4WM9A

Acinetobacter baumanii oxa-24 complex with avibactam
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
245
structure length
243
Chain Sequence
FHISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFKMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Molecular Basis of Selective Inhibition and Slow Reversibility of Avibactam against Class D Carbapenemases: A Structure-Guided Study of OXA-24 and OXA-48.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 77
structure length 243
sequence length 245
ec nomenclature
pdb deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4wm9A00
2HP5A 5AQBA 2DRWA 1E3UD 1K57A 2XDMA 4WZ5A 5CECA 2PU4A 4BD0A 5EPHA 3UN7A 5KZHA 1PZOA 3BLSA 3WRTA 4P85A 3HLFA 1E3UA 3G32A 3OCLA 1K55A 3RXWA 4JF4A 4S2PA 3GTCA 3SH8A 4QJGA 2H5SA 1JWZA 1GHIA 3QNBA 5DF9A 4E6WA 4PM5A 3RJUA 2RL3A 1BULA 4D2OA 4KG5A 2P9VA 3ZG5A 4M3KA 3BFFA 2Y4AA 1YT4A 4E3LA 4XUXA 4S2NC 1I2SA 3A3JA 5FQMA 1ERMA 1EWZA 4PM9A 1YLZA 4MBHA 3N8SA 1WYCA 1L2SA 4N1XA 1NY0A 4NK3A 4E3JA 3VOYA 1BZAA 4E6XA 1E25A 1SDEA 4KQOA 2WKEA 3W8KA 2XD5A 2H0YA 3DW0A 4QU3A 5E2FA 5GLAA 4S2LA 5FQ9A 1XKZA 1XA7A 3V3SA 3IHBA 4OP5A 2Y2GA 2G2UA 5HFOA 4ZAMA 3ZFZA 1MBLA 5BOHA 4R23A 5AQ9A 1K38A 1MPLA 4WMCD 1I2WA 3O3VA 1K25A 3C4OA 4FD8A 1ZKJA 3LY4A 1KVLA 4WMCA 3PBSA 5CRFA 2OV5A 2JBFA 3G2ZA 1ES4A 3ZG7B 4KG2A 3B3XA 1BUEA 3JYIA 4JXGA 3GV9A 1KE3A 1MXOA 5EE8A 5FASA 4FH4A 1FR6A 3O88A 4OVDA 1G6AA 1KE0A 3MFDA 4GB7A 2WGWA 3M2KA 4N9LA 3ZG8B 2ZC7A 1ALQA 1MWRA 4GKUA 1VQQA 1IYOA 4OONA 4S2MA 1CI9A 1PIOA 5FQQA 3W4PA 1N9BA 1FR1A 3D4FA 1FOFA 4S2OA 1GHMA 4FH2A 3BM6A 5IHVA 4HBUA 4ZBEA 3Q82A 3LY3A 1K4FA 4BL2A 5FDHA 1BT5A 4N1HA 4R1GA 5EVLA 3IF6C 3BEBA 5DTTA 5HAIA 1KGGA 1K56A 2C6WB 3OPHA 5KSCA 5FATA 4K91A 2ZQ9A 1BLSA 2DNSA 3ZVWA 2J8YA 3TG9A 1PYYA 4GD6A 5F1FA 1XGIA 4WEJA 1BTLA 3MKEA 3UDIA 4DDYA 3IH9A 4U0XA 2X01A 4DE1A 4KG6A 3PTEA 3W4QA 2ZJ9A 5GLDA 2EFUA 2R9XA 4Q8IA 3VMAA 2XLNA 4EWFA 2XF3A 4OQ0A 1PWGA 5FQKA 5M19A 3MZEA 3E2KA 4F94A 3G31A 3HUMA 3VFFA 1FQGA 4IBXA 3VSKA 4DRTA 2QZ6A 3N6IA 4MBFA 3M2JA 4DE2A 2H0TA 3A3DA 2E8IA 5U47A 3A3IA 4UA6A 3SH9A 4R3BA 3G34A 1K6SA 4EBLA 4QB8A 2HP6A 3LEZA 3WS0A 4KZBA 5DF7A 5FQJA 3SS3A 4KZ7A 5FI7A 1LLBA 2JCHA 3BFEA 1W8QA 2UWXA 5FQIA 2Y2JA 3FV7A 2J9OA 4PM6A 4DE3A 1NYYA 3M6BA 4LCMA 3EQVA 2Y2MA 2XR0A 1KDSA 4LV0A 5TFQA 3UPOA 1BLCA 1K4EA 3IXHA 4QHCA 1BLPA 1CEFA 4N92A 3OZHA 4JKTA 2Y2PA 5CGSA 3UPNA 5E2HA 4KZ8A 1YMXA 4IVIA 3N8LA 5FI6A 1KDWA 4O7DA 3WRZA 4EUZA 1IYQA 3GMWA 4HEFA 3ZVTA 3EQUA 4E3NA 3P98A 1Z6FA 1MKIA 1BSGA 3IF5A 1FCOA 1JWVA 3Q07A 4ID4A 4BQMA 1NYMA 1O7EA 3BRMA 1W5DA 4LV3A 1FCMA 1ONGA 1PZPA 2Q9MA 1NRFA 4GDNA 3AGEA 3PAGA 3NY4A 2ZLYA 3VOZA 4C6YA 2QMIA 1U60A 4L0LA 4P6BA 2WADA 5EUAA 5FAPA 4FSFA 1MWSA 4GNUA 4LV2A 5JYPA 3Q7VB 4JXSA 2FFYA 4BLMA 4LV1A 2ZC6B 1H8YA 2XH9A 4NETA 4BJPA 2EX9A 2ZC5B 3M6HA 3FKWA 3NDGA 1HVBA 3IWIA 2EX6A 4OPQA 4GN2A 5E43A 5EOOA 5TGFA 1IKIA 1ONHA 1WYBA 1YMSA 2JC7A 2V1ZA 4R4SA 4RX3A 3S4XA 4GDBA 3BFGA 2HP9A 2XFTA 2WKIA 4B4XA 1DY6A 3HLWA 3PBOA 3N8RA 1MWTA 3HUNA 5CERA 3UPPA 1LL5A 1W7FA 4JPMA 1LHYA 2WZZA 2BLSA 3MKFA 3MZDA 1QMFA 3I7JA 5DTKA 2EX2A 4OPYA 1RGZA 1ZC2A 3N7WA 4PM8A 3VP0A 1YLYA 1G68A 1TDLA 1YLTA 5F82A 3V5MA 3TSGA 1BLHA 1KVMA 1DJBA 1LL9A 2DCFA 4GOGA 4N9KA 4QD4A 3HLDA 3UE3A 4K0WA 4KZ5A 4P0MA 3ZG9B 4X56A 5GHZA 3HLEA 1IELA 1SHVA 3ZNYA 4E3KA 3VP3A 1YM1A 4RA7A 2C5WB 2WZXA 3DTMA 4IEDA 1NZUA 4JXVA 4KZ6A 4WYYA 3UE1A 5TR7A 3W4OA 1JTDA 5HAQA 1PI5A 1K54C 4IBRA 2HDUA 4YFMA 2XGNA 4OPZA 1DJCA 1XPBA 4PPRA 1L0EA 5GLBA 4OOYA 2Y2LA 5I94A 1AXBA 5DF8A 2P74A 4QY5A 1CK3A 1XA1A 1GA0A 4PMAA 3OPPA 1VM1A 4KQRA 5EECA 4RVAA 1L0FA 4OLGA 4MBKA 3GSGA 1J9MA 2VGJA 3IH8A 1ESIA 3MBZA 3O86A 4Y0UA 3HREA 2WK0A 2J9PA 3UY6A 5FA7A 3E2LA 5D3OA 2FFFB 5F1GA 5AQ7A 1HZOA 1CEGA 2Y91A 1M6KA 1LI0A 1MY8A 3UDXA 2B5RA 4X69A 4B4ZA 4KZ4A 3BLMA 4MNRA 2H10A 3NDEA 4DF6A 5CEDA 2OSUA 2OLUA 4OQIA 4BD1A 4MEZA 1RGYA 3FZCA 4JF5A 5J8XA 2XK1A 3OC2A 1ESUA 5CHMA 1ERQA 2QPNA 2WGVA 5FSRA 4CPKA 3C5AA 5HL1A 2XEPA 1KGFA 1CI8A 2Y2IA 1C3BA 1EI5A 2ZQDA 3PBNA 1WE4A 3IF6B 4P87A 4S2IA 4DE0A 2XFSA 2HDSA 1SDNA 2Y2OA 4GD8A 2A49A 4ZJ2A 4BENA 4JF6A 5A92A 2ZM0A 5KSHA 3IXDA 4R0QA 3ZG0A 3SS4A 1YLPA 5GHYA 5CGXA 4OQHA 4LENA 2V20A 1RP5A 3HLGA 1XGJA 4Y0TA 3UDFA 4DXBA 3IWOA 4X6TA 5G18A 2HPBA 1H5XA 4H8RA 3CG5A 2J7VA 3FKVA 3G2YA 5GL9A 3PBRA 1GCEA 3UO9A 3AGFA 4S2KA 2Y55A 4KQQA 1O07A 2WKHA 2Z2LB 2ZQ7A 2Y2NA 5GLCA 4R4RA 2GDNA 1PI4A 4WELA 2Y2KA 2ZC4B 4S2NA 5A91A 1GA9A 4OQGA 1SCWA 2ZQCA 4DXCA 1KE4A 2ZD8A 3VP4A 2V2FF 3O87A 5EOEA 5EVIC 3LCEA 3MZFA 4A5RA 4E3IA 3IHAA 1RCJA 3WWXA 4E3MA 2ZM8A 3V39A 5FI2A 3WS4A 3C7VA 3OCNA 5JYOA 3IXGA 3IQAA 1KGEA 3NC8A 3Q1FA 4EBPA 3HLCA 3FYZA 2BG1A 2HDRA 3ITBA 1PWCA 3C7UA 4KENB 4U0TA 4XUZA 5A93A 1IYPA 1S6RA 2JE5A 4S2JA 3WS5A 4WEKA 5HARA 1K57C 2EXAA 4KZAA 1PW1A 4WZ5C 3Q7ZA 1LI9A 4JXWA 4BL3A 2PBYA 5F83A 1JWPA 4YINA 1K55C 5HW3A 5CHUA 2EX8A 5CXWA 5CGWA 2R9WA 3UNWA 1ZG6A 1FCNA 1NXYA 3OPLA 4WBGA 3CMZA 3WS2A 4OOMA 4EBNA 4HBTA 5EVIB 5HX9A 4FCFA 1ZG4A 1MWUA 1NJ4A 3FWLA 1N4OA 2Q9NA 3S22A 1FSWA 1DJAA 2WUQA 3GVBA 3IWQA 4EQIA 4MLLA 3V3RA 4Y0OA 3P09A 2X02A 1K54A 5AQAA 1M40A 3NIAA 3CJMA 3ZNTA 4JBFA 1TEMA 1TDGA 5FAQA 2WAEA 4ZJ1A 3BYDA 3ISGA 5M18A 4ZTKA 4OLDA 3SOIA 2A3UA 4XXRA 3V50A 2X71A 4OPRA 3GR2A 4UA9A 3QNCA 2ZMAA 3PBQA 5CHJA 2WGIA 3HVFA 2Y2HA 4DKIA 1W8YA 3HUOA 1OMEA 2EXBA 3Q81A 4WM9A 3VFHA 3IF6A 3HL9A 3IT9A 4E3OA 3ZDJA 1PWDA 4LCLA 1TVFA 2ZM2A 2P9VB 4UHUA 5DTSA 3RXXA 3DWZA 2PU2A 5CEBA 1JTGA 3ZHHA 2ZQAA 1K6RA 4OOLA 2EFXA 1YQSA 3BFCA 3SH7A 1IEMA 3VP2A 1YLJA 2WAFA 4OH0A 3ITAA 5HAPA 2ZQ8A 4HESA 2CC1A 3A3EA 1XX2A 4ZDXA 4KZ9A 4Y7PA 4QY6A 1H8ZA 2ZC3B 1EROA 5M1AA 2Y59A 2XD1A 3OPRA 4GZBA 3IXBA 1K56D 2HDQA 4IVKA 3QHYA 3VSLA 5CTMA 2WYXA 3TOIA 2RCXA 1Q2PA 1IKGA 4X68A 1XP4A 2OLVA 5DVAA 3HBRA 5E2GA 4C3QA 4R3JA 3WS1A 1L0DA 3GQZA 5A90A 3C4PA 4EV4A 5KMWA 3LO7A 3ZGAB 3BECA 4OKPA 1ES2A 1I5QA 1Q2QA 3Q7VA 3S1YA 1QMEA 1S0WA 1IYSA 4UA7A 5E2EA 1ES5A 1Y54A 4WZ4A 3DWKA 3NI9A 4ZJ3A 1GHPA 4CJNA 2VGKA 5L2FA 1W79A 2G2WA 3G35A 4Z9QA 3ZCZA 4X55A 2WGWB 3PAEA 1E4DA 2Y2QA 3A3FA 4UAAA 4RX2A 2I72A 3SS5A 2XQZA 4DDSA 3MXSA 4KZ3A 1HTZA 4OP8A 5EVID 4RYEA 5FAOA 3UE0A 3GRJA 1FSYA 3VP1A 1ES3A 1L0GA 5EVIA 1HD8A 3BFDA 3NBLA 1YLWA 3HLBA 3PBTA 3NCKA 5GHXA 2IWDA 3CZDA 2IWCA 4PM7A 3G30A 4K0XA 4C75A 3G4PA 4JLFA 5CTNA 4X53A 1NZOA 1XXMA 3N4IA 4U3TA 1PW8A 2IWBA 2Z2MB 1SKFA 3MXRA 3AGDA 4B88A 1JVJA
chains in the Genus database with same CATH superfamily
5AQBA 2DRWA 3R4KA 1E3UD 4CLCC 5HL6A 2CMNA 5EPHA 4MN7A 3OCLA 2O9AA 1PNEA 2H5SA 3CWFA 1JWZA 1XJ3A 4BBUA 2RL3A 4YWZA 4HHDA 3OLOA 1Y28A 4E3LA 3MSHA 4HNBA 1I2SA 3A3JA 3C2WA 1STZA 1ERMA 3T4JA 2GX5A 4N1XA 4NK3A 1E25A 1SDEA 2WKEA 3W8KA 3QP5A 2H0YA 4QU3A 5E2FA 4G3KA 1XKZA 1TS7A 4YOFA 4B9OA 1MKMA 5AQ9A 1K38A 1OJGA 2V9AA 4FD8A 3LY4A 1TS6A 3ZG7B 3B3XA 3JYIA 4L9EA 4WUJA 2WKRA 3MFDA 4K08A 4GB7A 2O9CA 3M2KA 2NUPC 1VEUB 1T19A 1VQQA 5G4YA 3D4FA 4HP9A 2QYBA 3BM6A 2M7VA 4HBUA 4ZBEA 3TRCA 1K4FA 3MQOA 4R1GA 3UMDA 3G6OA 2M7UA 3F1OB 4K91A 2ZMFA 2WKQA 3E4QA 4LPZA 4ME4A 4DDYA 4DE1A 4KG6A 3VMAA 3G31A 1FQGA 2J3TD 4MBFA 3M2JA 4BBVA 2I9VA 3A3DA 4MCWA 3A3IA 4UA6A 2VA0A 3RFBA 3UB7A 4KUKA 3GECA 2XRNA 2HP6A 2HGVA 3SS3A 2AVXA 4KZ7A 5FI7A 2BTFP 2VGLM 1LLBA 4CLCD 2W27A 1OT6A 2ZBBA 2J9OA 4PM6A 4Q0JA 3EWKA 5C5KA 2Y2MA 1G28A 1V9ZA 2HJ9C 3MXQA 5DJTA 1CEFA 3OZHA 2Y2PA 2VZWA 1YMXA 3T4KA 5FI6A 1KDWA 3LGOA 4EUZA 3ZVTA 3P98A 2PBDP 4EESA 3Q07A 4CLCE 4ID4A 1NYMA 1W5DA 4LV3A 2Q9MA 1NRFA 4GDNA 3AGEA 3VOZA 2QMIA 1U60A 4HJ6A 4L0LA 4FSFA 4LV2A 2FFYA 2ZC5B 3FKWA 4L9FA 2EX6A 2W1TB 4GN2A 4HP4A 5TGFA 1IKIA 1WYBA 4RX3A 2JC7A 4JGQA 4GDBA 4R3AA 1S67L 3UPPA 1LL5A 1CQAA 2WZZA 1LSXA 3T1RA 1H0MA 3I7JA 5F82A 2P08A 1VHMA 3TSGA 4II7A 2JKTI 2P04A 3HLDA 4P0MA 3OOVA 3HLEA 1IELA 3ZNYA 3EGDC 3VP3A 4RA7A 4KZ6A 4WYYA 3UE1A 5TR7A 5HAQA 2LB9A 2XGNA 2JKRI 1F9IA 1L0EA 2Y2LA 5I94A 1JVJA 2P74A 2H28A 1VM1A 4KQRA 3LIDA 4OLGA 4NKPA 1YPRA 2VGJA 3LICA 3UY6A 3E2LA 3TE8A 1CEGA 3HJIA 2Y91A 1M6KA 1LI0A 3E4PA 1T18A 3UDXA 4KZ4A 3BLMA 5F6AA 4JF5A 5J8XA 2XK1A 2YKFA 5CHMA 2QPNA 3H7WB 4MMNA 3P01A 2FZ0A 2Y2IA 4S2IA 3PBNA 4JGRA 1HLUP 4ZJ2A 5A92A 4JF6A 5FEFA 5GHYA 4LENA 3DTIA 3IS2A 2KDKA 2HPBA 3FKVA 3G2YA 1S4RA 1O07A 2Z2LB 4HI4A 2GDNA 1PI4A 2ZC4B 5A91A 2BASA 2ZQCA 3HJKA 2V2FF 3O87A 4E3IA 5HDCA 4GS9A 2L4RA 3V39A 5JYOA 5TBMA 1KGEA 3DBAA 3LIBA 2HDRA 3C7UA 4KENB 5A93A 3WS5A 5DFXA 3LI8A 4MN6A 4UQIM 1LSVA 3ZYTA 4YINA 1YSPA 2EX8A 2R9WA 3UNWA 2ACGA 3WS2A 3F1NA 4EBNA 4HBTA 5EVIB 3P7NA 5HWTA 3W2ZA 1DJAA 2WUQA 2PT7A 4Y0OA 3P09A 1K54A 4DJ3A 2WAEA 3ISGA 4OLDA 3E4OA 4OPRA 3CI6A 2E8JA 3IBJA 1OMEA 4E3OA 4I39A 1PWDA 2ZM2A 4UHUA 1SKOB 3DWZA 3T4QA 5CEBA 4DN0A 2WAFA 1H3QA 2V8FA 1K0KA 1T1CA 4PHTA 1EROA 5L8MA 2XD1A 4GZBA 2HDQA 5CTMA 1IKGA 5FEGA 4C3QA 4F3LB 4EV4A 3PXPA 4MDZA 5KMWA 3BECA 1TF1A 3C30A 3S1YA 4UA7A 3DWKA 2G2WA 4X55A 2Y2QA 2I72A 4DDSA 4KZ3A 2OOLA 4RYEA 1ZHHB 5J4EA 1G5UA 3EOIA 1FSYA 3GRJA 3VP1A 4YNRA 5EFWA 1LL8A 5CTNA 3N4IA 1VETB 3ZQ5A 3MXRA 4Y15A 3AGDA 5HPFA 2XDMA 1G6OA 5CECA 4BD0A 5HDDA 4P85A 3HLFA 3G32A 4JF4A 3JVUA 3H82B 2P7JA 4HQAA 3QNBA 4E6WA 4PM5A 1BULA 1W63Q 3LI9A 4M3KA 2Y4AA 1YT4A 4XUXA 4PM9A 5K5BA 2QJ5A 1NY0A 3T4LA 3VOYA 1T1AA 3GDIA 3T4SA 1OTBA 2XD5A 4CLCB 5GLAA 5FQ9A 1XA7A 4OP5A 2Y2GA 2G2UA 1YKDA 5BOHA 4H6JA 3LR0A 1FIKA 4HOIA 2VEAA 3O3VA 3UMEA 4WLAA 4WMCA 2JBFA 3G2ZA 4JGPA 4MN5A 3SZTA 3LR3A 3ULFA 1BUEA 3QP1A 3K3CA 5FASA 1FR6A 3O88A 1S4SA 4GS9B 2V0UA 2WGWA 4N9LA 3ZG8B 1ALQA 3FC7A 3RH8B 4OONA 1CI9A 5FQQA 3W4PA 1FOFA 1GHMA 1P0ZA 1P97A 3LY3A 3SW1A 5DTTA 5HAIA 3R7WB 2GZAA 1BLSA 1DRMA 3TG9A 4NEED 1PYYA 2A2LA 4WEJA 3MKEA 4U0XA 4Q8IA 5DJUA 2XF3A 3OBFA 4EWFA 1PWGA 3E2KA 3VSKA 1DP9A 3N6IA 4DE2A 3B47A 3EEAA 4QWOA 1A0KA 1YSQA 3CHWP 4EBLA 5DKKA 5DF7A 5FQJA 3MF0A 3BFEA 5FQIA 4NXEA 3M6BA 4GW9A 3L7HA 5HSQA 1TS0A 2XR0A 2OAQ1 2HF6A 1BLCA 1K4EA 3IXHA 4QHCA 1BLPA 5KIZA 1H8MA 3UPNA 5E2HA 4KZ8A 4IVIA 4O7DA 3GMWA 1Z6FA 1MKIA 4EQ1A 3IF5A 1O7EA 2YKHA 3NY4A 2ZOHA 3K2NA 2WADA 5EUAA 1XJ6A 4GNUA 4BLMA 3IWIA 3VV4A 4EERA 1XFQA 1ONHA 4FOFA 2O9BA 4I38A 4B4XA 3PBOA 3N8RA 3BQAA 1LHYA 3MKFA 4HH3A 3MZDA 1QMFA 2EX2A 3LFVA 3N7WA 3VE3A 1F2KA 3KSFA 2QWSA 1DJBA 1LL9A 1XJ4A 5I5LA 2VGLS 2WZXA 4IEDA 4FUWA 1CF0A 1K54C 4YFMA 1DJCA 4OOYA 4Y5FA 1AXBA 4ARZB 4QY5A 1GSXA 1GA0A 1F5MA 4MBKA 3EEHA 2KLIA 4EETB 1ESIA 3QP6A 1N9LA 3HREA 2WK0A 4LRZE 5D3OA 2FFFB 3O5YA 4NXFA 4O0PA 2B5RA 4X69A 2H10A 4DF6A 2OSUA 4RQ9A 4OQIA 1RGYA 5HPIA 4GHIA 2W0NA 1ACFA 2WGVA 5HL1A 2XEPA 2ZQDA 1WE4A 3IF6B 5IS1A 2XFSA 4GD8A 1OTIA 2A49A 5KSHA 4X25A 2J3WA 3ZG0A 4PKYA 2V20A 2M1CA 3HLGA 4Y17A 5EV0A 3C38A 5G18A 2XA7S 3CG5A 4Y2FA 2J7VA 3CLOA 3UB6A 3LIFA 1GCEA 3NOTC 3UO9A 2NUTC 3AGFA 2Y55A 4KQQA 5GLCA 1GA9A 1KE4A 5EOEA 3MZFA 3U4LP 2ZM8A 3WS4A 4Q0HA 3IQAA 5F69A 1XJ2A 3HLCA 4U0TA 4XUZA 2JKTM 1PW1A 4X1LA 4UEYA 4BL3A 3CITA 5F83A 1S1ZA 1JWPA 3MQQA 4D60A 1KOUA 3OPLA 4WBGA 1OTDA 3NOPC 1PFLA 1D06A 5HX9A 2JKRM 4EQIA 2INWA 3KYZA 5L09A 3ZNTA 3CJMA 1TEMA 4XT2B 4PAUA 4ZTKA 1V9YA 2XA7M 4XXRA 3V50A 3UB5P 4UA9A 2ZMAA 3TW8A 3HVFA 1W8YA 3HUOA 5FL3A 4EUVA 2GJ3A 3ICYA 1TVFA 5HD3A 2PU2A 4OH0A 5HAPA 2VV6A 2ZQ8A 1SZVA 1DP8A 2B02A 5AVEA 2W3DA 4KZ9A 2EA9A 4Y7PA 3NECA 3FPWA 3BY8A 1H8ZA 2ZC3B 5M1AA 3K3DA 1K56D 3LUQA 2W1RA 1BYWA 2G7UA 3TOIA 3MS6A 2VLGA 4X68A 4UQIS 3C4PA 3ZGAB 1I5QA 3Q7VA 4B93A 4CJNA 2DMWA 3NI9A 4ZJ3A 2VGKA 5L2FA 3G35A 1LSWA 3A3FA 3SS5A 3MXSA 3A0RA 4ETZA 1UWNX 3NOUC 3F1PA 1ES3A 1L0GA 1HD8A 2VK3A 3BFDA 3NBLA 3NCKA 2IWDA 3BJNA 4P6ZS 3G4PA 4JLFA 1NZOA 1XXMA 4WZ5A 3U2AA 2PU4A 5KZHA 1PZOA 3BLSA 2J80A 1K55A 4FTXA 4QJGA 1GHIA 2P9VA 3ZG5A 2A24A 2KX6A 1EWZA 1YLZA 5F68A 3B33A 4LFUA 1WYCA 1L2SA 2PRFA 4GLQA 4E6XA 5MC7A 1X0OA 4KQOA 3DW0A 4S2LA 1OT9A 3V3SA 3IHBA 5HFOA 4ZAMA 3MJQA 2Z6DA 4WMCD 3BY9A 3DTEA 2JKFA 1I2WA 1IFQA 1K25A 2QJ7A 3C4OA 1ZKJA 3KYEA 3PBSA 4P6ZM 1F98A 4KG2A 4JXGA 3GV9A 1MXOA 4FH4A 3CPTA 2MJ6A 1FILA 1PIOA 1N9BA 3VOLA 3Q82A 2OWJA 2QKPA 1UGUA 1K56A 3OPHA 2O99A 4AFIA 2ZQ9A 2DNSA 3MQ0A 2J8YA 3ZVWA 5F1FA 1XGIA 1BTLA 2X01A 5GLDA 2EFUA 4O01A 1IOUA 1UWPX 4I5SA 3BW6A 4HJ3A 3HUMA 4IBXA 1ODVA 2QZ6A 5HDSA 2E8IA 3SH9A 3UE6A 4PKYG 3IX3A 4X1MA 4R3BA 2LB5A 3WS0A 2PYPA 2V1AA 4KQDA 2JCHA 1W8QA 4DE3A 3LEQA 4NXGA 4LCMA 2PD8A 3UPOA 2JKGA 5TFQA 5HWWA 4JKTA 5CGSA 4LRXC 3WRZA 5L07A 1IYQA 4HEFA 3EQUA 3PR6A 1BSGA 1FCOA 1JWVA 4BQMA 2L0WA 1FCMA 1PZPA 3PAGA 5JYPA 1MWSA 3Q7VB 3NJAA 1H8YA 2XH9A 4I3IA 1VEUA 4BJPA 2EX9A 1HVBA 5EOOA 4BMWA 1YMSA 4R4SA 2UV0E 3IS2B 3HLWA 1MWTA 1W63M 3HUNA 1W7FA 2BLSA 1NWZA 3VE4A 5DTKA 1RGZA 1ZC2A 4PM8A 3VP0A 1YLTA 3F1OA 3V5MA 1BLHA 3T50A 4IUKA 2DCFA 4QD4A 5GHZA 1SHVA 1YM1A 2C5WB 1T1BA 1NZUA 5FDSA 5TBMB 3LR5A 3E98A 2HDUA 4OPZA 5GLBA 5DF8A 1GSVA 4PMAA 3OPPA 5EECA 4IHQA 4RVAA 3QP4A 4ESPA 3GSGA 2D01A 3F1NB 1TD5A 4Y0UA 5FA7A 4NXBA 5F1GA 5AQ7A 1HZOA 1XFNA 1NRJA 4B4ZA 2B95A 2GNXA 1DP6A 4MNRA 3NDEA 5CEDA 4BD1A 4MEZA 3FZCA 4EEPA 3DTKA 5FSRA 1S66L 4CPKA 1KGFA 1CI8A 4Y13A 1C3BA 4P87A 2HDSA 2Y2OA 2W3GA 3T1QB 2XROA 2W1TA 3SS4A 1YLPA 3CPTB 4OQHA 2Z6CA 1RP5A 2ZL1A 3UDFA 4DXBA 2V1BA 3IWOA 4LLOB 2O0YA 2HV1A 3CUEC 4H8RA 3PBRA 1AWIA 2B18A 3QP2A 2WKHA 2Y2NA 4R4RA 3D3OA 4OQGA 2D02A 4EW7A 3S7OA 3VP4A 3LCEA 4A5RA 3T1SA 4Y3IA 4E3MA 5FI2A 3IXGA 3NC8A 3FPVA 3ITBA 1IYPA 2JE5A 2PR6A 3S7PA 5HARA 2EXAA 4WF0A 4WZ5C 1S1YA 1OTEA 2W3FA 4JXWA 5DFYA 1K55C 5HW3A 5CHUA 5CXWA 1NXYA 3CMZA 3PYPA 4OOMA 5IT5A 4FCFA 1ZG4A 2W3HA 2XSSA 1MWUA 1NJ4A 3S22A 1N4OA 2Q9NA 1FSWA 1Z09A 4M4XA 4MLLA 1CJFA 1NLYA 4HJ4A 3MMHA 5AQAA 1M40A 4JBFA 5FAQA 3H9WA 4ZJ1A 3BYDA 2A3UA 4GJ4A 5G4ZA 3GR2A 3QNCA 1PRQA 3PBQA 5CHJA 3H7WA 4DKIA 5EM0A 2EXBA 2VX8A 3VFHA 2JN7A 2K31A 5DTSA 1JTGA 2ZQAA 2EFXA 1YQSA 3SH7A 1IEMA 3TJZC 1YLJA 3VP2A 4HESA 2CC1A 3IBRA 4ZDXA 3IX4A 3DAVA 2V8CA 3OPRA 4E04A 4IVKA 3QHYA 3S7QA 3VSLA 4H6JB 2RCXA 1Q2PA 1XP4A 1EW0A 3HBRA 2WKPA 1GSWA 3KX0X 5E2GA 4R3JA 3WS1A 5A90A 1OJ5A 4OKPA 3T4TA 1ES2A 1QMEA 1IYSA 2HZ5A 5F5YA 1ES5A 1Y54A 1NLZA 4WZ4A 1W79A 2WGWB 4NG2A 3PAEA 3NHQA 4UAAA 4ZRRA 3UE0A 3KSGA 1D7EA 5EVIA 1YLWA 5GHXA 3CZDA 4PM7A 3G30A 3JPUA 3IX8A 3KSIA 5IU1A 1SKFA 4B88A 2HP5A 1K57A 3UN7A 4DJ2A 3WRTA 1E3UA 3RXWA 4I3JA 4S2PA 3GTCA 3SH8A 5EM1A 5DF9A 3RJUA 4D2OA 2VV7A 4KG5A 1SKOA 1N9OA 3A0VA 3BFFA 4R38A 4S2NC 2ZMVA 5FQMA 3EGXC 4MBHA 3N8SA 5HZHA 4JGOA 4E3JA 1BZAA 2KOIA 2R78A 2PD7A 2ZL1B 3LR4A 3ZFZA 1MBLA 4R23A 1VB6A 1MPLA 4F3LA 1KVLA 5CRFA 2OV5A 1ES4A 2PYRA 1KE3A 5EE8A 4OVDA 1G6AA 1KE0A 2ZC7A 1MWRA 4GKUA 1IYOA 4S2MA 4G3VA 1FR1A 4S2OA 4FH2A 5IHVA 4LRYC 3BWLA 2OWHA 4BL2A 5FDHA 1BT5A 4N1HA 5EVLA 3IF6C 3BEBA 3MR0A 1KGGA 2Y8HA 2C6WB 3LIAA 5KSCA 5FATA 2IA2A 1VETA 5DKLA 1MC0A 4BWIA 4GD6A 2W3EA 3UDIA 3IH9A 3PTEA 3W4QA 2ZJ9A 2R9XA 2XLNA 4OQ0A 3H82A 5FQKA 5M19A 3MZEA 3CUEA 4F94A 3VFFA 4DRTA 4GCZA 2V0WA 1WA9A 2H0TA 3KO6A 5U47A 3LYXA 3G34A 1K6SA 2PHYA 4QB8A 3LEZA 4KZBA 2UWXA 5J3WA 2Y2JA 3FV7A 5LBRA 1NYYA 3EQVA 4CLCA 1P9WA 1KDSA 4LV0A 3PHYA 5HWVA 4N92A 2K2NA 3T1XA 3N8LA 4EEUA 3NULA 4E3NA 5AJGA 1YAXA 3HCYA 3BRMA 4I3AA 4GHIB 4ETXA 1ONGA 2FH5A 2ZLYA 4C6YA 4P6BA 5L10A 5FAPA 2K7SA 3KYQA 2Y79A 4JXSA 4O8GA 4LV1A 2ZC6B 4NETA 3M6HA 4OPQA 3NDGA 5E43A 3T12B 2V1ZA 3S4XA 3BFGA 2HP9A 2XFTA 2WKIA 1DY6A 1OPXA 5CERA 4JPMA 4OPYA 3R7WA 1Y4OA 5HD5A 1YLYA 1G68A 1TDLA 1KVMA 4GOGA 4N9KA 3UE3A 4K0WA 4KZ5A 3ZG9B 4X56A 1ZTUA 4E3KA 3DTMA 4JXVA 3W4OA 1JTDA 1PI5A 4IBRA 1XPBA 4PPRA 1CK3A 1XA1A 1L0FA 1J9MA 3IH8A 3MBZA 3D72A 3O86A 2J9PA 2VKSA 4R70A 1LT0A 1MY8A 4HH2A 2OLUA 4WL9A 3OC2A 1ESUA 1ERQA 2Q0OA 2ZOIA 3C5AA 1EI5A 4DE0A 3QP8A 1SDNA 2EWWA 5J7EA 4EU0A 4BENA 5TJJA 2ZM0A 3IXDA 4R0QA 5CGXA 4HIAA 3UB8A 1XGJA 4Y0TA 3A0SA 4Q0IA 3E0YA 4LGWA 2PDRA 1JNUA 4X6TA 1H5XA 5GL9A 3JVVA 4S2KA 2ZQ7A 4WELA 2Y2KA 4S2NA 1SCWA 4DXCA 2ZD8A 5EVIC 3IHAA 1RCJA 2PAVP 3WWXA 3C7VA 3OCNA 1TS8A 2OAP1 3Q1FA 4EBPA 3FYZA 2BG1A 1PWCA 4DMZA 1S6RA 4S2JA 4WEKA 1K57C 4KZAA 3Q7ZA 4ARZA 1LI9A 3D9YA 2PBYA 2VV8A 3CAXA 2VJWA 5CX7A 5CGWA 1ZG6A 1FCNA 3F1PB 1P9RA 5AVFA 3FWLA 2L1MA 4KUOA 1L3LA 3IWQA 3GVBA 3V3RA 2X02A 3NIAA 2PR5A 1TDGA 5M18A 3SOIA 1MZUA 2X71A 4L9GA 3RTYA 2WGIA 2Y2HA 2EWVA 3Q81A 4WM9A 3IF6A 3HL9A 3IT9A 3ZDJA 4LCLA 2P9VB 3B42A 2A24B 3RXXA 3ZHHA 1K6RA 4IJGA 4OOLA 3BFCA 4HY8A 4BBTA 3ITAA 5A8BA 3A3EA 1XX2A 3BQ8A 3FG8A 1J3WA 5EVEA 3C8CA 4QY6A 4G3WA 2Y59A 4IUHA 3IXBA 4CQHA 2WYXA 2OLVA 4QPRA 5DVAA 3L9KA 1L0DA 3GQZA 3LO7A 1OTAA 4Z1WA 4EXOA 1Q2QA 3LIEA 1S0WA 2JHEA 4WN5A 5E2EA 3UB9A 3T4OA 1GHPA 2QHKA 1N9NA 3ZCZA 4Z9QA 4R6LA 3MFXA 1E4DA 3V67A 4RX2A 2XQZA 1HTZA 4OP8A 5EVID 5FAOA 3S7NA 3PBTA 3HLBA 2HJEA 2J3TC 2IWCA 3KSHA 4K0XA 4C75A 4X53A 4U3TA 1PW8A 2IWBA 2Z2MB 4XT2A 1D1JA
chains in the Genus database with same CATH topology
2HP5A 5AQBA 2DRWA 1E3UD 1K57A 2XDMA 4WZ5A 5CECA 2PU4A 4BD0A 5EPHA 3UN7A 5KZHA 1PZOA 3BLSA 3WRTA 4P85A 3HLFA 1E3UA 3G32A 3OCLA 1K55A 3RXWA 4JF4A 4S2PA 3GTCA 3SH8A 4QJGA 2H5SA 1JWZA 1GHIA 3QNBA 5DF9A 4E6WA 4PM5A 3RJUA 2RL3A 1BULA 4D2OA 4KG5A 2P9VA 3ZG5A 4M3KA 3BFFA 2Y4AA 1YT4A 4E3LA 4XUXA 4S2NC 1I2SA 3A3JA 5FQMA 1ERMA 1EWZA 4PM9A 1YLZA 4MBHA 3N8SA 1WYCA 1L2SA 4N1XA 1NY0A 4NK3A 4E3JA 3VOYA 1BZAA 4E6XA 1E25A 1SDEA 4KQOA 2WKEA 3W8KA 2XD5A 2H0YA 3DW0A 4QU3A 5E2FA 5GLAA 4S2LA 5FQ9A 1XKZA 1XA7A 3V3SA 3IHBA 4OP5A 2Y2GA 2G2UA 5HFOA 4ZAMA 3ZFZA 1MBLA 5BOHA 4R23A 5AQ9A 1K38A 1MPLA 4WMCD 1I2WA 3O3VA 1K25A 3C4OA 4FD8A 1ZKJA 3LY4A 1KVLA 4WMCA 3PBSA 5CRFA 2OV5A 2JBFA 3G2ZA 1ES4A 3ZG7B 4KG2A 3B3XA 1BUEA 3JYIA 4JXGA 3GV9A 1KE3A 1MXOA 5EE8A 5FASA 4FH4A 1FR6A 3O88A 4OVDA 1G6AA 1KE0A 3MFDA 4GB7A 2WGWA 3M2KA 4N9LA 3ZG8B 2ZC7A 1ALQA 1MWRA 4GKUA 1VQQA 1IYOA 4OONA 4S2MA 1CI9A 1PIOA 5FQQA 3W4PA 1N9BA 1FR1A 3D4FA 1FOFA 4S2OA 1GHMA 4FH2A 3BM6A 5IHVA 4HBUA 4ZBEA 3Q82A 3LY3A 1K4FA 4BL2A 5FDHA 1BT5A 4N1HA 4R1GA 5EVLA 3IF6C 3BEBA 5DTTA 5HAIA 1KGGA 1K56A 2C6WB 3OPHA 5KSCA 5FATA 4K91A 2ZQ9A 1BLSA 2DNSA 3ZVWA 2J8YA 3TG9A 1PYYA 4GD6A 5F1FA 1XGIA 4WEJA 1BTLA 3MKEA 3UDIA 4DDYA 3IH9A 4U0XA 2X01A 4DE1A 4KG6A 3PTEA 3W4QA 2ZJ9A 5GLDA 2EFUA 2R9XA 4Q8IA 3VMAA 2XLNA 4EWFA 2XF3A 4OQ0A 1PWGA 5FQKA 5M19A 3MZEA 3E2KA 4F94A 3G31A 3HUMA 3VFFA 1FQGA 4IBXA 3VSKA 4DRTA 2QZ6A 3N6IA 4MBFA 3M2JA 4DE2A 2H0TA 3A3DA 2E8IA 5U47A 3A3IA 4UA6A 3SH9A 4R3BA 3G34A 1K6SA 4EBLA 4QB8A 2HP6A 3LEZA 3WS0A 4KZBA 5DF7A 5FQJA 3SS3A 4KZ7A 5FI7A 1LLBA 2JCHA 3BFEA 1W8QA 2UWXA 5FQIA 2Y2JA 3FV7A 2J9OA 4PM6A 4DE3A 1NYYA 3M6BA 4LCMA 3EQVA 2Y2MA 2XR0A 1KDSA 4LV0A 5TFQA 3UPOA 1BLCA 1K4EA 3IXHA 4QHCA 1BLPA 1CEFA 4N92A 3OZHA 4JKTA 2Y2PA 5CGSA 3UPNA 5E2HA 4KZ8A 1YMXA 4IVIA 3N8LA 5FI6A 1KDWA 4O7DA 3WRZA 4EUZA 1IYQA 3GMWA 4HEFA 3ZVTA 3EQUA 4E3NA 3P98A 1Z6FA 1MKIA 1BSGA 3IF5A 1FCOA 1JWVA 3Q07A 4ID4A 4BQMA 1NYMA 1O7EA 3BRMA 1W5DA 4LV3A 1FCMA 1ONGA 1PZPA 2Q9MA 1NRFA 4GDNA 3AGEA 3PAGA 3NY4A 2ZLYA 3VOZA 4C6YA 2QMIA 1U60A 4L0LA 4P6BA 2WADA 5EUAA 5FAPA 4FSFA 1MWSA 4GNUA 4LV2A 5JYPA 3Q7VB 4JXSA 2FFYA 4BLMA 4LV1A 2ZC6B 1H8YA 2XH9A 4NETA 4BJPA 2EX9A 2ZC5B 3M6HA 3FKWA 3NDGA 1HVBA 3IWIA 2EX6A 4OPQA 4GN2A 5E43A 5EOOA 5TGFA 1IKIA 1ONHA 1WYBA 1YMSA 2JC7A 2V1ZA 4R4SA 4RX3A 3S4XA 4GDBA 3BFGA 2HP9A 2XFTA 2WKIA 4B4XA 1DY6A 3HLWA 3PBOA 3N8RA 1MWTA 3HUNA 5CERA 3UPPA 1LL5A 1W7FA 4JPMA 1LHYA 2WZZA 2BLSA 3MKFA 3MZDA 1QMFA 3I7JA 5DTKA 2EX2A 4OPYA 1RGZA 1ZC2A 3N7WA 4PM8A 3VP0A 1YLYA 1G68A 1TDLA 1YLTA 5F82A 3V5MA 3TSGA 1BLHA 1KVMA 1DJBA 1LL9A 2DCFA 4GOGA 4N9KA 4QD4A 3HLDA 3UE3A 4K0WA 4KZ5A 4P0MA 3ZG9B 4X56A 5GHZA 3HLEA 1IELA 1SHVA 3ZNYA 4E3KA 3VP3A 1YM1A 4RA7A 2C5WB 2WZXA 3DTMA 4IEDA 1NZUA 4JXVA 4KZ6A 4WYYA 3UE1A 5TR7A 3W4OA 1JTDA 5HAQA 1PI5A 1K54C 4IBRA 2HDUA 4YFMA 2XGNA 4OPZA 1DJCA 1XPBA 4PPRA 1L0EA 5GLBA 4OOYA 2Y2LA 5I94A 1AXBA 5DF8A 2P74A 4QY5A 1CK3A 1XA1A 1GA0A 4PMAA 3OPPA 1VM1A 4KQRA 5EECA 4RVAA 1L0FA 4OLGA 4MBKA 3GSGA 1J9MA 2VGJA 3IH8A 1ESIA 3MBZA 3O86A 4Y0UA 3HREA 2WK0A 2J9PA 3UY6A 5FA7A 3E2LA 5D3OA 2FFFB 5F1GA 5AQ7A 1HZOA 1CEGA 2Y91A 1M6KA 1LI0A 1MY8A 3UDXA 2B5RA 4X69A 4B4ZA 4KZ4A 3BLMA 4MNRA 2H10A 3NDEA 4DF6A 5CEDA 2OSUA 2OLUA 4OQIA 4BD1A 4MEZA 1RGYA 3FZCA 4JF5A 5J8XA 2XK1A 3OC2A 1ESUA 5CHMA 1ERQA 2QPNA 2WGVA 5FSRA 4CPKA 3C5AA 5HL1A 2XEPA 1KGFA 1CI8A 2Y2IA 1C3BA 1EI5A 2ZQDA 3PBNA 1WE4A 3IF6B 4P87A 4S2IA 4DE0A 2XFSA 2HDSA 1SDNA 2Y2OA 4GD8A 2A49A 4ZJ2A 4BENA 4JF6A 5A92A 2ZM0A 5KSHA 3IXDA 4R0QA 3ZG0A 3SS4A 1YLPA 5GHYA 5CGXA 4OQHA 4LENA 2V20A 1RP5A 3HLGA 1XGJA 4Y0TA 3UDFA 4DXBA 3IWOA 4X6TA 5G18A 2HPBA 1H5XA 4H8RA 3CG5A 2J7VA 3FKVA 3G2YA 5GL9A 3PBRA 1GCEA 3UO9A 3AGFA 4S2KA 2Y55A 4KQQA 1O07A 2WKHA 2Z2LB 2ZQ7A 2Y2NA 5GLCA 4R4RA 2GDNA 1PI4A 4WELA 2Y2KA 2ZC4B 4S2NA 5A91A 1GA9A 4OQGA 1SCWA 2ZQCA 4DXCA 1KE4A 2ZD8A 3VP4A 2V2FF 3O87A 5EOEA 5EVIC 3LCEA 3MZFA 4A5RA 4E3IA 3IHAA 1RCJA 3WWXA 4E3MA 2ZM8A 3V39A 5FI2A 3WS4A 3C7VA 3OCNA 5JYOA 3IXGA 3IQAA 1KGEA 3NC8A 3Q1FA 4EBPA 3HLCA 3FYZA 2BG1A 2HDRA 3ITBA 1PWCA 3C7UA 4KENB 4U0TA 4XUZA 5A93A 1IYPA 1S6RA 2JE5A 4S2JA 3WS5A 4WEKA 5HARA 1K57C 2EXAA 4KZAA 1PW1A 4WZ5C 3Q7ZA 1LI9A 4JXWA 4BL3A 2PBYA 5F83A 1JWPA 4YINA 1K55C 5HW3A 5CHUA 2EX8A 5CXWA 5CGWA 2R9WA 3UNWA 1ZG6A 1FCNA 1NXYA 3OPLA 4WBGA 3CMZA 3WS2A 4OOMA 4EBNA 4HBTA 5EVIB 5HX9A 4FCFA 1ZG4A 1MWUA 1NJ4A 3FWLA 1N4OA 2Q9NA 3S22A 1FSWA 1DJAA 2WUQA 3GVBA 3IWQA 4EQIA 4MLLA 3V3RA 4Y0OA 3P09A 2X02A 1K54A 5AQAA 1M40A 3NIAA 3CJMA 3ZNTA 4JBFA 1TEMA 1TDGA 5FAQA 2WAEA 4ZJ1A 3BYDA 3ISGA 5M18A 4ZTKA 4OLDA 3SOIA 2A3UA 4XXRA 3V50A 2X71A 4OPRA 3GR2A 4UA9A 3QNCA 2ZMAA 3PBQA 5CHJA 2WGIA 3HVFA 2Y2HA 4DKIA 1W8YA 3HUOA 1OMEA 2EXBA 3Q81A 4WM9A 3VFHA 3IF6A 3HL9A 3IT9A 4E3OA 3ZDJA 1PWDA 4LCLA 1TVFA 2ZM2A 2P9VB 4UHUA 5DTSA 3RXXA 3DWZA 2PU2A 5CEBA 1JTGA 3ZHHA 2ZQAA 1K6RA 4OOLA 2EFXA 1YQSA 3BFCA 3SH7A 1IEMA 3VP2A 1YLJA 2WAFA 4OH0A 3ITAA 5HAPA 2ZQ8A 4HESA 2CC1A 3A3EA 1XX2A 4ZDXA 4KZ9A 4Y7PA 4QY6A 1H8ZA 2ZC3B 1EROA 5M1AA 2Y59A 2XD1A 3OPRA 4GZBA 3IXBA 1K56D 2HDQA 4IVKA 3QHYA 3VSLA 5CTMA 2WYXA 3TOIA 2RCXA 1Q2PA 1IKGA 4X68A 1XP4A 2OLVA 5DVAA 3HBRA 5E2GA 4C3QA 4R3JA 3WS1A 1L0DA 3GQZA 5A90A 3C4PA 4EV4A 5KMWA 3LO7A 3ZGAB 3BECA 4OKPA 1ES2A 1I5QA 1Q2QA 3Q7VA 3S1YA 1QMEA 1S0WA 1IYSA 4UA7A 5E2EA 1ES5A 1Y54A 4WZ4A 3DWKA 3NI9A 4ZJ3A 1GHPA 4CJNA 2VGKA 5L2FA 1W79A 2G2WA 3G35A 4Z9QA 3ZCZA 4X55A 2WGWB 3PAEA 1E4DA 2Y2QA 3A3FA 4UAAA 4RX2A 2I72A 3SS5A 2XQZA 4DDSA 3MXSA 4KZ3A 1HTZA 4OP8A 5EVID 4RYEA 5FAOA 3UE0A 3GRJA 1FSYA 3VP1A 1ES3A 1L0GA 5EVIA 1HD8A 3BFDA 3NBLA 1YLWA 3HLBA 3PBTA 3NCKA 5GHXA 2IWDA 3CZDA 2IWCA 4PM7A 3G30A 4K0XA 4C75A 3G4PA 4JLFA 5CTNA 4X53A 1NZOA 1XXMA 3N4IA 4U3TA 1PW8A 2IWBA 2Z2MB 1SKFA 3MXRA 3AGDA 4B88A 1JVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HP5 A;  5AQB A;  2DRW A;  1E3U D;  1K57 A;  2XDM A;  4WZ5 A;  5CEC A;  2PU4 A;  4BD0 A;  5EPH A;  3UN7 A;  5KZH A;  1PZO A;  3BLS A;  3WRT A;  4P85 A;  3HLF A;  1E3U A;  3G32 A;  3OCL A;  1K55 A;  3RXW A;  4JF4 A;  4S2P A;  3GTC A;  3SH8 A;  4QJG A;  2H5S A;  1JWZ A;  1GHI A;  3QNB A;  5DF9 A;  4E6W A;  4PM5 A;  3RJU A;  2RL3 A;  1BUL A;  4D2O A;  4KG5 A;  2P9V A;  3ZG5 A;  4M3K A;  3BFF A;  2Y4A A;  1YT4 A;  4E3L A;  4XUX A;  4S2N C;  1I2S A;  3A3J A;  5FQM A;  1ERM A;  1EWZ A;  4PM9 A;  1YLZ A;  4MBH A;  3N8S A;  1WYC A;  1L2S A;  4N1X A;  1NY0 A;  4NK3 A;  4E3J A;  3VOY A;  1BZA A;  4E6X A;  1E25 A;  1SDE A;  4KQO A;  2WKE A;  3W8K A;  2XD5 A;  2H0Y A;  3DW0 A;  4QU3 A;  5E2F A;  5GLA A;  4S2L A;  5FQ9 A;  1XKZ A;  1XA7 A;  3V3S A;  3IHB A;  4OP5 A;  2Y2G A;  2G2U A;  5HFO A;  4ZAM A;  3ZFZ A;  1MBL A;  5BOH A;  4R23 A;  5AQ9 A;  1K38 A;  1MPL A;  4WMC D;  1I2W A;  3O3V A;  1K25 A;  3C4O A;  4FD8 A;  1ZKJ A;  3LY4 A;  1KVL A;  4WMC A;  3PBS A;  5CRF A;  2OV5 A;  2JBF A;  3G2Z A;  1ES4 A;  3ZG7 B;  4KG2 A;  3B3X A;  1BUE A;  3JYI A;  4JXG A;  3GV9 A;  1KE3 A;  1MXO A;  5EE8 A;  5FAS A;  4FH4 A;  1FR6 A;  3O88 A;  4OVD A;  1G6A A;  1KE0 A;  3MFD A;  4GB7 A;  2WGW A;  3M2K A;  4N9L A;  3ZG8 B;  2ZC7 A;  1ALQ A;  1MWR A;  4GKU A;  1VQQ A;  1IYO A;  4OON A;  4S2M A;  1CI9 A;  1PIO A;  5FQQ A;  3W4P A;  1N9B A;  1FR1 A;  3D4F A;  1FOF A;  4S2O A;  1GHM A;  4FH2 A;  3BM6 A;  5IHV A;  4HBU A;  4ZBE A;  3Q82 A;  3LY3 A;  1K4F A;  4BL2 A;  5FDH A;  1BT5 A;  4N1H A;  4R1G A;  5EVL A;  3IF6 C;  3BEB A;  5DTT A;  5HAI A;  1KGG A;  1K56 A;  2C6W B;  3OPH A;  5KSC A;  5FAT A;  4K91 A;  2ZQ9 A;  1BLS A;  2DNS A;  3ZVW A;  2J8Y A;  3TG9 A;  1PYY A;  4GD6 A;  5F1F A;  1XGI A;  4WEJ A;  1BTL A;  3MKE A;  3UDI A;  4DDY A;  3IH9 A;  4U0X A;  2X01 A;  4DE1 A;  4KG6 A;  3PTE A;  3W4Q A;  2ZJ9 A;  5GLD A;  2EFU A;  2R9X A;  4Q8I A;  3VMA A;  2XLN A;  4EWF A;  2XF3 A;  4OQ0 A;  1PWG A;  5FQK A;  5M19 A;  3MZE A;  3E2K A;  4F94 A;  3G31 A;  3HUM A;  3VFF A;  1FQG A;  4IBX A;  3VSK A;  4DRT A;  2QZ6 A;  3N6I A;  4MBF A;  3M2J A;  4DE2 A;  2H0T A;  3A3D A;  2E8I A;  5U47 A;  3A3I A;  4UA6 A;  3SH9 A;  4R3B A;  3G34 A;  1K6S A;  4EBL A;  4QB8 A;  2HP6 A;  3LEZ A;  3WS0 A;  4KZB A;  5DF7 A;  5FQJ A;  3SS3 A;  4KZ7 A;  5FI7 A;  1LLB A;  2JCH A;  3BFE A;  1W8Q A;  2UWX A;  5FQI A;  2Y2J A;  3FV7 A;  2J9O A;  4PM6 A;  4DE3 A;  1NYY A;  3M6B A;  4LCM A;  3EQV A;  2Y2M A;  2XR0 A;  1KDS A;  4LV0 A;  5TFQ A;  3UPO A;  1BLC A;  1K4E A;  3IXH A;  4QHC A;  1BLP A;  1CEF A;  4N92 A;  3OZH A;  4JKT A;  2Y2P A;  5CGS A;  3UPN A;  5E2H A;  4KZ8 A;  1YMX A;  4IVI A;  3N8L A;  5FI6 A;  1KDW A;  4O7D A;  3WRZ A;  4EUZ A;  1IYQ A;  3GMW A;  4HEF A;  3ZVT A;  3EQU A;  4E3N A;  3P98 A;  1Z6F A;  1MKI A;  1BSG A;  3IF5 A;  1FCO A;  1JWV A;  3Q07 A;  4ID4 A;  4BQM A;  1NYM A;  1O7E A;  3BRM A;  1W5D A;  4LV3 A;  1FCM A;  1ONG A;  1PZP A;  2Q9M A;  1NRF A;  4GDN A;  3AGE A;  3PAG A;  3NY4 A;  2ZLY A;  3VOZ A;  4C6Y A;  2QMI A;  1U60 A;  4L0L A;  4P6B A;  2WAD A;  5EUA A;  5FAP A;  4FSF A;  1MWS A;  4GNU A;  4LV2 A;  5JYP A;  3Q7V B;  4JXS A;  2FFY A;  4BLM A;  4LV1 A;  2ZC6 B;  1H8Y A;  2XH9 A;  4NET A;  4BJP A;  2EX9 A;  2ZC5 B;  3M6H A;  3FKW A;  3NDG A;  1HVB A;  3IWI A;  2EX6 A;  4OPQ A;  4GN2 A;  5E43 A;  5EOO A;  5TGF A;  1IKI A;  1ONH A;  1WYB A;  1YMS A;  2JC7 A;  2V1Z A;  4R4S A;  4RX3 A;  3S4X A;  4GDB A;  3BFG A;  2HP9 A;  2XFT A;  2WKI A;  4B4X A;  1DY6 A;  3HLW A;  3PBO A;  3N8R A;  1MWT A;  3HUN A;  5CER A;  3UPP A;  1LL5 A;  1W7F A;  4JPM A;  1LHY A;  2WZZ A;  2BLS A;  3MKF A;  3MZD A;  1QMF A;  3I7J A;  5DTK A;  2EX2 A;  4OPY A;  1RGZ A;  1ZC2 A;  3N7W A;  4PM8 A;  3VP0 A;  1YLY A;  1G68 A;  1TDL A;  1YLT A;  5F82 A;  3V5M A;  3TSG A;  1BLH A;  1KVM A;  1DJB A;  1LL9 A;  2DCF A;  4GOG A;  4N9K A;  4QD4 A;  3HLD A;  3UE3 A;  4K0W A;  4KZ5 A;  4P0M A;  3ZG9 B;  4X56 A;  5GHZ A;  3HLE A;  1IEL A;  1SHV A;  3ZNY A;  4E3K A;  3VP3 A;  1YM1 A;  4RA7 A;  2C5W B;  2WZX A;  3DTM A;  4IED A;  1NZU A;  4JXV A;  4KZ6 A;  4WYY A;  3UE1 A;  5TR7 A;  3W4O A;  1JTD A;  5HAQ A;  1PI5 A;  1K54 C;  4IBR A;  2HDU A;  4YFM A;  2XGN A;  4OPZ A;  1DJC A;  1XPB A;  4PPR A;  1L0E A;  5GLB A;  4OOY A;  2Y2L A;  5I94 A;  1AXB A;  5DF8 A;  2P74 A;  4QY5 A;  1CK3 A;  1XA1 A;  1GA0 A;  4PMA A;  3OPP A;  1VM1 A;  4KQR A;  5EEC A;  4RVA A;  1L0F A;  4OLG A;  4MBK A;  3GSG A;  1J9M A;  2VGJ A;  3IH8 A;  1ESI A;  3MBZ A;  3O86 A;  4Y0U A;  3HRE A;  2WK0 A;  2J9P A;  3UY6 A;  5FA7 A;  3E2L A;  5D3O A;  2FFF B;  5F1G A;  5AQ7 A;  1HZO A;  1CEG A;  2Y91 A;  1M6K A;  1LI0 A;  1MY8 A;  3UDX A;  2B5R A;  4X69 A;  4B4Z A;  4KZ4 A;  3BLM A;  4MNR A;  2H10 A;  3NDE A;  4DF6 A;  5CED A;  2OSU A;  2OLU A;  4OQI A;  4BD1 A;  4MEZ A;  1RGY A;  3FZC A;  4JF5 A;  5J8X A;  2XK1 A;  3OC2 A;  1ESU A;  5CHM A;  1ERQ A;  2QPN A;  2WGV A;  5FSR A;  4CPK A;  3C5A A;  5HL1 A;  2XEP A;  1KGF A;  1CI8 A;  2Y2I A;  1C3B A;  1EI5 A;  2ZQD A;  3PBN A;  1WE4 A;  3IF6 B;  4P87 A;  4S2I A;  4DE0 A;  2XFS A;  2HDS A;  1SDN A;  2Y2O A;  4GD8 A;  2A49 A;  4ZJ2 A;  4BEN A;  4JF6 A;  5A92 A;  2ZM0 A;  5KSH A;  3IXD A;  4R0Q A;  3ZG0 A;  3SS4 A;  1YLP A;  5GHY A;  5CGX A;  4OQH A;  4LEN A;  2V20 A;  1RP5 A;  3HLG A;  1XGJ A;  4Y0T A;  3UDF A;  4DXB A;  3IWO A;  4X6T A;  5G18 A;  2HPB A;  1H5X A;  4H8R A;  3CG5 A;  2J7V A;  3FKV A;  3G2Y A;  5GL9 A;  3PBR A;  1GCE A;  3UO9 A;  3AGF A;  4S2K A;  2Y55 A;  4KQQ A;  1O07 A;  2WKH A;  2Z2L B;  2ZQ7 A;  2Y2N A;  5GLC A;  4R4R A;  2GDN A;  1PI4 A;  4WEL A;  2Y2K A;  2ZC4 B;  4S2N A;  5A91 A;  1GA9 A;  4OQG A;  1SCW A;  2ZQC A;  4DXC A;  1KE4 A;  2ZD8 A;  3VP4 A;  2V2F F;  3O87 A;  5EOE A;  5EVI C;  3LCE A;  3MZF A;  4A5R A;  4E3I A;  3IHA A;  1RCJ A;  3WWX A;  4E3M A;  2ZM8 A;  3V39 A;  5FI2 A;  3WS4 A;  3C7V A;  3OCN A;  5JYO A;  3IXG A;  3IQA A;  1KGE A;  3NC8 A;  3Q1F A;  4EBP A;  3HLC A;  3FYZ A;  2BG1 A;  2HDR A;  3ITB A;  1PWC A;  3C7U A;  4KEN B;  4U0T A;  4XUZ A;  5A93 A;  1IYP A;  1S6R A;  2JE5 A;  4S2J A;  3WS5 A;  4WEK A;  5HAR A;  1K57 C;  2EXA A;  4KZA A;  1PW1 A;  4WZ5 C;  3Q7Z A;  1LI9 A;  4JXW A;  4BL3 A;  2PBY A;  5F83 A;  1JWP A;  4YIN A;  1K55 C;  5HW3 A;  5CHU A;  2EX8 A;  5CXW A;  5CGW A;  2R9W A;  3UNW A;  1ZG6 A;  1FCN A;  1NXY A;  3OPL A;  4WBG A;  3CMZ A;  3WS2 A;  4OOM A;  4EBN A;  4HBT A;  5EVI B;  5HX9 A;  4FCF A;  1ZG4 A;  1MWU A;  1NJ4 A;  3FWL A;  1N4O A;  2Q9N A;  3S22 A;  1FSW A;  1DJA A;  2WUQ A;  3GVB A;  3IWQ A;  4EQI A;  4MLL A;  3V3R A;  4Y0O A;  3P09 A;  2X02 A;  1K54 A;  5AQA A;  1M40 A;  3NIA A;  3CJM A;  3ZNT A;  4JBF A;  1TEM A;  1TDG A;  5FAQ A;  2WAE A;  4ZJ1 A;  3BYD A;  3ISG A;  5M18 A;  4ZTK A;  4OLD A;  3SOI A;  2A3U A;  4XXR A;  3V50 A;  2X71 A;  4OPR A;  3GR2 A;  4UA9 A;  3QNC A;  2ZMA A;  3PBQ A;  5CHJ A;  2WGI A;  3HVF A;  2Y2H A;  4DKI A;  1W8Y A;  3HUO A;  1OME A;  2EXB A;  3Q81 A;  4WM9 A;  3VFH A;  3IF6 A;  3HL9 A;  3IT9 A;  4E3O A;  3ZDJ A;  1PWD A;  4LCL A;  1TVF A;  2ZM2 A;  2P9V B;  4UHU A;  5DTS A;  3RXX A;  3DWZ A;  2PU2 A;  5CEB A;  1JTG A;  3ZHH A;  2ZQA A;  1K6R A;  4OOL A;  2EFX A;  1YQS A;  3BFC A;  3SH7 A;  1IEM A;  3VP2 A;  1YLJ A;  2WAF A;  4OH0 A;  3ITA A;  5HAP A;  2ZQ8 A;  4HES A;  2CC1 A;  3A3E A;  1XX2 A;  4ZDX A;  4KZ9 A;  4Y7P A;  4QY6 A;  1H8Z A;  2ZC3 B;  1ERO A;  5M1A A;  2Y59 A;  2XD1 A;  3OPR A;  4GZB A;  3IXB A;  1K56 D;  2HDQ A;  4IVK A;  3QHY A;  3VSL A;  5CTM A;  2WYX A;  3TOI A;  2RCX A;  1Q2P A;  1IKG A;  4X68 A;  1XP4 A;  2OLV A;  5DVA A;  3HBR A;  5E2G A;  4C3Q A;  4R3J A;  3WS1 A;  1L0D A;  3GQZ A;  5A90 A;  3C4P A;  4EV4 A;  5KMW A;  3LO7 A;  3ZGA B;  3BEC A;  4OKP A;  1ES2 A;  1I5Q A;  1Q2Q A;  3Q7V A;  3S1Y A;  1QME A;  1S0W A;  1IYS A;  4UA7 A;  5E2E A;  1ES5 A;  1Y54 A;  4WZ4 A;  3DWK A;  3NI9 A;  4ZJ3 A;  1GHP A;  4CJN A;  2VGK A;  5L2F A;  1W79 A;  2G2W A;  3G35 A;  4Z9Q A;  3ZCZ A;  4X55 A;  2WGW B;  3PAE A;  1E4D A;  2Y2Q A;  3A3F A;  4UAA A;  4RX2 A;  2I72 A;  3SS5 A;  2XQZ A;  4DDS A;  3MXS A;  4KZ3 A;  1HTZ A;  4OP8 A;  5EVI D;  4RYE A;  5FAO A;  3UE0 A;  3GRJ A;  1FSY A;  3VP1 A;  1ES3 A;  1L0G A;  5EVI A;  1HD8 A;  3BFD A;  3NBL A;  1YLW A;  3HLB A;  3PBT A;  3NCK A;  5GHX A;  2IWD A;  3CZD A;  2IWC A;  4PM7 A;  3G30 A;  4K0X A;  4C75 A;  3G4P A;  4JLF A;  5CTN A;  4X53 A;  1NZO A;  1XXM A;  3N4I A;  4U3T A;  1PW8 A;  2IWB A;  2Z2M B;  1SKF A;  3MXR A;  3AGD A;  4B88 A;  1JVJ A; 
#chains in the Genus database with same CATH topology
 5AQB A;  2DRW A;  3R4K A;  1E3U D;  4CLC C;  5HL6 A;  2CMN A;  5EPH A;  4MN7 A;  3OCL A;  2O9A A;  1PNE A;  2H5S A;  3CWF A;  1JWZ A;  1XJ3 A;  4BBU A;  2RL3 A;  4YWZ A;  4HHD A;  3OLO A;  1Y28 A;  4E3L A;  3MSH A;  4HNB A;  1I2S A;  3A3J A;  3C2W A;  1STZ A;  1ERM A;  3T4J A;  2GX5 A;  4N1X A;  4NK3 A;  1E25 A;  1SDE A;  2WKE A;  3W8K A;  3QP5 A;  2H0Y A;  4QU3 A;  5E2F A;  4G3K A;  1XKZ A;  1TS7 A;  4YOF A;  4B9O A;  1MKM A;  5AQ9 A;  1K38 A;  1OJG A;  2V9A A;  4FD8 A;  3LY4 A;  1TS6 A;  3ZG7 B;  3B3X A;  3JYI A;  4L9E A;  4WUJ A;  2WKR A;  3MFD A;  4K08 A;  4GB7 A;  2O9C A;  3M2K A;  2NUP C;  1VEU B;  1T19 A;  1VQQ A;  5G4Y A;  3D4F A;  4HP9 A;  2QYB A;  3BM6 A;  2M7V A;  4HBU A;  4ZBE A;  3TRC A;  1K4F A;  3MQO A;  4R1G A;  3UMD A;  3G6O A;  2M7U A;  3F1O B;  4K91 A;  2ZMF A;  2WKQ A;  3E4Q A;  4LPZ A;  4ME4 A;  4DDY A;  4DE1 A;  4KG6 A;  3VMA A;  3G31 A;  1FQG A;  2J3T D;  4MBF A;  3M2J A;  4BBV A;  2I9V A;  3A3D A;  4MCW A;  3A3I A;  4UA6 A;  2VA0 A;  3RFB A;  3UB7 A;  4KUK A;  3GEC A;  2XRN A;  2HP6 A;  2HGV A;  3SS3 A;  2AVX A;  4KZ7 A;  5FI7 A;  2BTF P;  2VGL M;  1LLB A;  4CLC D;  2W27 A;  1OT6 A;  2ZBB A;  2J9O A;  4PM6 A;  4Q0J A;  3EWK A;  5C5K A;  2Y2M A;  1G28 A;  1V9Z A;  2HJ9 C;  3MXQ A;  5DJT A;  1CEF A;  3OZH A;  2Y2P A;  2VZW A;  1YMX A;  3T4K A;  5FI6 A;  1KDW A;  3LGO A;  4EUZ A;  3ZVT A;  3P98 A;  2PBD P;  4EES A;  3Q07 A;  4CLC E;  4ID4 A;  1NYM A;  1W5D A;  4LV3 A;  2Q9M A;  1NRF A;  4GDN A;  3AGE A;  3VOZ A;  2QMI A;  1U60 A;  4HJ6 A;  4L0L A;  4FSF A;  4LV2 A;  2FFY A;  2ZC5 B;  3FKW A;  4L9F A;  2EX6 A;  2W1T B;  4GN2 A;  4HP4 A;  5TGF A;  1IKI A;  1WYB A;  4RX3 A;  2JC7 A;  4JGQ A;  4GDB A;  4R3A A;  1S67 L;  3UPP A;  1LL5 A;  1CQA A;  2WZZ A;  1LSX A;  3T1R A;  1H0M A;  3I7J A;  5F82 A;  2P08 A;  1VHM A;  3TSG A;  4II7 A;  2JKT I;  2P04 A;  3HLD A;  4P0M A;  3OOV A;  3HLE A;  1IEL A;  3ZNY A;  3EGD C;  3VP3 A;  4RA7 A;  4KZ6 A;  4WYY A;  3UE1 A;  5TR7 A;  5HAQ A;  2LB9 A;  2XGN A;  2JKR I;  1F9I A;  1L0E A;  2Y2L A;  5I94 A;  1JVJ A;  2P74 A;  2H28 A;  1VM1 A;  4KQR A;  3LID A;  4OLG A;  4NKP A;  1YPR A;  2VGJ A;  3LIC A;  3UY6 A;  3E2L A;  3TE8 A;  1CEG A;  3HJI A;  2Y91 A;  1M6K A;  1LI0 A;  3E4P A;  1T18 A;  3UDX A;  4KZ4 A;  3BLM A;  5F6A A;  4JF5 A;  5J8X A;  2XK1 A;  2YKF A;  5CHM A;  2QPN A;  3H7W B;  4MMN A;  3P01 A;  2FZ0 A;  2Y2I A;  4S2I A;  3PBN A;  4JGR A;  1HLU P;  4ZJ2 A;  5A92 A;  4JF6 A;  5FEF A;  5GHY A;  4LEN A;  3DTI A;  3IS2 A;  2KDK A;  2HPB A;  3FKV A;  3G2Y A;  1S4R A;  1O07 A;  2Z2L B;  4HI4 A;  2GDN A;  1PI4 A;  2ZC4 B;  5A91 A;  2BAS A;  2ZQC A;  3HJK A;  2V2F F;  3O87 A;  4E3I A;  5HDC A;  4GS9 A;  2L4R A;  3V39 A;  5JYO A;  5TBM A;  1KGE A;  3DBA A;  3LIB A;  2HDR A;  3C7U A;  4KEN B;  5A93 A;  3WS5 A;  5DFX A;  3LI8 A;  4MN6 A;  4UQI M;  1LSV A;  3ZYT A;  4YIN A;  1YSP A;  2EX8 A;  2R9W A;  3UNW A;  2ACG A;  3WS2 A;  3F1N A;  4EBN A;  4HBT A;  5EVI B;  3P7N A;  5HWT A;  3W2Z A;  1DJA A;  2WUQ A;  2PT7 A;  4Y0O A;  3P09 A;  1K54 A;  4DJ3 A;  2WAE A;  3ISG A;  4OLD A;  3E4O A;  4OPR A;  3CI6 A;  2E8J A;  3IBJ A;  1OME A;  4E3O A;  4I39 A;  1PWD A;  2ZM2 A;  4UHU A;  1SKO B;  3DWZ A;  3T4Q A;  5CEB A;  4DN0 A;  2WAF A;  1H3Q A;  2V8F A;  1K0K A;  1T1C A;  4PHT A;  1ERO A;  5L8M A;  2XD1 A;  4GZB A;  2HDQ A;  5CTM A;  1IKG A;  5FEG A;  4C3Q A;  4F3L B;  4EV4 A;  3PXP A;  4MDZ A;  5KMW A;  3BEC A;  1TF1 A;  3C30 A;  3S1Y A;  4UA7 A;  3DWK A;  2G2W A;  4X55 A;  2Y2Q A;  2I72 A;  4DDS A;  4KZ3 A;  2OOL A;  4RYE A;  1ZHH B;  5J4E A;  1G5U A;  3EOI A;  1FSY A;  3GRJ A;  3VP1 A;  4YNR A;  5EFW A;  1LL8 A;  5CTN A;  3N4I A;  1VET B;  3ZQ5 A;  3MXR A;  4Y15 A;  3AGD A;  5HPF A;  2XDM A;  1G6O A;  5CEC A;  4BD0 A;  5HDD A;  4P85 A;  3HLF A;  3G32 A;  4JF4 A;  3JVU A;  3H82 B;  2P7J A;  4HQA A;  3QNB A;  4E6W A;  4PM5 A;  1BUL A;  1W63 Q;  3LI9 A;  4M3K A;  2Y4A A;  1YT4 A;  4XUX A;  4PM9 A;  5K5B A;  2QJ5 A;  1NY0 A;  3T4L A;  3VOY A;  1T1A A;  3GDI A;  3T4S A;  1OTB A;  2XD5 A;  4CLC B;  5GLA A;  5FQ9 A;  1XA7 A;  4OP5 A;  2Y2G A;  2G2U A;  1YKD A;  5BOH A;  4H6J A;  3LR0 A;  1FIK A;  4HOI A;  2VEA A;  3O3V A;  3UME A;  4WLA A;  4WMC A;  2JBF A;  3G2Z A;  4JGP A;  4MN5 A;  3SZT A;  3LR3 A;  3ULF A;  1BUE A;  3QP1 A;  3K3C A;  5FAS A;  1FR6 A;  3O88 A;  1S4S A;  4GS9 B;  2V0U A;  2WGW A;  4N9L A;  3ZG8 B;  1ALQ A;  3FC7 A;  3RH8 B;  4OON A;  1CI9 A;  5FQQ A;  3W4P A;  1FOF A;  1GHM A;  1P0Z A;  1P97 A;  3LY3 A;  3SW1 A;  5DTT A;  5HAI A;  3R7W B;  2GZA A;  1BLS A;  1DRM A;  3TG9 A;  4NEE D;  1PYY A;  2A2L A;  4WEJ A;  3MKE A;  4U0X A;  4Q8I A;  5DJU A;  2XF3 A;  3OBF A;  4EWF A;  1PWG A;  3E2K A;  3VSK A;  1DP9 A;  3N6I A;  4DE2 A;  3B47 A;  3EEA A;  4QWO A;  1A0K A;  1YSQ A;  3CHW P;  4EBL A;  5DKK A;  5DF7 A;  5FQJ A;  3MF0 A;  3BFE A;  5FQI A;  4NXE A;  3M6B A;  4GW9 A;  3L7H A;  5HSQ A;  1TS0 A;  2XR0 A;  2OAQ 1;  2HF6 A;  1BLC A;  1K4E A;  3IXH A;  4QHC A;  1BLP A;  5KIZ A;  1H8M A;  3UPN A;  5E2H A;  4KZ8 A;  4IVI A;  4O7D A;  3GMW A;  1Z6F A;  1MKI A;  4EQ1 A;  3IF5 A;  1O7E A;  2YKH A;  3NY4 A;  2ZOH A;  3K2N A;  2WAD A;  5EUA A;  1XJ6 A;  4GNU A;  4BLM A;  3IWI A;  3VV4 A;  4EER A;  1XFQ A;  1ONH A;  4FOF A;  2O9B A;  4I38 A;  4B4X A;  3PBO A;  3N8R A;  3BQA A;  1LHY A;  3MKF A;  4HH3 A;  3MZD A;  1QMF A;  2EX2 A;  3LFV A;  3N7W A;  3VE3 A;  1F2K A;  3KSF A;  2QWS A;  1DJB A;  1LL9 A;  1XJ4 A;  5I5L A;  2VGL S;  2WZX A;  4IED A;  4FUW A;  1CF0 A;  1K54 C;  4YFM A;  1DJC A;  4OOY A;  4Y5F A;  1AXB A;  4ARZ B;  4QY5 A;  1GSX A;  1GA0 A;  1F5M A;  4MBK A;  3EEH A;  2KLI A;  4EET B;  1ESI A;  3QP6 A;  1N9L A;  3HRE A;  2WK0 A;  4LRZ E;  5D3O A;  2FFF B;  3O5Y A;  4NXF A;  4O0P A;  2B5R A;  4X69 A;  2H10 A;  4DF6 A;  2OSU A;  4RQ9 A;  4OQI A;  1RGY A;  5HPI A;  4GHI A;  2W0N A;  1ACF A;  2WGV A;  5HL1 A;  2XEP A;  2ZQD A;  1WE4 A;  3IF6 B;  5IS1 A;  2XFS A;  4GD8 A;  1OTI A;  2A49 A;  5KSH A;  4X25 A;  2J3W A;  3ZG0 A;  4PKY A;  2V20 A;  2M1C A;  3HLG A;  4Y17 A;  5EV0 A;  3C38 A;  5G18 A;  2XA7 S;  3CG5 A;  4Y2F A;  2J7V A;  3CLO A;  3UB6 A;  3LIF A;  1GCE A;  3NOT C;  3UO9 A;  2NUT C;  3AGF A;  2Y55 A;  4KQQ A;  5GLC A;  1GA9 A;  1KE4 A;  5EOE A;  3MZF A;  3U4L P;  2ZM8 A;  3WS4 A;  4Q0H A;  3IQA A;  5F69 A;  1XJ2 A;  3HLC A;  4U0T A;  4XUZ A;  2JKT M;  1PW1 A;  4X1L A;  4UEY A;  4BL3 A;  3CIT A;  5F83 A;  1S1Z A;  1JWP A;  3MQQ A;  4D60 A;  1KOU A;  3OPL A;  4WBG A;  1OTD A;  3NOP C;  1PFL A;  1D06 A;  5HX9 A;  2JKR M;  4EQI A;  2INW A;  3KYZ A;  5L09 A;  3ZNT A;  3CJM A;  1TEM A;  4XT2 B;  4PAU A;  4ZTK A;  1V9Y A;  2XA7 M;  4XXR A;  3V50 A;  3UB5 P;  4UA9 A;  2ZMA A;  3TW8 A;  3HVF A;  1W8Y A;  3HUO A;  5FL3 A;  4EUV A;  2GJ3 A;  3ICY A;  1TVF A;  5HD3 A;  2PU2 A;  4OH0 A;  5HAP A;  2VV6 A;  2ZQ8 A;  1SZV A;  1DP8 A;  2B02 A;  5AVE A;  2W3D A;  4KZ9 A;  2EA9 A;  4Y7P A;  3NEC A;  3FPW A;  3BY8 A;  1H8Z A;  2ZC3 B;  5M1A A;  3K3D A;  1K56 D;  3LUQ A;  2W1R A;  1BYW A;  2G7U A;  3TOI A;  3MS6 A;  2VLG A;  4X68 A;  4UQI S;  3C4P A;  3ZGA B;  1I5Q A;  3Q7V A;  4B93 A;  4CJN A;  2DMW A;  3NI9 A;  4ZJ3 A;  2VGK A;  5L2F A;  3G35 A;  1LSW A;  3A3F A;  3SS5 A;  3MXS A;  3A0R A;  4ETZ A;  1UWN X;  3NOU C;  3F1P A;  1ES3 A;  1L0G A;  1HD8 A;  2VK3 A;  3BFD A;  3NBL A;  3NCK A;  2IWD A;  3BJN A;  4P6Z S;  3G4P A;  4JLF A;  1NZO A;  1XXM A;  4WZ5 A;  3U2A A;  2PU4 A;  5KZH A;  1PZO A;  3BLS A;  2J80 A;  1K55 A;  4FTX A;  4QJG A;  1GHI A;  2P9V A;  3ZG5 A;  2A24 A;  2KX6 A;  1EWZ A;  1YLZ A;  5F68 A;  3B33 A;  4LFU A;  1WYC A;  1L2S A;  2PRF A;  4GLQ A;  4E6X A;  5MC7 A;  1X0O A;  4KQO A;  3DW0 A;  4S2L A;  1OT9 A;  3V3S A;  3IHB A;  5HFO A;  4ZAM A;  3MJQ A;  2Z6D A;  4WMC D;  3BY9 A;  3DTE A;  2JKF A;  1I2W A;  1IFQ A;  1K25 A;  2QJ7 A;  3C4O A;  1ZKJ A;  3KYE A;  3PBS A;  4P6Z M;  1F98 A;  4KG2 A;  4JXG A;  3GV9 A;  1MXO A;  4FH4 A;  3CPT A;  2MJ6 A;  1FIL A;  1PIO A;  1N9B A;  3VOL A;  3Q82 A;  2OWJ A;  2QKP A;  1UGU A;  1K56 A;  3OPH A;  2O99 A;  4AFI A;  2ZQ9 A;  2DNS A;  3MQ0 A;  2J8Y A;  3ZVW A;  5F1F A;  1XGI A;  1BTL A;  2X01 A;  5GLD A;  2EFU A;  4O01 A;  1IOU A;  1UWP X;  4I5S A;  3BW6 A;  4HJ3 A;  3HUM A;  4IBX A;  1ODV A;  2QZ6 A;  5HDS A;  2E8I A;  3SH9 A;  3UE6 A;  4PKY G;  3IX3 A;  4X1M A;  4R3B A;  2LB5 A;  3WS0 A;  2PYP A;  2V1A A;  4KQD A;  2JCH A;  1W8Q A;  4DE3 A;  3LEQ A;  4NXG A;  4LCM A;  2PD8 A;  3UPO A;  2JKG A;  5TFQ A;  5HWW A;  4JKT A;  5CGS A;  4LRX C;  3WRZ A;  5L07 A;  1IYQ A;  4HEF A;  3EQU A;  3PR6 A;  1BSG A;  1FCO A;  1JWV A;  4BQM A;  2L0W A;  1FCM A;  1PZP A;  3PAG A;  5JYP A;  1MWS A;  3Q7V B;  3NJA A;  1H8Y A;  2XH9 A;  4I3I A;  1VEU A;  4BJP A;  2EX9 A;  1HVB A;  5EOO A;  4BMW A;  1YMS A;  4R4S A;  2UV0 E;  3IS2 B;  3HLW A;  1MWT A;  1W63 M;  3HUN A;  1W7F A;  2BLS A;  1NWZ A;  3VE4 A;  5DTK A;  1RGZ A;  1ZC2 A;  4PM8 A;  3VP0 A;  1YLT A;  3F1O A;  3V5M A;  1BLH A;  3T50 A;  4IUK A;  2DCF A;  4QD4 A;  5GHZ A;  1SHV A;  1YM1 A;  2C5W B;  1T1B A;  1NZU A;  5FDS A;  5TBM B;  3LR5 A;  3E98 A;  2HDU A;  4OPZ A;  5GLB A;  5DF8 A;  1GSV A;  4PMA A;  3OPP A;  5EEC A;  4IHQ A;  4RVA A;  3QP4 A;  4ESP A;  3GSG A;  2D01 A;  3F1N B;  1TD5 A;  4Y0U A;  5FA7 A;  4NXB A;  5F1G A;  5AQ7 A;  1HZO A;  1XFN A;  1NRJ A;  4B4Z A;  2B95 A;  2GNX A;  1DP6 A;  4MNR A;  3NDE A;  5CED A;  4BD1 A;  4MEZ A;  3FZC A;  4EEP A;  3DTK A;  5FSR A;  1S66 L;  4CPK A;  1KGF A;  1CI8 A;  4Y13 A;  1C3B A;  4P87 A;  2HDS A;  2Y2O A;  2W3G A;  3T1Q B;  2XRO A;  2W1T A;  3SS4 A;  1YLP A;  3CPT B;  4OQH A;  2Z6C A;  1RP5 A;  2ZL1 A;  3UDF A;  4DXB A;  2V1B A;  3IWO A;  4LLO B;  2O0Y A;  2HV1 A;  3CUE C;  4H8R A;  3PBR A;  1AWI A;  2B18 A;  3QP2 A;  2WKH A;  2Y2N A;  4R4R A;  3D3O A;  4OQG A;  2D02 A;  4EW7 A;  3S7O A;  3VP4 A;  3LCE A;  4A5R A;  3T1S A;  4Y3I A;  4E3M A;  5FI2 A;  3IXG A;  3NC8 A;  3FPV A;  3ITB A;  1IYP A;  2JE5 A;  2PR6 A;  3S7P A;  5HAR A;  2EXA A;  4WF0 A;  4WZ5 C;  1S1Y A;  1OTE A;  2W3F A;  4JXW A;  5DFY A;  1K55 C;  5HW3 A;  5CHU A;  5CXW A;  1NXY A;  3CMZ A;  3PYP A;  4OOM A;  5IT5 A;  4FCF A;  1ZG4 A;  2W3H A;  2XSS A;  1MWU A;  1NJ4 A;  3S22 A;  1N4O A;  2Q9N A;  1FSW A;  1Z09 A;  4M4X A;  4MLL A;  1CJF A;  1NLY A;  4HJ4 A;  3MMH A;  5AQA A;  1M40 A;  4JBF A;  5FAQ A;  3H9W A;  4ZJ1 A;  3BYD A;  2A3U A;  4GJ4 A;  5G4Z A;  3GR2 A;  3QNC A;  1PRQ A;  3PBQ A;  5CHJ A;  3H7W A;  4DKI A;  5EM0 A;  2EXB A;  2VX8 A;  3VFH A;  2JN7 A;  2K31 A;  5DTS A;  1JTG A;  2ZQA A;  2EFX A;  1YQS A;  3SH7 A;  1IEM A;  3TJZ C;  1YLJ A;  3VP2 A;  4HES A;  2CC1 A;  3IBR A;  4ZDX A;  3IX4 A;  3DAV A;  2V8C A;  3OPR A;  4E04 A;  4IVK A;  3QHY A;  3S7Q A;  3VSL A;  4H6J B;  2RCX A;  1Q2P A;  1XP4 A;  1EW0 A;  3HBR A;  2WKP A;  1GSW A;  3KX0 X;  5E2G A;  4R3J A;  3WS1 A;  5A90 A;  1OJ5 A;  4OKP A;  3T4T A;  1ES2 A;  1QME A;  1IYS A;  2HZ5 A;  5F5Y A;  1ES5 A;  1Y54 A;  1NLZ A;  4WZ4 A;  1W79 A;  2WGW B;  4NG2 A;  3PAE A;  3NHQ A;  4UAA A;  4ZRR A;  3UE0 A;  3KSG A;  1D7E A;  5EVI A;  1YLW A;  5GHX A;  3CZD A;  4PM7 A;  3G30 A;  3JPU A;  3IX8 A;  3KSI A;  5IU1 A;  1SKF A;  4B88 A;  2HP5 A;  1K57 A;  3UN7 A;  4DJ2 A;  3WRT A;  1E3U A;  3RXW A;  4I3J A;  4S2P A;  3GTC A;  3SH8 A;  5EM1 A;  5DF9 A;  3RJU A;  4D2O A;  2VV7 A;  4KG5 A;  1SKO A;  1N9O A;  3A0V A;  3BFF A;  4R38 A;  4S2N C;  2ZMV A;  5FQM A;  3EGX C;  4MBH A;  3N8S A;  5HZH A;  4JGO A;  4E3J A;  1BZA A;  2KOI A;  2R78 A;  2PD7 A;  2ZL1 B;  3LR4 A;  3ZFZ A;  1MBL A;  4R23 A;  1VB6 A;  1MPL A;  4F3L A;  1KVL A;  5CRF A;  2OV5 A;  1ES4 A;  2PYR A;  1KE3 A;  5EE8 A;  4OVD A;  1G6A A;  1KE0 A;  2ZC7 A;  1MWR A;  4GKU A;  1IYO A;  4S2M A;  4G3V A;  1FR1 A;  4S2O A;  4FH2 A;  5IHV A;  4LRY C;  3BWL A;  2OWH A;  4BL2 A;  5FDH A;  1BT5 A;  4N1H A;  5EVL A;  3IF6 C;  3BEB A;  3MR0 A;  1KGG A;  2Y8H A;  2C6W B;  3LIA A;  5KSC A;  5FAT A;  2IA2 A;  1VET A;  5DKL A;  1MC0 A;  4BWI A;  4GD6 A;  2W3E A;  3UDI A;  3IH9 A;  3PTE A;  3W4Q A;  2ZJ9 A;  2R9X A;  2XLN A;  4OQ0 A;  3H82 A;  5FQK A;  5M19 A;  3MZE A;  3CUE A;  4F94 A;  3VFF A;  4DRT A;  4GCZ A;  2V0W A;  1WA9 A;  2H0T A;  3KO6 A;  5U47 A;  3LYX A;  3G34 A;  1K6S A;  2PHY A;  4QB8 A;  3LEZ A;  4KZB A;  2UWX A;  5J3W A;  2Y2J A;  3FV7 A;  5LBR A;  1NYY A;  3EQV A;  4CLC A;  1P9W A;  1KDS A;  4LV0 A;  3PHY A;  5HWV A;  4N92 A;  2K2N A;  3T1X A;  3N8L A;  4EEU A;  3NUL A;  4E3N A;  5AJG A;  1YAX A;  3HCY A;  3BRM A;  4I3A A;  4GHI B;  4ETX A;  1ONG A;  2FH5 A;  2ZLY A;  4C6Y A;  4P6B A;  5L10 A;  5FAP A;  2K7S A;  3KYQ A;  2Y79 A;  4JXS A;  4O8G A;  4LV1 A;  2ZC6 B;  4NET A;  3M6H A;  4OPQ A;  3NDG A;  5E43 A;  3T12 B;  2V1Z A;  3S4X A;  3BFG A;  2HP9 A;  2XFT A;  2WKI A;  1DY6 A;  1OPX A;  5CER A;  4JPM A;  4OPY A;  3R7W A;  1Y4O A;  5HD5 A;  1YLY A;  1G68 A;  1TDL A;  1KVM A;  4GOG A;  4N9K A;  3UE3 A;  4K0W A;  4KZ5 A;  3ZG9 B;  4X56 A;  1ZTU A;  4E3K A;  3DTM A;  4JXV A;  3W4O A;  1JTD A;  1PI5 A;  4IBR A;  1XPB A;  4PPR A;  1CK3 A;  1XA1 A;  1L0F A;  1J9M A;  3IH8 A;  3MBZ A;  3D72 A;  3O86 A;  2J9P A;  2VKS A;  4R70 A;  1LT0 A;  1MY8 A;  4HH2 A;  2OLU A;  4WL9 A;  3OC2 A;  1ESU A;  1ERQ A;  2Q0O A;  2ZOI A;  3C5A A;  1EI5 A;  4DE0 A;  3QP8 A;  1SDN A;  2EWW A;  5J7E A;  4EU0 A;  4BEN A;  5TJJ A;  2ZM0 A;  3IXD A;  4R0Q A;  5CGX A;  4HIA A;  3UB8 A;  1XGJ A;  4Y0T A;  3A0S A;  4Q0I A;  3E0Y A;  4LGW A;  2PDR A;  1JNU A;  4X6T A;  1H5X A;  5GL9 A;  3JVV A;  4S2K A;  2ZQ7 A;  4WEL A;  2Y2K A;  4S2N A;  1SCW A;  4DXC A;  2ZD8 A;  5EVI C;  3IHA A;  1RCJ A;  2PAV P;  3WWX A;  3C7V A;  3OCN A;  1TS8 A;  2OAP 1;  3Q1F A;  4EBP A;  3FYZ A;  2BG1 A;  1PWC A;  4DMZ A;  1S6R A;  4S2J A;  4WEK A;  1K57 C;  4KZA A;  3Q7Z A;  4ARZ A;  1LI9 A;  3D9Y A;  2PBY A;  2VV8 A;  3CAX A;  2VJW A;  5CX7 A;  5CGW A;  1ZG6 A;  1FCN A;  3F1P B;  1P9R A;  5AVF A;  3FWL A;  2L1M A;  4KUO A;  1L3L A;  3IWQ A;  3GVB A;  3V3R A;  2X02 A;  3NIA A;  2PR5 A;  1TDG A;  5M18 A;  3SOI A;  1MZU A;  2X71 A;  4L9G A;  3RTY A;  2WGI A;  2Y2H A;  2EWV A;  3Q81 A;  4WM9 A;  3IF6 A;  3HL9 A;  3IT9 A;  3ZDJ A;  4LCL A;  2P9V B;  3B42 A;  2A24 B;  3RXX A;  3ZHH A;  1K6R A;  4IJG A;  4OOL A;  3BFC A;  4HY8 A;  4BBT A;  3ITA A;  5A8B A;  3A3E A;  1XX2 A;  3BQ8 A;  3FG8 A;  1J3W A;  5EVE A;  3C8C A;  4QY6 A;  4G3W A;  2Y59 A;  4IUH A;  3IXB A;  4CQH A;  2WYX A;  2OLV A;  4QPR A;  5DVA A;  3L9K A;  1L0D A;  3GQZ A;  3LO7 A;  1OTA A;  4Z1W A;  4EXO A;  1Q2Q A;  3LIE A;  1S0W A;  2JHE A;  4WN5 A;  5E2E A;  3UB9 A;  3T4O A;  1GHP A;  2QHK A;  1N9N A;  3ZCZ A;  4Z9Q A;  4R6L A;  3MFX A;  1E4D A;  3V67 A;  4RX2 A;  2XQZ A;  1HTZ A;  4OP8 A;  5EVI D;  5FAO A;  3S7N A;  3PBT A;  3HLB A;  2HJE A;  2J3T C;  2IWC A;  3KSH A;  4K0X A;  4C75 A;  4X53 A;  4U3T A;  1PW8 A;  2IWB A;  2Z2M B;  4XT2 A;  1D1J A; 
#chains in the Genus database with same CATH homology
 2HP5 A;  5AQB A;  2DRW A;  1E3U D;  1K57 A;  2XDM A;  4WZ5 A;  5CEC A;  2PU4 A;  4BD0 A;  5EPH A;  3UN7 A;  5KZH A;  1PZO A;  3BLS A;  3WRT A;  4P85 A;  3HLF A;  1E3U A;  3G32 A;  3OCL A;  1K55 A;  3RXW A;  4JF4 A;  4S2P A;  3GTC A;  3SH8 A;  4QJG A;  2H5S A;  1JWZ A;  1GHI A;  3QNB A;  5DF9 A;  4E6W A;  4PM5 A;  3RJU A;  2RL3 A;  1BUL A;  4D2O A;  4KG5 A;  2P9V A;  3ZG5 A;  4M3K A;  3BFF A;  2Y4A A;  1YT4 A;  4E3L A;  4XUX A;  4S2N C;  1I2S A;  3A3J A;  5FQM A;  1ERM A;  1EWZ A;  4PM9 A;  1YLZ A;  4MBH A;  3N8S A;  1WYC A;  1L2S A;  4N1X A;  1NY0 A;  4NK3 A;  4E3J A;  3VOY A;  1BZA A;  4E6X A;  1E25 A;  1SDE A;  4KQO A;  2WKE A;  3W8K A;  2XD5 A;  2H0Y A;  3DW0 A;  4QU3 A;  5E2F A;  5GLA A;  4S2L A;  5FQ9 A;  1XKZ A;  1XA7 A;  3V3S A;  3IHB A;  4OP5 A;  2Y2G A;  2G2U A;  5HFO A;  4ZAM A;  3ZFZ A;  1MBL A;  5BOH A;  4R23 A;  5AQ9 A;  1K38 A;  1MPL A;  4WMC D;  1I2W A;  3O3V A;  1K25 A;  3C4O A;  4FD8 A;  1ZKJ A;  3LY4 A;  1KVL A;  4WMC A;  3PBS A;  5CRF A;  2OV5 A;  2JBF A;  3G2Z A;  1ES4 A;  3ZG7 B;  4KG2 A;  3B3X A;  1BUE A;  3JYI A;  4JXG A;  3GV9 A;  1KE3 A;  1MXO A;  5EE8 A;  5FAS A;  4FH4 A;  1FR6 A;  3O88 A;  4OVD A;  1G6A A;  1KE0 A;  3MFD A;  4GB7 A;  2WGW A;  3M2K A;  4N9L A;  3ZG8 B;  2ZC7 A;  1ALQ A;  1MWR A;  4GKU A;  1VQQ A;  1IYO A;  4OON A;  4S2M A;  1CI9 A;  1PIO A;  5FQQ A;  3W4P A;  1N9B A;  1FR1 A;  3D4F A;  1FOF A;  4S2O A;  1GHM A;  4FH2 A;  3BM6 A;  5IHV A;  4HBU A;  4ZBE A;  3Q82 A;  3LY3 A;  1K4F A;  4BL2 A;  5FDH A;  1BT5 A;  4N1H A;  4R1G A;  5EVL A;  3IF6 C;  3BEB A;  5DTT A;  5HAI A;  1KGG A;  1K56 A;  2C6W B;  3OPH A;  5KSC A;  5FAT A;  4K91 A;  2ZQ9 A;  1BLS A;  2DNS A;  3ZVW A;  2J8Y A;  3TG9 A;  1PYY A;  4GD6 A;  5F1F A;  1XGI A;  4WEJ A;  1BTL A;  3MKE A;  3UDI A;  4DDY A;  3IH9 A;  4U0X A;  2X01 A;  4DE1 A;  4KG6 A;  3PTE A;  3W4Q A;  2ZJ9 A;  5GLD A;  2EFU A;  2R9X A;  4Q8I A;  3VMA A;  2XLN A;  4EWF A;  2XF3 A;  4OQ0 A;  1PWG A;  5FQK A;  5M19 A;  3MZE A;  3E2K A;  4F94 A;  3G31 A;  3HUM A;  3VFF A;  1FQG A;  4IBX A;  3VSK A;  4DRT A;  2QZ6 A;  3N6I A;  4MBF A;  3M2J A;  4DE2 A;  2H0T A;  3A3D A;  2E8I A;  5U47 A;  3A3I A;  4UA6 A;  3SH9 A;  4R3B A;  3G34 A;  1K6S A;  4EBL A;  4QB8 A;  2HP6 A;  3LEZ A;  3WS0 A;  4KZB A;  5DF7 A;  5FQJ A;  3SS3 A;  4KZ7 A;  5FI7 A;  1LLB A;  2JCH A;  3BFE A;  1W8Q A;  2UWX A;  5FQI A;  2Y2J A;  3FV7 A;  2J9O A;  4PM6 A;  4DE3 A;  1NYY A;  3M6B A;  4LCM A;  3EQV A;  2Y2M A;  2XR0 A;  1KDS A;  4LV0 A;  5TFQ A;  3UPO A;  1BLC A;  1K4E A;  3IXH A;  4QHC A;  1BLP A;  1CEF A;  4N92 A;  3OZH A;  4JKT A;  2Y2P A;  5CGS A;  3UPN A;  5E2H A;  4KZ8 A;  1YMX A;  4IVI A;  3N8L A;  5FI6 A;  1KDW A;  4O7D A;  3WRZ A;  4EUZ A;  1IYQ A;  3GMW A;  4HEF A;  3ZVT A;  3EQU A;  4E3N A;  3P98 A;  1Z6F A;  1MKI A;  1BSG A;  3IF5 A;  1FCO A;  1JWV A;  3Q07 A;  4ID4 A;  4BQM A;  1NYM A;  1O7E A;  3BRM A;  1W5D A;  4LV3 A;  1FCM A;  1ONG A;  1PZP A;  2Q9M A;  1NRF A;  4GDN A;  3AGE A;  3PAG A;  3NY4 A;  2ZLY A;  3VOZ A;  4C6Y A;  2QMI A;  1U60 A;  4L0L A;  4P6B A;  2WAD A;  5EUA A;  5FAP A;  4FSF A;  1MWS A;  4GNU A;  4LV2 A;  5JYP A;  3Q7V B;  4JXS A;  2FFY A;  4BLM A;  4LV1 A;  2ZC6 B;  1H8Y A;  2XH9 A;  4NET A;  4BJP A;  2EX9 A;  2ZC5 B;  3M6H A;  3FKW A;  3NDG A;  1HVB A;  3IWI A;  2EX6 A;  4OPQ A;  4GN2 A;  5E43 A;  5EOO A;  5TGF A;  1IKI A;  1ONH A;  1WYB A;  1YMS A;  2JC7 A;  2V1Z A;  4R4S A;  4RX3 A;  3S4X A;  4GDB A;  3BFG A;  2HP9 A;  2XFT A;  2WKI A;  4B4X A;  1DY6 A;  3HLW A;  3PBO A;  3N8R A;  1MWT A;  3HUN A;  5CER A;  3UPP A;  1LL5 A;  1W7F A;  4JPM A;  1LHY A;  2WZZ A;  2BLS A;  3MKF A;  3MZD A;  1QMF A;  3I7J A;  5DTK A;  2EX2 A;  4OPY A;  1RGZ A;  1ZC2 A;  3N7W A;  4PM8 A;  3VP0 A;  1YLY A;  1G68 A;  1TDL A;  1YLT A;  5F82 A;  3V5M A;  3TSG A;  1BLH A;  1KVM A;  1DJB A;  1LL9 A;  2DCF A;  4GOG A;  4N9K A;  4QD4 A;  3HLD A;  3UE3 A;  4K0W A;  4KZ5 A;  4P0M A;  3ZG9 B;  4X56 A;  5GHZ A;  3HLE A;  1IEL A;  1SHV A;  3ZNY A;  4E3K A;  3VP3 A;  1YM1 A;  4RA7 A;  2C5W B;  2WZX A;  3DTM A;  4IED A;  1NZU A;  4JXV A;  4KZ6 A;  4WYY A;  3UE1 A;  5TR7 A;  3W4O A;  1JTD A;  5HAQ A;  1PI5 A;  1K54 C;  4IBR A;  2HDU A;  4YFM A;  2XGN A;  4OPZ A;  1DJC A;  1XPB A;  4PPR A;  1L0E A;  5GLB A;  4OOY A;  2Y2L A;  5I94 A;  1AXB A;  5DF8 A;  2P74 A;  4QY5 A;  1CK3 A;  1XA1 A;  1GA0 A;  4PMA A;  3OPP A;  1VM1 A;  4KQR A;  5EEC A;  4RVA A;  1L0F A;  4OLG A;  4MBK A;  3GSG A;  1J9M A;  2VGJ A;  3IH8 A;  1ESI A;  3MBZ A;  3O86 A;  4Y0U A;  3HRE A;  2WK0 A;  2J9P A;  3UY6 A;  5FA7 A;  3E2L A;  5D3O A;  2FFF B;  5F1G A;  5AQ7 A;  1HZO A;  1CEG A;  2Y91 A;  1M6K A;  1LI0 A;  1MY8 A;  3UDX A;  2B5R A;  4X69 A;  4B4Z A;  4KZ4 A;  3BLM A;  4MNR A;  2H10 A;  3NDE A;  4DF6 A;  5CED A;  2OSU A;  2OLU A;  4OQI A;  4BD1 A;  4MEZ A;  1RGY A;  3FZC A;  4JF5 A;  5J8X A;  2XK1 A;  3OC2 A;  1ESU A;  5CHM A;  1ERQ A;  2QPN A;  2WGV A;  5FSR A;  4CPK A;  3C5A A;  5HL1 A;  2XEP A;  1KGF A;  1CI8 A;  2Y2I A;  1C3B A;  1EI5 A;  2ZQD A;  3PBN A;  1WE4 A;  3IF6 B;  4P87 A;  4S2I A;  4DE0 A;  2XFS A;  2HDS A;  1SDN A;  2Y2O A;  4GD8 A;  2A49 A;  4ZJ2 A;  4BEN A;  4JF6 A;  5A92 A;  2ZM0 A;  5KSH A;  3IXD A;  4R0Q A;  3ZG0 A;  3SS4 A;  1YLP A;  5GHY A;  5CGX A;  4OQH A;  4LEN A;  2V20 A;  1RP5 A;  3HLG A;  1XGJ A;  4Y0T A;  3UDF A;  4DXB A;  3IWO A;  4X6T A;  5G18 A;  2HPB A;  1H5X A;  4H8R A;  3CG5 A;  2J7V A;  3FKV A;  3G2Y A;  5GL9 A;  3PBR A;  1GCE A;  3UO9 A;  3AGF A;  4S2K A;  2Y55 A;  4KQQ A;  1O07 A;  2WKH A;  2Z2L B;  2ZQ7 A;  2Y2N A;  5GLC A;  4R4R A;  2GDN A;  1PI4 A;  4WEL A;  2Y2K A;  2ZC4 B;  4S2N A;  5A91 A;  1GA9 A;  4OQG A;  1SCW A;  2ZQC A;  4DXC A;  1KE4 A;  2ZD8 A;  3VP4 A;  2V2F F;  3O87 A;  5EOE A;  5EVI C;  3LCE A;  3MZF A;  4A5R A;  4E3I A;  3IHA A;  1RCJ A;  3WWX A;  4E3M A;  2ZM8 A;  3V39 A;  5FI2 A;  3WS4 A;  3C7V A;  3OCN A;  5JYO A;  3IXG A;  3IQA A;  1KGE A;  3NC8 A;  3Q1F A;  4EBP A;  3HLC A;  3FYZ A;  2BG1 A;  2HDR A;  3ITB A;  1PWC A;  3C7U A;  4KEN B;  4U0T A;  4XUZ A;  5A93 A;  1IYP A;  1S6R A;  2JE5 A;  4S2J A;  3WS5 A;  4WEK A;  5HAR A;  1K57 C;  2EXA A;  4KZA A;  1PW1 A;  4WZ5 C;  3Q7Z A;  1LI9 A;  4JXW A;  4BL3 A;  2PBY A;  5F83 A;  1JWP A;  4YIN A;  1K55 C;  5HW3 A;  5CHU A;  2EX8 A;  5CXW A;  5CGW A;  2R9W A;  3UNW A;  1ZG6 A;  1FCN A;  1NXY A;  3OPL A;  4WBG A;  3CMZ A;  3WS2 A;  4OOM A;  4EBN A;  4HBT A;  5EVI B;  5HX9 A;  4FCF A;  1ZG4 A;  1MWU A;  1NJ4 A;  3FWL A;  1N4O A;  2Q9N A;  3S22 A;  1FSW A;  1DJA A;  2WUQ A;  3GVB A;  3IWQ A;  4EQI A;  4MLL A;  3V3R A;  4Y0O A;  3P09 A;  2X02 A;  1K54 A;  5AQA A;  1M40 A;  3NIA A;  3CJM A;  3ZNT A;  4JBF A;  1TEM A;  1TDG A;  5FAQ A;  2WAE A;  4ZJ1 A;  3BYD A;  3ISG A;  5M18 A;  4ZTK A;  4OLD A;  3SOI A;  2A3U A;  4XXR A;  3V50 A;  2X71 A;  4OPR A;  3GR2 A;  4UA9 A;  3QNC A;  2ZMA A;  3PBQ A;  5CHJ A;  2WGI A;  3HVF A;  2Y2H A;  4DKI A;  1W8Y A;  3HUO A;  1OME A;  2EXB A;  3Q81 A;  4WM9 A;  3VFH A;  3IF6 A;  3HL9 A;  3IT9 A;  4E3O A;  3ZDJ A;  1PWD A;  4LCL A;  1TVF A;  2ZM2 A;  2P9V B;  4UHU A;  5DTS A;  3RXX A;  3DWZ A;  2PU2 A;  5CEB A;  1JTG A;  3ZHH A;  2ZQA A;  1K6R A;  4OOL A;  2EFX A;  1YQS A;  3BFC A;  3SH7 A;  1IEM A;  3VP2 A;  1YLJ A;  2WAF A;  4OH0 A;  3ITA A;  5HAP A;  2ZQ8 A;  4HES A;  2CC1 A;  3A3E A;  1XX2 A;  4ZDX A;  4KZ9 A;  4Y7P A;  4QY6 A;  1H8Z A;  2ZC3 B;  1ERO A;  5M1A A;  2Y59 A;  2XD1 A;  3OPR A;  4GZB A;  3IXB A;  1K56 D;  2HDQ A;  4IVK A;  3QHY A;  3VSL A;  5CTM A;  2WYX A;  3TOI A;  2RCX A;  1Q2P A;  1IKG A;  4X68 A;  1XP4 A;  2OLV A;  5DVA A;  3HBR A;  5E2G A;  4C3Q A;  4R3J A;  3WS1 A;  1L0D A;  3GQZ A;  5A90 A;  3C4P A;  4EV4 A;  5KMW A;  3LO7 A;  3ZGA B;  3BEC A;  4OKP A;  1ES2 A;  1I5Q A;  1Q2Q A;  3Q7V A;  3S1Y A;  1QME A;  1S0W A;  1IYS A;  4UA7 A;  5E2E A;  1ES5 A;  1Y54 A;  4WZ4 A;  3DWK A;  3NI9 A;  4ZJ3 A;  1GHP A;  4CJN A;  2VGK A;  5L2F A;  1W79 A;  2G2W A;  3G35 A;  4Z9Q A;  3ZCZ A;  4X55 A;  2WGW B;  3PAE A;  1E4D A;  2Y2Q A;  3A3F A;  4UAA A;  4RX2 A;  2I72 A;  3SS5 A;  2XQZ A;  4DDS A;  3MXS A;  4KZ3 A;  1HTZ A;  4OP8 A;  5EVI D;  4RYE A;  5FAO A;  3UE0 A;  3GRJ A;  1FSY A;  3VP1 A;  1ES3 A;  1L0G A;  5EVI A;  1HD8 A;  3BFD A;  3NBL A;  1YLW A;  3HLB A;  3PBT A;  3NCK A;  5GHX A;  2IWD A;  3CZD A;  2IWC A;  4PM7 A;  3G30 A;  4K0X A;  4C75 A;  3G4P A;  4JLF A;  5CTN A;  4X53 A;  1NZO A;  1XXM A;  3N4I A;  4U3T A;  1PW8 A;  2IWB A;  2Z2M B;  1SKF A;  3MXR A;  3AGD A;  4B88 A;  1JVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...