4CLCA

Crystal structure of ybr137w protein
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
169
Chain Sequence
b'VVLDKKLLERLTSRKVPLEELEDMEKRCFLSTFTYQDAFDLGTYIRNAVKENFPEKPVAIDISLPNGHCLFRTVTYGGSALDNDFWIQRKKKTALRFGHSSFYMGCKKGDKTPEEKFFVDSKEYAFHGGAVLIQSERSDYPYACLTISGLKQEEDHLMALSSLIAFANE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0303 PROTEIN YBR137W
molecule tags Protein transport
source organism Saccharomyces cerevisiae
publication title Structural and Functional Characterization of Ybr137Wp Implicate its Involvement in the Targeting of Tail-Anchored Proteins to Membranes.
pubmed doi rcsb
total genus 56
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4clcA00
4CLCA 4BMWA 4CLCB 5CX7A 4NKPA 4CLCD 2A2LA 3FPWA 4CLCC 3FPVA 4CLCE
chains in the Genus database with same CATH superfamily
4MEZA 1OJGA 2KX6A 3FYZA 3FKVA 1FOFA 1KVMA 5L10A 4B93A 5TBMB 2PBDP 4RQ9A 4RA7A 4OOMA 3TOIA 3UB5P 5HDCA 4F3LA 2DMWA 4BD1A 1K57A 1GHMA 5HZHA 2ZQ7A 5FAPA 4LLOB 4S2NA 4X56A 4ZAMA 3MZEA 3QP5A 4B4ZA 3LI9A 2HF6A 1KOUA 2D02A 5CECA 1MWSA 3D4FA 3CMZA 4BWIA 2VGKA 2JKTI 1E3UD 1PFLA 3C2WA 4FUWA 2WAEA 1XGIA 4HJ6A 3IH9A 2JKFA 3HLWA 4ETXA 2PD8A 4OOYA 2OV5A 1VQQA 3IWQA 5DTTA 1ZG6A 4IBRA 5KSCA 4S2KA 4LV0A 2VV6A 4OPRA 2Y55A 2DCFA 4OP8A 4JF6A 5HD5A 3A0SA 5F5YA 2OOLA 4C3QA 1Y28A 4LFUA 5TBMA 1YLYA 2EFXA 3PBQA 4N1HA 3ZNYA 3TRCA 4DDSA 1M40A 4WN5A 4OLDA 1S66L 4LCLA 3ZG0A 5HAIA 3UO9A 1LSXA 3KSGA 1TDLA 3HJIA 4WEJA 5EVID 3HLDA 4GNUA 3WS5A 1CK3A 4DXBA 1ESIA 3OCLA 4KUOA 5GLBA 2XR0A 4N9KA 2V8CA 3UMDA 1S4SA 2R9XA 3VE3A 4EBPA 5FI2A 2VA0A 3BYDA 5EUAA 4I3IA 4IUHA 2EX8A 1FCMA 4H8RA 3T4TA 2FFYA 3C4PA 5CX7A 3U4LP 5D3OA 3M6BA 3T50A 4XUZA 5GLDA 1ERQA 3DTIA 4BMWA 5FQJA 1N9BA 1ZHHB 2H28A 3ULFA 2QJ7A 3ZG9B 4EV4A 5JYPA 5FI7A 1OTIA 2Y8HA 3MXSA 1CI9A 1YKDA 4D2OA 4NK3A 2XFTA 5EVIA 1IYSA 3A0RA 4GLQA 4EW7A 2Y4AA 4M3KA 1FR6A 5TR7A 2XF3A 1LL8A 3A3DA 1K6SA 4OQHA 1PI4A 5EV0A 4B9OA 3DTMA 3KSIA 1BTLA 4GJ4A 2HGVA 4CQHA 4RX2A 2J9OA 3F1NA 3GR2A 3JVVA 3DTKA 4LRZE 4LRYC 5HAPA 3LIEA 1W8YA 4FD8A 4IVIA 1IYPA 3QP2A 3RXWA 3IBJA 5HPIA 4YINA 2V2FF 5GHZA 4EERA 4N1XA 1J9MA 2E8IA 4GZBA 4L9GA 4BQMA 3WS4A 1Y4OA 1YT4A 2O9AA 1JTGA 1MKMA 3A3FA 1DP9A 1VETB 3BFDA 1OTAA 4JF5A 3VP1A 4PKYA 3T4JA 1TS0A 3NCKA 3ZYTA 3CAXA 1G6OA 3CUEA 3IF6B 5TGFA 2L4RA 1VHMA 1Q2QA 1P9WA 4OP5A 2PR6A 3E0YA 4P6BA 5AVFA 5GHYA 2Z6DA 3R7WB 3KYZA 4KQDA 3VV4A 5A93A 4DE0A 5DVAA 3WWXA 3NHQA 1OJ5A 3DBAA 3UE1A 1PI5A 2ZLYA 3N6IA 4JKTA 5JYOA 4MBFA 2M1CA 3LR0A 4DRTA 4NXGA 3L7HA 3G2ZA 4EU0A 4GDNA 4CJNA 5GL9A 4F94A 3A0VA 3BFEA 4LENA 1RGYA 1IYQA 3F1PA 3BRMA 2ZQDA 1OTBA 4K91A 1VETA 1NRFA 4XXRA 2V1BA 1XGJA 2Y2KA 4PM5A 1PWGA 4E3JA 3IS2A 5HWWA 4YFMA 3UN7A 2W3FA 1H8YA 3DWZA 4RYEA 1XA7A 3S4XA 1I5QA 1W63M 1TEMA 1YMSA 1TD5A 1ES5A 3H9WA 4IEDA 2Q0OA 4NXEA 5CERA 3IBRA 2XSSA 1XA1A 4FH4A 3RH8B 4KENB 3MR0A 1PRQA 4HESA 3UDXA 2QPNA 3EQVA 3BW6A 2PT7A 2K2NA 3O5YA 4E3IA 2CC1A 4PPRA 1YSPA 1ESUA 4Q0JA 4ETZA 2KDKA 1N4OA 4OQ0A 2VEAA 2HZ5A 3SH7A 4CLCC 1E25A 5TFQA 2QMIA 1LL5A 3WS1A 3MQ0A 4KZ6A 3NDEA 1K0KA 3HCYA 3MFXA 3UY6A 3UB9A 2A2LA 4PM9A 1K55A 1OMEA 1W63Q 1TDGA 2J80A 3OPRA 3GTCA 1BUEA 3N4IA 4EUZA 2ZQAA 4MDZA 3VFHA 4NEED 4ZJ2A 1FSYA 1NXYA 1I2WA 4DXCA 2EX2A 5GHXA 3ICYA 1SZVA 4JXWA 4R38A 4KZBA 3MKFA 1NJ4A 4LRXC 1N9NA 3F1NB 3MXRA 1U60A 4S2MA 3LICA 1OPXA 3LGOA 3MZDA 3C38A 2QYBA 3T4LA 4LV3A 3S7QA 5EVEA 1RP5A 1O7EA 2A24A 3ZGAB 5FEFA 1ALQA 4EETB 2HDQA 4M4XA 4WZ5A 4B4XA 1Z09A 5DF8A 3Q7VA 3GDIA 1K38A 2W3HA 4NETA 4L9EA 2INWA 4QWOA 4GN2A 3ZFZA 3QP6A 5F6AA 5J4EA 5FI6A 4Q0HA 4QD4A 2HJEA 5FQQA 2FZ0A 1DP8A 2QJ5A 2GJ3A 5FQMA 4GOGA 5L2FA 5FSRA 3P7NA 3G35A 4B88A 3D72A 2XA7S 5HAQA 4EWFA 3MQOA 2XD1A 4NXFA 5HFOA 3AGEA 2OSUA 3BLSA 1YPRA 5CHMA 1XFNA 2GX5A 1GHPA 1DJBA 2PYRA 5FAQA 3VE4A 4AFIA 3A3JA 4ARZA 1SKFA 3MSHA 4GS9A 3F1OA 5FDHA 3HLFA 4YWZA 4WLAA 2MJ6A 4JXGA 2OLVA 3ISGA 2Z2MB 4NG2A 4O7DA 1VM1A 5F69A 4X1LA 3GV9A 2PHYA 1XJ4A 2OLUA 3GVBA 4P87A 5IHVA 2G2UA 1S67L 2W3GA 1NLZA 5CEDA 1PZPA 1H0MA 2M7VA 3HBRA 5CGWA 2HDRA 4E3LA 1XX2A 3NI9A 2Y2GA 2Y79A 2JKRI 1XJ6A 3HLCA 3V50A 2RL3A 5DFXA 2HP5A 4Q0IA 4Y13A 1H3QA 1CJFA 2VGLM 4HY8A 1X0OA 2P08A 4WBGA 5KZHA 3MMHA 3VMAA 4MBKA 2EWVA 1JWVA 3UNWA 2Y2IA 2OAQ1 2ZC6B 1GSVA 5EOOA 1GSXA 3PAGA 4LV2A 5DKLA 4U0TA 4EBLA 1NZOA 3FWLA 3K2NA 4JGRA 5L09A 3CPTA 2V20A 1Z6FA 5KSHA 1K25A 2W1RA 3LIFA 4FH2A 5L07A 4DKIA 3G34A 2VZWA 3U2AA 4LGWA 3P01A 2HV1A 2O9CA 4BD0A 3FPVA 1LI0A 3BFFA 2O99A 3C4OA 4GD8A 4UEYA 4WZ4A 2ZD8A 2IWDA 3DWKA 2BLSA 2WGIA 3R4KA 2J3WA 3SOIA 4UQIS 3MQQA 1H8MA 4KZ9A 3ZVWA 3G30A 3Q81A 4X68A 1BZAA 2ZC5B 4E04A 2XRNA 3MZFA 2FH5A 3G4PA 2XEPA 5U47A 4Y3IA 3IF5A 4U3TA 4QU3A 5CGXA 2WK0A 4R6LA 2H5SA 4KG2A 4X25A 2JKGA 4PMAA 1PW1A 2ZMFA 3LFVA 1ONHA 4II7A 1K57C 4ZRRA 4S2LA 5CEBA 2PRFA 1FR1A 3JYIA 4NXBA 3T4QA 3CJMA 4Y17A 3CUEC 4KG5A 4U0XA 2EA9A 2BASA 4X55A 3OCNA 1TVFA 1KDWA 3SW1A 4GCZA 2P04A 4GS9B 3LIDA 3PHYA 3PAEA 4IBXA 5HDDA 2V0WA 1L0GA 4OH0A 1V9ZA 1L0FA 3GSGA 4G3KA 1KE3A 4JGPA 3LI8A 3ITAA 1ZKJA 3HREA 5IU1A 1YQSA 1KGGA 3TJZC 1WA9A 4HBTA 3ZHHA 4S2PA 1BLCA 1NWZA 1XXMA 3HUMA 2P9VB 3S7OA 1MWTA 4R0QA 4WMCA 1LLBA 1YLZA 5E2EA 1PZOA 5M19A 3JPUA 1YLPA 1IEMA 1G68A 3IXHA 5CTNA 5GLAA 4PHTA 4Z1WA 2VV8A 4DE1A 5F1GA 1HLUP 2FFFB 1HZOA 1CEGA 1HTZA 4HBUA 3A3EA 4KZ7A 1IYOA 2OWHA 1BLHA 3JVUA 3HLBA 2G2WA 4O01A 3VP2A 3IX3A 5FATA 3T1SA 1OTDA 1P0ZA 1SDEA 2A3UA 4MN5A 5EVLA 4JGOA 3V3SA 2LB5A 3UDIA 3R7WA 2O0YA 1PNEA 2BG1A 3LY3A 1SKOA 3K3CA 3S22A 2ZMVA 5CHJA 2ZMAA 2A24B 3OPHA 4Y5FA 3CZDA 4CLCE 5KMWA 4WUJA 5J3WA 4IVKA 1XP4A 3WS0A 4R70A 3LR5A 1YSQA 3T4SA 4ZDXA 4KQQA 4LCMA 1D1JA 1MWUA 3H7WA 3EGXC 1L0DA 1Q2PA 3IXGA 4HI4A 2XD5A 3ZG8B 2ZC3B 1SCWA 1IOUA 2C5WB 2YKHA 3UPOA 3IXDA 1KGEA 2B02A 3GRJA 3NIAA 3AGDA 3UE0A 4L0LA 1MKIA 2WGVA 5HDSA 2PU4A 2J3TD 3O88A 3T4KA 3ZCZA 1OTEA 3KO6A 4LPZA 2B5RA 3LUQA 4JXVA 1MBLA 2WYXA 3T12B 1LT0A 1DJCA 1K54C 4DE2A 2I9VA 2VK3A 2EX9A 1IKIA 2D01A 3NOPC 1AWIA 1SHVA 3OLOA 3N8RA 4Y0UA 4EQ1A 5CHUA 2H0YA 4IHQA 2EXBA 3ZVTA 1EWZA 4OVDA 5E2FA 1L0EA 5MC7A 4N92A 2RCXA 3UMEA 3NULA 3NC8A 3BY8A 2JHEA 3C30A 5AQ7A 2E8JA 4OPZA 2XQZA 1T1BA 1L3LA 5E2HA 3LO7A 3VP4A 3N8SA 3NECA 4KQRA 1IELA 3H82B 4E3KA 2KLIA 2JKTM 5F82A 1S4RA 4PKYG 2OWJA 4HH3A 4K08A 3OPPA 4BLMA 1BT5A 4FCFA 2G7UA 2P74A 3V3RA 3HVFA 1PWCA 4FTXA 1W5DA 2ACGA 1KE4A 3CITA 3E2LA 3RFBA 2EX6A 3VFFA 1PIOA 1NYMA 3WRZA 1YAXA 4CLCB 3K3DA 3MBZA 4MNRA 5GLCA 4GHIB 4DMZA 5I94A 3ZDJA 5FASA 2PD7A 4F3LB 2WADA 5TJJA 2W27A 2WKRA 5FQKA 3BY9A 2P7JA 3C7VA 3UE3A 2ZQ8A 5DF9A 2GDNA 4HIAA 3OZHA 1LSVA 2Y2QA 1CEFA 3LIAA 1BSGA 1W79A 1JWZA 2VX8A 1ZG4A 3EEAA 3W8KA 3BFCA 2R9WA 1HVBA 3AGFA 1GA0A 1STZA 4WMCD 2PDRA 5BOHA 5CXWA 4HNBA 3N8LA 2XA7M 3IF6A 2WGWA 4R3JA 4JLFA 5HX9A 5LBRA 1JTDA 5F1FA 2Y59A 2OAP1 5AJGA 1ACFA 1G28A 4YNRA 4E3NA 1MPLA 5HPFA 1ES3A 3BM6A 4WYYA 3BWLA 4KUKA 1MXOA 4DF6A 4MBHA 1FCOA 4ZBEA 2EWWA 3W4QA 2CMNA 4BJPA 1F5MA 3UB7A 3OC2A 2GZAA 1I2SA 5E2GA 5E43A 2WKPA 2VLGA 3MXQA 4C75A 4WZ5C 5HWVA 3HJKA 3PTEA 4ID4A 2J8YA 5A8BA 2M7UA 4XUXA 2L0WA 5FEGA 5KIZA 3GMWA 5DKKA 5IT5A 3H7WB 3B47A 1H8ZA 2YKFA 3EQUA 1XPBA 4R3AA 4BBTA 4O8GA 3WRTA 2WKEA 1J3WA 4S2NC 1TF1A 4XT2B 1BLPA 1C3BA 4FSFA 3TG9A 3UDFA 3WS2A 1D7EA 1JNUA 2VV7A 2P9VA 4FOFA 4DDYA 5HW3A 2H10A 5EVIB 5C5KA 5EECA 3GECA 3PXPA 3HL9A 5HL6A 1L2SA 1FILA 4R1GA 3KYEA 3EGDC 3BECA 5G4YA 3H82A 4BBUA 2J7VA 1JWPA 2X01A 3DAVA 1TS6A 3NJAA 2HP6A 4ARZB 1G6AA 1KGFA 4UA7A 2Y2HA 3LR4A 1UWNX 4XT2A 4PM6A 1T18A 1KE0A 3QNBA 3Q7VB 4HEFA 4Y7PA 2QZ6A 3M6HA 4BENA 2NUTC 3EOIA 4P6ZM 2NUPC 3E98A 1UGUA 2ZQ9A 4WELA 3IWIA 1MY8A 2J3TC 1XJ2A 3PR6A 1EI5A 2EXAA 3MS6A 3W4PA 4H6JA 4R3BA 4DJ2A 3IF6C 4HHDA 3NBLA 4WEKA 4S2OA 4PM8A 1F2KA 4QHCA 1D06A 1S6RA 1W7FA 3ZQ5A 3M2KA 4I3AA 4KG6A 2PU2A 4JPMA 4KZ5A 4ZTKA 5L8MA 3KSHA 4QY5A 2PYPA 4L9FA 1W8QA 2XH9A 4GW9A 5DTSA 3KX0X 3QP1A 1TS7A 3QP8A 1EROA 4N9LA 5J7EA 4BBVA 5EM0A 3G32A 5G18A 3F1PB 1G5UA 1N9LA 1OT9A 5EE8A 2ZC4B 1EW0A 1YLJA 2V1AA 5DFYA 3NDGA 4UA6A 1DY6A 3IS2B 3IHBA 3E4PA 2ZL1B 1NYYA 3BEBA 2WGWB 4DJ3A 1YLWA 3Q7ZA 1TS8A 5DF7A 1VEUA 2Y2LA 2XGNA 1WYBA 4PAUA 5CRFA 3HUOA 3PBOA 5FQIA 3CI6A 1NLYA 2WKQA 5FDSA 2V0UA 3MJQA 3CG5A 4R4RA 4EUVA 3SZTA 1K54A 4R23A 2Y2NA 3LCEA 1DP6A 3M2JA 1AXBA 5A91A 1YMXA 2JN7A 2X02A 3NOTC 1S0WA 1V9YA 2XFSA 3BJNA 3BQ8A 4P85A 2W0NA 1BYWA 2IWCA 4QJGA 3QNCA 2Z6CA 3V5MA 3E4QA 3L9KA 1CQAA 4JXSA 5EVIC 4GB7A 5HL1A 3BLMA 1XJ3A 4K0XA 2VKSA 3PBRA 1M6KA 3O86A 4Y0OA 4MN7A 4ESPA 4KZ3A 2Y2JA 2KOIA 1VEUB 3E2KA 1PYYA 3BQAA 2JCHA 4RX3A 3UPNA 1PW8A 3TE8A 3LR3A 1K56D 1CI8A 1FCNA 5CGSA 4X1MA 3IX8A 3T4OA 1GCEA 3C5AA 2R78A 2QWSA 3FZCA 1F9IA 4OONA 3NOUC 2WAFA 1T1AA 2JKRM 2W1TA 3DW0A 3C8CA 2X71A 3VOZA 1MZUA 5DJTA 4H6JB 2HJ9C 1QMFA 3IHAA 2VGLS 4G3VA 2JBFA 1OT6A 2Y91A 3FG8A 1LI9A 2ZJ9A 3KSFA 1IFQA 1HD8A 4WF0A 1RGZA 4O0PA 5FAOA 2I72A 3S1YA 1MC0A 1LHYA 2ZOIA 4IUKA 1FSWA 1RCJA 3IH8A 5HSQA 2XDMA 3O87A 1BULA 4JF4A 3IXBA 1WE4A 4HOIA 2DRWA 1MWRA 2PBYA 3RJUA 3OBFA 3E4OA 3A3IA 4HP4A 3S7NA 3I7JA 1YM1A 1E3UA 1GA9A 4YOFA 2Z2LB 1P97A 4I5SA 3VOLA 1KDSA 1ERMA 4UA9A 2DNSA 2W1TB 3ZG7B 4MMNA 3VSLA 3FPWA 5K5BA 2EFUA 5HWTA 4ZJ1A 2Y2OA 4HH2A 1QMEA 5DTKA 3V39A 1ZC2A 4OKPA 4KZ8A 3PBSA 1NRJA 3FV7A 4P0MA 4UQIM 1T1CA 2PR5A 1K6RA 1F98A 3HUNA 4HQAA 4E6WA 3IT9A 4Y15A 4MN6A 4I38A 4JGQA 5A90A 3EEHA 4Q8IA 3CHWP 4DN0A 1WYCA 4S2JA 2A49A 1NZUA 1SDNA 2JC7A 4GKUA 3FKWA 1UWPX 1K56A 1Y54A 4HJ4A 3T1RA 1DJAA 2AVXA 3MF0A 1GSWA 1ONGA 1SKOB 4GHIA 2C6WB 4D60A 3SS5A 4G3WA 4KZ4A 3ITBA 2PAVP 4DE3A 3HLEA 2K7SA 2O9BA 2K31A 3Q1FA 3O3VA 3OOVA 4HP9A 2UWXA 1S1ZA 4I3JA 3DTEA 3W4OA 3LY4A 1FIKA 2Q9NA 3CLOA 2V1ZA 2WZXA 2LB9A 3Q07A 3G31A 2J9PA 2WKHA 2IA2A 2ZQCA 3D9YA 2B18A 5FA7A 3VOYA 5EFWA 5M18A 2WKIA 4KQOA 1S1YA 3B33A 3C7UA 1CF0A 4QB8A 2W3EA 4MCWA 4HJ3A 4CPKA 5DJUA 3IQAA 2ZBBA 3PBTA 4EQIA 4OLGA 5AQBA 5EPHA 4E6XA 3LEQA 4PM7A 4EESA 5G4ZA 4EEUA 3QHYA 4KZAA 4UHUA 4WL9A 4I39A 2BTFP 4OPQA 4R4SA 3W2ZA 4OPYA 3SS4A 3F1OB 3D3OA 1JVJA 4GDBA 3V67A 4OQIA 3PBNA 4MLLA 4Y0TA 2UV0E 4X6TA 5AQAA 2ZL1A 3QP4A 3MKEA 3UB6A 3CWFA 3RTYA 4JBFA 4X69A 1XFQA 4S2IA 3PYPA 1DRMA 5CTMA 4Z9QA 1GHIA 4WM9A 1VB6A 3ZNTA 4QY6A 3VP3A 2V9AA 1K4FA 2VGJA 4LV1A 3GQZA 5I5LA 3P09A 4RVAA 2IWBA 3UB8A 1XKZA 3RXXA 5AQ9A 1ZTUA 2V8FA 4UAAA 4QPRA 4IJGA 3UE6A 3CPTB 2ZOHA 5IS1A 2Y2PA 1K55C 5F68A 3HLGA 3G2YA 3B42A 3IWOA 4E3OA 4BL2A 2QHKA 2HPBA 1E4DA 3T1XA 2ZM8A 3FC7A 2QKPA 2W3DA 2XLNA 4P6ZS 5M1AA 2VJWA 4EBNA 3UPPA 4ME4A 4GD6A 2HP9A 3NY4A 2H0TA 4E3MA 2HDUA 2B95A 3EWKA 5AVEA 4OQGA 3B3XA 1H5XA 1PWDA 5FQ9A 3SS3A 3SH9A 5A92A 1P9RA 5EOEA 3G6OA 3KYQA 4ZJ3A 3OPLA 5F83A 3T1QB 3ZG5A 4NKPA 1ES2A 1A0KA 2ZC7A 3BFGA 4X53A 2L1MA 4EEPA 4EXOA 4A5RA 3VSKA 4CLCD 1IKGA 5HARA 1O07A 1K4EA 3LIBA 3S7PA 1KVLA 1ODVA 3P98A 1LL9A 2HDSA 2ZM2A 4OOLA 3VP0A 2XK1A 2Q9MA 2ZM0A 5EM1A 3LEZA 5J8XA 3Q82A 3N7WA 5HD3A 1ES4A 1YLTA 1LSWA 2JE5A 3IX4A 4BL3A 4K0WA 1N9OA 2WUQA 5FL3A 4Y2FA 4C6YA 3SH8A 2WZZA 1BLSA 2XROA 1FQGA 1T19A 3MFDA 2GNXA 4CLCA 3TSGA 1NY0A 2Y2MA 3LYXA 3TW8A
chains in the Genus database with same CATH topology
1OJGA 2KX6A 3P7NA 3C30A 3D72A 2XA7S 3T4OA 1T1BA 3MQOA 4B93A 5TBMB 4RQ9A 4NXFA 2R78A 4OOMA 1XFNA 2GX5A 4F3LA 5HDCA 2QWSA 3H82B 2DMWA 5HZHA 1F9IA 2KLIA 2JKTM 2PYRA 4LLOB 1S4RA 4PKYG 2OWJA 3VE4A 4AFIA 3LI9A 2HF6A 4HH3A 1KOUA 2D02A 3NOUC 4ARZA 1T1AA 4BWIA 4K08A 2JKRM 4GS9A 2JKTI 2W1TA 3F1OA 3C8CA 3C2WA 4YWZA 4WLAA 2G7UA 2MJ6A 4HJ6A 1MZUA 4ETXA 5DJTA 2PD8A 4H6JB 2HJ9C 2VGLS 3CITA 4G3VA 1OT6A 5F69A 3RFBA 3FG8A 3KSFA 1IFQA 4WF0A 2VV6A 4O0PA 2PHYA 1XJ4A 1YAXA 4CLCB 1MC0A 3K3DA 2ZOIA 4IUKA 1S67L 5HD5A 3A0SA 5HSQA 2W3GA 5F5YA 2OOLA 1NLZA 4GHIB 4DMZA 1Y28A 4HOIA 5TBMA 2M7VA 3PBQA 3OBFA 3TRCA 3E4OA 4WN5A 4HP4A 2PD7A 1S66L 3S7NA 4F3LB 5TJJA 2Y79A 1LSXA 2JKRI 3KSGA 4YOFA 3HJIA 2W27A 1XJ6A 4WEJA 2WKRA 1P97A 4I5SA 3VOLA 5DFXA 3BY9A 4Q0IA 2P7JA 3UE3A 1H3QA 2W1TB 5DF9A 3OCLA 4HIAA 4KUOA 1LSVA 2VGLM 4HY8A 1X0OA 3LIAA 3UMDA 1S4SA 2P08A 4MMNA 3VE3A 2VX8A 3EEAA 2VA0A 3MMHA 3FPWA 5K5BA 1STZA 5HWTA 2EWVA 2PDRA 4HH2A 4I3IA 4IUHA 4HNBA 2XA7M 3PBSA 1NRJA 3T4TA 4UQIM 5CX7A 5LBRA 2OAQ1 3T50A 1T1CA 2PR5A 2OAP1 5AJGA 4BMWA 1GSVA 1F98A 4HQAA 1G28A 1ZHHB 2H28A 4YNRA 3ULFA 1GSXA 2QJ7A 5HPFA 4MN6A 4I38A 1OTIA 2Y8HA 5DKLA 4JGQA 1YKDA 3EEHA 3BWLA 4KUKA 3K2NA 4JGRA 4DN0A 3A0RA 4GLQA 4EW7A 1LL8A 5KSHA 2EWWA 2W1RA 3LIFA 2CMNA 4B9OA 1UWPX 3KSIA 4BJPA 2VZWA 4HJ4A 3U2AA 1F5MA 3UB7A 3P01A 3OC2A 2GZAA 2HV1A 3MF0A 1GSWA 2O9CA 4GJ4A 2HGVA 4CQHA 3FPVA 2WKPA 3F1NA 3JVVA 4GHIA 4LRZE 2O99A 2VLGA 3MXQA 4LRYC 3LIEA 5HWVA 4G3WA 3HJKA 4UEYA 3IBJA 3R4KA 5HPIA 2J3WA 4EERA 4UQIS 3MQQA 5A8BA 1H8MA 2K7SA 2M7UA 2O9BA 2K31A 4L9GA 2L0WA 5KIZA 4E04A 5DKKA 2O9AA 2XRNA 3H7WB 5IT5A 3B47A 3OOVA 4HP9A 2YKFA 1MKMA 2FH5A 3EQUA 1S1ZA 4I3JA 4R3AA 1DP9A 4BBTA 4O8GA 4Y3IA 3CLOA 1OTAA 4R6LA 4PKYA 2LB9A 3T4JA 1TF1A 4XT2B 1TS0A 4FSFA 2IA2A 1D7EA 1JNUA 3CAXA 3ZYTA 2VV7A 1G6OA 2B18A 3CUEA 4FOFA 2ZMFA 3LFVA 5C5KA 4II7A 5EFWA 3GECA 3PXPA 4KQOA 2L4RA 1VHMA 1S1YA 5HL6A 4ZRRA 1P9WA 3B33A 2PR6A 3EGDC 3E0YA 4NXBA 3T4QA 5G4YA 3H82A 5AVFA 4BBUA 2Z6DA 3R7WB 1TS6A 2W3EA 3CUEC 3NJAA 4ARZB 2EA9A 3KYZA 2BASA 4HJ3A 4KQDA 4MCWA 3VV4A 3NHQA 1OJ5A 3DBAA 3LR4A 3OCNA 5DJUA 3SW1A 1UWNX 4GCZA 4XT2A 1T18A 2P04A 2ZBBA 3PBTA 4GS9B 3LIDA 3PHYA 5HDDA 2M1CA 2V0WA 3LR0A 4NXGA 1V9ZA 4EU0A 2NUTC 3EOIA 4G3KA 4P6ZM 3A0VA 2NUPC 4EESA 5G4ZA 4EEUA 3E98A 1UGUA 3F1PA 4JGPA 3LI8A 1OTBA 5IU1A 4WELA 4WL9A 4I39A 2V1BA 2J3TC 1XJ2A 3TJZC 3W2ZA 1WA9A 3F1OB 3D3OA 3PR6A 3IS2A 1NWZA 5HWWA 3V67A 3S7OA 3PBNA 4H6JA 4DJ2A 4HHDA 2W3FA 4WEKA 1D06A 3UB6A 3CWFA 3RTYA 3ZQ5A 1W63M 4I3AA 1XFQA 4PHTA 4Z1WA 2VV8A 5L8MA 3PYPA 1DRMA 3KSHA 1TD5A 2PYPA 3H9WA 1VB6A 4L9FA 4NXEA 4GW9A 2V9AA 3IBRA 2XSSA 3KX0X 2OWHA 1TS7A 3JVUA 5I5LA 3RH8B 3MR0A 5J7EA 4O01A 3UB8A 4BBVA 3EQVA 3BW6A 2PT7A 1ZTUA 2K2NA 3O5YA 4QPRA 4IJGA 1OTDA 3UE6A 1P0ZA 2ZOHA 3F1PB 1N9LA 1OT9A 5IS1A 1YSPA 4MN5A 1EW0A 2V1AA 4Q0JA 5F68A 4JGOA 2LB5A 3B42A 3R7WA 4ETZA 2KDKA 2O0YA 5DFYA 2QHKA 2VEAA 3K3CA 2ZMVA 2A24B 3FC7A 4CLCC 4Y5FA 4CLCE 2QKPA 2W3DA 3IS2B 4WUJA 5J3WA 4R70A 3MQ0A 3E4PA 3LR5A 1YSQA 3HCYA 4P6ZS 2VJWA 3MFXA 4ME4A 3UB9A 2A2LA 3T4SA 4DJ3A 1TS8A 3EWKA 5AVEA 3H7WA 4PAUA 3EGXC 1W63Q 2J80A 3PBOA 4HI4A 3CI6A 1NLYA 2WKQA 1P9RA 2V0UA 3MJQA 1IOUA 4EUVA 3G6OA 3KYQA 4MDZA 4NKPA 4NEED 2YKHA 2B02A 2L1MA 4EEPA 4EXOA 4CLCD 4L0LA 3ICYA 1DP6A 4R38A 5HDSA 3LIBA 3S7PA 2J3TD 2JN7A 3NOTC 1V9YA 3T4KA 3BJNA 4LRXC 3BQ8A 1N9NA 1ODVA 3F1NB 2W0NA 1OTEA 3KO6A 1BYWA 4LPZA 3LUQA 3LICA 1OPXA 4OOLA 2Z6CA 3C38A 2QYBA 3T4LA 1LT0A 3S7QA 2A24A 3E4QA 4EETB 4M4XA 2JHEA 2I9VA 5HD3A 1LSWA 1XJ3A 2VKSA 1N9OA 3PBRA 2D01A 3NOPC 5FL3A 4Y2FA 4MN7A 3GDIA 3OLOA 2W3HA 4EQ1A 2KOIA 4L9EA 2INWA 4IHQA 2XROA 3BQAA 5F6AA 5J4EA 1T19A 3TE8A 5MC7A 4Q0HA 2GNXA 3LR3A 2HJEA 4CLCA 3UMEA 2FZ0A 1DP8A 2QJ5A 2GJ3A 3LYXA 3TW8A 3BY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLC A;  4BMW A;  4CLC B;  5CX7 A;  4NKP A;  4CLC D;  2A2L A;  3FPW A;  4CLC C;  3FPV A;  4CLC E; 
#chains in the Genus database with same CATH topology
 4MEZ A;  1OJG A;  2KX6 A;  3FYZ A;  3FKV A;  1FOF A;  1KVM A;  5L10 A;  4B93 A;  5TBM B;  2PBD P;  4RQ9 A;  4RA7 A;  4OOM A;  3TOI A;  3UB5 P;  5HDC A;  4F3L A;  2DMW A;  4BD1 A;  1K57 A;  1GHM A;  5HZH A;  2ZQ7 A;  5FAP A;  4LLO B;  4S2N A;  4X56 A;  4ZAM A;  3MZE A;  3QP5 A;  4B4Z A;  3LI9 A;  2HF6 A;  1KOU A;  2D02 A;  5CEC A;  1MWS A;  3D4F A;  3CMZ A;  4BWI A;  2VGK A;  2JKT I;  1E3U D;  1PFL A;  3C2W A;  4FUW A;  2WAE A;  1XGI A;  4HJ6 A;  3IH9 A;  2JKF A;  3HLW A;  4ETX A;  2PD8 A;  4OOY A;  2OV5 A;  1VQQ A;  3IWQ A;  5DTT A;  1ZG6 A;  4IBR A;  5KSC A;  4S2K A;  4LV0 A;  2VV6 A;  4OPR A;  2Y55 A;  2DCF A;  4OP8 A;  4JF6 A;  5HD5 A;  3A0S A;  5F5Y A;  2OOL A;  4C3Q A;  1Y28 A;  4LFU A;  5TBM A;  1YLY A;  2EFX A;  3PBQ A;  4N1H A;  3ZNY A;  3TRC A;  4DDS A;  1M40 A;  4WN5 A;  4OLD A;  1S66 L;  4LCL A;  3ZG0 A;  5HAI A;  3UO9 A;  1LSX A;  3KSG A;  1TDL A;  3HJI A;  4WEJ A;  5EVI D;  3HLD A;  4GNU A;  3WS5 A;  1CK3 A;  4DXB A;  1ESI A;  3OCL A;  4KUO A;  5GLB A;  2XR0 A;  4N9K A;  2V8C A;  3UMD A;  1S4S A;  2R9X A;  3VE3 A;  4EBP A;  5FI2 A;  2VA0 A;  3BYD A;  5EUA A;  4I3I A;  4IUH A;  2EX8 A;  1FCM A;  4H8R A;  3T4T A;  2FFY A;  3C4P A;  5CX7 A;  3U4L P;  5D3O A;  3M6B A;  3T50 A;  4XUZ A;  5GLD A;  1ERQ A;  3DTI A;  4BMW A;  5FQJ A;  1N9B A;  1ZHH B;  2H28 A;  3ULF A;  2QJ7 A;  3ZG9 B;  4EV4 A;  5JYP A;  5FI7 A;  1OTI A;  2Y8H A;  3MXS A;  1CI9 A;  1YKD A;  4D2O A;  4NK3 A;  2XFT A;  5EVI A;  1IYS A;  3A0R A;  4GLQ A;  4EW7 A;  2Y4A A;  4M3K A;  1FR6 A;  5TR7 A;  2XF3 A;  1LL8 A;  3A3D A;  1K6S A;  4OQH A;  1PI4 A;  5EV0 A;  4B9O A;  3DTM A;  3KSI A;  1BTL A;  4GJ4 A;  2HGV A;  4CQH A;  4RX2 A;  2J9O A;  3F1N A;  3GR2 A;  3JVV A;  3DTK A;  4LRZ E;  4LRY C;  5HAP A;  3LIE A;  1W8Y A;  4FD8 A;  4IVI A;  1IYP A;  3QP2 A;  3RXW A;  3IBJ A;  5HPI A;  4YIN A;  2V2F F;  5GHZ A;  4EER A;  4N1X A;  1J9M A;  2E8I A;  4GZB A;  4L9G A;  4BQM A;  3WS4 A;  1Y4O A;  1YT4 A;  2O9A A;  1JTG A;  1MKM A;  3A3F A;  1DP9 A;  1VET B;  3BFD A;  1OTA A;  4JF5 A;  3VP1 A;  4PKY A;  3T4J A;  1TS0 A;  3NCK A;  3ZYT A;  3CAX A;  1G6O A;  3CUE A;  3IF6 B;  5TGF A;  2L4R A;  1VHM A;  1Q2Q A;  1P9W A;  4OP5 A;  2PR6 A;  3E0Y A;  4P6B A;  5AVF A;  5GHY A;  2Z6D A;  3R7W B;  3KYZ A;  4KQD A;  3VV4 A;  5A93 A;  4DE0 A;  5DVA A;  3WWX A;  3NHQ A;  1OJ5 A;  3DBA A;  3UE1 A;  1PI5 A;  2ZLY A;  3N6I A;  4JKT A;  5JYO A;  4MBF A;  2M1C A;  3LR0 A;  4DRT A;  4NXG A;  3L7H A;  3G2Z A;  4EU0 A;  4GDN A;  4CJN A;  5GL9 A;  4F94 A;  3A0V A;  3BFE A;  4LEN A;  1RGY A;  1IYQ A;  3F1P A;  3BRM A;  2ZQD A;  1OTB A;  4K91 A;  1VET A;  1NRF A;  4XXR A;  2V1B A;  1XGJ A;  2Y2K A;  4PM5 A;  1PWG A;  4E3J A;  3IS2 A;  5HWW A;  4YFM A;  3UN7 A;  2W3F A;  1H8Y A;  3DWZ A;  4RYE A;  1XA7 A;  3S4X A;  1I5Q A;  1W63 M;  1TEM A;  1YMS A;  1TD5 A;  1ES5 A;  3H9W A;  4IED A;  2Q0O A;  4NXE A;  5CER A;  3IBR A;  2XSS A;  1XA1 A;  4FH4 A;  3RH8 B;  4KEN B;  3MR0 A;  1PRQ A;  4HES A;  3UDX A;  2QPN A;  3EQV A;  3BW6 A;  2PT7 A;  2K2N A;  3O5Y A;  4E3I A;  2CC1 A;  4PPR A;  1YSP A;  1ESU A;  4Q0J A;  4ETZ A;  2KDK A;  1N4O A;  4OQ0 A;  2VEA A;  2HZ5 A;  3SH7 A;  4CLC C;  1E25 A;  5TFQ A;  2QMI A;  1LL5 A;  3WS1 A;  3MQ0 A;  4KZ6 A;  3NDE A;  1K0K A;  3HCY A;  3MFX A;  3UY6 A;  3UB9 A;  2A2L A;  4PM9 A;  1K55 A;  1OME A;  1W63 Q;  1TDG A;  2J80 A;  3OPR A;  3GTC A;  1BUE A;  3N4I A;  4EUZ A;  2ZQA A;  4MDZ A;  3VFH A;  4NEE D;  4ZJ2 A;  1FSY A;  1NXY A;  1I2W A;  4DXC A;  2EX2 A;  5GHX A;  3ICY A;  1SZV A;  4JXW A;  4R38 A;  4KZB A;  3MKF A;  1NJ4 A;  4LRX C;  1N9N A;  3F1N B;  3MXR A;  1U60 A;  4S2M A;  3LIC A;  1OPX A;  3LGO A;  3MZD A;  3C38 A;  2QYB A;  3T4L A;  4LV3 A;  3S7Q A;  5EVE A;  1RP5 A;  1O7E A;  2A24 A;  3ZGA B;  5FEF A;  1ALQ A;  4EET B;  2HDQ A;  4M4X A;  4WZ5 A;  4B4X A;  1Z09 A;  5DF8 A;  3Q7V A;  3GDI A;  1K38 A;  2W3H A;  4NET A;  4L9E A;  2INW A;  4QWO A;  4GN2 A;  3ZFZ A;  3QP6 A;  5F6A A;  5J4E A;  5FI6 A;  4Q0H A;  4QD4 A;  2HJE A;  5FQQ A;  2FZ0 A;  1DP8 A;  2QJ5 A;  2GJ3 A;  5FQM A;  4GOG A;  5L2F A;  5FSR A;  3P7N A;  3G35 A;  4B88 A;  3D72 A;  2XA7 S;  5HAQ A;  4EWF A;  3MQO A;  2XD1 A;  4NXF A;  5HFO A;  3AGE A;  2OSU A;  3BLS A;  1YPR A;  5CHM A;  1XFN A;  2GX5 A;  1GHP A;  1DJB A;  2PYR A;  5FAQ A;  3VE4 A;  4AFI A;  3A3J A;  4ARZ A;  1SKF A;  3MSH A;  4GS9 A;  3F1O A;  5FDH A;  3HLF A;  4YWZ A;  4WLA A;  2MJ6 A;  4JXG A;  2OLV A;  3ISG A;  2Z2M B;  4NG2 A;  4O7D A;  1VM1 A;  5F69 A;  4X1L A;  3GV9 A;  2PHY A;  1XJ4 A;  2OLU A;  3GVB A;  4P87 A;  5IHV A;  2G2U A;  1S67 L;  2W3G A;  1NLZ A;  5CED A;  1PZP A;  1H0M A;  2M7V A;  3HBR A;  5CGW A;  2HDR A;  4E3L A;  1XX2 A;  3NI9 A;  2Y2G A;  2Y79 A;  2JKR I;  1XJ6 A;  3HLC A;  3V50 A;  2RL3 A;  5DFX A;  2HP5 A;  4Q0I A;  4Y13 A;  1H3Q A;  1CJF A;  2VGL M;  4HY8 A;  1X0O A;  2P08 A;  4WBG A;  5KZH A;  3MMH A;  3VMA A;  4MBK A;  2EWV A;  1JWV A;  3UNW A;  2Y2I A;  2OAQ 1;  2ZC6 B;  1GSV A;  5EOO A;  1GSX A;  3PAG A;  4LV2 A;  5DKL A;  4U0T A;  4EBL A;  1NZO A;  3FWL A;  3K2N A;  4JGR A;  5L09 A;  3CPT A;  2V20 A;  1Z6F A;  5KSH A;  1K25 A;  2W1R A;  3LIF A;  4FH2 A;  5L07 A;  4DKI A;  3G34 A;  2VZW A;  3U2A A;  4LGW A;  3P01 A;  2HV1 A;  2O9C A;  4BD0 A;  3FPV A;  1LI0 A;  3BFF A;  2O99 A;  3C4O A;  4GD8 A;  4UEY A;  4WZ4 A;  2ZD8 A;  2IWD A;  3DWK A;  2BLS A;  2WGI A;  3R4K A;  2J3W A;  3SOI A;  4UQI S;  3MQQ A;  1H8M A;  4KZ9 A;  3ZVW A;  3G30 A;  3Q81 A;  4X68 A;  1BZA A;  2ZC5 B;  4E04 A;  2XRN A;  3MZF A;  2FH5 A;  3G4P A;  2XEP A;  5U47 A;  4Y3I A;  3IF5 A;  4U3T A;  4QU3 A;  5CGX A;  2WK0 A;  4R6L A;  2H5S A;  4KG2 A;  4X25 A;  2JKG A;  4PMA A;  1PW1 A;  2ZMF A;  3LFV A;  1ONH A;  4II7 A;  1K57 C;  4ZRR A;  4S2L A;  5CEB A;  2PRF A;  1FR1 A;  3JYI A;  4NXB A;  3T4Q A;  3CJM A;  4Y17 A;  3CUE C;  4KG5 A;  4U0X A;  2EA9 A;  2BAS A;  4X55 A;  3OCN A;  1TVF A;  1KDW A;  3SW1 A;  4GCZ A;  2P04 A;  4GS9 B;  3LID A;  3PHY A;  3PAE A;  4IBX A;  5HDD A;  2V0W A;  1L0G A;  4OH0 A;  1V9Z A;  1L0F A;  3GSG A;  4G3K A;  1KE3 A;  4JGP A;  3LI8 A;  3ITA A;  1ZKJ A;  3HRE A;  5IU1 A;  1YQS A;  1KGG A;  3TJZ C;  1WA9 A;  4HBT A;  3ZHH A;  4S2P A;  1BLC A;  1NWZ A;  1XXM A;  3HUM A;  2P9V B;  3S7O A;  1MWT A;  4R0Q A;  4WMC A;  1LLB A;  1YLZ A;  5E2E A;  1PZO A;  5M19 A;  3JPU A;  1YLP A;  1IEM A;  1G68 A;  3IXH A;  5CTN A;  5GLA A;  4PHT A;  4Z1W A;  2VV8 A;  4DE1 A;  5F1G A;  1HLU P;  2FFF B;  1HZO A;  1CEG A;  1HTZ A;  4HBU A;  3A3E A;  4KZ7 A;  1IYO A;  2OWH A;  1BLH A;  3JVU A;  3HLB A;  2G2W A;  4O01 A;  3VP2 A;  3IX3 A;  5FAT A;  3T1S A;  1OTD A;  1P0Z A;  1SDE A;  2A3U A;  4MN5 A;  5EVL A;  4JGO A;  3V3S A;  2LB5 A;  3UDI A;  3R7W A;  2O0Y A;  1PNE A;  2BG1 A;  3LY3 A;  1SKO A;  3K3C A;  3S22 A;  2ZMV A;  5CHJ A;  2ZMA A;  2A24 B;  3OPH A;  4Y5F A;  3CZD A;  4CLC E;  5KMW A;  4WUJ A;  5J3W A;  4IVK A;  1XP4 A;  3WS0 A;  4R70 A;  3LR5 A;  1YSQ A;  3T4S A;  4ZDX A;  4KQQ A;  4LCM A;  1D1J A;  1MWU A;  3H7W A;  3EGX C;  1L0D A;  1Q2P A;  3IXG A;  4HI4 A;  2XD5 A;  3ZG8 B;  2ZC3 B;  1SCW A;  1IOU A;  2C5W B;  2YKH A;  3UPO A;  3IXD A;  1KGE A;  2B02 A;  3GRJ A;  3NIA A;  3AGD A;  3UE0 A;  4L0L A;  1MKI A;  2WGV A;  5HDS A;  2PU4 A;  2J3T D;  3O88 A;  3T4K A;  3ZCZ A;  1OTE A;  3KO6 A;  4LPZ A;  2B5R A;  3LUQ A;  4JXV A;  1MBL A;  2WYX A;  3T12 B;  1LT0 A;  1DJC A;  1K54 C;  4DE2 A;  2I9V A;  2VK3 A;  2EX9 A;  1IKI A;  2D01 A;  3NOP C;  1AWI A;  1SHV A;  3OLO A;  3N8R A;  4Y0U A;  4EQ1 A;  5CHU A;  2H0Y A;  4IHQ A;  2EXB A;  3ZVT A;  1EWZ A;  4OVD A;  5E2F A;  1L0E A;  5MC7 A;  4N92 A;  2RCX A;  3UME A;  3NUL A;  3NC8 A;  3BY8 A;  2JHE A;  3C30 A;  5AQ7 A;  2E8J A;  4OPZ A;  2XQZ A;  1T1B A;  1L3L A;  5E2H A;  3LO7 A;  3VP4 A;  3N8S A;  3NEC A;  4KQR A;  1IEL A;  3H82 B;  4E3K A;  2KLI A;  2JKT M;  5F82 A;  1S4R A;  4PKY G;  2OWJ A;  4HH3 A;  4K08 A;  3OPP A;  4BLM A;  1BT5 A;  4FCF A;  2G7U A;  2P74 A;  3V3R A;  3HVF A;  1PWC A;  4FTX A;  1W5D A;  2ACG A;  1KE4 A;  3CIT A;  3E2L A;  3RFB A;  2EX6 A;  3VFF A;  1PIO A;  1NYM A;  3WRZ A;  1YAX A;  4CLC B;  3K3D A;  3MBZ A;  4MNR A;  5GLC A;  4GHI B;  4DMZ A;  5I94 A;  3ZDJ A;  5FAS A;  2PD7 A;  4F3L B;  2WAD A;  5TJJ A;  2W27 A;  2WKR A;  5FQK A;  3BY9 A;  2P7J A;  3C7V A;  3UE3 A;  2ZQ8 A;  5DF9 A;  2GDN A;  4HIA A;  3OZH A;  1LSV A;  2Y2Q A;  1CEF A;  3LIA A;  1BSG A;  1W79 A;  1JWZ A;  2VX8 A;  1ZG4 A;  3EEA A;  3W8K A;  3BFC A;  2R9W A;  1HVB A;  3AGF A;  1GA0 A;  1STZ A;  4WMC D;  2PDR A;  5BOH A;  5CXW A;  4HNB A;  3N8L A;  2XA7 M;  3IF6 A;  2WGW A;  4R3J A;  4JLF A;  5HX9 A;  5LBR A;  1JTD A;  5F1F A;  2Y59 A;  2OAP 1;  5AJG A;  1ACF A;  1G28 A;  4YNR A;  4E3N A;  1MPL A;  5HPF A;  1ES3 A;  3BM6 A;  4WYY A;  3BWL A;  4KUK A;  1MXO A;  4DF6 A;  4MBH A;  1FCO A;  4ZBE A;  2EWW A;  3W4Q A;  2CMN A;  4BJP A;  1F5M A;  3UB7 A;  3OC2 A;  2GZA A;  1I2S A;  5E2G A;  5E43 A;  2WKP A;  2VLG A;  3MXQ A;  4C75 A;  4WZ5 C;  5HWV A;  3HJK A;  3PTE A;  4ID4 A;  2J8Y A;  5A8B A;  2M7U A;  4XUX A;  2L0W A;  5FEG A;  5KIZ A;  3GMW A;  5DKK A;  5IT5 A;  3H7W B;  3B47 A;  1H8Z A;  2YKF A;  3EQU A;  1XPB A;  4R3A A;  4BBT A;  4O8G A;  3WRT A;  2WKE A;  1J3W A;  4S2N C;  1TF1 A;  4XT2 B;  1BLP A;  1C3B A;  4FSF A;  3TG9 A;  3UDF A;  3WS2 A;  1D7E A;  1JNU A;  2VV7 A;  2P9V A;  4FOF A;  4DDY A;  5HW3 A;  2H10 A;  5EVI B;  5C5K A;  5EEC A;  3GEC A;  3PXP A;  3HL9 A;  5HL6 A;  1L2S A;  1FIL A;  4R1G A;  3KYE A;  3EGD C;  3BEC A;  5G4Y A;  3H82 A;  4BBU A;  2J7V A;  1JWP A;  2X01 A;  3DAV A;  1TS6 A;  3NJA A;  2HP6 A;  4ARZ B;  1G6A A;  1KGF A;  4UA7 A;  2Y2H A;  3LR4 A;  1UWN X;  4XT2 A;  4PM6 A;  1T18 A;  1KE0 A;  3QNB A;  3Q7V B;  4HEF A;  4Y7P A;  2QZ6 A;  3M6H A;  4BEN A;  2NUT C;  3EOI A;  4P6Z M;  2NUP C;  3E98 A;  1UGU A;  2ZQ9 A;  4WEL A;  3IWI A;  1MY8 A;  2J3T C;  1XJ2 A;  3PR6 A;  1EI5 A;  2EXA A;  3MS6 A;  3W4P A;  4H6J A;  4R3B A;  4DJ2 A;  3IF6 C;  4HHD A;  3NBL A;  4WEK A;  4S2O A;  4PM8 A;  1F2K A;  4QHC A;  1D06 A;  1S6R A;  1W7F A;  3ZQ5 A;  3M2K A;  4I3A A;  4KG6 A;  2PU2 A;  4JPM A;  4KZ5 A;  4ZTK A;  5L8M A;  3KSH A;  4QY5 A;  2PYP A;  4L9F A;  1W8Q A;  2XH9 A;  4GW9 A;  5DTS A;  3KX0 X;  3QP1 A;  1TS7 A;  3QP8 A;  1ERO A;  4N9L A;  5J7E A;  4BBV A;  5EM0 A;  3G32 A;  5G18 A;  3F1P B;  1G5U A;  1N9L A;  1OT9 A;  5EE8 A;  2ZC4 B;  1EW0 A;  1YLJ A;  2V1A A;  5DFY A;  3NDG A;  4UA6 A;  1DY6 A;  3IS2 B;  3IHB A;  3E4P A;  2ZL1 B;  1NYY A;  3BEB A;  2WGW B;  4DJ3 A;  1YLW A;  3Q7Z A;  1TS8 A;  5DF7 A;  1VEU A;  2Y2L A;  2XGN A;  1WYB A;  4PAU A;  5CRF A;  3HUO A;  3PBO A;  5FQI A;  3CI6 A;  1NLY A;  2WKQ A;  5FDS A;  2V0U A;  3MJQ A;  3CG5 A;  4R4R A;  4EUV A;  3SZT A;  1K54 A;  4R23 A;  2Y2N A;  3LCE A;  1DP6 A;  3M2J A;  1AXB A;  5A91 A;  1YMX A;  2JN7 A;  2X02 A;  3NOT C;  1S0W A;  1V9Y A;  2XFS A;  3BJN A;  3BQ8 A;  4P85 A;  2W0N A;  1BYW A;  2IWC A;  4QJG A;  3QNC A;  2Z6C A;  3V5M A;  3E4Q A;  3L9K A;  1CQA A;  4JXS A;  5EVI C;  4GB7 A;  5HL1 A;  3BLM A;  1XJ3 A;  4K0X A;  2VKS A;  3PBR A;  1M6K A;  3O86 A;  4Y0O A;  4MN7 A;  4ESP A;  4KZ3 A;  2Y2J A;  2KOI A;  1VEU B;  3E2K A;  1PYY A;  3BQA A;  2JCH A;  4RX3 A;  3UPN A;  1PW8 A;  3TE8 A;  3LR3 A;  1K56 D;  1CI8 A;  1FCN A;  5CGS A;  4X1M A;  3IX8 A;  3T4O A;  1GCE A;  3C5A A;  2R78 A;  2QWS A;  3FZC A;  1F9I A;  4OON A;  3NOU C;  2WAF A;  1T1A A;  2JKR M;  2W1T A;  3DW0 A;  3C8C A;  2X71 A;  3VOZ A;  1MZU A;  5DJT A;  4H6J B;  2HJ9 C;  1QMF A;  3IHA A;  2VGL S;  4G3V A;  2JBF A;  1OT6 A;  2Y91 A;  3FG8 A;  1LI9 A;  2ZJ9 A;  3KSF A;  1IFQ A;  1HD8 A;  4WF0 A;  1RGZ A;  4O0P A;  5FAO A;  2I72 A;  3S1Y A;  1MC0 A;  1LHY A;  2ZOI A;  4IUK A;  1FSW A;  1RCJ A;  3IH8 A;  5HSQ A;  2XDM A;  3O87 A;  1BUL A;  4JF4 A;  3IXB A;  1WE4 A;  4HOI A;  2DRW A;  1MWR A;  2PBY A;  3RJU A;  3OBF A;  3E4O A;  3A3I A;  4HP4 A;  3S7N A;  3I7J A;  1YM1 A;  1E3U A;  1GA9 A;  4YOF A;  2Z2L B;  1P97 A;  4I5S A;  3VOL A;  1KDS A;  1ERM A;  4UA9 A;  2DNS A;  2W1T B;  3ZG7 B;  4MMN A;  3VSL A;  3FPW A;  5K5B A;  2EFU A;  5HWT A;  4ZJ1 A;  2Y2O A;  4HH2 A;  1QME A;  5DTK A;  3V39 A;  1ZC2 A;  4OKP A;  4KZ8 A;  3PBS A;  1NRJ A;  3FV7 A;  4P0M A;  4UQI M;  1T1C A;  2PR5 A;  1K6R A;  1F98 A;  3HUN A;  4HQA A;  4E6W A;  3IT9 A;  4Y15 A;  4MN6 A;  4I38 A;  4JGQ A;  5A90 A;  3EEH A;  4Q8I A;  3CHW P;  4DN0 A;  1WYC A;  4S2J A;  2A49 A;  1NZU A;  1SDN A;  2JC7 A;  4GKU A;  3FKW A;  1UWP X;  1K56 A;  1Y54 A;  4HJ4 A;  3T1R A;  1DJA A;  2AVX A;  3MF0 A;  1GSW A;  1ONG A;  1SKO B;  4GHI A;  2C6W B;  4D60 A;  3SS5 A;  4G3W A;  4KZ4 A;  3ITB A;  2PAV P;  4DE3 A;  3HLE A;  2K7S A;  2O9B A;  2K31 A;  3Q1F A;  3O3V A;  3OOV A;  4HP9 A;  2UWX A;  1S1Z A;  4I3J A;  3DTE A;  3W4O A;  3LY4 A;  1FIK A;  2Q9N A;  3CLO A;  2V1Z A;  2WZX A;  2LB9 A;  3Q07 A;  3G31 A;  2J9P A;  2WKH A;  2IA2 A;  2ZQC A;  3D9Y A;  2B18 A;  5FA7 A;  3VOY A;  5EFW A;  5M18 A;  2WKI A;  4KQO A;  1S1Y A;  3B33 A;  3C7U A;  1CF0 A;  4QB8 A;  2W3E A;  4MCW A;  4HJ3 A;  4CPK A;  5DJU A;  3IQA A;  2ZBB A;  3PBT A;  4EQI A;  4OLG A;  5AQB A;  5EPH A;  4E6X A;  3LEQ A;  4PM7 A;  4EES A;  5G4Z A;  4EEU A;  3QHY A;  4KZA A;  4UHU A;  4WL9 A;  4I39 A;  2BTF P;  4OPQ A;  4R4S A;  3W2Z A;  4OPY A;  3SS4 A;  3F1O B;  3D3O A;  1JVJ A;  4GDB A;  3V67 A;  4OQI A;  3PBN A;  4MLL A;  4Y0T A;  2UV0 E;  4X6T A;  5AQA A;  2ZL1 A;  3QP4 A;  3MKE A;  3UB6 A;  3CWF A;  3RTY A;  4JBF A;  4X69 A;  1XFQ A;  4S2I A;  3PYP A;  1DRM A;  5CTM A;  4Z9Q A;  1GHI A;  4WM9 A;  1VB6 A;  3ZNT A;  4QY6 A;  3VP3 A;  2V9A A;  1K4F A;  2VGJ A;  4LV1 A;  3GQZ A;  5I5L A;  3P09 A;  4RVA A;  2IWB A;  3UB8 A;  1XKZ A;  3RXX A;  5AQ9 A;  1ZTU A;  2V8F A;  4UAA A;  4QPR A;  4IJG A;  3UE6 A;  3CPT B;  2ZOH A;  5IS1 A;  2Y2P A;  1K55 C;  5F68 A;  3HLG A;  3G2Y A;  3B42 A;  3IWO A;  4E3O A;  4BL2 A;  2QHK A;  2HPB A;  1E4D A;  3T1X A;  2ZM8 A;  3FC7 A;  2QKP A;  2W3D A;  2XLN A;  4P6Z S;  5M1A A;  2VJW A;  4EBN A;  3UPP A;  4ME4 A;  4GD6 A;  2HP9 A;  3NY4 A;  2H0T A;  4E3M A;  2HDU A;  2B95 A;  3EWK A;  5AVE A;  4OQG A;  3B3X A;  1H5X A;  1PWD A;  5FQ9 A;  3SS3 A;  3SH9 A;  5A92 A;  1P9R A;  5EOE A;  3G6O A;  3KYQ A;  4ZJ3 A;  3OPL A;  5F83 A;  3T1Q B;  3ZG5 A;  4NKP A;  1ES2 A;  1A0K A;  2ZC7 A;  3BFG A;  4X53 A;  2L1M A;  4EEP A;  4EXO A;  4A5R A;  3VSK A;  4CLC D;  1IKG A;  5HAR A;  1O07 A;  1K4E A;  3LIB A;  3S7P A;  1KVL A;  1ODV A;  3P98 A;  1LL9 A;  2HDS A;  2ZM2 A;  4OOL A;  3VP0 A;  2XK1 A;  2Q9M A;  2ZM0 A;  5EM1 A;  3LEZ A;  5J8X A;  3Q82 A;  3N7W A;  5HD3 A;  1ES4 A;  1YLT A;  1LSW A;  2JE5 A;  3IX4 A;  4BL3 A;  4K0W A;  1N9O A;  2WUQ A;  5FL3 A;  4Y2F A;  4C6Y A;  3SH8 A;  2WZZ A;  1BLS A;  2XRO A;  1FQG A;  1T19 A;  3MFD A;  2GNX A;  4CLC A;  3TSG A;  1NY0 A;  2Y2M A;  3LYX A;  3TW8 A; 
#chains in the Genus database with same CATH homology
 1OJG A;  2KX6 A;  3P7N A;  3C30 A;  3D72 A;  2XA7 S;  3T4O A;  1T1B A;  3MQO A;  4B93 A;  5TBM B;  4RQ9 A;  4NXF A;  2R78 A;  4OOM A;  1XFN A;  2GX5 A;  4F3L A;  5HDC A;  2QWS A;  3H82 B;  2DMW A;  5HZH A;  1F9I A;  2KLI A;  2JKT M;  2PYR A;  4LLO B;  1S4R A;  4PKY G;  2OWJ A;  3VE4 A;  4AFI A;  3LI9 A;  2HF6 A;  4HH3 A;  1KOU A;  2D02 A;  3NOU C;  4ARZ A;  1T1A A;  4BWI A;  4K08 A;  2JKR M;  4GS9 A;  2JKT I;  2W1T A;  3F1O A;  3C8C A;  3C2W A;  4YWZ A;  4WLA A;  2G7U A;  2MJ6 A;  4HJ6 A;  1MZU A;  4ETX A;  5DJT A;  2PD8 A;  4H6J B;  2HJ9 C;  2VGL S;  3CIT A;  4G3V A;  1OT6 A;  5F69 A;  3RFB A;  3FG8 A;  3KSF A;  1IFQ A;  4WF0 A;  2VV6 A;  4O0P A;  2PHY A;  1XJ4 A;  1YAX A;  4CLC B;  1MC0 A;  3K3D A;  2ZOI A;  4IUK A;  1S67 L;  5HD5 A;  3A0S A;  5HSQ A;  2W3G A;  5F5Y A;  2OOL A;  1NLZ A;  4GHI B;  4DMZ A;  1Y28 A;  4HOI A;  5TBM A;  2M7V A;  3PBQ A;  3OBF A;  3TRC A;  3E4O A;  4WN5 A;  4HP4 A;  2PD7 A;  1S66 L;  3S7N A;  4F3L B;  5TJJ A;  2Y79 A;  1LSX A;  2JKR I;  3KSG A;  4YOF A;  3HJI A;  2W27 A;  1XJ6 A;  4WEJ A;  2WKR A;  1P97 A;  4I5S A;  3VOL A;  5DFX A;  3BY9 A;  4Q0I A;  2P7J A;  3UE3 A;  1H3Q A;  2W1T B;  5DF9 A;  3OCL A;  4HIA A;  4KUO A;  1LSV A;  2VGL M;  4HY8 A;  1X0O A;  3LIA A;  3UMD A;  1S4S A;  2P08 A;  4MMN A;  3VE3 A;  2VX8 A;  3EEA A;  2VA0 A;  3MMH A;  3FPW A;  5K5B A;  1STZ A;  5HWT A;  2EWV A;  2PDR A;  4HH2 A;  4I3I A;  4IUH A;  4HNB A;  2XA7 M;  3PBS A;  1NRJ A;  3T4T A;  4UQI M;  5CX7 A;  5LBR A;  2OAQ 1;  3T50 A;  1T1C A;  2PR5 A;  2OAP 1;  5AJG A;  4BMW A;  1GSV A;  1F98 A;  4HQA A;  1G28 A;  1ZHH B;  2H28 A;  4YNR A;  3ULF A;  1GSX A;  2QJ7 A;  5HPF A;  4MN6 A;  4I38 A;  1OTI A;  2Y8H A;  5DKL A;  4JGQ A;  1YKD A;  3EEH A;  3BWL A;  4KUK A;  3K2N A;  4JGR A;  4DN0 A;  3A0R A;  4GLQ A;  4EW7 A;  1LL8 A;  5KSH A;  2EWW A;  2W1R A;  3LIF A;  2CMN A;  4B9O A;  1UWP X;  3KSI A;  4BJP A;  2VZW A;  4HJ4 A;  3U2A A;  1F5M A;  3UB7 A;  3P01 A;  3OC2 A;  2GZA A;  2HV1 A;  3MF0 A;  1GSW A;  2O9C A;  4GJ4 A;  2HGV A;  4CQH A;  3FPV A;  2WKP A;  3F1N A;  3JVV A;  4GHI A;  4LRZ E;  2O99 A;  2VLG A;  3MXQ A;  4LRY C;  3LIE A;  5HWV A;  4G3W A;  3HJK A;  4UEY A;  3IBJ A;  3R4K A;  5HPI A;  2J3W A;  4EER A;  4UQI S;  3MQQ A;  5A8B A;  1H8M A;  2K7S A;  2M7U A;  2O9B A;  2K31 A;  4L9G A;  2L0W A;  5KIZ A;  4E04 A;  5DKK A;  2O9A A;  2XRN A;  3H7W B;  5IT5 A;  3B47 A;  3OOV A;  4HP9 A;  2YKF A;  1MKM A;  2FH5 A;  3EQU A;  1S1Z A;  4I3J A;  4R3A A;  1DP9 A;  4BBT A;  4O8G A;  4Y3I A;  3CLO A;  1OTA A;  4R6L A;  4PKY A;  2LB9 A;  3T4J A;  1TF1 A;  4XT2 B;  1TS0 A;  4FSF A;  2IA2 A;  1D7E A;  1JNU A;  3CAX A;  3ZYT A;  2VV7 A;  1G6O A;  2B18 A;  3CUE A;  4FOF A;  2ZMF A;  3LFV A;  5C5K A;  4II7 A;  5EFW A;  3GEC A;  3PXP A;  4KQO A;  2L4R A;  1VHM A;  1S1Y A;  5HL6 A;  4ZRR A;  1P9W A;  3B33 A;  2PR6 A;  3EGD C;  3E0Y A;  4NXB A;  3T4Q A;  5G4Y A;  3H82 A;  5AVF A;  4BBU A;  2Z6D A;  3R7W B;  1TS6 A;  2W3E A;  3CUE C;  3NJA A;  4ARZ B;  2EA9 A;  3KYZ A;  2BAS A;  4HJ3 A;  4KQD A;  4MCW A;  3VV4 A;  3NHQ A;  1OJ5 A;  3DBA A;  3LR4 A;  3OCN A;  5DJU A;  3SW1 A;  1UWN X;  4GCZ A;  4XT2 A;  1T18 A;  2P04 A;  2ZBB A;  3PBT A;  4GS9 B;  3LID A;  3PHY A;  5HDD A;  2M1C A;  2V0W A;  3LR0 A;  4NXG A;  1V9Z A;  4EU0 A;  2NUT C;  3EOI A;  4G3K A;  4P6Z M;  3A0V A;  2NUP C;  4EES A;  5G4Z A;  4EEU A;  3E98 A;  1UGU A;  3F1P A;  4JGP A;  3LI8 A;  1OTB A;  5IU1 A;  4WEL A;  4WL9 A;  4I39 A;  2V1B A;  2J3T C;  1XJ2 A;  3TJZ C;  3W2Z A;  1WA9 A;  3F1O B;  3D3O A;  3PR6 A;  3IS2 A;  1NWZ A;  5HWW A;  3V67 A;  3S7O A;  3PBN A;  4H6J A;  4DJ2 A;  4HHD A;  2W3F A;  4WEK A;  1D06 A;  3UB6 A;  3CWF A;  3RTY A;  3ZQ5 A;  1W63 M;  4I3A A;  1XFQ A;  4PHT A;  4Z1W A;  2VV8 A;  5L8M A;  3PYP A;  1DRM A;  3KSH A;  1TD5 A;  2PYP A;  3H9W A;  1VB6 A;  4L9F A;  4NXE A;  4GW9 A;  2V9A A;  3IBR A;  2XSS A;  3KX0 X;  2OWH A;  1TS7 A;  3JVU A;  5I5L A;  3RH8 B;  3MR0 A;  5J7E A;  4O01 A;  3UB8 A;  4BBV A;  3EQV A;  3BW6 A;  2PT7 A;  1ZTU A;  2K2N A;  3O5Y A;  4QPR A;  4IJG A;  1OTD A;  3UE6 A;  1P0Z A;  2ZOH A;  3F1P B;  1N9L A;  1OT9 A;  5IS1 A;  1YSP A;  4MN5 A;  1EW0 A;  2V1A A;  4Q0J A;  5F68 A;  4JGO A;  2LB5 A;  3B42 A;  3R7W A;  4ETZ A;  2KDK A;  2O0Y A;  5DFY A;  2QHK A;  2VEA A;  3K3C A;  2ZMV A;  2A24 B;  3FC7 A;  4CLC C;  4Y5F A;  4CLC E;  2QKP A;  2W3D A;  3IS2 B;  4WUJ A;  5J3W A;  4R70 A;  3MQ0 A;  3E4P A;  3LR5 A;  1YSQ A;  3HCY A;  4P6Z S;  2VJW A;  3MFX A;  4ME4 A;  3UB9 A;  2A2L A;  3T4S A;  4DJ3 A;  1TS8 A;  3EWK A;  5AVE A;  3H7W A;  4PAU A;  3EGX C;  1W63 Q;  2J80 A;  3PBO A;  4HI4 A;  3CI6 A;  1NLY A;  2WKQ A;  1P9R A;  2V0U A;  3MJQ A;  1IOU A;  4EUV A;  3G6O A;  3KYQ A;  4MDZ A;  4NKP A;  4NEE D;  2YKH A;  2B02 A;  2L1M A;  4EEP A;  4EXO A;  4CLC D;  4L0L A;  3ICY A;  1DP6 A;  4R38 A;  5HDS A;  3LIB A;  3S7P A;  2J3T D;  2JN7 A;  3NOT C;  1V9Y A;  3T4K A;  3BJN A;  4LRX C;  3BQ8 A;  1N9N A;  1ODV A;  3F1N B;  2W0N A;  1OTE A;  3KO6 A;  1BYW A;  4LPZ A;  3LUQ A;  3LIC A;  1OPX A;  4OOL A;  2Z6C A;  3C38 A;  2QYB A;  3T4L A;  1LT0 A;  3S7Q A;  2A24 A;  3E4Q A;  4EET B;  4M4X A;  2JHE A;  2I9V A;  5HD3 A;  1LSW A;  1XJ3 A;  2VKS A;  1N9O A;  3PBR A;  2D01 A;  3NOP C;  5FL3 A;  4Y2F A;  4MN7 A;  3GDI A;  3OLO A;  2W3H A;  4EQ1 A;  2KOI A;  4L9E A;  2INW A;  4IHQ A;  2XRO A;  3BQA A;  5F6A A;  5J4E A;  1T19 A;  3TE8 A;  5MC7 A;  4Q0H A;  2GNX A;  3LR3 A;  2HJE A;  4CLC A;  3UME A;  2FZ0 A;  1DP8 A;  2QJ5 A;  2GJ3 A;  3LYX A;  3TW8 A;  3BY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...