4CLCA

Crystal structure of ybr137w protein
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
169
Chain Sequence
VVLDKKLLERLTSRKVPLEELEDMEKRCFLSTFTYQDAFDLGTYIRNAVKENFPEKPVAIDISLPNGHCLFRTVTYGGSALDNDFWIQRKKKTALRFGHSSFYMGCKKGDKTPEEKFFVDSKEYAFHGGAVLIQSERSDYPYACLTISGLKQEEDHLMALSSLIAFANE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0303 PROTEIN YBR137W
publication title Structural and Functional Characterization of Ybr137Wp Implicate its Involvement in the Targeting of Tail-Anchored Proteins to Membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 56
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4clcA00
4CLCC 5CX7A 4NKPA 4CLCA 4BMWA 3FPWA 4CLCD 4CLCE 3FPVA 2A2LA 4CLCB
chains in the Genus database with same CATH superfamily
1EWZA 4G3KA 4BQMA 2YKFA 4MDZA 1DY6A 3QP1A 3LR4A 2V0WA 4KZ5A 1V9ZA 4OONA 1K6RA 3O3VA 3F1NB 3BFDA 3FPWA 2PHYA 2V2FF 2WGWA 3QP5A 1HD8A 2V0UA 2XA7M 3KYEA 3T50A 1TEMA 5HPIA 4S2IA 2ZC6B 2P9VB 3CMZA 2XLNA 3KO6A 5KMWA 5F5YA 3NECA 3N8RA 3MQOA 3FKWA 3A3FA 3C38A 3LIEA 3VOZA 5AQAA 4IUHA 3BLSA 5TBMB 5FQKA 2R9WA 3N4IA 3IX3A 1NRJA 5A90A 1K55A 3UNWA 1O07A 4X55A 1BLCA 4UA9A 1S1ZA 1SCWA 3EGXC 3T4KA 5AQ7A 4OKPA 3KSHA 2HZ5A 2PR5A 5EVEA 2DNSA 3CZDA 3NOUC 5HWVA 5TR7A 4WLAA 1LI9A 1H5XA 3NOTC 1ESUA 1NJ4A 1NYYA 3O87A 1PI5A 4HJ3A 2OLVA 1FQGA 2BLSA 2J9OA 3KYZA 4O8GA 4WEKA 5FI2A 4EUZA 3FYZA 3LGOA 4O0PA 1ESIA 4X25A 1ALQA 3PTEA 3W4QA 1H8MA 2H10A 2EX6A 5CECA 2HGVA 4GJ4A 2XD5A 3IF6A 4WBGA 5C5KA 5FA7A 1H8ZA 2ZMAA 3T4SA 3UMEA 1FIKA 3N8LA 5HAIA 3HLEA 4NG2A 3QP4A 1CJFA 5HWWA 1M40A 2PD8A 5F6AA 1K57A 5EVIC 2VJWA 4CLCC 3UB9A 4EWFA 2WGWB 3T4OA 2EFUA 3C30A 1XXMA 1W63M 3N6IA 5TJJA 1NZOA 5HX9A 2NUTC 4PAUA 2R78A 3UPPA 1IYSA 2KLIA 4I39A 1DJBA 1XX2A 4MLLA 4I3JA 3T4QA 2DMWA 3BY9A 1PFLA 2FFYA 4L9FA 2MJ6A 5EUAA 2P04A 4YOFA 4GS9A 3HLWA 3UDXA 1Z09A 5BOHA 5A8BA 2W0NA 1BLPA 1YLWA 1EI5A 3A0SA 4LCMA 1NYMA 5HD3A 3QP8A 1MWUA 1LI0A 5EECA 1KGGA 5G4ZA 2Y2KA 2R9XA 2VGLM 3FV7A 1L0GA 3NC8A 2ZOHA 2W1TB 5EE8A 2PDRA 3IBJA 2W3GA 4DE0A 1TS7A 4MMNA 3C7VA 1ZG4A 3UDFA 3HLCA 4Y5FA 1W79A 4C6YA 3IXGA 2Y4AA 4A5RA 1OJGA 3G4PA 1BLSA 3OBFA 4ZRRA 4IBXA 4OOYA 2P08A 2ZOIA 1L2SA 4IJGA 5DTSA 1PZOA 5FQMA 4E3NA 5CRFA 1DP6A 2GNXA 2JN7A 3IF6B 3CUEA 3NBLA 3GQZA 3RJUA 4R4SA 1ES5A 5L07A 1GHMA 4KUOA 2KX6A 1GHPA 3KSGA 3HUMA 4X6TA 4F3LB 1W8YA 3PBRA 4HP9A 3ZNYA 2Y2GA 3P7NA 3VE4A 3IXBA 2BTFP 4DN0A 5DVAA 2XF3A 1L3LA 3NIAA 3PBQA 4JBFA 4R70A 1SDEA 3KSIA 3MZFA 1DP8A 1NWZA 3MXRA 1T1CA 2JKTM 4HI4A 3D3OA 2W27A 5E2GA 2LB9A 3FC7A 2PRFA 3ZG9B 4X1LA 4FD8A 1IELA 4LGWA 2EXAA 5CXWA 1O7EA 1S6RA 1WE4A 2X01A 4HH2A 3W4OA 5J7EA 5CGSA 4DDYA 3EEAA 3U2AA 2JBFA 2ZQ8A 5A92A 1OT9A 2GJ3A 1JWPA 4WZ5C 2ZM0A 4GN2A 1PIOA 2Y55A 1UWNX 3HUNA 3K3CA 5F82A 4D2OA 1GSWA 4S2LA 1K6SA 4RVAA 4BWIA 4R3JA 1VB6A 3WS5A 1VEUB 4OPYA 4ZJ3A 3MR0A 1XA1A 3UE3A 1TD5A 3IS2A 1BYWA 4N9KA 2PAVP 4QD4A 2VKSA 1K55C 3MQQA 4OPZA 4HEFA 3ZHHA 1VETB 4U3TA 5CEDA 3VV4A 4EBPA 4PKYG 4UHUA 5EM0A 3HJIA 4LV1A 1FCNA 4Q0JA 3LR3A 5L2FA 4YWZA 4EU0A 1YMSA 2OWHA 2ZQDA 1MPLA 4CQHA 3FZCA 4LLOB 3MZDA 3MF0A 2AVXA 5EPHA 3UMDA 4E3MA 1Y28A 2ZQAA 2VGJA 4IUKA 4QPRA 5GHXA 5E2EA 1PW8A 2V8CA 2ZMVA 3IHAA 3HVFA 3D9YA 3FWLA 4L9GA 4Y15A 1XJ2A 4YFMA 1NZUA 5EFWA 3VP0A 4LRYC 5J4EA 2JC7A 4HESA 4KZ8A 4Y2FA 1P9RA 1FSWA 2GZAA 1PI4A 5MC7A 1W7FA 3C2WA 4GCZA 1K0KA 3PBNA 4R6LA 3DBAA 2O0YA 5FDHA 1VM1A 1GHIA 4GDBA 4UQIM 5F83A 3ISGA 4I38A 3F1NA 3EOIA 1K57C 2O9CA 1CI8A 4NKPA 4XUZA 3UB6A 2Y79A 3PBTA 3T4JA 3LIBA 2L4RA 2G7UA 4UAAA 3MFDA 3T4TA 1RP5A 3NHQA 5G4YA 1E3UA 2P9VA 1YPRA 4RX3A 4JXSA 5CTMA 1IYPA 3N7WA 3QNCA 4M4XA 3PAGA 5HL6A 3WRZA 3SOIA 4GNUA 1P0ZA 2LB5A 4GHIA 5TBMA 1K38A 2GX5A 4KG5A 1YLZA 4Y0TA 5IT5A 3JPUA 2G2WA 4HHDA 1KE0A 5M1AA 4FSFA 2A2LA 4OOMA 4IVKA 1IFQA 3IS2B 3KX0X 2Y2PA 5KSHA 2DRWA 1YLYA 4EQIA 5FEFA 4OOLA 3GECA 3IWQA 3DTMA 3FPVA 2EFXA 1BT5A 3M6HA 4ETXA 3BRMA 3ZVWA 2KOIA 4R3BA 4OQHA 3T12B 4PPRA 2H0TA 4DMZA 1CK3A 3C4OA 4WMCD 4LV3A 2OAP1 4JGQA 1MZUA 3L9KA 5AQ9A 4KQRA 1JNUA 4BJPA 1YM1A 2JKRM 5AJGA 2HPBA 1CEFA 4JGOA 3W4PA 3LR5A 4OLDA 4UA6A 2VK3A 2QPNA 5TGFA 4DRTA 4DKIA 3CAXA 1Z6FA 3MMHA 3Q7VB 3CUEC 4OPQA 2Y2IA 5FI7A 1OTAA 2A3UA 2WADA 1AWIA 1OTBA 4E3JA 3ZGAB 5E2HA 2WZXA 4PMAA 4QHCA 5FL3A 3HBRA 2ZBBA 3B33A 1XJ6A 3ZG5A 1MWTA 1V9YA 1XP4A 2WAEA 3B42A 1GSXA 3S7QA 4JLFA 1ACFA 3K2NA 3HJKA 3S22A 4WYYA 2HDRA 2JKRI 3B3XA 2KDKA 4EBNA 3LI8A 2DCFA 3BM6A 4B9OA 4GHIB 3E4OA 3MXSA 1W5DA 4HBUA 4LCLA 4O7DA 4LENA 1F98A 5FSRA 4ARZB 3UN7A 1P97A 4HJ6A 1YQSA 3G32A 4HY8A 4S2OA 2OAQ1 4Y0UA 1YLPA 1ZC2A 4LFUA 5DJTA 2J9PA 2INWA 4PM6A 4KENB 3LI9A 4DXBA 4JF5A 4OVDA 2W1TA 2OWJA 4DE3A 2K2NA 3UE6A 4EQ1A 1ES4A 1G5UA 4MN5A 1NLYA 2O99A 3E4PA 4JXGA 2ZM8A 1D06A 3E4QA 4B93A 3DAVA 3SH8A 2XSSA 2D02A 1BLHA 3RH8B 1I2WA 5E2FA 5CX7A 4S2NC 2Z2MB 5HFOA 4EV4A 1TS0A 3IHBA 3BFGA 3QNBA 3GMWA 4GB7A 1PWGA 1YMXA 2E8IA 4QU3A 5EVID 2XFSA 4BENA 4CLCD 2UV0E 2V1AA 1S1YA 4UQIS 1T19A 4N1XA 4X1MA 3DTIA 3A0VA 2J8YA 4F3LA 2Z6DA 3ITAA 1YAXA 1P9WA 3ZG7B 2VX8A 3QP6A 4QWOA 4JKTA 3V3SA 3JYIA 3T1SA 5GLBA 1KDWA 3SS5A 3ZNTA 4HJ4A 4GD6A 3WS2A 4MBKA 1STZA 4HNBA 1I2SA 2QKPA 3PBSA 3G2YA 2EX2A 5FAPA 5CGWA 4HIAA 1K4FA 4WEJA 1L0DA 3S7PA 3EGDC 3E2KA 4XT2A 3LY3A 4EERA 2EWVA 3TOIA 3RXXA 4N9LA 3G6OA 3Q07A 3C7UA 1ES2A 3FG8A 3HL9A 2ZC5B 3R4KA 5CHMA 1HZOA 1LSXA 2NUPC 4MEZA 4GLQA 1JWZA 2WKRA 3CITA 5CEBA 1FILA 1D1JA 1F9IA 2J3WA 4KG6A 3M6BA 3S4XA 5JYOA 2VV8A 3MBZA 2XGNA 2XD1A 3VMAA 1VEUA 2EX9A 4LV0A 4OP5A 3F1OA 2E8JA 4KZAA 4S2PA 3ICYA 4WF0A 4OQIA 1CF0A 2QZ6A 2ZMFA 1E25A 4KZBA 1TVFA 3FKVA 1U60A 1XGIA 1K25A 3GRJA 4Z1WA 4Q8IA 2ZM2A 1VETA 3SH7A 1L0EA 2W1RA 1JVJA 3ZFZA 5CHJA 1N9LA 5I94A 3BECA 4Q0HA 2OV5A 1SKOA 3UO9A 4P85A 4FCFA 1LSVA 5FEGA 2RCXA 3EQUA 2B02A 1XJ4A 4MBHA 5KZHA 2H5SA 4WUJA 2VV7A 1EW0A 2XK1A 4BD0A 5HWTA 3LIDA 1MWRA 5HARA 2W3HA 3LO7A 3LFVA 1PWCA 4H8RA 5GHYA 2PYPA 5F68A 2WZZA 3NOPC 3ULFA 2OOLA 1KE4A 3PAEA 3U4LP 3IH9A 1KVMA 1OTIA 4Y17A 3D72A 3MSHA 4E3IA 4U0TA 3I7JA 4ZAMA 3R7WB 2HDQA 4XT2B 1ZTUA 3Q7ZA 2W3DA 3Q81A 1DJCA 4R0QA 4MNRA 2WGIA 4RYEA 4N92A 4G3VA 1SHVA 4FH2A 3WRTA 2IWDA 2VGKA 3VP1A 3QP2A 2M7UA 2WK0A 2XH9A 2VZWA 3CI6A 2WKQA 2FH5A 2EX8A 2XDMA 2CMNA 4BBVA 1HTZA 4R4RA 4ME4A 1XJ3A 3LCEA 1HVBA 2JHEA 3C4PA 3G34A 5HPFA 1OTDA 4OQ0A 1QMFA 3F1OB 1BULA 4E3KA 1OJ5A 4KZ9A 1CEGA 2Z6CA 1QMEA 3C5AA 3BY8A 2PR6A 3S1YA 2PU4A 4KUKA 3S7NA 3CG5A 1ZG6A 1LT0A 4KQDA 4GW9A 1K56A 1XKZA 2ZC4B 4P6ZM 3VFHA 1XFNA 2GDNA 4BBUA 2P7JA 1KOUA 1SKOB 4AFIA 3CWFA 3NY4A 2XEPA 4U0XA 5U47A 5J8XA 4QB8A 2XFTA 5AVEA 4R1GA 3IH8A 3F1PA 1YLJA 2VEAA 4MCWA 2I9VA 2A24A 2Y91A 4KZ3A 1FCMA 4WN5A 4K91A 1S66L 4ZJ1A 3EQVA 2L0WA 5FAOA 3PYPA 4HBTA 2V9AA 1T1BA 5GHZA 4EUVA 1L0FA 1VHMA 3BJNA 3DWZA 2Y2QA 5F1GA 1IYQA 5FATA 3TW8A 5GLAA 3IF6C 3ZYTA 4O01A 3V67A 3IX8A 3Q7VA 1YSPA 1LL5A 2ZJ9A 1T1AA 3V50A 5CHUA 1MWSA 4DJ2A 4E6WA 1K54A 4JGRA 5CERA 1Q2PA 2VA0A 4S2JA 2ZC3B 5L09A 3MJQA 3OOVA 2G2UA 2H0YA 5HAPA 1CI9A 3OCNA 2V8FA 2ZLYA 4GOGA 4HQAA 2JKGA 5GLDA 3T1RA 5CGXA 1RCJA 4EETB 2V20A 1N9OA 4X56A 2OLUA 2M7VA 3V3RA 4N1HA 3UPOA 2Y2OA 1PZPA 4B4ZA 3GVBA 2PBDP 3E2LA 2Y59A 4ARZA 4P0MA 3VP2A 3OPLA 4ZDXA 3G30A 2QWSA 3OCLA 3SZTA 3BFEA 3O88A 1ZHHB 3Q1FA 4DE2A 2I72A 1N4OA 2HP5A 5FQJA 3IBRA 2P74A 3P09A 1BZAA 1NXYA 1XA7A 5IS1A 3OC2A 2JCHA 1LHYA 1JWVA 5L10A 3BQ8A 2PU2A 1H8YA 4Y3IA 1GA9A 4JXWA 4NETA 2HP9A 4BLMA 1XGJA 3F1PB 1IYOA 4NEED 2BG1A 2HF6A 1WYCA 4R3AA 2A24B 3JVUA 4X53A 4EESA 5EVIB 2WGVA 1HLUP 4OQGA 3D4FA 1GA0A 2IWBA 2Y2HA 3VE3A 3EEHA 1ZKJA 2QYBA 1YLTA 1G68A 2J3TC 3ZVTA 1I5QA 3NDGA 5F69A 3AGDA 3OZHA 4YINA 3ZG8B 5G18A 3WS0A 4RA7A 4F94A 5HL1A 1IKGA 2V1BA 4Y13A 1CQAA 4WZ4A 4NXFA 1GSVA 1FSYA 2JKFA 4R23A 4FUWA 4KG2A 1KE3A 3L7HA 4OH0A 2K7SA 3ZDJA 5FQQA 4IEDA 3W8KA 4Y0OA 3VFFA 2ZQ9A 3V5MA 1ONGA 4I5SA 4S2KA 3MQ0A 5FI6A 1VQQA 3DWKA 4BD1A 3BEBA 4BBTA 4K0WA 1IEMA 2M1CA 1PRQA 4WZ5A 4IVIA 4EXOA 4NXEA 4GZBA 1OMEA 4Q0IA 3BYDA 4P6ZS 4ZJ2A 3A3JA 5HDDA 1YKDA 2C5WB 2ACGA 2EWWA 2XROA 2B95A 3K3DA 3IQAA 5DJUA 1J9MA 2D01A 1JTDA 2CC1A 5M18A 2L1MA 3A3EA 4OP8A 5IHVA 3UB5P 3GTCA 2ZQCA 2IWCA 4EEUA 4X69A 2XQZA 2JE5A 1MY8A 4KZ7A 3BLMA 3BWLA 5TFQA 2PD7A 1F2KA 1K56D 5FDSA 3ZG0A 2XRNA 2B5RA 4Y7PA 4KZ6A 4NXBA 1J3WA 1S67L 3P98A 4B88A 3BQAA 5DF7A 3VSLA 3NDEA 3H7WA 1PWDA 4ESPA 3JVVA 2BASA 2FZ0A 4JF6A 3LEZA 1S4RA 3HLFA 4LRXC 3T1QB 3LICA 1W8QA 2UWXA 2X71A 3PBOA 3MFXA 1G6AA 1FOFA 3SS3A 4JPMA 3CPTA 1YT4A 4KZ4A 2Q0OA 3UY6A 1TDGA 4JF4A 3WWXA 2VV6A 1NLZA 1TF1A 4DF6A 3CLOA 3KYQA 1FCOA 3MS6A 2IA2A 5HAQA 5D3OA 4CPKA 2QJ5A 5EM1A 5DTTA 4E3OA 1FR1A 5EV0A 3VOYA 5HDSA 3NULA 5M19A 1KVLA 2W3FA 3WS4A 4BMWA 3LEQA 3R7WA 3MZEA 1E3UD 4QY5A 4C3QA 5JYPA 1OT6A 2WKIA 4QJGA 1DP9A 1K54C 3HUOA 3TSGA 4QY6A 2WKHA 4R38A 3IWOA 5A91A 5E43A 2HJEA 4PKYA 3ZQ5A 2V1ZA 3MKEA 5A93A 4MBFA 3VSKA 4P87A 2K31A 1TS6A 3S7OA 3SS4A 4ETZA 4DJ3A 1S4SA 5IU1A 4I3AA 1MKMA 4XUXA 4OLGA 4FOFA 4MN7A 5F1FA 4LV2A 1LSWA 3GSGA 3B47A 3CHWP 4KQQA 4WMCA 1MXOA 1IOUA 3LR0A 1BTLA 3H7WB 5AQBA 3IT9A 3IXHA 1ERQA 1WYBA 4BL3A 1W63Q 1ONHA 4UEYA 3IXDA 1OTEA 4HH3A 1AXBA 2H28A 3MKFA 5GLCA 1OPXA 1RGYA 5HZHA 3UDIA 3TG9A 3A0RA 2Y2NA 1Q2QA 2HDSA 2QMIA 2ZQ7A 3CPTB 5KSCA 1D7EA 3PR6A 4GKUA 3V39A 4CJNA 5KIZA 3H82A 4ZTKA 5FASA 5EVLA 3TRCA 4P6BA 1M6KA 1DRMA 1MBLA 3TJZC 3WS1A 5DFXA 2XA7S 3ZCZA 3CJMA 3BW6A 1H0MA 3HLDA 2Y2LA 1SDNA 4NK3A 5LBRA 4B4XA 4LPZA 4EW7A 2QHKA 4OPRA 3IX4A 3UB8A 1SZVA 5FAQA 4ZBEA 2EA9A 3M2KA 5I5LA 1NY0A 3NI9A 3RXWA 4IBRA 3A3IA 3GR2A 4II7A 2HDUA 4GS9B 2J80A 3DW0A 3HREA 3W2ZA 3SH9A 4PHTA 4L9EA 1EROA 2Y2MA 4FTXA 3HLGA 4FH4A 4DXCA 2WKEA 2Q9NA 4H6JA 4X68A 2O9BA 3VOLA 1N9BA 4UA7A 2B18A 2WUQA 2HP6A 1UGUA 4E3LA 3UE1A 3OPRA 1X0OA 3MXQA 1ERMA 1LLBA 2Q9MA 4PM8A 3LIAA 1E4DA 2JKTI 1TS8A 3LIFA 2ZL1A 2XR0A 3NCKA 5HSQA 2ZC7A 1IKIA 3IWIA 3DTEA 4BL2A 5AVFA 4S2NA 3SW1A 3G35A 1PNEA 5GL9A 1C3BA 1MC0A 4YNRA 5HD5A 4CLCE 5DKLA 1NRFA 1LL9A 3H9WA 4PM5A 3OPPA 4XXRA 3T1XA 3H82B 1PW1A 5EVIA 4JGPA 2WAFA 4CLCA 2W3EA 2Y2JA 3UPNA 2HV1A 1TDLA 2HJ9C 2PYRA 3VP3A 1FR6A 5L8MA 1G28A 4DE1A 2X02A 1S0WA 4WM9A 3O5YA 5FQIA 1K4EA 1RGZA 2FFFB 4ID4A 4IHQA 1XPBA 4MN6A 3ITBA 3BFFA 4HOIA 5EOOA 5DTKA 5DF9A 3RTYA 4RQ9A 3O86A 1ES3A 3E0YA 3VP4A 1BUEA 3PHYA 3G2ZA 3UE0A 2C6WB 4E6XA 1BSGA 4EEPA 5J3WA 3UB7A 3EWKA 1MKIA 2O9AA 3RFBA 4GDNA 2QJ7A 3M2JA 1XFQA 4H6JB 4D60A 1KDSA 2VLGA 1Y4OA 2VGLS 1F5MA 4RX2A 3TE8A 3T4LA 4DDSA 1SKFA 3HCYA 3LUQA 3LYXA 4PM9A 5FQ9A 1PYYA 3HLBA 1Y54A 4C75A 2A49A 4L0LA 4M3KA 2WYXA 4NXGA 3DTKA 3Q82A 4LRZE 3G31A 2ZL1B 3C8CA 3E98A 1ODVA 4HP4A 1YSQA 5HDCA 4K08A 3QHYA 4E04A 3KSFA 3P01A 5DFYA 2YKHA 2EXBA 2OSUA 1T18A 3AGEA 1KGFA 1N9NA 1KGEA 1DJAA 5EOEA 2RL3A 3GDIA 3AGFA 1UWPX 4KQOA 3GV9A 1GCEA 4I3IA 1JTGA 3NJAA 4GD8A 4EBLA 2J3TD 4Z9QA 5CTNA 3OLOA 1WA9A 4WL9A 4CLCB 3LY4A 1A0KA 4S2MA 3OPHA 3IF5A 4K0XA 5HW3A 3N8SA 5K5BA 1LL8A 2Y8HA 3BFCA 4WELA 3A3DA 1G6OA 2ZD8A 4JXVA 3PXPA 5DF8A 2PBYA 2WKPA 4PM7A 5DKKA 2Z2LB 1H3QA 2PT7A 4G3WA 2J7VA
chains in the Genus database with same CATH topology
1P9RA 3NOPC 2GZAA 3ULFA 4G3KA 2VV6A 1NLZA 2OOLA 2YKFA 1TF1A 4MDZA 3CLOA 5MC7A 3KYQA 3LR4A 2IA2A 3C2WA 4GCZA 3PBNA 4R6LA 1OTIA 2QJ5A 2V0WA 3DBAA 2O0YA 3D72A 1V9ZA 3F1NB 3FPWA 2PHYA 4UQIM 4I38A 3F1NA 5HDSA 3EOIA 2V0UA 2W3FA 2XA7M 3T50A 3R7WB 5HPIA 2O9CA 4XT2B 1ZTUA 4NKPA 4BMWA 3UB6A 2Y79A 3PBTA 3T4JA 3LIBA 2L4RA 3KO6A 2W3DA 2G7UA 3R7WA 5F5YA 3T4TA 3NHQA 5G4YA 3MQOA 4G3VA 1OT6A 3C38A 1DP9A 3LIEA 4M4XA 2M7UA 5HL6A 4IUHA 2VZWA 3CI6A 4R38A 2WKQA 5TBMB 2FH5A 1P0ZA 2CMNA 2LB5A 4GHIA 4BBVA 5TBMA 4ME4A 2HJEA 1XJ3A 4PKYA 1NRJA 2GX5A 3ZQ5A 5IT5A 2JHEA 4HHDA 4FSFA 5HPFA 2A2LA 4OOMA 1IFQA 2K31A 3IS2B 1TS6A 1OTDA 3S7OA 4ETZA 3KX0X 3F1OB 5KSHA 1S1ZA 3EGXC 3T4KA 1OJ5A 1S4SA 4DJ3A 5IU1A 4I3AA 1MKMA 2Z6CA 4FOFA 3BY8A 4OOLA 2PR6A 3KSHA 4MN7A 3GECA 4KUKA 3S7NA 2PR5A 1LSWA 3FPVA 1LT0A 4KQDA 4GW9A 3NOUC 5HWVA 4ETXA 2KOIA 3B47A 4WLAA 4P6ZM 4DMZA 1IOUA 1XFNA 3LR0A 3H7WB 2OAP1 2P7JA 4JGQA 4BBUA 3NOTC 1MZUA 1KOUA 4AFIA 3CWFA 4HJ3A 1W63Q 4UEYA 4WEKA 3KYZA 4O8GA 5AVEA 1OTEA 4HH3A 4O0PA 2H28A 3F1PA 1JNUA 1OPXA 2VEAA 4MCWA 5HZHA 1H8MA 2I9VA 3A0RA 4BJPA 2HGVA 2A24A 4GJ4A 2JKRM 5AJGA 1D7EA 3PR6A 4WN5A 4JGOA 5C5KA 1S66L 5KIZA 3LR5A 3EQVA 3H82A 2L0WA 3PYPA 3T4SA 3TRCA 3UMEA 2V9AA 1T1BA 1DRMA 4EUVA 1VHMA 3BJNA 3CAXA 5HWWA 3TJZC 5DFXA 2XA7S 2PD8A 3MMHA 3TW8A 3CUEC 3BW6A 5F6AA 3ZYTA 4O01A 3V67A 1OTAA 2VJWA 4CLCC 3UB9A 1OTBA 5LBRA 1YSPA 4LPZA 4EW7A 2QHKA 1T1AA 3T4OA 3C30A 5FL3A 1W63M 5TJJA 2ZBBA 3UB8A 4DJ2A 3B33A 2NUTC 1XJ6A 4JGRA 4PAUA 2R78A 2VA0A 1V9YA 2KLIA 2EA9A 3B42A 1GSXA 3MJQA 4I39A 5I5LA 4I3JA 3S7QA 3T4QA 2DMWA 3BY9A 3K2NA 3HJKA 4L9FA 3OOVA 2MJ6A 4II7A 2P04A 4GS9B 2J80A 2JKRI 3W2ZA 3OCNA 4PHTA 4YOFA 2KDKA 4GS9A 4L9EA 3LI8A 4HQAA 5A8BA 4B9OA 4GHIB 4EETB 3E4OA 1N9OA 2M7VA 2W0NA 4H6JA 2O9BA 1F98A 3VOLA 4ARZB 1P97A 4HJ6A 2B18A 4HY8A 3A0SA 4ARZA 1UGUA 2OAQ1 5HD3A 2QWSA 1X0OA 3OCLA 5DJTA 3MXQA 1ZHHB 5G4ZA 2INWA 3LIAA 2VGLM 2ZOHA 2W1TB 3LI9A 2PDRA 3IBJA 2JKTI 1TS8A 2W1TA 3LIFA 2W3GA 3IBRA 2OWJA 1TS7A 2K2NA 4MMNA 3UE6A 4EQ1A 5HSQA 5IS1A 3OC2A 4Y5FA 4MN5A 1NLYA 5AVFA 2O99A 3BQ8A 3E4PA 3SW1A 4Y3IA 1D06A 1OJGA 3E4QA 4B93A 3OBFA 4ZRRA 2XSSA 2D02A 3RH8B 3F1PB 2P08A 2ZOIA 1MC0A 4NEED 4YNRA 5CX7A 2HF6A 4IJGA 5HD5A 4R3AA 2A24B 1DP6A 3JVUA 2GNXA 4CLCE 5DKLA 4EESA 2JN7A 3H9WA 1TS0A 3CUEA 3H82B 4JGPA 4CLCA 3VE3A 2W3EA 4KUOA 4CLCD 3EEHA 2KX6A 2QYBA 2HV1A 2V1AA 1S1YA 3KSGA 4UQIS 1T19A 2HJ9C 2J3TC 3A0VA 4F3LB 2PYRA 5F69A 3PBRA 4HP9A 5L8MA 1G28A 4F3LA 3P7NA 2Z6DA 3O5YA 3VE4A 1YAXA 1P9WA 2V1BA 4DN0A 4IHQA 4MN6A 3PBQA 2VX8A 4HOIA 4R70A 5DF9A 3RTYA 4NXFA 1GSVA 4RQ9A 3KSIA 1DP8A 4HJ4A 3E0YA 1NWZA 3PHYA 1STZA 4HNBA 1T1CA 2JKTM 4HI4A 2QKPA 2K7SA 3D3OA 2W27A 3PBSA 4EEPA 2LB9A 3FC7A 5J3WA 3UB7A 3EWKA 2O9AA 4HIAA 4I5SA 3MQ0A 3RFBA 2QJ7A 4WEJA 1XFQA 4H6JB 2VLGA 3S7PA 4BBTA 3EGDC 2VGLS 1F5MA 2M1CA 4XT2A 4EERA 4HH2A 3TE8A 3T4LA 2EWVA 4EXOA 4NXEA 5J7EA 3HCYA 3LUQA 3LYXA 3EEAA 3U2AA 3G6OA 4Q0IA 1OT9A 2GJ3A 3FG8A 4P6ZS 3R4KA 4L0LA 1LSXA 4NXGA 5HDDA 1YKDA 2NUPC 4LRZE 1UWNX 4GLQA 2WKRA 3C8CA 2EWWA 3E98A 1ODVA 3CITA 2XROA 3K3CA 1GSWA 3K3DA 1F9IA 4HP4A 1YSQA 2J3WA 5HDCA 5DJUA 4BWIA 4K08A 4E04A 2D01A 3KSFA 1VB6A 2L1MA 2VV8A 3MR0A 3P01A 5DFYA 2YKHA 3UE3A 1TD5A 3IS2A 1BYWA 1T18A 1N9NA 3F1OA 4EEUA 2VKSA 3ICYA 4WF0A 3MQQA 2ZMFA 3GDIA 1UWPX 3BWLA 4Z1WA 2PD7A 3VV4A 4PKYG 4KQOA 2XRNA 4I3IA 3HJIA 3NJAA 4NXBA 4Q0JA 2W1RA 2J3TD 1S67L 3LR3A 4YWZA 3OLOA 4EU0A 1WA9A 2OWHA 3BQAA 4WL9A 4CQHA 4CLCB 4LLOB 1N9LA 3MF0A 3H7WA 3UMDA 4Q0HA 1Y28A 4IUKA 4QPRA 1LSVA 3JVVA 2BASA 2ZMVA 2FZ0A 3EQUA 5K5BA 1S4RA 1LL8A 1XJ4A 2B02A 4LRXC 4WUJA 2Y8HA 4L9GA 2VV7A 1EW0A 3LICA 1XJ2A 4WELA 5HWTA 1G6OA 3LIDA 3PBOA 2W3HA 3MFXA 5EFWA 3PXPA 5J4EA 4LRYC 3LFVA 2WKPA 2PYPA 5DKKA 1H3QA 2PT7A 4G3WA 5F68A 4Y2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLC C;  5CX7 A;  4NKP A;  4CLC A;  4BMW A;  3FPW A;  4CLC D;  4CLC E;  3FPV A;  2A2L A;  4CLC B; 
#chains in the Genus database with same CATH topology
 1EWZ A;  4G3K A;  4BQM A;  2YKF A;  4MDZ A;  1DY6 A;  3QP1 A;  3LR4 A;  2V0W A;  4KZ5 A;  1V9Z A;  4OON A;  1K6R A;  3O3V A;  3F1N B;  3BFD A;  3FPW A;  2PHY A;  2V2F F;  2WGW A;  3QP5 A;  1HD8 A;  2V0U A;  2XA7 M;  3KYE A;  3T50 A;  1TEM A;  5HPI A;  4S2I A;  2ZC6 B;  2P9V B;  3CMZ A;  2XLN A;  3KO6 A;  5KMW A;  5F5Y A;  3NEC A;  3N8R A;  3MQO A;  3FKW A;  3A3F A;  3C38 A;  3LIE A;  3VOZ A;  5AQA A;  4IUH A;  3BLS A;  5TBM B;  5FQK A;  2R9W A;  3N4I A;  3IX3 A;  1NRJ A;  5A90 A;  1K55 A;  3UNW A;  1O07 A;  4X55 A;  1BLC A;  4UA9 A;  1S1Z A;  1SCW A;  3EGX C;  3T4K A;  5AQ7 A;  4OKP A;  3KSH A;  2HZ5 A;  2PR5 A;  5EVE A;  2DNS A;  3CZD A;  3NOU C;  5HWV A;  5TR7 A;  4WLA A;  1LI9 A;  1H5X A;  3NOT C;  1ESU A;  1NJ4 A;  1NYY A;  3O87 A;  1PI5 A;  4HJ3 A;  2OLV A;  1FQG A;  2BLS A;  2J9O A;  3KYZ A;  4O8G A;  4WEK A;  5FI2 A;  4EUZ A;  3FYZ A;  3LGO A;  4O0P A;  1ESI A;  4X25 A;  1ALQ A;  3PTE A;  3W4Q A;  1H8M A;  2H10 A;  2EX6 A;  5CEC A;  2HGV A;  4GJ4 A;  2XD5 A;  3IF6 A;  4WBG A;  5C5K A;  5FA7 A;  1H8Z A;  2ZMA A;  3T4S A;  3UME A;  1FIK A;  3N8L A;  5HAI A;  3HLE A;  4NG2 A;  3QP4 A;  1CJF A;  5HWW A;  1M40 A;  2PD8 A;  5F6A A;  1K57 A;  5EVI C;  2VJW A;  4CLC C;  3UB9 A;  4EWF A;  2WGW B;  3T4O A;  2EFU A;  3C30 A;  1XXM A;  1W63 M;  3N6I A;  5TJJ A;  1NZO A;  5HX9 A;  2NUT C;  4PAU A;  2R78 A;  3UPP A;  1IYS A;  2KLI A;  4I39 A;  1DJB A;  1XX2 A;  4MLL A;  4I3J A;  3T4Q A;  2DMW A;  3BY9 A;  1PFL A;  2FFY A;  4L9F A;  2MJ6 A;  5EUA A;  2P04 A;  4YOF A;  4GS9 A;  3HLW A;  3UDX A;  1Z09 A;  5BOH A;  5A8B A;  2W0N A;  1BLP A;  1YLW A;  1EI5 A;  3A0S A;  4LCM A;  1NYM A;  5HD3 A;  3QP8 A;  1MWU A;  1LI0 A;  5EEC A;  1KGG A;  5G4Z A;  2Y2K A;  2R9X A;  2VGL M;  3FV7 A;  1L0G A;  3NC8 A;  2ZOH A;  2W1T B;  5EE8 A;  2PDR A;  3IBJ A;  2W3G A;  4DE0 A;  1TS7 A;  4MMN A;  3C7V A;  1ZG4 A;  3UDF A;  3HLC A;  4Y5F A;  1W79 A;  4C6Y A;  3IXG A;  2Y4A A;  4A5R A;  1OJG A;  3G4P A;  1BLS A;  3OBF A;  4ZRR A;  4IBX A;  4OOY A;  2P08 A;  2ZOI A;  1L2S A;  4IJG A;  5DTS A;  1PZO A;  5FQM A;  4E3N A;  5CRF A;  1DP6 A;  2GNX A;  2JN7 A;  3IF6 B;  3CUE A;  3NBL A;  3GQZ A;  3RJU A;  4R4S A;  1ES5 A;  5L07 A;  1GHM A;  4KUO A;  2KX6 A;  1GHP A;  3KSG A;  3HUM A;  4X6T A;  4F3L B;  1W8Y A;  3PBR A;  4HP9 A;  3ZNY A;  2Y2G A;  3P7N A;  3VE4 A;  3IXB A;  2BTF P;  4DN0 A;  5DVA A;  2XF3 A;  1L3L A;  3NIA A;  3PBQ A;  4JBF A;  4R70 A;  1SDE A;  3KSI A;  3MZF A;  1DP8 A;  1NWZ A;  3MXR A;  1T1C A;  2JKT M;  4HI4 A;  3D3O A;  2W27 A;  5E2G A;  2LB9 A;  3FC7 A;  2PRF A;  3ZG9 B;  4X1L A;  4FD8 A;  1IEL A;  4LGW A;  2EXA A;  5CXW A;  1O7E A;  1S6R A;  1WE4 A;  2X01 A;  4HH2 A;  3W4O A;  5J7E A;  5CGS A;  4DDY A;  3EEA A;  3U2A A;  2JBF A;  2ZQ8 A;  5A92 A;  1OT9 A;  2GJ3 A;  1JWP A;  4WZ5 C;  2ZM0 A;  4GN2 A;  1PIO A;  2Y55 A;  1UWN X;  3HUN A;  3K3C A;  5F82 A;  4D2O A;  1GSW A;  4S2L A;  1K6S A;  4RVA A;  4BWI A;  4R3J A;  1VB6 A;  3WS5 A;  1VEU B;  4OPY A;  4ZJ3 A;  3MR0 A;  1XA1 A;  3UE3 A;  1TD5 A;  3IS2 A;  1BYW A;  4N9K A;  2PAV P;  4QD4 A;  2VKS A;  1K55 C;  3MQQ A;  4OPZ A;  4HEF A;  3ZHH A;  1VET B;  4U3T A;  5CED A;  3VV4 A;  4EBP A;  4PKY G;  4UHU A;  5EM0 A;  3HJI A;  4LV1 A;  1FCN A;  4Q0J A;  3LR3 A;  5L2F A;  4YWZ A;  4EU0 A;  1YMS A;  2OWH A;  2ZQD A;  1MPL A;  4CQH A;  3FZC A;  4LLO B;  3MZD A;  3MF0 A;  2AVX A;  5EPH A;  3UMD A;  4E3M A;  1Y28 A;  2ZQA A;  2VGJ A;  4IUK A;  4QPR A;  5GHX A;  5E2E A;  1PW8 A;  2V8C A;  2ZMV A;  3IHA A;  3HVF A;  3D9Y A;  3FWL A;  4L9G A;  4Y15 A;  1XJ2 A;  4YFM A;  1NZU A;  5EFW A;  3VP0 A;  4LRY C;  5J4E A;  2JC7 A;  4HES A;  4KZ8 A;  4Y2F A;  1P9R A;  1FSW A;  2GZA A;  1PI4 A;  5MC7 A;  1W7F A;  3C2W A;  4GCZ A;  1K0K A;  3PBN A;  4R6L A;  3DBA A;  2O0Y A;  5FDH A;  1VM1 A;  1GHI A;  4GDB A;  4UQI M;  5F83 A;  3ISG A;  4I38 A;  3F1N A;  3EOI A;  1K57 C;  2O9C A;  1CI8 A;  4NKP A;  4XUZ A;  3UB6 A;  2Y79 A;  3PBT A;  3T4J A;  3LIB A;  2L4R A;  2G7U A;  4UAA A;  3MFD A;  3T4T A;  1RP5 A;  3NHQ A;  5G4Y A;  1E3U A;  2P9V A;  1YPR A;  4RX3 A;  4JXS A;  5CTM A;  1IYP A;  3N7W A;  3QNC A;  4M4X A;  3PAG A;  5HL6 A;  3WRZ A;  3SOI A;  4GNU A;  1P0Z A;  2LB5 A;  4GHI A;  5TBM A;  1K38 A;  2GX5 A;  4KG5 A;  1YLZ A;  4Y0T A;  5IT5 A;  3JPU A;  2G2W A;  4HHD A;  1KE0 A;  5M1A A;  4FSF A;  2A2L A;  4OOM A;  4IVK A;  1IFQ A;  3IS2 B;  3KX0 X;  2Y2P A;  5KSH A;  2DRW A;  1YLY A;  4EQI A;  5FEF A;  4OOL A;  3GEC A;  3IWQ A;  3DTM A;  3FPV A;  2EFX A;  1BT5 A;  3M6H A;  4ETX A;  3BRM A;  3ZVW A;  2KOI A;  4R3B A;  4OQH A;  3T12 B;  4PPR A;  2H0T A;  4DMZ A;  1CK3 A;  3C4O A;  4WMC D;  4LV3 A;  2OAP 1;  4JGQ A;  1MZU A;  3L9K A;  5AQ9 A;  4KQR A;  1JNU A;  4BJP A;  1YM1 A;  2JKR M;  5AJG A;  2HPB A;  1CEF A;  4JGO A;  3W4P A;  3LR5 A;  4OLD A;  4UA6 A;  2VK3 A;  2QPN A;  5TGF A;  4DRT A;  4DKI A;  3CAX A;  1Z6F A;  3MMH A;  3Q7V B;  3CUE C;  4OPQ A;  2Y2I A;  5FI7 A;  1OTA A;  2A3U A;  2WAD A;  1AWI A;  1OTB A;  4E3J A;  3ZGA B;  5E2H A;  2WZX A;  4PMA A;  4QHC A;  5FL3 A;  3HBR A;  2ZBB A;  3B33 A;  1XJ6 A;  3ZG5 A;  1MWT A;  1V9Y A;  1XP4 A;  2WAE A;  3B42 A;  1GSX A;  3S7Q A;  4JLF A;  1ACF A;  3K2N A;  3HJK A;  3S22 A;  4WYY A;  2HDR A;  2JKR I;  3B3X A;  2KDK A;  4EBN A;  3LI8 A;  2DCF A;  3BM6 A;  4B9O A;  4GHI B;  3E4O A;  3MXS A;  1W5D A;  4HBU A;  4LCL A;  4O7D A;  4LEN A;  1F98 A;  5FSR A;  4ARZ B;  3UN7 A;  1P97 A;  4HJ6 A;  1YQS A;  3G32 A;  4HY8 A;  4S2O A;  2OAQ 1;  4Y0U A;  1YLP A;  1ZC2 A;  4LFU A;  5DJT A;  2J9P A;  2INW A;  4PM6 A;  4KEN B;  3LI9 A;  4DXB A;  4JF5 A;  4OVD A;  2W1T A;  2OWJ A;  4DE3 A;  2K2N A;  3UE6 A;  4EQ1 A;  1ES4 A;  1G5U A;  4MN5 A;  1NLY A;  2O99 A;  3E4P A;  4JXG A;  2ZM8 A;  1D06 A;  3E4Q A;  4B93 A;  3DAV A;  3SH8 A;  2XSS A;  2D02 A;  1BLH A;  3RH8 B;  1I2W A;  5E2F A;  5CX7 A;  4S2N C;  2Z2M B;  5HFO A;  4EV4 A;  1TS0 A;  3IHB A;  3BFG A;  3QNB A;  3GMW A;  4GB7 A;  1PWG A;  1YMX A;  2E8I A;  4QU3 A;  5EVI D;  2XFS A;  4BEN A;  4CLC D;  2UV0 E;  2V1A A;  1S1Y A;  4UQI S;  1T19 A;  4N1X A;  4X1M A;  3DTI A;  3A0V A;  2J8Y A;  4F3L A;  2Z6D A;  3ITA A;  1YAX A;  1P9W A;  3ZG7 B;  2VX8 A;  3QP6 A;  4QWO A;  4JKT A;  3V3S A;  3JYI A;  3T1S A;  5GLB A;  1KDW A;  3SS5 A;  3ZNT A;  4HJ4 A;  4GD6 A;  3WS2 A;  4MBK A;  1STZ A;  4HNB A;  1I2S A;  2QKP A;  3PBS A;  3G2Y A;  2EX2 A;  5FAP A;  5CGW A;  4HIA A;  1K4F A;  4WEJ A;  1L0D A;  3S7P A;  3EGD C;  3E2K A;  4XT2 A;  3LY3 A;  4EER A;  2EWV A;  3TOI A;  3RXX A;  4N9L A;  3G6O A;  3Q07 A;  3C7U A;  1ES2 A;  3FG8 A;  3HL9 A;  2ZC5 B;  3R4K A;  5CHM A;  1HZO A;  1LSX A;  2NUP C;  4MEZ A;  4GLQ A;  1JWZ A;  2WKR A;  3CIT A;  5CEB A;  1FIL A;  1D1J A;  1F9I A;  2J3W A;  4KG6 A;  3M6B A;  3S4X A;  5JYO A;  2VV8 A;  3MBZ A;  2XGN A;  2XD1 A;  3VMA A;  1VEU A;  2EX9 A;  4LV0 A;  4OP5 A;  3F1O A;  2E8J A;  4KZA A;  4S2P A;  3ICY A;  4WF0 A;  4OQI A;  1CF0 A;  2QZ6 A;  2ZMF A;  1E25 A;  4KZB A;  1TVF A;  3FKV A;  1U60 A;  1XGI A;  1K25 A;  3GRJ A;  4Z1W A;  4Q8I A;  2ZM2 A;  1VET A;  3SH7 A;  1L0E A;  2W1R A;  1JVJ A;  3ZFZ A;  5CHJ A;  1N9L A;  5I94 A;  3BEC A;  4Q0H A;  2OV5 A;  1SKO A;  3UO9 A;  4P85 A;  4FCF A;  1LSV A;  5FEG A;  2RCX A;  3EQU A;  2B02 A;  1XJ4 A;  4MBH A;  5KZH A;  2H5S A;  4WUJ A;  2VV7 A;  1EW0 A;  2XK1 A;  4BD0 A;  5HWT A;  3LID A;  1MWR A;  5HAR A;  2W3H A;  3LO7 A;  3LFV A;  1PWC A;  4H8R A;  5GHY A;  2PYP A;  5F68 A;  2WZZ A;  3NOP C;  3ULF A;  2OOL A;  1KE4 A;  3PAE A;  3U4L P;  3IH9 A;  1KVM A;  1OTI A;  4Y17 A;  3D72 A;  3MSH A;  4E3I A;  4U0T A;  3I7J A;  4ZAM A;  3R7W B;  2HDQ A;  4XT2 B;  1ZTU A;  3Q7Z A;  2W3D A;  3Q81 A;  1DJC A;  4R0Q A;  4MNR A;  2WGI A;  4RYE A;  4N92 A;  4G3V A;  1SHV A;  4FH2 A;  3WRT A;  2IWD A;  2VGK A;  3VP1 A;  3QP2 A;  2M7U A;  2WK0 A;  2XH9 A;  2VZW A;  3CI6 A;  2WKQ A;  2FH5 A;  2EX8 A;  2XDM A;  2CMN A;  4BBV A;  1HTZ A;  4R4R A;  4ME4 A;  1XJ3 A;  3LCE A;  1HVB A;  2JHE A;  3C4P A;  3G34 A;  5HPF A;  1OTD A;  4OQ0 A;  1QMF A;  3F1O B;  1BUL A;  4E3K A;  1OJ5 A;  4KZ9 A;  1CEG A;  2Z6C A;  1QME A;  3C5A A;  3BY8 A;  2PR6 A;  3S1Y A;  2PU4 A;  4KUK A;  3S7N A;  3CG5 A;  1ZG6 A;  1LT0 A;  4KQD A;  4GW9 A;  1K56 A;  1XKZ A;  2ZC4 B;  4P6Z M;  3VFH A;  1XFN A;  2GDN A;  4BBU A;  2P7J A;  1KOU A;  1SKO B;  4AFI A;  3CWF A;  3NY4 A;  2XEP A;  4U0X A;  5U47 A;  5J8X A;  4QB8 A;  2XFT A;  5AVE A;  4R1G A;  3IH8 A;  3F1P A;  1YLJ A;  2VEA A;  4MCW A;  2I9V A;  2A24 A;  2Y91 A;  4KZ3 A;  1FCM A;  4WN5 A;  4K91 A;  1S66 L;  4ZJ1 A;  3EQV A;  2L0W A;  5FAO A;  3PYP A;  4HBT A;  2V9A A;  1T1B A;  5GHZ A;  4EUV A;  1L0F A;  1VHM A;  3BJN A;  3DWZ A;  2Y2Q A;  5F1G A;  1IYQ A;  5FAT A;  3TW8 A;  5GLA A;  3IF6 C;  3ZYT A;  4O01 A;  3V67 A;  3IX8 A;  3Q7V A;  1YSP A;  1LL5 A;  2ZJ9 A;  1T1A A;  3V50 A;  5CHU A;  1MWS A;  4DJ2 A;  4E6W A;  1K54 A;  4JGR A;  5CER A;  1Q2P A;  2VA0 A;  4S2J A;  2ZC3 B;  5L09 A;  3MJQ A;  3OOV A;  2G2U A;  2H0Y A;  5HAP A;  1CI9 A;  3OCN A;  2V8F A;  2ZLY A;  4GOG A;  4HQA A;  2JKG A;  5GLD A;  3T1R A;  5CGX A;  1RCJ A;  4EET B;  2V20 A;  1N9O A;  4X56 A;  2OLU A;  2M7V A;  3V3R A;  4N1H A;  3UPO A;  2Y2O A;  1PZP A;  4B4Z A;  3GVB A;  2PBD P;  3E2L A;  2Y59 A;  4ARZ A;  4P0M A;  3VP2 A;  3OPL A;  4ZDX A;  3G30 A;  2QWS A;  3OCL A;  3SZT A;  3BFE A;  3O88 A;  1ZHH B;  3Q1F A;  4DE2 A;  2I72 A;  1N4O A;  2HP5 A;  5FQJ A;  3IBR A;  2P74 A;  3P09 A;  1BZA A;  1NXY A;  1XA7 A;  5IS1 A;  3OC2 A;  2JCH A;  1LHY A;  1JWV A;  5L10 A;  3BQ8 A;  2PU2 A;  1H8Y A;  4Y3I A;  1GA9 A;  4JXW A;  4NET A;  2HP9 A;  4BLM A;  1XGJ A;  3F1P B;  1IYO A;  4NEE D;  2BG1 A;  2HF6 A;  1WYC A;  4R3A A;  2A24 B;  3JVU A;  4X53 A;  4EES A;  5EVI B;  2WGV A;  1HLU P;  4OQG A;  3D4F A;  1GA0 A;  2IWB A;  2Y2H A;  3VE3 A;  3EEH A;  1ZKJ A;  2QYB A;  1YLT A;  1G68 A;  2J3T C;  3ZVT A;  1I5Q A;  3NDG A;  5F69 A;  3AGD A;  3OZH A;  4YIN A;  3ZG8 B;  5G18 A;  3WS0 A;  4RA7 A;  4F94 A;  5HL1 A;  1IKG A;  2V1B A;  4Y13 A;  1CQA A;  4WZ4 A;  4NXF A;  1GSV A;  1FSY A;  2JKF A;  4R23 A;  4FUW A;  4KG2 A;  1KE3 A;  3L7H A;  4OH0 A;  2K7S A;  3ZDJ A;  5FQQ A;  4IED A;  3W8K A;  4Y0O A;  3VFF A;  2ZQ9 A;  3V5M A;  1ONG A;  4I5S A;  4S2K A;  3MQ0 A;  5FI6 A;  1VQQ A;  3DWK A;  4BD1 A;  3BEB A;  4BBT A;  4K0W A;  1IEM A;  2M1C A;  1PRQ A;  4WZ5 A;  4IVI A;  4EXO A;  4NXE A;  4GZB A;  1OME A;  4Q0I A;  3BYD A;  4P6Z S;  4ZJ2 A;  3A3J A;  5HDD A;  1YKD A;  2C5W B;  2ACG A;  2EWW A;  2XRO A;  2B95 A;  3K3D A;  3IQA A;  5DJU A;  1J9M A;  2D01 A;  1JTD A;  2CC1 A;  5M18 A;  2L1M A;  3A3E A;  4OP8 A;  5IHV A;  3UB5 P;  3GTC A;  2ZQC A;  2IWC A;  4EEU A;  4X69 A;  2XQZ A;  2JE5 A;  1MY8 A;  4KZ7 A;  3BLM A;  3BWL A;  5TFQ A;  2PD7 A;  1F2K A;  1K56 D;  5FDS A;  3ZG0 A;  2XRN A;  2B5R A;  4Y7P A;  4KZ6 A;  4NXB A;  1J3W A;  1S67 L;  3P98 A;  4B88 A;  3BQA A;  5DF7 A;  3VSL A;  3NDE A;  3H7W A;  1PWD A;  4ESP A;  3JVV A;  2BAS A;  2FZ0 A;  4JF6 A;  3LEZ A;  1S4R A;  3HLF A;  4LRX C;  3T1Q B;  3LIC A;  1W8Q A;  2UWX A;  2X71 A;  3PBO A;  3MFX A;  1G6A A;  1FOF A;  3SS3 A;  4JPM A;  3CPT A;  1YT4 A;  4KZ4 A;  2Q0O A;  3UY6 A;  1TDG A;  4JF4 A;  3WWX A;  2VV6 A;  1NLZ A;  1TF1 A;  4DF6 A;  3CLO A;  3KYQ A;  1FCO A;  3MS6 A;  2IA2 A;  5HAQ A;  5D3O A;  4CPK A;  2QJ5 A;  5EM1 A;  5DTT A;  4E3O A;  1FR1 A;  5EV0 A;  3VOY A;  5HDS A;  3NUL A;  5M19 A;  1KVL A;  2W3F A;  3WS4 A;  4BMW A;  3LEQ A;  3R7W A;  3MZE A;  1E3U D;  4QY5 A;  4C3Q A;  5JYP A;  1OT6 A;  2WKI A;  4QJG A;  1DP9 A;  1K54 C;  3HUO A;  3TSG A;  4QY6 A;  2WKH A;  4R38 A;  3IWO A;  5A91 A;  5E43 A;  2HJE A;  4PKY A;  3ZQ5 A;  2V1Z A;  3MKE A;  5A93 A;  4MBF A;  3VSK A;  4P87 A;  2K31 A;  1TS6 A;  3S7O A;  3SS4 A;  4ETZ A;  4DJ3 A;  1S4S A;  5IU1 A;  4I3A A;  1MKM A;  4XUX A;  4OLG A;  4FOF A;  4MN7 A;  5F1F A;  4LV2 A;  1LSW A;  3GSG A;  3B47 A;  3CHW P;  4KQQ A;  4WMC A;  1MXO A;  1IOU A;  3LR0 A;  1BTL A;  3H7W B;  5AQB A;  3IT9 A;  3IXH A;  1ERQ A;  1WYB A;  4BL3 A;  1W63 Q;  1ONH A;  4UEY A;  3IXD A;  1OTE A;  4HH3 A;  1AXB A;  2H28 A;  3MKF A;  5GLC A;  1OPX A;  1RGY A;  5HZH A;  3UDI A;  3TG9 A;  3A0R A;  2Y2N A;  1Q2Q A;  2HDS A;  2QMI A;  2ZQ7 A;  3CPT B;  5KSC A;  1D7E A;  3PR6 A;  4GKU A;  3V39 A;  4CJN A;  5KIZ A;  3H82 A;  4ZTK A;  5FAS A;  5EVL A;  3TRC A;  4P6B A;  1M6K A;  1DRM A;  1MBL A;  3TJZ C;  3WS1 A;  5DFX A;  2XA7 S;  3ZCZ A;  3CJM A;  3BW6 A;  1H0M A;  3HLD A;  2Y2L A;  1SDN A;  4NK3 A;  5LBR A;  4B4X A;  4LPZ A;  4EW7 A;  2QHK A;  4OPR A;  3IX4 A;  3UB8 A;  1SZV A;  5FAQ A;  4ZBE A;  2EA9 A;  3M2K A;  5I5L A;  1NY0 A;  3NI9 A;  3RXW A;  4IBR A;  3A3I A;  3GR2 A;  4II7 A;  2HDU A;  4GS9 B;  2J80 A;  3DW0 A;  3HRE A;  3W2Z A;  3SH9 A;  4PHT A;  4L9E A;  1ERO A;  2Y2M A;  4FTX A;  3HLG A;  4FH4 A;  4DXC A;  2WKE A;  2Q9N A;  4H6J A;  4X68 A;  2O9B A;  3VOL A;  1N9B A;  4UA7 A;  2B18 A;  2WUQ A;  2HP6 A;  1UGU A;  4E3L A;  3UE1 A;  3OPR A;  1X0O A;  3MXQ A;  1ERM A;  1LLB A;  2Q9M A;  4PM8 A;  3LIA A;  1E4D A;  2JKT I;  1TS8 A;  3LIF A;  2ZL1 A;  2XR0 A;  3NCK A;  5HSQ A;  2ZC7 A;  1IKI A;  3IWI A;  3DTE A;  4BL2 A;  5AVF A;  4S2N A;  3SW1 A;  3G35 A;  1PNE A;  5GL9 A;  1C3B A;  1MC0 A;  4YNR A;  5HD5 A;  4CLC E;  5DKL A;  1NRF A;  1LL9 A;  3H9W A;  4PM5 A;  3OPP A;  4XXR A;  3T1X A;  3H82 B;  1PW1 A;  5EVI A;  4JGP A;  2WAF A;  4CLC A;  2W3E A;  2Y2J A;  3UPN A;  2HV1 A;  1TDL A;  2HJ9 C;  2PYR A;  3VP3 A;  1FR6 A;  5L8M A;  1G28 A;  4DE1 A;  2X02 A;  1S0W A;  4WM9 A;  3O5Y A;  5FQI A;  1K4E A;  1RGZ A;  2FFF B;  4ID4 A;  4IHQ A;  1XPB A;  4MN6 A;  3ITB A;  3BFF A;  4HOI A;  5EOO A;  5DTK A;  5DF9 A;  3RTY A;  4RQ9 A;  3O86 A;  1ES3 A;  3E0Y A;  3VP4 A;  1BUE A;  3PHY A;  3G2Z A;  3UE0 A;  2C6W B;  4E6X A;  1BSG A;  4EEP A;  5J3W A;  3UB7 A;  3EWK A;  1MKI A;  2O9A A;  3RFB A;  4GDN A;  2QJ7 A;  3M2J A;  1XFQ A;  4H6J B;  4D60 A;  1KDS A;  2VLG A;  1Y4O A;  2VGL S;  1F5M A;  4RX2 A;  3TE8 A;  3T4L A;  4DDS A;  1SKF A;  3HCY A;  3LUQ A;  3LYX A;  4PM9 A;  5FQ9 A;  1PYY A;  3HLB A;  1Y54 A;  4C75 A;  2A49 A;  4L0L A;  4M3K A;  2WYX A;  4NXG A;  3DTK A;  3Q82 A;  4LRZ E;  3G31 A;  2ZL1 B;  3C8C A;  3E98 A;  1ODV A;  4HP4 A;  1YSQ A;  5HDC A;  4K08 A;  3QHY A;  4E04 A;  3KSF A;  3P01 A;  5DFY A;  2YKH A;  2EXB A;  2OSU A;  1T18 A;  3AGE A;  1KGF A;  1N9N A;  1KGE A;  1DJA A;  5EOE A;  2RL3 A;  3GDI A;  3AGF A;  1UWP X;  4KQO A;  3GV9 A;  1GCE A;  4I3I A;  1JTG A;  3NJA A;  4GD8 A;  4EBL A;  2J3T D;  4Z9Q A;  5CTN A;  3OLO A;  1WA9 A;  4WL9 A;  4CLC B;  3LY4 A;  1A0K A;  4S2M A;  3OPH A;  3IF5 A;  4K0X A;  5HW3 A;  3N8S A;  5K5B A;  1LL8 A;  2Y8H A;  3BFC A;  4WEL A;  3A3D A;  1G6O A;  2ZD8 A;  4JXV A;  3PXP A;  5DF8 A;  2PBY A;  2WKP A;  4PM7 A;  5DKK A;  2Z2L B;  1H3Q A;  2PT7 A;  4G3W A;  2J7V A; 
#chains in the Genus database with same CATH homology
 1P9R A;  3NOP C;  2GZA A;  3ULF A;  4G3K A;  2VV6 A;  1NLZ A;  2OOL A;  2YKF A;  1TF1 A;  4MDZ A;  3CLO A;  5MC7 A;  3KYQ A;  3LR4 A;  2IA2 A;  3C2W A;  4GCZ A;  3PBN A;  4R6L A;  1OTI A;  2QJ5 A;  2V0W A;  3DBA A;  2O0Y A;  3D72 A;  1V9Z A;  3F1N B;  3FPW A;  2PHY A;  4UQI M;  4I38 A;  3F1N A;  5HDS A;  3EOI A;  2V0U A;  2W3F A;  2XA7 M;  3T50 A;  3R7W B;  5HPI A;  2O9C A;  4XT2 B;  1ZTU A;  4NKP A;  4BMW A;  3UB6 A;  2Y79 A;  3PBT A;  3T4J A;  3LIB A;  2L4R A;  3KO6 A;  2W3D A;  2G7U A;  3R7W A;  5F5Y A;  3T4T A;  3NHQ A;  5G4Y A;  3MQO A;  4G3V A;  1OT6 A;  3C38 A;  1DP9 A;  3LIE A;  4M4X A;  2M7U A;  5HL6 A;  4IUH A;  2VZW A;  3CI6 A;  4R38 A;  2WKQ A;  5TBM B;  2FH5 A;  1P0Z A;  2CMN A;  2LB5 A;  4GHI A;  4BBV A;  5TBM A;  4ME4 A;  2HJE A;  1XJ3 A;  4PKY A;  1NRJ A;  2GX5 A;  3ZQ5 A;  5IT5 A;  2JHE A;  4HHD A;  4FSF A;  5HPF A;  2A2L A;  4OOM A;  1IFQ A;  2K31 A;  3IS2 B;  1TS6 A;  1OTD A;  3S7O A;  4ETZ A;  3KX0 X;  3F1O B;  5KSH A;  1S1Z A;  3EGX C;  3T4K A;  1OJ5 A;  1S4S A;  4DJ3 A;  5IU1 A;  4I3A A;  1MKM A;  2Z6C A;  4FOF A;  3BY8 A;  4OOL A;  2PR6 A;  3KSH A;  4MN7 A;  3GEC A;  4KUK A;  3S7N A;  2PR5 A;  1LSW A;  3FPV A;  1LT0 A;  4KQD A;  4GW9 A;  3NOU C;  5HWV A;  4ETX A;  2KOI A;  3B47 A;  4WLA A;  4P6Z M;  4DMZ A;  1IOU A;  1XFN A;  3LR0 A;  3H7W B;  2OAP 1;  2P7J A;  4JGQ A;  4BBU A;  3NOT C;  1MZU A;  1KOU A;  4AFI A;  3CWF A;  4HJ3 A;  1W63 Q;  4UEY A;  4WEK A;  3KYZ A;  4O8G A;  5AVE A;  1OTE A;  4HH3 A;  4O0P A;  2H28 A;  3F1P A;  1JNU A;  1OPX A;  2VEA A;  4MCW A;  5HZH A;  1H8M A;  2I9V A;  3A0R A;  4BJP A;  2HGV A;  2A24 A;  4GJ4 A;  2JKR M;  5AJG A;  1D7E A;  3PR6 A;  4WN5 A;  4JGO A;  5C5K A;  1S66 L;  5KIZ A;  3LR5 A;  3EQV A;  3H82 A;  2L0W A;  3PYP A;  3T4S A;  3TRC A;  3UME A;  2V9A A;  1T1B A;  1DRM A;  4EUV A;  1VHM A;  3BJN A;  3CAX A;  5HWW A;  3TJZ C;  5DFX A;  2XA7 S;  2PD8 A;  3MMH A;  3TW8 A;  3CUE C;  3BW6 A;  5F6A A;  3ZYT A;  4O01 A;  3V67 A;  1OTA A;  2VJW A;  4CLC C;  3UB9 A;  1OTB A;  5LBR A;  1YSP A;  4LPZ A;  4EW7 A;  2QHK A;  1T1A A;  3T4O A;  3C30 A;  5FL3 A;  1W63 M;  5TJJ A;  2ZBB A;  3UB8 A;  4DJ2 A;  3B33 A;  2NUT C;  1XJ6 A;  4JGR A;  4PAU A;  2R78 A;  2VA0 A;  1V9Y A;  2KLI A;  2EA9 A;  3B42 A;  1GSX A;  3MJQ A;  4I39 A;  5I5L A;  4I3J A;  3S7Q A;  3T4Q A;  2DMW A;  3BY9 A;  3K2N A;  3HJK A;  4L9F A;  3OOV A;  2MJ6 A;  4II7 A;  2P04 A;  4GS9 B;  2J80 A;  2JKR I;  3W2Z A;  3OCN A;  4PHT A;  4YOF A;  2KDK A;  4GS9 A;  4L9E A;  3LI8 A;  4HQA A;  5A8B A;  4B9O A;  4GHI B;  4EET B;  3E4O A;  1N9O A;  2M7V A;  2W0N A;  4H6J A;  2O9B A;  1F98 A;  3VOL A;  4ARZ B;  1P97 A;  4HJ6 A;  2B18 A;  4HY8 A;  3A0S A;  4ARZ A;  1UGU A;  2OAQ 1;  5HD3 A;  2QWS A;  1X0O A;  3OCL A;  5DJT A;  3MXQ A;  1ZHH B;  5G4Z A;  2INW A;  3LIA A;  2VGL M;  2ZOH A;  2W1T B;  3LI9 A;  2PDR A;  3IBJ A;  2JKT I;  1TS8 A;  2W1T A;  3LIF A;  2W3G A;  3IBR A;  2OWJ A;  1TS7 A;  2K2N A;  4MMN A;  3UE6 A;  4EQ1 A;  5HSQ A;  5IS1 A;  3OC2 A;  4Y5F A;  4MN5 A;  1NLY A;  5AVF A;  2O99 A;  3BQ8 A;  3E4P A;  3SW1 A;  4Y3I A;  1D06 A;  1OJG A;  3E4Q A;  4B93 A;  3OBF A;  4ZRR A;  2XSS A;  2D02 A;  3RH8 B;  3F1P B;  2P08 A;  2ZOI A;  1MC0 A;  4NEE D;  4YNR A;  5CX7 A;  2HF6 A;  4IJG A;  5HD5 A;  4R3A A;  2A24 B;  1DP6 A;  3JVU A;  2GNX A;  4CLC E;  5DKL A;  4EES A;  2JN7 A;  3H9W A;  1TS0 A;  3CUE A;  3H82 B;  4JGP A;  4CLC A;  3VE3 A;  2W3E A;  4KUO A;  4CLC D;  3EEH A;  2KX6 A;  2QYB A;  2HV1 A;  2V1A A;  1S1Y A;  3KSG A;  4UQI S;  1T19 A;  2HJ9 C;  2J3T C;  3A0V A;  4F3L B;  2PYR A;  5F69 A;  3PBR A;  4HP9 A;  5L8M A;  1G28 A;  4F3L A;  3P7N A;  2Z6D A;  3O5Y A;  3VE4 A;  1YAX A;  1P9W A;  2V1B A;  4DN0 A;  4IHQ A;  4MN6 A;  3PBQ A;  2VX8 A;  4HOI A;  4R70 A;  5DF9 A;  3RTY A;  4NXF A;  1GSV A;  4RQ9 A;  3KSI A;  1DP8 A;  4HJ4 A;  3E0Y A;  1NWZ A;  3PHY A;  1STZ A;  4HNB A;  1T1C A;  2JKT M;  4HI4 A;  2QKP A;  2K7S A;  3D3O A;  2W27 A;  3PBS A;  4EEP A;  2LB9 A;  3FC7 A;  5J3W A;  3UB7 A;  3EWK A;  2O9A A;  4HIA A;  4I5S A;  3MQ0 A;  3RFB A;  2QJ7 A;  4WEJ A;  1XFQ A;  4H6J B;  2VLG A;  3S7P A;  4BBT A;  3EGD C;  2VGL S;  1F5M A;  2M1C A;  4XT2 A;  4EER A;  4HH2 A;  3TE8 A;  3T4L A;  2EWV A;  4EXO A;  4NXE A;  5J7E A;  3HCY A;  3LUQ A;  3LYX A;  3EEA A;  3U2A A;  3G6O A;  4Q0I A;  1OT9 A;  2GJ3 A;  3FG8 A;  4P6Z S;  3R4K A;  4L0L A;  1LSX A;  4NXG A;  5HDD A;  1YKD A;  2NUP C;  4LRZ E;  1UWN X;  4GLQ A;  2WKR A;  3C8C A;  2EWW A;  3E98 A;  1ODV A;  3CIT A;  2XRO A;  3K3C A;  1GSW A;  3K3D A;  1F9I A;  4HP4 A;  1YSQ A;  2J3W A;  5HDC A;  5DJU A;  4BWI A;  4K08 A;  4E04 A;  2D01 A;  3KSF A;  1VB6 A;  2L1M A;  2VV8 A;  3MR0 A;  3P01 A;  5DFY A;  2YKH A;  3UE3 A;  1TD5 A;  3IS2 A;  1BYW A;  1T18 A;  1N9N A;  3F1O A;  4EEU A;  2VKS A;  3ICY A;  4WF0 A;  3MQQ A;  2ZMF A;  3GDI A;  1UWP X;  3BWL A;  4Z1W A;  2PD7 A;  3VV4 A;  4PKY G;  4KQO A;  2XRN A;  4I3I A;  3HJI A;  3NJA A;  4NXB A;  4Q0J A;  2W1R A;  2J3T D;  1S67 L;  3LR3 A;  4YWZ A;  3OLO A;  4EU0 A;  1WA9 A;  2OWH A;  3BQA A;  4WL9 A;  4CQH A;  4CLC B;  4LLO B;  1N9L A;  3MF0 A;  3H7W A;  3UMD A;  4Q0H A;  1Y28 A;  4IUK A;  4QPR A;  1LSV A;  3JVV A;  2BAS A;  2ZMV A;  2FZ0 A;  3EQU A;  5K5B A;  1S4R A;  1LL8 A;  1XJ4 A;  2B02 A;  4LRX C;  4WUJ A;  2Y8H A;  4L9G A;  2VV7 A;  1EW0 A;  3LIC A;  1XJ2 A;  4WEL A;  5HWT A;  1G6O A;  3LID A;  3PBO A;  2W3H A;  3MFX A;  5EFW A;  3PXP A;  5J4E A;  4LRY C;  3LFV A;  2WKP A;  2PYP A;  5DKK A;  1H3Q A;  2PT7 A;  4G3W A;  5F68 A;  4Y2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...