Z A;  3ULF A;  3IWI A;  2WGI A;  1ERQ A;  1YQS A;  3QP1 A;  1W63 Q;  1YPR A;  2EX2 A;  3NDE A;  3RTY A;  5DVA A;  3N8L A;  1VEU B;  2ACG A;  3BFE A;  5GL9 A;  2E8J A;  2W3D A;  1K6R A;  3TW8 A;  3G32 A;  2ZOH A;  4R4S A;  4OVD A;  3SZT A;  4KG5 A;  3UDF A;  4O01 A;  1NZO A;  4ZJ1 A;  1MWT A;  2XRO A;  5GHZ A;  4IBR A;  2ZBB A;  5U47 A;  2EWV A;  2O9B A;  2EX6 A;  3BLS A;  3JPU A;  4E3K A;  2EFU A;  2Q0O A;  1KGF A;  3IF5 A;  4PMA A;  4XXR A;  5HDC A;  2G2W A;  5FQQ A;  5BOH A;  4MBF A;  3Q7Z A;  2Y55 A;  1LSX A;  5CHM A;  5F1F A;  2YKF A;  3SW1 A;  3H7W B;  4K08 A;  1K0K A;  4OOY A;  2VA0 A;  3OZH A;  3NOU C;  2V0W A;  1OTE A;  1CI9 A;  3E2K A;  3UMD A;  3UO9 A;  1CQA A;  5EOE A;  1K55 C;  1BUL A;  1NWZ A;  1VM1 A;  1G5U A;  2HGV A;  3T12 B;  4R38 A;  3C5A A;  5KIZ A;  4JLF A;  5CEC A;  1FR6 A;  3OBF A;  1OTA A;  5HW3 A;  2PD8 A;  4EER A;  3S7P A;  4R0Q A;  2HP9 A;  1YLP A;  4LLO B;  2JBF A;  4EEU A;  2P9V B;  1FIK A;  3OPL A;  1W79 A;  3Q82 A;  1DP9 A;  3DBA A;  4WZ5 A;  5TFQ A;  2EXB A;  3UE1 A;  1S67 L;  4DMZ A;  1SKF A;  1MC0 A;  5E2F A;  3R7W B;  1MWU A;  2W3H A;  2RCX A;  5EM0 A;  1I2W A;  3K3C A;  4HH3 A;  2FFF B;  3SH7 A;  1XX2 A;  4P6Z M;  2R9W A;  3OPP A;  3M2K A;  3CUE A;  3HLG A;  4PM5 A;  4WEK A;  3CAX A;  3ZG9 B;  3VMA A;  2BAS A;  2HDR A;  2QJ5 A;  3PR6 A;  3IXH A;  3V3R A;  2AVX A;  3DTM A;  1H8Y A;  1ACF A;  3NBL A;  3BLM A;  4FUW A;  3FPV A;  4BJP A;  2X71 A;  2PBD P;  4GHI A;  1Z09 A;  4GNU A;  4LFU A;  1K6S A;  4OKP A;  3JYI A;  3PTE A;  4DE1 A;  5L2F A;  5A93 A;  1VHM A;  2PDR A;  4ME4 A;  1D06 A;  5HAP A;  2V1B A;  4EBP A;  2LB5 A;  4KUK A;  3L9K A;  3BW6 A;  5CTN A;  4M3K A;  2JN7 A;  2K31 A;  2HJ9 C;  1KGG A;  1L3L A;  4QD4 A;  1V9Y A;  1XGJ A;  4FTX A;  2X02 A;  4HJ4 A;  4GD8 A;  3NY4 A;  2ZMV A;  4IHQ A;  3Q07 A;  2J7V A;  3EEH A;  3T1S A;  4Y0U A;  4KZ6 A;  4Y7P A;  4UHU A;  3CPT B;  4DJ2 A;  4HJ6 A;  3ZCZ A;  1W63 M;  4DN0 A;  2LB9 A;  3PBN A;  2Y2Q A;  5KMW A;  1MWR A;  1BZA A;  4CJN A;  1S6R A;  3LIB A;  5FAP A;  1WYB A;  2OLV A;  1FCM A;  4GDN A;  5FSR A;  4UQI S;  4HBT A;  5E2G A;  1M6K A;  3MXS A;  3QP8 A;  1D7E A;  1H5X A;  2XQZ A;  3T4S A;  3IXB A;  3GVB A;  5DFX A;  3S7Q A;  2OWH A;  3GMW A;  3GSG A;  4WMC D;  2BG1 A;  1GA0 A;  4EQI A;  1S4R A;  5DJU A;  5CED A;  3B3X A;  4AFI A;  1STZ A;  2PAV P;  2Y2J A;  4LV1 A;  5TJJ A;  1E3U A;  2JKT M;  5GHX A;  4WLA A;  4RQ9 A;  2KDK A;  2KLI A;  4P87 A;  1YMS A;  4BQM A;  3U2A A;  1OJG A;  1MBL A;  3C4P A;  2P74 A;  2O9C A;  3PBT A;  4R4R A;  4GKU A;  2VX8 A;  1XGI A;  4WYY A;  2XR0 A;  4C75 A;  3IS2 B;  3KX0 X;  1VQQ A;  3NC8 A;  3E98 A;  4I3A A;  2DMW A;  1PZP A;  4GB7 A;  4P85 A;  4HJ3 A;  4PHT A;  5HL1 A;  3ICY A;  3KYQ A;  4JXS A;  4NEE D;  1LI9 A;  2M1C A;  2JKR M;  1YKD A;  5DTT A;  3BFG A;  1O07 A;  4MBK A;  2INW A;  3TG9 A;  4HEF A;  4OPZ A;  5GLB A;  2HJE A;  1HLU P;  4X56 A;  4RX2 A;  2XFT A;  3BFD A;  1N9O A;  3AGF A;  1BLH A;  3FC7 A;  5A8B A;  4E6W A;  3T4T A;  1W8Q A;  2V8F A;  4JXG A;  4Y15 A;  4MLL A;  1G68 A;  1TEM A;  2VK3 A;  3QP4 A;  4G3W A;  3HRE A;  3Q1F A;  4P0M A;  1SKO A;  1DP6 A;  4HP9 A;  3B42 A;  3RXW A;  5K5B A;  1NLY A;  3N6I A;  4DRT A;  5TBM A;  3CIT A;  1GHP A;  4BBU A;  4HIA A;  2Y8H A;  3NDG A;  3VSL A;  1KDS A;  1X0O A;  3T1R A;  4UEY A;  2ZQ8 A;  1LL9 A;  5HAQ A;  3T4J A;  3UPP A;  1JWP A;  4YNR A;  1H0M A;  1IKG A;  1CEG A;  4HQA A;  2IA2 A;  3MBZ A;  3WRZ A;  4ETZ A;  3P98 A;  4GS9 A;  2NUP C;  1P9R A;  3IF6 A;  3DTI A;  5G4Z A;  3A0V A;  3KSH A;  2JHE A;  2GDN A;  4UA9 A;  2WGW A;  3G35 A;  3EOI A;  4LV3 A;  1FSY A;  2WYX A;  3MQQ A;  5FAO A;  3HL9 A;  4EQ1 A;  4DE0 A;  5JYO A;  5AJG A;  1BYW A;  1IYP A;  2W3G A;  1GSX A;  4PAU A;  4GCZ A;  3H9W A;  2G2U A;  2WKI A;  3SS3 A;  3LEZ A;  5L10 A;  4F3L B;  2YKH A;  2GZA A;  1FR1 A;  1S66 L;  2Z6D A;  4ZJ2 A;  1KVM A;  4KG6 A;  2VGK A;  4FCF A;  1GHM A;  1KE3 A;  3G34 A;  5E2H A;  1ZKJ A;  3H82 A;  3LI8 A;  3W4Q A;  2HDU A;  5C5K A;  4N1X A;  3K2N A;  4Q0I A;  4XUZ A;  4I39 A;  3VFH A;  2VV8 A;  4CQH A;  2EFX A;  1DY6 A;  1BLP A;  4R3J A;  2J80 A;  4IED A;  4MCW A;  3GR2 A;  3MR0 A;  3KYE A;  1IYS A;  1XKZ A;  4L0L A;  3QP5 A;  4S2N C;  1Y4O A;  3MQ0 A;  3VE4 A;  2NUT C;  3IWQ A;  4YOF A;  4DKI A;  4DXB A;  5FAT A;  5FQK A;  2V1A A;  4FD8 A;  1ZC2 A;  4Y5F A;  2VLG A;  3HLF A;  1XJ6 A;  5AQ9 A;  2O99 A;  4O8G A;  4HY8 A;  3E0Y A;  4DJ3 A;  3D72 A;  3NJA A;  3WS1 A;  1K4F A;  4WZ4 A;  4NXG A;  4OPY A;  1ONG A;  4IUK A;  4I5S A;  1T1C A;  3CHW P;  4IUH A;  4KZA A;  4LRZ E;  4P6Z S;  2A3U A;  1K57 A;  3LEQ A;  3UE3 A;  4E3I A;  3MFD A;  4OPQ A;  2W1T A;  3RFB A;  3UB6 A;  2QWS A;  2PYP A;  2P7J A;  2ZQD A;  2H28 A;  1A0K A;  3UN7 A;  4LV0 A;  1CK3 A;  4DE3 A;  3F1P A;  3EGX C;  3LR0 A;  4JF6 A;  4DF6 A;  1F5M A;  3R4K A;  3SS4 A;  2UWX A;  3VOZ A;  4N9K A;  1K38 A;  5GLD A;  2A49 A;  2FFY A;  5KSH A;  5EOO A;  3GEC A;  4WBG A;  3HJI A;  3C7U A;  3ZG5 A;  1N9B A;  5AVE A;  5AVF A;  4S2M A;  3MXR A;  3MZF A;  2WGV A;  1PWC A;  3MFX A;  1F2K A;  5EVI A;  5EUA A;  1S1Z A;  4KZ9 A;  1KE0 A;  3BEC A;  1T1A A;  3PBS A;  3HBR A;  1K56 A;  2Y4A A;  4YFM A;  1IEM A;  3TOI A;  4E3N A;  4S2I A;  3W2Z A;  4JXW A;  3PXP A;  4DE2 A;  4S2K A;  1E25 A;  2WAE A;  4CLC A;  4BMW A;  2QYB A;  3ZDJ A;  1NY0 A;  1EW0 A;  2L1M A;  3T4O A;  2V20 A;  3N8R A;  1BTL A;  4ZBE A;  5FAS A;  1PWD A;  5F68 A;  1ES4 A;  2IWD A;  3Q81 A;  1NJ4 A;  1L0D A;  2ZC6 B;  2P08 A;  5GLC A;  4BD0 A;  1HVB A;  4GHI B;  4EUZ A;  1JVJ A;  4QWO A;  3C4O A;  4R3B A;  3LYX A;  4XT2 A;  2VGL M;  5M18 A;  3OCN A;  1PNE A;  4JKT A;  2QJ7 A;  4WZ5 C;  4PPR A;  4EBL A;  3MKF A;  4OP5 A;  3RH8 B;  1FQG A;  2HPB A;  4OQ0 A;  4OLD A;  1XA7 A;  1KDW A;  2OSU A;  1P97 A;  4JGP A;  2XLN A;  5FI2 A;  1S0W A;  3UE0 A;  3M6B A;  3V5M A;  2PR5 A;  4KG2 A;  3N7W A;  1DJA A;  4I3J A;  2XD5 A;  3PAE A;  3F1N A;  3LIE A;  2ZQA A;  5I5L A;  3P01 A;  2PR6 A;  4B4Z A;  5G18 A;  4K0X A;  1U60 A;  2QKP A;  5F5Y A;  4WM9 A;  2ZM8 A;  4BD1 A;  1BLC A;  1PIO A;  4WUJ A;  4PKY G;  4Q8I A;  1YT4 A;  1K4E A;  2J3W A;  3PBQ A;  3UDX A;  4LV2 A;  3O88 A;  3T50 A;  3EQU A;  3TSG A;  1K25 A;  1NRJ A;  1XPB A;  3QNB A;  5HX9 A;  3NI9 A;  1RGZ A;  2VV7 A;  4ID4 A;  5CHJ A;  1BT5 A;  2Q9N A;  2K2N A;  4JXV A;  2OAQ 1;  3IBR A;  1TS0 A;  1PI4 A;  2B18 A;  1JTD A;  2EWW A;  3E4Q A;  4S2J A;  1UGU A;  3T4L A;  3IH8 A;  5L8M A;  5DTK A;  4XUX A;  3IXG A;  1OTI A;  1DJC A;  3CLO A;  1YLJ A;  1OJ5 A;  4ESP A;  3G6O A;  1DRM A;  3ZVW A;  2Y2N A;  2HV1 A;  5IHV A;  5F6A A;  3UPO A;  2IWB A;  5DKK A;  3VP4 A;  1ESU A;  1RGY A;  3HUM A;  2UV0 E;  5CER A;  4S2P A;  3GQZ A;  3VOY A;  4A5R A;  1XXM A;  2ZQ9 A;  4KZ4 A;  2X01 A;  3VP1 A;  2Y79 A;  1EWZ A;  1WE4 A;  2HDS A;  5CHU A;  2HZ5 A;  2E8I A;  1YM1 A;  3S7N A;  5CEB A;  5CRF A;  1L2S A;  3UE6 A;  4HES A;  4II7 A;  1MKM A;  2WKR A;  4HNB A;  4QY6 A;  4FOF A;  3IT9 A;  3ISG A;  4LGW A;  2V2F F;  4KQD A;  2XGN A;  5HD5 A;  1SKO B;  3DWZ A;  5FL3 A;  1G6A A;  2B02 A;  4MMN A;  4QB8 A;  4QPR A;  5TBM B;  2OLU A;  1WYC A;  3KYZ A;  2OWJ A;  3DW0 A;  4U0T A;  5HAI A;  4JF5 A;  1YLW A;  4LRY C;  4X6T A;  1T18 A;  4NXE A;  2Y2H A;  5IS1 A;  1J9M A;  2PBY A;  2L4R A;  5A91 A;  1PW1 A;  3NCK A;  1H3Q A;  4ARZ A;  4EWF A;  4GS9 B;  5FI6 A;  3IF6 B;  3EWK A;  1CI8 A;  3LIC A;  3IQA A;  2XFS A;  5E2E A;  4PKY A;  4BBV A;  2WGW B;  2HF6 A;  5FQJ A;  5J7E A;  5FI7 A;  4KUO A;  3HCY A;  3FV7 A;  3B47 A;  4K0W A;  4E3J A;  5DJT A;  3HLE A;  4WEL A;  4BL3 A;  1D1J A;  1KVL A;  3K3D A;  3VP3 A;  3KO6 A;  3A3I A;  3U4L P;  3CMZ A;  2V9A A;  1XFQ A;  4HP4 A;  4R6L A;  2ZQC A;  2P04 A;  2ZQ7 A;  2WKE A;  1HZO A;  4OP8 A;  2ZC3 B;  3T1Q B;  4E6X A;  4GZB A;  5GHY A;  3KSI A;  2C6W B;  1MPL A;  4KQQ A;  3S1Y A;  3T4K A;  3UB7 A;  3FZC A;  3HLW A;  3IF6 C;  3H82 B;  5FEG A;  3A0R A;  2I72 A;  3LR4 A;  1ZHH B;  2XA7 S;  2B5R A;  3L7H A;  3MKE A;  2H10 A;  3OC2 A;  4QY5 A;  3WS4 A;  3Q7V A;  1H8Z A;  1NRF A;  3JVU A;  3C7V A;  1MZU A;  1RP5 A;  2XH9 A;  3F1O B;  4PM9 A;  1TS7 A;  5HD3 A;  1XJ4 A;  3IHB A;  4BWI A;  5M1A A;  2JKT I;  2Y91 A;  1KE4 A;  3LI9 A;  3LR5 A;  1OT9 A;  3MSH A;  3NUL A;  1DP8 A;  1VET A;  2J3T C;  3PBR A;  2Y2G A;  5FA7 A;  4RVA A;  5HFO A;  2C5W B;  4LEN A;  1JWZ A;  4X25 A;  5FDH A;  4MN6 A; 
#chains in the Genus database with same CATH homology
 1A0K A;  3CPT B;  1FIL A;  1PFL A;  2V8F A;  2B95 A;  5EVE A;  5EM0 A;  2VK3 A;  5FEF A;  5FDS A;  2JKG A;  4X1M A;  1SKO A;  1D1J A;  4X1L A;  1VET B;  1AWI A;  3U4L P;  3T1R A;  2ZL1 A;  1F2K A;  2HZ5 A;  5EV0 A;  5EM1 A;  2BTF P;  3D9Y A;  3T1Q B;  2PAV P;  3KYE A;  1ACF A;  4FUW A;  1K0K A;  1Y4O A;  1J3W A;  2PBD P;  1SZV A;  5FEG A;  1Z09 A;  1SKO B;  2PRF A;  3L7H A;  4D60 A;  1PRQ A;  1VEU A;  1CQA A;  3NEC A;  3CPT A;  3L9K A;  1G5U A;  3T12 B;  1CF0 A;  2ZL1 B;  2JKF A;  3T1X A;  4FTX A;  3UB5 P;  3MSH A;  3NUL A;  3CHW P;  2V8C A;  3MS6 A;  1VET A;  3LGO A;  1FIK A;  4QWO A;  3DAV A;  1YPR A;  1PNE A;  3T1S A;  3LEQ A;  1HLU P;  1VEU B;  2ACG A;  2E8J A;  4X25 A;  4ESP A;  1CJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...