3IX3A

Lasr-oc12 hsl complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
163
structure length
163
Chain Sequence
FLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLSVEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional activator protein lasR
publication title LasR-OC12 HSL complex
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
total genus 57
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3ix3A00
3IX4A 4Y17A 3SZTA 3QP8A 3QP6A 3QP1A 3QP5A 4LGWA 3JPUA 4Y15A 4Y13A 2AVXA 5L09A 3QP4A 5L07A 2UV0E 3IX8A 1L3LA 3IX3A 4NG2A 2Q0OA 1H0MA 5L10A 3QP2A 4LFUA
chains in the Genus database with same CATH superfamily
1HLUP 5E2HA 3QP5A 3N7WA 3F1NB 2QJ5A 3PR6A 4JGOA 4RYEA 3ZVTA 5TR7A 4E6XA 3C4OA 1H8YA 1LT0A 4R70A 2A2LA 3A3IA 3NECA 1FQGA 4KQRA 4U0XA 3W2ZA 1FSWA 1BZAA 1CK3A 3TW8A 4HI4A 4D60A 5E43A 4H6JA 1BLCA 3LIFA 4GHIA 4CLCC 4H8RA 3BFDA 3WRTA 1EWZA 4WEKA 2V0WA 4QWOA 3N8RA 2VA0A 2JKRI 2GX5A 4EUZA 2Y2IA 3NDGA 1S1YA 3MZEA 3OPHA 1ZG6A 2ZM8A 3TE8A 3DAVA 1KVMA 2V1AA 4S2JA 1XA1A 2IA2A 5F82A 3IWIA 3Q7VA 1YLJA 4II7A 4S2NA 2HJEA 1C3BA 3T50A 4RX2A 3QP8A 4Z1WA 3LCEA 3HJKA 2OLVA 2ZL1B 3IF6B 3HL9A 2Q9MA 1TDLA 3F1PB 1OTBA 3ZNTA 4LV2A 1RP5A 3D72A 4P85A 3MMHA 1BULA 3WWXA 4WN5A 1FIKA 1LSWA 3IF5A 1GA9A 4I5SA 4C3QA 1P9RA 4GS9A 5EM0A 4OP5A 3RFBA 1NY0A 3PHYA 4BMWA 3PAGA 3S4XA 3V50A 3T1QB 4UQIM 4OOMA 4CQHA 4HQAA 2IWCA 4ZJ3A 3N4IA 4MCWA 3N6IA 5HX9A 2PBDP 3SZTA 5GHXA 2OAQ1 4FH2A 1CJFA 3IQAA 3EGXC 3LEQA 4PAUA 1HTZA 4JXWA 4OPQA 2WGVA 1G68A 5FQMA 3T4SA 2DNSA 3ZG9B 2V9AA 2CMNA 5CEDA 1N9LA 1YLWA 2FZ0A 3BFFA 2Y2JA 4Q8IA 2VGKA 4QJGA 3LFVA 1W8QA 4DXCA 3PBSA 4E3MA 2WZXA 1LL8A 2PD8A 1FR1A 4KZ3A 1JWZA 4PM7A 4S2PA 4WYYA 1HVBA 2JKRM 3UE3A 3LIBA 5IT5A 4M3KA 1TEMA 4HP9A 4F3LA 2PD7A 1DY6A 1CF0A 2G2UA 2J9OA 3FWLA 2VX8A 3AGEA 1IEMA 3L7HA 1V9YA 1H8MA 2WUQA 3U2AA 4OQ0A 2GZAA 4WLAA 3GECA 4H6JB 2XLNA 3QNCA 3DWKA 4R3BA 3HUMA 4GHIB 4S2LA 4HBTA 2E8IA 5MC7A 5FAPA 4QPRA 4NG2A 3RXWA 3CHWP 2PBYA 3HLEA 5TFQA 3NOTC 3VE4A 3NHQA 5AJGA 3OLOA 1DRMA 2P74A 5FI7A 2ZQ7A 2ZMAA 1K0KA 2FH5A 4HP4A 3S7OA 2B95A 4KZ8A 4Y0OA 2I9VA 3DTKA 3UPOA 1PWCA 2XD5A 1IKGA 1H0MA 3Q7VB 1T1BA 4MNRA 5A92A 2FFFB 3LI9A 2X71A 3WS4A 4ZBEA 4X69A 5HDCA 2V1BA 5LBRA 2HF6A 1MKMA 4GB7A 2XA7S 4UHUA 3R4KA 5DF8A 3IX4A 4GS9B 3KO6A 5GLCA 4GJ4A 2ZQCA 1FCMA 1MWUA 2Y2KA 1GA0A 3UNWA 3CPTA 1ZKJA 4X68A 5GHZA 3E0YA 4E6WA 4X1LA 3KYQA 2H10A 5FAOA 4ZAMA 3KYZA 2V8CA 5CTMA 2L0WA 3QHYA 2PDRA 3M6HA 4OQHA 5K5BA 3LGOA 4GLQA 3DW0A 3W4OA 4YINA 2NUPC 2O99A 3BFCA 2OV5A 1E4DA 4LCMA 2KLIA 4KQOA 1ERQA 1L2SA 1YLYA 3O3VA 3LO7A 1SHVA 1W5DA 2YKFA 3RXXA 3GSGA 4FUWA 4OQGA 4S2NC 4YOFA 1MBLA 1NXYA 5A90A 2ZQAA 3CUEC 4BL3A 2HV1A 3T4KA 5CEBA 4ZDXA 3NJAA 2M7VA 1OJGA 5L8MA 1P9WA 5M1AA 3HLGA 2R9XA 3ULFA 3T4OA 2XFTA 2G2WA 1H5XA 2K2NA 1BLPA 2QHKA 2PT7A 3F1NA 3B47A 3A3FA 4IJGA 3ZHHA 2WGIA 1N9NA 2W27A 1I2SA 1XFNA 1GHIA 2DRWA 2X01A 3SOIA 4E3OA 4DDSA 3SH7A 2P9VA 1AWIA 4HBUA 5KIZA 3KSIA 1GSVA 3EGDC 3QP6A 4I38A 5HWWA 4EEUA 3P09A 4FTXA 4EEPA 2J7VA 4I3JA 3N8LA 4MBKA 2R9WA 4OOLA 2Z6DA 4MDZA 5KMWA 5M19A 2A49A 5G4ZA 5HWVA 4RA7A 1X0OA 5DF9A 1XPBA 4IHQA 1YPRA 3M2JA 4XXRA 3ZFZA 5HDSA 3CI6A 3NOUC 2WAFA 3IXBA 4GKUA 3ZCZA 1ES5A 2GDNA 4JPMA 3IXDA 1T1AA 1JNUA 1MKIA 3Q1FA 3W4QA 3HUOA 5DVAA 1VM1A 4Y15A 5EM1A 3A0SA 4IBXA 3KX0X 2Q9NA 3R7WA 1SDNA 1S0WA 3EOIA 1L3LA 3H9WA 1S4RA 3LIDA 4EXOA 2ZOIA 1YAXA 1EROA 2P04A 3MQOA 4KENB 5DTTA 1XX2A 2WKQA 2DCFA 1L0FA 3IT9A 4P87A 5JYPA 2A3UA 3KYEA 1K4FA 2BLSA 5FASA 3CPTB 5TJJA 4XT2B 2JKTI 4WMCD 1ES3A 5A93A 1BLSA 2Z2MB 3FYZA 2Z2LB 3EQUA 5L09A 3AGDA 2RL3A 2NUTC 5HZHA 3LR3A 5D3OA 3EWKA 1W7FA 2D02A 3GDIA 1WYBA 3SS5A 4BBTA 3MXRA 3E4OA 4OPYA 3WS5A 2INWA 1BT5A 1OT9A 4PMAA 5A8BA 3MKEA 1UWPX 2CC1A 1PYYA 2BASA 5EOEA 1G6AA 3ISGA 4ZRRA 3MR0A 1LSVA 4LRXC 1NRFA 4UA7A 2Y2LA 4OP8A 4Y13A 2OSUA 3UPNA 2W1TA 4R3JA 2EFXA 3PTEA 3VOLA 5HAQA 3W4PA 1PFLA 3LICA 3LR0A 2L4RA 3T4TA 2OAP1 3FKVA 2K31A 3ZGAB 2PYRA 2XK1A 5I5LA 4RX3A 3UMEA 1EI5A 1PW1A 3MQQA 1W79A 4PM8A 4I39A 2ZQ9A 2O9AA 1IFQA 3MJQA 2H0TA 2Y2HA 5J3WA 1SDEA 2P9VB 1PRQA 1EW0A 2EFUA 4CJNA 1NYYA 2ZC4B 3IS2A 4QU3A 3D9YA 4MBFA 4Q0JA 1LI9A 1K57A 1OTDA 2H28A 3V67A 4U0TA 4N92A 1VETB 3LYXA 4WZ4A 5GLDA 2XROA 4QY6A 2QYBA 5HPFA 3S22A 3CMZA 1KGGA 3G31A 2W3HA 4N9LA 2HP5A 3PBOA 2VKSA 3HJIA 4MLLA 5DFXA 3IX8A 3GV9A 3BFGA 3UE0A 3JYIA 1L0DA 4ZJ2A 3F1OA 2JKTM 1DP9A 3U4LP 4R23A 2EWVA 2VLGA 4AFIA 3K3CA 4JLFA 4N1XA 1K55A 1MXOA 4ETZA 5JYOA 4Y3IA 1M40A 5HD5A 3R7WB 4HY8A 2J9PA 4DRTA 3WS0A 3G2YA 2QWSA 3WS1A 5HW3A 2QJ7A 5C5KA 4OPZA 1CEFA 1N9BA 2WK0A 3UE6A 5J7EA 5J4EA 3A3JA 1XJ2A 2PR6A 5CX7A 4XUZA 4Q0HA 3MFDA 4EQ1A 4GOGA 3K3DA 4YNRA 3TJZC 4NXFA 4KZ6A 4LLOB 4HH2A 3O87A 3NC8A 4GD8A 2KOIA 4JXGA 4NXGA 1I2WA 3BYDA 2RCXA 3LIAA 3MFXA 1KOUA 3C4PA 2KDKA 4OONA 2V20A 5AQ9A 3BECA 1K6RA 4HESA 4R1GA 4WBGA 1ESUA 4WMCA 2WYXA 3MBZA 4E3NA 3D4FA 2QMIA 4HEFA 4OQIA 4PM9A 1XGJA 2XR0A 3LY4A 1J9MA 2ZBBA 4L0LA 1N9OA 3ZG7B 2JN7A 2VJWA 5A91A 2ACGA 3IWOA 4Y0UA 1PIOA 1YSPA 3IF6C 3NY4A 2HDQA 3IH9A 2W1TB 5CGXA 2P08A 5CXWA 2Y2NA 1YMSA 4Z9QA 5I94A 1VQQA 5KZHA 3ZG5A 1PI5A 3UO9A 1T19A 3E2KA 1U60A 3T1SA 4JKTA 3C38A 5FDSA 5L2FA 4HJ3A 1DP8A 3QP1A 3ZQ5A 4UA9A 1IYPA 5HDDA 3V39A 3OPLA 1K4EA 4JGRA 2XA7M 3QP4A 4YFMA 2X02A 4R4SA 1FSYA 1TS7A 1TS0A 3FZCA 3QNBA 1ONGA 3BY9A 4DE0A 4NXEA 1XJ4A 5DTKA 4B4ZA 3HLDA 5F6AA 3Q82A 4F94A 4S2MA 3IS2B 1VB6A 3HCYA 3M2KA 4L9FA 4DJ2A 2B5RA 3HUNA 3VV4A 2JKGA 3GR2A 1IOUA 4R0QA 5IS1A 5F5YA 2ZLYA 3K2NA 4WZ5C 5KSCA 3H82A 3NIAA 2K7SA 1XA7A 1JTDA 3KSGA 1OPXA 3JPUA 1XJ3A 2Y59A 1IYOA 4ID4A 3MKFA 1YLZA 2W3GA 1JWPA 5DTSA 2M7UA 5HSQA 3T4LA 5DKKA 2ZMFA 4GZBA 2Z6CA 4HOIA 2J3WA 3P7NA 3F1OB 3JVUA 5TBMB 3EQVA 4PM5A 3L9KA 3A0RA 3BEBA 2VZWA 3TOIA 5GL9A 5FQJA 1OTEA 5HAPA 2J3TD 3G2ZA 5EV0A 4B4XA 4BD1A 2WKRA 1IYSA 1KGEA 4LV1A 2W0NA 3O5YA 1XFQA 3IHAA 4P0MA 2PR5A 4G3VA 3BLSA 3LI8A 2WKEA 4EESA 3VE3A 1K54A 3VP3A 3BY8A 3UB9A 4XT2A 3NULA 3P01A 4R4RA 3UDXA 1LI0A 2VV7A 4PHTA 4KUKA 2QZ6A 5GLBA 3GQZA 3DTEA 2HDUA 4LPZA 2XRNA 4CPKA 1UGUA 3UB5P 4BJPA 4P6BA 2V0UA 3C8CA 2LB9A 1FILA 4EV4A 4NK3A 4KZ9A 1KGFA 4EBPA 2XDMA 3T1RA 1W8YA 1KVLA 4FOFA 1SKOA 1YT4A 4RVAA 4JF6A 4R3AA 5AVFA 3ZG0A 3OOVA 1J3WA 4EBNA 3HLBA 3PBRA 2JC7A 1K55C 4BBUA 3D3OA 1MWTA 2JCHA 2OWJA 4GW9A 4O01A 3HVFA 1H8ZA 2J80A 2LB5A 3OBFA 3C7UA 2Y91A 3HLFA 3EEAA 3BQAA 1OTIA 1OTAA 3NBLA 4IVKA 3OPRA 1E25A 1GHPA 3VSKA 5M18A 3TSGA 2O9BA 3G34A 2UV0E 5G18A 4P6ZS 1XP4A 4QHCA 1HZOA 2Y79A 4G3WA 4IVIA 4MMNA 4BENA 1FCNA 1Z09A 4EU0A 5G4YA 1XXMA 1L0GA 5FDHA 4HNBA 2GNXA 2HPBA 4EERA 4S2KA 1O7EA 5AQBA 4ARZA 1VETA 1TS8A 4NETA 4GNUA 4KG5A 3FKWA 2C5WB 1S66L 3TRCA 4LV0A 3H82B 5EVIB 5AVEA 1PWGA 4IUKA 1TD5A 3O86A 1FCOA 2W3DA 5FI6A 1GSXA 2HP6A 1BYWA 3PBQA 1KE4A 3UE1A 4X6TA 4NKPA 1Q2QA 2HP9A 2Y4AA 4DDYA 1O07A 4U3TA 4L9EA 3C7VA 1D06A 5FSRA 4MEZA 1KE3A 5EE8A 1DJBA 2VGLS 1M6KA 1ERMA 4ZJ1A 4IEDA 1CI9A 2IWBA 1XGIA 3T4QA 1K6SA 5EFWA 4KQQA 3UDFA 2IWDA 4BD0A 3ITBA 4JXVA 5L07A 3CAXA 2XEPA 4GDBA 4X1MA 3BJNA 4DN0A 5CTNA 1WA9A 3ZYTA 1ESIA 4UA6A 2V8FA 3V5MA 2HZ5A 3OC2A 5J8XA 1PZOA 5DJUA 2HDRA 5HAIA 3VSLA 3CZDA 2ZQ8A 3MXQA 1P0ZA 5FAQA 2Y2MA 3B33A 2WAEA 5F1GA 4X55A 4I3IA 3RH8B 3I7JA 3VFFA 2GJ3A 1YQSA 2R78A 3FPVA 1K25A 3A3DA 2WKPA 2EWWA 2EX8A 4LV3A 5FQKA 1PWDA 1NLYA 4CLCB 1ODVA 1SKOB 1A0KA 1G6OA 2W3FA 2XH9A 3W8KA 3Q07A 4UAAA 3NCKA 1NWZA 5F69A 4LRZE 4Y7PA 1TS6A 1ACFA 3MXSA 3BW6A 2EXBA 3RTYA 2P7JA 1LL5A 2OOLA 5EVLA 2ZQDA 5AQAA 5DFYA 5CRFA 3EEHA 2EX6A 1PW8A 1K54C 3IX3A 2ZMVA 2VGJA 3NDEA 3OCLA 1NRJA 4MN5A 1K56D 1ES2A 3IH8A 2VV8A 3VP2A 5EVID 3LR4A 4GD6A 5CGWA 5EVEA 3CWFA 3SS3A 3OZHA 2WGWB 4JBFA 4X25A 4ARZB 3MZFA 5DKLA 1LLBA 2MJ6A 3A3EA 4I3AA 4WEJA 4LFUA 4OVDA 3DTIA 3UMDA 2H5SA 4LENA 4ESPA 4YWZA 5KSHA 2AVXA 1TVFA 1YM1A 2M1CA 3LUQA 2EX2A 5FQIA 3SW1A 3C5AA 1PNEA 4MN7A 4KUOA 4GN2A 5TBMA 5E2EA 4FSFA 2WKHA 5EPHA 3LIEA 1G5UA 1JVJA 3BQ8A 1LHYA 4ME4A 1BUEA 1OMEA 3CJMA 4NEED 3UN7A 1S67L 5CECA 2QKPA 2VEAA 2C6WB 4MBHA 3A0VA 4IBRA 4OOYA 2O9CA 3NI9A 4B9OA 2ZOHA 3BM6A 3H7WB 4GDNA 1MWSA 4JF5A 2XSSA 3PBNA 3CUEA 3HBRA 4EW7A 1RGZA 5HARA 5HPIA 2ZM2A 3VP4A 1W63M 3UB8A 1RGYA 3VOZA 3LR5A 1N4OA 1GSWA 4WL9A 1ZHHB 3UY6A 1MC0A 2G7UA 2Y55A 3CITA 4CLCD 4PPRA 4DF6A 2JBFA 1CQAA 3E4QA 2W1RA 2ZC3B 4JF4A 4DKIA 3T12B 3VOYA 3VMAA 2VV6A 4HJ6A 4B88A 3KSHA 1ALQA 1F2KA 5CHMA 3QP2A 2PYPA 4NXBA 3ICYA 4Y2FA 3G6OA 3HLCA 2DMWA 2XD1A 2XGNA 1HD8A 1STZA 5HD3A 4KQDA 1IELA 2B18A 3AGFA 3SS4A 5BOHA 4Y17A 3M6BA 5IU1A 2Y2GA 4IUHA 1YLPA 4DJ3A 1E3UD 2EA9A 2ZC5B 5E2FA 5CGSA 4ETXA 4S2OA 1F5MA 1BLHA 3GRJA 4KG6A 3BFEA 2Q0OA 4E3IA 1D1JA 2HGVA 5DF7A 4RQ9A 2J3TC 5EOOA 4FCFA 2W3EA 1UWNX 1QMFA 1OT6A 4QB8A 3PBTA 1Y54A 2EX9A 3MQ0A 3VP0A 3G30A 1XJ6A 2OWHA 5EUAA 2OLUA 2Y8HA 1YLTA 4WELA 2D01A 3MZDA 4UQIS 1WE4A 3WS2A 4UEYA 4EUVA 1TF1A 3E4PA 3B42A 1ZTUA 1BSGA 1K56A 1GHMA 1K38A 4ZTKA 5EVIA 5CHJA 1VHMA 4O7DA 3OPPA 1KE0A 3HREA 4O0PA 1P97A 2PU2A 1IYQA 3E2LA 3G35A 2FFYA 4LCLA 4KZ7A 3KSFA 1Y28A 2XQZA 3S7PA 1VEUA 3UB6A 5HL6A 2UWXA 2ZC7A 2Y2QA 1S6RA 4C75A 1TDGA 2PHYA 2A24A 4R6LA 4KZBA 5F68A 2WZZA 5TGFA 4K0WA 5HWTA 4D2OA 4KZAA 4EBLA 4FD8A 3O88A 3WRZA 5AQ7A 2VK3A 4PKYG 2ZJ9A 4P6ZM 4X56A 1S1ZA 2XF3A 5FQQA 4K0XA 1S4SA 1KDSA 4BQMA 3IXGA 5GLAA 1K57C 3MF0A 5DJTA 4KZ4A 1YMXA 4FH4A 2YKHA 1Z6FA 3ZVWA 1CEGA 1QMEA 3N8SA 4C6YA 1CI8A 1NZUA 3Q7ZA 5FL3A 1NZOA 1NJ4A 3G32A 4E3LA 3MSHA 4B93A 4CLCA 2PU4A 3PXPA 4Y5FA 1NYMA 4EETB 4CLCE 5F1FA 4E3JA 1AXBA 1F98A 2O0YA 4OH0A 2Y2PA 3GTCA 2JE5A 2ZC6B 3JVVA 4N1HA 3BWLA 5CHUA 4Y0TA 3UPPA 1OJ5A 2HJ9C 2WADA 4N9KA 5FA7A 3V3SA 5FATA 3ZG8B 3FC7A 3LEZA 2VGLM 3LY3A 1LL9A 3UDIA 4WF0A 4WM9A 3SH8A 5CERA 3DTMA 3S7QA 1GCEA 4Q0IA 1H3QA 2BTFP 4HH3A 1E3UA 2Y2OA 1FOFA 2B02A 4F3LB 1MPLA 3BRMA 4KG2A 1V9ZA 2WGWA 3E98A 4O8GA 3C2WA 5L10A 4XUXA 1DJAA 4DE1A 1SKFA 1MZUA 4GCZA 3SH9A 1Q2PA 4QY5A 5FQ9A 4LGWA 3CG5A 3C30A 3FV7A 4S2IA 2H0YA 1JTGA 3T4JA 1L0EA 4BLMA 3MS6A 4JGQA 1FR6A 4PKYA 3DWZA 3PAEA 3ZDJA 2V1ZA 5HFOA 4DXBA 2E8JA 1Y4OA 3IBRA 1VEUB 3HLWA 3NOPC 5E2GA 3IWQA 1T18A 3GVBA 2ZM0A 3VP1A 3IXHA 4G3KA 2A24B 4A5RA 5EECA 2EXAA 3H7WA 5U47A 1XKZA 3ITAA 2J8YA 5FEGA 4M4XA 1DP6A 3IHBA 3G4PA 2ZL1A 3IF6A 4HJ4A 3Q81A 3F1PA 4X53A 4BWIA 1LSXA 1ES4A 5FEFA 2KX6A 1NLZA 2V2FF 2BG1A 4PM6A 1MWRA 1F9IA 2WKIA 1DJCA 4KZ5A 1I5QA 4JGPA 4OKPA 1PZPA 4OLDA 3S1YA 4HHDA 3FG8A 1RCJA 3IBJA 1W63Q 4DE2A 4BL2A 3UB7A 1KDWA 3OCNA 4JXSA 4R38A 4WUJA 5EVIC 4QD4A 1SZVA 4EQIA 4E3KA 3S7NA 1ZG4A 2PRFA 1WYCA 1ONHA 2HDSA 4BBVA 4K08A 1MY8A 2ZD8A 4L9GA 4E04A 1SCWA 5IHVA 3B3XA 3V3RA 3T1XA 1YKDA 4MN6A 4WZ5A 5GHYA 4K91A 1BTLA 4HIAA 1PI4A 1G28A 3RJUA 1ZC2A 2JKFA 3BLMA 4OLGA 3PYPA 2QPNA 3ZNYA 4EWFA 1YSQA 1D7EA 1JWVA 2I72A 2PAVP 4LRYC 3GMWA 3P98A 5FI2A 2XFSA 3CLOA 3FPWA 2JHEA 3DBAA 4DMZA 3TG9A 2L1MA 1IKIA 3VFHA 4DE3A 4OPRA 5HL1A 1T1CA 5F83A
chains in the Genus database with same CATH topology
3IX4A 4Y17A 3SZTA 3QP8A 3QP6A 3QP1A 3QP5A 4LGWA 3JPUA 4Y15A 4Y13A 2AVXA 5L09A 3QP4A 5L07A 2UV0E 3IX8A 1L3LA 3IX3A 4NG2A 2Q0OA 1H0MA 5L10A 3QP2A 4LFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IX4 A;  4Y17 A;  3SZT A;  3QP8 A;  3QP6 A;  3QP1 A;  3QP5 A;  4LGW A;  3JPU A;  4Y15 A;  4Y13 A;  2AVX A;  5L09 A;  3QP4 A;  5L07 A;  2UV0 E;  3IX8 A;  1L3L A;  3IX3 A;  4NG2 A;  2Q0O A;  1H0M A;  5L10 A;  3QP2 A;  4LFU A; 
#chains in the Genus database with same CATH topology
 1HLU P;  5E2H A;  3QP5 A;  3N7W A;  3F1N B;  2QJ5 A;  3PR6 A;  4JGO A;  4RYE A;  3ZVT A;  5TR7 A;  4E6X A;  3C4O A;  1H8Y A;  1LT0 A;  4R70 A;  2A2L A;  3A3I A;  3NEC A;  1FQG A;  4KQR A;  4U0X A;  3W2Z A;  1FSW A;  1BZA A;  1CK3 A;  3TW8 A;  4HI4 A;  4D60 A;  5E43 A;  4H6J A;  1BLC A;  3LIF A;  4GHI A;  4CLC C;  4H8R A;  3BFD A;  3WRT A;  1EWZ A;  4WEK A;  2V0W A;  4QWO A;  3N8R A;  2VA0 A;  2JKR I;  2GX5 A;  4EUZ A;  2Y2I A;  3NDG A;  1S1Y A;  3MZE A;  3OPH A;  1ZG6 A;  2ZM8 A;  3TE8 A;  3DAV A;  1KVM A;  2V1A A;  4S2J A;  1XA1 A;  2IA2 A;  5F82 A;  3IWI A;  3Q7V A;  1YLJ A;  4II7 A;  4S2N A;  2HJE A;  1C3B A;  3T50 A;  4RX2 A;  3QP8 A;  4Z1W A;  3LCE A;  3HJK A;  2OLV A;  2ZL1 B;  3IF6 B;  3HL9 A;  2Q9M A;  1TDL A;  3F1P B;  1OTB A;  3ZNT A;  4LV2 A;  1RP5 A;  3D72 A;  4P85 A;  3MMH A;  1BUL A;  3WWX A;  4WN5 A;  1FIK A;  1LSW A;  3IF5 A;  1GA9 A;  4I5S A;  4C3Q A;  1P9R A;  4GS9 A;  5EM0 A;  4OP5 A;  3RFB A;  1NY0 A;  3PHY A;  4BMW A;  3PAG A;  3S4X A;  3V50 A;  3T1Q B;  4UQI M;  4OOM A;  4CQH A;  4HQA A;  2IWC A;  4ZJ3 A;  3N4I A;  4MCW A;  3N6I A;  5HX9 A;  2PBD P;  3SZT A;  5GHX A;  2OAQ 1;  4FH2 A;  1CJF A;  3IQA A;  3EGX C;  3LEQ A;  4PAU A;  1HTZ A;  4JXW A;  4OPQ A;  2WGV A;  1G68 A;  5FQM A;  3T4S A;  2DNS A;  3ZG9 B;  2V9A A;  2CMN A;  5CED A;  1N9L A;  1YLW A;  2FZ0 A;  3BFF A;  2Y2J A;  4Q8I A;  2VGK A;  4QJG A;  3LFV A;  1W8Q A;  4DXC A;  3PBS A;  4E3M A;  2WZX A;  1LL8 A;  2PD8 A;  1FR1 A;  4KZ3 A;  1JWZ A;  4PM7 A;  4S2P A;  4WYY A;  1HVB A;  2JKR M;  3UE3 A;  3LIB A;  5IT5 A;  4M3K A;  1TEM A;  4HP9 A;  4F3L A;  2PD7 A;  1DY6 A;  1CF0 A;  2G2U A;  2J9O A;  3FWL A;  2VX8 A;  3AGE A;  1IEM A;  3L7H A;  1V9Y A;  1H8M A;  2WUQ A;  3U2A A;  4OQ0 A;  2GZA A;  4WLA A;  3GEC A;  4H6J B;  2XLN A;  3QNC A;  3DWK A;  4R3B A;  3HUM A;  4GHI B;  4S2L A;  4HBT A;  2E8I A;  5MC7 A;  5FAP A;  4QPR A;  4NG2 A;  3RXW A;  3CHW P;  2PBY A;  3HLE A;  5TFQ A;  3NOT C;  3VE4 A;  3NHQ A;  5AJG A;  3OLO A;  1DRM A;  2P74 A;  5FI7 A;  2ZQ7 A;  2ZMA A;  1K0K A;  2FH5 A;  4HP4 A;  3S7O A;  2B95 A;  4KZ8 A;  4Y0O A;  2I9V A;  3DTK A;  3UPO A;  1PWC A;  2XD5 A;  1IKG A;  1H0M A;  3Q7V B;  1T1B A;  4MNR A;  5A92 A;  2FFF B;  3LI9 A;  2X71 A;  3WS4 A;  4ZBE A;  4X69 A;  5HDC A;  2V1B A;  5LBR A;  2HF6 A;  1MKM A;  4GB7 A;  2XA7 S;  4UHU A;  3R4K A;  5DF8 A;  3IX4 A;  4GS9 B;  3KO6 A;  5GLC A;  4GJ4 A;  2ZQC A;  1FCM A;  1MWU A;  2Y2K A;  1GA0 A;  3UNW A;  3CPT A;  1ZKJ A;  4X68 A;  5GHZ A;  3E0Y A;  4E6W A;  4X1L A;  3KYQ A;  2H10 A;  5FAO A;  4ZAM A;  3KYZ A;  2V8C A;  5CTM A;  2L0W A;  3QHY A;  2PDR A;  3M6H A;  4OQH A;  5K5B A;  3LGO A;  4GLQ A;  3DW0 A;  3W4O A;  4YIN A;  2NUP C;  2O99 A;  3BFC A;  2OV5 A;  1E4D A;  4LCM A;  2KLI A;  4KQO A;  1ERQ A;  1L2S A;  1YLY A;  3O3V A;  3LO7 A;  1SHV A;  1W5D A;  2YKF A;  3RXX A;  3GSG A;  4FUW A;  4OQG A;  4S2N C;  4YOF A;  1MBL A;  1NXY A;  5A90 A;  2ZQA A;  3CUE C;  4BL3 A;  2HV1 A;  3T4K A;  5CEB A;  4ZDX A;  3NJA A;  2M7V A;  1OJG A;  5L8M A;  1P9W A;  5M1A A;  3HLG A;  2R9X A;  3ULF A;  3T4O A;  2XFT A;  2G2W A;  1H5X A;  2K2N A;  1BLP A;  2QHK A;  2PT7 A;  3F1N A;  3B47 A;  3A3F A;  4IJG A;  3ZHH A;  2WGI A;  1N9N A;  2W27 A;  1I2S A;  1XFN A;  1GHI A;  2DRW A;  2X01 A;  3SOI A;  4E3O A;  4DDS A;  3SH7 A;  2P9V A;  1AWI A;  4HBU A;  5KIZ A;  3KSI A;  1GSV A;  3EGD C;  3QP6 A;  4I38 A;  5HWW A;  4EEU A;  3P09 A;  4FTX A;  4EEP A;  2J7V A;  4I3J A;  3N8L A;  4MBK A;  2R9W A;  4OOL A;  2Z6D A;  4MDZ A;  5KMW A;  5M19 A;  2A49 A;  5G4Z A;  5HWV A;  4RA7 A;  1X0O A;  5DF9 A;  1XPB A;  4IHQ A;  1YPR A;  3M2J A;  4XXR A;  3ZFZ A;  5HDS A;  3CI6 A;  3NOU C;  2WAF A;  3IXB A;  4GKU A;  3ZCZ A;  1ES5 A;  2GDN A;  4JPM A;  3IXD A;  1T1A A;  1JNU A;  1MKI A;  3Q1F A;  3W4Q A;  3HUO A;  5DVA A;  1VM1 A;  4Y15 A;  5EM1 A;  3A0S A;  4IBX A;  3KX0 X;  2Q9N A;  3R7W A;  1SDN A;  1S0W A;  3EOI A;  1L3L A;  3H9W A;  1S4R A;  3LID A;  4EXO A;  2ZOI A;  1YAX A;  1ERO A;  2P04 A;  3MQO A;  4KEN B;  5DTT A;  1XX2 A;  2WKQ A;  2DCF A;  1L0F A;  3IT9 A;  4P87 A;  5JYP A;  2A3U A;  3KYE A;  1K4F A;  2BLS A;  5FAS A;  3CPT B;  5TJJ A;  4XT2 B;  2JKT I;  4WMC D;  1ES3 A;  5A93 A;  1BLS A;  2Z2M B;  3FYZ A;  2Z2L B;  3EQU A;  5L09 A;  3AGD A;  2RL3 A;  2NUT C;  5HZH A;  3LR3 A;  5D3O A;  3EWK A;  1W7F A;  2D02 A;  3GDI A;  1WYB A;  3SS5 A;  4BBT A;  3MXR A;  3E4O A;  4OPY A;  3WS5 A;  2INW A;  1BT5 A;  1OT9 A;  4PMA A;  5A8B A;  3MKE A;  1UWP X;  2CC1 A;  1PYY A;  2BAS A;  5EOE A;  1G6A A;  3ISG A;  4ZRR A;  3MR0 A;  1LSV A;  4LRX C;  1NRF A;  4UA7 A;  2Y2L A;  4OP8 A;  4Y13 A;  2OSU A;  3UPN A;  2W1T A;  4R3J A;  2EFX A;  3PTE A;  3VOL A;  5HAQ A;  3W4P A;  1PFL A;  3LIC A;  3LR0 A;  2L4R A;  3T4T A;  2OAP 1;  3FKV A;  2K31 A;  3ZGA B;  2PYR A;  2XK1 A;  5I5L A;  4RX3 A;  3UME A;  1EI5 A;  1PW1 A;  3MQQ A;  1W79 A;  4PM8 A;  4I39 A;  2ZQ9 A;  2O9A A;  1IFQ A;  3MJQ A;  2H0T A;  2Y2H A;  5J3W A;  1SDE A;  2P9V B;  1PRQ A;  1EW0 A;  2EFU A;  4CJN A;  1NYY A;  2ZC4 B;  3IS2 A;  4QU3 A;  3D9Y A;  4MBF A;  4Q0J A;  1LI9 A;  1K57 A;  1OTD A;  2H28 A;  3V67 A;  4U0T A;  4N92 A;  1VET B;  3LYX A;  4WZ4 A;  5GLD A;  2XRO A;  4QY6 A;  2QYB A;  5HPF A;  3S22 A;  3CMZ A;  1KGG A;  3G31 A;  2W3H A;  4N9L A;  2HP5 A;  3PBO A;  2VKS A;  3HJI A;  4MLL A;  5DFX A;  3IX8 A;  3GV9 A;  3BFG A;  3UE0 A;  3JYI A;  1L0D A;  4ZJ2 A;  3F1O A;  2JKT M;  1DP9 A;  3U4L P;  4R23 A;  2EWV A;  2VLG A;  4AFI A;  3K3C A;  4JLF A;  4N1X A;  1K55 A;  1MXO A;  4ETZ A;  5JYO A;  4Y3I A;  1M40 A;  5HD5 A;  3R7W B;  4HY8 A;  2J9P A;  4DRT A;  3WS0 A;  3G2Y A;  2QWS A;  3WS1 A;  5HW3 A;  2QJ7 A;  5C5K A;  4OPZ A;  1CEF A;  1N9B A;  2WK0 A;  3UE6 A;  5J7E A;  5J4E A;  3A3J A;  1XJ2 A;  2PR6 A;  5CX7 A;  4XUZ A;  4Q0H A;  3MFD A;  4EQ1 A;  4GOG A;  3K3D A;  4YNR A;  3TJZ C;  4NXF A;  4KZ6 A;  4LLO B;  4HH2 A;  3O87 A;  3NC8 A;  4GD8 A;  2KOI A;  4JXG A;  4NXG A;  1I2W A;  3BYD A;  2RCX A;  3LIA A;  3MFX A;  1KOU A;  3C4P A;  2KDK A;  4OON A;  2V20 A;  5AQ9 A;  3BEC A;  1K6R A;  4HES A;  4R1G A;  4WBG A;  1ESU A;  4WMC A;  2WYX A;  3MBZ A;  4E3N A;  3D4F A;  2QMI A;  4HEF A;  4OQI A;  4PM9 A;  1XGJ A;  2XR0 A;  3LY4 A;  1J9M A;  2ZBB A;  4L0L A;  1N9O A;  3ZG7 B;  2JN7 A;  2VJW A;  5A91 A;  2ACG A;  3IWO A;  4Y0U A;  1PIO A;  1YSP A;  3IF6 C;  3NY4 A;  2HDQ A;  3IH9 A;  2W1T B;  5CGX A;  2P08 A;  5CXW A;  2Y2N A;  1YMS A;  4Z9Q A;  5I94 A;  1VQQ A;  5KZH A;  3ZG5 A;  1PI5 A;  3UO9 A;  1T19 A;  3E2K A;  1U60 A;  3T1S A;  4JKT A;  3C38 A;  5FDS A;  5L2F A;  4HJ3 A;  1DP8 A;  3QP1 A;  3ZQ5 A;  4UA9 A;  1IYP A;  5HDD A;  3V39 A;  3OPL A;  1K4E A;  4JGR A;  2XA7 M;  3QP4 A;  4YFM A;  2X02 A;  4R4S A;  1FSY A;  1TS7 A;  1TS0 A;  3FZC A;  3QNB A;  1ONG A;  3BY9 A;  4DE0 A;  4NXE A;  1XJ4 A;  5DTK A;  4B4Z A;  3HLD A;  5F6A A;  3Q82 A;  4F94 A;  4S2M A;  3IS2 B;  1VB6 A;  3HCY A;  3M2K A;  4L9F A;  4DJ2 A;  2B5R A;  3HUN A;  3VV4 A;  2JKG A;  3GR2 A;  1IOU A;  4R0Q A;  5IS1 A;  5F5Y A;  2ZLY A;  3K2N A;  4WZ5 C;  5KSC A;  3H82 A;  3NIA A;  2K7S A;  1XA7 A;  1JTD A;  3KSG A;  1OPX A;  3JPU A;  1XJ3 A;  2Y59 A;  1IYO A;  4ID4 A;  3MKF A;  1YLZ A;  2W3G A;  1JWP A;  5DTS A;  2M7U A;  5HSQ A;  3T4L A;  5DKK A;  2ZMF A;  4GZB A;  2Z6C A;  4HOI A;  2J3W A;  3P7N A;  3F1O B;  3JVU A;  5TBM B;  3EQV A;  4PM5 A;  3L9K A;  3A0R A;  3BEB A;  2VZW A;  3TOI A;  5GL9 A;  5FQJ A;  1OTE A;  5HAP A;  2J3T D;  3G2Z A;  5EV0 A;  4B4X A;  4BD1 A;  2WKR A;  1IYS A;  1KGE A;  4LV1 A;  2W0N A;  3O5Y A;  1XFQ A;  3IHA A;  4P0M A;  2PR5 A;  4G3V A;  3BLS A;  3LI8 A;  2WKE A;  4EES A;  3VE3 A;  1K54 A;  3VP3 A;  3BY8 A;  3UB9 A;  4XT2 A;  3NUL A;  3P01 A;  4R4R A;  3UDX A;  1LI0 A;  2VV7 A;  4PHT A;  4KUK A;  2QZ6 A;  5GLB A;  3GQZ A;  3DTE A;  2HDU A;  4LPZ A;  2XRN A;  4CPK A;  1UGU A;  3UB5 P;  4BJP A;  4P6B A;  2V0U A;  3C8C A;  2LB9 A;  1FIL A;  4EV4 A;  4NK3 A;  4KZ9 A;  1KGF A;  4EBP A;  2XDM A;  3T1R A;  1W8Y A;  1KVL A;  4FOF A;  1SKO A;  1YT4 A;  4RVA A;  4JF6 A;  4R3A A;  5AVF A;  3ZG0 A;  3OOV A;  1J3W A;  4EBN A;  3HLB A;  3PBR A;  2JC7 A;  1K55 C;  4BBU A;  3D3O A;  1MWT A;  2JCH A;  2OWJ A;  4GW9 A;  4O01 A;  3HVF A;  1H8Z A;  2J80 A;  2LB5 A;  3OBF A;  3C7U A;  2Y91 A;  3HLF A;  3EEA A;  3BQA A;  1OTI A;  1OTA A;  3NBL A;  4IVK A;  3OPR A;  1E25 A;  1GHP A;  3VSK A;  5M18 A;  3TSG A;  2O9B A;  3G34 A;  2UV0 E;  5G18 A;  4P6Z S;  1XP4 A;  4QHC A;  1HZO A;  2Y79 A;  4G3W A;  4IVI A;  4MMN A;  4BEN A;  1FCN A;  1Z09 A;  4EU0 A;  5G4Y A;  1XXM A;  1L0G A;  5FDH A;  4HNB A;  2GNX A;  2HPB A;  4EER A;  4S2K A;  1O7E A;  5AQB A;  4ARZ A;  1VET A;  1TS8 A;  4NET A;  4GNU A;  4KG5 A;  3FKW A;  2C5W B;  1S66 L;  3TRC A;  4LV0 A;  3H82 B;  5EVI B;  5AVE A;  1PWG A;  4IUK A;  1TD5 A;  3O86 A;  1FCO A;  2W3D A;  5FI6 A;  1GSX A;  2HP6 A;  1BYW A;  3PBQ A;  1KE4 A;  3UE1 A;  4X6T A;  4NKP A;  1Q2Q A;  2HP9 A;  2Y4A A;  4DDY A;  1O07 A;  4U3T A;  4L9E A;  3C7V A;  1D06 A;  5FSR A;  4MEZ A;  1KE3 A;  5EE8 A;  1DJB A;  2VGL S;  1M6K A;  1ERM A;  4ZJ1 A;  4IED A;  1CI9 A;  2IWB A;  1XGI A;  3T4Q A;  1K6S A;  5EFW A;  4KQQ A;  3UDF A;  2IWD A;  4BD0 A;  3ITB A;  4JXV A;  5L07 A;  3CAX A;  2XEP A;  4GDB A;  4X1M A;  3BJN A;  4DN0 A;  5CTN A;  1WA9 A;  3ZYT A;  1ESI A;  4UA6 A;  2V8F A;  3V5M A;  2HZ5 A;  3OC2 A;  5J8X A;  1PZO A;  5DJU A;  2HDR A;  5HAI A;  3VSL A;  3CZD A;  2ZQ8 A;  3MXQ A;  1P0Z A;  5FAQ A;  2Y2M A;  3B33 A;  2WAE A;  5F1G A;  4X55 A;  4I3I A;  3RH8 B;  3I7J A;  3VFF A;  2GJ3 A;  1YQS A;  2R78 A;  3FPV A;  1K25 A;  3A3D A;  2WKP A;  2EWW A;  2EX8 A;  4LV3 A;  5FQK A;  1PWD A;  1NLY A;  4CLC B;  1ODV A;  1SKO B;  1A0K A;  1G6O A;  2W3F A;  2XH9 A;  3W8K A;  3Q07 A;  4UAA A;  3NCK A;  1NWZ A;  5F69 A;  4LRZ E;  4Y7P A;  1TS6 A;  1ACF A;  3MXS A;  3BW6 A;  2EXB A;  3RTY A;  2P7J A;  1LL5 A;  2OOL A;  5EVL A;  2ZQD A;  5AQA A;  5DFY A;  5CRF A;  3EEH A;  2EX6 A;  1PW8 A;  1K54 C;  3IX3 A;  2ZMV A;  2VGJ A;  3NDE A;  3OCL A;  1NRJ A;  4MN5 A;  1K56 D;  1ES2 A;  3IH8 A;  2VV8 A;  3VP2 A;  5EVI D;  3LR4 A;  4GD6 A;  5CGW A;  5EVE A;  3CWF A;  3SS3 A;  3OZH A;  2WGW B;  4JBF A;  4X25 A;  4ARZ B;  3MZF A;  5DKL A;  1LLB A;  2MJ6 A;  3A3E A;  4I3A A;  4WEJ A;  4LFU A;  4OVD A;  3DTI A;  3UMD A;  2H5S A;  4LEN A;  4ESP A;  4YWZ A;  5KSH A;  2AVX A;  1TVF A;  1YM1 A;  2M1C A;  3LUQ A;  2EX2 A;  5FQI A;  3SW1 A;  3C5A A;  1PNE A;  4MN7 A;  4KUO A;  4GN2 A;  5TBM A;  5E2E A;  4FSF A;  2WKH A;  5EPH A;  3LIE A;  1G5U A;  1JVJ A;  3BQ8 A;  1LHY A;  4ME4 A;  1BUE A;  1OME A;  3CJM A;  4NEE D;  3UN7 A;  1S67 L;  5CEC A;  2QKP A;  2VEA A;  2C6W B;  4MBH A;  3A0V A;  4IBR A;  4OOY A;  2O9C A;  3NI9 A;  4B9O A;  2ZOH A;  3BM6 A;  3H7W B;  4GDN A;  1MWS A;  4JF5 A;  2XSS A;  3PBN A;  3CUE A;  3HBR A;  4EW7 A;  1RGZ A;  5HAR A;  5HPI A;  2ZM2 A;  3VP4 A;  1W63 M;  3UB8 A;  1RGY A;  3VOZ A;  3LR5 A;  1N4O A;  1GSW A;  4WL9 A;  1ZHH B;  3UY6 A;  1MC0 A;  2G7U A;  2Y55 A;  3CIT A;  4CLC D;  4PPR A;  4DF6 A;  2JBF A;  1CQA A;  3E4Q A;  2W1R A;  2ZC3 B;  4JF4 A;  4DKI A;  3T12 B;  3VOY A;  3VMA A;  2VV6 A;  4HJ6 A;  4B88 A;  3KSH A;  1ALQ A;  1F2K A;  5CHM A;  3QP2 A;  2PYP A;  4NXB A;  3ICY A;  4Y2F A;  3G6O A;  3HLC A;  2DMW A;  2XD1 A;  2XGN A;  1HD8 A;  1STZ A;  5HD3 A;  4KQD A;  1IEL A;  2B18 A;  3AGF A;  3SS4 A;  5BOH A;  4Y17 A;  3M6B A;  5IU1 A;  2Y2G A;  4IUH A;  1YLP A;  4DJ3 A;  1E3U D;  2EA9 A;  2ZC5 B;  5E2F A;  5CGS A;  4ETX A;  4S2O A;  1F5M A;  1BLH A;  3GRJ A;  4KG6 A;  3BFE A;  2Q0O A;  4E3I A;  1D1J A;  2HGV A;  5DF7 A;  4RQ9 A;  2J3T C;  5EOO A;  4FCF A;  2W3E A;  1UWN X;  1QMF A;  1OT6 A;  4QB8 A;  3PBT A;  1Y54 A;  2EX9 A;  3MQ0 A;  3VP0 A;  3G30 A;  1XJ6 A;  2OWH A;  5EUA A;  2OLU A;  2Y8H A;  1YLT A;  4WEL A;  2D01 A;  3MZD A;  4UQI S;  1WE4 A;  3WS2 A;  4UEY A;  4EUV A;  1TF1 A;  3E4P A;  3B42 A;  1ZTU A;  1BSG A;  1K56 A;  1GHM A;  1K38 A;  4ZTK A;  5EVI A;  5CHJ A;  1VHM A;  4O7D A;  3OPP A;  1KE0 A;  3HRE A;  4O0P A;  1P97 A;  2PU2 A;  1IYQ A;  3E2L A;  3G35 A;  2FFY A;  4LCL A;  4KZ7 A;  3KSF A;  1Y28 A;  2XQZ A;  3S7P A;  1VEU A;  3UB6 A;  5HL6 A;  2UWX A;  2ZC7 A;  2Y2Q A;  1S6R A;  4C75 A;  1TDG A;  2PHY A;  2A24 A;  4R6L A;  4KZB A;  5F68 A;  2WZZ A;  5TGF A;  4K0W A;  5HWT A;  4D2O A;  4KZA A;  4EBL A;  4FD8 A;  3O88 A;  3WRZ A;  5AQ7 A;  2VK3 A;  4PKY G;  2ZJ9 A;  4P6Z M;  4X56 A;  1S1Z A;  2XF3 A;  5FQQ A;  4K0X A;  1S4S A;  1KDS A;  4BQM A;  3IXG A;  5GLA A;  1K57 C;  3MF0 A;  5DJT A;  4KZ4 A;  1YMX A;  4FH4 A;  2YKH A;  1Z6F A;  3ZVW A;  1CEG A;  1QME A;  3N8S A;  4C6Y A;  1CI8 A;  1NZU A;  3Q7Z A;  5FL3 A;  1NZO A;  1NJ4 A;  3G32 A;  4E3L A;  3MSH A;  4B93 A;  4CLC A;  2PU4 A;  3PXP A;  4Y5F A;  1NYM A;  4EET B;  4CLC E;  5F1F A;  4E3J A;  1AXB A;  1F98 A;  2O0Y A;  4OH0 A;  2Y2P A;  3GTC A;  2JE5 A;  2ZC6 B;  3JVV A;  4N1H A;  3BWL A;  5CHU A;  4Y0T A;  3UPP A;  1OJ5 A;  2HJ9 C;  2WAD A;  4N9K A;  5FA7 A;  3V3S A;  5FAT A;  3ZG8 B;  3FC7 A;  3LEZ A;  2VGL M;  3LY3 A;  1LL9 A;  3UDI A;  4WF0 A;  4WM9 A;  3SH8 A;  5CER A;  3DTM A;  3S7Q A;  1GCE A;  4Q0I A;  1H3Q A;  2BTF P;  4HH3 A;  1E3U A;  2Y2O A;  1FOF A;  2B02 A;  4F3L B;  1MPL A;  3BRM A;  4KG2 A;  1V9Z A;  2WGW A;  3E98 A;  4O8G A;  3C2W A;  5L10 A;  4XUX A;  1DJA A;  4DE1 A;  1SKF A;  1MZU A;  4GCZ A;  3SH9 A;  1Q2P A;  4QY5 A;  5FQ9 A;  4LGW A;  3CG5 A;  3C30 A;  3FV7 A;  4S2I A;  2H0Y A;  1JTG A;  3T4J A;  1L0E A;  4BLM A;  3MS6 A;  4JGQ A;  1FR6 A;  4PKY A;  3DWZ A;  3PAE A;  3ZDJ A;  2V1Z A;  5HFO A;  4DXB A;  2E8J A;  1Y4O A;  3IBR A;  1VEU B;  3HLW A;  3NOP C;  5E2G A;  3IWQ A;  1T18 A;  3GVB A;  2ZM0 A;  3VP1 A;  3IXH A;  4G3K A;  2A24 B;  4A5R A;  5EEC A;  2EXA A;  3H7W A;  5U47 A;  1XKZ A;  3ITA A;  2J8Y A;  5FEG A;  4M4X A;  1DP6 A;  3IHB A;  3G4P A;  2ZL1 A;  3IF6 A;  4HJ4 A;  3Q81 A;  3F1P A;  4X53 A;  4BWI A;  1LSX A;  1ES4 A;  5FEF A;  2KX6 A;  1NLZ A;  2V2F F;  2BG1 A;  4PM6 A;  1MWR A;  1F9I A;  2WKI A;  1DJC A;  4KZ5 A;  1I5Q A;  4JGP A;  4OKP A;  1PZP A;  4OLD A;  3S1Y A;  4HHD A;  3FG8 A;  1RCJ A;  3IBJ A;  1W63 Q;  4DE2 A;  4BL2 A;  3UB7 A;  1KDW A;  3OCN A;  4JXS A;  4R38 A;  4WUJ A;  5EVI C;  4QD4 A;  1SZV A;  4EQI A;  4E3K A;  3S7N A;  1ZG4 A;  2PRF A;  1WYC A;  1ONH A;  2HDS A;  4BBV A;  4K08 A;  1MY8 A;  2ZD8 A;  4L9G A;  4E04 A;  1SCW A;  5IHV A;  3B3X A;  3V3R A;  3T1X A;  1YKD A;  4MN6 A;  4WZ5 A;  5GHY A;  4K91 A;  1BTL A;  4HIA A;  1PI4 A;  1G28 A;  3RJU A;  1ZC2 A;  2JKF A;  3BLM A;  4OLG A;  3PYP A;  2QPN A;  3ZNY A;  4EWF A;  1YSQ A;  1D7E A;  1JWV A;  2I72 A;  2PAV P;  4LRY C;  3GMW A;  3P98 A;  5FI2 A;  2XFS A;  3CLO A;  3FPW A;  2JHE A;  3DBA A;  4DMZ A;  3TG9 A;  2L1M A;  1IKI A;  3VFH A;  4DE3 A;  4OPR A;  5HL1 A;  1T1C A;  5F83 A; 
#chains in the Genus database with same CATH homology
 3IX4 A;  4Y17 A;  3SZT A;  3QP8 A;  3QP6 A;  3QP1 A;  3QP5 A;  4LGW A;  3JPU A;  4Y15 A;  4Y13 A;  2AVX A;  5L09 A;  3QP4 A;  5L07 A;  2UV0 E;  3IX8 A;  1L3L A;  3IX3 A;  4NG2 A;  2Q0O A;  1H0M A;  5L10 A;  3QP2 A;  4LFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...