4WM9A

Acinetobacter baumanii oxa-24 complex with avibactam
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
245
structure length
243
Chain Sequence
FHISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFKMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Molecular Basis of Selective Inhibition and Slow Reversibility of Avibactam against Class D Carbapenemases: A Structure-Guided Study of OXA-24 and OXA-48.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 77
structure length 243
sequence length 245
ec nomenclature
pdb deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4wm9A00
4OQGA 3UPNA 3IWIA 4QJGA 5KMWA 3UE3A 5E2EA 4DRTA 3IF6B 5DTSA 3BLMA 3HUMA 3UDFA 5FSRA 5FASA 5AQBA 1CK3A 1NZOA 1KVMA 4KQQA 3A3DA 3ZCZA 4GN2A 4DXCA 4GOGA 3PBNA 5HFOA 3M2JA 4KZ4A 5I94A 3A3IA 4GKUA 3OPLA 2Y55A 4R1GA 4WMCA 5HL1A 3ZNYA 4OQ0A 2Y2OA 2Z2MB 1JVJA 1K54C 4S2KA 2XD5A 1OMEA 3HLGA 4IBRA 1ES2A 1MY8A 5FI2A 1SKFA 3ZG8B 5M1AA 2WAEA 1K6RA 2WZXA 3PAGA 2XGNA 5TR7A 4BJPA 4RX3A 1PI4A 2XH9A 3HLBA 1ERMA 4GD8A 2QMIA 4IVIA 5GLCA 4CPKA 1QMEA 5HW3A 3BFDA 5CGSA 1CI9A 2ZQAA 4DE3A 2EFUA 5J8XA 1K55A 2HDUA 4X53A 1YM1A 3NY4A 4B88A 2WADA 3AGDA 1EI5A 1WYBA 4MBFA 5EOEA 4XUXA 2H10A 4EBPA 3EQVA 4QY6A 4OQHA 4S2LA 3C4OA 1JWVA 4BENA 4ZJ1A 2ZQDA 5E43A 1YMXA 1TVFA 1KGGA 1O07A 2R9WA 4EBLA 3PBTA 5M19A 3QNCA 1YLPA 3EQUA 5AQ7A 1PIOA 1SHVA 1K56D 4HBUA 3Q7ZA 3UPPA 1GCEA 2XLNA 1LL9A 4S2NA 4WELA 3ZG5A 2FFYA 4OOMA 4MBHA 4LV0A 5CRFA 1AXBA 3WS4A 1G6AA 3W4OA 4OPZA 3SOIA 4MEZA 1IKIA 4UA6A 2VGJA 4GB7A 1E3UA 1I5QA 2HP6A 2Y2MA 3Q07A 4FH2A 3RXXA 3WS0A 1EROA 5TGFA 1K25A 4KZ7A 4LCLA 1XP4A 1YLTA 1I2SA 4KENB 3S4XA 4BD1A 1FSWA 2EXAA 3CZDA 4KG6A 3V50A 3MKEA 2ZC7A 1K57A 3ZNTA 3BFCA 1HTZA 1BULA 3HLCA 3O88A 3IF6A 4R3JA 5A92A 4OONA 5F1FA 4GD6A 4Y0TA 4WEJA 1FOFA 1NJ4A 2Y91A 3ZG9B 3CG5A 2BLSA 4EBNA 4OP8A 4OOLA 5EUAA 3HUOA 1XX2A 4OOYA 2XD1A 3UE1A 3A3JA 5L2FA 4YFMA 2Q9MA 3AGEA 2DNSA 3IHAA 3IXBA 4OLDA 3CMZA 3UO9A 2RCXA 1W8QA 3NDEA 3C4PA 4JF5A 1ONGA 1C3BA 1PW8A 2X71A 3MXRA 4D2OA 3HUNA 3FV7A 5FATA 3A3EA 1ESUA 3G31A 4NK3A 4BLMA 1DJCA 3OPPA 1KE3A 1NZUA 4FSFA 4B4XA 1FQGA 2G2UA 3UN7A 3E2LA 4C6YA 2JBFA 3G4PA 1I2WA 1VQQA 5FQQA 4DDYA 1LHYA 3QNBA 4DDSA 4E6WA 1Q2QA 1L0EA 2JC7A 2QZ6A 5FDHA 3D4FA 4N9LA 4PM8A 3V3SA 1MWTA 1FCMA 1NY0A 1GHMA 3OPRA 1NYMA 5EVIC 5GLDA 1PZOA 1Q2PA 2WKHA 2DRWA 2XDMA 3N7WA 1DY6A 5CGXA 4IBXA 5FQ9A 4E3IA 1MPLA 1O7EA 4OPQA 3HVFA 5A91A 4RYEA 2HP5A 3NBLA 3VSKA 1ZG6A 3HREA 5CTMA 3WS5A 2E8IA 4CJNA 1IYSA 3Q81A 4XXRA 3C7VA 3UY6A 1HD8A 2ZQCA 4DF6A 5AQAA 4E3MA 3UDIA 3PTEA 2WKEA 1L0GA 2Y2KA 2HDQA 1J9MA 1Z6FA 4HBTA 1G68A 4X56A 2OLUA 3ZHHA 2XF3A 4P87A 3LEZA 4WZ5C 3VP4A 3IT9A 4BL2A 3BFEA 3UPOA 4ID4A 3BFGA 5CEDA 1ES4A 2HDSA 3PBSA 3Q82A 3LCEA 4R4RA 3SH8A 4WYYA 1IYQA 4OPRA 4X68A 5GLAA 3I7JA 1PWCA 3CJMA 1TDLA 4BL3A 2ZMAA 4DE1A 1FCOA 2Y2NA 4KZ8A 5FQIA 2XR0A 2J9OA 4OVDA 1U60A 2WGVA 4Y0OA 1KDSA 2C5WB 4EWFA 3OCLA 3GTCA 5FA7A 1KGFA 4MBKA 3PBOA 3BM6A 4FD8A 4JKTA 4WZ4A 4JBFA 3WS2A 3VP0A 1RP5A 5CGWA 2XFTA 5DTTA 1MBLA 4UA7A 3FWLA 1PWGA 1IYOA 2X02A 4OH0A 2Q9NA 4LV2A 1XXMA 1XA1A 3S1YA 1CEFA 1YLZA 4RX2A 2I72A 3BFFA 2EX2A 3VP1A 1S6RA 4PM6A 4M3KA 3MFDA 3P98A 4NETA 1HVBA 1BLSA 1SCWA 2CC1A 1ALQA 2H5SA 1KDWA 2WGIA 1BUEA 1K4FA 5CTNA 4IVKA 4E6XA 3BLSA 2ZQ9A 4X55A 3IWOA 4LCMA 2WUQA 4H8RA 5G18A 1ES5A 1RCJA 1W7FA 2ZJ9A 4KZ6A 1BLHA 3HLWA 4C75A 1HZOA 3IWQA 1KE4A 3VSLA 4KZ5A 2Y2HA 1S0WA 4E3JA 1K56A 2P9VB 2ZC4B 3TG9A 1SDNA 1YLWA 2Y2JA 2ZM0A 1XKZA 3ZVWA 3NI9A 4MNRA 5IHVA 4QU3A 2EX6A 4N9KA 1W8YA 1XGJA 1ZG4A 1BT5A 4R0QA 1N9BA 4L0LA 5U47A 4KZ9A 3PBRA 1W79A 2A49A 5EPHA 1KGEA 2V20A 2WZZA 3O86A 1K6SA 4FH4A 1JWZA 5F82A 5FQMA 1K55C 2Y2QA 5EVID 5CEBA 3WWXA 2Y59A 4GDBA 2WYXA 3LY4A 4YINA 1GA9A 3TSGA 4JLFA 4KZ3A 3N8LA 2X01A 4A5RA 3RJUA 3M2KA 3NCKA 2WKIA 3BEBA 4ZBEA 1IELA 3PBQA 1JTGA 2ZM2A 1FCNA 3M6HA 1N4OA 4N92A 5GHYA 4UHUA 2ZC6B 5F83A 1RGYA 1YQSA 2EXBA 4S2NC 1W5DA 3S22A 5CECA 1MWRA 1MKIA 2BG1A 4KG2A 4LV1A 2WK0A 4P85A 4WM9A 4Z9QA 1L0DA 3FYZA 1ZKJA 4MLLA 4JPMA 4ZJ2A 2QPNA 1PYYA 3G34A 2XFSA 3MBZA 3IXDA 1PW1A 2J7VA 3M6BA 5E2GA 1RGZA 3GRJA 5JYOA 3QHYA 4C3QA 4X69A 3FKVA 1E25A 2IWBA 4ZTKA 3W8KA 1M6KA 3DWZA 3GMWA 4WBGA 2EFXA 3LO7A 4JXGA 1K57C 1K54A 2C6WB 3G35A 2J9PA 4QD4A 3DTMA 1DJBA 3IF6C 1BTLA 4QHCA 4U0XA 2OV5A 4JF6A 1K4EA 4WEKA 3VFFA 5KSCA 3ISGA 4LENA 1VM1A 3B3XA 5F1GA 4LV3A 3ZVTA 1BLCA 1M40A 4Y7PA 5HARA 2ZC3B 4DXBA 2P9VA 5DF8A 4N1HA 3IH9A 5DF7A 1LI0A 2WAFA 2VGKA 2Y2PA 3ZG0A 3DW0A 5EVIB 2GDNA 3FZCA 1NRFA 1QMFA 1K38A 1CI8A 2J8YA 3G30A 1KE0A 3IQAA 3HLFA 4GDNA 1TDGA 4KZAA 4E3KA 4K91A 3ZFZA 2WGWB 3W4QA 5CXWA 3UNWA 3V39A 5DTKA 4OP5A 2XQZA 3O3VA 2A3UA 4KQOA 1DJAA 2PU2A 1SDEA 4N1XA 4WMCD 4K0XA 2DCFA 4DKIA 2JE5A 3Q7VA 3GV9A 3JYIA 3NIAA 2OSUA 4OKPA 1FSYA 4E3LA 5HAQA 3IXHA 2B5RA 4ZDXA 2P74A 1LLBA 2ZQ7A 4KG5A 4QY5A 3GVBA 5FAQA 3V5MA 4S2OA 3VFHA 2Z2LB 4S2MA 3GSGA 1LI9A 3VOYA 5KZHA 3P09A 3MZFA 3UDXA 1WE4A 2ZLYA 4X6TA 5HAIA 3OPHA 5BOHA 4PM7A 3NC8A 3ITAA 1EWZA 5FAPA 3PAEA 1TEMA 3HL9A 4FCFA 3ZGAB 1ESIA 2UWXA 3WS1A 5HX9A 1ZC2A 5E2FA 3WRTA 5EOOA 3MZDA 2XK1A 3DWKA 3OCNA 5GHZA 3RXWA 2Y2IA 1L0FA 1ONHA 1CEGA 2FFFB 4OPYA 1FR6A 2V2FF 5FAOA 3SS4A 4F94A 1GHPA 4Q8IA 5FQJA 4U3TA 5KSHA 1XA7A 4EQIA 1IYPA 5CHMA 1IKGA 2IWCA 1WYCA 2V1ZA 1NXYA 2PU4A 1GHIA 3E2KA 1XPBA 5FQKA 3ZDJA 4PMAA 4EUZA 3GR2A 4EV4A 3OC2A 3Q1FA 4PPRA 5EECA 4R4SA 1H5XA 3HLDA 4K0WA 1E3UD 4UAAA 4GNUA 4PM5A 4JXSA 3NDGA 4S2IA 1ERQA 3IXGA 5GL9A 5GLBA 3O87A 3Q7VB 3A3FA 5A90A 3IF5A 3V3RA 1BZAA 5HAPA 3LY3A 3MZEA 3SS3A 3IHBA 5GHXA 4U0TA 4HEFA 1H8ZA 5EVIA 5CERA 4RVAA 3HLEA 4ZAMA 3ZG7B 4B4ZA 4S2JA 3W4PA 2HDRA 3GQZA 3N4IA 5JYPA 3N8RA 5D3OA 5EVLA 2WGWA 3N8SA 1JTDA 5E2HA 4IEDA 3WRZA 1FR1A 3OZHA 4KZBA 5CHUA 4Y0UA 1ES3A 1PWDA 4UA9A 2IWDA 1MWSA 1JWPA 1MWUA 3VMAA 2HP9A 4DE0A 1BLPA 3VP3A 4E3NA 4JF4A 4OQIA 4JXVA 3BRMA 4S2PA 2ZM8A 1Y54A 3G2YA 1GA0A 4PM9A 2ZQ8A 2Y2GA 5FI6A 3MXSA 2Y4AA 3SS5A 1L2SA 3AGFA 5M18A 1PZPA 2G2WA 2ZC5B 4OLGA 4WZ5A 4E3OA 3G32A 2EX8A 3UE0A 3SH7A 3SH9A 3G2ZA 2H0TA 1YLYA 1BSGA 1LL5A 1MXOA 4P0MA 5A93A 1YMSA 4R3BA 2R9XA 1IEMA 1NYYA 3C7UA 3ITBA 3FKWA 2HPBA 5EE8A 2XEPA 4DE2A 4KQRA 5CHJA 3IH8A 5TFQA 3VP2A 4BD0A 4RA7A 4ZJ3A 4BQMA 2Y2LA 3N6IA 2ZD8A 5FI7A 1H8YA 4P6BA 4R23A 1YT4A 3C5AA 3MKFA 3HBRA 2RL3A 5DVAA 3VOZA 3TOIA 2PBYA 4GZBA 4HESA 2EX9A 1PI5A 1XGIA 2OLVA 4JXWA 4XUZA 3BECA 2H0YA 1YLJA 4O7DA 5AQ9A 1KVLA 2JCHA 1E4DA 4QB8A 5DF9A 3BYDA
chains in the Genus database with same CATH superfamily
1G28A 4OQGA 3B33A 4QJGA 4Y5FA 5FSRA 5EM0A 1DP9A 4GOGA 3PBNA 5F68A 5HFOA 1PRQA 5I94A 3MMHA 4GKUA 3OPLA 2Y55A 2HF6A 1V9ZA 1NLYA 2Q0OA 1JVJA 4S2KA 3UB8A 4IBRA 1SKFA 4JGQA 5M1AA 2WAEA 1PI4A 5EM1A 3HLBA 5GLCA 4IVIA 1QMEA 4Y17A 3BFDA 3MF0A 2ZQAA 3IBJA 4DE3A 2O9CA 3MQ0A 4B88A 2VK3A 1EI5A 3E4PA 4MN6A 1DP8A 4I5SA 4BBVA 2BTFP 4ZJ1A 3T4TA 2FZ0A 1YMXA 1CF0A 4EBLA 4QWOA 1K56D 4HBUA 3Q7ZA 3LIBA 5L07A 2WKQA 4OOMA 4MBHA 4GLQA 3KX0X 4OPZA 4MEZA 3PXPA 1ODVA 4UA6A 5F69A 4G3KA 1I5QA 2W0NA 4FH2A 3RXXA 4KZ7A 5HSQA 1YLTA 4KENB 1FSWA 3TW8A 5FL3A 1N9NA 3ZNTA 1HTZA 2JKTM 3ZG9B 2QYBA 3QP8A 1S4SA 4OOYA 2XD1A 2H28A 1V9YA 2Q9MA 4OLDA 3F1PB 1W8QA 5FATA 4BLMA 1VEUB 4B4XA 2G2UA 2P08A 4NXBA 4C6YA 2JBFA 1I2WA 1LHYA 2QZ6A 1UWPX 3FC7A 4PM8A 3LIFA 1NY0A 3OPRA 5EVIC 3E0YA 3N7WA 5CGXA 4IBXA 5A91A 2HP5A 3NBLA 5CTMA 3LYXA 4CJNA 4YNRA 3Q81A 4XXRA 1HD8A 3JVVA 1L0GA 2Y2KA 3ZHHA 4BL2A 3IT9A 3CLOA 2HDSA 3Q82A 4R4RA 2PAVP 3I7JA 1PWCA 3CJMA 2ZMAA 4HH3A 4Y0OA 5HWTA 4EWFA 2PDRA 5TJJA 4WZ4A 3PBOA 3BM6A 4FD8A 3WS2A 4GS9A 5CGWA 4I3AA 3VE4A 1XXMA 1XA1A 1W63M 1YLZA 4RX2A 2QHKA 3DAVA 1ALQA 5C5KA 3KSGA 1RCJA 2EA9A 4KZ5A 2Y2HA 3S7NA 1K56A 1F9IA 4FUWA 2ZM0A 3H7WA 2QWSA 2EX6A 4N9KA 3T1SA 4KZ9A 1KGEA 3ZYTA 3BQAA 3T4OA 2JKRI 5FQMA 3T12B 4WN5A 3WWXA 3T1XA 1MKMA 3LY4A 3LR0A 3EWKA 4YINA 1NRJA 4GS9B 4KZ3A 5DKLA 3QP1A 3NCKA 2WKIA 3C38A 2BASA 1FCNA 5CECA 3T1RA 1JNUA 3C30A 5IT5A 4GCZA 4HP4A 4KQDA 3MBZA 3M6BA 5E2GA 4C3QA 2IWBA 4ZTKA 4LRZE 3DWZA 1SZVA 4U0XA 2W1TA 2PYPA 4JF6A 3ISGA 4LENA 3ZVTA 2VGLM 1M40A 1S1YA 2ZC3B 5DF8A 3ZG0A 2GDNA 1QMFA 2OWHA 3IQAA 4RQ9A 3HLFA 1TDGA 4K91A 4P6ZS 3V39A 1P9RA 5DTKA 4IHQA 4DKIA 3D72A 2JE5A 3KSHA 3JYIA 3B47A 3IXHA 2ZQ7A 4KG5A 3GVBA 5FAQA 4S2OA 3GSGA 3K3DA 5L8MA 3CHWP 4I3IA 5AVEA 3ITAA 3ZGAB 5HX9A 4DJ3A 3DWKA 3OCNA 3RXWA 1ONHA 1CEGA 4OPYA 5FAOA 3D3OA 5KSHA 1XA7A 4EQIA 1STZA 2W3HA 1IKGA 1WYCA 2PU4A 1GHIA 1D7EA 3EEHA 1H8MA 3MJQA 4GJ4A 4PMAA 4EUZA 4EV4A 3OC2A 4PPRA 3EEAA 5IS1A 3NDGA 3V3RA 3SS3A 5GHXA 4U0TA 4HY8A 5CERA 3HLEA 4B4ZA 4R70A 4S2JA 3N8RA 5EVLA 3N8SA 5G4ZA 1ES3A 5HDDA 4H6JA 4WL9A 4LRXC 3BRMA 3G2YA 1GA0A 2ZQ8A 2G2WA 1LT0A 4WZ5A 4E3OA 3SH9A 2H0TA 2FH5A 1LL5A 4BMWA 5HD5A 4KQRA 5TFQA 3IH8A 4HP9A 4P6ZM 4RA7A 4ZJ3A 2Y2LA 3N6IA 2ZD8A 1H8YA 4P6BA 3UB6A 1YT4A 3F1OA 2HJEA 3KO6A 4HESA 2OLVA 4JXWA 2ZOIA 3BECA 2B02A 3QP2A 5KMWA 4PAUA 3UE3A 3NOUC 4DRTA 5DTSA 3DBAA 3UDFA 5FASA 4R38A 2O0YA 4K08A 4OQ0A 3LICA 3R7WA 2Y2OA 4CLCC 3BJNA 3DTIA 1S4RA 2PR5A 2XD5A 1CQAA 3E98A 3CPTA 5FI2A 3ZG8B 1K6RA 4BJPA 2XGNA 4RX3A 2A24B 4EXOA 4GD8A 3SZTA 5CGSA 1CI9A 5HDCA 4X53A 3NY4A 2WADA 1G6OA 4MBFA 3EQVA 4OQHA 4G3VA 2JHEA 2ZQDA 1O07A 3H82A 5M19A 3EQUA 1OJ5A 1SHVA 5I5LA 3UPPA 1GCEA 4S2NA 3ZG5A 5TBMA 5FDSA 4XT2B 5CRFA 4EU0A 3SOIA 1IKIA 4GB7A 1N9OA 5LBRA 2Y2MA 3Q07A 1EROA 5TGFA 1XP4A 4IUKA 2EXAA 3V50A 4KG6A 3MKEA 1K57A 4EQ1A 4Y0TA 1FOFA 2Y91A 2BLSA 4EBNA 4OP8A 1XX2A 3T4KA 2R78A 5L2FA 3IXBA 3IHAA 3CMZA 2RCXA 3H82B 4JF5A 1PW8A 3MXRA 3HUNA 3A3EA 4NK3A 1WA9A 2OOLA 1XJ2A 4E6WA 1L0EA 5FDHA 4N9LA 1ACFA 2OWJA 2GZAA 1NYMA 2EWWA 1PZOA 3BY8A 1DY6A 4OPQA 4I39A 2VLGA 3MFXA 1XFQA 2E8IA 3TJZC 1IYSA 5FEFA 4HJ4A 4DF6A 2WKEA 3UE6A 1Z6FA 4HBTA 2OLUA 3FPVA 2XF3A 4P87A 3LEZA 4WZ5C 3UPOA 1T18A 5CEDA 3PBSA 4BWIA 1XJ4A 4BL3A 4DE1A 3L7HA 5FQIA 2XR0A 4ESPA 3OCLA 3GTCA 5FA7A 1KGFA 4ME4A 1OPXA 4JBFA 4UA7A 3E4OA 2L4RA 3T50A 1IYOA 1LSVA 2Q9NA 2K31A 2I72A 3F1PA 3BFFA 5HDSA 3P98A 4NETA 1HVBA 4D2OA 2WGIA 2VA0A 1VEUA 4LPZA 2ZQ9A 4X55A 3IWOA 4LCMA 1TS0A 1W7FA 3GDIA 4KZ6A 4C75A 4E3JA 2P9VB 2XA7M 3OLOA 3TG9A 1XKZA 5J3WA 4MNRA 3F1NB 2M7UA 1W8YA 1XGJA 1ZG4A 1N9BA 1W79A 2A49A 5EPHA 1UGUA 2WZZA 1K6SA 5F82A 5CEBA 1D1JA 4LLOB 2WYXA 4Y3IA 4JLFA 5L09A 2XRNA 2X01A 2OAP1 2I9VA 2P04A 3P01A 2ZM2A 5EVEA 1N4OA 4N92A 4UHUA 2ZC6B 1RGYA 4S2NC 1W5DA 3S22A 3UB9A 2Z6CA 1TD5A 4LV1A 2YKFA 4WM9A 3MQOA 4JPMA 4EW7A 4DMZA 2W27A 3GMWA 4WBGA 1K57C 3PR6A 2J9PA 4QD4A 1P97A 5J4EA 3UMDA 1K4EA 4Q0HA 5FEGA 4N1HA 2E8JA 1CJFA 2WAFA 3DW0A 3CI6A 1LSWA 3FZCA 1NRFA 1K38A 1KOUA 1OTAA 4E3KA 4GDNA 1DP6A 2WGWB 3W4QA 2GX5A 3Q7VA 3GECA 3P7NA 2V8CA 5HPFA 3CUEA 3P09A 2PBDP 3UDXA 1WE4A 2ZLYA 5HAIA 4EEUA 3NC8A 3MR0A 4EESA 3PAEA 2V0UA 1ZTUA 2HV1A 5E2FA 5GHZA 2PR6A 4E04A 2G7UA 1IYPA 1G5UA 1ZHHB 1NXYA 3E2KA 5HD3A 3KYZA 3GR2A 3QP5A 5AJGA 2V0WA 5EECA 4K0WA 1E3UD 4UAAA 4PM5A 4S2IA 3IXGA 5GLBA 3O87A 3Q7VB 3A3FA 5HAPA 3MZEA 4NG2A 4R6LA 4ZAMA 3ZG7B 2HDRA 2ZL1B 5JYPA 4PHTA 3IS2B 5D3OA 3OBFA 2VZWA 1JTDA 3H9WA 3OZHA 4KZBA 4KUKA 4Y0UA 4ETXA 3VMAA 2HP9A 4JF4A 4DN0A 5FI6A 4PM9A 3MXSA 4OLGA 3QP6A 3G32A 2EX8A 2K7SA 1OTDA 3G2ZA 3RH8B 1YLYA 3UMEA 1YMSA 2R9XA 1VETB 3C7UA 1GSXA 2XEPA 2LB9A 4JGOA 4IUHA 3VP2A 5FI7A 3C5AA 2B95A 2EWVA 5DVAA 2VJWA 4HNBA 2W3FA 2PBYA 3BY9A 4XUZA 3BQ8A 2QKPA 2H0YA 2QJ7A 5AQ9A 2JCHA 4QB8A 3BYDA 1YAXA 5E2EA 3IF6B 4I3JA 3MS6A 1CK3A 1KVMA 3A3DA 3JVUA 4ZRRA 2Y8HA 3M2JA 2V9AA 4R1GA 5HL1A 2JKRM 2Z2MB 1OMEA 3HLGA 3BWLA 1ES2A 2WZXA 4FOFA 2XH9A 2QMIA 1AWIA 1K55A 1WYBA 5J7EA 4EETB 4S2LA 1JWVA 4BENA 5E43A 2D02A 3IX4A 2B18A 4CLCB 4NKPA 1Z09A 2LB5A 1KGGA 2VEAA 1YLPA 3MXQA 2XLNA 4WELA 1PFLA 2FFYA 1AXBA 3WS4A 2PT7A 1E3UA 2VV8A 3WS0A 4LCLA 4MCWA 1I2SA 4LRYC 3S4XA 5DJTA 3CZDA 2ZC7A 5F5YA 4X1MA 1NLZA 4R3JA 3VE3A 4OONA 5F1FA 4WEJA 3U4LP 1XJ6A 4HQAA 5EUAA 3HUOA 2VKSA 3K3CA 4YFMA 3AGEA 2DNSA 1OTBA 5AVFA 3C4PA 1ONGA 1C3BA 2X71A 3BW6A 3G31A 3OPPA 1NZUA 2A24A 4DDYA 3G4PA 2Y79A 1VQQA 3NECA 3QNBA 1Q2QA 2JC7A 3D4FA 1GSVA 1YPRA 5GLDA 2WKHA 2XDMA 5FQ9A 1MPLA 1O7EA 3HVFA 4RYEA 3VSKA 1ZG6A 3VV4A 2VX8A 3LR4A 5KIZA 4XT2A 2ZQCA 4E3MA 3UDIA 2HDQA 1J9MA 3O5YA 1P9WA 1MZUA 3VP4A 2ZOHA 3BFGA 4WUJA 1ES4A 3LCEA 3NHQA 4WYYA 1IYQA 4OPRA 4X68A 1S67L 1TS7A 4IJGA 3S7QA 2JKFA 4OVDA 2J9OA 1KDSA 5F6AA 3NJAA 3MSHA 4JKTA 3VP0A 1RP5A 2XFTA 1MBLA 3RTYA 2JN7A 5DKKA 4LV2A 3S1YA 4NXFA 2EX2A 3VP1A 4NXEA 4M3KA 4CLCE 1BLSA 1OT9A 2H5SA 4E6XA 1J3WA 4O01A 4H8RA 3TRCA 1ES5A 4MN7A 4O8GA 3IWQA 3VSLA 3K2NA 2Y2JA 1GSWA 5DFXA 4GHIB 4UEYA 2ACGA 4L0LA 2HZ5A 2V20A 3O86A 3A0RA 1JWZA 4YWZA 1K55C 4B9OA 2Y59A 4GDBA 1F2KA 5HPIA 3LIDA 5DFYA 3RJUA 4A5RA 3BEBA 4ZBEA 1IELA 3PBQA 4LFUA 1YSPA 1SKOB 1MKIA 1S66L 2BG1A 4KG2A 2W3DA 4P85A 2WK0A 1L0DA 3FYZA 2PRFA 4MLLA 2QPNA 1PYYA 3IXDA 1T1BA 3GRJA 4F3LB 2JKGA 3FKVA 1E25A 5CX7A 1M6KA 2WKRA 1K54A 2C6WB 3G35A 3NOPC 3DTMA 3RFBA 4QHCA 4PKYG 4Q0IA 1T1CA 3B3XA 5F1GA 4LV3A 1H0MA 5HARA 2P9VA 2J3TD 2VGKA 3LUQA 5EVIB 2HJ9C 2JKTI 3F1NA 4FTXA 1CI8A 3G30A 4KZAA 3ZFZA 2XQZA 3O3VA 4KQOA 4N1XA 2PU2A 4WMCD 4K0XA 2PD7A 4E3LA 3GV9A 3NIAA 1FSYA 3SW1A 4ZDXA 1PNEA 1LLBA 4QPRA 4QY5A 2M1CA 3V5MA 3VFHA 1LI9A 3MZFA 3L9KA 4X6TA 3OPHA 5BOHA 4PM7A 3LIAA 5FAPA 5K5BA 3WS1A 3SS4A 1FR6A 2UV0E 2V2FF 4F94A 1W63Q 4Q8IA 4U3TA 3C2WA 1XPBA 5FQKA 3S7PA 3Q1FA 3R4KA 4Y2FA 4R4SA 1H5XA 4GNUA 3LI9A 1ERQA 3LR3A 5A90A 4JGRA 1BZAA 3LY3A 1FILA 3IHBA 2L0WA 3CWFA 3EOIA 3KYEA 4HEFA 1S1ZA 3OOVA 3QP4A 3GQZA 3N4IA 4HH2A 2WGWA 2WKPA 4IEDA 3C8CA 5CHUA 1PWDA 1MWSA 1JWPA 1MWUA 4OQIA 2ZM8A 2Y2GA 2Y4AA 4UQIS 3SS5A 5M18A 1PZPA 2ZC5B 4WF0A 1P0ZA 3SH7A 1TS6A 1BSGA 4GW9A 1MXOA 5A93A 3A0VA 4R3BA 1IEMA 1NYYA 3ITBA 2HPBA 5EE8A 4DE2A 5CHJA 4HIAA 4CLCD 1A0KA 2J80A 3VOZA 3TOIA 4GZBA 1XGIA 4ARZA 2ZMVA 4DJ2A 1YLJA 4O7DA 1KVLA 4BBTA 1E4DA 3UB5P 5DF9A 3UPNA 3IWIA 5EV0A 4LGWA 2NUTC 3BLMA 5HWWA 3HUMA 5AQBA 1NZOA 4KQQA 3ZCZA 4GN2A 4DXCA 4KZ4A 2KLIA 3A3IA 4EEPA 4WMCA 3ZNYA 1X0OA 1K54C 2ZL1A 1MY8A 2YKHA 3T4SA 3IS2A 3PAGA 5TR7A 1T1AA 2HGVA 1NWZA 1ERMA 1TF1A 2AVXA 2VGLS 4CPKA 5HW3A 4MN5A 2EFUA 5J8XA 2HDUA 1YM1A 2W3EA 3AGDA 2GNXA 5EOEA 1N9LA 2H10A 4XUXA 4EBPA 2D01A 4QY6A 2V1BA 2V1AA 3C4OA 4ARZB 2NUPC 2ZBBA 1TVFA 2R9WA 3PBTA 4KUOA 3QNCA 1OTIA 5HZHA 1VETA 5AQ7A 4WLAA 1PIOA 2MJ6A 3MQQA 4I38A 1LL9A 4LV0A 1XFNA 2W3GA 1G6AA 3W4OA 3FG8A 2VGJA 2HP6A 3T4JA 3LI8A 1K25A 4UQIM 1T19A 4G3WA 5MC7A 1OJGA 1YSQA 4BD1A 4CQHA 2OAQ1 3BFCA 1BULA 3HLCA 3O88A 3IF6A 5A92A 4GD6A 1NJ4A 1UWNX 3CG5A 4OOLA 1F5MA 3UE1A 3A3JA 3IX3A 3ZQ5A 4X1LA 4AFIA 2L1MA 2GJ3A 4Y15A 3NDEA 3UO9A 3FV7A 4ETZA 1ESUA 1DJCA 1KE3A 4FSFA 3IBRA 4HOIA 1FQGA 3UN7A 3KSFA 3E2LA 1VB6A 5FQQA 4DDSA 3DTKA 2PYRA 3W2ZA 3T4QA 3V3SA 1MWTA 1FCMA 5DJUA 1GHMA 1IFQA 1Q2PA 3H7WB 2DRWA 3T4LA 2KX6A 4CLCA 4E3IA 5L10A 1BYWA 3WS5A 3HREA 4Y13A 1IOUA 3C7VA 3UY6A 1Y4OA 5AQAA 3PTEA 4NEED 1G68A 4X56A 3BFEA 4ID4A 2VV7A 4M4XA 3SH8A 4R3AA 2CMNA 5GLAA 2INWA 4JGPA 4II7A 1TDLA 1FCOA 2PHYA 2Y2NA 1FIKA 4KZ8A 1LSXA 1EW0A 1U60A 2WGVA 2C5WB 1YKDA 3PHYA 4MBKA 2XROA 5DTTA 3LGOA 3FWLA 1PWGA 2X02A 4OH0A 3IX8A 1CEFA 2O9BA 1LL8A 1S6RA 3DTEA 4PM6A 3MFDA 2J3TC 2IA2A 1SCWA 2CC1A 3E4QA 1KDWA 5CTNA 1BUEA 1K4FA 4IVKA 3BLSA 2W1TB 5HL6A 2WUQA 5G18A 2ZJ9A 3NOTC 1BLHA 1OT6A 3HLWA 1HZOA 1KE4A 4HJ3A 3VOLA 1S0WA 3LEQA 3EGXC 3KYQA 1XJ3A 2ZC4B 3CUEC 1SDNA 1YLWA 3S7OA 2VV6A 3ZVWA 3NI9A 5IHVA 3HJIA 4QU3A 3NULA 3LFVA 1Y28A 1BT5A 4R0QA 5U47A 3PBRA 4FH4A 4NXGA 2Y2QA 5EVID 2V8FA 1GA9A 2K2NA 3TSGA 4HI4A 3N8LA 4D60A 4Q0JA 3M2KA 4PKYA 1JTGA 3M6HA 5GHYA 5F83A 1YQSA 2EXBA 4HJ6A 3JPUA 3ULFA 1MWRA 4Z9QA 3G6OA 2A2LA 4O0PA 1ZKJA 4ZJ2A 4HHDA 4MDZA 3G34A 3UB7A 2XFSA 1PW1A 2J7VA 1RGZA 5JYOA 3QHYA 2Z6DA 4X69A 4L9GA 3W8KA 2O99A 4BBUA 2XSSA 2EFXA 3LO7A 4JXGA 2M7VA 1DJBA 2KOIA 3IF6C 3LR5A 1BTLA 2OV5A 2DMWA 4WEKA 3VFFA 5KSCA 1DRMA 1VM1A 2J3WA 1BLCA 4Y7PA 4DXBA 3HJKA 3IH9A 5DF7A 1LI0A 2Y2PA 4MMNA 4B93A 2J8YA 4GHIA 1KE0A 5HWVA 5CXWA 3UNWA 4OP5A 2A3UA 1DJAA 1SDEA 1D06A 2DCFA 5A8BA 4OKPA 4H6JB 2OSUA 5HAQA 2B5RA 2P74A 4EERA 1HLUP 1OTEA 2Z2LB 4S2MA 3VOYA 5KZHA 1MC0A 2P7JA 3A0SA 3ICYA 3B42A 4X25A 1EWZA 1TEMA 3HL9A 4FCFA 1SKOA 1ESIA 2UWXA 1ZC2A 3WRTA 5EOOA 3MZDA 2XK1A 3CITA 3F1OB 4YOFA 2Y2IA 1L0FA 3D9YA 3T1QB 3PYPA 2FFFB 5IU1A 1GHPA 5FQJA 1F98A 4F3LA 5CHMA 1L3LA 2IWCA 2V1ZA 2QJ5A 3TE8A 4L9EA 3ZDJA 3HLDA 4JXSA 3LIEA 5GL9A 4EUVA 2KDKA 3IF5A 3FPWA 2O9AA 5G4YA 1H8ZA 5EVIA 3R7WB 3U2AA 3CAXA 4RVAA 3W4PA 3CPTB 3V67A 3HCYA 5E2HA 3WRZA 1FR1A 1H3QA 4UA9A 2IWDA 2XA7S 3EGDC 4DE0A 1BLPA 3VP3A 4E3NA 3KSIA 4S2PA 4JXVA 1Y54A 1L2SA 3AGFA 2ZMFA 3UE0A 4P0MA 3FKWA 5EFWA 5TBMB 4BD0A 1VHMA 4BQMA 4R23A 3MKFA 3HBRA 1TS8A 2RL3A 4Z1WA 2W1RA 2EX9A 1PI5A 4L9FA 1K0KA 2PD8A
chains in the Genus database with same CATH topology
4OQGA 3UPNA 3IWIA 4QJGA 5KMWA 3UE3A 5E2EA 4DRTA 3IF6B 5DTSA 3BLMA 3HUMA 3UDFA 5FSRA 5FASA 5AQBA 1CK3A 1NZOA 1KVMA 4KQQA 3A3DA 3ZCZA 4GN2A 4DXCA 4GOGA 3PBNA 5HFOA 3M2JA 4KZ4A 5I94A 3A3IA 4GKUA 3OPLA 2Y55A 4R1GA 4WMCA 5HL1A 3ZNYA 4OQ0A 2Y2OA 2Z2MB 1JVJA 1K54C 4S2KA 2XD5A 1OMEA 3HLGA 4IBRA 1ES2A 1MY8A 5FI2A 1SKFA 3ZG8B 5M1AA 2WAEA 1K6RA 2WZXA 3PAGA 2XGNA 5TR7A 4BJPA 4RX3A 1PI4A 2XH9A 3HLBA 1ERMA 4GD8A 2QMIA 4IVIA 5GLCA 4CPKA 1QMEA 5HW3A 3BFDA 5CGSA 1CI9A 2ZQAA 4DE3A 2EFUA 5J8XA 1K55A 2HDUA 4X53A 1YM1A 3NY4A 4B88A 2WADA 3AGDA 1EI5A 1WYBA 4MBFA 5EOEA 4XUXA 2H10A 4EBPA 3EQVA 4QY6A 4OQHA 4S2LA 3C4OA 1JWVA 4BENA 4ZJ1A 2ZQDA 5E43A 1YMXA 1TVFA 1KGGA 1O07A 2R9WA 4EBLA 3PBTA 5M19A 3QNCA 1YLPA 3EQUA 5AQ7A 1PIOA 1SHVA 1K56D 4HBUA 3Q7ZA 3UPPA 1GCEA 2XLNA 1LL9A 4S2NA 4WELA 3ZG5A 2FFYA 4OOMA 4MBHA 4LV0A 5CRFA 1AXBA 3WS4A 1G6AA 3W4OA 4OPZA 3SOIA 4MEZA 1IKIA 4UA6A 2VGJA 4GB7A 1E3UA 1I5QA 2HP6A 2Y2MA 3Q07A 4FH2A 3RXXA 3WS0A 1EROA 5TGFA 1K25A 4KZ7A 4LCLA 1XP4A 1YLTA 1I2SA 4KENB 3S4XA 4BD1A 1FSWA 2EXAA 3CZDA 4KG6A 3V50A 3MKEA 2ZC7A 1K57A 3ZNTA 3BFCA 1HTZA 1BULA 3HLCA 3O88A 3IF6A 4R3JA 5A92A 4OONA 5F1FA 4GD6A 4Y0TA 4WEJA 1FOFA 1NJ4A 2Y91A 3ZG9B 3CG5A 2BLSA 4EBNA 4OP8A 4OOLA 5EUAA 3HUOA 1XX2A 4OOYA 2XD1A 3UE1A 3A3JA 5L2FA 4YFMA 2Q9MA 3AGEA 2DNSA 3IHAA 3IXBA 4OLDA 3CMZA 3UO9A 2RCXA 1W8QA 3NDEA 3C4PA 4JF5A 1ONGA 1C3BA 1PW8A 2X71A 3MXRA 4D2OA 3HUNA 3FV7A 5FATA 3A3EA 1ESUA 3G31A 4NK3A 4BLMA 1DJCA 3OPPA 1KE3A 1NZUA 4FSFA 4B4XA 1FQGA 2G2UA 3UN7A 3E2LA 4C6YA 2JBFA 3G4PA 1I2WA 1VQQA 5FQQA 4DDYA 1LHYA 3QNBA 4DDSA 4E6WA 1Q2QA 1L0EA 2JC7A 2QZ6A 5FDHA 3D4FA 4N9LA 4PM8A 3V3SA 1MWTA 1FCMA 1NY0A 1GHMA 3OPRA 1NYMA 5EVIC 5GLDA 1PZOA 1Q2PA 2WKHA 2DRWA 2XDMA 3N7WA 1DY6A 5CGXA 4IBXA 5FQ9A 4E3IA 1MPLA 1O7EA 4OPQA 3HVFA 5A91A 4RYEA 2HP5A 3NBLA 3VSKA 1ZG6A 3HREA 5CTMA 3WS5A 2E8IA 4CJNA 1IYSA 3Q81A 4XXRA 3C7VA 3UY6A 1HD8A 2ZQCA 4DF6A 5AQAA 4E3MA 3UDIA 3PTEA 2WKEA 1L0GA 2Y2KA 2HDQA 1J9MA 1Z6FA 4HBTA 1G68A 4X56A 2OLUA 3ZHHA 2XF3A 4P87A 3LEZA 4WZ5C 3VP4A 3IT9A 4BL2A 3BFEA 3UPOA 4ID4A 3BFGA 5CEDA 1ES4A 2HDSA 3PBSA 3Q82A 3LCEA 4R4RA 3SH8A 4WYYA 1IYQA 4OPRA 4X68A 5GLAA 3I7JA 1PWCA 3CJMA 1TDLA 4BL3A 2ZMAA 4DE1A 1FCOA 2Y2NA 4KZ8A 5FQIA 2XR0A 2J9OA 4OVDA 1U60A 2WGVA 4Y0OA 1KDSA 2C5WB 4EWFA 3OCLA 3GTCA 5FA7A 1KGFA 4MBKA 3PBOA 3BM6A 4FD8A 4JKTA 4WZ4A 4JBFA 3WS2A 3VP0A 1RP5A 5CGWA 2XFTA 5DTTA 1MBLA 4UA7A 3FWLA 1PWGA 1IYOA 2X02A 4OH0A 2Q9NA 4LV2A 1XXMA 1XA1A 3S1YA 1CEFA 1YLZA 4RX2A 2I72A 3BFFA 2EX2A 3VP1A 1S6RA 4PM6A 4M3KA 3MFDA 3P98A 4NETA 1HVBA 1BLSA 1SCWA 2CC1A 1ALQA 2H5SA 1KDWA 2WGIA 1BUEA 1K4FA 5CTNA 4IVKA 4E6XA 3BLSA 2ZQ9A 4X55A 3IWOA 4LCMA 2WUQA 4H8RA 5G18A 1ES5A 1RCJA 1W7FA 2ZJ9A 4KZ6A 1BLHA 3HLWA 4C75A 1HZOA 3IWQA 1KE4A 3VSLA 4KZ5A 2Y2HA 1S0WA 4E3JA 1K56A 2P9VB 2ZC4B 3TG9A 1SDNA 1YLWA 2Y2JA 2ZM0A 1XKZA 3ZVWA 3NI9A 4MNRA 5IHVA 4QU3A 2EX6A 4N9KA 1W8YA 1XGJA 1ZG4A 1BT5A 4R0QA 1N9BA 4L0LA 5U47A 4KZ9A 3PBRA 1W79A 2A49A 5EPHA 1KGEA 2V20A 2WZZA 3O86A 1K6SA 4FH4A 1JWZA 5F82A 5FQMA 1K55C 2Y2QA 5EVID 5CEBA 3WWXA 2Y59A 4GDBA 2WYXA 3LY4A 4YINA 1GA9A 3TSGA 4JLFA 4KZ3A 3N8LA 2X01A 4A5RA 3RJUA 3M2KA 3NCKA 2WKIA 3BEBA 4ZBEA 1IELA 3PBQA 1JTGA 2ZM2A 1FCNA 3M6HA 1N4OA 4N92A 5GHYA 4UHUA 2ZC6B 5F83A 1RGYA 1YQSA 2EXBA 4S2NC 1W5DA 3S22A 5CECA 1MWRA 1MKIA 2BG1A 4KG2A 4LV1A 2WK0A 4P85A 4WM9A 4Z9QA 1L0DA 3FYZA 1ZKJA 4MLLA 4JPMA 4ZJ2A 2QPNA 1PYYA 3G34A 2XFSA 3MBZA 3IXDA 1PW1A 2J7VA 3M6BA 5E2GA 1RGZA 3GRJA 5JYOA 3QHYA 4C3QA 4X69A 3FKVA 1E25A 2IWBA 4ZTKA 3W8KA 1M6KA 3DWZA 3GMWA 4WBGA 2EFXA 3LO7A 4JXGA 1K57C 1K54A 2C6WB 3G35A 2J9PA 4QD4A 3DTMA 1DJBA 3IF6C 1BTLA 4QHCA 4U0XA 2OV5A 4JF6A 1K4EA 4WEKA 3VFFA 5KSCA 3ISGA 4LENA 1VM1A 3B3XA 5F1GA 4LV3A 3ZVTA 1BLCA 1M40A 4Y7PA 5HARA 2ZC3B 4DXBA 2P9VA 5DF8A 4N1HA 3IH9A 5DF7A 1LI0A 2WAFA 2VGKA 2Y2PA 3ZG0A 3DW0A 5EVIB 2GDNA 3FZCA 1NRFA 1QMFA 1K38A 1CI8A 2J8YA 3G30A 1KE0A 3IQAA 3HLFA 4GDNA 1TDGA 4KZAA 4E3KA 4K91A 3ZFZA 2WGWB 3W4QA 5CXWA 3UNWA 3V39A 5DTKA 4OP5A 2XQZA 3O3VA 2A3UA 4KQOA 1DJAA 2PU2A 1SDEA 4N1XA 4WMCD 4K0XA 2DCFA 4DKIA 2JE5A 3Q7VA 3GV9A 3JYIA 3NIAA 2OSUA 4OKPA 1FSYA 4E3LA 5HAQA 3IXHA 2B5RA 4ZDXA 2P74A 1LLBA 2ZQ7A 4KG5A 4QY5A 3GVBA 5FAQA 3V5MA 4S2OA 3VFHA 2Z2LB 4S2MA 3GSGA 1LI9A 3VOYA 5KZHA 3P09A 3MZFA 3UDXA 1WE4A 2ZLYA 4X6TA 5HAIA 3OPHA 5BOHA 4PM7A 3NC8A 3ITAA 1EWZA 5FAPA 3PAEA 1TEMA 3HL9A 4FCFA 3ZGAB 1ESIA 2UWXA 3WS1A 5HX9A 1ZC2A 5E2FA 3WRTA 5EOOA 3MZDA 2XK1A 3DWKA 3OCNA 5GHZA 3RXWA 2Y2IA 1L0FA 1ONHA 1CEGA 2FFFB 4OPYA 1FR6A 2V2FF 5FAOA 3SS4A 4F94A 1GHPA 4Q8IA 5FQJA 4U3TA 5KSHA 1XA7A 4EQIA 1IYPA 5CHMA 1IKGA 2IWCA 1WYCA 2V1ZA 1NXYA 2PU4A 1GHIA 3E2KA 1XPBA 5FQKA 3ZDJA 4PMAA 4EUZA 3GR2A 4EV4A 3OC2A 3Q1FA 4PPRA 5EECA 4R4SA 1H5XA 3HLDA 4K0WA 1E3UD 4UAAA 4GNUA 4PM5A 4JXSA 3NDGA 4S2IA 1ERQA 3IXGA 5GL9A 5GLBA 3O87A 3Q7VB 3A3FA 5A90A 3IF5A 3V3RA 1BZAA 5HAPA 3LY3A 3MZEA 3SS3A 3IHBA 5GHXA 4U0TA 4HEFA 1H8ZA 5EVIA 5CERA 4RVAA 3HLEA 4ZAMA 3ZG7B 4B4ZA 4S2JA 3W4PA 2HDRA 3GQZA 3N4IA 5JYPA 3N8RA 5D3OA 5EVLA 2WGWA 3N8SA 1JTDA 5E2HA 4IEDA 3WRZA 1FR1A 3OZHA 4KZBA 5CHUA 4Y0UA 1ES3A 1PWDA 4UA9A 2IWDA 1MWSA 1JWPA 1MWUA 3VMAA 2HP9A 4DE0A 1BLPA 3VP3A 4E3NA 4JF4A 4OQIA 4JXVA 3BRMA 4S2PA 2ZM8A 1Y54A 3G2YA 1GA0A 4PM9A 2ZQ8A 2Y2GA 5FI6A 3MXSA 2Y4AA 3SS5A 1L2SA 3AGFA 5M18A 1PZPA 2G2WA 2ZC5B 4OLGA 4WZ5A 4E3OA 3G32A 2EX8A 3UE0A 3SH7A 3SH9A 3G2ZA 2H0TA 1YLYA 1BSGA 1LL5A 1MXOA 4P0MA 5A93A 1YMSA 4R3BA 2R9XA 1IEMA 1NYYA 3C7UA 3ITBA 3FKWA 2HPBA 5EE8A 2XEPA 4DE2A 4KQRA 5CHJA 3IH8A 5TFQA 3VP2A 4BD0A 4RA7A 4ZJ3A 4BQMA 2Y2LA 3N6IA 2ZD8A 5FI7A 1H8YA 4P6BA 4R23A 1YT4A 3C5AA 3MKFA 3HBRA 2RL3A 5DVAA 3VOZA 3TOIA 2PBYA 4GZBA 4HESA 2EX9A 1PI5A 1XGIA 2OLVA 4JXWA 4XUZA 3BECA 2H0YA 1YLJA 4O7DA 5AQ9A 1KVLA 2JCHA 1E4DA 4QB8A 5DF9A 3BYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OQG A;  3UPN A;  3IWI A;  4QJG A;  5KMW A;  3UE3 A;  5E2E A;  4DRT A;  3IF6 B;  5DTS A;  3BLM A;  3HUM A;  3UDF A;  5FSR A;  5FAS A;  5AQB A;  1CK3 A;  1NZO A;  1KVM A;  4KQQ A;  3A3D A;  3ZCZ A;  4GN2 A;  4DXC A;  4GOG A;  3PBN A;  5HFO A;  3M2J A;  4KZ4 A;  5I94 A;  3A3I A;  4GKU A;  3OPL A;  2Y55 A;  4R1G A;  4WMC A;  5HL1 A;  3ZNY A;  4OQ0 A;  2Y2O A;  2Z2M B;  1JVJ A;  1K54 C;  4S2K A;  2XD5 A;  1OME A;  3HLG A;  4IBR A;  1ES2 A;  1MY8 A;  5FI2 A;  1SKF A;  3ZG8 B;  5M1A A;  2WAE A;  1K6R A;  2WZX A;  3PAG A;  2XGN A;  5TR7 A;  4BJP A;  4RX3 A;  1PI4 A;  2XH9 A;  3HLB A;  1ERM A;  4GD8 A;  2QMI A;  4IVI A;  5GLC A;  4CPK A;  1QME A;  5HW3 A;  3BFD A;  5CGS A;  1CI9 A;  2ZQA A;  4DE3 A;  2EFU A;  5J8X A;  1K55 A;  2HDU A;  4X53 A;  1YM1 A;  3NY4 A;  4B88 A;  2WAD A;  3AGD A;  1EI5 A;  1WYB A;  4MBF A;  5EOE A;  4XUX A;  2H10 A;  4EBP A;  3EQV A;  4QY6 A;  4OQH A;  4S2L A;  3C4O A;  1JWV A;  4BEN A;  4ZJ1 A;  2ZQD A;  5E43 A;  1YMX A;  1TVF A;  1KGG A;  1O07 A;  2R9W A;  4EBL A;  3PBT A;  5M19 A;  3QNC A;  1YLP A;  3EQU A;  5AQ7 A;  1PIO A;  1SHV A;  1K56 D;  4HBU A;  3Q7Z A;  3UPP A;  1GCE A;  2XLN A;  1LL9 A;  4S2N A;  4WEL A;  3ZG5 A;  2FFY A;  4OOM A;  4MBH A;  4LV0 A;  5CRF A;  1AXB A;  3WS4 A;  1G6A A;  3W4O A;  4OPZ A;  3SOI A;  4MEZ A;  1IKI A;  4UA6 A;  2VGJ A;  4GB7 A;  1E3U A;  1I5Q A;  2HP6 A;  2Y2M A;  3Q07 A;  4FH2 A;  3RXX A;  3WS0 A;  1ERO A;  5TGF A;  1K25 A;  4KZ7 A;  4LCL A;  1XP4 A;  1YLT A;  1I2S A;  4KEN B;  3S4X A;  4BD1 A;  1FSW A;  2EXA A;  3CZD A;  4KG6 A;  3V50 A;  3MKE A;  2ZC7 A;  1K57 A;  3ZNT A;  3BFC A;  1HTZ A;  1BUL A;  3HLC A;  3O88 A;  3IF6 A;  4R3J A;  5A92 A;  4OON A;  5F1F A;  4GD6 A;  4Y0T A;  4WEJ A;  1FOF A;  1NJ4 A;  2Y91 A;  3ZG9 B;  3CG5 A;  2BLS A;  4EBN A;  4OP8 A;  4OOL A;  5EUA A;  3HUO A;  1XX2 A;  4OOY A;  2XD1 A;  3UE1 A;  3A3J A;  5L2F A;  4YFM A;  2Q9M A;  3AGE A;  2DNS A;  3IHA A;  3IXB A;  4OLD A;  3CMZ A;  3UO9 A;  2RCX A;  1W8Q A;  3NDE A;  3C4P A;  4JF5 A;  1ONG A;  1C3B A;  1PW8 A;  2X71 A;  3MXR A;  4D2O A;  3HUN A;  3FV7 A;  5FAT A;  3A3E A;  1ESU A;  3G31 A;  4NK3 A;  4BLM A;  1DJC A;  3OPP A;  1KE3 A;  1NZU A;  4FSF A;  4B4X A;  1FQG A;  2G2U A;  3UN7 A;  3E2L A;  4C6Y A;  2JBF A;  3G4P A;  1I2W A;  1VQQ A;  5FQQ A;  4DDY A;  1LHY A;  3QNB A;  4DDS A;  4E6W A;  1Q2Q A;  1L0E A;  2JC7 A;  2QZ6 A;  5FDH A;  3D4F A;  4N9L A;  4PM8 A;  3V3S A;  1MWT A;  1FCM A;  1NY0 A;  1GHM A;  3OPR A;  1NYM A;  5EVI C;  5GLD A;  1PZO A;  1Q2P A;  2WKH A;  2DRW A;  2XDM A;  3N7W A;  1DY6 A;  5CGX A;  4IBX A;  5FQ9 A;  4E3I A;  1MPL A;  1O7E A;  4OPQ A;  3HVF A;  5A91 A;  4RYE A;  2HP5 A;  3NBL A;  3VSK A;  1ZG6 A;  3HRE A;  5CTM A;  3WS5 A;  2E8I A;  4CJN A;  1IYS A;  3Q81 A;  4XXR A;  3C7V A;  3UY6 A;  1HD8 A;  2ZQC A;  4DF6 A;  5AQA A;  4E3M A;  3UDI A;  3PTE A;  2WKE A;  1L0G A;  2Y2K A;  2HDQ A;  1J9M A;  1Z6F A;  4HBT A;  1G68 A;  4X56 A;  2OLU A;  3ZHH A;  2XF3 A;  4P87 A;  3LEZ A;  4WZ5 C;  3VP4 A;  3IT9 A;  4BL2 A;  3BFE A;  3UPO A;  4ID4 A;  3BFG A;  5CED A;  1ES4 A;  2HDS A;  3PBS A;  3Q82 A;  3LCE A;  4R4R A;  3SH8 A;  4WYY A;  1IYQ A;  4OPR A;  4X68 A;  5GLA A;  3I7J A;  1PWC A;  3CJM A;  1TDL A;  4BL3 A;  2ZMA A;  4DE1 A;  1FCO A;  2Y2N A;  4KZ8 A;  5FQI A;  2XR0 A;  2J9O A;  4OVD A;  1U60 A;  2WGV A;  4Y0O A;  1KDS A;  2C5W B;  4EWF A;  3OCL A;  3GTC A;  5FA7 A;  1KGF A;  4MBK A;  3PBO A;  3BM6 A;  4FD8 A;  4JKT A;  4WZ4 A;  4JBF A;  3WS2 A;  3VP0 A;  1RP5 A;  5CGW A;  2XFT A;  5DTT A;  1MBL A;  4UA7 A;  3FWL A;  1PWG A;  1IYO A;  2X02 A;  4OH0 A;  2Q9N A;  4LV2 A;  1XXM A;  1XA1 A;  3S1Y A;  1CEF A;  1YLZ A;  4RX2 A;  2I72 A;  3BFF A;  2EX2 A;  3VP1 A;  1S6R A;  4PM6 A;  4M3K A;  3MFD A;  3P98 A;  4NET A;  1HVB A;  1BLS A;  1SCW A;  2CC1 A;  1ALQ A;  2H5S A;  1KDW A;  2WGI A;  1BUE A;  1K4F A;  5CTN A;  4IVK A;  4E6X A;  3BLS A;  2ZQ9 A;  4X55 A;  3IWO A;  4LCM A;  2WUQ A;  4H8R A;  5G18 A;  1ES5 A;  1RCJ A;  1W7F A;  2ZJ9 A;  4KZ6 A;  1BLH A;  3HLW A;  4C75 A;  1HZO A;  3IWQ A;  1KE4 A;  3VSL A;  4KZ5 A;  2Y2H A;  1S0W A;  4E3J A;  1K56 A;  2P9V B;  2ZC4 B;  3TG9 A;  1SDN A;  1YLW A;  2Y2J A;  2ZM0 A;  1XKZ A;  3ZVW A;  3NI9 A;  4MNR A;  5IHV A;  4QU3 A;  2EX6 A;  4N9K A;  1W8Y A;  1XGJ A;  1ZG4 A;  1BT5 A;  4R0Q A;  1N9B A;  4L0L A;  5U47 A;  4KZ9 A;  3PBR A;  1W79 A;  2A49 A;  5EPH A;  1KGE A;  2V20 A;  2WZZ A;  3O86 A;  1K6S A;  4FH4 A;  1JWZ A;  5F82 A;  5FQM A;  1K55 C;  2Y2Q A;  5EVI D;  5CEB A;  3WWX A;  2Y59 A;  4GDB A;  2WYX A;  3LY4 A;  4YIN A;  1GA9 A;  3TSG A;  4JLF A;  4KZ3 A;  3N8L A;  2X01 A;  4A5R A;  3RJU A;  3M2K A;  3NCK A;  2WKI A;  3BEB A;  4ZBE A;  1IEL A;  3PBQ A;  1JTG A;  2ZM2 A;  1FCN A;  3M6H A;  1N4O A;  4N92 A;  5GHY A;  4UHU A;  2ZC6 B;  5F83 A;  1RGY A;  1YQS A;  2EXB A;  4S2N C;  1W5D A;  3S22 A;  5CEC A;  1MWR A;  1MKI A;  2BG1 A;  4KG2 A;  4LV1 A;  2WK0 A;  4P85 A;  4WM9 A;  4Z9Q A;  1L0D A;  3FYZ A;  1ZKJ A;  4MLL A;  4JPM A;  4ZJ2 A;  2QPN A;  1PYY A;  3G34 A;  2XFS A;  3MBZ A;  3IXD A;  1PW1 A;  2J7V A;  3M6B A;  5E2G A;  1RGZ A;  3GRJ A;  5JYO A;  3QHY A;  4C3Q A;  4X69 A;  3FKV A;  1E25 A;  2IWB A;  4ZTK A;  3W8K A;  1M6K A;  3DWZ A;  3GMW A;  4WBG A;  2EFX A;  3LO7 A;  4JXG A;  1K57 C;  1K54 A;  2C6W B;  3G35 A;  2J9P A;  4QD4 A;  3DTM A;  1DJB A;  3IF6 C;  1BTL A;  4QHC A;  4U0X A;  2OV5 A;  4JF6 A;  1K4E A;  4WEK A;  3VFF A;  5KSC A;  3ISG A;  4LEN A;  1VM1 A;  3B3X A;  5F1G A;  4LV3 A;  3ZVT A;  1BLC A;  1M40 A;  4Y7P A;  5HAR A;  2ZC3 B;  4DXB A;  2P9V A;  5DF8 A;  4N1H A;  3IH9 A;  5DF7 A;  1LI0 A;  2WAF A;  2VGK A;  2Y2P A;  3ZG0 A;  3DW0 A;  5EVI B;  2GDN A;  3FZC A;  1NRF A;  1QMF A;  1K38 A;  1CI8 A;  2J8Y A;  3G30 A;  1KE0 A;  3IQA A;  3HLF A;  4GDN A;  1TDG A;  4KZA A;  4E3K A;  4K91 A;  3ZFZ A;  2WGW B;  3W4Q A;  5CXW A;  3UNW A;  3V39 A;  5DTK A;  4OP5 A;  2XQZ A;  3O3V A;  2A3U A;  4KQO A;  1DJA A;  2PU2 A;  1SDE A;  4N1X A;  4WMC D;  4K0X A;  2DCF A;  4DKI A;  2JE5 A;  3Q7V A;  3GV9 A;  3JYI A;  3NIA A;  2OSU A;  4OKP A;  1FSY A;  4E3L A;  5HAQ A;  3IXH A;  2B5R A;  4ZDX A;  2P74 A;  1LLB A;  2ZQ7 A;  4KG5 A;  4QY5 A;  3GVB A;  5FAQ A;  3V5M A;  4S2O A;  3VFH A;  2Z2L B;  4S2M A;  3GSG A;  1LI9 A;  3VOY A;  5KZH A;  3P09 A;  3MZF A;  3UDX A;  1WE4 A;  2ZLY A;  4X6T A;  5HAI A;  3OPH A;  5BOH A;  4PM7 A;  3NC8 A;  3ITA A;  1EWZ A;  5FAP A;  3PAE A;  1TEM A;  3HL9 A;  4FCF A;  3ZGA B;  1ESI A;  2UWX A;  3WS1 A;  5HX9 A;  1ZC2 A;  5E2F A;  3WRT A;  5EOO A;  3MZD A;  2XK1 A;  3DWK A;  3OCN A;  5GHZ A;  3RXW A;  2Y2I A;  1L0F A;  1ONH A;  1CEG A;  2FFF B;  4OPY A;  1FR6 A;  2V2F F;  5FAO A;  3SS4 A;  4F94 A;  1GHP A;  4Q8I A;  5FQJ A;  4U3T A;  5KSH A;  1XA7 A;  4EQI A;  1IYP A;  5CHM A;  1IKG A;  2IWC A;  1WYC A;  2V1Z A;  1NXY A;  2PU4 A;  1GHI A;  3E2K A;  1XPB A;  5FQK A;  3ZDJ A;  4PMA A;  4EUZ A;  3GR2 A;  4EV4 A;  3OC2 A;  3Q1F A;  4PPR A;  5EEC A;  4R4S A;  1H5X A;  3HLD A;  4K0W A;  1E3U D;  4UAA A;  4GNU A;  4PM5 A;  4JXS A;  3NDG A;  4S2I A;  1ERQ A;  3IXG A;  5GL9 A;  5GLB A;  3O87 A;  3Q7V B;  3A3F A;  5A90 A;  3IF5 A;  3V3R A;  1BZA A;  5HAP A;  3LY3 A;  3MZE A;  3SS3 A;  3IHB A;  5GHX A;  4U0T A;  4HEF A;  1H8Z A;  5EVI A;  5CER A;  4RVA A;  3HLE A;  4ZAM A;  3ZG7 B;  4B4Z A;  4S2J A;  3W4P A;  2HDR A;  3GQZ A;  3N4I A;  5JYP A;  3N8R A;  5D3O A;  5EVL A;  2WGW A;  3N8S A;  1JTD A;  5E2H A;  4IED A;  3WRZ A;  1FR1 A;  3OZH A;  4KZB A;  5CHU A;  4Y0U A;  1ES3 A;  1PWD A;  4UA9 A;  2IWD A;  1MWS A;  1JWP A;  1MWU A;  3VMA A;  2HP9 A;  4DE0 A;  1BLP A;  3VP3 A;  4E3N A;  4JF4 A;  4OQI A;  4JXV A;  3BRM A;  4S2P A;  2ZM8 A;  1Y54 A;  3G2Y A;  1GA0 A;  4PM9 A;  2ZQ8 A;  2Y2G A;  5FI6 A;  3MXS A;  2Y4A A;  3SS5 A;  1L2S A;  3AGF A;  5M18 A;  1PZP A;  2G2W A;  2ZC5 B;  4OLG A;  4WZ5 A;  4E3O A;  3G32 A;  2EX8 A;  3UE0 A;  3SH7 A;  3SH9 A;  3G2Z A;  2H0T A;  1YLY A;  1BSG A;  1LL5 A;  1MXO A;  4P0M A;  5A93 A;  1YMS A;  4R3B A;  2R9X A;  1IEM A;  1NYY A;  3C7U A;  3ITB A;  3FKW A;  2HPB A;  5EE8 A;  2XEP A;  4DE2 A;  4KQR A;  5CHJ A;  3IH8 A;  5TFQ A;  3VP2 A;  4BD0 A;  4RA7 A;  4ZJ3 A;  4BQM A;  2Y2L A;  3N6I A;  2ZD8 A;  5FI7 A;  1H8Y A;  4P6B A;  4R23 A;  1YT4 A;  3C5A A;  3MKF A;  3HBR A;  2RL3 A;  5DVA A;  3VOZ A;  3TOI A;  2PBY A;  4GZB A;  4HES A;  2EX9 A;  1PI5 A;  1XGI A;  2OLV A;  4JXW A;  4XUZ A;  3BEC A;  2H0Y A;  1YLJ A;  4O7D A;  5AQ9 A;  1KVL A;  2JCH A;  1E4D A;  4QB8 A;  5DF9 A;  3BYD A; 
#chains in the Genus database with same CATH topology
 1G28 A;  4OQG A;  3B33 A;  4QJG A;  4Y5F A;  5FSR A;  5EM0 A;  1DP9 A;  4GOG A;  3PBN A;  5F68 A;  5HFO A;  1PRQ A;  5I94 A;  3MMH A;  4GKU A;  3OPL A;  2Y55 A;  2HF6 A;  1V9Z A;  1NLY A;  2Q0O A;  1JVJ A;  4S2K A;  3UB8 A;  4IBR A;  1SKF A;  4JGQ A;  5M1A A;  2WAE A;  1PI4 A;  5EM1 A;  3HLB A;  5GLC A;  4IVI A;  1QME A;  4Y17 A;  3BFD A;  3MF0 A;  2ZQA A;  3IBJ A;  4DE3 A;  2O9C A;  3MQ0 A;  4B88 A;  2VK3 A;  1EI5 A;  3E4P A;  4MN6 A;  1DP8 A;  4I5S A;  4BBV A;  2BTF P;  4ZJ1 A;  3T4T A;  2FZ0 A;  1YMX A;  1CF0 A;  4EBL A;  4QWO A;  1K56 D;  4HBU A;  3Q7Z A;  3LIB A;  5L07 A;  2WKQ A;  4OOM A;  4MBH A;  4GLQ A;  3KX0 X;  4OPZ A;  4MEZ A;  3PXP A;  1ODV A;  4UA6 A;  5F69 A;  4G3K A;  1I5Q A;  2W0N A;  4FH2 A;  3RXX A;  4KZ7 A;  5HSQ A;  1YLT A;  4KEN B;  1FSW A;  3TW8 A;  5FL3 A;  1N9N A;  3ZNT A;  1HTZ A;  2JKT M;  3ZG9 B;  2QYB A;  3QP8 A;  1S4S A;  4OOY A;  2XD1 A;  2H28 A;  1V9Y A;  2Q9M A;  4OLD A;  3F1P B;  1W8Q A;  5FAT A;  4BLM A;  1VEU B;  4B4X A;  2G2U A;  2P08 A;  4NXB A;  4C6Y A;  2JBF A;  1I2W A;  1LHY A;  2QZ6 A;  1UWP X;  3FC7 A;  4PM8 A;  3LIF A;  1NY0 A;  3OPR A;  5EVI C;  3E0Y A;  3N7W A;  5CGX A;  4IBX A;  5A91 A;  2HP5 A;  3NBL A;  5CTM A;  3LYX A;  4CJN A;  4YNR A;  3Q81 A;  4XXR A;  1HD8 A;  3JVV A;  1L0G A;  2Y2K A;  3ZHH A;  4BL2 A;  3IT9 A;  3CLO A;  2HDS A;  3Q82 A;  4R4R A;  2PAV P;  3I7J A;  1PWC A;  3CJM A;  2ZMA A;  4HH3 A;  4Y0O A;  5HWT A;  4EWF A;  2PDR A;  5TJJ A;  4WZ4 A;  3PBO A;  3BM6 A;  4FD8 A;  3WS2 A;  4GS9 A;  5CGW A;  4I3A A;  3VE4 A;  1XXM A;  1XA1 A;  1W63 M;  1YLZ A;  4RX2 A;  2QHK A;  3DAV A;  1ALQ A;  5C5K A;  3KSG A;  1RCJ A;  2EA9 A;  4KZ5 A;  2Y2H A;  3S7N A;  1K56 A;  1F9I A;  4FUW A;  2ZM0 A;  3H7W A;  2QWS A;  2EX6 A;  4N9K A;  3T1S A;  4KZ9 A;  1KGE A;  3ZYT A;  3BQA A;  3T4O A;  2JKR I;  5FQM A;  3T12 B;  4WN5 A;  3WWX A;  3T1X A;  1MKM A;  3LY4 A;  3LR0 A;  3EWK A;  4YIN A;  1NRJ A;  4GS9 B;  4KZ3 A;  5DKL A;  3QP1 A;  3NCK A;  2WKI A;  3C38 A;  2BAS A;  1FCN A;  5CEC A;  3T1R A;  1JNU A;  3C30 A;  5IT5 A;  4GCZ A;  4HP4 A;  4KQD A;  3MBZ A;  3M6B A;  5E2G A;  4C3Q A;  2IWB A;  4ZTK A;  4LRZ E;  3DWZ A;  1SZV A;  4U0X A;  2W1T A;  2PYP A;  4JF6 A;  3ISG A;  4LEN A;  3ZVT A;  2VGL M;  1M40 A;  1S1Y A;  2ZC3 B;  5DF8 A;  3ZG0 A;  2GDN A;  1QMF A;  2OWH A;  3IQA A;  4RQ9 A;  3HLF A;  1TDG A;  4K91 A;  4P6Z S;  3V39 A;  1P9R A;  5DTK A;  4IHQ A;  4DKI A;  3D72 A;  2JE5 A;  3KSH A;  3JYI A;  3B47 A;  3IXH A;  2ZQ7 A;  4KG5 A;  3GVB A;  5FAQ A;  4S2O A;  3GSG A;  3K3D A;  5L8M A;  3CHW P;  4I3I A;  5AVE A;  3ITA A;  3ZGA B;  5HX9 A;  4DJ3 A;  3DWK A;  3OCN A;  3RXW A;  1ONH A;  1CEG A;  4OPY A;  5FAO A;  3D3O A;  5KSH A;  1XA7 A;  4EQI A;  1STZ A;  2W3H A;  1IKG A;  1WYC A;  2PU4 A;  1GHI A;  1D7E A;  3EEH A;  1H8M A;  3MJQ A;  4GJ4 A;  4PMA A;  4EUZ A;  4EV4 A;  3OC2 A;  4PPR A;  3EEA A;  5IS1 A;  3NDG A;  3V3R A;  3SS3 A;  5GHX A;  4U0T A;  4HY8 A;  5CER A;  3HLE A;  4B4Z A;  4R70 A;  4S2J A;  3N8R A;  5EVL A;  3N8S A;  5G4Z A;  1ES3 A;  5HDD A;  4H6J A;  4WL9 A;  4LRX C;  3BRM A;  3G2Y A;  1GA0 A;  2ZQ8 A;  2G2W A;  1LT0 A;  4WZ5 A;  4E3O A;  3SH9 A;  2H0T A;  2FH5 A;  1LL5 A;  4BMW A;  5HD5 A;  4KQR A;  5TFQ A;  3IH8 A;  4HP9 A;  4P6Z M;  4RA7 A;  4ZJ3 A;  2Y2L A;  3N6I A;  2ZD8 A;  1H8Y A;  4P6B A;  3UB6 A;  1YT4 A;  3F1O A;  2HJE A;  3KO6 A;  4HES A;  2OLV A;  4JXW A;  2ZOI A;  3BEC A;  2B02 A;  3QP2 A;  5KMW A;  4PAU A;  3UE3 A;  3NOU C;  4DRT A;  5DTS A;  3DBA A;  3UDF A;  5FAS A;  4R38 A;  2O0Y A;  4K08 A;  4OQ0 A;  3LIC A;  3R7W A;  2Y2O A;  4CLC C;  3BJN A;  3DTI A;  1S4R A;  2PR5 A;  2XD5 A;  1CQA A;  3E98 A;  3CPT A;  5FI2 A;  3ZG8 B;  1K6R A;  4BJP A;  2XGN A;  4RX3 A;  2A24 B;  4EXO A;  4GD8 A;  3SZT A;  5CGS A;  1CI9 A;  5HDC A;  4X53 A;  3NY4 A;  2WAD A;  1G6O A;  4MBF A;  3EQV A;  4OQH A;  4G3V A;  2JHE A;  2ZQD A;  1O07 A;  3H82 A;  5M19 A;  3EQU A;  1OJ5 A;  1SHV A;  5I5L A;  3UPP A;  1GCE A;  4S2N A;  3ZG5 A;  5TBM A;  5FDS A;  4XT2 B;  5CRF A;  4EU0 A;  3SOI A;  1IKI A;  4GB7 A;  1N9O A;  5LBR A;  2Y2M A;  3Q07 A;  1ERO A;  5TGF A;  1XP4 A;  4IUK A;  2EXA A;  3V50 A;  4KG6 A;  3MKE A;  1K57 A;  4EQ1 A;  4Y0T A;  1FOF A;  2Y91 A;  2BLS A;  4EBN A;  4OP8 A;  1XX2 A;  3T4K A;  2R78 A;  5L2F A;  3IXB A;  3IHA A;  3CMZ A;  2RCX A;  3H82 B;  4JF5 A;  1PW8 A;  3MXR A;  3HUN A;  3A3E A;  4NK3 A;  1WA9 A;  2OOL A;  1XJ2 A;  4E6W A;  1L0E A;  5FDH A;  4N9L A;  1ACF A;  2OWJ A;  2GZA A;  1NYM A;  2EWW A;  1PZO A;  3BY8 A;  1DY6 A;  4OPQ A;  4I39 A;  2VLG A;  3MFX A;  1XFQ A;  2E8I A;  3TJZ C;  1IYS A;  5FEF A;  4HJ4 A;  4DF6 A;  2WKE A;  3UE6 A;  1Z6F A;  4HBT A;  2OLU A;  3FPV A;  2XF3 A;  4P87 A;  3LEZ A;  4WZ5 C;  3UPO A;  1T18 A;  5CED A;  3PBS A;  4BWI A;  1XJ4 A;  4BL3 A;  4DE1 A;  3L7H A;  5FQI A;  2XR0 A;  4ESP A;  3OCL A;  3GTC A;  5FA7 A;  1KGF A;  4ME4 A;  1OPX A;  4JBF A;  4UA7 A;  3E4O A;  2L4R A;  3T50 A;  1IYO A;  1LSV A;  2Q9N A;  2K31 A;  2I72 A;  3F1P A;  3BFF A;  5HDS A;  3P98 A;  4NET A;  1HVB A;  4D2O A;  2WGI A;  2VA0 A;  1VEU A;  4LPZ A;  2ZQ9 A;  4X55 A;  3IWO A;  4LCM A;  1TS0 A;  1W7F A;  3GDI A;  4KZ6 A;  4C75 A;  4E3J A;  2P9V B;  2XA7 M;  3OLO A;  3TG9 A;  1XKZ A;  5J3W A;  4MNR A;  3F1N B;  2M7U A;  1W8Y A;  1XGJ A;  1ZG4 A;  1N9B A;  1W79 A;  2A49 A;  5EPH A;  1UGU A;  2WZZ A;  1K6S A;  5F82 A;  5CEB A;  1D1J A;  4LLO B;  2WYX A;  4Y3I A;  4JLF A;  5L09 A;  2XRN A;  2X01 A;  2OAP 1;  2I9V A;  2P04 A;  3P01 A;  2ZM2 A;  5EVE A;  1N4O A;  4N92 A;  4UHU A;  2ZC6 B;  1RGY A;  4S2N C;  1W5D A;  3S22 A;  3UB9 A;  2Z6C A;  1TD5 A;  4LV1 A;  2YKF A;  4WM9 A;  3MQO A;  4JPM A;  4EW7 A;  4DMZ A;  2W27 A;  3GMW A;  4WBG A;  1K57 C;  3PR6 A;  2J9P A;  4QD4 A;  1P97 A;  5J4E A;  3UMD A;  1K4E A;  4Q0H A;  5FEG A;  4N1H A;  2E8J A;  1CJF A;  2WAF A;  3DW0 A;  3CI6 A;  1LSW A;  3FZC A;  1NRF A;  1K38 A;  1KOU A;  1OTA A;  4E3K A;  4GDN A;  1DP6 A;  2WGW B;  3W4Q A;  2GX5 A;  3Q7V A;  3GEC A;  3P7N A;  2V8C A;  5HPF A;  3CUE A;  3P09 A;  2PBD P;  3UDX A;  1WE4 A;  2ZLY A;  5HAI A;  4EEU A;  3NC8 A;  3MR0 A;  4EES A;  3PAE A;  2V0U A;  1ZTU A;  2HV1 A;  5E2F A;  5GHZ A;  2PR6 A;  4E04 A;  2G7U A;  1IYP A;  1G5U A;  1ZHH B;  1NXY A;  3E2K A;  5HD3 A;  3KYZ A;  3GR2 A;  3QP5 A;  5AJG A;  2V0W A;  5EEC A;  4K0W A;  1E3U D;  4UAA A;  4PM5 A;  4S2I A;  3IXG A;  5GLB A;  3O87 A;  3Q7V B;  3A3F A;  5HAP A;  3MZE A;  4NG2 A;  4R6L A;  4ZAM A;  3ZG7 B;  2HDR A;  2ZL1 B;  5JYP A;  4PHT A;  3IS2 B;  5D3O A;  3OBF A;  2VZW A;  1JTD A;  3H9W A;  3OZH A;  4KZB A;  4KUK A;  4Y0U A;  4ETX A;  3VMA A;  2HP9 A;  4JF4 A;  4DN0 A;  5FI6 A;  4PM9 A;  3MXS A;  4OLG A;  3QP6 A;  3G32 A;  2EX8 A;  2K7S A;  1OTD A;  3G2Z A;  3RH8 B;  1YLY A;  3UME A;  1YMS A;  2R9X A;  1VET B;  3C7U A;  1GSX A;  2XEP A;  2LB9 A;  4JGO A;  4IUH A;  3VP2 A;  5FI7 A;  3C5A A;  2B95 A;  2EWV A;  5DVA A;  2VJW A;  4HNB A;  2W3F A;  2PBY A;  3BY9 A;  4XUZ A;  3BQ8 A;  2QKP A;  2H0Y A;  2QJ7 A;  5AQ9 A;  2JCH A;  4QB8 A;  3BYD A;  1YAX A;  5E2E A;  3IF6 B;  4I3J A;  3MS6 A;  1CK3 A;  1KVM A;  3A3D A;  3JVU A;  4ZRR A;  2Y8H A;  3M2J A;  2V9A A;  4R1G A;  5HL1 A;  2JKR M;  2Z2M B;  1OME A;  3HLG A;  3BWL A;  1ES2 A;  2WZX A;  4FOF A;  2XH9 A;  2QMI A;  1AWI A;  1K55 A;  1WYB A;  5J7E A;  4EET B;  4S2L A;  1JWV A;  4BEN A;  5E43 A;  2D02 A;  3IX4 A;  2B18 A;  4CLC B;  4NKP A;  1Z09 A;  2LB5 A;  1KGG A;  2VEA A;  1YLP A;  3MXQ A;  2XLN A;  4WEL A;  1PFL A;  2FFY A;  1AXB A;  3WS4 A;  2PT7 A;  1E3U A;  2VV8 A;  3WS0 A;  4LCL A;  4MCW A;  1I2S A;  4LRY C;  3S4X A;  5DJT A;  3CZD A;  2ZC7 A;  5F5Y A;  4X1M A;  1NLZ A;  4R3J A;  3VE3 A;  4OON A;  5F1F A;  4WEJ A;  3U4L P;  1XJ6 A;  4HQA A;  5EUA A;  3HUO A;  2VKS A;  3K3C A;  4YFM A;  3AGE A;  2DNS A;  1OTB A;  5AVF A;  3C4P A;  1ONG A;  1C3B A;  2X71 A;  3BW6 A;  3G31 A;  3OPP A;  1NZU A;  2A24 A;  4DDY A;  3G4P A;  2Y79 A;  1VQQ A;  3NEC A;  3QNB A;  1Q2Q A;  2JC7 A;  3D4F A;  1GSV A;  1YPR A;  5GLD A;  2WKH A;  2XDM A;  5FQ9 A;  1MPL A;  1O7E A;  3HVF A;  4RYE A;  3VSK A;  1ZG6 A;  3VV4 A;  2VX8 A;  3LR4 A;  5KIZ A;  4XT2 A;  2ZQC A;  4E3M A;  3UDI A;  2HDQ A;  1J9M A;  3O5Y A;  1P9W A;  1MZU A;  3VP4 A;  2ZOH A;  3BFG A;  4WUJ A;  1ES4 A;  3LCE A;  3NHQ A;  4WYY A;  1IYQ A;  4OPR A;  4X68 A;  1S67 L;  1TS7 A;  4IJG A;  3S7Q A;  2JKF A;  4OVD A;  2J9O A;  1KDS A;  5F6A A;  3NJA A;  3MSH A;  4JKT A;  3VP0 A;  1RP5 A;  2XFT A;  1MBL A;  3RTY A;  2JN7 A;  5DKK A;  4LV2 A;  3S1Y A;  4NXF A;  2EX2 A;  3VP1 A;  4NXE A;  4M3K A;  4CLC E;  1BLS A;  1OT9 A;  2H5S A;  4E6X A;  1J3W A;  4O01 A;  4H8R A;  3TRC A;  1ES5 A;  4MN7 A;  4O8G A;  3IWQ A;  3VSL A;  3K2N A;  2Y2J A;  1GSW A;  5DFX A;  4GHI B;  4UEY A;  2ACG A;  4L0L A;  2HZ5 A;  2V20 A;  3O86 A;  3A0R A;  1JWZ A;  4YWZ A;  1K55 C;  4B9O A;  2Y59 A;  4GDB A;  1F2K A;  5HPI A;  3LID A;  5DFY A;  3RJU A;  4A5R A;  3BEB A;  4ZBE A;  1IEL A;  3PBQ A;  4LFU A;  1YSP A;  1SKO B;  1MKI A;  1S66 L;  2BG1 A;  4KG2 A;  2W3D A;  4P85 A;  2WK0 A;  1L0D A;  3FYZ A;  2PRF A;  4MLL A;  2QPN A;  1PYY A;  3IXD A;  1T1B A;  3GRJ A;  4F3L B;  2JKG A;  3FKV A;  1E25 A;  5CX7 A;  1M6K A;  2WKR A;  1K54 A;  2C6W B;  3G35 A;  3NOP C;  3DTM A;  3RFB A;  4QHC A;  4PKY G;  4Q0I A;  1T1C A;  3B3X A;  5F1G A;  4LV3 A;  1H0M A;  5HAR A;  2P9V A;  2J3T D;  2VGK A;  3LUQ A;  5EVI B;  2HJ9 C;  2JKT I;  3F1N A;  4FTX A;  1CI8 A;  3G30 A;  4KZA A;  3ZFZ A;  2XQZ A;  3O3V A;  4KQO A;  4N1X A;  2PU2 A;  4WMC D;  4K0X A;  2PD7 A;  4E3L A;  3GV9 A;  3NIA A;  1FSY A;  3SW1 A;  4ZDX A;  1PNE A;  1LLB A;  4QPR A;  4QY5 A;  2M1C A;  3V5M A;  3VFH A;  1LI9 A;  3MZF A;  3L9K A;  4X6T A;  3OPH A;  5BOH A;  4PM7 A;  3LIA A;  5FAP A;  5K5B A;  3WS1 A;  3SS4 A;  1FR6 A;  2UV0 E;  2V2F F;  4F94 A;  1W63 Q;  4Q8I A;  4U3T A;  3C2W A;  1XPB A;  5FQK A;  3S7P A;  3Q1F A;  3R4K A;  4Y2F A;  4R4S A;  1H5X A;  4GNU A;  3LI9 A;  1ERQ A;  3LR3 A;  5A90 A;  4JGR A;  1BZA A;  3LY3 A;  1FIL A;  3IHB A;  2L0W A;  3CWF A;  3EOI A;  3KYE A;  4HEF A;  1S1Z A;  3OOV A;  3QP4 A;  3GQZ A;  3N4I A;  4HH2 A;  2WGW A;  2WKP A;  4IED A;  3C8C A;  5CHU A;  1PWD A;  1MWS A;  1JWP A;  1MWU A;  4OQI A;  2ZM8 A;  2Y2G A;  2Y4A A;  4UQI S;  3SS5 A;  5M18 A;  1PZP A;  2ZC5 B;  4WF0 A;  1P0Z A;  3SH7 A;  1TS6 A;  1BSG A;  4GW9 A;  1MXO A;  5A93 A;  3A0V A;  4R3B A;  1IEM A;  1NYY A;  3ITB A;  2HPB A;  5EE8 A;  4DE2 A;  5CHJ A;  4HIA A;  4CLC D;  1A0K A;  2J80 A;  3VOZ A;  3TOI A;  4GZB A;  1XGI A;  4ARZ A;  2ZMV A;  4DJ2 A;  1YLJ A;  4O7D A;  1KVL A;  4BBT A;  1E4D A;  3UB5 P;  5DF9 A;  3UPN A;  3IWI A;  5EV0 A;  4LGW A;  2NUT C;  3BLM A;  5HWW A;  3HUM A;  5AQB A;  1NZO A;  4KQQ A;  3ZCZ A;  4GN2 A;  4DXC A;  4KZ4 A;  2KLI A;  3A3I A;  4EEP A;  4WMC A;  3ZNY A;  1X0O A;  1K54 C;  2ZL1 A;  1MY8 A;  2YKH A;  3T4S A;  3IS2 A;  3PAG A;  5TR7 A;  1T1A A;  2HGV A;  1NWZ A;  1ERM A;  1TF1 A;  2AVX A;  2VGL S;  4CPK A;  5HW3 A;  4MN5 A;  2EFU A;  5J8X A;  2HDU A;  1YM1 A;  2W3E A;  3AGD A;  2GNX A;  5EOE A;  1N9L A;  2H10 A;  4XUX A;  4EBP A;  2D01 A;  4QY6 A;  2V1B A;  2V1A A;  3C4O A;  4ARZ B;  2NUP C;  2ZBB A;  1TVF A;  2R9W A;  3PBT A;  4KUO A;  3QNC A;  1OTI A;  5HZH A;  1VET A;  5AQ7 A;  4WLA A;  1PIO A;  2MJ6 A;  3MQQ A;  4I38 A;  1LL9 A;  4LV0 A;  1XFN A;  2W3G A;  1G6A A;  3W4O A;  3FG8 A;  2VGJ A;  2HP6 A;  3T4J A;  3LI8 A;  1K25 A;  4UQI M;  1T19 A;  4G3W A;  5MC7 A;  1OJG A;  1YSQ A;  4BD1 A;  4CQH A;  2OAQ 1;  3BFC A;  1BUL A;  3HLC A;  3O88 A;  3IF6 A;  5A92 A;  4GD6 A;  1NJ4 A;  1UWN X;  3CG5 A;  4OOL A;  1F5M A;  3UE1 A;  3A3J A;  3IX3 A;  3ZQ5 A;  4X1L A;  4AFI A;  2L1M A;  2GJ3 A;  4Y15 A;  3NDE A;  3UO9 A;  3FV7 A;  4ETZ A;  1ESU A;  1DJC A;  1KE3 A;  4FSF A;  3IBR A;  4HOI A;  1FQG A;  3UN7 A;  3KSF A;  3E2L A;  1VB6 A;  5FQQ A;  4DDS A;  3DTK A;  2PYR A;  3W2Z A;  3T4Q A;  3V3S A;  1MWT A;  1FCM A;  5DJU A;  1GHM A;  1IFQ A;  1Q2P A;  3H7W B;  2DRW A;  3T4L A;  2KX6 A;  4CLC A;  4E3I A;  5L10 A;  1BYW A;  3WS5 A;  3HRE A;  4Y13 A;  1IOU A;  3C7V A;  3UY6 A;  1Y4O A;  5AQA A;  3PTE A;  4NEE D;  1G68 A;  4X56 A;  3BFE A;  4ID4 A;  2VV7 A;  4M4X A;  3SH8 A;  4R3A A;  2CMN A;  5GLA A;  2INW A;  4JGP A;  4II7 A;  1TDL A;  1FCO A;  2PHY A;  2Y2N A;  1FIK A;  4KZ8 A;  1LSX A;  1EW0 A;  1U60 A;  2WGV A;  2C5W B;  1YKD A;  3PHY A;  4MBK A;  2XRO A;  5DTT A;  3LGO A;  3FWL A;  1PWG A;  2X02 A;  4OH0 A;  3IX8 A;  1CEF A;  2O9B A;  1LL8 A;  1S6R A;  3DTE A;  4PM6 A;  3MFD A;  2J3T C;  2IA2 A;  1SCW A;  2CC1 A;  3E4Q A;  1KDW A;  5CTN A;  1BUE A;  1K4F A;  4IVK A;  3BLS A;  2W1T B;  5HL6 A;  2WUQ A;  5G18 A;  2ZJ9 A;  3NOT C;  1BLH A;  1OT6 A;  3HLW A;  1HZO A;  1KE4 A;  4HJ3 A;  3VOL A;  1S0W A;  3LEQ A;  3EGX C;  3KYQ A;  1XJ3 A;  2ZC4 B;  3CUE C;  1SDN A;  1YLW A;  3S7O A;  2VV6 A;  3ZVW A;  3NI9 A;  5IHV A;  3HJI A;  4QU3 A;  3NUL A;  3LFV A;  1Y28 A;  1BT5 A;  4R0Q A;  5U47 A;  3PBR A;  4FH4 A;  4NXG A;  2Y2Q A;  5EVI D;  2V8F A;  1GA9 A;  2K2N A;  3TSG A;  4HI4 A;  3N8L A;  4D60 A;  4Q0J A;  3M2K A;  4PKY A;  1JTG A;  3M6H A;  5GHY A;  5F83 A;  1YQS A;  2EXB A;  4HJ6 A;  3JPU A;  3ULF A;  1MWR A;  4Z9Q A;  3G6O A;  2A2L A;  4O0P A;  1ZKJ A;  4ZJ2 A;  4HHD A;  4MDZ A;  3G34 A;  3UB7 A;  2XFS A;  1PW1 A;  2J7V A;  1RGZ A;  5JYO A;  3QHY A;  2Z6D A;  4X69 A;  4L9G A;  3W8K A;  2O99 A;  4BBU A;  2XSS A;  2EFX A;  3LO7 A;  4JXG A;  2M7V A;  1DJB A;  2KOI A;  3IF6 C;  3LR5 A;  1BTL A;  2OV5 A;  2DMW A;  4WEK A;  3VFF A;  5KSC A;  1DRM A;  1VM1 A;  2J3W A;  1BLC A;  4Y7P A;  4DXB A;  3HJK A;  3IH9 A;  5DF7 A;  1LI0 A;  2Y2P A;  4MMN A;  4B93 A;  2J8Y A;  4GHI A;  1KE0 A;  5HWV A;  5CXW A;  3UNW A;  4OP5 A;  2A3U A;  1DJA A;  1SDE A;  1D06 A;  2DCF A;  5A8B A;  4OKP A;  4H6J B;  2OSU A;  5HAQ A;  2B5R A;  2P74 A;  4EER A;  1HLU P;  1OTE A;  2Z2L B;  4S2M A;  3VOY A;  5KZH A;  1MC0 A;  2P7J A;  3A0S A;  3ICY A;  3B42 A;  4X25 A;  1EWZ A;  1TEM A;  3HL9 A;  4FCF A;  1SKO A;  1ESI A;  2UWX A;  1ZC2 A;  3WRT A;  5EOO A;  3MZD A;  2XK1 A;  3CIT A;  3F1O B;  4YOF A;  2Y2I A;  1L0F A;  3D9Y A;  3T1Q B;  3PYP A;  2FFF B;  5IU1 A;  1GHP A;  5FQJ A;  1F98 A;  4F3L A;  5CHM A;  1L3L A;  2IWC A;  2V1Z A;  2QJ5 A;  3TE8 A;  4L9E A;  3ZDJ A;  3HLD A;  4JXS A;  3LIE A;  5GL9 A;  4EUV A;  2KDK A;  3IF5 A;  3FPW A;  2O9A A;  5G4Y A;  1H8Z A;  5EVI A;  3R7W B;  3U2A A;  3CAX A;  4RVA A;  3W4P A;  3CPT B;  3V67 A;  3HCY A;  5E2H A;  3WRZ A;  1FR1 A;  1H3Q A;  4UA9 A;  2IWD A;  2XA7 S;  3EGD C;  4DE0 A;  1BLP A;  3VP3 A;  4E3N A;  3KSI A;  4S2P A;  4JXV A;  1Y54 A;  1L2S A;  3AGF A;  2ZMF A;  3UE0 A;  4P0M A;  3FKW A;  5EFW A;  5TBM B;  4BD0 A;  1VHM A;  4BQM A;  4R23 A;  3MKF A;  3HBR A;  1TS8 A;  2RL3 A;  4Z1W A;  2W1R A;  2EX9 A;  1PI5 A;  4L9F A;  1K0K A;  2PD8 A; 
#chains in the Genus database with same CATH homology
 4OQG A;  3UPN A;  3IWI A;  4QJG A;  5KMW A;  3UE3 A;  5E2E A;  4DRT A;  3IF6 B;  5DTS A;  3BLM A;  3HUM A;  3UDF A;  5FSR A;  5FAS A;  5AQB A;  1CK3 A;  1NZO A;  1KVM A;  4KQQ A;  3A3D A;  3ZCZ A;  4GN2 A;  4DXC A;  4GOG A;  3PBN A;  5HFO A;  3M2J A;  4KZ4 A;  5I94 A;  3A3I A;  4GKU A;  3OPL A;  2Y55 A;  4R1G A;  4WMC A;  5HL1 A;  3ZNY A;  4OQ0 A;  2Y2O A;  2Z2M B;  1JVJ A;  1K54 C;  4S2K A;  2XD5 A;  1OME A;  3HLG A;  4IBR A;  1ES2 A;  1MY8 A;  5FI2 A;  1SKF A;  3ZG8 B;  5M1A A;  2WAE A;  1K6R A;  2WZX A;  3PAG A;  2XGN A;  5TR7 A;  4BJP A;  4RX3 A;  1PI4 A;  2XH9 A;  3HLB A;  1ERM A;  4GD8 A;  2QMI A;  4IVI A;  5GLC A;  4CPK A;  1QME A;  5HW3 A;  3BFD A;  5CGS A;  1CI9 A;  2ZQA A;  4DE3 A;  2EFU A;  5J8X A;  1K55 A;  2HDU A;  4X53 A;  1YM1 A;  3NY4 A;  4B88 A;  2WAD A;  3AGD A;  1EI5 A;  1WYB A;  4MBF A;  5EOE A;  4XUX A;  2H10 A;  4EBP A;  3EQV A;  4QY6 A;  4OQH A;  4S2L A;  3C4O A;  1JWV A;  4BEN A;  4ZJ1 A;  2ZQD A;  5E43 A;  1YMX A;  1TVF A;  1KGG A;  1O07 A;  2R9W A;  4EBL A;  3PBT A;  5M19 A;  3QNC A;  1YLP A;  3EQU A;  5AQ7 A;  1PIO A;  1SHV A;  1K56 D;  4HBU A;  3Q7Z A;  3UPP A;  1GCE A;  2XLN A;  1LL9 A;  4S2N A;  4WEL A;  3ZG5 A;  2FFY A;  4OOM A;  4MBH A;  4LV0 A;  5CRF A;  1AXB A;  3WS4 A;  1G6A A;  3W4O A;  4OPZ A;  3SOI A;  4MEZ A;  1IKI A;  4UA6 A;  2VGJ A;  4GB7 A;  1E3U A;  1I5Q A;  2HP6 A;  2Y2M A;  3Q07 A;  4FH2 A;  3RXX A;  3WS0 A;  1ERO A;  5TGF A;  1K25 A;  4KZ7 A;  4LCL A;  1XP4 A;  1YLT A;  1I2S A;  4KEN B;  3S4X A;  4BD1 A;  1FSW A;  2EXA A;  3CZD A;  4KG6 A;  3V50 A;  3MKE A;  2ZC7 A;  1K57 A;  3ZNT A;  3BFC A;  1HTZ A;  1BUL A;  3HLC A;  3O88 A;  3IF6 A;  4R3J A;  5A92 A;  4OON A;  5F1F A;  4GD6 A;  4Y0T A;  4WEJ A;  1FOF A;  1NJ4 A;  2Y91 A;  3ZG9 B;  3CG5 A;  2BLS A;  4EBN A;  4OP8 A;  4OOL A;  5EUA A;  3HUO A;  1XX2 A;  4OOY A;  2XD1 A;  3UE1 A;  3A3J A;  5L2F A;  4YFM A;  2Q9M A;  3AGE A;  2DNS A;  3IHA A;  3IXB A;  4OLD A;  3CMZ A;  3UO9 A;  2RCX A;  1W8Q A;  3NDE A;  3C4P A;  4JF5 A;  1ONG A;  1C3B A;  1PW8 A;  2X71 A;  3MXR A;  4D2O A;  3HUN A;  3FV7 A;  5FAT A;  3A3E A;  1ESU A;  3G31 A;  4NK3 A;  4BLM A;  1DJC A;  3OPP A;  1KE3 A;  1NZU A;  4FSF A;  4B4X A;  1FQG A;  2G2U A;  3UN7 A;  3E2L A;  4C6Y A;  2JBF A;  3G4P A;  1I2W A;  1VQQ A;  5FQQ A;  4DDY A;  1LHY A;  3QNB A;  4DDS A;  4E6W A;  1Q2Q A;  1L0E A;  2JC7 A;  2QZ6 A;  5FDH A;  3D4F A;  4N9L A;  4PM8 A;  3V3S A;  1MWT A;  1FCM A;  1NY0 A;  1GHM A;  3OPR A;  1NYM A;  5EVI C;  5GLD A;  1PZO A;  1Q2P A;  2WKH A;  2DRW A;  2XDM A;  3N7W A;  1DY6 A;  5CGX A;  4IBX A;  5FQ9 A;  4E3I A;  1MPL A;  1O7E A;  4OPQ A;  3HVF A;  5A91 A;  4RYE A;  2HP5 A;  3NBL A;  3VSK A;  1ZG6 A;  3HRE A;  5CTM A;  3WS5 A;  2E8I A;  4CJN A;  1IYS A;  3Q81 A;  4XXR A;  3C7V A;  3UY6 A;  1HD8 A;  2ZQC A;  4DF6 A;  5AQA A;  4E3M A;  3UDI A;  3PTE A;  2WKE A;  1L0G A;  2Y2K A;  2HDQ A;  1J9M A;  1Z6F A;  4HBT A;  1G68 A;  4X56 A;  2OLU A;  3ZHH A;  2XF3 A;  4P87 A;  3LEZ A;  4WZ5 C;  3VP4 A;  3IT9 A;  4BL2 A;  3BFE A;  3UPO A;  4ID4 A;  3BFG A;  5CED A;  1ES4 A;  2HDS A;  3PBS A;  3Q82 A;  3LCE A;  4R4R A;  3SH8 A;  4WYY A;  1IYQ A;  4OPR A;  4X68 A;  5GLA A;  3I7J A;  1PWC A;  3CJM A;  1TDL A;  4BL3 A;  2ZMA A;  4DE1 A;  1FCO A;  2Y2N A;  4KZ8 A;  5FQI A;  2XR0 A;  2J9O A;  4OVD A;  1U60 A;  2WGV A;  4Y0O A;  1KDS A;  2C5W B;  4EWF A;  3OCL A;  3GTC A;  5FA7 A;  1KGF A;  4MBK A;  3PBO A;  3BM6 A;  4FD8 A;  4JKT A;  4WZ4 A;  4JBF A;  3WS2 A;  3VP0 A;  1RP5 A;  5CGW A;  2XFT A;  5DTT A;  1MBL A;  4UA7 A;  3FWL A;  1PWG A;  1IYO A;  2X02 A;  4OH0 A;  2Q9N A;  4LV2 A;  1XXM A;  1XA1 A;  3S1Y A;  1CEF A;  1YLZ A;  4RX2 A;  2I72 A;  3BFF A;  2EX2 A;  3VP1 A;  1S6R A;  4PM6 A;  4M3K A;  3MFD A;  3P98 A;  4NET A;  1HVB A;  1BLS A;  1SCW A;  2CC1 A;  1ALQ A;  2H5S A;  1KDW A;  2WGI A;  1BUE A;  1K4F A;  5CTN A;  4IVK A;  4E6X A;  3BLS A;  2ZQ9 A;  4X55 A;  3IWO A;  4LCM A;  2WUQ A;  4H8R A;  5G18 A;  1ES5 A;  1RCJ A;  1W7F A;  2ZJ9 A;  4KZ6 A;  1BLH A;  3HLW A;  4C75 A;  1HZO A;  3IWQ A;  1KE4 A;  3VSL A;  4KZ5 A;  2Y2H A;  1S0W A;  4E3J A;  1K56 A;  2P9V B;  2ZC4 B;  3TG9 A;  1SDN A;  1YLW A;  2Y2J A;  2ZM0 A;  1XKZ A;  3ZVW A;  3NI9 A;  4MNR A;  5IHV A;  4QU3 A;  2EX6 A;  4N9K A;  1W8Y A;  1XGJ A;  1ZG4 A;  1BT5 A;  4R0Q A;  1N9B A;  4L0L A;  5U47 A;  4KZ9 A;  3PBR A;  1W79 A;  2A49 A;  5EPH A;  1KGE A;  2V20 A;  2WZZ A;  3O86 A;  1K6S A;  4FH4 A;  1JWZ A;  5F82 A;  5FQM A;  1K55 C;  2Y2Q A;  5EVI D;  5CEB A;  3WWX A;  2Y59 A;  4GDB A;  2WYX A;  3LY4 A;  4YIN A;  1GA9 A;  3TSG A;  4JLF A;  4KZ3 A;  3N8L A;  2X01 A;  4A5R A;  3RJU A;  3M2K A;  3NCK A;  2WKI A;  3BEB A;  4ZBE A;  1IEL A;  3PBQ A;  1JTG A;  2ZM2 A;  1FCN A;  3M6H A;  1N4O A;  4N92 A;  5GHY A;  4UHU A;  2ZC6 B;  5F83 A;  1RGY A;  1YQS A;  2EXB A;  4S2N C;  1W5D A;  3S22 A;  5CEC A;  1MWR A;  1MKI A;  2BG1 A;  4KG2 A;  4LV1 A;  2WK0 A;  4P85 A;  4WM9 A;  4Z9Q A;  1L0D A;  3FYZ A;  1ZKJ A;  4MLL A;  4JPM A;  4ZJ2 A;  2QPN A;  1PYY A;  3G34 A;  2XFS A;  3MBZ A;  3IXD A;  1PW1 A;  2J7V A;  3M6B A;  5E2G A;  1RGZ A;  3GRJ A;  5JYO A;  3QHY A;  4C3Q A;  4X69 A;  3FKV A;  1E25 A;  2IWB A;  4ZTK A;  3W8K A;  1M6K A;  3DWZ A;  3GMW A;  4WBG A;  2EFX A;  3LO7 A;  4JXG A;  1K57 C;  1K54 A;  2C6W B;  3G35 A;  2J9P A;  4QD4 A;  3DTM A;  1DJB A;  3IF6 C;  1BTL A;  4QHC A;  4U0X A;  2OV5 A;  4JF6 A;  1K4E A;  4WEK A;  3VFF A;  5KSC A;  3ISG A;  4LEN A;  1VM1 A;  3B3X A;  5F1G A;  4LV3 A;  3ZVT A;  1BLC A;  1M40 A;  4Y7P A;  5HAR A;  2ZC3 B;  4DXB A;  2P9V A;  5DF8 A;  4N1H A;  3IH9 A;  5DF7 A;  1LI0 A;  2WAF A;  2VGK A;  2Y2P A;  3ZG0 A;  3DW0 A;  5EVI B;  2GDN A;  3FZC A;  1NRF A;  1QMF A;  1K38 A;  1CI8 A;  2J8Y A;  3G30 A;  1KE0 A;  3IQA A;  3HLF A;  4GDN A;  1TDG A;  4KZA A;  4E3K A;  4K91 A;  3ZFZ A;  2WGW B;  3W4Q A;  5CXW A;  3UNW A;  3V39 A;  5DTK A;  4OP5 A;  2XQZ A;  3O3V A;  2A3U A;  4KQO A;  1DJA A;  2PU2 A;  1SDE A;  4N1X A;  4WMC D;  4K0X A;  2DCF A;  4DKI A;  2JE5 A;  3Q7V A;  3GV9 A;  3JYI A;  3NIA A;  2OSU A;  4OKP A;  1FSY A;  4E3L A;  5HAQ A;  3IXH A;  2B5R A;  4ZDX A;  2P74 A;  1LLB A;  2ZQ7 A;  4KG5 A;  4QY5 A;  3GVB A;  5FAQ A;  3V5M A;  4S2O A;  3VFH A;  2Z2L B;  4S2M A;  3GSG A;  1LI9 A;  3VOY A;  5KZH A;  3P09 A;  3MZF A;  3UDX A;  1WE4 A;  2ZLY A;  4X6T A;  5HAI A;  3OPH A;  5BOH A;  4PM7 A;  3NC8 A;  3ITA A;  1EWZ A;  5FAP A;  3PAE A;  1TEM A;  3HL9 A;  4FCF A;  3ZGA B;  1ESI A;  2UWX A;  3WS1 A;  5HX9 A;  1ZC2 A;  5E2F A;  3WRT A;  5EOO A;  3MZD A;  2XK1 A;  3DWK A;  3OCN A;  5GHZ A;  3RXW A;  2Y2I A;  1L0F A;  1ONH A;  1CEG A;  2FFF B;  4OPY A;  1FR6 A;  2V2F F;  5FAO A;  3SS4 A;  4F94 A;  1GHP A;  4Q8I A;  5FQJ A;  4U3T A;  5KSH A;  1XA7 A;  4EQI A;  1IYP A;  5CHM A;  1IKG A;  2IWC A;  1WYC A;  2V1Z A;  1NXY A;  2PU4 A;  1GHI A;  3E2K A;  1XPB A;  5FQK A;  3ZDJ A;  4PMA A;  4EUZ A;  3GR2 A;  4EV4 A;  3OC2 A;  3Q1F A;  4PPR A;  5EEC A;  4R4S A;  1H5X A;  3HLD A;  4K0W A;  1E3U D;  4UAA A;  4GNU A;  4PM5 A;  4JXS A;  3NDG A;  4S2I A;  1ERQ A;  3IXG A;  5GL9 A;  5GLB A;  3O87 A;  3Q7V B;  3A3F A;  5A90 A;  3IF5 A;  3V3R A;  1BZA A;  5HAP A;  3LY3 A;  3MZE A;  3SS3 A;  3IHB A;  5GHX A;  4U0T A;  4HEF A;  1H8Z A;  5EVI A;  5CER A;  4RVA A;  3HLE A;  4ZAM A;  3ZG7 B;  4B4Z A;  4S2J A;  3W4P A;  2HDR A;  3GQZ A;  3N4I A;  5JYP A;  3N8R A;  5D3O A;  5EVL A;  2WGW A;  3N8S A;  1JTD A;  5E2H A;  4IED A;  3WRZ A;  1FR1 A;  3OZH A;  4KZB A;  5CHU A;  4Y0U A;  1ES3 A;  1PWD A;  4UA9 A;  2IWD A;  1MWS A;  1JWP A;  1MWU A;  3VMA A;  2HP9 A;  4DE0 A;  1BLP A;  3VP3 A;  4E3N A;  4JF4 A;  4OQI A;  4JXV A;  3BRM A;  4S2P A;  2ZM8 A;  1Y54 A;  3G2Y A;  1GA0 A;  4PM9 A;  2ZQ8 A;  2Y2G A;  5FI6 A;  3MXS A;  2Y4A A;  3SS5 A;  1L2S A;  3AGF A;  5M18 A;  1PZP A;  2G2W A;  2ZC5 B;  4OLG A;  4WZ5 A;  4E3O A;  3G32 A;  2EX8 A;  3UE0 A;  3SH7 A;  3SH9 A;  3G2Z A;  2H0T A;  1YLY A;  1BSG A;  1LL5 A;  1MXO A;  4P0M A;  5A93 A;  1YMS A;  4R3B A;  2R9X A;  1IEM A;  1NYY A;  3C7U A;  3ITB A;  3FKW A;  2HPB A;  5EE8 A;  2XEP A;  4DE2 A;  4KQR A;  5CHJ A;  3IH8 A;  5TFQ A;  3VP2 A;  4BD0 A;  4RA7 A;  4ZJ3 A;  4BQM A;  2Y2L A;  3N6I A;  2ZD8 A;  5FI7 A;  1H8Y A;  4P6B A;  4R23 A;  1YT4 A;  3C5A A;  3MKF A;  3HBR A;  2RL3 A;  5DVA A;  3VOZ A;  3TOI A;  2PBY A;  4GZB A;  4HES A;  2EX9 A;  1PI5 A;  1XGI A;  2OLV A;  4JXW A;  4XUZ A;  3BEC A;  2H0Y A;  1YLJ A;  4O7D A;  5AQ9 A;  1KVL A;  2JCH A;  1E4D A;  4QB8 A;  5DF9 A;  3BYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...