4CLCA

Crystal structure of ybr137w protein
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
169
structure length
169
Chain Sequence
VVLDKKLLERLTSRKVPLEELEDMEKRCFLSTFTYQDAFDLGTYIRNAVKENFPEKPVAIDISLPNGHCLFRTVTYGGSALDNDFWIQRKKKTALRFGHSSFYMGCKKGDKTPEEKFFVDSKEYAFHGGAVLIQSERSDYPYACLTISGLKQEEDHLMALSSLIAFANE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0303 PROTEIN YBR137W
publication title Structural and Functional Characterization of Ybr137Wp Implicate its Involvement in the Targeting of Tail-Anchored Proteins to Membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 56
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03928 Haem_degrading Haem-degrading
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.150 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4clcA00
4CLCA 4CLCB 3FPWA 4CLCD 4CLCE 5CX7A 4NKPA 3FPVA 4CLCC 4BMWA 2A2LA
chains in the Genus database with same CATH superfamily
4KQDA 4OOLA 4UHUA 5EOOA 2PBDP 4EETB 1MZUA 4R4RA 2W3GA 4OQGA 3IS2B 2O9AA 1IYQA 3DTIA 2JKFA 3H82A 4X1LA 5CGSA 4UA9A 5C5KA 4PAUA 2K31A 1TS0A 4EW7A 3LO7A 5FI7A 3WS5A 4DMZA 4S2KA 2GZAA 3HUOA 5A90A 2J7VA 4IJGA 4PM6A 3FPWA 2KLIA 2ZQDA 3NY4A 3ZG7B 3G2ZA 3OZHA 3Q7VA 4WYYA 5DKKA 4BQMA 3KSGA 3NI9A 3R4KA 4E3KA 3IXHA 4E04A 3UMEA 1YMXA 2IWCA 3VP3A 3GMWA 1YMSA 4E3LA 4OONA 5K5BA 2J3WA 1D06A 2HJEA 4DDYA 2QWSA 1VQQA 4OLDA 3SZTA 2DNSA 1F9IA 1ERMA 1VETB 2HP5A 4OOYA 5DFXA 4S2OA 3NJAA 3C5AA 3BLSA 4S2NA 2ZD8A 5MC7A 1CK3A 3T1SA 1CEFA 2XFTA 4LCMA 2Y2OA 3MKFA 3BY9A 3ZG5A 4KG5A 1TS6A 1IFQA 4MMNA 2ZQ9A 2IWDA 4UA6A 1AXBA 3G2YA 4P85A 3F1PA 2J9PA 1IYSA 3FWLA 3ULFA 1GSVA 3V3RA 4KZ8A 3LY3A 3I7JA 4HJ3A 3JVUA 4LV1A 4UQIM 4XUXA 2NUPC 3HLCA 5M18A 2C5WB 1L3LA 3UDXA 2BG1A 3E0YA 4BENA 4C75A 1V9YA 2R9WA 2H0TA 1ZG4A 4II7A 1K56D 4R38A 5FI2A 1F5MA 1UWPX 2JN7A 4I5SA 4IBXA 4ETZA 1N4OA 1G68A 3P09A 1P9RA 4K0XA 5FQIA 2P08A 3N4IA 3KO6A 2XQZA 1LL8A 4NETA 4CLCE 3UB9A 3V50A 1QMFA 2PYRA 1H3QA 4FUWA 2Y2MA 3MZFA 2X02A 2WAEA 5CXWA 1XFNA 3CMZA 1G5UA 3S7OA 4X1MA 4HP4A 2XRNA 1T18A 1BZAA 1CI9A 3T1XA 2H10A 5D3OA 3O3VA 1W63M 3RXWA 4HBTA 3V67A 4S2NC 1XA1A 1KGFA 4QPRA 3S7PA 1YPRA 1NY0A 5FQJA 2OV5A 5L8MA 1T1AA 4ID4A 4O8GA 5FATA 2P04A 4I3IA 3ITBA 4X55A 1QMEA 3W4QA 1VEUB 2W3HA 3G6OA 2QJ5A 1TS7A 3RH8B 1XP4A 4EWFA 3OPLA 3WS2A 4FSFA 2VLGA 3JPUA 3BECA 1IYOA 4I3AA 3A0RA 3B47A 4F3LA 2WGIA 2ZMFA 4QB8A 3UB5P 1FR1A 2VJWA 3SS5A 1CEGA 2KDKA 4X56A 1PI5A 4HJ6A 3OCNA 1MXOA 5EUAA 1S1YA 1L0GA 4E3OA 3ISGA 4Y15A 1NZOA 3SOIA 2B95A 4BBTA 2P7JA 1H8ZA 4B93A 1KGGA 2HF6A 4WMCA 1H8YA 3DTKA 4P6BA 4HBUA 5HWTA 5J4EA 3H82B 4OQIA 3CPTA 5IU1A 4AFIA 1ONHA 3MJQA 1A0KA 3T4KA 4PM5A 1MKMA 1LHYA 4EV4A 3CITA 4K0WA 4P6ZS 4ZJ3A 1SDEA 4UEYA 3Q7VB 1YT4A 4DE0A 3VE4A 2E8JA 4MBKA 4L9GA 4O01A 3MXSA 2M1CA 2XEPA 5HAIA 4JLFA 5CERA 2WUQA 2LB9A 5F1FA 5A92A 4JF6A 4K91A 3FV7A 1PWCA 4KG2A 4KZ9A 5HWWA 5HWVA 5HZHA 1ZTUA 3GSGA 5E2HA 1Y28A 4LV3A 3RJUA 3RXXA 1W63Q 3EGDC 4N1XA 3MFDA 2HDUA 1JTDA 1PZPA 1O7EA 4ZAMA 4UA7A 4PM7A 1HZOA 1TS8A 5HDDA 5DJUA 5M1AA 2M7UA 1RGYA 2HPBA 3GRJA 2RCXA 2JKTI 5FEGA 3MXQA 5A8BA 3UDFA 4B9OA 3MXRA 4Y0UA 3HLWA 3C30A 3F1PB 3LIAA 3QP2A 5EE8A 4YOFA 4E6WA 2L4RA 3PBQA 3WS1A 5AQ9A 1E3UD 1O07A 3BJNA 3IT9A 5GLAA 1S0WA 1PWGA 4QWOA 4YFMA 1CF0A 4MEZA 4HJ4A 3BY8A 4NXBA 1Z09A 3QHYA 5FDSA 2JE5A 1Q2QA 2JKTM 4KENB 3UN7A 2W1RA 1XPBA 1DP6A 3NOTC 2J3TC 2B18A 3CLOA 3UPNA 4A5RA 2ZM8A 4UAAA 3WS4A 3CJMA 4HH2A 5F1GA 1I2SA 4DF6A 1Q2PA 1PNEA 2L0WA 4PKYG 4RA7A 1YLJA 4LV2A 2VGLM 3MQOA 2HP6A 2INWA 4LGWA 1E25A 2L1MA 1XGIA 5HDSA 5L10A 2VA0A 2ZC3B 5EPHA 5FA7A 4Y17A 3UDIA 3RTYA 3EWKA 4X25A 5IS1A 3HJIA 2XDMA 2C6WB 3Q82A 4HOIA 4EESA 1LL9A 2ACGA 2EXAA 1DJAA 4ETXA 4H6JB 2HJ9C 1KDSA 3UB7A 1K55C 1WE4A 4S2PA 3QNCA 2H28A 1KDWA 2OWJA 2V2FF 2ZJ9A 3GR2A 3W4PA 4RVAA 2OSUA 4F3LB 2XSSA 2OAQ1 4KZAA 2V1ZA 3RFBA 5EVID 3G31A 3HLDA 4B4XA 4C6YA 5FQMA 2PRFA 3G30A 3KSFA 5AQ7A 5CECA 2AVXA 4LFUA 5U47A 3GTCA 2V0WA 4E3MA 5L07A 1GHMA 5DF8A 1U60A 2J80A 3DWKA 3GQZA 4FD8A 5I5LA 3MF0A 2Y2LA 1YLPA 3UNWA 5JYPA 2P74A 2ZMAA 2PU2A 2PBYA 3CPTB 4JPMA 4QD4A 4GS9A 1F2KA 5GHXA 4G3VA 3TOIA 2JKGA 1ERQA 1V9ZA 3PR6A 3KSIA 2VV6A 1S4RA 2PT7A 3UB6A 3ZDJA 1ES4A 4CLCD 5KZHA 2A3UA 4FH2A 3CI6A 3Q07A 1BULA 1OPXA 4LCLA 5DTTA 3O86A 1PRQA 3ZVWA 3LR4A 3N8RA 3UE1A 4EQ1A 1XJ3A 4HESA 4QY5A 4WLAA 4JGRA 5AVFA 1ES3A 4RX3A 4H8RA 5HDCA 2FH5A 1AWIA 2A24A 2Y2PA 3MQ0A 4R0QA 3GV9A 5FAQA 3BFCA 3VP4A 1OT6A 4OP8A 3OLOA 3E4OA 1DRMA 3C4PA 3NOUC 2FZ0A 3PAEA 2W3FA 3IF5A 3IX4A 1YKDA 1K4EA 1EW0A 1N9LA 3IHBA 5EFWA 1PFLA 5GHZA 1BLPA 4Y0OA 1MWTA 4U0XA 4ZBEA 3VFHA 3E4QA 4DE2A 3AGDA 5IT5A 2WADA 4L9FA 2OAP1 5A91A 4RX2A 1H8MA 5TJJA 4WEKA 1ZG6A 4KZ7A 3Q1FA 4N92A 3ZHHA 4XXRA 2XH9A 2Y2IA 1XJ2A 4BL3A 1FIKA 4FOFA 3BFGA 2XFSA 2FFYA 4GJ4A 3LEZA 3LR0A 2VGJA 5J3WA 4EUVA 3BQAA 4MBHA 3HREA 4QHCA 4R70A 5E2FA 1CJFA 2JCHA 2WKRA 1ZHHB 2P9VA 3NECA 1BSGA 4O0PA 3PBSA 5HL6A 5HPFA 1K6RA 5DTSA 2ZOHA 2Q0OA 1HLUP 2WAFA 3PYPA 1ES2A 3PTEA 4KZBA 3V3SA 5GLDA 4BD1A 2ZQAA 5GLBA 4Q0IA 5EECA 3UY6A 3S4XA 1LLBA 3D72A 4EERA 1MC0A 3MSHA 2ZC7A 2W3DA 1L0EA 2DRWA 4JBFA 4EUZA 3TG9A 1JVJA 2CMNA 2PDRA 4GD8A 1PI4A 1N9OA 4CJNA 4QY6A 1M6KA 2RL3A 2G2UA 2V0UA 2HZ5A 1F98A 3VSLA 1T19A 3ZG9B 2R9XA 1LSXA 4IBRA 4JF5A 3F1NB 5F83A 5HD3A 1RGZA 3VOZA 2HGVA 4BLMA 5CX7A 3U2AA 3ZGAB 4Y0TA 3PBTA 1ES5A 4OQHA 1YSQA 1RCJA 3IXBA 3MR0A 3T12B 1MWUA 3TW8A 3GDIA 2IWBA 2JC7A 1DY6A 3HLFA 2Q9MA 4LLOB 2XGNA 2ZOIA 2XF3A 3FC7A 4OLGA 3KYQA 3CG5A 2ZC5B 3ZG8B 4IVIA 2KOIA 5J8XA 3DW0A 1G6AA 5EM0A 4ARZA 5HX9A 4HQAA 2W27A 4GDBA 3S7QA 1JTGA 4Y2FA 1BUEA 1YAXA 5HPIA 1YLYA 3CUEC 4EBPA 4E6XA 2DCFA 2XA7S 3HLBA 5F82A 3G35A 1Y4OA 4H6JA 1XJ4A 2R78A 2V9AA 2EX8A 5G4ZA 4WZ4A 4GN2A 2V1AA 1XA7A 5AQBA 3TE8A 4GS9B 4WEJA 1S4SA 3HUMA 4MN5A 3LI8A 5M19A 5E2GA 3KSHA 1WA9A 1IYPA 3VOLA 5AJGA 3EEAA 4Y5FA 3LR3A 1PYYA 2WZZA 4S2LA 4KQQA 1NRJA 5TGFA 4LPZA 3FYZA 1D1JA 3OPHA 4DXCA 3N6IA 1MY8A 5EVIC 2Y4AA 3Q7ZA 4X68A 2QMIA 3JYIA 2VV7A 1YLTA 5TBMA 2PD8A 2VV8A 3SS3A 1PWDA 3LCEA 3MFXA 4Z9QA 3M2KA 3OPPA 3T4OA 1YSPA 2I72A 3IBRA 3W8KA 2A24B 5G4YA 3MKEA 3IH9A 3L7HA 5L2FA 4WZ5A 4WL9A 4E3NA 5EVLA 1G6OA 4LRXC 1EROA 1L0FA 3C4OA 4L0LA 3FZCA 3UMDA 2ZLYA 1MKIA 3IQAA 3V39A 2E8IA 1JWZA 3O88A 4JXSA 4R6LA 3VE3A 4YNRA 3O87A 2J8YA 3D4FA 4DDSA 3BYDA 1NYMA 2Y91A 3DWZA 5CEDA 3LY4A 3PBNA 4RQ9A 4DJ2A 1FSWA 4R3BA 3K3CA 4JGPA 1SKOA 3WRTA 4ESPA 4KUOA 5CHMA 3U4LP 4XT2A 2VEAA 1XKZA 3NIAA 4LRYC 2A2LA 4B88A 4UQIS 2QHKA 5FDHA 5KSCA 1KVLA 2P9VB 3SS4A 5GLCA 5FEFA 2QPNA 2GX5A 3LGOA 3GECA 4N9LA 1K56A 4CPKA 5CGXA 1IKIA 3T4TA 4WELA 2WKIA 1HTZA 4JXVA 3CHWP 5CEBA 1K55A 4HP9A 4JXWA 5CGWA 1VB6A 3BRMA 1BLCA 3M2JA 2ZM0A 3SW1A 3T4SA 1K57A 1K6SA 1W8QA 4YWZA 1M40A 3ICYA 3MMHA 3CZDA 2QZ6A 3M6BA 1DP8A 4X6TA 4WZ5C 3A3DA 5EVIB 1KE3A 4G3KA 1BTLA 4PM8A 5BOHA 3IWOA 3VP1A 3KYZA 4MDZA 2EWVA 5GHYA 3QP6A 3LIEA 4R1GA 3T4QA 4CQHA 4X69A 1ACFA 2WK0A 3L9KA 4IVKA 1KGEA 3PHYA 4OOMA 2Y8HA 3PXPA 1OJGA 3T4LA 2O0YA 4ARZB 4BL2A 2Q9NA 3A3JA 3TSGA 4LENA 3F1NA 3E2KA 3B33A 2Z6CA 1FR6A 3WWXA 3N8LA 3QP8A 1GCEA 4KZ6A 3S1YA 4DKIA 2PR6A 3NDGA 2EFXA 3AGEA 3F1OA 4Y13A 3A0SA 3BFEA 2XD1A 5JYOA 3IF6A 3VV4A 2VZWA 3IX8A 4EBLA 1W5DA 2X71A 1H5XA 2KX6A 2YKHA 3ZNTA 2XR0A 4GLQA 1FCMA 1GA9A 1P97A 2Z2LB 1XX2A 4U3TA 2WGWA 2ZC4B 4KQRA 5FQKA 2GNXA 2W0NA 3UO9A 4ZTKA 1K57C 2UWXA 4IEDA 4I38A 4O7DA 1N9NA 1SKFA 3AGFA 3E2LA 1OTAA 1IELA 4NEED 1S66L 3HVFA 3LYXA 1K0KA 3P98A 5F68A 1MBLA 3HBRA 1FOFA 3OCLA 4HIAA 3DTEA 5CHUA 1UWNX 1T1BA 3A3EA 3IWIA 2Z6DA 1FILA 5TBMB 4YINA 1PIOA 3Q81A 4P0MA 5EM1A 4DXBA 1ZC2A 4K08A 1LSWA 2LB5A 2HV1A 5KMWA 2ZQ7A 3B3XA 4NG2A 3W2ZA 1OTEA 4DJ3A 5AQAA 5HAPA 3CWFA 2V8FA 2VGKA 3QP1A 2QKPA 4NXEA 4XUZA 3UE0A 1IKGA 1IEMA 4MLLA 1IOUA 5IHVA 4Q8IA 5TR7A 4R3JA 2ZQCA 3NCKA 3LI9A 2XLNA 5CRFA 4PHTA 3OPRA 3OOVA 4OVDA 2Y2KA 2WKEA 3R7WA 4E3IA 4WBGA 3ITAA 3FPVA 3LIBA 3ZG0A 2X01A 4FH4A 3BWLA 4RYEA 1K25A 1E3UA 3IF6C 1SKOB 4BD0A 4GNUA 4L9EA 4GHIA 1HVBA 4FCFA 1BT5A 4XT2B 2PAVP 1K4FA 3VFFA 2V1BA 3FG8A 1VM1A 3EEHA 3MZDA 4GB7A 5HW3A 3W4OA 3A3IA 5FSRA 1J3WA 1Z6FA 5DVAA 2D01A 5EOEA 1SCWA 3ZCZA 4Q0HA 3PBRA 4MBFA 2EX9A 3C7VA 4Y3IA 2MJ6A 3LR5A 4HY8A 4KZ5A 3IHAA 2WKHA 3TJZC 1P9WA 2ZBBA 3UE6A 1K38A 2VGLS 4WMCD 1LI9A 3IX3A 5FAPA 4BBVA 1RP5A 2FFFB 4OPQA 2WGVA 3VSKA 3IH8A 3ZQ5A 5FASA 4ME4A 1PW1A 3CUEA 4F94A 5I94A 1JWPA 2Y2QA 4GD6A 3D9YA 3HCYA 4BMWA 5EV0A 4NXGA 4P6ZM 1JNUA 2J3TD 4JF4A 3VP0A 3NBLA 2Y55A 2EA9A 4C3QA 4N1HA 3T1QB 1CQAA 5HAQA 4OP5A 3DTMA 2V20A 1EI5A 2IA2A 2J9OA 4P87A 5DJTA 2O9BA 4E3JA 2K7SA 2O9CA 1S6RA 5FQ9A 4DE3A 1ZKJA 4MCWA 4IHQA 1YLZA 3NULA 1FCOA 2JBFA 2WZXA 5F6AA 5EVIA 1DJCA 2UV0E 4KQOA 2HDQA 1XFQA 4HHDA 4HH3A 3E4PA 3F1OB 2YKFA 1TEMA 3C38A 3IF6B 4OPRA 1L2SA 1WYBA 3B42A 5HD5A 2PD7A 2Y2GA 2PU4A 1ALQA 1OT9A 4S2IA 1JWVA 1NZUA 3N7WA 4Q0JA 4LV0A 4ZDXA 2WGWB 1S1ZA 1KE4A 3GVBA 3V5MA 1ONGA 4R4SA 4KZ3A 4JKTA 5DTKA 4D60A 3UPOA 3CAXA 2EFUA 4Z1WA 2XD5A 5L09A 1KOUA 1BLSA 4S2MA 2A49A 2PYPA 4CLCA 2CC1A 1K54A 1NLYA 4OPZA 2O99A 4OKPA 4WF0A 2Y2JA 5EVEA 3ZFZA 1E4DA 2JKRI 1FSYA 3QP5A 2W1TA 1NYYA 1T1CA 4GOGA 1W8YA 3T4JA 4IUKA 3VOYA 4LRZE 3DBAA 2PR5A 1OMEA 4N9KA 2VK3A 3HUNA 1STZA 1GHPA 4MN7A 4Y7PA 3HLEA 1MWSA 4WM9A 3S7NA 4ZJ2A 4GDNA 2JKRM 1OTDA 1C3BA 1OJ5A 3FKVA 3S22A 2BASA 3G32A 3LIFA 2OLVA 3R7WB 1L0DA 1TDGA 2ZL1B 3ZNYA 3O5YA 3LEQA 4X53A 1HD8A 3LICA 3NC8A 3G4PA 3P7NA 2D02A 5J7EA 5F5YA 5F69A 4FTXA 4GHIB 1DJBA 3OC2A 4M4XA 2Y2HA 3MBZA 4EXOA 3BFFA 1LL5A 1NLZA 3EQUA 4PKYA 1BLHA 4R23A 1SZVA 4MNRA 1FQGA 5DKLA 2Y59A 2EWWA 3NHQA 5CTNA 4CLCC 4EEUA 2B5RA 1K54C 4GKUA 1LI0A 3KYEA 2Z2MB 3PBOA 2XROA 3SH9A 3H7WA 4PMAA 1DP9A 4EEPA 4WN5A 2OLUA 1ESIA 2M7VA 3VMAA 2HP9A 3ZVTA 2BLSA 2GDNA 4EBNA 4QJGA 3C8CA 2ZM2A 5LBRA 1NXYA 1MPLA 5DF7A 3IS2A 5E2EA 4JGQA 3LIDA 1BYWA 1UGUA 3BQ8A 3HJKA 2EXBA 3E98A 3BFDA 2ZQ8A 4BWIA 3HL9A 2I9VA 1OTIA 2EX2A 2B02A 1P0ZA 1SDNA 2GJ3A 3EQVA 4KG6A 4U0TA 4I3JA 1KVMA 1VHMA 4QU3A 2K2NA 4EQIA 2DMWA 1OTBA 3BEBA 2OWHA 4BJPA 2ZC6B 2HDRA 1EWZA 1CI8A 1VETA 2G7UA 2WKQA 1NJ4A 3JVVA 1PZOA 3MQQA 3VP2A 1J9MA 4G3WA 4PM9A 3EOIA 2WYXA 1TF1A 3UPPA 1MWRA 4ZJ1A 1ESUA 3EGXC 3NOPC 4OH0A 1LT0A 2V8CA 4DE1A 3LUQA 1Y54A 1FCNA 1WYCA 2QJ7A 5E43A 2JHEA 5CHJA 4OPYA 5DF9A 4EU0A 1GA0A 4M3KA 4NXFA 3HLGA 3ZYTA 3LFVA 5AVEA 1SHVA 2G2WA 4CLCB 4GCZA 1XGJA 3UE3A 1NRFA 3UB8A 1S67L 1I5QA 3IWQA 2W1TB 3K2NA 4KUKA 1H0MA 2Y2NA 4WUJA 1YLWA 5G18A 1G28A 2PHYA 3KX0X 2HDSA 5FAOA 3K3DA 3PAGA 5DFYA 1TDLA 4GW9A 5HL1A 5HSQA 3WS0A 3A3FA 1XXMA 2ZMVA 4I39A 5CTMA 4HI4A 4IUHA 1ODVA 4JGOA 4BBUA 4DRTA 4HEFA 3IXDA 1YM1A 2QYBA 2EX6A 5FL3A 1W7FA 3G34A 2WKPA 1W79A 3T50A 3C7UA 5KSHA 2VX8A 1X0OA 4KZ4A 1XJ6A 4ZRRA 1GSXA 3SH7A 3SH8A 2H0YA 4NK3A 4D2OA 1I2WA 1TD5A 4DN0A 3TRCA 4GZBA 2W3EA 1GSWA 1TVFA 3T1RA 3MZEA 1N9BA 1D7EA 3H9WA 5HFOA 3QP4A 5A93A 3N8SA 1LSVA 3WRZA 3BLMA 3OBFA 4S2JA 3BM6A 5KIZA 5GL9A 2NUTC 1VEUA 1NWZA 3DAVA 5FI6A 2H5SA 4HNBA 2OOLA 4B4ZA 5HARA 3NDEA 4PPRA 5FQQA 1KE0A 4JXGA 3MS6A 3BW6A 3A0VA 3FKWA 3IBJA 4R3AA 1YQSA 3M6HA 2ZL1A 4OQ0A 3P01A 3H7WB 2XA7M 3C2WA 3D3OA 1PW8A 2BTFP 4NKPA 3QNBA 2XK1A 5TFQA 3IXGA 4MN6A 2VKSA 2Y79A 1GHIA
chains in the Genus database with same CATH topology
3C38A 2L1MA 3UMDA 4KQDA 3B42A 5HD5A 2PD7A 4OOLA 5HDSA 4EETB 1MZUA 2W3GA 1OT9A 2VA0A 4R6LA 3VE3A 4YNRA 4Q0JA 3IS2B 2O9AA 3H82A 5C5KA 1S1ZA 3RTYA 4PAUA 2K31A 1TS0A 4EW7A 3EWKA 3PBNA 4RQ9A 5IS1A 3HJIA 4DJ2A 2GZAA 4DMZA 4HOIA 3CAXA 4EESA 3K3CA 4IJGA 4JGPA 4Z1WA 1KOUA 3FPWA 4ETXA 2KLIA 4H6JB 4KUOA 2PYPA 2HJ9C 4CLCA 4XT2A 2VEAA 5DKKA 1NLYA 3KSGA 3R4KA 3UB7A 2O99A 4E04A 4LRYC 3UMEA 2A2LA 2H28A 4WF0A 2OWJA 4UQIS 2QHKA 2JKRI 2GX5A 5K5BA 3GECA 2W1TA 2J3WA 1D06A 2HJEA 2QWSA 3T4TA 2XSSA 4F3LB 2OAQ1 4WELA 1T1CA 3T4JA 4IUKA 4LRZE 4HP9A 3RFBA 3DBAA 2PR5A 1F9IA 1VB6A 5DFXA 3NJAA 1STZA 3KSFA 3SW1A 5MC7A 3T4SA 4MN7A 2V0WA 3S7NA 4YWZA 2J80A 2JKRM 1OTDA 1OJ5A 3BY9A 5I5LA 2BASA 3MF0A 3ICYA 3MMHA 1TS6A 1IFQA 3LIFA 4MMNA 3R7WB 4GS9A 1DP8A 3O5YA 3F1PA 4G3VA 4G3KA 3ULFA 3LICA 1GSVA 3P7NA 1V9ZA 2D02A 3PR6A 5J7EA 5F5YA 3KSIA 2VV6A 5F69A 4GHIB 1S4RA 3KYZA 2PT7A 4MDZA 2EWVA 3UB6A 4HJ3A 3JVUA 3LIEA 4CLCD 3OC2A 3T4QA 4UQIM 4M4XA 4CQHA 2NUPC 4EXOA 3CI6A 3E0YA 1NLZA 3EQUA 3PHYA 1OPXA 4OOMA 4PKYA 2Y8HA 3PXPA 1V9YA 1OJGA 4II7A 4R38A 5DKLA 3T4LA 2O0YA 4ARZB 3LR4A 4EQ1A 1XJ3A 1F5MA 1UWPX 2EWWA 2JN7A 4I5SA 3NHQA 4CLCC 4WLAA 4JGRA 4EEUA 4ETZA 5AVFA 3F1NA 5HDCA 2FH5A 2A24A 3MQ0A 1P9RA 2Z6CA 3B33A 2P08A 3PBOA 2XROA 3KO6A 3H7WA 1LL8A 1OT6A 4CLCE 1DP9A 3UB9A 3OLOA 3E4OA 1DRMA 4EEPA 3NOUC 4WN5A 2FZ0A 2PYRA 2PR6A 1H3QA 2W3FA 2M7VA 3F1OA 1YKDA 3A0SA 1EW0A 1N9LA 1XFNA 3S7OA 3VV4A 2VZWA 5EFWA 4HP4A 3C8CA 2XRNA 1T18A 5LBRA 2KX6A 2YKHA 4GLQA 3E4QA 1W63M 5IT5A 1P97A 4L9FA 3V67A 3IS2A 4JGQA 2OAP1 3LIDA 2GNXA 4QPRA 3S7PA 1BYWA 1H8MA 5TJJA 1UGUA 2W0NA 3BQ8A 4WEKA 3HJKA 5L8MA 4I38A 1T1AA 4O8GA 1N9NA 1XJ2A 2P04A 1OTAA 3E98A 4I3IA 4NEED 1S66L 4FOFA 3LYXA 5F68A 4GJ4A 3LR0A 2W3HA 4BWIA 3OCLA 3G6OA 5J3WA 2I9VA 1OTIA 4HIAA 4EUVA 2QJ5A 2B02A 1P0ZA 2GJ3A 3BQAA 1TS7A 1UWNX 1T1BA 4R70A 3EQVA 3RH8B 2Z6DA 2WKRA 4I3JA 1ZHHB 1VHMA 5TBMB 4FSFA 2VLGA 4O0PA 3PBSA 5HL6A 5HPFA 2K2NA 2ZOHA 4I3AA 3A0RA 3B47A 4K08A 3PYPA 1LSWA 2DMWA 4F3LA 1OTBA 2LB5A 2HV1A 2ZMFA 2OWHA 4BJPA 2VJWA 4L0LA 4DJ3A 4Q0IA 3W2ZA 1OTEA 3CWFA 3D72A 4EERA 1MC0A 2KDKA 4HJ6A 2W3DA 3OCNA 2G7UA 2QKPA 2WKQA 1S1YA 4NXEA 3JVVA 3MQQA 2CMNA 2PDRA 1IOUA 1N9OA 4G3WA 3EOIA 4BBTA 1TF1A 2P7JA 4B93A 2HF6A 2V0UA 3EGXC 1F98A 3LI9A 3NOPC 1T19A 4PHTA 5HWTA 1LT0A 3OOVA 5J4EA 1LSXA 3R7WA 3F1NB 3LUQA 3H82B 5HD3A 5IU1A 2HGVA 4AFIA 3FPVA 3LIBA 2QJ7A 3MJQA 5CX7A 3U2AA 2JHEA 3T4KA 3BWLA 1MKMA 5DF9A 3PBTA 3CITA 4EU0A 4P6ZS 1YSQA 3ZYTA 4L9EA 4NXFA 4GHIA 3LFVA 4UEYA 3MR0A 5AVEA 4CLCB 4XT2B 3TW8A 3GDIA 2V1BA 3FG8A 3VE4A 4GCZA 4LLOB 4L9GA 2ZOIA 4O01A 3UE3A 3UB8A 3EEHA 1S67L 3FC7A 2M1CA 3KYQA 2W1TB 2LB9A 3K2NA 2KOIA 4KUKA 4WUJA 1G28A 2PHYA 4ARZA 5HWVA 3KX0X 5HWWA 2D01A 5HZHA 4HQAA 3K3DA 1ZTUA 2W27A 5DFYA 4GW9A 5HSQA 4Q0HA 3S7QA 1Y28A 3PBRA 1W63Q 4Y2FA 3EGDC 2ZMVA 1YAXA 4I39A 5HPIA 4Y3IA 4HI4A 4IUHA 2MJ6A 1ODVA 4JGOA 3LR5A 4BBUA 4HY8A 2QYBA 5FL3A 3CUEC 3TJZC 1P9WA 2XA7S 2WKPA 2ZBBA 3T50A 5KSHA 1TS8A 5HDDA 5DJUA 3UE6A 2VX8A 2VGLS 2M7UA 4H6JA 1X0OA 1XJ4A 1XJ6A 2R78A 2V9AA 4ZRRA 5G4ZA 1GSXA 4BBVA 2JKTI 3MXQA 5A8BA 2V1AA 4B9OA 3TE8A 4GS9B 3ZQ5A 3C30A 4ME4A 3F1PB 1TD5A 3LIAA 3CUEA 4DN0A 4WEJA 3TRCA 1S4SA 2W3EA 3HCYA 1GSWA 4YOFA 4BMWA 4MN5A 3LI8A 4NXGA 4P6ZM 1JNUA 3KSHA 2L4RA 1WA9A 2J3TD 3PBQA 3BJNA 1D7EA 3H9WA 3VOLA 1LSVA 5AJGA 3EEAA 3OBFA 2EA9A 3LR3A 4Y5FA 5KIZA 1NRJA 4HJ4A 3BY8A 4LPZA 4NXBA 2NUTC 1NWZA 4HNBA 2IA2A 2JKTM 2OOLA 5DJTA 2O9BA 2W1RA 2K7SA 2VV7A 1DP6A 3NOTC 2O9CA 5TBMA 2PD8A 2J3TC 2VV8A 2B18A 3CLOA 3MFXA 3BW6A 3T4OA 1YSPA 3A0VA 3IBJA 4HH2A 4IHQA 4MCWA 4R3AA 3IBRA 2A24B 5G4YA 5F6AA 3P01A 2L0WA 3H7WB 2XA7M 3C2WA 3D3OA 4PKYG 4NKPA 4KQOA 4WL9A 2VGLM 1XFQA 1G6OA 4HHDA 4LRXC 4MN6A 4HH3A 3E4PA 2VKSA 3F1OB 3MQOA 2YKFA 2Y79A 2INWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLC A;  4CLC B;  3FPW A;  4CLC D;  4CLC E;  5CX7 A;  4NKP A;  3FPV A;  4CLC C;  4BMW A;  2A2L A; 
#chains in the Genus database with same CATH topology
 4KQD A;  4OOL A;  4UHU A;  5EOO A;  2PBD P;  4EET B;  1MZU A;  4R4R A;  2W3G A;  4OQG A;  3IS2 B;  2O9A A;  1IYQ A;  3DTI A;  2JKF A;  3H82 A;  4X1L A;  5CGS A;  4UA9 A;  5C5K A;  4PAU A;  2K31 A;  1TS0 A;  4EW7 A;  3LO7 A;  5FI7 A;  3WS5 A;  4DMZ A;  4S2K A;  2GZA A;  3HUO A;  5A90 A;  2J7V A;  4IJG A;  4PM6 A;  3FPW A;  2KLI A;  2ZQD A;  3NY4 A;  3ZG7 B;  3G2Z A;  3OZH A;  3Q7V A;  4WYY A;  5DKK A;  4BQM A;  3KSG A;  3NI9 A;  3R4K A;  4E3K A;  3IXH A;  4E04 A;  3UME A;  1YMX A;  2IWC A;  3VP3 A;  3GMW A;  1YMS A;  4E3L A;  4OON A;  5K5B A;  2J3W A;  1D06 A;  2HJE A;  4DDY A;  2QWS A;  1VQQ A;  4OLD A;  3SZT A;  2DNS A;  1F9I A;  1ERM A;  1VET B;  2HP5 A;  4OOY A;  5DFX A;  4S2O A;  3NJA A;  3C5A A;  3BLS A;  4S2N A;  2ZD8 A;  5MC7 A;  1CK3 A;  3T1S A;  1CEF A;  2XFT A;  4LCM A;  2Y2O A;  3MKF A;  3BY9 A;  3ZG5 A;  4KG5 A;  1TS6 A;  1IFQ A;  4MMN A;  2ZQ9 A;  2IWD A;  4UA6 A;  1AXB A;  3G2Y A;  4P85 A;  3F1P A;  2J9P A;  1IYS A;  3FWL A;  3ULF A;  1GSV A;  3V3R A;  4KZ8 A;  3LY3 A;  3I7J A;  4HJ3 A;  3JVU A;  4LV1 A;  4UQI M;  4XUX A;  2NUP C;  3HLC A;  5M18 A;  2C5W B;  1L3L A;  3UDX A;  2BG1 A;  3E0Y A;  4BEN A;  4C75 A;  1V9Y A;  2R9W A;  2H0T A;  1ZG4 A;  4II7 A;  1K56 D;  4R38 A;  5FI2 A;  1F5M A;  1UWP X;  2JN7 A;  4I5S A;  4IBX A;  4ETZ A;  1N4O A;  1G68 A;  3P09 A;  1P9R A;  4K0X A;  5FQI A;  2P08 A;  3N4I A;  3KO6 A;  2XQZ A;  1LL8 A;  4NET A;  4CLC E;  3UB9 A;  3V50 A;  1QMF A;  2PYR A;  1H3Q A;  4FUW A;  2Y2M A;  3MZF A;  2X02 A;  2WAE A;  5CXW A;  1XFN A;  3CMZ A;  1G5U A;  3S7O A;  4X1M A;  4HP4 A;  2XRN A;  1T18 A;  1BZA A;  1CI9 A;  3T1X A;  2H10 A;  5D3O A;  3O3V A;  1W63 M;  3RXW A;  4HBT A;  3V67 A;  4S2N C;  1XA1 A;  1KGF A;  4QPR A;  3S7P A;  1YPR A;  1NY0 A;  5FQJ A;  2OV5 A;  5L8M A;  1T1A A;  4ID4 A;  4O8G A;  5FAT A;  2P04 A;  4I3I A;  3ITB A;  4X55 A;  1QME A;  3W4Q A;  1VEU B;  2W3H A;  3G6O A;  2QJ5 A;  1TS7 A;  3RH8 B;  1XP4 A;  4EWF A;  3OPL A;  3WS2 A;  4FSF A;  2VLG A;  3JPU A;  3BEC A;  1IYO A;  4I3A A;  3A0R A;  3B47 A;  4F3L A;  2WGI A;  2ZMF A;  4QB8 A;  3UB5 P;  1FR1 A;  2VJW A;  3SS5 A;  1CEG A;  2KDK A;  4X56 A;  1PI5 A;  4HJ6 A;  3OCN A;  1MXO A;  5EUA A;  1S1Y A;  1L0G A;  4E3O A;  3ISG A;  4Y15 A;  1NZO A;  3SOI A;  2B95 A;  4BBT A;  2P7J A;  1H8Z A;  4B93 A;  1KGG A;  2HF6 A;  4WMC A;  1H8Y A;  3DTK A;  4P6B A;  4HBU A;  5HWT A;  5J4E A;  3H82 B;  4OQI A;  3CPT A;  5IU1 A;  4AFI A;  1ONH A;  3MJQ A;  1A0K A;  3T4K A;  4PM5 A;  1MKM A;  1LHY A;  4EV4 A;  3CIT A;  4K0W A;  4P6Z S;  4ZJ3 A;  1SDE A;  4UEY A;  3Q7V B;  1YT4 A;  4DE0 A;  3VE4 A;  2E8J A;  4MBK A;  4L9G A;  4O01 A;  3MXS A;  2M1C A;  2XEP A;  5HAI A;  4JLF A;  5CER A;  2WUQ A;  2LB9 A;  5F1F A;  5A92 A;  4JF6 A;  4K91 A;  3FV7 A;  1PWC A;  4KG2 A;  4KZ9 A;  5HWW A;  5HWV A;  5HZH A;  1ZTU A;  3GSG A;  5E2H A;  1Y28 A;  4LV3 A;  3RJU A;  3RXX A;  1W63 Q;  3EGD C;  4N1X A;  3MFD A;  2HDU A;  1JTD A;  1PZP A;  1O7E A;  4ZAM A;  4UA7 A;  4PM7 A;  1HZO A;  1TS8 A;  5HDD A;  5DJU A;  5M1A A;  2M7U A;  1RGY A;  2HPB A;  3GRJ A;  2RCX A;  2JKT I;  5FEG A;  3MXQ A;  5A8B A;  3UDF A;  4B9O A;  3MXR A;  4Y0U A;  3HLW A;  3C30 A;  3F1P B;  3LIA A;  3QP2 A;  5EE8 A;  4YOF A;  4E6W A;  2L4R A;  3PBQ A;  3WS1 A;  5AQ9 A;  1E3U D;  1O07 A;  3BJN A;  3IT9 A;  5GLA A;  1S0W A;  1PWG A;  4QWO A;  4YFM A;  1CF0 A;  4MEZ A;  4HJ4 A;  3BY8 A;  4NXB A;  1Z09 A;  3QHY A;  5FDS A;  2JE5 A;  1Q2Q A;  2JKT M;  4KEN B;  3UN7 A;  2W1R A;  1XPB A;  1DP6 A;  3NOT C;  2J3T C;  2B18 A;  3CLO A;  3UPN A;  4A5R A;  2ZM8 A;  4UAA A;  3WS4 A;  3CJM A;  4HH2 A;  5F1G A;  1I2S A;  4DF6 A;  1Q2P A;  1PNE A;  2L0W A;  4PKY G;  4RA7 A;  1YLJ A;  4LV2 A;  2VGL M;  3MQO A;  2HP6 A;  2INW A;  4LGW A;  1E25 A;  2L1M A;  1XGI A;  5HDS A;  5L10 A;  2VA0 A;  2ZC3 B;  5EPH A;  5FA7 A;  4Y17 A;  3UDI A;  3RTY A;  3EWK A;  4X25 A;  5IS1 A;  3HJI A;  2XDM A;  2C6W B;  3Q82 A;  4HOI A;  4EES A;  1LL9 A;  2ACG A;  2EXA A;  1DJA A;  4ETX A;  4H6J B;  2HJ9 C;  1KDS A;  3UB7 A;  1K55 C;  1WE4 A;  4S2P A;  3QNC A;  2H28 A;  1KDW A;  2OWJ A;  2V2F F;  2ZJ9 A;  3GR2 A;  3W4P A;  4RVA A;  2OSU A;  4F3L B;  2XSS A;  2OAQ 1;  4KZA A;  2V1Z A;  3RFB A;  5EVI D;  3G31 A;  3HLD A;  4B4X A;  4C6Y A;  5FQM A;  2PRF A;  3G30 A;  3KSF A;  5AQ7 A;  5CEC A;  2AVX A;  4LFU A;  5U47 A;  3GTC A;  2V0W A;  4E3M A;  5L07 A;  1GHM A;  5DF8 A;  1U60 A;  2J80 A;  3DWK A;  3GQZ A;  4FD8 A;  5I5L A;  3MF0 A;  2Y2L A;  1YLP A;  3UNW A;  5JYP A;  2P74 A;  2ZMA A;  2PU2 A;  2PBY A;  3CPT B;  4JPM A;  4QD4 A;  4GS9 A;  1F2K A;  5GHX A;  4G3V A;  3TOI A;  2JKG A;  1ERQ A;  1V9Z A;  3PR6 A;  3KSI A;  2VV6 A;  1S4R A;  2PT7 A;  3UB6 A;  3ZDJ A;  1ES4 A;  4CLC D;  5KZH A;  2A3U A;  4FH2 A;  3CI6 A;  3Q07 A;  1BUL A;  1OPX A;  4LCL A;  5DTT A;  3O86 A;  1PRQ A;  3ZVW A;  3LR4 A;  3N8R A;  3UE1 A;  4EQ1 A;  1XJ3 A;  4HES A;  4QY5 A;  4WLA A;  4JGR A;  5AVF A;  1ES3 A;  4RX3 A;  4H8R A;  5HDC A;  2FH5 A;  1AWI A;  2A24 A;  2Y2P A;  3MQ0 A;  4R0Q A;  3GV9 A;  5FAQ A;  3BFC A;  3VP4 A;  1OT6 A;  4OP8 A;  3OLO A;  3E4O A;  1DRM A;  3C4P A;  3NOU C;  2FZ0 A;  3PAE A;  2W3F A;  3IF5 A;  3IX4 A;  1YKD A;  1K4E A;  1EW0 A;  1N9L A;  3IHB A;  5EFW A;  1PFL A;  5GHZ A;  1BLP A;  4Y0O A;  1MWT A;  4U0X A;  4ZBE A;  3VFH A;  3E4Q A;  4DE2 A;  3AGD A;  5IT5 A;  2WAD A;  4L9F A;  2OAP 1;  5A91 A;  4RX2 A;  1H8M A;  5TJJ A;  4WEK A;  1ZG6 A;  4KZ7 A;  3Q1F A;  4N92 A;  3ZHH A;  4XXR A;  2XH9 A;  2Y2I A;  1XJ2 A;  4BL3 A;  1FIK A;  4FOF A;  3BFG A;  2XFS A;  2FFY A;  4GJ4 A;  3LEZ A;  3LR0 A;  2VGJ A;  5J3W A;  4EUV A;  3BQA A;  4MBH A;  3HRE A;  4QHC A;  4R70 A;  5E2F A;  1CJF A;  2JCH A;  2WKR A;  1ZHH B;  2P9V A;  3NEC A;  1BSG A;  4O0P A;  3PBS A;  5HL6 A;  5HPF A;  1K6R A;  5DTS A;  2ZOH A;  2Q0O A;  1HLU P;  2WAF A;  3PYP A;  1ES2 A;  3PTE A;  4KZB A;  3V3S A;  5GLD A;  4BD1 A;  2ZQA A;  5GLB A;  4Q0I A;  5EEC A;  3UY6 A;  3S4X A;  1LLB A;  3D72 A;  4EER A;  1MC0 A;  3MSH A;  2ZC7 A;  2W3D A;  1L0E A;  2DRW A;  4JBF A;  4EUZ A;  3TG9 A;  1JVJ A;  2CMN A;  2PDR A;  4GD8 A;  1PI4 A;  1N9O A;  4CJN A;  4QY6 A;  1M6K A;  2RL3 A;  2G2U A;  2V0U A;  2HZ5 A;  1F98 A;  3VSL A;  1T19 A;  3ZG9 B;  2R9X A;  1LSX A;  4IBR A;  4JF5 A;  3F1N B;  5F83 A;  5HD3 A;  1RGZ A;  3VOZ A;  2HGV A;  4BLM A;  5CX7 A;  3U2A A;  3ZGA B;  4Y0T A;  3PBT A;  1ES5 A;  4OQH A;  1YSQ A;  1RCJ A;  3IXB A;  3MR0 A;  3T12 B;  1MWU A;  3TW8 A;  3GDI A;  2IWB A;  2JC7 A;  1DY6 A;  3HLF A;  2Q9M A;  4LLO B;  2XGN A;  2ZOI A;  2XF3 A;  3FC7 A;  4OLG A;  3KYQ A;  3CG5 A;  2ZC5 B;  3ZG8 B;  4IVI A;  2KOI A;  5J8X A;  3DW0 A;  1G6A A;  5EM0 A;  4ARZ A;  5HX9 A;  4HQA A;  2W27 A;  4GDB A;  3S7Q A;  1JTG A;  4Y2F A;  1BUE A;  1YAX A;  5HPI A;  1YLY A;  3CUE C;  4EBP A;  4E6X A;  2DCF A;  2XA7 S;  3HLB A;  5F82 A;  3G35 A;  1Y4O A;  4H6J A;  1XJ4 A;  2R78 A;  2V9A A;  2EX8 A;  5G4Z A;  4WZ4 A;  4GN2 A;  2V1A A;  1XA7 A;  5AQB A;  3TE8 A;  4GS9 B;  4WEJ A;  1S4S A;  3HUM A;  4MN5 A;  3LI8 A;  5M19 A;  5E2G A;  3KSH A;  1WA9 A;  1IYP A;  3VOL A;  5AJG A;  3EEA A;  4Y5F A;  3LR3 A;  1PYY A;  2WZZ A;  4S2L A;  4KQQ A;  1NRJ A;  5TGF A;  4LPZ A;  3FYZ A;  1D1J A;  3OPH A;  4DXC A;  3N6I A;  1MY8 A;  5EVI C;  2Y4A A;  3Q7Z A;  4X68 A;  2QMI A;  3JYI A;  2VV7 A;  1YLT A;  5TBM A;  2PD8 A;  2VV8 A;  3SS3 A;  1PWD A;  3LCE A;  3MFX A;  4Z9Q A;  3M2K A;  3OPP A;  3T4O A;  1YSP A;  2I72 A;  3IBR A;  3W8K A;  2A24 B;  5G4Y A;  3MKE A;  3IH9 A;  3L7H A;  5L2F A;  4WZ5 A;  4WL9 A;  4E3N A;  5EVL A;  1G6O A;  4LRX C;  1ERO A;  1L0F A;  3C4O A;  4L0L A;  3FZC A;  3UMD A;  2ZLY A;  1MKI A;  3IQA A;  3V39 A;  2E8I A;  1JWZ A;  3O88 A;  4JXS A;  4R6L A;  3VE3 A;  4YNR A;  3O87 A;  2J8Y A;  3D4F A;  4DDS A;  3BYD A;  1NYM A;  2Y91 A;  3DWZ A;  5CED A;  3LY4 A;  3PBN A;  4RQ9 A;  4DJ2 A;  1FSW A;  4R3B A;  3K3C A;  4JGP A;  1SKO A;  3WRT A;  4ESP A;  4KUO A;  5CHM A;  3U4L P;  4XT2 A;  2VEA A;  1XKZ A;  3NIA A;  4LRY C;  2A2L A;  4B88 A;  4UQI S;  2QHK A;  5FDH A;  5KSC A;  1KVL A;  2P9V B;  3SS4 A;  5GLC A;  5FEF A;  2QPN A;  2GX5 A;  3LGO A;  3GEC A;  4N9L A;  1K56 A;  4CPK A;  5CGX A;  1IKI A;  3T4T A;  4WEL A;  2WKI A;  1HTZ A;  4JXV A;  3CHW P;  5CEB A;  1K55 A;  4HP9 A;  4JXW A;  5CGW A;  1VB6 A;  3BRM A;  1BLC A;  3M2J A;  2ZM0 A;  3SW1 A;  3T4S A;  1K57 A;  1K6S A;  1W8Q A;  4YWZ A;  1M40 A;  3ICY A;  3MMH A;  3CZD A;  2QZ6 A;  3M6B A;  1DP8 A;  4X6T A;  4WZ5 C;  3A3D A;  5EVI B;  1KE3 A;  4G3K A;  1BTL A;  4PM8 A;  5BOH A;  3IWO A;  3VP1 A;  3KYZ A;  4MDZ A;  2EWV A;  5GHY A;  3QP6 A;  3LIE A;  4R1G A;  3T4Q A;  4CQH A;  4X69 A;  1ACF A;  2WK0 A;  3L9K A;  4IVK A;  1KGE A;  3PHY A;  4OOM A;  2Y8H A;  3PXP A;  1OJG A;  3T4L A;  2O0Y A;  4ARZ B;  4BL2 A;  2Q9N A;  3A3J A;  3TSG A;  4LEN A;  3F1N A;  3E2K A;  3B33 A;  2Z6C A;  1FR6 A;  3WWX A;  3N8L A;  3QP8 A;  1GCE A;  4KZ6 A;  3S1Y A;  4DKI A;  2PR6 A;  3NDG A;  2EFX A;  3AGE A;  3F1O A;  4Y13 A;  3A0S A;  3BFE A;  2XD1 A;  5JYO A;  3IF6 A;  3VV4 A;  2VZW A;  3IX8 A;  4EBL A;  1W5D A;  2X71 A;  1H5X A;  2KX6 A;  2YKH A;  3ZNT A;  2XR0 A;  4GLQ A;  1FCM A;  1GA9 A;  1P97 A;  2Z2L B;  1XX2 A;  4U3T A;  2WGW A;  2ZC4 B;  4KQR A;  5FQK A;  2GNX A;  2W0N A;  3UO9 A;  4ZTK A;  1K57 C;  2UWX A;  4IED A;  4I38 A;  4O7D A;  1N9N A;  1SKF A;  3AGF A;  3E2L A;  1OTA A;  1IEL A;  4NEE D;  1S66 L;  3HVF A;  3LYX A;  1K0K A;  3P98 A;  5F68 A;  1MBL A;  3HBR A;  1FOF A;  3OCL A;  4HIA A;  3DTE A;  5CHU A;  1UWN X;  1T1B A;  3A3E A;  3IWI A;  2Z6D A;  1FIL A;  5TBM B;  4YIN A;  1PIO A;  3Q81 A;  4P0M A;  5EM1 A;  4DXB A;  1ZC2 A;  4K08 A;  1LSW A;  2LB5 A;  2HV1 A;  5KMW A;  2ZQ7 A;  3B3X A;  4NG2 A;  3W2Z A;  1OTE A;  4DJ3 A;  5AQA A;  5HAP A;  3CWF A;  2V8F A;  2VGK A;  3QP1 A;  2QKP A;  4NXE A;  4XUZ A;  3UE0 A;  1IKG A;  1IEM A;  4MLL A;  1IOU A;  5IHV A;  4Q8I A;  5TR7 A;  4R3J A;  2ZQC A;  3NCK A;  3LI9 A;  2XLN A;  5CRF A;  4PHT A;  3OPR A;  3OOV A;  4OVD A;  2Y2K A;  2WKE A;  3R7W A;  4E3I A;  4WBG A;  3ITA A;  3FPV A;  3LIB A;  3ZG0 A;  2X01 A;  4FH4 A;  3BWL A;  4RYE A;  1K25 A;  1E3U A;  3IF6 C;  1SKO B;  4BD0 A;  4GNU A;  4L9E A;  4GHI A;  1HVB A;  4FCF A;  1BT5 A;  4XT2 B;  2PAV P;  1K4F A;  3VFF A;  2V1B A;  3FG8 A;  1VM1 A;  3EEH A;  3MZD A;  4GB7 A;  5HW3 A;  3W4O A;  3A3I A;  5FSR A;  1J3W A;  1Z6F A;  5DVA A;  2D01 A;  5EOE A;  1SCW A;  3ZCZ A;  4Q0H A;  3PBR A;  4MBF A;  2EX9 A;  3C7V A;  4Y3I A;  2MJ6 A;  3LR5 A;  4HY8 A;  4KZ5 A;  3IHA A;  2WKH A;  3TJZ C;  1P9W A;  2ZBB A;  3UE6 A;  1K38 A;  2VGL S;  4WMC D;  1LI9 A;  3IX3 A;  5FAP A;  4BBV A;  1RP5 A;  2FFF B;  4OPQ A;  2WGV A;  3VSK A;  3IH8 A;  3ZQ5 A;  5FAS A;  4ME4 A;  1PW1 A;  3CUE A;  4F94 A;  5I94 A;  1JWP A;  2Y2Q A;  4GD6 A;  3D9Y A;  3HCY A;  4BMW A;  5EV0 A;  4NXG A;  4P6Z M;  1JNU A;  2J3T D;  4JF4 A;  3VP0 A;  3NBL A;  2Y55 A;  2EA9 A;  4C3Q A;  4N1H A;  3T1Q B;  1CQA A;  5HAQ A;  4OP5 A;  3DTM A;  2V20 A;  1EI5 A;  2IA2 A;  2J9O A;  4P87 A;  5DJT A;  2O9B A;  4E3J A;  2K7S A;  2O9C A;  1S6R A;  5FQ9 A;  4DE3 A;  1ZKJ A;  4MCW A;  4IHQ A;  1YLZ A;  3NUL A;  1FCO A;  2JBF A;  2WZX A;  5F6A A;  5EVI A;  1DJC A;  2UV0 E;  4KQO A;  2HDQ A;  1XFQ A;  4HHD A;  4HH3 A;  3E4P A;  3F1O B;  2YKF A;  1TEM A;  3C38 A;  3IF6 B;  4OPR A;  1L2S A;  1WYB A;  3B42 A;  5HD5 A;  2PD7 A;  2Y2G A;  2PU4 A;  1ALQ A;  1OT9 A;  4S2I A;  1JWV A;  1NZU A;  3N7W A;  4Q0J A;  4LV0 A;  4ZDX A;  2WGW B;  1S1Z A;  1KE4 A;  3GVB A;  3V5M A;  1ONG A;  4R4S A;  4KZ3 A;  4JKT A;  5DTK A;  4D60 A;  3UPO A;  3CAX A;  2EFU A;  4Z1W A;  2XD5 A;  5L09 A;  1KOU A;  1BLS A;  4S2M A;  2A49 A;  2PYP A;  4CLC A;  2CC1 A;  1K54 A;  1NLY A;  4OPZ A;  2O99 A;  4OKP A;  4WF0 A;  2Y2J A;  5EVE A;  3ZFZ A;  1E4D A;  2JKR I;  1FSY A;  3QP5 A;  2W1T A;  1NYY A;  1T1C A;  4GOG A;  1W8Y A;  3T4J A;  4IUK A;  3VOY A;  4LRZ E;  3DBA A;  2PR5 A;  1OME A;  4N9K A;  2VK3 A;  3HUN A;  1STZ A;  1GHP A;  4MN7 A;  4Y7P A;  3HLE A;  1MWS A;  4WM9 A;  3S7N A;  4ZJ2 A;  4GDN A;  2JKR M;  1OTD A;  1C3B A;  1OJ5 A;  3FKV A;  3S22 A;  2BAS A;  3G32 A;  3LIF A;  2OLV A;  3R7W B;  1L0D A;  1TDG A;  2ZL1 B;  3ZNY A;  3O5Y A;  3LEQ A;  4X53 A;  1HD8 A;  3LIC A;  3NC8 A;  3G4P A;  3P7N A;  2D02 A;  5J7E A;  5F5Y A;  5F69 A;  4FTX A;  4GHI B;  1DJB A;  3OC2 A;  4M4X A;  2Y2H A;  3MBZ A;  4EXO A;  3BFF A;  1LL5 A;  1NLZ A;  3EQU A;  4PKY A;  1BLH A;  4R23 A;  1SZV A;  4MNR A;  1FQG A;  5DKL A;  2Y59 A;  2EWW A;  3NHQ A;  5CTN A;  4CLC C;  4EEU A;  2B5R A;  1K54 C;  4GKU A;  1LI0 A;  3KYE A;  2Z2M B;  3PBO A;  2XRO A;  3SH9 A;  3H7W A;  4PMA A;  1DP9 A;  4EEP A;  4WN5 A;  2OLU A;  1ESI A;  2M7V A;  3VMA A;  2HP9 A;  3ZVT A;  2BLS A;  2GDN A;  4EBN A;  4QJG A;  3C8C A;  2ZM2 A;  5LBR A;  1NXY A;  1MPL A;  5DF7 A;  3IS2 A;  5E2E A;  4JGQ A;  3LID A;  1BYW A;  1UGU A;  3BQ8 A;  3HJK A;  2EXB A;  3E98 A;  3BFD A;  2ZQ8 A;  4BWI A;  3HL9 A;  2I9V A;  1OTI A;  2EX2 A;  2B02 A;  1P0Z A;  1SDN A;  2GJ3 A;  3EQV A;  4KG6 A;  4U0T A;  4I3J A;  1KVM A;  1VHM A;  4QU3 A;  2K2N A;  4EQI A;  2DMW A;  1OTB A;  3BEB A;  2OWH A;  4BJP A;  2ZC6 B;  2HDR A;  1EWZ A;  1CI8 A;  1VET A;  2G7U A;  2WKQ A;  1NJ4 A;  3JVV A;  1PZO A;  3MQQ A;  3VP2 A;  1J9M A;  4G3W A;  4PM9 A;  3EOI A;  2WYX A;  1TF1 A;  3UPP A;  1MWR A;  4ZJ1 A;  1ESU A;  3EGX C;  3NOP C;  4OH0 A;  1LT0 A;  2V8C A;  4DE1 A;  3LUQ A;  1Y54 A;  1FCN A;  1WYC A;  2QJ7 A;  5E43 A;  2JHE A;  5CHJ A;  4OPY A;  5DF9 A;  4EU0 A;  1GA0 A;  4M3K A;  4NXF A;  3HLG A;  3ZYT A;  3LFV A;  5AVE A;  1SHV A;  2G2W A;  4CLC B;  4GCZ A;  1XGJ A;  3UE3 A;  1NRF A;  3UB8 A;  1S67 L;  1I5Q A;  3IWQ A;  2W1T B;  3K2N A;  4KUK A;  1H0M A;  2Y2N A;  4WUJ A;  1YLW A;  5G18 A;  1G28 A;  2PHY A;  3KX0 X;  2HDS A;  5FAO A;  3K3D A;  3PAG A;  5DFY A;  1TDL A;  4GW9 A;  5HL1 A;  5HSQ A;  3WS0 A;  3A3F A;  1XXM A;  2ZMV A;  4I39 A;  5CTM A;  4HI4 A;  4IUH A;  1ODV A;  4JGO A;  4BBU A;  4DRT A;  4HEF A;  3IXD A;  1YM1 A;  2QYB A;  2EX6 A;  5FL3 A;  1W7F A;  3G34 A;  2WKP A;  1W79 A;  3T50 A;  3C7U A;  5KSH A;  2VX8 A;  1X0O A;  4KZ4 A;  1XJ6 A;  4ZRR A;  1GSX A;  3SH7 A;  3SH8 A;  2H0Y A;  4NK3 A;  4D2O A;  1I2W A;  1TD5 A;  4DN0 A;  3TRC A;  4GZB A;  2W3E A;  1GSW A;  1TVF A;  3T1R A;  3MZE A;  1N9B A;  1D7E A;  3H9W A;  5HFO A;  3QP4 A;  5A93 A;  3N8S A;  1LSV A;  3WRZ A;  3BLM A;  3OBF A;  4S2J A;  3BM6 A;  5KIZ A;  5GL9 A;  2NUT C;  1VEU A;  1NWZ A;  3DAV A;  5FI6 A;  2H5S A;  4HNB A;  2OOL A;  4B4Z A;  5HAR A;  3NDE A;  4PPR A;  5FQQ A;  1KE0 A;  4JXG A;  3MS6 A;  3BW6 A;  3A0V A;  3FKW A;  3IBJ A;  4R3A A;  1YQS A;  3M6H A;  2ZL1 A;  4OQ0 A;  3P01 A;  3H7W B;  2XA7 M;  3C2W A;  3D3O A;  1PW8 A;  2BTF P;  4NKP A;  3QNB A;  2XK1 A;  5TFQ A;  3IXG A;  4MN6 A;  2VKS A;  2Y79 A;  1GHI A; 
#chains in the Genus database with same CATH homology
 3C38 A;  2L1M A;  3UMD A;  4KQD A;  3B42 A;  5HD5 A;  2PD7 A;  4OOL A;  5HDS A;  4EET B;  1MZU A;  2W3G A;  1OT9 A;  2VA0 A;  4R6L A;  3VE3 A;  4YNR A;  4Q0J A;  3IS2 B;  2O9A A;  3H82 A;  5C5K A;  1S1Z A;  3RTY A;  4PAU A;  2K31 A;  1TS0 A;  4EW7 A;  3EWK A;  3PBN A;  4RQ9 A;  5IS1 A;  3HJI A;  4DJ2 A;  2GZA A;  4DMZ A;  4HOI A;  3CAX A;  4EES A;  3K3C A;  4IJG A;  4JGP A;  4Z1W A;  1KOU A;  3FPW A;  4ETX A;  2KLI A;  4H6J B;  4KUO A;  2PYP A;  2HJ9 C;  4CLC A;  4XT2 A;  2VEA A;  5DKK A;  1NLY A;  3KSG A;  3R4K A;  3UB7 A;  2O99 A;  4E04 A;  4LRY C;  3UME A;  2A2L A;  2H28 A;  4WF0 A;  2OWJ A;  4UQI S;  2QHK A;  2JKR I;  2GX5 A;  5K5B A;  3GEC A;  2W1T A;  2J3W A;  1D06 A;  2HJE A;  2QWS A;  3T4T A;  2XSS A;  4F3L B;  2OAQ 1;  4WEL A;  1T1C A;  3T4J A;  4IUK A;  4LRZ E;  4HP9 A;  3RFB A;  3DBA A;  2PR5 A;  1F9I A;  1VB6 A;  5DFX A;  3NJA A;  1STZ A;  3KSF A;  3SW1 A;  5MC7 A;  3T4S A;  4MN7 A;  2V0W A;  3S7N A;  4YWZ A;  2J80 A;  2JKR M;  1OTD A;  1OJ5 A;  3BY9 A;  5I5L A;  2BAS A;  3MF0 A;  3ICY A;  3MMH A;  1TS6 A;  1IFQ A;  3LIF A;  4MMN A;  3R7W B;  4GS9 A;  1DP8 A;  3O5Y A;  3F1P A;  4G3V A;  4G3K A;  3ULF A;  3LIC A;  1GSV A;  3P7N A;  1V9Z A;  2D02 A;  3PR6 A;  5J7E A;  5F5Y A;  3KSI A;  2VV6 A;  5F69 A;  4GHI B;  1S4R A;  3KYZ A;  2PT7 A;  4MDZ A;  2EWV A;  3UB6 A;  4HJ3 A;  3JVU A;  3LIE A;  4CLC D;  3OC2 A;  3T4Q A;  4UQI M;  4M4X A;  4CQH A;  2NUP C;  4EXO A;  3CI6 A;  3E0Y A;  1NLZ A;  3EQU A;  3PHY A;  1OPX A;  4OOM A;  4PKY A;  2Y8H A;  3PXP A;  1V9Y A;  1OJG A;  4II7 A;  4R38 A;  5DKL A;  3T4L A;  2O0Y A;  4ARZ B;  3LR4 A;  4EQ1 A;  1XJ3 A;  1F5M A;  1UWP X;  2EWW A;  2JN7 A;  4I5S A;  3NHQ A;  4CLC C;  4WLA A;  4JGR A;  4EEU A;  4ETZ A;  5AVF A;  3F1N A;  5HDC A;  2FH5 A;  2A24 A;  3MQ0 A;  1P9R A;  2Z6C A;  3B33 A;  2P08 A;  3PBO A;  2XRO A;  3KO6 A;  3H7W A;  1LL8 A;  1OT6 A;  4CLC E;  1DP9 A;  3UB9 A;  3OLO A;  3E4O A;  1DRM A;  4EEP A;  3NOU C;  4WN5 A;  2FZ0 A;  2PYR A;  2PR6 A;  1H3Q A;  2W3F A;  2M7V A;  3F1O A;  1YKD A;  3A0S A;  1EW0 A;  1N9L A;  1XFN A;  3S7O A;  3VV4 A;  2VZW A;  5EFW A;  4HP4 A;  3C8C A;  2XRN A;  1T18 A;  5LBR A;  2KX6 A;  2YKH A;  4GLQ A;  3E4Q A;  1W63 M;  5IT5 A;  1P97 A;  4L9F A;  3V67 A;  3IS2 A;  4JGQ A;  2OAP 1;  3LID A;  2GNX A;  4QPR A;  3S7P A;  1BYW A;  1H8M A;  5TJJ A;  1UGU A;  2W0N A;  3BQ8 A;  4WEK A;  3HJK A;  5L8M A;  4I38 A;  1T1A A;  4O8G A;  1N9N A;  1XJ2 A;  2P04 A;  1OTA A;  3E98 A;  4I3I A;  4NEE D;  1S66 L;  4FOF A;  3LYX A;  5F68 A;  4GJ4 A;  3LR0 A;  2W3H A;  4BWI A;  3OCL A;  3G6O A;  5J3W A;  2I9V A;  1OTI A;  4HIA A;  4EUV A;  2QJ5 A;  2B02 A;  1P0Z A;  2GJ3 A;  3BQA A;  1TS7 A;  1UWN X;  1T1B A;  4R70 A;  3EQV A;  3RH8 B;  2Z6D A;  2WKR A;  4I3J A;  1ZHH B;  1VHM A;  5TBM B;  4FSF A;  2VLG A;  4O0P A;  3PBS A;  5HL6 A;  5HPF A;  2K2N A;  2ZOH A;  4I3A A;  3A0R A;  3B47 A;  4K08 A;  3PYP A;  1LSW A;  2DMW A;  4F3L A;  1OTB A;  2LB5 A;  2HV1 A;  2ZMF A;  2OWH A;  4BJP A;  2VJW A;  4L0L A;  4DJ3 A;  4Q0I A;  3W2Z A;  1OTE A;  3CWF A;  3D72 A;  4EER A;  1MC0 A;  2KDK A;  4HJ6 A;  2W3D A;  3OCN A;  2G7U A;  2QKP A;  2WKQ A;  1S1Y A;  4NXE A;  3JVV A;  3MQQ A;  2CMN A;  2PDR A;  1IOU A;  1N9O A;  4G3W A;  3EOI A;  4BBT A;  1TF1 A;  2P7J A;  4B93 A;  2HF6 A;  2V0U A;  3EGX C;  1F98 A;  3LI9 A;  3NOP C;  1T19 A;  4PHT A;  5HWT A;  1LT0 A;  3OOV A;  5J4E A;  1LSX A;  3R7W A;  3F1N B;  3LUQ A;  3H82 B;  5HD3 A;  5IU1 A;  2HGV A;  4AFI A;  3FPV A;  3LIB A;  2QJ7 A;  3MJQ A;  5CX7 A;  3U2A A;  2JHE A;  3T4K A;  3BWL A;  1MKM A;  5DF9 A;  3PBT A;  3CIT A;  4EU0 A;  4P6Z S;  1YSQ A;  3ZYT A;  4L9E A;  4NXF A;  4GHI A;  3LFV A;  4UEY A;  3MR0 A;  5AVE A;  4CLC B;  4XT2 B;  3TW8 A;  3GDI A;  2V1B A;  3FG8 A;  3VE4 A;  4GCZ A;  4LLO B;  4L9G A;  2ZOI A;  4O01 A;  3UE3 A;  3UB8 A;  3EEH A;  1S67 L;  3FC7 A;  2M1C A;  3KYQ A;  2W1T B;  2LB9 A;  3K2N A;  2KOI A;  4KUK A;  4WUJ A;  1G28 A;  2PHY A;  4ARZ A;  5HWV A;  3KX0 X;  5HWW A;  2D01 A;  5HZH A;  4HQA A;  3K3D A;  1ZTU A;  2W27 A;  5DFY A;  4GW9 A;  5HSQ A;  4Q0H A;  3S7Q A;  1Y28 A;  3PBR A;  1W63 Q;  4Y2F A;  3EGD C;  2ZMV A;  1YAX A;  4I39 A;  5HPI A;  4Y3I A;  4HI4 A;  4IUH A;  2MJ6 A;  1ODV A;  4JGO A;  3LR5 A;  4BBU A;  4HY8 A;  2QYB A;  5FL3 A;  3CUE C;  3TJZ C;  1P9W A;  2XA7 S;  2WKP A;  2ZBB A;  3T50 A;  5KSH A;  1TS8 A;  5HDD A;  5DJU A;  3UE6 A;  2VX8 A;  2VGL S;  2M7U A;  4H6J A;  1X0O A;  1XJ4 A;  1XJ6 A;  2R78 A;  2V9A A;  4ZRR A;  5G4Z A;  1GSX A;  4BBV A;  2JKT I;  3MXQ A;  5A8B A;  2V1A A;  4B9O A;  3TE8 A;  4GS9 B;  3ZQ5 A;  3C30 A;  4ME4 A;  3F1P B;  1TD5 A;  3LIA A;  3CUE A;  4DN0 A;  4WEJ A;  3TRC A;  1S4S A;  2W3E A;  3HCY A;  1GSW A;  4YOF A;  4BMW A;  4MN5 A;  3LI8 A;  4NXG A;  4P6Z M;  1JNU A;  3KSH A;  2L4R A;  1WA9 A;  2J3T D;  3PBQ A;  3BJN A;  1D7E A;  3H9W A;  3VOL A;  1LSV A;  5AJG A;  3EEA A;  3OBF A;  2EA9 A;  3LR3 A;  4Y5F A;  5KIZ A;  1NRJ A;  4HJ4 A;  3BY8 A;  4LPZ A;  4NXB A;  2NUT C;  1NWZ A;  4HNB A;  2IA2 A;  2JKT M;  2OOL A;  5DJT A;  2O9B A;  2W1R A;  2K7S A;  2VV7 A;  1DP6 A;  3NOT C;  2O9C A;  5TBM A;  2PD8 A;  2J3T C;  2VV8 A;  2B18 A;  3CLO A;  3MFX A;  3BW6 A;  3T4O A;  1YSP A;  3A0V A;  3IBJ A;  4HH2 A;  4IHQ A;  4MCW A;  4R3A A;  3IBR A;  2A24 B;  5G4Y A;  5F6A A;  3P01 A;  2L0W A;  3H7W B;  2XA7 M;  3C2W A;  3D3O A;  4PKY G;  4NKP A;  4KQO A;  4WL9 A;  2VGL M;  1XFQ A;  1G6O A;  4HHD A;  4LRX C;  4MN6 A;  4HH3 A;  3E4P A;  2VKS A;  3F1O B;  3MQO A;  2YKF A;  2Y79 A;  2INW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...