3IX3A

Lasr-oc12 hsl complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
163
structure length
163
Chain Sequence
FLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLSVEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional activator protein lasR
publication title LasR-OC12 HSL complex
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
total genus 57
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3ix3A00
3IX3A 2AVXA 1H0MA 3IX4A 2UV0E 4Y17A 1L3LA 5L09A 3QP5A 3QP2A 2Q0OA 3IX8A 5L10A 4LGWA 5L07A 4LFUA 3QP4A 4Y13A 4Y15A 4NG2A 3QP1A 3SZTA 3JPUA 3QP6A 3QP8A
chains in the Genus database with same CATH superfamily
1W7FA 3BEBA 2VEAA 1K38A 5IHVA 1LL8A 3W4QA 4S2OA 4DJ3A 2PD8A 2DMWA 2GZAA 3N7WA 3H82B 4IHQA 4ARZA 4L0LA 3SOIA 5I5LA 5E2GA 1I2WA 3NY4A 4R6LA 3CITA 2PR6A 2Y2KA 4MLLA 4C6YA 1TF1A 2L0WA 3SS3A 1OPXA 3ZGAB 1CQAA 1VM1A 3BLSA 1PZOA 3HLDA 4HHDA 4DN0A 1GHPA 3ITBA 1ZG6A 2HJEA 5HPIA 1NZUA 2DCFA 2B5RA 3VSLA 4WMCA 5G18A 2V20A 2B18A 1KOUA 1PI5A 1ZHHB 4ZRRA 4R0QA 3LIAA 4N9KA 2XDMA 2MJ6A 3G31A 5DVAA 1HVBA 1YLTA 4X1MA 2ZM0A 4OVDA 1MWTA 5EVID 1TS6A 2VK3A 4E3NA 2VV7A 1LLBA 3LYXA 4KZ5A 4QB8A 4KZ7A 4E6XA 3O5YA 1NLZA 4GNUA 5A92A 3LO7A 4FOFA 4H8RA 1YAXA 5E2HA 4WELA 3ZQ5A 2L1MA 3CWFA 4Y2FA 1F5MA 2ZMFA 3DAVA 5EOOA 2WUQA 3NULA 1YLWA 2A24A 4WZ5A 2WZXA 4PKYG 2Y55A 4KQOA 1P97A 1M6KA 4OOYA 3A0SA 1Y28A 4DMZA 2UV0E 4S2NA 4KG5A 3IS2B 2HP6A 3VOZA 1BYWA 4K0XA 4NKPA 4K91A 4KG6A 5FA7A 3LR5A 1IELA 4IVKA 3HJKA 4GB7A 5EOEA 1L0DA 4WZ4A 4EBNA 3W4OA 4WN5A 4I3JA 3T4LA 5IU1A 3OPPA 3PBTA 2VGLS 4GCZA 3E98A 2WGIA 4CLCA 3NOTC 1D1JA 3A3EA 4LV0A 1CEGA 2X71A 2W0NA 4OKPA 4EBPA 1GCEA 1VQQA 3MR0A 4B88A 4K0WA 2FFYA 4WEKA 3FPVA 5CHJA 4KG2A 1IOUA 4CPKA 5HW3A 3UDXA 5GLDA 5F83A 3BRMA 1N9LA 4QWOA 3IWQA 4S2PA 2G2WA 2Y2JA 1CI9A 3O3VA 2O9AA 3TJZC 3S7QA 4OLGA 3BFCA 5EM1A 4GDBA 5A90A 3FKWA 1YT4A 4FD8A 1MC0A 2V8FA 3HLWA 3LY4A 3ZCZA 3BQAA 1DP6A 1S4RA 4FUWA 1K25A 1OMEA 1YLYA 2H0TA 2HPBA 1PW1A 2O99A 1NWZA 4H6JA 5J3WA 4KQRA 4WEJA 1UWNX 3I7JA 1XPBA 3P7NA 2PU2A 2QKPA 3EEAA 2IWBA 3IH9A 3R7WB 3SS4A 3FG8A 3VOLA 1SCWA 3UE0A 2WKRA 2WGVA 1H8ZA 1W63M 2JKRI 3F1OB 3BY9A 4Y0UA 1S67L 1PI4A 2X02A 3V67A 3OPHA 1CI8A 3N8RA 4KQDA 5L10A 3LIFA 2JKRM 2W1TA 5CEDA 2HV1A 5K5BA 3BFEA 3GECA 3HJIA 1JVJA 3CI6A 4ZBEA 4B4XA 5AQAA 3LIBA 3VSKA 1CJFA 5KSHA 2VGLM 2LB9A 3SH8A 4F94A 3Q81A 4I39A 3A3DA 5DKLA 4HP9A 3QP6A 3VP4A 2Y2QA 3ZNYA 3C5AA 5DF9A 1VETA 1W5DA 1DY6A 4LV1A 4KZ9A 4YFMA 4K08A 3E0YA 4LRZE 3VOYA 3T4SA 3MXSA 2PBYA 4BL3A 4HJ6A 1VEUB 5HWVA 4PKYA 2VV6A 4BJPA 2Z2LB 3N6IA 3ZVTA 4IBXA 3ZVWA 3FC7A 2EFUA 4JXWA 3ZNTA 1S0WA 5FDHA 2ZL1B 3Q7VA 3NHQA 1S1YA 1I2SA 1M40A 5FQJA 1YMXA 5L8MA 2WZZA 3HL9A 1IYOA 3UB6A 5M1AA 2R9XA 5F82A 4I3AA 2Q9MA 5EVIA 5FL3A 2ZC5B 2HDUA 1T1BA 1T19A 3A0RA 1MZUA 4L9FA 2RCXA 4HEFA 5HL6A 3M6HA 4UAAA 2H10A 4EEPA 5CERA 4IEDA 4GKUA 2OAP1 4G3WA 1BULA 3EQUA 3SS5A 4XXRA 3HLGA 2Z2MB 4U3TA 5TJJA 3HLCA 1UGUA 3QNCA 1ES4A 1IEMA 3N8LA 3HUNA 2JHEA 5HAQA 2QWSA 4GS9A 1H5XA 1N9NA 4ID4A 2ZQ8A 4O01A 5J7EA 3RH8B 1YKDA 4WYYA 2WGWA 4E04A 3EEHA 1KDWA 5AQBA 3Q82A 2FZ0A 3IF6A 4OPZA 4QPRA 4EERA 2EX9A 3DTMA 5J8XA 5EPHA 1NYMA 1FCNA 4ZAMA 4EETB 3DWZA 2HF6A 2YKHA 1LI9A 4WF0A 1K56D 1WYCA 3PTEA 5FAPA 3VFHA 2R9WA 3U4LP 2Y4AA 4WZ5C 3LICA 3H7WB 1XJ3A 3HLFA 1YM1A 3IQAA 5DTKA 1PYYA 4S2NC 2YKFA 2JKFA 4RYEA 1NJ4A 3H9WA 4MNRA 2O9BA 3E4OA 3T1XA 3UNWA 3VV4A 2ZC6B 3T4QA 4JPMA 4EV4A 1FOFA 5LBRA 3CHWP 3WWXA 4LRXC 3MXRA 1P0ZA 1G68A 3NI9A 3PAGA 4HESA 1IKIA 4G3VA 1OT9A 1AWIA 4HNBA 4CLCC 1PNEA 1FCMA 3JVUA 1G6OA 5F1FA 1AXBA 1D7EA 4Q0JA 4C75A 2WK0A 5TBMB 4WL9A 2A49A 3TSGA 2Y2NA 3OCLA 2J3TC 5I94A 1JWZA 1SDEA 2A3UA 2XA7M 1SKFA 1UWPX 4S2MA 3G34A 3FV7A 4NK3A 1K57A 3IX8A 4LPZA 1PWGA 1YSQA 3IS2A 4LCLA 1XXMA 3Q07A 1I5QA 3N4IA 3T4JA 1OTDA 1STZA 2Z6DA 3KSFA 3PBNA 4OPRA 3ZG0A 4WLAA 4L9GA 2PD7A 3UDFA 3L9KA 1TVFA 3B33A 5A93A 4RA7A 1K0KA 1L0GA 3IHAA 4O7DA 4UA7A 3S4XA 3FPWA 1OTIA 2OLVA 3VP3A 4WM9A 4IUHA 4F3LA 1GSVA 4WUJA 3MKEA 5CRFA 2OV5A 4YWZA 5F1GA 3HUOA 1VHMA 3WS0A 3IWOA 4EUZA 1Q2PA 1L0EA 1GHIA 1PW8A 4NXEA 4OP5A 2Z6CA 2ZOIA 3V50A 5HARA 1N4OA 4EXOA 2AVXA 4E6WA 4X53A 3HLEA 1KE3A 4E3LA 3T4TA 1E4DA 3CUEA 5FAOA 2OSUA 4E3KA 5FATA 4HY8A 4G3KA 2VGKA 1YSPA 4MBFA 4R4SA 4RQ9A 1BLHA 3V3RA 3JYIA 4OQHA 1W63Q 5CGXA 4R70A 1ZG4A 5GHXA 4X69A 2HDQA 5GHYA 1H0MA 3IH8A 4ZJ1A 3VP2A 3W4PA 3UB8A 4B93A 2EX8A 2CMNA 4LFUA 4X56A 3UB7A 3NECA 3RTYA 2NUPC 2BG1A 2ZM8A 4DRTA 3SZTA 1ALQA 5G4ZA 3ISGA 1LSWA 2EWVA 1RCJA 4GJ4A 1P9WA 1IKGA 3M2KA 5FSRA 4RX3A 3HBRA 4OQ0A 4HJ4A 4EUVA 2BTFP 1S6RA 4EEUA 5FEGA 4Q8IA 1SZVA 5DJUA 3C4PA 3MJQA 4FCFA 3T1QB 1DRMA 4JBFA 5HX9A 3M6BA 3G35A 3UE6A 5FDSA 2Y2OA 2PBDP 2Q0OA 1GSWA 1Z6FA 3MQ0A 2ZQ9A 1FSWA 3A0VA 4DXBA 4N92A 3NIAA 1SKOB 2G7UA 3ICYA 4Y0OA 5F69A 3AGEA 3EOIA 1XX2A 2WKPA 4EESA 1U60A 1RGZA 2ACGA 5TR7A 5EVIC 5FAQA 5DTTA 1IYQA 1ONGA 4M4XA 3MQQA 2ZLYA 5DF8A 1K56A 2K31A 3Q7ZA 4LRYC 5KSCA 3AGDA 3AGFA 1G5UA 2XD1A 3OPRA 4XT2B 1TD5A 3CZDA 1IFQA 1PRQA 1MWUA 1T1AA 3F1PA 5CHUA 2XEPA 4C3QA 3W8KA 1ONHA 1BTLA 2K7SA 2LB5A 4JF5A 5HWWA 3B47A 4JXSA 2ZL1A 3MZFA 1JWPA 2WKIA 3IF6C 1YLJA 5HZHA 2ZOHA 3QP5A 3VP0A 3OZHA 3GMWA 3M2JA 1S66L 3C4OA 2W1RA 3OLOA 3RXXA 3LFVA 5EECA 2PT7A 3G32A 4EQ1A 1O7EA 2P9VA 3PBSA 4HBTA 1OTBA 3NCKA 4DE1A 3C2WA 5HL1A 1TS8A 1F2KA 2PU4A 2PYRA 5L07A 2IWCA 3CPTA 2H0YA 2IWDA 2IA2A 5CXWA 4JLFA 3CAXA 3DTKA 3CLOA 4PAUA 4P87A 5HDCA 1FCOA 1MY8A 5DF7A 1RP5A 2JCHA 3QP2A 1T18A 1PWCA 4PM6A 2WAEA 2L4RA 5F5YA 4PMAA 4N1XA 2C6WB 2W3FA 4U0TA 1D06A 3R4KA 2ZC3B 2A24B 2CC1A 4KZAA 4YNRA 4PM7A 1EROA 4MEZA 1WA9A 1OJ5A 3MFXA 3C30A 1K57C 3BFDA 1XJ4A 1H8YA 1XGIA 1XA1A 1JNUA 2J7VA 3A3JA 2Y2MA 4RVAA 1LL5A 1XGJA 3T12B 3F1NB 5E2FA 1QMEA 2ZBBA 4NEED 4OOMA 1HTZA 2ZD8A 1YMSA 5GLCA 4GHIB 5KZHA 5HFOA 4YINA 3PBOA 4GN2A 1DJAA 4KZ4A 1OT6A 4KENB 4PM8A 2QJ5A 1L3LA 4S2JA 4E3JA 2OWJA 3ZG9B 3IXGA 5A91A 1XFQA 4BBTA 5JYPA 3SH7A 1TDLA 4IBRA 4EBLA 1J3WA 4E3OA 4ETXA 1MXOA 4NETA 4B9OA 4HBUA 5TBMA 2Y91A 4PHTA 4OQGA 4JXVA 5CECA 1J9MA 3C38A 5AQ9A 3S1YA 4BBVA 2ZQCA 2V1ZA 4FSFA 3ZFZA 4HQAA 3RJUA 3UPOA 1LSVA 4OPYA 3SH9A 4UA9A 3T4OA 4IJGA 3TRCA 2R78A 3OOVA 3G6OA 2Y59A 5AVEA 2G2UA 4IUKA 3SW1A 3MBZA 1TS0A 1ZKJA 3B42A 1H8MA 3CUEC 1YPRA 2OLUA 5KMWA 2D02A 2XA7S 4HP4A 5CGSA 4BLMA 3KSHA 4GD8A 3UB5P 2ZMVA 3BJNA 5DKKA 3KYEA 3ZHHA 3O88A 5IT5A 4JKTA 2JBFA 3IWIA 4H6JB 5F68A 5CTMA 5CGWA 1YLZA 1VB6A 1NY0A 3LIDA 5FI2A 3GRJA 2JC7A 1SDNA 3PR6A 4KUOA 4KZBA 3OPLA 5M19A 3H82A 1XJ2A 1BLSA 4MN7A 4MBHA 1LL9A 4ZTKA 3JPUA 2OOLA 4X68A 1WYBA 3MZEA 1MWSA 2ZMAA 3LY3A 4EWFA 3BLMA 2W1TB 1NXYA 1Q2QA 4Z1WA 4MN6A 4X6TA 2JKGA 2VKSA 3UB9A 4Q0HA 3PAEA 3A3FA 4KUKA 4R23A 3D72A 2W3EA 4WBGA 1HD8A 2UWXA 2J3TD 2Y2GA 5GHZA 4O8GA 1OJGA 3GTCA 4NXGA 2NUTC 3IBJA 4DJ2A 4NXFA 3O86A 1V9YA 4FH4A 4MCWA 1VETB 2H28A 2KLIA 2XH9A 2GDNA 2WKEA 2M1CA 1DJBA 5AJGA 1CEFA 4DKIA 2W27A 2Y2IA 2ZC4B 2XD5A 1RGYA 4LV2A 4Y3IA 4LENA 4KZ8A 3BM6A 3TE8A 3DBAA 1C3BA 1GA0A 2H5SA 2EX6A 5G4YA 1OTAA 5EV0A 4ME4A 3Q7VB 5DTSA 4EQIA 4UHUA 3KYZA 1V9ZA 1L2SA 4HI4A 5DJTA 1G6AA 4QY6A 3UY6A 3VP1A 3GSGA 2XF3A 4XUXA 3L7HA 1YQSA 2XR0A 2J8YA 3WS4A 3PBQA 5EE8A 3K3CA 2V2FF 3IX4A 4EU0A 2VLGA 1P9RA 2ZQDA 5L09A 2C5WB 3ULFA 2JKTI 3LR3A 2XFTA 1O07A 1A0KA 4L9EA 3NOPC 2P08A 1NYYA 5M18A 3LR4A 4ZJ2A 2JKTM 4ZDXA 3UMDA 3GVBA 1T1CA 1LSXA 5HPFA 5MC7A 3IXDA 3VFFA 4CJNA 1FILA 2Y2LA 2XROA 3EWKA 5GL9A 2M7VA 4Y5FA 1NRJA 4BL2A 4GS9B 4R1GA 1ERQA 2WGWB 1LI0A 3CJMA 3D3OA 1X0OA 3IF6B 3G2ZA 1S1ZA 5FI7A 3C7VA 1DP9A 1K55A 1WE4A 4OLDA 4GD6A 4FTXA 4MMNA 4S2IA 1BLPA 5U47A 4DE0A 5HSQA 3EGXC 3GDIA 2PRFA 4GZBA 4LLOB 5FQMA 4P85A 3LR0A 3LEZA 5EFWA 4JGOA 4OONA 3PHYA 2XLNA 1FR1A 3Q1FA 2X01A 4CLCE 1FSYA 4R3JA 1N9OA 3R7WA 1ZC2A 1MKMA 1ODVA 4DF6A 3P09A 4R3AA 2HP9A 2VGJA 3F1OA 1L0FA 4QHCA 5D3OA 2WYXA 4PPRA 2W3DA 2KOIA 3OC2A 1MWRA 3UE1A 5TGFA 4YOFA 3GR2A 1H3QA 3KX0X 1FR6A 3LI8A 2VZWA 3C7UA 5FQ9A 1QMFA 3BFGA 2V1BA 2PAVP 3RFBA 3OBFA 4XUZA 1HLUP 5HAPA 4AFIA 5KIZA 3PXPA 5IS1A 1NRFA 4S2LA 4ETZA 4R4RA 5FASA 3A3IA 4BBUA 1BT5A 2INWA 3UO9A 2DNSA 2Y2HA 2P04A 3UDIA 1W79A 3NJAA 1K4EA 2EX2A 3G2YA 1JWVA 3HVFA 4CQHA 3WS5A 3VE4A 3GQZA 4HH2A 1MKIA 3NDEA 1ERMA 4UA6A 2K2NA 3FYZA 4QY5A 3BQ8A 3F1NA 1K4FA 3BFFA 1NLYA 2ZQAA 4LCMA 5C5KA 3P98A 4N1HA 5HD5A 3UPPA 3K2NA 4GHIA 1VEUA 5A8BA 5DFXA 4OH0A 1LHYA 1BUEA 4KQQA 1MPLA 3HREA 1OTEA 4JXGA 2Y8HA 4UEYA 3WS2A 1ACFA 5F6AA 2PDRA 4X1LA 5J4EA 3W2ZA 4F3LB 1IYSA 4I38A 2XGNA 2EXBA 1K6RA 4GLQA 2JE5A 3JVVA 2FFFB 1E3UD 3DTEA 2VX8A 4E3MA 4GDNA 3V5MA 4R38A 4ARZB 4BWIA 2Q9NA 3RXWA 5L2FA 5HDDA 5CEBA 1SHVA 1BZAA 2XSSA 4A5RA 3MSHA 3DTIA 2B02A 2PR5A 4UQIS 5EVEA 4P0MA 1ZTUA 4Z9QA 1FIKA 2BLSA 2P74A 4PM9A 3LIEA 3MQOA 3N8SA 3NBLA 1K54A 4R3BA 3T1RA 2M7UA 1ES2A 3LI9A 4MDZA 5TFQA 4JF6A 3TOIA 2J80A 1F9IA 4S2KA 1FQGA 1BLCA 2V0WA 1KGGA 2J9OA 4I3IA 3B3XA 4M3KA 2PHYA 3DW0A 3HUMA 3MKFA 5FQQA 1Y54A 3OCNA 2KX6A 1PWDA 5FI6A 3D9YA 2QZ6A 2W3HA 5DFYA 4JGRA 3D4FA 2QJ7A 3EQVA 4OP8A 3KSIA 4P6ZS 4HOIA 4BENA 1KVMA 1XKZA 1N9BA 4OPQA 3BWLA 3H7WA 3KO6A 4X55A 1KE0A 1NZOA 1ESUA 1GSXA 1Y4OA 5FQIA 4O0PA 3ZG7B 3LCEA 1KE4A 1IYPA 1CK3A 4ZJ3A 1MBLA 2EA9A 3MMHA 1W8QA 4LGWA 5HWTA 1XA7A 4OOLA 4KZ3A 2QPNA 4ESPA 2WKHA 3NC8A 3MF0A 3BECA 3IX3A 3MFDA 2WADA 3QNBA 1Z09A 4CLCB 1ESIA 5EUAA 4LV3A 5CTNA 4E3IA 2V9AA 2PYPA 2HDSA 4MN5A 3U2AA 4Y15A 2HZ5A 3DWKA 3UN7A 3FKVA 5FEFA 3WRZA 3F1PB 4UQIM 2P7JA 1XJ6A 4WMCD 3C8CA 2ZM2A 4HJ3A 2VA0A 3T1SA 3IT9A 4JGPA 4BD1A 4DE3A 4DE2A 3WS1A 3S7NA 3ITAA 5EVLA 3FZCA 3QP8A 5AVFA 5HD3A 5E2EA 1K55C 3O87A 5HDSA 2Y2PA 1DJCA 1XFNA 2WKQA 1DP8A 2J9PA 4X25A 4DDYA 4HIAA 4JGQA 2GJ3A 4MBKA 2EXAA 2QYBA 2HGVA 1EW0A 3K3DA 3KYQA 3T4KA 3MXQA 1E25A 2DRWA 4Y7PA 4DDSA 2P9VB 3ZYTA 2XQZA 4P6ZM 2HP5A 2VJWA 3LEQA 5JYOA 4NXBA 1K6SA 1LT0A 3CPTB 2E8JA 2HDRA 2GX5A 2ZJ9A 2JN7A 1YLPA 4I5SA 2FH5A 3NDGA 3VMAA 3ZDJA 3IXBA 3ZG8B 3BYDA 2B95A 4NG2A 2QMIA 3CMZA 3TW8A 3UPNA 2V0UA 2V1AA 2D01A 3E4PA 1GA9A 3LUQA 2XK1A 2GNXA 4Q0IA 3E4QA 1KGFA 1KVLA 4QJGA 3S7OA 4CLCD 3HLBA 3IBRA 2W3GA 5AQ7A 3IF5A 3E2KA 1G28A 3VE3A 3NOUC 3PYPA 1JTDA 4N9LA 4IVIA 5CHMA 3T50A 4D60A 2ZQ7A 2BASA 3HCYA 1EWZA 3V39A 3FWLA 2A2LA 4II7A 3TG9A 3G30A 4BQMA 1PIOA 1TDGA 3IXHA 3WRTA 3QP4A 1CF0A 3MS6A 4GOGA 2OAQ1 3P01A 1E3UA 1ES5A 3KSGA 4EW7A 1GHMA 2EWWA 3G4PA 2J3WA 2V8CA 3EGDC 3MZDA 1F98A 5E43A 1EI5A 2OWHA 3BW6A 2QHKA 1XP4A 1S4SA 2I72A 4Y0TA 5EM0A 2I9VA 4D2OA 2VV8A 3LGOA 1W8YA 5GLBA 5FQKA 4PM5A 4Y13A 1KDSA 4OQIA 2WAFA 3QHYA 5CX7A 3ZG5A 5BOHA 4FH2A 1KGEA 4BD0A 1SKOA 4QU3A 4Y17A 3S22A 4QD4A 3BY8A 2XFSA 1BSGA 5EVIB 1PZPA 2KDKA 4DXCA 2E8IA 4U0XA 3UMEA 3PBRA 3IHBA 2EFXA 3CG5A 2ZC7A 2O9CA 5HAIA 4B4ZA 1ES3A 4BMWA 4GW9A 4JF4A 1HZOA 4RX2A 4HH3A 1K54C 1JTGA 3V3SA 4XT2A 2O0YA 4P6BA 1TEMA 2RL3A 2XRNA 5GLAA 3GV9A 1TS7A 3E2LA 3S7PA 1PFLA 2Y79A 2HJ9C 3QP1A 3UE3A 4KZ6A
chains in the Genus database with same CATH topology
3IX3A 2AVXA 1H0MA 3IX4A 2UV0E 4Y17A 1L3LA 5L09A 3QP5A 3QP2A 2Q0OA 3IX8A 5L10A 4LGWA 5L07A 4LFUA 3QP4A 4Y13A 4Y15A 4NG2A 3QP1A 3SZTA 3JPUA 3QP6A 3QP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IX3 A;  2AVX A;  1H0M A;  3IX4 A;  2UV0 E;  4Y17 A;  1L3L A;  5L09 A;  3QP5 A;  3QP2 A;  2Q0O A;  3IX8 A;  5L10 A;  4LGW A;  5L07 A;  4LFU A;  3QP4 A;  4Y13 A;  4Y15 A;  4NG2 A;  3QP1 A;  3SZT A;  3JPU A;  3QP6 A;  3QP8 A; 
#chains in the Genus database with same CATH topology
 1W7F A;  3BEB A;  2VEA A;  1K38 A;  5IHV A;  1LL8 A;  3W4Q A;  4S2O A;  4DJ3 A;  2PD8 A;  2DMW A;  2GZA A;  3N7W A;  3H82 B;  4IHQ A;  4ARZ A;  4L0L A;  3SOI A;  5I5L A;  5E2G A;  1I2W A;  3NY4 A;  4R6L A;  3CIT A;  2PR6 A;  2Y2K A;  4MLL A;  4C6Y A;  1TF1 A;  2L0W A;  3SS3 A;  1OPX A;  3ZGA B;  1CQA A;  1VM1 A;  3BLS A;  1PZO A;  3HLD A;  4HHD A;  4DN0 A;  1GHP A;  3ITB A;  1ZG6 A;  2HJE A;  5HPI A;  1NZU A;  2DCF A;  2B5R A;  3VSL A;  4WMC A;  5G18 A;  2V20 A;  2B18 A;  1KOU A;  1PI5 A;  1ZHH B;  4ZRR A;  4R0Q A;  3LIA A;  4N9K A;  2XDM A;  2MJ6 A;  3G31 A;  5DVA A;  1HVB A;  1YLT A;  4X1M A;  2ZM0 A;  4OVD A;  1MWT A;  5EVI D;  1TS6 A;  2VK3 A;  4E3N A;  2VV7 A;  1LLB A;  3LYX A;  4KZ5 A;  4QB8 A;  4KZ7 A;  4E6X A;  3O5Y A;  1NLZ A;  4GNU A;  5A92 A;  3LO7 A;  4FOF A;  4H8R A;  1YAX A;  5E2H A;  4WEL A;  3ZQ5 A;  2L1M A;  3CWF A;  4Y2F A;  1F5M A;  2ZMF A;  3DAV A;  5EOO A;  2WUQ A;  3NUL A;  1YLW A;  2A24 A;  4WZ5 A;  2WZX A;  4PKY G;  2Y55 A;  4KQO A;  1P97 A;  1M6K A;  4OOY A;  3A0S A;  1Y28 A;  4DMZ A;  2UV0 E;  4S2N A;  4KG5 A;  3IS2 B;  2HP6 A;  3VOZ A;  1BYW A;  4K0X A;  4NKP A;  4K91 A;  4KG6 A;  5FA7 A;  3LR5 A;  1IEL A;  4IVK A;  3HJK A;  4GB7 A;  5EOE A;  1L0D A;  4WZ4 A;  4EBN A;  3W4O A;  4WN5 A;  4I3J A;  3T4L A;  5IU1 A;  3OPP A;  3PBT A;  2VGL S;  4GCZ A;  3E98 A;  2WGI A;  4CLC A;  3NOT C;  1D1J A;  3A3E A;  4LV0 A;  1CEG A;  2X71 A;  2W0N A;  4OKP A;  4EBP A;  1GCE A;  1VQQ A;  3MR0 A;  4B88 A;  4K0W A;  2FFY A;  4WEK A;  3FPV A;  5CHJ A;  4KG2 A;  1IOU A;  4CPK A;  5HW3 A;  3UDX A;  5GLD A;  5F83 A;  3BRM A;  1N9L A;  4QWO A;  3IWQ A;  4S2P A;  2G2W A;  2Y2J A;  1CI9 A;  3O3V A;  2O9A A;  3TJZ C;  3S7Q A;  4OLG A;  3BFC A;  5EM1 A;  4GDB A;  5A90 A;  3FKW A;  1YT4 A;  4FD8 A;  1MC0 A;  2V8F A;  3HLW A;  3LY4 A;  3ZCZ A;  3BQA A;  1DP6 A;  1S4R A;  4FUW A;  1K25 A;  1OME A;  1YLY A;  2H0T A;  2HPB A;  1PW1 A;  2O99 A;  1NWZ A;  4H6J A;  5J3W A;  4KQR A;  4WEJ A;  1UWN X;  3I7J A;  1XPB A;  3P7N A;  2PU2 A;  2QKP A;  3EEA A;  2IWB A;  3IH9 A;  3R7W B;  3SS4 A;  3FG8 A;  3VOL A;  1SCW A;  3UE0 A;  2WKR A;  2WGV A;  1H8Z A;  1W63 M;  2JKR I;  3F1O B;  3BY9 A;  4Y0U A;  1S67 L;  1PI4 A;  2X02 A;  3V67 A;  3OPH A;  1CI8 A;  3N8R A;  4KQD A;  5L10 A;  3LIF A;  2JKR M;  2W1T A;  5CED A;  2HV1 A;  5K5B A;  3BFE A;  3GEC A;  3HJI A;  1JVJ A;  3CI6 A;  4ZBE A;  4B4X A;  5AQA A;  3LIB A;  3VSK A;  1CJF A;  5KSH A;  2VGL M;  2LB9 A;  3SH8 A;  4F94 A;  3Q81 A;  4I39 A;  3A3D A;  5DKL A;  4HP9 A;  3QP6 A;  3VP4 A;  2Y2Q A;  3ZNY A;  3C5A A;  5DF9 A;  1VET A;  1W5D A;  1DY6 A;  4LV1 A;  4KZ9 A;  4YFM A;  4K08 A;  3E0Y A;  4LRZ E;  3VOY A;  3T4S A;  3MXS A;  2PBY A;  4BL3 A;  4HJ6 A;  1VEU B;  5HWV A;  4PKY A;  2VV6 A;  4BJP A;  2Z2L B;  3N6I A;  3ZVT A;  4IBX A;  3ZVW A;  3FC7 A;  2EFU A;  4JXW A;  3ZNT A;  1S0W A;  5FDH A;  2ZL1 B;  3Q7V A;  3NHQ A;  1S1Y A;  1I2S A;  1M40 A;  5FQJ A;  1YMX A;  5L8M A;  2WZZ A;  3HL9 A;  1IYO A;  3UB6 A;  5M1A A;  2R9X A;  5F82 A;  4I3A A;  2Q9M A;  5EVI A;  5FL3 A;  2ZC5 B;  2HDU A;  1T1B A;  1T19 A;  3A0R A;  1MZU A;  4L9F A;  2RCX A;  4HEF A;  5HL6 A;  3M6H A;  4UAA A;  2H10 A;  4EEP A;  5CER A;  4IED A;  4GKU A;  2OAP 1;  4G3W A;  1BUL A;  3EQU A;  3SS5 A;  4XXR A;  3HLG A;  2Z2M B;  4U3T A;  5TJJ A;  3HLC A;  1UGU A;  3QNC A;  1ES4 A;  1IEM A;  3N8L A;  3HUN A;  2JHE A;  5HAQ A;  2QWS A;  4GS9 A;  1H5X A;  1N9N A;  4ID4 A;  2ZQ8 A;  4O01 A;  5J7E A;  3RH8 B;  1YKD A;  4WYY A;  2WGW A;  4E04 A;  3EEH A;  1KDW A;  5AQB A;  3Q82 A;  2FZ0 A;  3IF6 A;  4OPZ A;  4QPR A;  4EER A;  2EX9 A;  3DTM A;  5J8X A;  5EPH A;  1NYM A;  1FCN A;  4ZAM A;  4EET B;  3DWZ A;  2HF6 A;  2YKH A;  1LI9 A;  4WF0 A;  1K56 D;  1WYC A;  3PTE A;  5FAP A;  3VFH A;  2R9W A;  3U4L P;  2Y4A A;  4WZ5 C;  3LIC A;  3H7W B;  1XJ3 A;  3HLF A;  1YM1 A;  3IQA A;  5DTK A;  1PYY A;  4S2N C;  2YKF A;  2JKF A;  4RYE A;  1NJ4 A;  3H9W A;  4MNR A;  2O9B A;  3E4O A;  3T1X A;  3UNW A;  3VV4 A;  2ZC6 B;  3T4Q A;  4JPM A;  4EV4 A;  1FOF A;  5LBR A;  3CHW P;  3WWX A;  4LRX C;  3MXR A;  1P0Z A;  1G68 A;  3NI9 A;  3PAG A;  4HES A;  1IKI A;  4G3V A;  1OT9 A;  1AWI A;  4HNB A;  4CLC C;  1PNE A;  1FCM A;  3JVU A;  1G6O A;  5F1F A;  1AXB A;  1D7E A;  4Q0J A;  4C75 A;  2WK0 A;  5TBM B;  4WL9 A;  2A49 A;  3TSG A;  2Y2N A;  3OCL A;  2J3T C;  5I94 A;  1JWZ A;  1SDE A;  2A3U A;  2XA7 M;  1SKF A;  1UWP X;  4S2M A;  3G34 A;  3FV7 A;  4NK3 A;  1K57 A;  3IX8 A;  4LPZ A;  1PWG A;  1YSQ A;  3IS2 A;  4LCL A;  1XXM A;  3Q07 A;  1I5Q A;  3N4I A;  3T4J A;  1OTD A;  1STZ A;  2Z6D A;  3KSF A;  3PBN A;  4OPR A;  3ZG0 A;  4WLA A;  4L9G A;  2PD7 A;  3UDF A;  3L9K A;  1TVF A;  3B33 A;  5A93 A;  4RA7 A;  1K0K A;  1L0G A;  3IHA A;  4O7D A;  4UA7 A;  3S4X A;  3FPW A;  1OTI A;  2OLV A;  3VP3 A;  4WM9 A;  4IUH A;  4F3L A;  1GSV A;  4WUJ A;  3MKE A;  5CRF A;  2OV5 A;  4YWZ A;  5F1G A;  3HUO A;  1VHM A;  3WS0 A;  3IWO A;  4EUZ A;  1Q2P A;  1L0E A;  1GHI A;  1PW8 A;  4NXE A;  4OP5 A;  2Z6C A;  2ZOI A;  3V50 A;  5HAR A;  1N4O A;  4EXO A;  2AVX A;  4E6W A;  4X53 A;  3HLE A;  1KE3 A;  4E3L A;  3T4T A;  1E4D A;  3CUE A;  5FAO A;  2OSU A;  4E3K A;  5FAT A;  4HY8 A;  4G3K A;  2VGK A;  1YSP A;  4MBF A;  4R4S A;  4RQ9 A;  1BLH A;  3V3R A;  3JYI A;  4OQH A;  1W63 Q;  5CGX A;  4R70 A;  1ZG4 A;  5GHX A;  4X69 A;  2HDQ A;  5GHY A;  1H0M A;  3IH8 A;  4ZJ1 A;  3VP2 A;  3W4P A;  3UB8 A;  4B93 A;  2EX8 A;  2CMN A;  4LFU A;  4X56 A;  3UB7 A;  3NEC A;  3RTY A;  2NUP C;  2BG1 A;  2ZM8 A;  4DRT A;  3SZT A;  1ALQ A;  5G4Z A;  3ISG A;  1LSW A;  2EWV A;  1RCJ A;  4GJ4 A;  1P9W A;  1IKG A;  3M2K A;  5FSR A;  4RX3 A;  3HBR A;  4OQ0 A;  4HJ4 A;  4EUV A;  2BTF P;  1S6R A;  4EEU A;  5FEG A;  4Q8I A;  1SZV A;  5DJU A;  3C4P A;  3MJQ A;  4FCF A;  3T1Q B;  1DRM A;  4JBF A;  5HX9 A;  3M6B A;  3G35 A;  3UE6 A;  5FDS A;  2Y2O A;  2PBD P;  2Q0O A;  1GSW A;  1Z6F A;  3MQ0 A;  2ZQ9 A;  1FSW A;  3A0V A;  4DXB A;  4N92 A;  3NIA A;  1SKO B;  2G7U A;  3ICY A;  4Y0O A;  5F69 A;  3AGE A;  3EOI A;  1XX2 A;  2WKP A;  4EES A;  1U60 A;  1RGZ A;  2ACG A;  5TR7 A;  5EVI C;  5FAQ A;  5DTT A;  1IYQ A;  1ONG A;  4M4X A;  3MQQ A;  2ZLY A;  5DF8 A;  1K56 A;  2K31 A;  3Q7Z A;  4LRY C;  5KSC A;  3AGD A;  3AGF A;  1G5U A;  2XD1 A;  3OPR A;  4XT2 B;  1TD5 A;  3CZD A;  1IFQ A;  1PRQ A;  1MWU A;  1T1A A;  3F1P A;  5CHU A;  2XEP A;  4C3Q A;  3W8K A;  1ONH A;  1BTL A;  2K7S A;  2LB5 A;  4JF5 A;  5HWW A;  3B47 A;  4JXS A;  2ZL1 A;  3MZF A;  1JWP A;  2WKI A;  3IF6 C;  1YLJ A;  5HZH A;  2ZOH A;  3QP5 A;  3VP0 A;  3OZH A;  3GMW A;  3M2J A;  1S66 L;  3C4O A;  2W1R A;  3OLO A;  3RXX A;  3LFV A;  5EEC A;  2PT7 A;  3G32 A;  4EQ1 A;  1O7E A;  2P9V A;  3PBS A;  4HBT A;  1OTB A;  3NCK A;  4DE1 A;  3C2W A;  5HL1 A;  1TS8 A;  1F2K A;  2PU4 A;  2PYR A;  5L07 A;  2IWC A;  3CPT A;  2H0Y A;  2IWD A;  2IA2 A;  5CXW A;  4JLF A;  3CAX A;  3DTK A;  3CLO A;  4PAU A;  4P87 A;  5HDC A;  1FCO A;  1MY8 A;  5DF7 A;  1RP5 A;  2JCH A;  3QP2 A;  1T18 A;  1PWC A;  4PM6 A;  2WAE A;  2L4R A;  5F5Y A;  4PMA A;  4N1X A;  2C6W B;  2W3F A;  4U0T A;  1D06 A;  3R4K A;  2ZC3 B;  2A24 B;  2CC1 A;  4KZA A;  4YNR A;  4PM7 A;  1ERO A;  4MEZ A;  1WA9 A;  1OJ5 A;  3MFX A;  3C30 A;  1K57 C;  3BFD A;  1XJ4 A;  1H8Y A;  1XGI A;  1XA1 A;  1JNU A;  2J7V A;  3A3J A;  2Y2M A;  4RVA A;  1LL5 A;  1XGJ A;  3T12 B;  3F1N B;  5E2F A;  1QME A;  2ZBB A;  4NEE D;  4OOM A;  1HTZ A;  2ZD8 A;  1YMS A;  5GLC A;  4GHI B;  5KZH A;  5HFO A;  4YIN A;  3PBO A;  4GN2 A;  1DJA A;  4KZ4 A;  1OT6 A;  4KEN B;  4PM8 A;  2QJ5 A;  1L3L A;  4S2J A;  4E3J A;  2OWJ A;  3ZG9 B;  3IXG A;  5A91 A;  1XFQ A;  4BBT A;  5JYP A;  3SH7 A;  1TDL A;  4IBR A;  4EBL A;  1J3W A;  4E3O A;  4ETX A;  1MXO A;  4NET A;  4B9O A;  4HBU A;  5TBM A;  2Y91 A;  4PHT A;  4OQG A;  4JXV A;  5CEC A;  1J9M A;  3C38 A;  5AQ9 A;  3S1Y A;  4BBV A;  2ZQC A;  2V1Z A;  4FSF A;  3ZFZ A;  4HQA A;  3RJU A;  3UPO A;  1LSV A;  4OPY A;  3SH9 A;  4UA9 A;  3T4O A;  4IJG A;  3TRC A;  2R78 A;  3OOV A;  3G6O A;  2Y59 A;  5AVE A;  2G2U A;  4IUK A;  3SW1 A;  3MBZ A;  1TS0 A;  1ZKJ A;  3B42 A;  1H8M A;  3CUE C;  1YPR A;  2OLU A;  5KMW A;  2D02 A;  2XA7 S;  4HP4 A;  5CGS A;  4BLM A;  3KSH A;  4GD8 A;  3UB5 P;  2ZMV A;  3BJN A;  5DKK A;  3KYE A;  3ZHH A;  3O88 A;  5IT5 A;  4JKT A;  2JBF A;  3IWI A;  4H6J B;  5F68 A;  5CTM A;  5CGW A;  1YLZ A;  1VB6 A;  1NY0 A;  3LID A;  5FI2 A;  3GRJ A;  2JC7 A;  1SDN A;  3PR6 A;  4KUO A;  4KZB A;  3OPL A;  5M19 A;  3H82 A;  1XJ2 A;  1BLS A;  4MN7 A;  4MBH A;  1LL9 A;  4ZTK A;  3JPU A;  2OOL A;  4X68 A;  1WYB A;  3MZE A;  1MWS A;  2ZMA A;  3LY3 A;  4EWF A;  3BLM A;  2W1T B;  1NXY A;  1Q2Q A;  4Z1W A;  4MN6 A;  4X6T A;  2JKG A;  2VKS A;  3UB9 A;  4Q0H A;  3PAE A;  3A3F A;  4KUK A;  4R23 A;  3D72 A;  2W3E A;  4WBG A;  1HD8 A;  2UWX A;  2J3T D;  2Y2G A;  5GHZ A;  4O8G A;  1OJG A;  3GTC A;  4NXG A;  2NUT C;  3IBJ A;  4DJ2 A;  4NXF A;  3O86 A;  1V9Y A;  4FH4 A;  4MCW A;  1VET B;  2H28 A;  2KLI A;  2XH9 A;  2GDN A;  2WKE A;  2M1C A;  1DJB A;  5AJG A;  1CEF A;  4DKI A;  2W27 A;  2Y2I A;  2ZC4 B;  2XD5 A;  1RGY A;  4LV2 A;  4Y3I A;  4LEN A;  4KZ8 A;  3BM6 A;  3TE8 A;  3DBA A;  1C3B A;  1GA0 A;  2H5S A;  2EX6 A;  5G4Y A;  1OTA A;  5EV0 A;  4ME4 A;  3Q7V B;  5DTS A;  4EQI A;  4UHU A;  3KYZ A;  1V9Z A;  1L2S A;  4HI4 A;  5DJT A;  1G6A A;  4QY6 A;  3UY6 A;  3VP1 A;  3GSG A;  2XF3 A;  4XUX A;  3L7H A;  1YQS A;  2XR0 A;  2J8Y A;  3WS4 A;  3PBQ A;  5EE8 A;  3K3C A;  2V2F F;  3IX4 A;  4EU0 A;  2VLG A;  1P9R A;  2ZQD A;  5L09 A;  2C5W B;  3ULF A;  2JKT I;  3LR3 A;  2XFT A;  1O07 A;  1A0K A;  4L9E A;  3NOP C;  2P08 A;  1NYY A;  5M18 A;  3LR4 A;  4ZJ2 A;  2JKT M;  4ZDX A;  3UMD A;  3GVB A;  1T1C A;  1LSX A;  5HPF A;  5MC7 A;  3IXD A;  3VFF A;  4CJN A;  1FIL A;  2Y2L A;  2XRO A;  3EWK A;  5GL9 A;  2M7V A;  4Y5F A;  1NRJ A;  4BL2 A;  4GS9 B;  4R1G A;  1ERQ A;  2WGW B;  1LI0 A;  3CJM A;  3D3O A;  1X0O A;  3IF6 B;  3G2Z A;  1S1Z A;  5FI7 A;  3C7V A;  1DP9 A;  1K55 A;  1WE4 A;  4OLD A;  4GD6 A;  4FTX A;  4MMN A;  4S2I A;  1BLP A;  5U47 A;  4DE0 A;  5HSQ A;  3EGX C;  3GDI A;  2PRF A;  4GZB A;  4LLO B;  5FQM A;  4P85 A;  3LR0 A;  3LEZ A;  5EFW A;  4JGO A;  4OON A;  3PHY A;  2XLN A;  1FR1 A;  3Q1F A;  2X01 A;  4CLC E;  1FSY A;  4R3J A;  1N9O A;  3R7W A;  1ZC2 A;  1MKM A;  1ODV A;  4DF6 A;  3P09 A;  4R3A A;  2HP9 A;  2VGJ A;  3F1O A;  1L0F A;  4QHC A;  5D3O A;  2WYX A;  4PPR A;  2W3D A;  2KOI A;  3OC2 A;  1MWR A;  3UE1 A;  5TGF A;  4YOF A;  3GR2 A;  1H3Q A;  3KX0 X;  1FR6 A;  3LI8 A;  2VZW A;  3C7U A;  5FQ9 A;  1QMF A;  3BFG A;  2V1B A;  2PAV P;  3RFB A;  3OBF A;  4XUZ A;  1HLU P;  5HAP A;  4AFI A;  5KIZ A;  3PXP A;  5IS1 A;  1NRF A;  4S2L A;  4ETZ A;  4R4R A;  5FAS A;  3A3I A;  4BBU A;  1BT5 A;  2INW A;  3UO9 A;  2DNS A;  2Y2H A;  2P04 A;  3UDI A;  1W79 A;  3NJA A;  1K4E A;  2EX2 A;  3G2Y A;  1JWV A;  3HVF A;  4CQH A;  3WS5 A;  3VE4 A;  3GQZ A;  4HH2 A;  1MKI A;  3NDE A;  1ERM A;  4UA6 A;  2K2N A;  3FYZ A;  4QY5 A;  3BQ8 A;  3F1N A;  1K4F A;  3BFF A;  1NLY A;  2ZQA A;  4LCM A;  5C5K A;  3P98 A;  4N1H A;  5HD5 A;  3UPP A;  3K2N A;  4GHI A;  1VEU A;  5A8B A;  5DFX A;  4OH0 A;  1LHY A;  1BUE A;  4KQQ A;  1MPL A;  3HRE A;  1OTE A;  4JXG A;  2Y8H A;  4UEY A;  3WS2 A;  1ACF A;  5F6A A;  2PDR A;  4X1L A;  5J4E A;  3W2Z A;  4F3L B;  1IYS A;  4I38 A;  2XGN A;  2EXB A;  1K6R A;  4GLQ A;  2JE5 A;  3JVV A;  2FFF B;  1E3U D;  3DTE A;  2VX8 A;  4E3M A;  4GDN A;  3V5M A;  4R38 A;  4ARZ B;  4BWI A;  2Q9N A;  3RXW A;  5L2F A;  5HDD A;  5CEB A;  1SHV A;  1BZA A;  2XSS A;  4A5R A;  3MSH A;  3DTI A;  2B02 A;  2PR5 A;  4UQI S;  5EVE A;  4P0M A;  1ZTU A;  4Z9Q A;  1FIK A;  2BLS A;  2P74 A;  4PM9 A;  3LIE A;  3MQO A;  3N8S A;  3NBL A;  1K54 A;  4R3B A;  3T1R A;  2M7U A;  1ES2 A;  3LI9 A;  4MDZ A;  5TFQ A;  4JF6 A;  3TOI A;  2J80 A;  1F9I A;  4S2K A;  1FQG A;  1BLC A;  2V0W A;  1KGG A;  2J9O A;  4I3I A;  3B3X A;  4M3K A;  2PHY A;  3DW0 A;  3HUM A;  3MKF A;  5FQQ A;  1Y54 A;  3OCN A;  2KX6 A;  1PWD A;  5FI6 A;  3D9Y A;  2QZ6 A;  2W3H A;  5DFY A;  4JGR A;  3D4F A;  2QJ7 A;  3EQV A;  4OP8 A;  3KSI A;  4P6Z S;  4HOI A;  4BEN A;  1KVM A;  1XKZ A;  1N9B A;  4OPQ A;  3BWL A;  3H7W A;  3KO6 A;  4X55 A;  1KE0 A;  1NZO A;  1ESU A;  1GSX A;  1Y4O A;  5FQI A;  4O0P A;  3ZG7 B;  3LCE A;  1KE4 A;  1IYP A;  1CK3 A;  4ZJ3 A;  1MBL A;  2EA9 A;  3MMH A;  1W8Q A;  4LGW A;  5HWT A;  1XA7 A;  4OOL A;  4KZ3 A;  2QPN A;  4ESP A;  2WKH A;  3NC8 A;  3MF0 A;  3BEC A;  3IX3 A;  3MFD A;  2WAD A;  3QNB A;  1Z09 A;  4CLC B;  1ESI A;  5EUA A;  4LV3 A;  5CTN A;  4E3I A;  2V9A A;  2PYP A;  2HDS A;  4MN5 A;  3U2A A;  4Y15 A;  2HZ5 A;  3DWK A;  3UN7 A;  3FKV A;  5FEF A;  3WRZ A;  3F1P B;  4UQI M;  2P7J A;  1XJ6 A;  4WMC D;  3C8C A;  2ZM2 A;  4HJ3 A;  2VA0 A;  3T1S A;  3IT9 A;  4JGP A;  4BD1 A;  4DE3 A;  4DE2 A;  3WS1 A;  3S7N A;  3ITA A;  5EVL A;  3FZC A;  3QP8 A;  5AVF A;  5HD3 A;  5E2E A;  1K55 C;  3O87 A;  5HDS A;  2Y2P A;  1DJC A;  1XFN A;  2WKQ A;  1DP8 A;  2J9P A;  4X25 A;  4DDY A;  4HIA A;  4JGQ A;  2GJ3 A;  4MBK A;  2EXA A;  2QYB A;  2HGV A;  1EW0 A;  3K3D A;  3KYQ A;  3T4K A;  3MXQ A;  1E25 A;  2DRW A;  4Y7P A;  4DDS A;  2P9V B;  3ZYT A;  2XQZ A;  4P6Z M;  2HP5 A;  2VJW A;  3LEQ A;  5JYO A;  4NXB A;  1K6S A;  1LT0 A;  3CPT B;  2E8J A;  2HDR A;  2GX5 A;  2ZJ9 A;  2JN7 A;  1YLP A;  4I5S A;  2FH5 A;  3NDG A;  3VMA A;  3ZDJ A;  3IXB A;  3ZG8 B;  3BYD A;  2B95 A;  4NG2 A;  2QMI A;  3CMZ A;  3TW8 A;  3UPN A;  2V0U A;  2V1A A;  2D01 A;  3E4P A;  1GA9 A;  3LUQ A;  2XK1 A;  2GNX A;  4Q0I A;  3E4Q A;  1KGF A;  1KVL A;  4QJG A;  3S7O A;  4CLC D;  3HLB A;  3IBR A;  2W3G A;  5AQ7 A;  3IF5 A;  3E2K A;  1G28 A;  3VE3 A;  3NOU C;  3PYP A;  1JTD A;  4N9L A;  4IVI A;  5CHM A;  3T50 A;  4D60 A;  2ZQ7 A;  2BAS A;  3HCY A;  1EWZ A;  3V39 A;  3FWL A;  2A2L A;  4II7 A;  3TG9 A;  3G30 A;  4BQM A;  1PIO A;  1TDG A;  3IXH A;  3WRT A;  3QP4 A;  1CF0 A;  3MS6 A;  4GOG A;  2OAQ 1;  3P01 A;  1E3U A;  1ES5 A;  3KSG A;  4EW7 A;  1GHM A;  2EWW A;  3G4P A;  2J3W A;  2V8C A;  3EGD C;  3MZD A;  1F98 A;  5E43 A;  1EI5 A;  2OWH A;  3BW6 A;  2QHK A;  1XP4 A;  1S4S A;  2I72 A;  4Y0T A;  5EM0 A;  2I9V A;  4D2O A;  2VV8 A;  3LGO A;  1W8Y A;  5GLB A;  5FQK A;  4PM5 A;  4Y13 A;  1KDS A;  4OQI A;  2WAF A;  3QHY A;  5CX7 A;  3ZG5 A;  5BOH A;  4FH2 A;  1KGE A;  4BD0 A;  1SKO A;  4QU3 A;  4Y17 A;  3S22 A;  4QD4 A;  3BY8 A;  2XFS A;  1BSG A;  5EVI B;  1PZP A;  2KDK A;  4DXC A;  2E8I A;  4U0X A;  3UME A;  3PBR A;  3IHB A;  2EFX A;  3CG5 A;  2ZC7 A;  2O9C A;  5HAI A;  4B4Z A;  1ES3 A;  4BMW A;  4GW9 A;  4JF4 A;  1HZO A;  4RX2 A;  4HH3 A;  1K54 C;  1JTG A;  3V3S A;  4XT2 A;  2O0Y A;  4P6B A;  1TEM A;  2RL3 A;  2XRN A;  5GLA A;  3GV9 A;  1TS7 A;  3E2L A;  3S7P A;  1PFL A;  2Y79 A;  2HJ9 C;  3QP1 A;  3UE3 A;  4KZ6 A; 
#chains in the Genus database with same CATH homology
 3IX3 A;  2AVX A;  1H0M A;  3IX4 A;  2UV0 E;  4Y17 A;  1L3L A;  5L09 A;  3QP5 A;  3QP2 A;  2Q0O A;  3IX8 A;  5L10 A;  4LGW A;  5L07 A;  4LFU A;  3QP4 A;  4Y13 A;  4Y15 A;  4NG2 A;  3QP1 A;  3SZT A;  3JPU A;  3QP6 A;  3QP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...