4CLCA

Crystal structure of ybr137w protein
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
169
Chain Sequence
VVLDKKLLERLTSRKVPLEELEDMEKRCFLSTFTYQDAFDLGTYIRNAVKENFPEKPVAIDISLPNGHCLFRTVTYGGSALDNDFWIQRKKKTALRFGHSSFYMGCKKGDKTPEEKFFVDSKEYAFHGGAVLIQSERSDYPYACLTISGLKQEEDHLMALSSLIAFANE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords UPF0303 PROTEIN YBR137W
publication title Structural and Functional Characterization of Ybr137Wp Implicate its Involvement in the Targeting of Tail-Anchored Proteins to Membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 56
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4clcA00
4CLCB 4BMWA 5CX7A 4CLCC 4CLCA 4CLCD 4NKPA 2A2LA 3FPVA 4CLCE 3FPWA
chains in the Genus database with same CATH superfamily
5D3OA 4JGQA 4X69A 3IF6A 2IWDA 1YLZA 4X68A 5AVFA 3O88A 1M6KA 3LFVA 1Z09A 2Z6DA 3SH9A 1KDSA 3R7WA 5TR7A 4HBUA 2M7VA 4D2OA 5J7EA 4ZBEA 2Y8HA 4EXOA 2WKEA 4HNBA 3PAGA 1IOUA 4DXBA 2O9CA 1FSWA 2ZMVA 5HAPA 2HDSA 4DF6A 4NXEA 3P7NA 3M2KA 3F1PB 4EUZA 1T1AA 3GSGA 3VSLA 3E2KA 3KYZA 4HEFA 3FKWA 5TFQA 3UE3A 1CQAA 1JWVA 5FI2A 5E2EA 3LR5A 5CX7A 3QHYA 1W63M 5KSCA 5K5BA 3UB6A 2B02A 2VV6A 1NLYA 3CJMA 4GHIB 2HP6A 3WS4A 1ERMA 1RGYA 1ALQA 2A49A 2IWBA 2W0NA 2QMIA 1IYSA 4Y17A 3H7WA 3TRCA 3GMWA 1H8YA 3T4JA 1ZHHB 1MWTA 3SS5A 3Q82A 4O0PA 1YSQA 3HLEA 5E2GA 3IS2A 4RX2A 1S1ZA 2CC1A 3PTEA 3N8LA 3MKFA 1LSWA 2RCXA 3S7QA 5CGXA 5E2HA 5FQJA 1VEUA 5FAOA 3NY4A 4HY8A 2PBYA 3IWIA 1QMFA 2VK3A 3CWFA 1SCWA 2ZM0A 3BY8A 2O9AA 3CMZA 1UWNX 3BECA 4FH2A 2OLUA 1A0KA 5IS1A 1XFQA 2X01A 1ES2A 5E43A 2J8YA 3ZHHA 5FQQA 4LV1A 2VZWA 3ZG5A 2V8CA 3EEAA 5KMWA 3KSGA 4DE2A 2KDKA 4MBKA 1I2SA 2GDNA 1T1CA 2P9VA 3C4PA 4X55A 4KUKA 3S4XA 2BTFP 2OOLA 3UE0A 4KUOA 1UWPX 4E3JA 3LICA 2JN7A 4QJGA 5FQMA 5EVID 1BT5A 3ITBA 2OAQ1 2Z2MB 5EFWA 4F3LA 4EWFA 4GZBA 3HUOA 3N6IA 4FUWA 5FQIA 4E04A 4E6XA 2ZC4B 3PR6A 5M1AA 3N7WA 2X71A 4XXRA 3U4LP 3W4QA 1YMSA 3L7HA 4I3IA 3RFBA 3BFFA 3E4QA 1I2WA 4MDZA 2P08A 5CECA 1G28A 3D9YA 4P85A 4ZRRA 5L2FA 4YNRA 2WAEA 4I5SA 1XGIA 1JTGA 5AVEA 5FL3A 3LIBA 4KZAA 2HZ5A 3ZVTA 4JGPA 2PR5A 1L0FA 2JHEA 3IX8A 3UMEA 3C7UA 4I3JA 3ITAA 4EQIA 2INWA 4Q0JA 3C7VA 3A0VA 4PPRA 5HWVA 3UY6A 2J9OA 4KG6A 5FI7A 4BENA 2VV8A 3NIAA 3WS0A 4HI4A 1ZG4A 3QNCA 1L3LA 2ZBBA 4N9LA 1ACFA 4JXGA 1RGZA 5F5YA 4Y0OA 2PRFA 2I9VA 3IXDA 1BLPA 1IELA 5KZHA 1H5XA 3VP2A 4WN5A 1MBLA 3IT9A 1ESUA 3Q1FA 4WMCA 1G5UA 2V0UA 3W4OA 3O87A 3L9KA 3UMDA 1GHMA 2Y2OA 2HF6A 2WGIA 2CMNA 1KE3A 1S0WA 2ZOHA 1YPRA 4R4SA 4DJ3A 4P87A 4HESA 2IWCA 4OP5A 1SDEA 3UB9A 1IKIA 4OPYA 2M7UA 1TS6A 4O8GA 3ZNYA 4EEPA 2EX9A 1K4EA 1VM1A 2G2UA 3VV4A 1T18A 3K2NA 5EVIC 3E2LA 1GHIA 3GQZA 2J3TC 3ZVWA 2O9BA 3EGXC 4QY5A 4G3VA 2Y4AA 1OPXA 2L0WA 3OC2A 5F1GA 5A93A 3AGFA 3ULFA 1H3QA 2VJWA 4PAUA 1DP9A 1ZTUA 2HDQA 5I5LA 4IEDA 4YFMA 3P01A 3TE8A 5HD5A 1XJ2A 4LRXC 2VGJA 1K55C 2Z6CA 1VHMA 3LO7A 4R70A 3UPOA 1PWCA 5CEDA 4EBPA 3B3XA 1KDWA 3M6HA 3Q81A 3F1NA 1ES4A 2PD8A 1KGGA 3GR2A 3IWQA 3FKVA 2A2LA 1BLSA 3DTIA 4NXFA 4KZ7A 4GB7A 1TDLA 2DCFA 5DKKA 1D7EA 3C30A 3DTEA 2ZC5B 3GV9A 4C3QA 3UO9A 4KZ3A 1FSYA 4BL2A 2ZMFA 2XDMA 3N4IA 4WYYA 3UE6A 3CLOA 1VQQA 1BLCA 4FH4A 5FEFA 4H8RA 1S4RA 3ZQ5A 2OWHA 3PBTA 5FQ9A 4JXVA 5HW3A 5JYOA 4R1GA 4JXWA 2H5SA 4XUZA 3B33A 3UDFA 1NZUA 2VV7A 1MZUA 1DRMA 4KQQA 4U3TA 3VFHA 1J3WA 4P6BA 4HJ6A 2D01A 2WGWA 4C75A 3HLCA 3LR4A 3T12B 4X6TA 4QPRA 1UGUA 2QHKA 2WADA 4Y15A 3HBRA 4X1MA 4LRYC 1EWZA 3EEHA 2QKPA 3KYEA 4OH0A 2W3FA 2OLVA 3NOTC 1K0KA 3S7PA 3BRMA 3HUNA 3O3VA 4PKYA 5FASA 4EV4A 4EETB 1C3BA 1CEGA 4PKYG 1TS0A 2B18A 3T50A 5CTNA 3UDIA 1Y4OA 1K6SA 4OQHA 1CK3A 1OJ5A 4IBXA 4BMWA 1NYYA 4Y0TA 1SHVA 3IBJA 1S4SA 3LR3A 1SKOA 1QMEA 2A24A 2GZAA 5CHMA 1F2KA 5FATA 1MPLA 4R3JA 3VFFA 1YLPA 1FCMA 3W8KA 4XT2A 2V1BA 1H8MA 4B4XA 4QD4A 1TD5A 1XGJA 3NECA 2OV5A 3IX4A 1IYPA 4GDBA 1K54A 1Q2PA 5CXWA 1S6RA 3VOYA 4CQHA 4ZTKA 2FH5A 3W4PA 4CLCA 3T1SA 4Z9QA 3IXHA 1LL9A 2KLIA 1O07A 3HLDA 4KG2A 1PWDA 4GS9A 3EWKA 2WKRA 3S1YA 1NRFA 3WS5A 2Y55A 4EUVA 3LIDA 4B93A 2PT7A 1GSVA 4WM9A 2ZQ7A 4JF4A 1Y28A 1HZOA 5FAQA 1D1JA 1NRJA 1STZA 3ZG9B 5HWTA 3NOPC 4HHDA 3UNWA 1H0MA 4S2NA 2W3HA 1BTLA 3F1OA 5GHYA 1E25A 4JGOA 4JGRA 1JVJA 5HPIA 3OZHA 3OPRA 4YOFA 3IXBA 1P9RA 3A3JA 4UA6A 1N9NA 2HGVA 4N1XA 4DE3A 1Z6FA 4UHUA 1K4FA 1TS8A 3ZYTA 1L0DA 5AQ9A 2B95A 4BD1A 3GTCA 5F1FA 3SH7A 1XJ3A 4BQMA 1N9LA 2EWWA 4UAAA 5F68A 4HH2A 4WLAA 3ZG0A 1W8QA 2QZ6A 4MN7A 5DTKA 4Z1WA 1YQSA 2R9WA 2EFUA 3QP6A 4RQ9A 3M6BA 1OTDA 2H10A 5M19A 1D06A 1YLJA 2OSUA 5GHZA 3OPHA 4OP8A 1VETB 3TSGA 4QWOA 2J7VA 3QP4A 5GLAA 1PI5A 1ES3A 3O86A 1LLBA 3IF5A 5CRFA 1P97A 4JXSA 2K7SA 3K3CA 2EFXA 2XR0A 4OOYA 4HQAA 3UB7A 1K57C 3LY4A 4S2MA 3MXSA 5EV0A 1FIKA 1Y54A 5HL1A 3FWLA 5GL9A 2PHYA 2WKQA 4OOLA 3MFDA 3A3FA 5HZHA 4OLGA 3C2WA 4OOMA 2JE5A 2V9AA 4QHCA 5L10A 3R4KA 4R23A 5F69A 2HDRA 2NUPC 3V39A 1LI0A 1K57A 2V1AA 4GHIA 3VSKA 4HJ3A 4WMCD 5DKLA 3ZG8B 5AQ7A 4Y13A 4F94A 3MF0A 4KZBA 2C6WB 2Y2HA 3PBNA 4MBFA 4UQIM 3U2AA 3UB8A 2G2WA 4PM8A 2ZOIA 3UE1A 3B47A 4N9KA 4RYEA 2W1TB 3UB5P 2WUQA 2W3GA 3IHAA 4L9FA 1IKGA 1L0EA 3BFGA 4DJ2A 2ZQDA 4L9GA 1PI4A 2GX5A 3ZGAB 3C4OA 2VLGA 2VGLS 2XRNA 3BFDA 5L07A 3OOVA 4IUKA 5TGFA 3TW8A 3S7OA 5CERA 4KZ5A 3EGDC 2KOIA 4P6ZS 2O0YA 4BBTA 4E3LA 5GLBA 4P0MA 3BQAA 4F3LB 1XA7A 3HUMA 2J3TD 4X53A 1ZKJA 3D72A 3WS2A 1BLHA 1NWZA 2ZL1B 5JYPA 1FOFA 3HCYA 4MBHA 3E0YA 3IX3A 4GKUA 1YLYA 3BLSA 2O99A 3VP1A 1HLUP 1LHYA 5F83A 3T4QA 1TVFA 3CUEA 1M40A 1IYQA 4Y3IA 4BL3A 4GJ4A 4I38A 1OT6A 4YWZA 1KE0A 3GDIA 4EQ1A 4ETZA 3VP3A 2Q0OA 2Z2LB 2V0WA 3JYIA 4DE0A 1G6AA 4M4XA 3SW1A 1EW0A 1KGFA 2PBDP 2J80A 5I94A 4JKTA 2ZQCA 4IUHA 5KSHA 3N8SA 4R6LA 3LIEA 4DE1A 2RL3A 2JBFA 1W8YA 3BLMA 1L0GA 3EOIA 1ONGA 3VOLA 3FG8A 5GLCA 2XH9A 4Y0UA 2OAP1 2Y91A 3SS4A 4E6WA 1NJ4A 3OLOA 1PW8A 2KX6A 4S2KA 3MXRA 1WYBA 1KOUA 5A92A 4AFIA 3DW0A 3MBZA 4FSFA 4QY6A 4DRTA 4GNUA 5TJJA 5C5KA 2E8IA 3NULA 4GDNA 2PAVP 1PZPA 2WKPA 4XUXA 3P98A 1ZG6A 2L4RA 4LV0A 3G30A 5J3WA 4S2IA 5EVIB 1PIOA 4H6JA 4PHTA 4E3MA 3KO6A 3FC7A 5DJUA 2ZMAA 4KZ9A 4KENB 3NBLA 2R78A 3S7NA 2HJ9C 1H8ZA 2FFYA 3BJNA 1NXYA 3BM6A 4K0XA 1PW1A 4X1LA 4HOIA 3G35A 2UWXA 4B4ZA 3PBSA 1XXMA 3Q7VB 4I3AA 2PU2A 3H82B 1JTDA 3HLWA 4CLCD 2Y2JA 2EX6A 4PM9A 3LGOA 3MQ0A 3BFCA 3G4PA 1FCNA 3PYPA 4MLLA 4GCZA 3SZTA 1TDGA 2XFSA 4JPMA 4NXBA 5L8MA 3MZEA 1OT9A 5DJTA 4JF6A 1YMXA 5FQKA 3IQAA 2VGLM 3G34A 2L1MA 5TBMB 4OVDA 2ZC6B 2WK0A 4EEUA 1S67L 4I39A 1WYCA 4ARZB 4EU0A 3QP5A 4WZ5A 1PZOA 2WGWB 2XROA 4NEED 1V9ZA 4P6ZM 2JC7A 2P74A 1K25A 3GVBA 4OONA 1FILA 5L09A 1IYOA 4GLQA 1MKMA 5HDSA 2W3EA 3NOUC 1XP4A 3ZDJA 1PWGA 1RP5A 5EECA 1V9YA 2J3WA 5IT5A 4LCMA 3S22A 2DNSA 1OJGA 3CAXA 2PDRA 5HDCA 3Q7ZA 3D4FA 1DJAA 4HBTA 4KG5A 1S66L 4NETA 4UA7A 1K6RA 5E2FA 3G32A 3PHYA 3T4TA 2D02A 4EERA 1E3UA 4BWIA 2YKFA 2VX8A 4LENA 4II7A 4MN6A 2XK1A 4YINA 1L2SA 3BQ8A 3E4PA 2Y59A 2Y2IA 1XJ6A 1IEMA 4BBVA 2JKTI 2XFTA 1Q2QA 5AJGA 4BBUA 5EOEA 1K54C 3PBQA 2IA2A 4M3KA 1KGEA 4BLMA 1NY0A 1BSGA 4B9OA 4CLCC 1BUEA 2WYXA 4KZ8A 4Y5FA 3WS1A 3A3IA 1MWUA 2Q9NA 5CTMA 4DDYA 3HLGA 4B88A 1GA0A 4BJPA 3QP8A 2XA7S 5F6AA 3ZNTA 1GCEA 4EBNA 4A5RA 1NZOA 1P9WA 5CGSA 3JVVA 3T4OA 1FQGA 2PU4A 2Y2GA 5DF9A 1GA9A 2J9PA 5HD3A 1W5DA 4ZJ3A 3HJKA 4HJ4A 3VP4A 3IHBA 1SKFA 3M2JA 4S2NC 3RJUA 1ESIA 4IJGA 4OQ0A 2XF3A 5HWWA 2QYBA 1HVBA 1GSWA 1XPBA 2EWVA 4IVIA 5DTSA 3HREA 2ACGA 3DAVA 3BY9A 2Y79A 3ISGA 1TS7A 3PBRA 4MEZA 4GOGA 3CPTB 2Y2MA 5EM1A 1ERQA 2W3DA 2P04A 1EROA 4OLDA 3LI8A 4RVAA 5G4ZA 1YM1A 4HP9A 1G6OA 3SS3A 1WE4A 3IF6B 4D60A 3I7JA 2HDUA 1G68A 3MMHA 4O01A 3R7WB 4DKIA 4FOFA 3RXWA 5CGWA 5DFYA 3V67A 4KZ4A 4LPZA 2AVXA 3V3RA 1AWIA 1MC0A 1TF1A 4GW9A 3GECA 4JLFA 2ZQ9A 4LLOB 4WEKA 2A3UA 4LFUA 3JVUA 2Y2QA 2JCHA 3N8RA 1W79A 3CZDA 1LI9A 1CI9A 5EM0A 3UDXA 4KQDA 1HD8A 1E4DA 2VEAA 3C38A 1CJFA 3AGEA 1FR6A 3H7WB 1VB6A 3V5MA 4ZJ2A 5EPHA 3F1PA 2QPNA 2B5RA 4K08A 2NUTC 2XSSA 1DJCA 2C5WB 2BASA 5EVEA 1VETA 4IHQA 5HAQA 3IS2B 1T1BA 1OTEA 2PR6A 1RCJA 3BEBA 5BOHA 4EESA 2H0TA 4MMNA 2HP9A 3WRTA 3MKEA 2PD7A 3QP1A 4ETXA 3KSFA 2Y2LA 1DP8A 1SZVA 4MN5A 1VEUB 1AXBA 3SOIA 3G2YA 2Y2KA 1XJ4A 4KZ6A 3LI9A 2XD5A 2XGNA 2EX8A 4GD8A 3BW6A 1S1YA 5HPFA 2H28A 4R3BA 4R38A 3D3OA 1ODVA 4S2OA 5DVAA 1NLZA 4DMZA 4G3WA 3OCNA 4WUJA 3T4KA 2P9VB 3T1RA 1FCOA 3FPWA 3MQQA 4PM6A 5AQBA 5IU1A 4HIAA 4WZ4A 3KSIA 3IH8A 3WRZA 3WWXA 4WELA 1EI5A 3NI9A 1DY6A 3DBAA 2W1TA 5AQAA 4L9EA 5G4YA 5HARA 1WA9A 2K2NA 3AGDA 3UN7A 3T1XA 3T4LA 1YLWA 4G3KA 3NCKA 3BYDA 4U0TA 5FDSA 1K56A 2JKTM 2XA7M 4UEYA 2PYRA 5DF7A 5HFOA 2R9XA 2EXBA 4EW7A 3HLFA 3G2ZA 1SDNA 2ZQ8A 2ZQAA 1P0ZA 3O5YA 5DF8A 5FI6A 4RX3A 3CUEC 1W63Q 3HL9A 3MSHA 1YLTA 5DFXA 2VA0A 3SH8A 4NXGA 3P09A 3V3SA 4Q0IA 1T19A 5FA7A 3MS6A 4PM5A 2ZL1A 2BLSA 3VMAA 2V8FA 2XLNA 3C8CA 4OPQA 3EQVA 2V20A 4LV2A 2HP5A 1XX2A 1LSVA 1BYWA 4GN2A 3GRJA 3VE4A 4KQRA 3E98A 1OTBA 2V2FF 1MXOA 3ICYA 2QJ7A 3PXPA 3DTMA 5A91A 2XQZA 1OTAA 1W7FA 3MZFA 5HAIA 4E3OA 5EUAA 4MCWA 3CG5A 4LGWA 1MWSA 1DJBA 3CI6A 1PFLA 2H0YA 3FZCA 5EE8A 5J8XA 2Y2PA 4QU3A 5FSRA 2MJ6A 1NYMA 2YKHA 1HTZA 4OKPA 4ME4A 3TJZC 4OQGA 3FPVA 4X56A 3HVFA 5CHJA 2M1CA 1KE4A 5A8BA 2LB5A 4GD6A 1E3UD 1PRQA 4H6JB 2JKRI 2W27A 4K91A 4WF0A 2G7UA 4LCLA 1MWRA 5M18A 5A90A 2XD1A 4Y7PA 1XA1A 5HL6A 4DDSA 4ESPA 3PBOA 1CI8A 1X0OA 3F1NB 4NG2A 2Y2NA 5GHXA 1GSXA 1MY8A 1K38A 4ZJ1A 5FAPA 2ZJ9A 1PNEA 1LL8A 4N92A 1DP6A 2OWJA 5EVIA 3ZCZA 2UV0E 3Q07A 1PYYA 4Q0HA 3LR0A 1N9BA 5J4EA 3LY3A 3DTKA 3A0SA 3B42A 3V50A 3MQOA 1N9OA 3G6OA 3NJAA 3QNBA 3ZG7B 3T1QB 3E4OA 4S2PA 4PMAA 3LEZA 4DN0A 1YKDA 4Y2FA 3W2ZA 2E8JA 1K55A 4U0XA 4IBRA 5LBRA 1ZC2A 5GLDA 1JWZA 4EBLA 3Q7VA 3OBFA 3H82A 4WZ5C 1XKZA 2VKSA 4RA7A 3LUQA 1XFNA 5F82A 1ES5A 3UPPA 2HV1A 2P7JA 4JBFA 2GJ3A 2ZC3B 2I72A 4CJNA 4MNRA 4S2JA 5CHUA 4HH3A 2Q9MA 3LIAA 3IWOA 3OCLA 3IH9A 4FCFA 3MJQA 4WEJA 2XEPA 1GHPA 3NDGA 3FYZA 1F9IA 2WGVA 3G31A 2QWSA 2HJEA 2ZLYA 5TBMA 1LL5A 4KQOA 2EX2A 4OPRA 3RH8B 4ARZA 1JNUA 3NDEA 3LCEA 4R4RA 5EOOA 4WL9A 3LYXA 3TOIA 3VP0A 5IHVA 5FEGA 2WZXA 3FV7A 3DWZA 1CF0A 3HLBA 1IFQA 3A0RA 4ZAMA 4L0LA 4DXCA 2LB9A 4R0QA 3EQUA 4UQIS 1I5QA 4E3KA 4CPKA 4OQIA 1LT0A 4OPZA 3MFXA 4X25A 1SKOB 3OPLA 4IVKA 1F5MA 2A24B 3T4SA 3KX0X 2ZM8A 4E3IA 2BG1A 4S2LA 5CEBA 4N1HA 4ID4A 2JKFA 3ZFZA 4QB8A 3IXGA 4XT2B 5EVLA 5HSQA 3VE3A 2WAFA 3CITA 3IBRA 1O7EA 2HPBA 1KVMA 4LRZE 4C6YA 4HP4A 4LV3A 1JWPA 2ZM2A 2ZD8A 2PYPA 4PM7A 4CLCB 3A3EA 1TEMA 1J9MA 4UA9A 3K3DA 3RXXA 2VGKA 3RTYA 5KIZA 1F98A 3TG9A 4GS9B 2EXAA 3PAEA 3A3DA 2FZ0A 3JPUA 2EA9A 1OMEA 3UPNA 5G18A 3KYQA 2QJ5A 1BULA 2V1ZA 5U47A 2FFFB 2WZZA 1CEFA 1OTIA 3LIFA 4FTXA 3F1OB 2GNXA 3HJIA 3C5AA 5FDHA 3OPPA 4NK3A 4WBGA 1MKIA 3MZDA 5DTTA 2DMWA 3DWKA 4FD8A 2JKGA 4K0WA 3QP2A 3CHWP 3KSHA 4O7DA 4ZDXA 2X02A 3NHQA 2DRWA 4R3AA 2W1RA 2WKIA 5MC7A 1ONHA 1FR1A 4BD0A 4JF5A 4Q8IA 3BWLA 1YT4A 3IF6C 5HDDA 5HX9A 2JKRM 1KVLA 3CPTA 4E3NA 3H9WA 3LEQA 2K31A 4CLCE 1YSPA 1K56D 3MR0A 3BFEA 1YAXA 1LSXA 4NKPA 3MXQA 1U60A 3NC8A 2WKHA 2ZC7A 1BZAA 3VOZA 1N4OA
chains in the Genus database with same CATH topology
2JKTM 2XA7M 4H6JA 4JGQA 4UEYA 2PYRA 4EETB 4PKYG 5AVFA 1TS0A 2B18A 3T50A 4PHTA 3LFVA 2Z6DA 4EW7A 3R7WA 3KO6A 3FC7A 5DJUA 1OJ5A 1P0ZA 3O5YA 4BMWA 2M7VA 2R78A 3S7NA 3CUEC 5J7EA 1W63Q 2HJ9C 3IBJA 1S4SA 3LR3A 2Y8HA 5DFXA 3BJNA 4EXOA 2VA0A 4HNBA 1IOUA 2A24A 2GZAA 4NXGA 2O9CA 4Q0IA 2ZMVA 1T19A 4NXEA 3P7NA 3F1PB 4HOIA 1T1AA 4XT2A 2V1BA 3PBSA 1H8MA 3KYZA 4I3AA 3C8CA 3H82B 3UE3A 1TD5A 3LR5A 5CX7A 1W63M 4CLCD 5K5BA 3UB6A 3EQVA 2B02A 2VV6A 1LSVA 1NLYA 1BYWA 3MQ0A 3VE4A 4CQHA 4GHIB 3E98A 2FH5A 4CLCA 1OTBA 3PYPA 2W0NA 4GCZA 2KLIA 3H7WA 3TRCA 3ICYA 2QJ7A 3T4JA 1ZHHB 3PXPA 4NXBA 5L8MA 1OT9A 4GS9A 1OTAA 4O0PA 3EWKA 2WKRA 5DJTA 1YSQA 3IS2A 2VGLM 4EUVA 3LIDA 1S1ZA 2L1MA 4B93A 5TBMB 2PT7A 4EEUA 1S67L 4I39A 1GSVA 4MCWA 4ARZB 4EU0A 2XROA 4NEED 1LSWA 1Y28A 1V9ZA 3S7QA 4P6ZM 3CI6A 4HY8A 1NRJA 1STZA 5HWTA 3CWFA 3NOPC 4HHDA 3BY8A 2MJ6A 2O9AA 2W3HA 4GLQA 2YKHA 1MKMA 5HDSA 1UWNX 2W3EA 3NOUC 3F1OA 4JGOA 5IS1A 1XFQA 4JGRA 4ME4A 3TJZC 5HPIA 3FPVA 4YOFA 1P9RA 1V9YA 1N9NA 2HGVA 2J3WA 2VZWA 5IT5A 3EEAA 3KSGA 2M1CA 5A8BA 1TS8A 2KDKA 3ZYTA 2LB5A 1OJGA 3CAXA 2PDRA 5HDCA 1T1CA 4H6JB 1S66L 4KUKA 2OOLA 2JKRI 3PHYA 1XJ3A 2W27A 1UWPX 4KUOA 3T4TA 1N9LA 2D02A 4EERA 4WF0A 2EWWA 2G7UA 2YKFA 4BWIA 2VX8A 5F68A 4HH2A 4II7A 4WLAA 4MN6A 3LICA 2JN7A 3BQ8A 3E4PA 5HL6A 4MN7A 1XJ6A 3PBOA 1X0OA 4Z1WA 3F1NB 4BBVA 1GSXA 2JKTI 2OAQ1 5EFWA 5AJGA 4F3LA 1LL8A 4RQ9A 1DP6A 4BBUA 1OTDA 2OWJA 3PBQA 2IA2A 4E04A 4Q0HA 4B9OA 3LR0A 3PR6A 4CLCC 5J4EA 1D06A 4Y5FA 4I3IA 3RFBA 3E4QA 3A0SA 4MDZA 3B42A 3MQOA 2P08A 1G28A 1N9OA 3G6OA 4BJPA 3NJAA 2XA7S 5F6AA 4ZRRA 1P97A 4YNRA 3E4OA 4I5SA 2K7SA 5AVEA 3K3CA 5FL3A 3LIBA 4HQAA 3UB7A 4DN0A 1YKDA 4JGPA 1P9WA 4Y2FA 2PR5A 3W2ZA 2JHEA 3JVVA 3T4OA 3UMEA 4I3JA 2INWA 4Q0JA 5LBRA 5DF9A 3A0VA 5HWVA 3OBFA 3H82A 2PHYA 2VKSA 2WKQA 4OOLA 2VV8A 5HD3A 4HI4A 3LUQA 5HZHA 3C2WA 4OOMA 1XFNA 3HJKA 2V9AA 4HJ4A 2HV1A 3R4KA 2P7JA 2ZBBA 5F69A 2NUPC 2V1AA 2GJ3A 4GHIA 4IJGA 5F5YA 4HJ3A 5HWWA 2QYBA 4HH3A 5DKLA 2I9VA 1GSWA 3LIAA 3MF0A 3OCLA 3PBNA 2EWVA 3MJQA 4UQIM 3U2AA 4WN5A 3UB8A 2V0UA 3BY9A 4WEJA 2Y79A 1TS7A 3UMDA 2ZOIA 1F9IA 3B47A 3PBRA 2QWSA 2HJEA 2HF6A 2CMNA 5TBMA 4KQOA 2W1TB 2ZOHA 2W3DA 3RH8B 2P04A 4ARZA 1JNUA 2W3GA 4L9FA 3LI8A 4DJ3A 4WL9A 3LYXA 4DJ2A 4L9GA 5G4ZA 2GX5A 4HP9A 2VLGA 2VGLS 2XRNA 1G6OA 3UB9A 3OOVA 4IUKA 2M7UA 1TS6A 4O8GA 4EEPA 1IFQA 3A0RA 3TW8A 4L0LA 3S7OA 3VV4A 3EGDC 3MMHA 4O01A 2LB9A 3R7WB 1T18A 3K2NA 2KOIA 3EQUA 2O0YA 4P6ZS 4UQIS 4BBTA 4FOFA 5DFYA 3V67A 2J3TC 3BQAA 1LT0A 2O9BA 4LPZA 3MFXA 3EGXC 4G3VA 1OPXA 4F3LB 2L0WA 1F5MA 2A24B 3T4SA 3OC2A 1MC0A 1TF1A 4GW9A 2J3TD 3KX0X 3ULFA 3D72A 3GECA 1H3QA 2VJWA 1NWZA 4PAUA 1DP9A 1ZTUA 4XT2B 5I5LA 4LLOB 4WEKA 5HSQA 3P01A 3TE8A 5HD5A 3VE3A 1XJ2A 4LRXC 3JVUA 3CITA 3IBRA 3HCYA 2Z6CA 1VHMA 4R70A 3E0YA 4LRZE 4HP4A 3F1NA 2PD8A 2PYPA 2A2LA 4KQDA 4CLCB 2VEAA 4NXFA 3C38A 2O99A 3K3DA 3H7WB 5DKKA 1VB6A 1D7EA 3T4QA 3RTYA 5KIZA 3C30A 3F1PA 1F98A 3CUEA 4GS9B 4K08A 4Y3IA 4GJ4A 2NUTC 2XSSA 2BASA 4I38A 1OT6A 4IHQA 4YWZA 3GDIA 3IS2B 4EQ1A 1T1BA 1OTEA 2ZMFA 2PR6A 4ETZA 2FZ0A 4EESA 3UE6A 4MMNA 3CLOA 2V0WA 2PD7A 1S4RA 2EA9A 3ZQ5A 4ETXA 4M4XA 3KSFA 3SW1A 1EW0A 2OWHA 1DP8A 2J80A 4MN5A 3PBTA 4IUHA 5KSHA 3KYQA 2QJ5A 4R6LA 3LIEA 1XJ4A 3LI9A 1OTIA 3B33A 3LIFA 3EOIA 3F1OB 2GNXA 3VOLA 3HJIA 3BW6A 3FG8A 1S1YA 5HPFA 2H28A 2VV7A 1MZUA 4R38A 3D3OA 1DRMA 2OAP1 1ODVA 1NLZA 2DMWA 3OLOA 4DMZA 4G3WA 3OCNA 3KSHA 4HJ6A 2KX6A 4WUJA 2D01A 1KOUA 3T4KA 4AFIA 3FPWA 3MQQA 3NHQA 3LR4A 4R3AA 4QPRA 5IU1A 4HIAA 2W1RA 4FSFA 5MC7A 5TJJA 3KSIA 1UGUA 2QHKA 3BWLA 5C5KA 4WELA 5HDDA 2JKRM 4LRYC 3DBAA 2WKPA 2QKPA 3EEHA 3H9WA 2W1TA 2K31A 4L9EA 4CLCE 5G4YA 1YSPA 2W3FA 3MR0A 1YAXA 1WA9A 3NOTC 1LSXA 2K2NA 2L4RA 4NKPA 3MXQA 3S7PA 3T4LA 4G3KA 4PKYA 5J3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLC B;  4BMW A;  5CX7 A;  4CLC C;  4CLC A;  4CLC D;  4NKP A;  2A2L A;  3FPV A;  4CLC E;  3FPW A; 
#chains in the Genus database with same CATH topology
 5D3O A;  4JGQ A;  4X69 A;  3IF6 A;  2IWD A;  1YLZ A;  4X68 A;  5AVF A;  3O88 A;  1M6K A;  3LFV A;  1Z09 A;  2Z6D A;  3SH9 A;  1KDS A;  3R7W A;  5TR7 A;  4HBU A;  2M7V A;  4D2O A;  5J7E A;  4ZBE A;  2Y8H A;  4EXO A;  2WKE A;  4HNB A;  3PAG A;  1IOU A;  4DXB A;  2O9C A;  1FSW A;  2ZMV A;  5HAP A;  2HDS A;  4DF6 A;  4NXE A;  3P7N A;  3M2K A;  3F1P B;  4EUZ A;  1T1A A;  3GSG A;  3VSL A;  3E2K A;  3KYZ A;  4HEF A;  3FKW A;  5TFQ A;  3UE3 A;  1CQA A;  1JWV A;  5FI2 A;  5E2E A;  3LR5 A;  5CX7 A;  3QHY A;  1W63 M;  5KSC A;  5K5B A;  3UB6 A;  2B02 A;  2VV6 A;  1NLY A;  3CJM A;  4GHI B;  2HP6 A;  3WS4 A;  1ERM A;  1RGY A;  1ALQ A;  2A49 A;  2IWB A;  2W0N A;  2QMI A;  1IYS A;  4Y17 A;  3H7W A;  3TRC A;  3GMW A;  1H8Y A;  3T4J A;  1ZHH B;  1MWT A;  3SS5 A;  3Q82 A;  4O0P A;  1YSQ A;  3HLE A;  5E2G A;  3IS2 A;  4RX2 A;  1S1Z A;  2CC1 A;  3PTE A;  3N8L A;  3MKF A;  1LSW A;  2RCX A;  3S7Q A;  5CGX A;  5E2H A;  5FQJ A;  1VEU A;  5FAO A;  3NY4 A;  4HY8 A;  2PBY A;  3IWI A;  1QMF A;  2VK3 A;  3CWF A;  1SCW A;  2ZM0 A;  3BY8 A;  2O9A A;  3CMZ A;  1UWN X;  3BEC A;  4FH2 A;  2OLU A;  1A0K A;  5IS1 A;  1XFQ A;  2X01 A;  1ES2 A;  5E43 A;  2J8Y A;  3ZHH A;  5FQQ A;  4LV1 A;  2VZW A;  3ZG5 A;  2V8C A;  3EEA A;  5KMW A;  3KSG A;  4DE2 A;  2KDK A;  4MBK A;  1I2S A;  2GDN A;  1T1C A;  2P9V A;  3C4P A;  4X55 A;  4KUK A;  3S4X A;  2BTF P;  2OOL A;  3UE0 A;  4KUO A;  1UWP X;  4E3J A;  3LIC A;  2JN7 A;  4QJG A;  5FQM A;  5EVI D;  1BT5 A;  3ITB A;  2OAQ 1;  2Z2M B;  5EFW A;  4F3L A;  4EWF A;  4GZB A;  3HUO A;  3N6I A;  4FUW A;  5FQI A;  4E04 A;  4E6X A;  2ZC4 B;  3PR6 A;  5M1A A;  3N7W A;  2X71 A;  4XXR A;  3U4L P;  3W4Q A;  1YMS A;  3L7H A;  4I3I A;  3RFB A;  3BFF A;  3E4Q A;  1I2W A;  4MDZ A;  2P08 A;  5CEC A;  1G28 A;  3D9Y A;  4P85 A;  4ZRR A;  5L2F A;  4YNR A;  2WAE A;  4I5S A;  1XGI A;  1JTG A;  5AVE A;  5FL3 A;  3LIB A;  4KZA A;  2HZ5 A;  3ZVT A;  4JGP A;  2PR5 A;  1L0F A;  2JHE A;  3IX8 A;  3UME A;  3C7U A;  4I3J A;  3ITA A;  4EQI A;  2INW A;  4Q0J A;  3C7V A;  3A0V A;  4PPR A;  5HWV A;  3UY6 A;  2J9O A;  4KG6 A;  5FI7 A;  4BEN A;  2VV8 A;  3NIA A;  3WS0 A;  4HI4 A;  1ZG4 A;  3QNC A;  1L3L A;  2ZBB A;  4N9L A;  1ACF A;  4JXG A;  1RGZ A;  5F5Y A;  4Y0O A;  2PRF A;  2I9V A;  3IXD A;  1BLP A;  1IEL A;  5KZH A;  1H5X A;  3VP2 A;  4WN5 A;  1MBL A;  3IT9 A;  1ESU A;  3Q1F A;  4WMC A;  1G5U A;  2V0U A;  3W4O A;  3O87 A;  3L9K A;  3UMD A;  1GHM A;  2Y2O A;  2HF6 A;  2WGI A;  2CMN A;  1KE3 A;  1S0W A;  2ZOH A;  1YPR A;  4R4S A;  4DJ3 A;  4P87 A;  4HES A;  2IWC A;  4OP5 A;  1SDE A;  3UB9 A;  1IKI A;  4OPY A;  2M7U A;  1TS6 A;  4O8G A;  3ZNY A;  4EEP A;  2EX9 A;  1K4E A;  1VM1 A;  2G2U A;  3VV4 A;  1T18 A;  3K2N A;  5EVI C;  3E2L A;  1GHI A;  3GQZ A;  2J3T C;  3ZVW A;  2O9B A;  3EGX C;  4QY5 A;  4G3V A;  2Y4A A;  1OPX A;  2L0W A;  3OC2 A;  5F1G A;  5A93 A;  3AGF A;  3ULF A;  1H3Q A;  2VJW A;  4PAU A;  1DP9 A;  1ZTU A;  2HDQ A;  5I5L A;  4IED A;  4YFM A;  3P01 A;  3TE8 A;  5HD5 A;  1XJ2 A;  4LRX C;  2VGJ A;  1K55 C;  2Z6C A;  1VHM A;  3LO7 A;  4R70 A;  3UPO A;  1PWC A;  5CED A;  4EBP A;  3B3X A;  1KDW A;  3M6H A;  3Q81 A;  3F1N A;  1ES4 A;  2PD8 A;  1KGG A;  3GR2 A;  3IWQ A;  3FKV A;  2A2L A;  1BLS A;  3DTI A;  4NXF A;  4KZ7 A;  4GB7 A;  1TDL A;  2DCF A;  5DKK A;  1D7E A;  3C30 A;  3DTE A;  2ZC5 B;  3GV9 A;  4C3Q A;  3UO9 A;  4KZ3 A;  1FSY A;  4BL2 A;  2ZMF A;  2XDM A;  3N4I A;  4WYY A;  3UE6 A;  3CLO A;  1VQQ A;  1BLC A;  4FH4 A;  5FEF A;  4H8R A;  1S4R A;  3ZQ5 A;  2OWH A;  3PBT A;  5FQ9 A;  4JXV A;  5HW3 A;  5JYO A;  4R1G A;  4JXW A;  2H5S A;  4XUZ A;  3B33 A;  3UDF A;  1NZU A;  2VV7 A;  1MZU A;  1DRM A;  4KQQ A;  4U3T A;  3VFH A;  1J3W A;  4P6B A;  4HJ6 A;  2D01 A;  2WGW A;  4C75 A;  3HLC A;  3LR4 A;  3T12 B;  4X6T A;  4QPR A;  1UGU A;  2QHK A;  2WAD A;  4Y15 A;  3HBR A;  4X1M A;  4LRY C;  1EWZ A;  3EEH A;  2QKP A;  3KYE A;  4OH0 A;  2W3F A;  2OLV A;  3NOT C;  1K0K A;  3S7P A;  3BRM A;  3HUN A;  3O3V A;  4PKY A;  5FAS A;  4EV4 A;  4EET B;  1C3B A;  1CEG A;  4PKY G;  1TS0 A;  2B18 A;  3T50 A;  5CTN A;  3UDI A;  1Y4O A;  1K6S A;  4OQH A;  1CK3 A;  1OJ5 A;  4IBX A;  4BMW A;  1NYY A;  4Y0T A;  1SHV A;  3IBJ A;  1S4S A;  3LR3 A;  1SKO A;  1QME A;  2A24 A;  2GZA A;  5CHM A;  1F2K A;  5FAT A;  1MPL A;  4R3J A;  3VFF A;  1YLP A;  1FCM A;  3W8K A;  4XT2 A;  2V1B A;  1H8M A;  4B4X A;  4QD4 A;  1TD5 A;  1XGJ A;  3NEC A;  2OV5 A;  3IX4 A;  1IYP A;  4GDB A;  1K54 A;  1Q2P A;  5CXW A;  1S6R A;  3VOY A;  4CQH A;  4ZTK A;  2FH5 A;  3W4P A;  4CLC A;  3T1S A;  4Z9Q A;  3IXH A;  1LL9 A;  2KLI A;  1O07 A;  3HLD A;  4KG2 A;  1PWD A;  4GS9 A;  3EWK A;  2WKR A;  3S1Y A;  1NRF A;  3WS5 A;  2Y55 A;  4EUV A;  3LID A;  4B93 A;  2PT7 A;  1GSV A;  4WM9 A;  2ZQ7 A;  4JF4 A;  1Y28 A;  1HZO A;  5FAQ A;  1D1J A;  1NRJ A;  1STZ A;  3ZG9 B;  5HWT A;  3NOP C;  4HHD A;  3UNW A;  1H0M A;  4S2N A;  2W3H A;  1BTL A;  3F1O A;  5GHY A;  1E25 A;  4JGO A;  4JGR A;  1JVJ A;  5HPI A;  3OZH A;  3OPR A;  4YOF A;  3IXB A;  1P9R A;  3A3J A;  4UA6 A;  1N9N A;  2HGV A;  4N1X A;  4DE3 A;  1Z6F A;  4UHU A;  1K4F A;  1TS8 A;  3ZYT A;  1L0D A;  5AQ9 A;  2B95 A;  4BD1 A;  3GTC A;  5F1F A;  3SH7 A;  1XJ3 A;  4BQM A;  1N9L A;  2EWW A;  4UAA A;  5F68 A;  4HH2 A;  4WLA A;  3ZG0 A;  1W8Q A;  2QZ6 A;  4MN7 A;  5DTK A;  4Z1W A;  1YQS A;  2R9W A;  2EFU A;  3QP6 A;  4RQ9 A;  3M6B A;  1OTD A;  2H10 A;  5M19 A;  1D06 A;  1YLJ A;  2OSU A;  5GHZ A;  3OPH A;  4OP8 A;  1VET B;  3TSG A;  4QWO A;  2J7V A;  3QP4 A;  5GLA A;  1PI5 A;  1ES3 A;  3O86 A;  1LLB A;  3IF5 A;  5CRF A;  1P97 A;  4JXS A;  2K7S A;  3K3C A;  2EFX A;  2XR0 A;  4OOY A;  4HQA A;  3UB7 A;  1K57 C;  3LY4 A;  4S2M A;  3MXS A;  5EV0 A;  1FIK A;  1Y54 A;  5HL1 A;  3FWL A;  5GL9 A;  2PHY A;  2WKQ A;  4OOL A;  3MFD A;  3A3F A;  5HZH A;  4OLG A;  3C2W A;  4OOM A;  2JE5 A;  2V9A A;  4QHC A;  5L10 A;  3R4K A;  4R23 A;  5F69 A;  2HDR A;  2NUP C;  3V39 A;  1LI0 A;  1K57 A;  2V1A A;  4GHI A;  3VSK A;  4HJ3 A;  4WMC D;  5DKL A;  3ZG8 B;  5AQ7 A;  4Y13 A;  4F94 A;  3MF0 A;  4KZB A;  2C6W B;  2Y2H A;  3PBN A;  4MBF A;  4UQI M;  3U2A A;  3UB8 A;  2G2W A;  4PM8 A;  2ZOI A;  3UE1 A;  3B47 A;  4N9K A;  4RYE A;  2W1T B;  3UB5 P;  2WUQ A;  2W3G A;  3IHA A;  4L9F A;  1IKG A;  1L0E A;  3BFG A;  4DJ2 A;  2ZQD A;  4L9G A;  1PI4 A;  2GX5 A;  3ZGA B;  3C4O A;  2VLG A;  2VGL S;  2XRN A;  3BFD A;  5L07 A;  3OOV A;  4IUK A;  5TGF A;  3TW8 A;  3S7O A;  5CER A;  4KZ5 A;  3EGD C;  2KOI A;  4P6Z S;  2O0Y A;  4BBT A;  4E3L A;  5GLB A;  4P0M A;  3BQA A;  4F3L B;  1XA7 A;  3HUM A;  2J3T D;  4X53 A;  1ZKJ A;  3D72 A;  3WS2 A;  1BLH A;  1NWZ A;  2ZL1 B;  5JYP A;  1FOF A;  3HCY A;  4MBH A;  3E0Y A;  3IX3 A;  4GKU A;  1YLY A;  3BLS A;  2O99 A;  3VP1 A;  1HLU P;  1LHY A;  5F83 A;  3T4Q A;  1TVF A;  3CUE A;  1M40 A;  1IYQ A;  4Y3I A;  4BL3 A;  4GJ4 A;  4I38 A;  1OT6 A;  4YWZ A;  1KE0 A;  3GDI A;  4EQ1 A;  4ETZ A;  3VP3 A;  2Q0O A;  2Z2L B;  2V0W A;  3JYI A;  4DE0 A;  1G6A A;  4M4X A;  3SW1 A;  1EW0 A;  1KGF A;  2PBD P;  2J80 A;  5I94 A;  4JKT A;  2ZQC A;  4IUH A;  5KSH A;  3N8S A;  4R6L A;  3LIE A;  4DE1 A;  2RL3 A;  2JBF A;  1W8Y A;  3BLM A;  1L0G A;  3EOI A;  1ONG A;  3VOL A;  3FG8 A;  5GLC A;  2XH9 A;  4Y0U A;  2OAP 1;  2Y91 A;  3SS4 A;  4E6W A;  1NJ4 A;  3OLO A;  1PW8 A;  2KX6 A;  4S2K A;  3MXR A;  1WYB A;  1KOU A;  5A92 A;  4AFI A;  3DW0 A;  3MBZ A;  4FSF A;  4QY6 A;  4DRT A;  4GNU A;  5TJJ A;  5C5K A;  2E8I A;  3NUL A;  4GDN A;  2PAV P;  1PZP A;  2WKP A;  4XUX A;  3P98 A;  1ZG6 A;  2L4R A;  4LV0 A;  3G30 A;  5J3W A;  4S2I A;  5EVI B;  1PIO A;  4H6J A;  4PHT A;  4E3M A;  3KO6 A;  3FC7 A;  5DJU A;  2ZMA A;  4KZ9 A;  4KEN B;  3NBL A;  2R78 A;  3S7N A;  2HJ9 C;  1H8Z A;  2FFY A;  3BJN A;  1NXY A;  3BM6 A;  4K0X A;  1PW1 A;  4X1L A;  4HOI A;  3G35 A;  2UWX A;  4B4Z A;  3PBS A;  1XXM A;  3Q7V B;  4I3A A;  2PU2 A;  3H82 B;  1JTD A;  3HLW A;  4CLC D;  2Y2J A;  2EX6 A;  4PM9 A;  3LGO A;  3MQ0 A;  3BFC A;  3G4P A;  1FCN A;  3PYP A;  4MLL A;  4GCZ A;  3SZT A;  1TDG A;  2XFS A;  4JPM A;  4NXB A;  5L8M A;  3MZE A;  1OT9 A;  5DJT A;  4JF6 A;  1YMX A;  5FQK A;  3IQA A;  2VGL M;  3G34 A;  2L1M A;  5TBM B;  4OVD A;  2ZC6 B;  2WK0 A;  4EEU A;  1S67 L;  4I39 A;  1WYC A;  4ARZ B;  4EU0 A;  3QP5 A;  4WZ5 A;  1PZO A;  2WGW B;  2XRO A;  4NEE D;  1V9Z A;  4P6Z M;  2JC7 A;  2P74 A;  1K25 A;  3GVB A;  4OON A;  1FIL A;  5L09 A;  1IYO A;  4GLQ A;  1MKM A;  5HDS A;  2W3E A;  3NOU C;  1XP4 A;  3ZDJ A;  1PWG A;  1RP5 A;  5EEC A;  1V9Y A;  2J3W A;  5IT5 A;  4LCM A;  3S22 A;  2DNS A;  1OJG A;  3CAX A;  2PDR A;  5HDC A;  3Q7Z A;  3D4F A;  1DJA A;  4HBT A;  4KG5 A;  1S66 L;  4NET A;  4UA7 A;  1K6R A;  5E2F A;  3G32 A;  3PHY A;  3T4T A;  2D02 A;  4EER A;  1E3U A;  4BWI A;  2YKF A;  2VX8 A;  4LEN A;  4II7 A;  4MN6 A;  2XK1 A;  4YIN A;  1L2S A;  3BQ8 A;  3E4P A;  2Y59 A;  2Y2I A;  1XJ6 A;  1IEM A;  4BBV A;  2JKT I;  2XFT A;  1Q2Q A;  5AJG A;  4BBU A;  5EOE A;  1K54 C;  3PBQ A;  2IA2 A;  4M3K A;  1KGE A;  4BLM A;  1NY0 A;  1BSG A;  4B9O A;  4CLC C;  1BUE A;  2WYX A;  4KZ8 A;  4Y5F A;  3WS1 A;  3A3I A;  1MWU A;  2Q9N A;  5CTM A;  4DDY A;  3HLG A;  4B88 A;  1GA0 A;  4BJP A;  3QP8 A;  2XA7 S;  5F6A A;  3ZNT A;  1GCE A;  4EBN A;  4A5R A;  1NZO A;  1P9W A;  5CGS A;  3JVV A;  3T4O A;  1FQG A;  2PU4 A;  2Y2G A;  5DF9 A;  1GA9 A;  2J9P A;  5HD3 A;  1W5D A;  4ZJ3 A;  3HJK A;  4HJ4 A;  3VP4 A;  3IHB A;  1SKF A;  3M2J A;  4S2N C;  3RJU A;  1ESI A;  4IJG A;  4OQ0 A;  2XF3 A;  5HWW A;  2QYB A;  1HVB A;  1GSW A;  1XPB A;  2EWV A;  4IVI A;  5DTS A;  3HRE A;  2ACG A;  3DAV A;  3BY9 A;  2Y79 A;  3ISG A;  1TS7 A;  3PBR A;  4MEZ A;  4GOG A;  3CPT B;  2Y2M A;  5EM1 A;  1ERQ A;  2W3D A;  2P04 A;  1ERO A;  4OLD A;  3LI8 A;  4RVA A;  5G4Z A;  1YM1 A;  4HP9 A;  1G6O A;  3SS3 A;  1WE4 A;  3IF6 B;  4D60 A;  3I7J A;  2HDU A;  1G68 A;  3MMH A;  4O01 A;  3R7W B;  4DKI A;  4FOF A;  3RXW A;  5CGW A;  5DFY A;  3V67 A;  4KZ4 A;  4LPZ A;  2AVX A;  3V3R A;  1AWI A;  1MC0 A;  1TF1 A;  4GW9 A;  3GEC A;  4JLF A;  2ZQ9 A;  4LLO B;  4WEK A;  2A3U A;  4LFU A;  3JVU A;  2Y2Q A;  2JCH A;  3N8R A;  1W79 A;  3CZD A;  1LI9 A;  1CI9 A;  5EM0 A;  3UDX A;  4KQD A;  1HD8 A;  1E4D A;  2VEA A;  3C38 A;  1CJF A;  3AGE A;  1FR6 A;  3H7W B;  1VB6 A;  3V5M A;  4ZJ2 A;  5EPH A;  3F1P A;  2QPN A;  2B5R A;  4K08 A;  2NUT C;  2XSS A;  1DJC A;  2C5W B;  2BAS A;  5EVE A;  1VET A;  4IHQ A;  5HAQ A;  3IS2 B;  1T1B A;  1OTE A;  2PR6 A;  1RCJ A;  3BEB A;  5BOH A;  4EES A;  2H0T A;  4MMN A;  2HP9 A;  3WRT A;  3MKE A;  2PD7 A;  3QP1 A;  4ETX A;  3KSF A;  2Y2L A;  1DP8 A;  1SZV A;  4MN5 A;  1VEU B;  1AXB A;  3SOI A;  3G2Y A;  2Y2K A;  1XJ4 A;  4KZ6 A;  3LI9 A;  2XD5 A;  2XGN A;  2EX8 A;  4GD8 A;  3BW6 A;  1S1Y A;  5HPF A;  2H28 A;  4R3B A;  4R38 A;  3D3O A;  1ODV A;  4S2O A;  5DVA A;  1NLZ A;  4DMZ A;  4G3W A;  3OCN A;  4WUJ A;  3T4K A;  2P9V B;  3T1R A;  1FCO A;  3FPW A;  3MQQ A;  4PM6 A;  5AQB A;  5IU1 A;  4HIA A;  4WZ4 A;  3KSI A;  3IH8 A;  3WRZ A;  3WWX A;  4WEL A;  1EI5 A;  3NI9 A;  1DY6 A;  3DBA A;  2W1T A;  5AQA A;  4L9E A;  5G4Y A;  5HAR A;  1WA9 A;  2K2N A;  3AGD A;  3UN7 A;  3T1X A;  3T4L A;  1YLW A;  4G3K A;  3NCK A;  3BYD A;  4U0T A;  5FDS A;  1K56 A;  2JKT M;  2XA7 M;  4UEY A;  2PYR A;  5DF7 A;  5HFO A;  2R9X A;  2EXB A;  4EW7 A;  3HLF A;  3G2Z A;  1SDN A;  2ZQ8 A;  2ZQA A;  1P0Z A;  3O5Y A;  5DF8 A;  5FI6 A;  4RX3 A;  3CUE C;  1W63 Q;  3HL9 A;  3MSH A;  1YLT A;  5DFX A;  2VA0 A;  3SH8 A;  4NXG A;  3P09 A;  3V3S A;  4Q0I A;  1T19 A;  5FA7 A;  3MS6 A;  4PM5 A;  2ZL1 A;  2BLS A;  3VMA A;  2V8F A;  2XLN A;  3C8C A;  4OPQ A;  3EQV A;  2V20 A;  4LV2 A;  2HP5 A;  1XX2 A;  1LSV A;  1BYW A;  4GN2 A;  3GRJ A;  3VE4 A;  4KQR A;  3E98 A;  1OTB A;  2V2F F;  1MXO A;  3ICY A;  2QJ7 A;  3PXP A;  3DTM A;  5A91 A;  2XQZ A;  1OTA A;  1W7F A;  3MZF A;  5HAI A;  4E3O A;  5EUA A;  4MCW A;  3CG5 A;  4LGW A;  1MWS A;  1DJB A;  3CI6 A;  1PFL A;  2H0Y A;  3FZC A;  5EE8 A;  5J8X A;  2Y2P A;  4QU3 A;  5FSR A;  2MJ6 A;  1NYM A;  2YKH A;  1HTZ A;  4OKP A;  4ME4 A;  3TJZ C;  4OQG A;  3FPV A;  4X56 A;  3HVF A;  5CHJ A;  2M1C A;  1KE4 A;  5A8B A;  2LB5 A;  4GD6 A;  1E3U D;  1PRQ A;  4H6J B;  2JKR I;  2W27 A;  4K91 A;  4WF0 A;  2G7U A;  4LCL A;  1MWR A;  5M18 A;  5A90 A;  2XD1 A;  4Y7P A;  1XA1 A;  5HL6 A;  4DDS A;  4ESP A;  3PBO A;  1CI8 A;  1X0O A;  3F1N B;  4NG2 A;  2Y2N A;  5GHX A;  1GSX A;  1MY8 A;  1K38 A;  4ZJ1 A;  5FAP A;  2ZJ9 A;  1PNE A;  1LL8 A;  4N92 A;  1DP6 A;  2OWJ A;  5EVI A;  3ZCZ A;  2UV0 E;  3Q07 A;  1PYY A;  4Q0H A;  3LR0 A;  1N9B A;  5J4E A;  3LY3 A;  3DTK A;  3A0S A;  3B42 A;  3V50 A;  3MQO A;  1N9O A;  3G6O A;  3NJA A;  3QNB A;  3ZG7 B;  3T1Q B;  3E4O A;  4S2P A;  4PMA A;  3LEZ A;  4DN0 A;  1YKD A;  4Y2F A;  3W2Z A;  2E8J A;  1K55 A;  4U0X A;  4IBR A;  5LBR A;  1ZC2 A;  5GLD A;  1JWZ A;  4EBL A;  3Q7V A;  3OBF A;  3H82 A;  4WZ5 C;  1XKZ A;  2VKS A;  4RA7 A;  3LUQ A;  1XFN A;  5F82 A;  1ES5 A;  3UPP A;  2HV1 A;  2P7J A;  4JBF A;  2GJ3 A;  2ZC3 B;  2I72 A;  4CJN A;  4MNR A;  4S2J A;  5CHU A;  4HH3 A;  2Q9M A;  3LIA A;  3IWO A;  3OCL A;  3IH9 A;  4FCF A;  3MJQ A;  4WEJ A;  2XEP A;  1GHP A;  3NDG A;  3FYZ A;  1F9I A;  2WGV A;  3G31 A;  2QWS A;  2HJE A;  2ZLY A;  5TBM A;  1LL5 A;  4KQO A;  2EX2 A;  4OPR A;  3RH8 B;  4ARZ A;  1JNU A;  3NDE A;  3LCE A;  4R4R A;  5EOO A;  4WL9 A;  3LYX A;  3TOI A;  3VP0 A;  5IHV A;  5FEG A;  2WZX A;  3FV7 A;  3DWZ A;  1CF0 A;  3HLB A;  1IFQ A;  3A0R A;  4ZAM A;  4L0L A;  4DXC A;  2LB9 A;  4R0Q A;  3EQU A;  4UQI S;  1I5Q A;  4E3K A;  4CPK A;  4OQI A;  1LT0 A;  4OPZ A;  3MFX A;  4X25 A;  1SKO B;  3OPL A;  4IVK A;  1F5M A;  2A24 B;  3T4S A;  3KX0 X;  2ZM8 A;  4E3I A;  2BG1 A;  4S2L A;  5CEB A;  4N1H A;  4ID4 A;  2JKF A;  3ZFZ A;  4QB8 A;  3IXG A;  4XT2 B;  5EVL A;  5HSQ A;  3VE3 A;  2WAF A;  3CIT A;  3IBR A;  1O7E A;  2HPB A;  1KVM A;  4LRZ E;  4C6Y A;  4HP4 A;  4LV3 A;  1JWP A;  2ZM2 A;  2ZD8 A;  2PYP A;  4PM7 A;  4CLC B;  3A3E A;  1TEM A;  1J9M A;  4UA9 A;  3K3D A;  3RXX A;  2VGK A;  3RTY A;  5KIZ A;  1F98 A;  3TG9 A;  4GS9 B;  2EXA A;  3PAE A;  3A3D A;  2FZ0 A;  3JPU A;  2EA9 A;  1OME A;  3UPN A;  5G18 A;  3KYQ A;  2QJ5 A;  1BUL A;  2V1Z A;  5U47 A;  2FFF B;  2WZZ A;  1CEF A;  1OTI A;  3LIF A;  4FTX A;  3F1O B;  2GNX A;  3HJI A;  3C5A A;  5FDH A;  3OPP A;  4NK3 A;  4WBG A;  1MKI A;  3MZD A;  5DTT A;  2DMW A;  3DWK A;  4FD8 A;  2JKG A;  4K0W A;  3QP2 A;  3CHW P;  3KSH A;  4O7D A;  4ZDX A;  2X02 A;  3NHQ A;  2DRW A;  4R3A A;  2W1R A;  2WKI A;  5MC7 A;  1ONH A;  1FR1 A;  4BD0 A;  4JF5 A;  4Q8I A;  3BWL A;  1YT4 A;  3IF6 C;  5HDD A;  5HX9 A;  2JKR M;  1KVL A;  3CPT A;  4E3N A;  3H9W A;  3LEQ A;  2K31 A;  4CLC E;  1YSP A;  1K56 D;  3MR0 A;  3BFE A;  1YAX A;  1LSX A;  4NKP A;  3MXQ A;  1U60 A;  3NC8 A;  2WKH A;  2ZC7 A;  1BZA A;  3VOZ A;  1N4O A; 
#chains in the Genus database with same CATH homology
 2JKT M;  2XA7 M;  4H6J A;  4JGQ A;  4UEY A;  2PYR A;  4EET B;  4PKY G;  5AVF A;  1TS0 A;  2B18 A;  3T50 A;  4PHT A;  3LFV A;  2Z6D A;  4EW7 A;  3R7W A;  3KO6 A;  3FC7 A;  5DJU A;  1OJ5 A;  1P0Z A;  3O5Y A;  4BMW A;  2M7V A;  2R78 A;  3S7N A;  3CUE C;  5J7E A;  1W63 Q;  2HJ9 C;  3IBJ A;  1S4S A;  3LR3 A;  2Y8H A;  5DFX A;  3BJN A;  4EXO A;  2VA0 A;  4HNB A;  1IOU A;  2A24 A;  2GZA A;  4NXG A;  2O9C A;  4Q0I A;  2ZMV A;  1T19 A;  4NXE A;  3P7N A;  3F1P B;  4HOI A;  1T1A A;  4XT2 A;  2V1B A;  3PBS A;  1H8M A;  3KYZ A;  4I3A A;  3C8C A;  3H82 B;  3UE3 A;  1TD5 A;  3LR5 A;  5CX7 A;  1W63 M;  4CLC D;  5K5B A;  3UB6 A;  3EQV A;  2B02 A;  2VV6 A;  1LSV A;  1NLY A;  1BYW A;  3MQ0 A;  3VE4 A;  4CQH A;  4GHI B;  3E98 A;  2FH5 A;  4CLC A;  1OTB A;  3PYP A;  2W0N A;  4GCZ A;  2KLI A;  3H7W A;  3TRC A;  3ICY A;  2QJ7 A;  3T4J A;  1ZHH B;  3PXP A;  4NXB A;  5L8M A;  1OT9 A;  4GS9 A;  1OTA A;  4O0P A;  3EWK A;  2WKR A;  5DJT A;  1YSQ A;  3IS2 A;  2VGL M;  4EUV A;  3LID A;  1S1Z A;  2L1M A;  4B93 A;  5TBM B;  2PT7 A;  4EEU A;  1S67 L;  4I39 A;  1GSV A;  4MCW A;  4ARZ B;  4EU0 A;  2XRO A;  4NEE D;  1LSW A;  1Y28 A;  1V9Z A;  3S7Q A;  4P6Z M;  3CI6 A;  4HY8 A;  1NRJ A;  1STZ A;  5HWT A;  3CWF A;  3NOP C;  4HHD A;  3BY8 A;  2MJ6 A;  2O9A A;  2W3H A;  4GLQ A;  2YKH A;  1MKM A;  5HDS A;  1UWN X;  2W3E A;  3NOU C;  3F1O A;  4JGO A;  5IS1 A;  1XFQ A;  4JGR A;  4ME4 A;  3TJZ C;  5HPI A;  3FPV A;  4YOF A;  1P9R A;  1V9Y A;  1N9N A;  2HGV A;  2J3W A;  2VZW A;  5IT5 A;  3EEA A;  3KSG A;  2M1C A;  5A8B A;  1TS8 A;  2KDK A;  3ZYT A;  2LB5 A;  1OJG A;  3CAX A;  2PDR A;  5HDC A;  1T1C A;  4H6J B;  1S66 L;  4KUK A;  2OOL A;  2JKR I;  3PHY A;  1XJ3 A;  2W27 A;  1UWP X;  4KUO A;  3T4T A;  1N9L A;  2D02 A;  4EER A;  4WF0 A;  2EWW A;  2G7U A;  2YKF A;  4BWI A;  2VX8 A;  5F68 A;  4HH2 A;  4II7 A;  4WLA A;  4MN6 A;  3LIC A;  2JN7 A;  3BQ8 A;  3E4P A;  5HL6 A;  4MN7 A;  1XJ6 A;  3PBO A;  1X0O A;  4Z1W A;  3F1N B;  4BBV A;  1GSX A;  2JKT I;  2OAQ 1;  5EFW A;  5AJG A;  4F3L A;  1LL8 A;  4RQ9 A;  1DP6 A;  4BBU A;  1OTD A;  2OWJ A;  3PBQ A;  2IA2 A;  4E04 A;  4Q0H A;  4B9O A;  3LR0 A;  3PR6 A;  4CLC C;  5J4E A;  1D06 A;  4Y5F A;  4I3I A;  3RFB A;  3E4Q A;  3A0S A;  4MDZ A;  3B42 A;  3MQO A;  2P08 A;  1G28 A;  1N9O A;  3G6O A;  4BJP A;  3NJA A;  2XA7 S;  5F6A A;  4ZRR A;  1P97 A;  4YNR A;  3E4O A;  4I5S A;  2K7S A;  5AVE A;  3K3C A;  5FL3 A;  3LIB A;  4HQA A;  3UB7 A;  4DN0 A;  1YKD A;  4JGP A;  1P9W A;  4Y2F A;  2PR5 A;  3W2Z A;  2JHE A;  3JVV A;  3T4O A;  3UME A;  4I3J A;  2INW A;  4Q0J A;  5LBR A;  5DF9 A;  3A0V A;  5HWV A;  3OBF A;  3H82 A;  2PHY A;  2VKS A;  2WKQ A;  4OOL A;  2VV8 A;  5HD3 A;  4HI4 A;  3LUQ A;  5HZH A;  3C2W A;  4OOM A;  1XFN A;  3HJK A;  2V9A A;  4HJ4 A;  2HV1 A;  3R4K A;  2P7J A;  2ZBB A;  5F69 A;  2NUP C;  2V1A A;  2GJ3 A;  4GHI A;  4IJG A;  5F5Y A;  4HJ3 A;  5HWW A;  2QYB A;  4HH3 A;  5DKL A;  2I9V A;  1GSW A;  3LIA A;  3MF0 A;  3OCL A;  3PBN A;  2EWV A;  3MJQ A;  4UQI M;  3U2A A;  4WN5 A;  3UB8 A;  2V0U A;  3BY9 A;  4WEJ A;  2Y79 A;  1TS7 A;  3UMD A;  2ZOI A;  1F9I A;  3B47 A;  3PBR A;  2QWS A;  2HJE A;  2HF6 A;  2CMN A;  5TBM A;  4KQO A;  2W1T B;  2ZOH A;  2W3D A;  3RH8 B;  2P04 A;  4ARZ A;  1JNU A;  2W3G A;  4L9F A;  3LI8 A;  4DJ3 A;  4WL9 A;  3LYX A;  4DJ2 A;  4L9G A;  5G4Z A;  2GX5 A;  4HP9 A;  2VLG A;  2VGL S;  2XRN A;  1G6O A;  3UB9 A;  3OOV A;  4IUK A;  2M7U A;  1TS6 A;  4O8G A;  4EEP A;  1IFQ A;  3A0R A;  3TW8 A;  4L0L A;  3S7O A;  3VV4 A;  3EGD C;  3MMH A;  4O01 A;  2LB9 A;  3R7W B;  1T18 A;  3K2N A;  2KOI A;  3EQU A;  2O0Y A;  4P6Z S;  4UQI S;  4BBT A;  4FOF A;  5DFY A;  3V67 A;  2J3T C;  3BQA A;  1LT0 A;  2O9B A;  4LPZ A;  3MFX A;  3EGX C;  4G3V A;  1OPX A;  4F3L B;  2L0W A;  1F5M A;  2A24 B;  3T4S A;  3OC2 A;  1MC0 A;  1TF1 A;  4GW9 A;  2J3T D;  3KX0 X;  3ULF A;  3D72 A;  3GEC A;  1H3Q A;  2VJW A;  1NWZ A;  4PAU A;  1DP9 A;  1ZTU A;  4XT2 B;  5I5L A;  4LLO B;  4WEK A;  5HSQ A;  3P01 A;  3TE8 A;  5HD5 A;  3VE3 A;  1XJ2 A;  4LRX C;  3JVU A;  3CIT A;  3IBR A;  3HCY A;  2Z6C A;  1VHM A;  4R70 A;  3E0Y A;  4LRZ E;  4HP4 A;  3F1N A;  2PD8 A;  2PYP A;  2A2L A;  4KQD A;  4CLC B;  2VEA A;  4NXF A;  3C38 A;  2O99 A;  3K3D A;  3H7W B;  5DKK A;  1VB6 A;  1D7E A;  3T4Q A;  3RTY A;  5KIZ A;  3C30 A;  3F1P A;  1F98 A;  3CUE A;  4GS9 B;  4K08 A;  4Y3I A;  4GJ4 A;  2NUT C;  2XSS A;  2BAS A;  4I38 A;  1OT6 A;  4IHQ A;  4YWZ A;  3GDI A;  3IS2 B;  4EQ1 A;  1T1B A;  1OTE A;  2ZMF A;  2PR6 A;  4ETZ A;  2FZ0 A;  4EES A;  3UE6 A;  4MMN A;  3CLO A;  2V0W A;  2PD7 A;  1S4R A;  2EA9 A;  3ZQ5 A;  4ETX A;  4M4X A;  3KSF A;  3SW1 A;  1EW0 A;  2OWH A;  1DP8 A;  2J80 A;  4MN5 A;  3PBT A;  4IUH A;  5KSH A;  3KYQ A;  2QJ5 A;  4R6L A;  3LIE A;  1XJ4 A;  3LI9 A;  1OTI A;  3B33 A;  3LIF A;  3EOI A;  3F1O B;  2GNX A;  3VOL A;  3HJI A;  3BW6 A;  3FG8 A;  1S1Y A;  5HPF A;  2H28 A;  2VV7 A;  1MZU A;  4R38 A;  3D3O A;  1DRM A;  2OAP 1;  1ODV A;  1NLZ A;  2DMW A;  3OLO A;  4DMZ A;  4G3W A;  3OCN A;  3KSH A;  4HJ6 A;  2KX6 A;  4WUJ A;  2D01 A;  1KOU A;  3T4K A;  4AFI A;  3FPW A;  3MQQ A;  3NHQ A;  3LR4 A;  4R3A A;  4QPR A;  5IU1 A;  4HIA A;  2W1R A;  4FSF A;  5MC7 A;  5TJJ A;  3KSI A;  1UGU A;  2QHK A;  3BWL A;  5C5K A;  4WEL A;  5HDD A;  2JKR M;  4LRY C;  3DBA A;  2WKP A;  2QKP A;  3EEH A;  3H9W A;  2W1T A;  2K31 A;  4L9E A;  4CLC E;  5G4Y A;  1YSP A;  2W3F A;  3MR0 A;  1YAX A;  1WA9 A;  3NOT C;  1LSX A;  2K2N A;  2L4R A;  4NKP A;  3MXQ A;  3S7P A;  3T4L A;  4G3K A;  4PKY A;  5J3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...