3CPTA

Mp1-p14 scaffolding complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
119
Chain Sequence
DDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase 1-interacting protei
publication title Molecular dynamics-solvated interaction energy studies of protein-protein interactions: the MP1-p14 scaffolding complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 36
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08923 MAPKK1_Int Mitogen-activated protein kinase kinase 1 interacting
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3cptA00
5EV0A 1D1JA 2PBDP 2V8FA 3NECA 2VK3A 3T1XA 3D9YA 1SKOB 1G5UA 3LGOA 1VETA 3U4LP 1VETB 3MSHA 2ZL1A 2ZL1B 3T12B 1Y4OA 3T1QB 2V8CA 3T1SA 3UB5P 3L9KA 4FUWA 2HZ5A 2BTFP 5FEGA 3DAVA 3LEQA 3NULA 2E8JA 1SKOA 4D60A 1ACFA 2B95A 1CQAA 3T1RA 1AWIA 1J3WA 3MS6A 2PRFA 4X1LA 5EM1A 1CF0A 4ESPA 1HLUP 2ACGA 3CPTA 3CPTB 2JKFA 1FIKA 5EM0A 1VEUB 1Z09A 4FTXA 1PFLA 5FDSA 1K0KA 4QWOA 1SZVA 3KYEA 1F2KA 1PNEA 2PAVP 3L7HA 4X25A 4X1MA 5EVEA 1A0KA 1CJFA 1VEUA 1FILA 3CHWP 5FEFA 2JKGA 1YPRA 1PRQA
chains in the Genus database with same CATH superfamily
4C75A 1XFNA 4P0MA 4WUJA 3UPNA 1NRFA 2UV0E 1SHVA 2V8FA 1KGEA 4EERA 5FDHA 3E2LA 3D4FA 5DJUA 1S0WA 1VETB 3ISGA 3T4TA 2JCHA 1ERMA 2EFXA 3ZCZA 1NWZA 4X55A 3CLOA 4JF4A 2V1BA 3UB5P 3KSIA 3SH9A 3UE3A 1UWNX 1FCNA 2WAEA 2ZC3B 1HD8A 2V2FF 1FCMA 3Q81A 5DF8A 5F6AA 1CQAA 2OLUA 3PHYA 3HUNA 3SH7A 4LENA 4BL3A 2PYPA 1J3WA 3VSKA 3PTEA 3VSLA 5F1GA 1IOUA 4KZ3A 3BJNA 3UPPA 4HEFA 5EVID 3ZHHA 2HGVA 1N9LA 4NEED 2EX8A 2H0YA 2Y2QA 2FH5A 4WZ5A 3VFHA 2W0NA 5DFYA 3F1OB 4OP8A 1N9OA 2B02A 2QPNA 3ZG7B 1XJ4A 3WRZA 4OPYA 1W7FA 4LV3A 4H8RA 3VP0A 1YAXA 4MN6A 4Z9QA 1ESUA 1XGJA 5A8BA 1K38A 4X1MA 3WS1A 1LSVA 3RJUA 5D3OA 5EVEA 2JC7A 3BQAA 1IFQA 4JBFA 3LIEA 5AQ9A 3TE8A 3CHWP 3S22A 2JKGA 4PHTA 4PKYA 1DP6A 3ZNTA 3IXHA 1ALQA 4F3LB 3NOTC 2P08A 3UNWA 4I38A 1L3LA 2ZQAA 1OT9A 3LGOA 3NDGA 4ETXA 3AGFA 5DJTA 4JGRA 1CI8A 1T1AA 4OQ0A 3VE4A 1XPBA 3BW6A 4WF0A 2MJ6A 1NLZA 2ZM0A 3QNBA 4BWIA 5FQMA 2G7UA 4OQIA 4ZRRA 2H0TA 4DRTA 3ZQ5A 4DMZA 2EXAA 5FSRA 1JVJA 4JXSA 1V9YA 2HV1A 4R4RA 4GB7A 3PBOA 2KLIA 2Y59A 3MJQA 5E2HA 1BYWA 4BENA 4KQQA 2HJ9C 3QP5A 2VZWA 4FTXA 2VKSA 1T1CA 2IWCA 1ESIA 3CUEC 4QWOA 4WELA 3GVBA 5FQ9A 5F5YA 1MBLA 1IKGA 1H8YA 4QD4A 2WK0A 2W3GA 3V3RA 4HBTA 1PZPA 1AXBA 4NETA 2WUQA 3BECA 1OMEA 4HP4A 2WZXA 3UPOA 4Y7PA 2JKRI 1XKZA 5TBMB 4WYYA 4YNRA 2ZJ9A 3PR6A 1I2SA 2GZAA 2HDQA 4P6ZS 1CEFA 5AQAA 1F9IA 3TJZC 3ZYTA 4DDSA 3LO7A 4OQGA 2D02A 5HPFA 2X01A 5DKLA 4UAAA 1OJGA 3R4KA 5E43A 3HJIA 2VA0A 4GD8A 1JWVA 1K4FA 4KZAA 2PHYA 2X71A 3N8SA 1KE4A 5FL3A 2ZC4B 2E8JA 2L4RA 3N4IA 1DJBA 4ID4A 2B95A 4S2LA 3MKFA 4CLCC 4P85A 4GW9A 5M19A 4HESA 1YLTA 4HJ6A 1SKFA 4EEPA 3LR4A 4KZ4A 1JTDA 4PAUA 4I3IA 3UMDA 4R70A 2W1TA 2YKHA 4YOFA 3C7VA 1K4EA 1MWTA 2BASA 5J4EA 2L1MA 1K55C 3C38A 1PW1A 3KYEA 2OWJA 2ZQ8A 1ERQA 1TS0A 2V0UA 2HPBA 4B93A 5A93A 4DF6A 4Y0TA 3IX3A 2ZLYA 4DE3A 3SS5A 3IQAA 1PIOA 4LLOB 3VOYA 2W3HA 4ME4A 3GRJA 3N7WA 3N8RA 5HAQA 1M40A 5GLCA 3RTYA 2ZMFA 2NUPC 3W4OA 3P7NA 4S2KA 4GDNA 4S2NC 2WKQA 5EOEA 1BUEA 2OV5A 2WAFA 4Q8IA 4XT2A 1GCEA 1Y4OA 3Q1FA 1S1ZA 2ZC5B 1P97A 4QHCA 3V3SA 4DXCA 1OTBA 4Y15A 3LI8A 2PU4A 3NULA 1WE4A 1YM1A 1F98A 1XJ2A 2VV8A 5HL6A 4PMAA 1BSGA 1ZG4A 5IHVA 5DFXA 1WYBA 1K57A 2J9OA 3BLMA 1RCJA 3PBSA 1YQSA 3MQOA 4KQDA 1CF0A 3MMHA 4MNRA 2M7VA 1KOUA 1PI5A 4S2JA 4WLAA 3S7OA 1ZC2A 4MDZA 4JKTA 2R78A 2WGIA 3BQ8A 3W4QA 3MXQA 5TR7A 2CC1A 4KG2A 1NZOA 1NJ4A 4ZAMA 4CLCE 2QJ7A 3BY8A 4QPRA 4R23A 2J8YA 5L2FA 3QNCA 4XUZA 4WMCD 3KSHA 1TS6A 1LLBA 2HJEA 3O88A 4NKPA 5KZHA 4U3TA 4NXGA 4L9GA 1H0MA 3BWLA 2HP6A 3T4SA 3VFFA 1FILA 3HLFA 2UWXA 3OCNA 3G4PA 5FEFA 4Y2FA 5CEDA 1MKIA 1PRQA 4HBUA 2Y2LA 2XF3A 3R7WA 3VOZA 4DKIA 2Y79A 2KX6A 3SS4A 3NECA 2VK3A 1PWCA 1IYOA 1TD5A 1G5UA 1TF1A 4BQMA 3ULFA 5M18A 2GDNA 5EUAA 3KSFA 1BT5A 1VB6A 3UDXA 3DAVA 4PKYG 1FR6A 1KE0A 1OTEA 4KQRA 1KE3A 4I3JA 1T19A 3OPLA 1NYYA 3C4PA 4K08A 4O8GA 1CK3A 4G3WA 3CJMA 3OCLA 3B42A 2WGVA 4DE2A 3BFEA 1VQQA 4OOLA 4ZDXA 1XA1A 2W1TB 3PBNA 1FIKA 3N6IA 1Q2QA 3BFGA 2XFSA 1T18A 2P74A 1K56A 4BL2A 2EFUA 1RP5A 3OC2A 3TSGA 3O3VA 3HJKA 3RXWA 1ES3A 1RGYA 3UB9A 2V0WA 1UGUA 4CLCD 1G28A 1A0KA 1TS8A 3DWKA 3BFDA 1KVLA 1NXYA 3KX0X 4N1HA 4UQIS 3K3DA 3OBFA 1CI9A 3OZHA 5F83A 4C3QA 2E8IA 3EOIA 4DE1A 3P01A 2J3TD 2XSSA 1K56D 4BMWA 3DW0A 3HLEA 2PD8A 4NG2A 3FWLA 3NJAA 4GN2A 5EVLA 2Q9NA 3V39A 3M6BA 2Y2OA 4EEUA 3OPHA 4XT2B 2XQZA 1ONGA 4A5RA 1FSWA 2V8CA 4R4SA 3M6HA 1PI4A 2JKTI 5G18A 5HD3A 4Y3IA 1X0OA 5L8MA 4S2IA 2Q0OA 1MWRA 2B18A 2ZBBA 4OKPA 5EVIA 3IXGA 5CTMA 2J9PA 2EX2A 3ZG9B 1LI9A 2XH9A 4E3NA 4S2PA 1P9WA 4MBKA 3TRCA 2AVXA 3HUMA 3IF5A 2W1RA 2P9VA 1E3UA 5GL9A 3D3OA 3PAEA 2OAQ1 1S6RA 3KYZA 4O7DA 2XDMA 2IWBA 4B9OA 1TDGA 3C30A 2Z6CA 2PR6A 1ZTUA 3IHBA 1P0ZA 2X02A 3HREA 4K91A 4WZ4A 4GKUA 1OTDA 4P6ZM 3R7WB 1E3UD 4GDBA 3BFCA 1BTLA 4Q0IA 3IS2A 4LCMA 4R38A 4EBNA 5HL1A 3JYIA 3B3XA 4FH4A 3MFXA 2ZOHA 3Q7VA 4D2OA 2Z6DA 3A0RA 4N1XA 3LY3A 1FSYA 4DE0A 3UE6A 3LYXA 1L0FA 1ACFA 4OOMA 4GNUA 2H10A 3G2ZA 2I72A 4E3LA 3IWQA 5A92A 1KVMA 3HLWA 4GJ4A 4OP5A 2Y2MA 4DDYA 3WS4A 2O9AA 5HFOA 3P09A 4M4XA 2VJWA 4LRYC 1BLHA 2XA7S 4GZBA 1ES4A 5GLDA 4GHIB 2Y2HA 5F82A 1K0KA 4E3OA 3UMEA 1NRJA 2WGWA 3A3JA 2PAVP 2EWVA 1ZHHB 3ZGAB 1K57C 1VHMA 5FQIA 4MN5A 1TEMA 3QP8A 2WYXA 3WS5A 3C7UA 4PM6A 4EUZA 2EWWA 2QJ5A 3VOLA 3T4KA 5EV0A 1L2SA 3CMZA 4B88A 3HUOA 2JE5A 2Y2PA 4EWFA 2QHKA 2JN7A 5HARA 4MN7A 1I2WA 2KOIA 5G4ZA 2XLNA 3UY6A 1FQGA 1KGGA 3F1NA 3QP1A 4GD6A 4BLMA 3TOIA 1DJAA 3V5MA 5FASA 4NXEA 4LFUA 1BLCA 3MF0A 5JYPA 1H8MA 2ZMAA 3FYZA 3HLDA 3WS0A 3RFBA 5HX9A 1D06A 4MEZA 5EVIB 4HIAA 1K25A 3S7NA 4KENB 4BJPA 1PYYA 4U0TA 1XJ6A 4Y13A 3WWXA 3JVVA 4FSFA 1PWDA 1LL9A 2VLGA 5IS1A 4JPMA 2QWSA 2G2UA 2O9BA 4RYEA 4G3KA 3BEBA 4RQ9A 5F69A 2P9VB 2FFFB 4XUXA 2ZQ9A 4ZJ2A 5GHXA 1K54A 4E3KA 4EETB 2VX8A 1STZA 4NXFA 3S7QA 1KDSA 4MCWA 4GS9B 3Q82A 1XJ3A 1ZKJA 2I9VA 2HDRA 3NDEA 1BULA 2QYBA 2VV6A 3MZDA 5DTKA 4KUOA 1S1YA 4RA7A 2V20A 3VP4A 1D1JA 2C5WB 2CMNA 4YFMA 2HP5A 3A3FA 1YT4A 3GV9A 3IS2B 4HOIA 2A49A 2PT7A 2XFTA 3LIFA 3MSHA 3MR0A 3UDFA 3CAXA 4LV2A 4HI4A 5TFQA 4KZ5A 3PXPA 5J3WA 3Q7VB 2OWHA 1OTAA 1YLYA 4FUWA 2XRNA 4HJ4A 3G32A 1W63M 3LR0A 1U60A 4CPKA 5CHJA 3DWZA 1PWGA 3IX8A 1KGFA 1MPLA 5EFWA 4B4XA 2LB9A 1YLJA 1XFQA 3QP2A 1E4DA 3T1RA 2XEPA 5FAPA 2IWDA 2Y91A 1HTZA 3CPTA 3CZDA 2Y2IA 4IVKA 1MWSA 1Z09A 2D01A 3N8LA 1G6OA 3UB8A 1NY0A 3UB6A 3PBQA 3HL9A 5KSHA 5GLBA 4LV1A 4WMCA 1XX2A 5CGXA 5EOOA 1YMSA 2OSUA 3IH8A 3IBJA 3OPPA 3OPRA 1L0DA 3NI9A 2WGWB 1GA0A 1MKMA 3UO9A 2R9WA 1G68A 5EVIC 3S1YA 4UQIM 2INWA 4OLGA 5KSCA 4X53A 1QMFA 2WKRA 3EWKA 3G34A 2JKRM 3E4QA 3QP4A 1IELA 4UEYA 3UE0A 3FPWA 2LB5A 4WEKA 1S66L 4M3KA 3HLBA 4E6WA 2NUTC 1MXOA 3CUEA 4IBXA 3BY9A 5EECA 3IBRA 3KO6A 2HDUA 3S4XA 4II7A 3OLOA 3BFFA 5FI2A 5FQJA 3F1NB 3U4LP 4CQHA 4EBPA 1GSXA 1JTGA 5CEBA 4K0XA 4Y0UA 5HDCA 4WZ5C 2BTFP 3G30A 3M2JA 4JXVA 2ZQCA 2WKIA 5FAOA 1OT6A 3G2YA 5L10A 5C5KA 5A91A 5L07A 3NOUC 2VGJA 2XD5A 3DTEA 3IWOA 4OPZA 1NLYA 1D7EA 3UN7A 1EROA 3BM6A 4HP9A 4MMNA 2VGKA 3E4PA 2HF6A 2PDRA 1YKDA 3A3IA 3NCKA 3T4QA 3E4OA 3LICA 1PFLA 1S4RA 3U2AA 5HWVA 3QP6A 4WN5A 4Q0HA 3IHAA 3T4OA 2OOLA 1PNEA 4CLCA 4I5SA 2ZD8A 3EQVA 4PM8A 3MXSA 3GQZA 4FH2A 4S2OA 4WL9A 2GJ3A 1O7EA 5CX7A 2EA9A 4DXBA 4GHIA 2QMIA 1V9ZA 1YPRA 1XGIA 2ZC7A 5TGFA 3IT9A 1LL8A 2VGLS 5E2FA 3T50A 4EW7A 4ZJ3A 5J7EA 1LI0A 1K55A 1HVBA 3EGDC 1GHMA 4EQ1A 1SKOB 3UB7A 1H8ZA 2XD1A 3EQUA 4QJGA 5IU1A 2WKEA 3O5YA 1E25A 2ZL1A 2Y2KA 2G2WA 4OVDA 3HVFA 1L0GA 5J8XA 2R9XA 4UA7A 1T1BA 1OPXA 4Y5FA 4ZTKA 3PBTA 3SOIA 4KG5A 4I3AA 4JF6A 2JBFA 4DJ2A 2ZQ7A 2RL3A 3W4PA 2W3FA 3NIAA 4E3MA 4B4ZA 4R0QA 1DP8A 3V50A 3MXRA 5GHYA 5HDSA 1EW0A 2J3WA 2IA2A 2XA7M 4UA6A 3CPTB 2A24A 1LT0A 1W8YA 4LCLA 2ZQDA 2Y2NA 1VEUB 2PD7A 1TDLA 1F5MA 5FDSA 1TVFA 4ARZA 3A3EA 3LI9A 3LIAA 1IKIA 1J9MA 4N9KA 1W8QA 3IF6A 2GNXA 5CHMA 4EQIA 4JGQA 1CJFA 3FC7A 3EEAA 4X68A 5M1AA 3H7WA 1DJCA 5CXWA 3LCEA 5HDDA 1G6AA 3MQ0A 3O87A 2PYRA 4EU0A 4YWZA 2FFYA 2WADA 1RGZA 4LGWA 3MZEA 4GS9A 4QU3A 3T1XA 1MZUA 3MZFA 5KMWA 1K54C 4EV4A 1M6KA 4UHUA 4QY5A 2W27A 4U0XA 4E3JA 3T12B 3EEHA 1PZOA 2Y8HA 3V67A 4FOFA 2HZ5A 2P7JA 2ZOIA 2B5RA 4LPZA 3FKWA 4LRXC 5FI7A 3ZVWA 3KSGA 3F1PB 4D60A 4L0LA 3BRMA 2WZZA 3GSGA 1Y54A 5HW3A 3TG9A 1BLSA 1YSPA 4X1LA 4DJ3A 5LBRA 2ACGA 3OOVA 2ZM8A 1NZUA 2A3UA 2J7VA 4JXGA 3A0VA 4OONA 4IUKA 4X6TA 2EX9A 3G6OA 3LR3A 4MBHA 5CTNA 5DF9A 4IUHA 4N9LA 3UDIA 1SZVA 4K0WA 3ITBA 2Z2MB 3WRTA 4E6XA 1N9BA 3L7HA 4CLCB 4BBUA 4BD1A 3Q07A 4GCZA 3W8KA 5E2GA 2XK1A 3P98A 4BBVA 4N92A 1XP4A 4KZ6A 3ZNYA 4RX2A 1FR1A 3GECA 1LL5A 4GLQA 4KZ8A 4ETZA 3JPUA 1MY8A 5CHUA 3IWIA 2VV7A 2PBDP 4X56A 5IT5A 4JGOA 5HZHA 5DTTA 2HP9A 1MWUA 4O0PA 2GX5A 4PM9A 2PR5A 3VP3A 3B33A 3MBZA 4OQHA 1GHIA 2DNSA 1YLZA 1ODVA 2ZL1B 3T1QB 4WM9A 4DN0A 3ZG5A 3H9WA 5CGSA 3T1SA 4L9FA 2JKTM 3HLGA 1DRMA 5BOHA 5FEGA 4QY6A 1ONHA 3LEZA 2PBYA 4Z1WA 5EPHA 2P04A 4KZBA 3SH8A 5L09A 2M1CA 3T4LA 3GDIA 1H3QA 2YKFA 4HJ3A 2XR0A 4H6JB 3SW1A 4C6YA 2WKPA 2PRFA 3QHYA 3ZG8B 1H5XA 3LIBA 3PBRA 2A24B 4WEJA 5HWWA 2O9CA 5JYOA 2Z2LB 3A3DA 3FV7A 4ARZB 1S67L 3ZVTA 3DTMA 1F2KA 4LRZE 1FCOA 4JLFA 2O99A 3I7JA 3K3CA 3IF6B 5FATA 2ZM2A 2C6WB 3G31A 3Q7ZA 3SZTA 4R1GA 4KQOA 3HCYA 2BG1A 5DVAA 4MBFA 3H7WB 5DF7A 3LR5A 1C3BA 2OAP1 3H82A 2DRWA 1GA9A 3NBLA 5KIZA 3LY4A 3NC8A 1YLPA 3BYDA 5FA7A 3D9YA 1MC0A 2M7UA 5TJJA 4IJGA 4OH0A 1NYMA 3IH9A 2W3EA 3CWFA 3A0SA 3IXBA 1YLWA 1DP9A 1W79A 3C2WA 3L9KA 1LHYA 5U47A 2KDKA 3AGDA 3TW8A 2J3TC 3NHQA 1OJ5A 1ES2A 4CJNA 4EESA 1SKOA 4OLDA 5HPIA 3UE1A 5GLAA 3EGXC 3T4JA 5CECA 3HLCA 4EBLA 1AWIA 4R3JA 5AQ7A 2WKHA 5A90A 4PM7A 1LSWA 5HAPA 3W2ZA 4E3IA 4ESPA 5CRFA 4NK3A 1HLUP 2W3DA 1GSVA 3E98A 4BBTA 1EWZA 4JGPA 2EX6A 3E2KA 1LSXA 1Z6FA 2HDSA 4AFIA 1UWPX 2H28A 5DTSA 3NY4A 5I5LA 5E2EA 3WS2A 3PAGA 5FI6A 3LFVA 3K2NA 3BLSA 1KDWA 2Q9MA 1TS7A 4GOGA 3C4OA 2Y2JA 1Y28A 5AVEA 4IEDA 4KZ7A 1VEUA 4KZ9A 4HY8A 2VGLM 4KG6A 3ICYA 1IYSA 2ZC6B 5FAQA 4HH2A 1N4OA 3LIDA 1ES5A 3C8CA 3ZDJA 2L0WA 2DMWA 2OLVA 3CI6A 3MQQA 5HWTA 4S2MA 1HZOA 1JWPA 1W5DA 2K7SA 5AJGA 4PPRA 3IF6C 3DTKA 3M2KA 4L9EA 1VETA 2J80A 5K5BA 3GTCA 1SDEA 3JVUA 5DKKA 1I5QA 4RX3A 5CGWA 3C5AA 3KYQA 4MLLA 3RXXA 3LEQA 1WYCA 4ZBEA 4IVIA 3LUQA 3FG8A 5I94A 2Y4AA 5HAIA 1GHPA 4P87A 5CERA 1JWZA 1IYPA 2VEAA 1BZAA 1ZG6A 4HH3A 1L0EA 2Y2GA 2ZMVA 1FOFA 2A2LA 4Y17A 4HQAA 1XXMA 5EM1A 3VV4A 5FQKA 3ITAA 4RVAA 5HSQA 4R3BA 4P6BA 2JKFA 4HHDA 3B47A 5EM0A 1K6RA 3F1PA 2PU2A 1BLPA 4BD0A 1WA9A 3G35A 4KUKA 3F1OA 3CITA 3O86A 4Y0OA 2K2NA 1SCWA 3E0YA 2EXBA 3D72A 1JNUA 1VM1A 2RCXA 4X25A 2V9AA 1XA7A 3DBAA 4OOYA 5GHZA 1K6SA 1YSQA 3GR2A 5F1FA 2QKPA 1CEGA 2V1ZA 2JHEA 2XGNA 3H82B 4PM5A 3AGEA 4F3LA 2FZ0A 4OPRA 2V1AA 3FZCA 3CG5A 1N9NA 1DY6A 4EXOA 4JF5A 2DCFA 4R3AA 4R6LA 3FPVA 5G4YA 1QMEA 1S4SA 4FD8A 2XROA 1PW8A 5HD5A 4HNBA 3MFDA 2QZ6A 2BLSA 4O01A 1W63Q 3MKEA 4NXBA 4OPQA 1IYQA 4UA9A 1SDNA 2K31A 1EI5A 4JXWA 3FKVA 3MS6A 5F68A 4EUVA 5EE8A 3DTIA 3PYPA 2Y55A 3NOPC 3VMAA 4I39A 5FQQA 1Q2PA 4E04A 1P9RA 4QB8A 1O07A 3S7PA 4H6JA 4YINA 2O0YA 4S2NA 4WBGA 4X69A 4ZJ1A 4XXRA 4F94A 1YMXA 3VE3A 3SS3A 3ZG0A 5AVFA 3HBRA 4IBRA 4Q0JA 3VP1A 1GSWA 2H5SA 5MC7A 4IHQA 1OTIA 4G3VA 4FCFA 1IEMA 3IXDA 4LV0A 3ZFZA 3IX4A 5AQBA 3VP2A 3GMWA 3RH8B 5TBMA
chains in the Genus database with same CATH topology
5EV0A 1D1JA 2PBDP 2V8FA 3NECA 2VK3A 3T1XA 3D9YA 1SKOB 1G5UA 3LGOA 1VETA 3U4LP 1VETB 3MSHA 2ZL1A 2ZL1B 3T12B 1Y4OA 3T1QB 2V8CA 3T1SA 3UB5P 3L9KA 4FUWA 2HZ5A 2BTFP 5FEGA 3DAVA 3LEQA 3NULA 2E8JA 1SKOA 4D60A 1ACFA 2B95A 1CQAA 3T1RA 1AWIA 1J3WA 3MS6A 2PRFA 4X1LA 5EM1A 1CF0A 4ESPA 1HLUP 2ACGA 3CPTA 3CPTB 2JKFA 1FIKA 5EM0A 1VEUB 1Z09A 4FTXA 1PFLA 5FDSA 1K0KA 4QWOA 1SZVA 3KYEA 1F2KA 1PNEA 2PAVP 3L7HA 4X25A 4X1MA 5EVEA 1A0KA 1CJFA 1VEUA 1FILA 3CHWP 5FEFA 2JKGA 1YPRA 1PRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EV0 A;  1D1J A;  2PBD P;  2V8F A;  3NEC A;  2VK3 A;  3T1X A;  3D9Y A;  1SKO B;  1G5U A;  3LGO A;  1VET A;  3U4L P;  1VET B;  3MSH A;  2ZL1 A;  2ZL1 B;  3T12 B;  1Y4O A;  3T1Q B;  2V8C A;  3T1S A;  3UB5 P;  3L9K A;  4FUW A;  2HZ5 A;  2BTF P;  5FEG A;  3DAV A;  3LEQ A;  3NUL A;  2E8J A;  1SKO A;  4D60 A;  1ACF A;  2B95 A;  1CQA A;  3T1R A;  1AWI A;  1J3W A;  3MS6 A;  2PRF A;  4X1L A;  5EM1 A;  1CF0 A;  4ESP A;  1HLU P;  2ACG A;  3CPT A;  3CPT B;  2JKF A;  1FIK A;  5EM0 A;  1VEU B;  1Z09 A;  4FTX A;  1PFL A;  5FDS A;  1K0K A;  4QWO A;  1SZV A;  3KYE A;  1F2K A;  1PNE A;  2PAV P;  3L7H A;  4X25 A;  4X1M A;  5EVE A;  1A0K A;  1CJF A;  1VEU A;  1FIL A;  3CHW P;  5FEF A;  2JKG A;  1YPR A;  1PRQ A; 
#chains in the Genus database with same CATH topology
 4C75 A;  1XFN A;  4P0M A;  4WUJ A;  3UPN A;  1NRF A;  2UV0 E;  1SHV A;  2V8F A;  1KGE A;  4EER A;  5FDH A;  3E2L A;  3D4F A;  5DJU A;  1S0W A;  1VET B;  3ISG A;  3T4T A;  2JCH A;  1ERM A;  2EFX A;  3ZCZ A;  1NWZ A;  4X55 A;  3CLO A;  4JF4 A;  2V1B A;  3UB5 P;  3KSI A;  3SH9 A;  3UE3 A;  1UWN X;  1FCN A;  2WAE A;  2ZC3 B;  1HD8 A;  2V2F F;  1FCM A;  3Q81 A;  5DF8 A;  5F6A A;  1CQA A;  2OLU A;  3PHY A;  3HUN A;  3SH7 A;  4LEN A;  4BL3 A;  2PYP A;  1J3W A;  3VSK A;  3PTE A;  3VSL A;  5F1G A;  1IOU A;  4KZ3 A;  3BJN A;  3UPP A;  4HEF A;  5EVI D;  3ZHH A;  2HGV A;  1N9L A;  4NEE D;  2EX8 A;  2H0Y A;  2Y2Q A;  2FH5 A;  4WZ5 A;  3VFH A;  2W0N A;  5DFY A;  3F1O B;  4OP8 A;  1N9O A;  2B02 A;  2QPN A;  3ZG7 B;  1XJ4 A;  3WRZ A;  4OPY A;  1W7F A;  4LV3 A;  4H8R A;  3VP0 A;  1YAX A;  4MN6 A;  4Z9Q A;  1ESU A;  1XGJ A;  5A8B A;  1K38 A;  4X1M A;  3WS1 A;  1LSV A;  3RJU A;  5D3O A;  5EVE A;  2JC7 A;  3BQA A;  1IFQ A;  4JBF A;  3LIE A;  5AQ9 A;  3TE8 A;  3CHW P;  3S22 A;  2JKG A;  4PHT A;  4PKY A;  1DP6 A;  3ZNT A;  3IXH A;  1ALQ A;  4F3L B;  3NOT C;  2P08 A;  3UNW A;  4I38 A;  1L3L A;  2ZQA A;  1OT9 A;  3LGO A;  3NDG A;  4ETX A;  3AGF A;  5DJT A;  4JGR A;  1CI8 A;  1T1A A;  4OQ0 A;  3VE4 A;  1XPB A;  3BW6 A;  4WF0 A;  2MJ6 A;  1NLZ A;  2ZM0 A;  3QNB A;  4BWI A;  5FQM A;  2G7U A;  4OQI A;  4ZRR A;  2H0T A;  4DRT A;  3ZQ5 A;  4DMZ A;  2EXA A;  5FSR A;  1JVJ A;  4JXS A;  1V9Y A;  2HV1 A;  4R4R A;  4GB7 A;  3PBO A;  2KLI A;  2Y59 A;  3MJQ A;  5E2H A;  1BYW A;  4BEN A;  4KQQ A;  2HJ9 C;  3QP5 A;  2VZW A;  4FTX A;  2VKS A;  1T1C A;  2IWC A;  1ESI A;  3CUE C;  4QWO A;  4WEL A;  3GVB A;  5FQ9 A;  5F5Y A;  1MBL A;  1IKG A;  1H8Y A;  4QD4 A;  2WK0 A;  2W3G A;  3V3R A;  4HBT A;  1PZP A;  1AXB A;  4NET A;  2WUQ A;  3BEC A;  1OME A;  4HP4 A;  2WZX A;  3UPO A;  4Y7P A;  2JKR I;  1XKZ A;  5TBM B;  4WYY A;  4YNR A;  2ZJ9 A;  3PR6 A;  1I2S A;  2GZA A;  2HDQ A;  4P6Z S;  1CEF A;  5AQA A;  1F9I A;  3TJZ C;  3ZYT A;  4DDS A;  3LO7 A;  4OQG A;  2D02 A;  5HPF A;  2X01 A;  5DKL A;  4UAA A;  1OJG A;  3R4K A;  5E43 A;  3HJI A;  2VA0 A;  4GD8 A;  1JWV A;  1K4F A;  4KZA A;  2PHY A;  2X71 A;  3N8S A;  1KE4 A;  5FL3 A;  2ZC4 B;  2E8J A;  2L4R A;  3N4I A;  1DJB A;  4ID4 A;  2B95 A;  4S2L A;  3MKF A;  4CLC C;  4P85 A;  4GW9 A;  5M19 A;  4HES A;  1YLT A;  4HJ6 A;  1SKF A;  4EEP A;  3LR4 A;  4KZ4 A;  1JTD A;  4PAU A;  4I3I A;  3UMD A;  4R70 A;  2W1T A;  2YKH A;  4YOF A;  3C7V A;  1K4E A;  1MWT A;  2BAS A;  5J4E A;  2L1M A;  1K55 C;  3C38 A;  1PW1 A;  3KYE A;  2OWJ A;  2ZQ8 A;  1ERQ A;  1TS0 A;  2V0U A;  2HPB A;  4B93 A;  5A93 A;  4DF6 A;  4Y0T A;  3IX3 A;  2ZLY A;  4DE3 A;  3SS5 A;  3IQA A;  1PIO A;  4LLO B;  3VOY A;  2W3H A;  4ME4 A;  3GRJ A;  3N7W A;  3N8R A;  5HAQ A;  1M40 A;  5GLC A;  3RTY A;  2ZMF A;  2NUP C;  3W4O A;  3P7N A;  4S2K A;  4GDN A;  4S2N C;  2WKQ A;  5EOE A;  1BUE A;  2OV5 A;  2WAF A;  4Q8I A;  4XT2 A;  1GCE A;  1Y4O A;  3Q1F A;  1S1Z A;  2ZC5 B;  1P97 A;  4QHC A;  3V3S A;  4DXC A;  1OTB A;  4Y15 A;  3LI8 A;  2PU4 A;  3NUL A;  1WE4 A;  1YM1 A;  1F98 A;  1XJ2 A;  2VV8 A;  5HL6 A;  4PMA A;  1BSG A;  1ZG4 A;  5IHV A;  5DFX A;  1WYB A;  1K57 A;  2J9O A;  3BLM A;  1RCJ A;  3PBS A;  1YQS A;  3MQO A;  4KQD A;  1CF0 A;  3MMH A;  4MNR A;  2M7V A;  1KOU A;  1PI5 A;  4S2J A;  4WLA A;  3S7O A;  1ZC2 A;  4MDZ A;  4JKT A;  2R78 A;  2WGI A;  3BQ8 A;  3W4Q A;  3MXQ A;  5TR7 A;  2CC1 A;  4KG2 A;  1NZO A;  1NJ4 A;  4ZAM A;  4CLC E;  2QJ7 A;  3BY8 A;  4QPR A;  4R23 A;  2J8Y A;  5L2F A;  3QNC A;  4XUZ A;  4WMC D;  3KSH A;  1TS6 A;  1LLB A;  2HJE A;  3O88 A;  4NKP A;  5KZH A;  4U3T A;  4NXG A;  4L9G A;  1H0M A;  3BWL A;  2HP6 A;  3T4S A;  3VFF A;  1FIL A;  3HLF A;  2UWX A;  3OCN A;  3G4P A;  5FEF A;  4Y2F A;  5CED A;  1MKI A;  1PRQ A;  4HBU A;  2Y2L A;  2XF3 A;  3R7W A;  3VOZ A;  4DKI A;  2Y79 A;  2KX6 A;  3SS4 A;  3NEC A;  2VK3 A;  1PWC A;  1IYO A;  1TD5 A;  1G5U A;  1TF1 A;  4BQM A;  3ULF A;  5M18 A;  2GDN A;  5EUA A;  3KSF A;  1BT5 A;  1VB6 A;  3UDX A;  3DAV A;  4PKY G;  1FR6 A;  1KE0 A;  1OTE A;  4KQR A;  1KE3 A;  4I3J A;  1T19 A;  3OPL A;  1NYY A;  3C4P A;  4K08 A;  4O8G A;  1CK3 A;  4G3W A;  3CJM A;  3OCL A;  3B42 A;  2WGV A;  4DE2 A;  3BFE A;  1VQQ A;  4OOL A;  4ZDX A;  1XA1 A;  2W1T B;  3PBN A;  1FIK A;  3N6I A;  1Q2Q A;  3BFG A;  2XFS A;  1T18 A;  2P74 A;  1K56 A;  4BL2 A;  2EFU A;  1RP5 A;  3OC2 A;  3TSG A;  3O3V A;  3HJK A;  3RXW A;  1ES3 A;  1RGY A;  3UB9 A;  2V0W A;  1UGU A;  4CLC D;  1G28 A;  1A0K A;  1TS8 A;  3DWK A;  3BFD A;  1KVL A;  1NXY A;  3KX0 X;  4N1H A;  4UQI S;  3K3D A;  3OBF A;  1CI9 A;  3OZH A;  5F83 A;  4C3Q A;  2E8I A;  3EOI A;  4DE1 A;  3P01 A;  2J3T D;  2XSS A;  1K56 D;  4BMW A;  3DW0 A;  3HLE A;  2PD8 A;  4NG2 A;  3FWL A;  3NJA A;  4GN2 A;  5EVL A;  2Q9N A;  3V39 A;  3M6B A;  2Y2O A;  4EEU A;  3OPH A;  4XT2 B;  2XQZ A;  1ONG A;  4A5R A;  1FSW A;  2V8C A;  4R4S A;  3M6H A;  1PI4 A;  2JKT I;  5G18 A;  5HD3 A;  4Y3I A;  1X0O A;  5L8M A;  4S2I A;  2Q0O A;  1MWR A;  2B18 A;  2ZBB A;  4OKP A;  5EVI A;  3IXG A;  5CTM A;  2J9P A;  2EX2 A;  3ZG9 B;  1LI9 A;  2XH9 A;  4E3N A;  4S2P A;  1P9W A;  4MBK A;  3TRC A;  2AVX A;  3HUM A;  3IF5 A;  2W1R A;  2P9V A;  1E3U A;  5GL9 A;  3D3O A;  3PAE A;  2OAQ 1;  1S6R A;  3KYZ A;  4O7D A;  2XDM A;  2IWB A;  4B9O A;  1TDG A;  3C30 A;  2Z6C A;  2PR6 A;  1ZTU A;  3IHB A;  1P0Z A;  2X02 A;  3HRE A;  4K91 A;  4WZ4 A;  4GKU A;  1OTD A;  4P6Z M;  3R7W B;  1E3U D;  4GDB A;  3BFC A;  1BTL A;  4Q0I A;  3IS2 A;  4LCM A;  4R38 A;  4EBN A;  5HL1 A;  3JYI A;  3B3X A;  4FH4 A;  3MFX A;  2ZOH A;  3Q7V A;  4D2O A;  2Z6D A;  3A0R A;  4N1X A;  3LY3 A;  1FSY A;  4DE0 A;  3UE6 A;  3LYX A;  1L0F A;  1ACF A;  4OOM A;  4GNU A;  2H10 A;  3G2Z A;  2I72 A;  4E3L A;  3IWQ A;  5A92 A;  1KVM A;  3HLW A;  4GJ4 A;  4OP5 A;  2Y2M A;  4DDY A;  3WS4 A;  2O9A A;  5HFO A;  3P09 A;  4M4X A;  2VJW A;  4LRY C;  1BLH A;  2XA7 S;  4GZB A;  1ES4 A;  5GLD A;  4GHI B;  2Y2H A;  5F82 A;  1K0K A;  4E3O A;  3UME A;  1NRJ A;  2WGW A;  3A3J A;  2PAV P;  2EWV A;  1ZHH B;  3ZGA B;  1K57 C;  1VHM A;  5FQI A;  4MN5 A;  1TEM A;  3QP8 A;  2WYX A;  3WS5 A;  3C7U A;  4PM6 A;  4EUZ A;  2EWW A;  2QJ5 A;  3VOL A;  3T4K A;  5EV0 A;  1L2S A;  3CMZ A;  4B88 A;  3HUO A;  2JE5 A;  2Y2P A;  4EWF A;  2QHK A;  2JN7 A;  5HAR A;  4MN7 A;  1I2W A;  2KOI A;  5G4Z A;  2XLN A;  3UY6 A;  1FQG A;  1KGG A;  3F1N A;  3QP1 A;  4GD6 A;  4BLM A;  3TOI A;  1DJA A;  3V5M A;  5FAS A;  4NXE A;  4LFU A;  1BLC A;  3MF0 A;  5JYP A;  1H8M A;  2ZMA A;  3FYZ A;  3HLD A;  3WS0 A;  3RFB A;  5HX9 A;  1D06 A;  4MEZ A;  5EVI B;  4HIA A;  1K25 A;  3S7N A;  4KEN B;  4BJP A;  1PYY A;  4U0T A;  1XJ6 A;  4Y13 A;  3WWX A;  3JVV A;  4FSF A;  1PWD A;  1LL9 A;  2VLG A;  5IS1 A;  4JPM A;  2QWS A;  2G2U A;  2O9B A;  4RYE A;  4G3K A;  3BEB A;  4RQ9 A;  5F69 A;  2P9V B;  2FFF B;  4XUX A;  2ZQ9 A;  4ZJ2 A;  5GHX A;  1K54 A;  4E3K A;  4EET B;  2VX8 A;  1STZ A;  4NXF A;  3S7Q A;  1KDS A;  4MCW A;  4GS9 B;  3Q82 A;  1XJ3 A;  1ZKJ A;  2I9V A;  2HDR A;  3NDE A;  1BUL A;  2QYB A;  2VV6 A;  3MZD A;  5DTK A;  4KUO A;  1S1Y A;  4RA7 A;  2V20 A;  3VP4 A;  1D1J A;  2C5W B;  2CMN A;  4YFM A;  2HP5 A;  3A3F A;  1YT4 A;  3GV9 A;  3IS2 B;  4HOI A;  2A49 A;  2PT7 A;  2XFT A;  3LIF A;  3MSH A;  3MR0 A;  3UDF A;  3CAX A;  4LV2 A;  4HI4 A;  5TFQ A;  4KZ5 A;  3PXP A;  5J3W A;  3Q7V B;  2OWH A;  1OTA A;  1YLY A;  4FUW A;  2XRN A;  4HJ4 A;  3G32 A;  1W63 M;  3LR0 A;  1U60 A;  4CPK A;  5CHJ A;  3DWZ A;  1PWG A;  3IX8 A;  1KGF A;  1MPL A;  5EFW A;  4B4X A;  2LB9 A;  1YLJ A;  1XFQ A;  3QP2 A;  1E4D A;  3T1R A;  2XEP A;  5FAP A;  2IWD A;  2Y91 A;  1HTZ A;  3CPT A;  3CZD A;  2Y2I A;  4IVK A;  1MWS A;  1Z09 A;  2D01 A;  3N8L A;  1G6O A;  3UB8 A;  1NY0 A;  3UB6 A;  3PBQ A;  3HL9 A;  5KSH A;  5GLB A;  4LV1 A;  4WMC A;  1XX2 A;  5CGX A;  5EOO A;  1YMS A;  2OSU A;  3IH8 A;  3IBJ A;  3OPP A;  3OPR A;  1L0D A;  3NI9 A;  2WGW B;  1GA0 A;  1MKM A;  3UO9 A;  2R9W A;  1G68 A;  5EVI C;  3S1Y A;  4UQI M;  2INW A;  4OLG A;  5KSC A;  4X53 A;  1QMF A;  2WKR A;  3EWK A;  3G34 A;  2JKR M;  3E4Q A;  3QP4 A;  1IEL A;  4UEY A;  3UE0 A;  3FPW A;  2LB5 A;  4WEK A;  1S66 L;  4M3K A;  3HLB A;  4E6W A;  2NUT C;  1MXO A;  3CUE A;  4IBX A;  3BY9 A;  5EEC A;  3IBR A;  3KO6 A;  2HDU A;  3S4X A;  4II7 A;  3OLO A;  3BFF A;  5FI2 A;  5FQJ A;  3F1N B;  3U4L P;  4CQH A;  4EBP A;  1GSX A;  1JTG A;  5CEB A;  4K0X A;  4Y0U A;  5HDC A;  4WZ5 C;  2BTF P;  3G30 A;  3M2J A;  4JXV A;  2ZQC A;  2WKI A;  5FAO A;  1OT6 A;  3G2Y A;  5L10 A;  5C5K A;  5A91 A;  5L07 A;  3NOU C;  2VGJ A;  2XD5 A;  3DTE A;  3IWO A;  4OPZ A;  1NLY A;  1D7E A;  3UN7 A;  1ERO A;  3BM6 A;  4HP9 A;  4MMN A;  2VGK A;  3E4P A;  2HF6 A;  2PDR A;  1YKD A;  3A3I A;  3NCK A;  3T4Q A;  3E4O A;  3LIC A;  1PFL A;  1S4R A;  3U2A A;  5HWV A;  3QP6 A;  4WN5 A;  4Q0H A;  3IHA A;  3T4O A;  2OOL A;  1PNE A;  4CLC A;  4I5S A;  2ZD8 A;  3EQV A;  4PM8 A;  3MXS A;  3GQZ A;  4FH2 A;  4S2O A;  4WL9 A;  2GJ3 A;  1O7E A;  5CX7 A;  2EA9 A;  4DXB A;  4GHI A;  2QMI A;  1V9Z A;  1YPR A;  1XGI A;  2ZC7 A;  5TGF A;  3IT9 A;  1LL8 A;  2VGL S;  5E2F A;  3T50 A;  4EW7 A;  4ZJ3 A;  5J7E A;  1LI0 A;  1K55 A;  1HVB A;  3EGD C;  1GHM A;  4EQ1 A;  1SKO B;  3UB7 A;  1H8Z A;  2XD1 A;  3EQU A;  4QJG A;  5IU1 A;  2WKE A;  3O5Y A;  1E25 A;  2ZL1 A;  2Y2K A;  2G2W A;  4OVD A;  3HVF A;  1L0G A;  5J8X A;  2R9X A;  4UA7 A;  1T1B A;  1OPX A;  4Y5F A;  4ZTK A;  3PBT A;  3SOI A;  4KG5 A;  4I3A A;  4JF6 A;  2JBF A;  4DJ2 A;  2ZQ7 A;  2RL3 A;  3W4P A;  2W3F A;  3NIA A;  4E3M A;  4B4Z A;  4R0Q A;  1DP8 A;  3V50 A;  3MXR A;  5GHY A;  5HDS A;  1EW0 A;  2J3W A;  2IA2 A;  2XA7 M;  4UA6 A;  3CPT B;  2A24 A;  1LT0 A;  1W8Y A;  4LCL A;  2ZQD A;  2Y2N A;  1VEU B;  2PD7 A;  1TDL A;  1F5M A;  5FDS A;  1TVF A;  4ARZ A;  3A3E A;  3LI9 A;  3LIA A;  1IKI A;  1J9M A;  4N9K A;  1W8Q A;  3IF6 A;  2GNX A;  5CHM A;  4EQI A;  4JGQ A;  1CJF A;  3FC7 A;  3EEA A;  4X68 A;  5M1A A;  3H7W A;  1DJC A;  5CXW A;  3LCE A;  5HDD A;  1G6A A;  3MQ0 A;  3O87 A;  2PYR A;  4EU0 A;  4YWZ A;  2FFY A;  2WAD A;  1RGZ A;  4LGW A;  3MZE A;  4GS9 A;  4QU3 A;  3T1X A;  1MZU A;  3MZF A;  5KMW A;  1K54 C;  4EV4 A;  1M6K A;  4UHU A;  4QY5 A;  2W27 A;  4U0X A;  4E3J A;  3T12 B;  3EEH A;  1PZO A;  2Y8H A;  3V67 A;  4FOF A;  2HZ5 A;  2P7J A;  2ZOI A;  2B5R A;  4LPZ A;  3FKW A;  4LRX C;  5FI7 A;  3ZVW A;  3KSG A;  3F1P B;  4D60 A;  4L0L A;  3BRM A;  2WZZ A;  3GSG A;  1Y54 A;  5HW3 A;  3TG9 A;  1BLS A;  1YSP A;  4X1L A;  4DJ3 A;  5LBR A;  2ACG A;  3OOV A;  2ZM8 A;  1NZU A;  2A3U A;  2J7V A;  4JXG A;  3A0V A;  4OON A;  4IUK A;  4X6T A;  2EX9 A;  3G6O A;  3LR3 A;  4MBH A;  5CTN A;  5DF9 A;  4IUH A;  4N9L A;  3UDI A;  1SZV A;  4K0W A;  3ITB A;  2Z2M B;  3WRT A;  4E6X A;  1N9B A;  3L7H A;  4CLC B;  4BBU A;  4BD1 A;  3Q07 A;  4GCZ A;  3W8K A;  5E2G A;  2XK1 A;  3P98 A;  4BBV A;  4N92 A;  1XP4 A;  4KZ6 A;  3ZNY A;  4RX2 A;  1FR1 A;  3GEC A;  1LL5 A;  4GLQ A;  4KZ8 A;  4ETZ A;  3JPU A;  1MY8 A;  5CHU A;  3IWI A;  2VV7 A;  2PBD P;  4X56 A;  5IT5 A;  4JGO A;  5HZH A;  5DTT A;  2HP9 A;  1MWU A;  4O0P A;  2GX5 A;  4PM9 A;  2PR5 A;  3VP3 A;  3B33 A;  3MBZ A;  4OQH A;  1GHI A;  2DNS A;  1YLZ A;  1ODV A;  2ZL1 B;  3T1Q B;  4WM9 A;  4DN0 A;  3ZG5 A;  3H9W A;  5CGS A;  3T1S A;  4L9F A;  2JKT M;  3HLG A;  1DRM A;  5BOH A;  5FEG A;  4QY6 A;  1ONH A;  3LEZ A;  2PBY A;  4Z1W A;  5EPH A;  2P04 A;  4KZB A;  3SH8 A;  5L09 A;  2M1C A;  3T4L A;  3GDI A;  1H3Q A;  2YKF A;  4HJ3 A;  2XR0 A;  4H6J B;  3SW1 A;  4C6Y A;  2WKP A;  2PRF A;  3QHY A;  3ZG8 B;  1H5X A;  3LIB A;  3PBR A;  2A24 B;  4WEJ A;  5HWW A;  2O9C A;  5JYO A;  2Z2L B;  3A3D A;  3FV7 A;  4ARZ B;  1S67 L;  3ZVT A;  3DTM A;  1F2K A;  4LRZ E;  1FCO A;  4JLF A;  2O99 A;  3I7J A;  3K3C A;  3IF6 B;  5FAT A;  2ZM2 A;  2C6W B;  3G31 A;  3Q7Z A;  3SZT A;  4R1G A;  4KQO A;  3HCY A;  2BG1 A;  5DVA A;  4MBF A;  3H7W B;  5DF7 A;  3LR5 A;  1C3B A;  2OAP 1;  3H82 A;  2DRW A;  1GA9 A;  3NBL A;  5KIZ A;  3LY4 A;  3NC8 A;  1YLP A;  3BYD A;  5FA7 A;  3D9Y A;  1MC0 A;  2M7U A;  5TJJ A;  4IJG A;  4OH0 A;  1NYM A;  3IH9 A;  2W3E A;  3CWF A;  3A0S A;  3IXB A;  1YLW A;  1DP9 A;  1W79 A;  3C2W A;  3L9K A;  1LHY A;  5U47 A;  2KDK A;  3AGD A;  3TW8 A;  2J3T C;  3NHQ A;  1OJ5 A;  1ES2 A;  4CJN A;  4EES A;  1SKO A;  4OLD A;  5HPI A;  3UE1 A;  5GLA A;  3EGX C;  3T4J A;  5CEC A;  3HLC A;  4EBL A;  1AWI A;  4R3J A;  5AQ7 A;  2WKH A;  5A90 A;  4PM7 A;  1LSW A;  5HAP A;  3W2Z A;  4E3I A;  4ESP A;  5CRF A;  4NK3 A;  1HLU P;  2W3D A;  1GSV A;  3E98 A;  4BBT A;  1EWZ A;  4JGP A;  2EX6 A;  3E2K A;  1LSX A;  1Z6F A;  2HDS A;  4AFI A;  1UWP X;  2H28 A;  5DTS A;  3NY4 A;  5I5L A;  5E2E A;  3WS2 A;  3PAG A;  5FI6 A;  3LFV A;  3K2N A;  3BLS A;  1KDW A;  2Q9M A;  1TS7 A;  4GOG A;  3C4O A;  2Y2J A;  1Y28 A;  5AVE A;  4IED A;  4KZ7 A;  1VEU A;  4KZ9 A;  4HY8 A;  2VGL M;  4KG6 A;  3ICY A;  1IYS A;  2ZC6 B;  5FAQ A;  4HH2 A;  1N4O A;  3LID A;  1ES5 A;  3C8C A;  3ZDJ A;  2L0W A;  2DMW A;  2OLV A;  3CI6 A;  3MQQ A;  5HWT A;  4S2M A;  1HZO A;  1JWP A;  1W5D A;  2K7S A;  5AJG A;  4PPR A;  3IF6 C;  3DTK A;  3M2K A;  4L9E A;  1VET A;  2J80 A;  5K5B A;  3GTC A;  1SDE A;  3JVU A;  5DKK A;  1I5Q A;  4RX3 A;  5CGW A;  3C5A A;  3KYQ A;  4MLL A;  3RXX A;  3LEQ A;  1WYC A;  4ZBE A;  4IVI A;  3LUQ A;  3FG8 A;  5I94 A;  2Y4A A;  5HAI A;  1GHP A;  4P87 A;  5CER A;  1JWZ A;  1IYP A;  2VEA A;  1BZA A;  1ZG6 A;  4HH3 A;  1L0E A;  2Y2G A;  2ZMV A;  1FOF A;  2A2L A;  4Y17 A;  4HQA A;  1XXM A;  5EM1 A;  3VV4 A;  5FQK A;  3ITA A;  4RVA A;  5HSQ A;  4R3B A;  4P6B A;  2JKF A;  4HHD A;  3B47 A;  5EM0 A;  1K6R A;  3F1P A;  2PU2 A;  1BLP A;  4BD0 A;  1WA9 A;  3G35 A;  4KUK A;  3F1O A;  3CIT A;  3O86 A;  4Y0O A;  2K2N A;  1SCW A;  3E0Y A;  2EXB A;  3D72 A;  1JNU A;  1VM1 A;  2RCX A;  4X25 A;  2V9A A;  1XA7 A;  3DBA A;  4OOY A;  5GHZ A;  1K6S A;  1YSQ A;  3GR2 A;  5F1F A;  2QKP A;  1CEG A;  2V1Z A;  2JHE A;  2XGN A;  3H82 B;  4PM5 A;  3AGE A;  4F3L A;  2FZ0 A;  4OPR A;  2V1A A;  3FZC A;  3CG5 A;  1N9N A;  1DY6 A;  4EXO A;  4JF5 A;  2DCF A;  4R3A A;  4R6L A;  3FPV A;  5G4Y A;  1QME A;  1S4S A;  4FD8 A;  2XRO A;  1PW8 A;  5HD5 A;  4HNB A;  3MFD A;  2QZ6 A;  2BLS A;  4O01 A;  1W63 Q;  3MKE A;  4NXB A;  4OPQ A;  1IYQ A;  4UA9 A;  1SDN A;  2K31 A;  1EI5 A;  4JXW A;  3FKV A;  3MS6 A;  5F68 A;  4EUV A;  5EE8 A;  3DTI A;  3PYP A;  2Y55 A;  3NOP C;  3VMA A;  4I39 A;  5FQQ A;  1Q2P A;  4E04 A;  1P9R A;  4QB8 A;  1O07 A;  3S7P A;  4H6J A;  4YIN A;  2O0Y A;  4S2N A;  4WBG A;  4X69 A;  4ZJ1 A;  4XXR A;  4F94 A;  1YMX A;  3VE3 A;  3SS3 A;  3ZG0 A;  5AVF A;  3HBR A;  4IBR A;  4Q0J A;  3VP1 A;  1GSW A;  2H5S A;  5MC7 A;  4IHQ A;  1OTI A;  4G3V A;  4FCF A;  1IEM A;  3IXD A;  4LV0 A;  3ZFZ A;  3IX4 A;  5AQB A;  3VP2 A;  3GMW A;  3RH8 B;  5TBM A; 
#chains in the Genus database with same CATH homology
 5EV0 A;  1D1J A;  2PBD P;  2V8F A;  3NEC A;  2VK3 A;  3T1X A;  3D9Y A;  1SKO B;  1G5U A;  3LGO A;  1VET A;  3U4L P;  1VET B;  3MSH A;  2ZL1 A;  2ZL1 B;  3T12 B;  1Y4O A;  3T1Q B;  2V8C A;  3T1S A;  3UB5 P;  3L9K A;  4FUW A;  2HZ5 A;  2BTF P;  5FEG A;  3DAV A;  3LEQ A;  3NUL A;  2E8J A;  1SKO A;  4D60 A;  1ACF A;  2B95 A;  1CQA A;  3T1R A;  1AWI A;  1J3W A;  3MS6 A;  2PRF A;  4X1L A;  5EM1 A;  1CF0 A;  4ESP A;  1HLU P;  2ACG A;  3CPT A;  3CPT B;  2JKF A;  1FIK A;  5EM0 A;  1VEU B;  1Z09 A;  4FTX A;  1PFL A;  5FDS A;  1K0K A;  4QWO A;  1SZV A;  3KYE A;  1F2K A;  1PNE A;  2PAV P;  3L7H A;  4X25 A;  4X1M A;  5EVE A;  1A0K A;  1CJF A;  1VEU A;  1FIL A;  3CHW P;  5FEF A;  2JKG A;  1YPR A;  1PRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...