3IX3A

Lasr-oc12 hsl complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
163
structure length
163
Chain Sequence
FLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKDSQDYENAFIVGNYPAAWREHYDRAGYARVDPTVSHCTQSVLPIFWEPSIYQTRKQHEFFEEASAAGLVYGLTMPLHGARGELGALSLSVEAENRAEANRFMESVLPTLWMLKDYALQSGAGLAFEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional activator protein lasR
publication title LasR-OC12 HSL complex
rcsb
source organism Pseudomonas aeruginosa
total genus 57
structure length 163
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03472 Autoind_bind Autoinducer binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.80 Alpha Beta 2-Layer Sandwich Beta-Lactamase Transcription factor LuxR-like, autoinducer-binding domain 3ix3A00
3QP6A 5L07A 3QP2A 2Q0OA 3QP4A 4Y13A 3QP5A 1L3LA 2AVXA 3IX4A 4LFUA 4LGWA 5L10A 2UV0E 3IX3A 3IX8A 3QP1A 1H0MA 5L09A 4Y17A 4NG2A 3QP8A 4Y15A 3JPUA 3SZTA
chains in the Genus database with same CATH superfamily
4I3IA 3I7JA 2IA2A 3E0YA 1SZVA 3HREA 3ITBA 1VHMA 3OPPA 3F1NB 4MBFA 4R0QA 5AVFA 4R23A 3HLFA 4BBVA 3UB5P 5CGSA 2JBFA 3ZG5A 5AQ7A 4N92A 4UQIM 5FATA 3QP6A 4EU0A 1ZC2A 2J9PA 2XGNA 3MF0A 5CHJA 5DTTA 4GB7A 2ZQ7A 3EEHA 5J3WA 2GX5A 2WZXA 5GLBA 4FSFA 4ZJ1A 4WM9A 3KX0X 2W1RA 4BD0A 5DFXA 4IHQA 2EX6A 2PAVP 3WS5A 1T18A 2ACGA 3LR5A 1TS7A 1L0EA 3HL9A 4PHTA 4O0PA 4X6TA 1S4SA 3HLWA 3BQAA 5CERA 4KZ3A 3LY4A 4X25A 3A3EA 1MC0A 2CMNA 1GA9A 3NBLA 1F2KA 5TFQA 5CX7A 4S2NA 4C3QA 4E3MA 5A92A 2ZL1A 5GHYA 1N9LA 4EESA 3UPPA 2ZQAA 4HEFA 2B95A 1JWZA 3B33A 4BMWA 3E4PA 1Q2QA 3FV7A 1HTZA 4GS9A 4I3AA 4MN6A 1VB6A 1PNEA 3G34A 1L0FA 5FEGA 5KIZA 1Y28A 4JBFA 1Y54A 3NC8A 3ZG7B 1S66L 5HARA 1OTAA 2IWBA 4NXGA 4Y3IA 3N8SA 2O99A 4ZJ2A 4WEJA 2VX8A 1NXYA 1K6RA 4MN5A 4DE0A 2G7UA 4OQ0A 3S7NA 1IYQA 4PKYA 2ZD8A 3ZG8B 3F1PB 4JXGA 2Y2MA 1BLSA 4GKUA 2JE5A 1DJCA 4UA6A 3VE4A 3P7NA 4XT2B 2A24A 4WUJA 4B4XA 4BWIA 4C75A 4MBHA 4NETA 1BLCA 2XD1A 1FCMA 1N4OA 4D2OA 3HLDA 2Q0OA 2ZLYA 1FR6A 4PM9A 3K3CA 1KDSA 1HZOA 4S2IA 4P6ZM 1RCJA 5J4EA 3VP2A 3IHAA 3MZDA 2INWA 3LGOA 4EUVA 4MN7A 2ZBBA 2IWCA 4S2OA 2B02A 4DE1A 4R1GA 5EOOA 1ES4A 2OWHA 2ZC5B 1T19A 4KQQA 2ZQDA 3BFDA 3NOPC 4OOLA 5DJUA 3G6OA 5F82A 3CI6A 3GDIA 2ZOIA 5JYOA 5IHVA 3F1OB 3UNWA 4KZ7A 2K7SA 4OQIA 3NDEA 1NY0A 4WL9A 1EW0A 4K91A 1K56D 5CTNA 3IF5A 4GN2A 2EFXA 4DXCA 4LGWA 4OOYA 1K57C 4HNBA 1CK3A 3U4LP 4DE3A 2GJ3A 3EWKA 1IYOA 5HPFA 5I94A 1M40A 2FH5A 4MCWA 1E3UD 2J7VA 5FAPA 5CHUA 3P09A 1VEUA 3S1YA 4OQGA 1P9RA 2ZMAA 4N9LA 3C7UA 1JWVA 3IX8A 4B88A 1D7EA 1LSXA 5GLAA 5HZHA 1FOFA 1K56A 5HL1A 2VGLS 3F1NA 4P6BA 2WGIA 2M7VA 4P85A 3CPTB 2W0NA 3UPOA 2W3HA 3ZNTA 5FI7A 3EEAA 4XUXA 4DE2A 1E3UA 1QMFA 3LY3A 3R7WA 1XJ2A 1PIOA 1OJGA 2PBYA 2ZMFA 2OSUA 4EEPA 3SW1A 3IH9A 4QD4A 4OQHA 1YLWA 1BT5A 4UEYA 3MZEA 5GLDA 5HSQA 5HPIA 3LFVA 4NKPA 1ES5A 1W63Q 3KYEA 1ONGA 4K0WA 5AQ9A 5EPHA 5AJGA 1TEMA 2E8JA 3V67A 1S0WA 1CEFA 1T1CA 3OLOA 1IKIA 2JKTM 2HF6A 4LRYC 3HJIA 1NJ4A 4H8RA 4LCMA 5TBMB 3TW8A 2HGVA 4E3IA 2VKSA 4RA7A 5FQ9A 1OMEA 1J9MA 3VOZA 1YQSA 4GNUA 4P0MA 2XLNA 4GZBA 5CRFA 1I2SA 2J80A 1EWZA 1H8YA 3IBJA 4UA7A 4DN0A 3NIAA 4GLQA 4LCLA 4R38A 3R4KA 4B93A 2P74A 2VK3A 1PZOA 1ES3A 1YM1A 3Q82A 4N1XA 3DAVA 5IU1A 1ODVA 2MJ6A 4HJ6A 4DRTA 3H9WA 3T1SA 1LI0A 4ID4A 2H10A 3EGDC 2Y2JA 4R6LA 1YSPA 3C30A 3F1PA 3IWQA 2DRWA 3OOVA 1J3WA 4Q0JA 2XA7M 4DMZA 1YSQA 1PZPA 5F6AA 4Y13A 5DF9A 4ZBEA 2V20A 2H28A 3WS2A 5E2HA 2Y8HA 2PYPA 3E4OA 2CC1A 5U47A 3NI9A 4A5RA 5GHZA 1OTDA 3BEBA 5DJTA 3Q1FA 4PM8A 4KZBA 5HDSA 3K2NA 5IS1A 1FQGA 3H82B 1N9OA 4L0LA 5CXWA 3OBFA 1H0MA 4ZAMA 4R3JA 4M3KA 4IVIA 1ESUA 3WRTA 3VP1A 2J9OA 1PWCA 4KG2A 1SCWA 3FYZA 4I5SA 2HDRA 3BFGA 3ZNYA 3F1OA 5TGFA 2M1CA 1K4EA 5KSCA 3IQAA 5EUAA 3A0RA 1L0GA 5DF8A 3ISGA 5GHXA 3T1RA 4Y0TA 2BLSA 2NUTC 3RJUA 4NXFA 1ZKJA 3FG8A 5TR7A 3ULFA 3D9YA 4HP9A 4DJ3A 2V0WA 4FCFA 4OH0A 3PAEA 1LSVA 1T1AA 4JF4A 3MKEA 4LV2A 4ETZA 2EA9A 3Q81A 2R9XA 2EX2A 3W4PA 1CJFA 5FQIA 1W7FA 3QHYA 3N4IA 4KENB 4XXRA 3UE1A 2PBDP 3ITAA 2P7JA 3ZGAB 2EFUA 1LHYA 2A2LA 3PBRA 3N7WA 1KDWA 4ZDXA 1NRFA 3C38A 3OCLA 1PWGA 1SDNA 4R3AA 4WF0A 5F5YA 3CPTA 3E98A 1TS8A 1XX2A 3SH9A 4L9EA 1UWNX 3IXBA 4Y15A 4GOGA 3HLEA 2EX9A 2XF3A 3RTYA 2J3WA 3HBRA 4GW9A 4ZJ3A 3NHQA 1KE4A 1I5QA 3T4LA 2QKPA 3EGXC 2WK0A 1G6OA 3T4OA 4Y2FA 1DP8A 4KG5A 4DDSA 3A3IA 4B9OA 1K25A 3G35A 5FDSA 4BD1A 4HH2A 1W63M 2Y91A 2K2NA 3CITA 5EVIB 4AFIA 1STZA 3FKVA 4P6ZS 3NECA 2I9VA 3BECA 3WS4A 4F3LA 4X53A 1YLJA 3NJAA 2EXAA 2OWJA 3DTMA 2JCHA 1GHPA 5IT5A 3LEZA 5M18A 3LR3A 3H7WB 1IOUA 2WAEA 2HDSA 3GTCA 1XKZA 2O9BA 1XFNA 1N9BA 1ALQA 3BFCA 3FPVA 1KE3A 2GDNA 3PAGA 1XA1A 1F98A 1S6RA 1YLPA 5FQMA 3QP5A 3TG9A 4U0TA 4QU3A 4LPZA 5M1AA 1Q2PA 2Y2NA 3BJNA 1K57A 5EECA 3DTIA 2D02A 5F68A 3S7PA 4NK3A 3VFFA 5KMWA 2Z6CA 3EQVA 4S2LA 2BASA 3PBTA 1OT6A 1TDLA 1H8ZA 4QWOA 3FC7A 1AWIA 2HP5A 5EM0A 1H8MA 4E6XA 1GSVA 1ZG4A 1PI5A 5TJJA 3O87A 1K54C 4EBPA 4CJNA 2O9AA 3C4OA 5E2GA 2KOIA 3M2JA 3KO6A 3UY6A 1JTDA 4GD8A 1MKIA 2C5WB 3DTEA 1NZOA 4JXSA 4PM5A 2XDMA 2P04A 2PU4A 1KE0A 4LFUA 3UDFA 2WGWA 5A91A 3A3JA 1KOUA 1K0KA 3V3SA 2VV6A 2LB5A 4JGQA 3AGEA 3LUQA 3MQQA 3WS1A 3JYIA 1F9IA 3RFBA 2JC7A 3H82A 4YNRA 3UE3A 2V8CA 3SH8A 2M7UA 1ERQA 1MWSA 2W1TB 2BTFP 3G31A 5HAIA 4HJ3A 4ETXA 3Q7ZA 4HIAA 1FILA 3LI8A 5A8BA 3AGFA 1NZUA 2UWXA 4BENA 4N9KA 2XROA 4DDYA 1CEGA 2PDRA 2GZAA 4UA9A 3HUNA 4KZ5A 1OT9A 3MFDA 2X71A 4QY5A 1S1YA 4X55A 4OP5A 1GSXA 4RX2A 3T4SA 3IH8A 3E2KA 4OLGA 5CEBA 3LI9A 2HZ5A 3Q07A 3C4PA 4DKIA 3SS5A 1XXMA 3C2WA 2HJEA 3JVVA 2FFYA 1UWPX 1LL9A 2I72A 5LBRA 4CLCB 2WZZA 3O88A 2PYRA 4WN5A 4GCZA 3BM6A 3M2KA 3CMZA 4S2JA 1XGJA 2DCFA 3B47A 2Y2OA 3QNBA 1CI9A 2W27A 1W8QA 3OC2A 3Q7VA 3V3RA 4Y0OA 4KZ4A 2HP6A 1AXBA 1XP4A 4EETB 1VETB 4DJ2A 1MXOA 2PU2A 3CHWP 3NY4A 3LICA 2XA7S 3LIEA 4E6WA 1FCOA 2Y59A 4RVAA 3GVBA 1WE4A 3W4OA 4HOIA 4BQMA 2OV5A 3RXWA 4I39A 3UB8A 1YAXA 1MY8A 2O9CA 3T1XA 2R78A 4OP8A 1DJBA 3MJQA 2XRNA 1SKFA 4JKTA 1L2SA 3GSGA 4QPRA 2ZQ8A 2WYXA 5HWTA 2X02A 4IEDA 2O0YA 2Y55A 1RGZA 2QYBA 4MEZA 1ACFA 4QY6A 5EVLA 3PYPA 3DBAA 2PHYA 4JXWA 3IF6C 4E3KA 3VSKA 2KLIA 3HLCA 2PD8A 3T4JA 4PM6A 5AQAA 4OPYA 3TSGA 2WADA 4HI4A 2QWSA 2V1ZA 3UDXA 3OPHA 3L9KA 2XQZA 2AVXA 2WGVA 4GD6A 4R3BA 5J8XA 3EQUA 5D3OA 1IYPA 3UE6A 2K31A 4F94A 3BFEA 2EX8A 1IFQA 2KDKA 2ZQ9A 1HD8A 4K08A 5HD5A 3SS3A 4LLOB 1X0OA 4EQ1A 4BJPA 4PMAA 4I3JA 4KUOA 3DW0A 1SHVA 3JPUA 1OTEA 1BSGA 3BY8A 1PYYA 5F83A 3ZFZA 1FR1A 5J7EA 4FTXA 4PKYG 1PFLA 3W4QA 3E4QA 2YKHA 1K38A 3PBSA 3MFXA 4PAUA 1G28A 5E43A 1ESIA 2JHEA 1LT0A 1I2WA 1F5MA 4R70A 3HJKA 2Y2GA 3UB6A 5CHMA 1GHIA 1GSWA 5L10A 4HQAA 2FZ0A 4OPZA 2A3UA 3HCYA 2B18A 2W1TA 4WZ5C 1DY6A 3LR4A 5EOEA 4XT2A 3OPRA 3VFHA 2ZM8A 3IX4A 1MWTA 4DXBA 1GCEA 3MQ0A 4CLCE 1P0ZA 2PR6A 1V9ZA 4Y17A 2VZWA 4RQ9A 5EVIC 3FKWA 3LCEA 3MKFA 5K5BA 4OLDA 2PR5A 3PTEA 3IF6B 5L07A 1JWPA 3KSGA 4UQIS 3OZHA 1LL8A 5L2FA 3BQ8A 4O01A 2RCXA 4GS9B 4C6YA 3NDGA 1YLTA 5HWVA 2XK1A 2VGLM 2OLUA 3IBRA 4MMNA 3A0SA 3ZQ5A 4Y7PA 2JKTI 3VP0A 2VLGA 2ZC7A 3GR2A 3HUMA 4WEKA 2WUQA 2QHKA 1XJ6A 4II7A 3ICYA 3G2ZA 2PRFA 4FH2A 4FOFA 5DTSA 1PW1A 2DNSA 4KZ9A 1BYWA 4UHUA 3EOIA 3S7OA 2IWDA 1ES2A 3BW6A 1TVFA 4LV3A 2J3TC 4IJGA 5A93A 3UE0A 1CQAA 4ME4A 1K54A 3CUEA 3GECA 3CLOA 5HDDA 2VV8A 1MBLA 2QJ5A 4WZ4A 4JGRA 3SS4A 1NWZA 1LI9A 3N8RA 3QP4A 3CAXA 5AQBA 4Z9QA 2G2WA 2WAFA 4EW7A 1MWUA 3E2LA 4NXBA 3HUOA 3VV4A 4P87A 4JF6A 1YT4A 4BLMA 3P01A 4YWZA 2ZM0A 5E2EA 4R4SA 1E4DA 2XH9A 4X69A 3TOIA 4X1LA 1CF0A 4OKPA 3ZCZA 1PRQA 4LV1A 3O3VA 4ARZB 4EBNA 3ZYTA 5JYPA 3VMAA 5MC7A 4KZ8A 2X01A 1L3LA 4M4XA 5EE8A 1Y4OA 3IS2B 2V9AA 1E25A 2Z2MB 5FDHA 2L1MA 3LEQA 1H3QA 3MS6A 3UO9A 2L0WA 4WLAA 3VOYA 2FFFB 1NRJA 2H0TA 4LV0A 4YINA 1GHMA 2V2FF 4YFMA 1OTIA 1DJAA 4G3VA 3T4QA 5FL3A 2XSSA 4GJ4A 4KQRA 4H6JB 1MKMA 3HLBA 5TBMA 3VOLA 5EV0A 2Q9NA 5CGXA 1KVLA 3VP4A 3IX3A 1SKOB 2C6WB 1WYBA 3QNCA 3G4PA 1C3BA 2JKRM 4E04A 3R7WB 2VEAA 1P97A 4GHIB 2VJWA 3GMWA 3DWKA 1XFQA 3OCNA 2E8IA 3B42A 4LENA 4XUZA 1N9NA 5HD3A 4CLCC 4OOMA 4S2MA 5DKKA 4YOFA 5DVAA 2ZC4B 2V1BA 2H0YA 5FA7A 4ZRRA 3M6BA 5FQJA 1XA7A 1DRMA 4UAAA 4G3KA 3HVFA 4KZ6A 4FUWA 1U60A 1RP5A 2Y2KA 1ZG6A 3FPWA 1K55C 4JGOA 1D06A 1VM1A 1BLHA 3PBNA 3ZG9B 3LR0A 3CUEC 4KG6A 3ZG0A 4IUKA 1YMSA 3LIFA 2G2UA 1GA0A 4JXVA 5C5KA 1PW8A 3DTKA 4CQHA 4LRXC 1L0DA 3L7HA 3PBQA 4U0XA 1T1BA 2H5SA 4EEUA 1LLBA 5FQKA 3IF6A 3NOUC 4X68A 3GQZA 2Q9MA 3UB7A 3GRJA 2A49A 2WKHA 3S7QA 3QP8A 3BY9A 4IVKA 3T1QB 3JVUA 5HAPA 3IXDA 5F69A 3OPLA 1SDEA 2Z2LB 3SH7A 4FH4A 4CPKA 4K0XA 4RX3A 4ESPA 2D01A 2HDQA 3PBOA 4EERA 2HDUA 3MMHA 3AGDA 2Y4AA 1IEMA 3T4KA 5L09A 3IT9A 1MZUA 1OTBA 2XFSA 1TD5A 2LB9A 2WKEA 3VE3A 3T12B 2HPBA 1BULA 1EI5A 3ZHHA 4QHCA 4BBTA 4PPRA 5GLCA 2ZJ9A 2HJ9C 3P98A 4HHDA 1HLUP 2JKRI 4JGPA 4ZTKA 3A3DA 3UMEA 4HBTA 5FSRA 3BYDA 4OPRA 5FEFA 1TS0A 2W3FA 5KSHA 3IWOA 1DP6A 1FIKA 1JVJA 1Z09A 3BRMA 1O07A 5FAQA 2HP9A 3D72A 3T4TA 1LSWA 1IYSA 4MDZA 5FQQA 5HW3A 2PT7A 2EWWA 1O7EA 4G3WA 4HH3A 3T50A 5HAQA 3G30A 2P9VB 2JKFA 2VGJA 3W8KA 5EVEA 2OAQ1 3IWIA 5EVID 4HESA 4PM7A 5HWWA 4KQDA 2UV0E 1Z6FA 4IBXA 3UMDA 2XR0A 1IELA 2KX6A 4E3OA 4Q0IA 4ARZA 2BG1A 4WZ5A 4QB8A 2ZC3B 3IS2A 2Y2PA 1A0KA 4S2KA 5KZHA 4X56A 4N1HA 4U3TA 3LYXA 1JNUA 3C7VA 3BLSA 3A3FA 2OOLA 5F1FA 4EQIA 1ERMA 3CG5A 4O8GA 3RH8B 1FCNA 3MBZA 5EVIA 2PD7A 3O5YA 3WS0A 3D4FA 3TJZC 3D3OA 3GV9A 2WKQA 5DF7A 1VQQA 4S2NC 3V39A 3LIBA 3NCKA 3KSHA 2XEPA 5EM1A 5G4ZA 2DMWA 5L8MA 2L4RA 4H6JA 4EXOA 2VGKA 5G4YA 3RXXA 2OAP1 2J3TD 1NYMA 3H7WA 5DTKA 3A0VA 5E2FA 1TF1A 2ZOHA 1SKOA 1FSYA 1NLYA 2WKRA 2YKFA 5EFWA 1FSWA 3B3XA 1DP9A 3K3DA 4Z1WA 3BLMA 4GHIA 2W3GA 4IBRA 1YMXA 5HX9A 1YKDA 1XJ3A 4HBUA 3C8CA 1ONHA 1G5UA 5FASA 4Y0UA 1OJ5A 2WKPA 4S2PA 2ZMVA 1NLZA 2VA0A 5HFOA 3C5AA 1P9WA 3UDIA 1K6SA 2QMIA 3CZDA 3W2ZA 4BL3A 3UPNA 3G32A 3WWXA 4F3LB 3VSLA 2XD5A 3UN7A 5GL9A 1BUEA 3LO7A 3TRCA 3S4XA 1BLPA 2GNXA 3PXPA 1H5XA 4IUHA 2W3EA 2P08A 2QPNA 3O86A 5CECA 3ZVWA 4L9FA 1PWDA 4JPMA 3KYQA 1OPXA 4KQOA 3G2YA 1CI8A 4HP4A 1QMEA 3QP1A 1BZAA 4QJGA 4HY8A 4NG2A 4EV4A 1JTGA 2V0UA 5FAOA 3PHYA 1YLZA 1PI4A 3FWLA 3KSIA 3KSFA 1HVBA 1ZHHB 4R4RA 1KVMA 4BL2A 1IKGA 2JKGA 3SOIA 5HL6A 5HDCA 4FD8A 4KUKA 3N6IA 4JF5A 5FI2A 3FZCA 1WYCA 1K4FA 2QZ6A 2ZL1B 3V50A 4CLCD 4O7DA 2Y2QA 4EBLA 4EUZA 2Y79A 1G68A 1UGUA 3VP3A 1S67L 1YLYA 5AVEA 4E3NA 1TS6A 3V5MA 1W8YA 2RL3A 3BFFA 3MXSA 1M6KA 4Q8IA 3CJMA 1YPRA 1W5DA 3M6HA 1G6AA 2VV7A 4MNRA 2WGWB 2EWVA 3UB9A 4WYYA 3MR0A 3NOTC 1WA9A 4L9GA 1TDGA 4OVDA 5F1GA 2ZM2A 4CLCA 3BWLA 2P9VA 4MLLA 1XJ4A 4B4ZA 4WBGA 2R9WA 5G18A 2B5RA 3ZVTA 1S1ZA 2NUPC 2Y2IA 3IXHA 4OPQA 4E3LA 5BOHA 3QP2A 2A24B 1VETA 4D60A 1MPLA 3MZFA 1K55A 4EWFA 1KGEA 1KGFA 3NULA 1EROA 4DF6A 2V8FA 3N8LA 5DKLA 2Y2LA 2Y2HA 5CTMA 3IXGA 4HJ4A 4RYEA 3MQOA 2QJ7A 4Y5FA 2XFTA 1XGIA 4GDBA 5DFYA 1BTLA 4I38A 4WELA 3WRZA 3MXQA 3ZDJA 5I5LA 4JLFA 3LIAA 1MWRA 2V1AA 1XPBA 5M19A 1D1JA 5A90A 4WMCD 4NEED 4GDNA 2ZC6B 1NYYA 3MSHA 2EXBA 2OLVA 1S4RA 2Z6DA 4BBUA 2HV1A 2J8YA 3MXRA 5FI6A 3CWFA 4NXEA 4KZAA 2ZQCA 1RGYA 4OONA 3S22A 3IHBA 3HLGA 1V9YA 1W79A 3LIDA 3DWZA 3Q7VB 1ZTUA 3U2AA 3SZTA 2W3DA 4E3JA 3PR6A 3TE8A 4LRZE 4WMCA 2WKIA 5CEDA 4X1MA 4MBKA 1KGGA 5CGWA 2JN7A 1VEUB 1LL5A 4Q0HA 3KYZA
chains in the Genus database with same CATH topology
3QP6A 5L07A 3QP2A 2Q0OA 3QP4A 4Y13A 3QP5A 1L3LA 2AVXA 3IX4A 4LFUA 4LGWA 5L10A 2UV0E 3IX3A 3IX8A 3QP1A 1H0MA 5L09A 4Y17A 4NG2A 3QP8A 4Y15A 3JPUA 3SZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QP6 A;  5L07 A;  3QP2 A;  2Q0O A;  3QP4 A;  4Y13 A;  3QP5 A;  1L3L A;  2AVX A;  3IX4 A;  4LFU A;  4LGW A;  5L10 A;  2UV0 E;  3IX3 A;  3IX8 A;  3QP1 A;  1H0M A;  5L09 A;  4Y17 A;  4NG2 A;  3QP8 A;  4Y15 A;  3JPU A;  3SZT A; 
#chains in the Genus database with same CATH topology
 4I3I A;  3I7J A;  2IA2 A;  3E0Y A;  1SZV A;  3HRE A;  3ITB A;  1VHM A;  3OPP A;  3F1N B;  4MBF A;  4R0Q A;  5AVF A;  4R23 A;  3HLF A;  4BBV A;  3UB5 P;  5CGS A;  2JBF A;  3ZG5 A;  5AQ7 A;  4N92 A;  4UQI M;  5FAT A;  3QP6 A;  4EU0 A;  1ZC2 A;  2J9P A;  2XGN A;  3MF0 A;  5CHJ A;  5DTT A;  4GB7 A;  2ZQ7 A;  3EEH A;  5J3W A;  2GX5 A;  2WZX A;  5GLB A;  4FSF A;  4ZJ1 A;  4WM9 A;  3KX0 X;  2W1R A;  4BD0 A;  5DFX A;  4IHQ A;  2EX6 A;  2PAV P;  3WS5 A;  1T18 A;  2ACG A;  3LR5 A;  1TS7 A;  1L0E A;  3HL9 A;  4PHT A;  4O0P A;  4X6T A;  1S4S A;  3HLW A;  3BQA A;  5CER A;  4KZ3 A;  3LY4 A;  4X25 A;  3A3E A;  1MC0 A;  2CMN A;  1GA9 A;  3NBL A;  1F2K A;  5TFQ A;  5CX7 A;  4S2N A;  4C3Q A;  4E3M A;  5A92 A;  2ZL1 A;  5GHY A;  1N9L A;  4EES A;  3UPP A;  2ZQA A;  4HEF A;  2B95 A;  1JWZ A;  3B33 A;  4BMW A;  3E4P A;  1Q2Q A;  3FV7 A;  1HTZ A;  4GS9 A;  4I3A A;  4MN6 A;  1VB6 A;  1PNE A;  3G34 A;  1L0F A;  5FEG A;  5KIZ A;  1Y28 A;  4JBF A;  1Y54 A;  3NC8 A;  3ZG7 B;  1S66 L;  5HAR A;  1OTA A;  2IWB A;  4NXG A;  4Y3I A;  3N8S A;  2O99 A;  4ZJ2 A;  4WEJ A;  2VX8 A;  1NXY A;  1K6R A;  4MN5 A;  4DE0 A;  2G7U A;  4OQ0 A;  3S7N A;  1IYQ A;  4PKY A;  2ZD8 A;  3ZG8 B;  3F1P B;  4JXG A;  2Y2M A;  1BLS A;  4GKU A;  2JE5 A;  1DJC A;  4UA6 A;  3VE4 A;  3P7N A;  4XT2 B;  2A24 A;  4WUJ A;  4B4X A;  4BWI A;  4C75 A;  4MBH A;  4NET A;  1BLC A;  2XD1 A;  1FCM A;  1N4O A;  4D2O A;  3HLD A;  2Q0O A;  2ZLY A;  1FR6 A;  4PM9 A;  3K3C A;  1KDS A;  1HZO A;  4S2I A;  4P6Z M;  1RCJ A;  5J4E A;  3VP2 A;  3IHA A;  3MZD A;  2INW A;  3LGO A;  4EUV A;  4MN7 A;  2ZBB A;  2IWC A;  4S2O A;  2B02 A;  4DE1 A;  4R1G A;  5EOO A;  1ES4 A;  2OWH A;  2ZC5 B;  1T19 A;  4KQQ A;  2ZQD A;  3BFD A;  3NOP C;  4OOL A;  5DJU A;  3G6O A;  5F82 A;  3CI6 A;  3GDI A;  2ZOI A;  5JYO A;  5IHV A;  3F1O B;  3UNW A;  4KZ7 A;  2K7S A;  4OQI A;  3NDE A;  1NY0 A;  4WL9 A;  1EW0 A;  4K91 A;  1K56 D;  5CTN A;  3IF5 A;  4GN2 A;  2EFX A;  4DXC A;  4LGW A;  4OOY A;  1K57 C;  4HNB A;  1CK3 A;  3U4L P;  4DE3 A;  2GJ3 A;  3EWK A;  1IYO A;  5HPF A;  5I94 A;  1M40 A;  2FH5 A;  4MCW A;  1E3U D;  2J7V A;  5FAP A;  5CHU A;  3P09 A;  1VEU A;  3S1Y A;  4OQG A;  1P9R A;  2ZMA A;  4N9L A;  3C7U A;  1JWV A;  3IX8 A;  4B88 A;  1D7E A;  1LSX A;  5GLA A;  5HZH A;  1FOF A;  1K56 A;  5HL1 A;  2VGL S;  3F1N A;  4P6B A;  2WGI A;  2M7V A;  4P85 A;  3CPT B;  2W0N A;  3UPO A;  2W3H A;  3ZNT A;  5FI7 A;  3EEA A;  4XUX A;  4DE2 A;  1E3U A;  1QMF A;  3LY3 A;  3R7W A;  1XJ2 A;  1PIO A;  1OJG A;  2PBY A;  2ZMF A;  2OSU A;  4EEP A;  3SW1 A;  3IH9 A;  4QD4 A;  4OQH A;  1YLW A;  1BT5 A;  4UEY A;  3MZE A;  5GLD A;  5HSQ A;  5HPI A;  3LFV A;  4NKP A;  1ES5 A;  1W63 Q;  3KYE A;  1ONG A;  4K0W A;  5AQ9 A;  5EPH A;  5AJG A;  1TEM A;  2E8J A;  3V67 A;  1S0W A;  1CEF A;  1T1C A;  3OLO A;  1IKI A;  2JKT M;  2HF6 A;  4LRY C;  3HJI A;  1NJ4 A;  4H8R A;  4LCM A;  5TBM B;  3TW8 A;  2HGV A;  4E3I A;  2VKS A;  4RA7 A;  5FQ9 A;  1OME A;  1J9M A;  3VOZ A;  1YQS A;  4GNU A;  4P0M A;  2XLN A;  4GZB A;  5CRF A;  1I2S A;  2J80 A;  1EWZ A;  1H8Y A;  3IBJ A;  4UA7 A;  4DN0 A;  3NIA A;  4GLQ A;  4LCL A;  4R38 A;  3R4K A;  4B93 A;  2P74 A;  2VK3 A;  1PZO A;  1ES3 A;  1YM1 A;  3Q82 A;  4N1X A;  3DAV A;  5IU1 A;  1ODV A;  2MJ6 A;  4HJ6 A;  4DRT A;  3H9W A;  3T1S A;  1LI0 A;  4ID4 A;  2H10 A;  3EGD C;  2Y2J A;  4R6L A;  1YSP A;  3C30 A;  3F1P A;  3IWQ A;  2DRW A;  3OOV A;  1J3W A;  4Q0J A;  2XA7 M;  4DMZ A;  1YSQ A;  1PZP A;  5F6A A;  4Y13 A;  5DF9 A;  4ZBE A;  2V20 A;  2H28 A;  3WS2 A;  5E2H A;  2Y8H A;  2PYP A;  3E4O A;  2CC1 A;  5U47 A;  3NI9 A;  4A5R A;  5GHZ A;  1OTD A;  3BEB A;  5DJT A;  3Q1F A;  4PM8 A;  4KZB A;  5HDS A;  3K2N A;  5IS1 A;  1FQG A;  3H82 B;  1N9O A;  4L0L A;  5CXW A;  3OBF A;  1H0M A;  4ZAM A;  4R3J A;  4M3K A;  4IVI A;  1ESU A;  3WRT A;  3VP1 A;  2J9O A;  1PWC A;  4KG2 A;  1SCW A;  3FYZ A;  4I5S A;  2HDR A;  3BFG A;  3ZNY A;  3F1O A;  5TGF A;  2M1C A;  1K4E A;  5KSC A;  3IQA A;  5EUA A;  3A0R A;  1L0G A;  5DF8 A;  3ISG A;  5GHX A;  3T1R A;  4Y0T A;  2BLS A;  2NUT C;  3RJU A;  4NXF A;  1ZKJ A;  3FG8 A;  5TR7 A;  3ULF A;  3D9Y A;  4HP9 A;  4DJ3 A;  2V0W A;  4FCF A;  4OH0 A;  3PAE A;  1LSV A;  1T1A A;  4JF4 A;  3MKE A;  4LV2 A;  4ETZ A;  2EA9 A;  3Q81 A;  2R9X A;  2EX2 A;  3W4P A;  1CJF A;  5FQI A;  1W7F A;  3QHY A;  3N4I A;  4KEN B;  4XXR A;  3UE1 A;  2PBD P;  3ITA A;  2P7J A;  3ZGA B;  2EFU A;  1LHY A;  2A2L A;  3PBR A;  3N7W A;  1KDW A;  4ZDX A;  1NRF A;  3C38 A;  3OCL A;  1PWG A;  1SDN A;  4R3A A;  4WF0 A;  5F5Y A;  3CPT A;  3E98 A;  1TS8 A;  1XX2 A;  3SH9 A;  4L9E A;  1UWN X;  3IXB A;  4Y15 A;  4GOG A;  3HLE A;  2EX9 A;  2XF3 A;  3RTY A;  2J3W A;  3HBR A;  4GW9 A;  4ZJ3 A;  3NHQ A;  1KE4 A;  1I5Q A;  3T4L A;  2QKP A;  3EGX C;  2WK0 A;  1G6O A;  3T4O A;  4Y2F A;  1DP8 A;  4KG5 A;  4DDS A;  3A3I A;  4B9O A;  1K25 A;  3G35 A;  5FDS A;  4BD1 A;  4HH2 A;  1W63 M;  2Y91 A;  2K2N A;  3CIT A;  5EVI B;  4AFI A;  1STZ A;  3FKV A;  4P6Z S;  3NEC A;  2I9V A;  3BEC A;  3WS4 A;  4F3L A;  4X53 A;  1YLJ A;  3NJA A;  2EXA A;  2OWJ A;  3DTM A;  2JCH A;  1GHP A;  5IT5 A;  3LEZ A;  5M18 A;  3LR3 A;  3H7W B;  1IOU A;  2WAE A;  2HDS A;  3GTC A;  1XKZ A;  2O9B A;  1XFN A;  1N9B A;  1ALQ A;  3BFC A;  3FPV A;  1KE3 A;  2GDN A;  3PAG A;  1XA1 A;  1F98 A;  1S6R A;  1YLP A;  5FQM A;  3QP5 A;  3TG9 A;  4U0T A;  4QU3 A;  4LPZ A;  5M1A A;  1Q2P A;  2Y2N A;  3BJN A;  1K57 A;  5EEC A;  3DTI A;  2D02 A;  5F68 A;  3S7P A;  4NK3 A;  3VFF A;  5KMW A;  2Z6C A;  3EQV A;  4S2L A;  2BAS A;  3PBT A;  1OT6 A;  1TDL A;  1H8Z A;  4QWO A;  3FC7 A;  1AWI A;  2HP5 A;  5EM0 A;  1H8M A;  4E6X A;  1GSV A;  1ZG4 A;  1PI5 A;  5TJJ A;  3O87 A;  1K54 C;  4EBP A;  4CJN A;  2O9A A;  3C4O A;  5E2G A;  2KOI A;  3M2J A;  3KO6 A;  3UY6 A;  1JTD A;  4GD8 A;  1MKI A;  2C5W B;  3DTE A;  1NZO A;  4JXS A;  4PM5 A;  2XDM A;  2P04 A;  2PU4 A;  1KE0 A;  4LFU A;  3UDF A;  2WGW A;  5A91 A;  3A3J A;  1KOU A;  1K0K A;  3V3S A;  2VV6 A;  2LB5 A;  4JGQ A;  3AGE A;  3LUQ A;  3MQQ A;  3WS1 A;  3JYI A;  1F9I A;  3RFB A;  2JC7 A;  3H82 A;  4YNR A;  3UE3 A;  2V8C A;  3SH8 A;  2M7U A;  1ERQ A;  1MWS A;  2W1T B;  2BTF P;  3G31 A;  5HAI A;  4HJ3 A;  4ETX A;  3Q7Z A;  4HIA A;  1FIL A;  3LI8 A;  5A8B A;  3AGF A;  1NZU A;  2UWX A;  4BEN A;  4N9K A;  2XRO A;  4DDY A;  1CEG A;  2PDR A;  2GZA A;  4UA9 A;  3HUN A;  4KZ5 A;  1OT9 A;  3MFD A;  2X71 A;  4QY5 A;  1S1Y A;  4X55 A;  4OP5 A;  1GSX A;  4RX2 A;  3T4S A;  3IH8 A;  3E2K A;  4OLG A;  5CEB A;  3LI9 A;  2HZ5 A;  3Q07 A;  3C4P A;  4DKI A;  3SS5 A;  1XXM A;  3C2W A;  2HJE A;  3JVV A;  2FFY A;  1UWP X;  1LL9 A;  2I72 A;  5LBR A;  4CLC B;  2WZZ A;  3O88 A;  2PYR A;  4WN5 A;  4GCZ A;  3BM6 A;  3M2K A;  3CMZ A;  4S2J A;  1XGJ A;  2DCF A;  3B47 A;  2Y2O A;  3QNB A;  1CI9 A;  2W27 A;  1W8Q A;  3OC2 A;  3Q7V A;  3V3R A;  4Y0O A;  4KZ4 A;  2HP6 A;  1AXB A;  1XP4 A;  4EET B;  1VET B;  4DJ2 A;  1MXO A;  2PU2 A;  3CHW P;  3NY4 A;  3LIC A;  2XA7 S;  3LIE A;  4E6W A;  1FCO A;  2Y59 A;  4RVA A;  3GVB A;  1WE4 A;  3W4O A;  4HOI A;  4BQM A;  2OV5 A;  3RXW A;  4I39 A;  3UB8 A;  1YAX A;  1MY8 A;  2O9C A;  3T1X A;  2R78 A;  4OP8 A;  1DJB A;  3MJQ A;  2XRN A;  1SKF A;  4JKT A;  1L2S A;  3GSG A;  4QPR A;  2ZQ8 A;  2WYX A;  5HWT A;  2X02 A;  4IED A;  2O0Y A;  2Y55 A;  1RGZ A;  2QYB A;  4MEZ A;  1ACF A;  4QY6 A;  5EVL A;  3PYP A;  3DBA A;  2PHY A;  4JXW A;  3IF6 C;  4E3K A;  3VSK A;  2KLI A;  3HLC A;  2PD8 A;  3T4J A;  4PM6 A;  5AQA A;  4OPY A;  3TSG A;  2WAD A;  4HI4 A;  2QWS A;  2V1Z A;  3UDX A;  3OPH A;  3L9K A;  2XQZ A;  2AVX A;  2WGV A;  4GD6 A;  4R3B A;  5J8X A;  3EQU A;  5D3O A;  1IYP A;  3UE6 A;  2K31 A;  4F94 A;  3BFE A;  2EX8 A;  1IFQ A;  2KDK A;  2ZQ9 A;  1HD8 A;  4K08 A;  5HD5 A;  3SS3 A;  4LLO B;  1X0O A;  4EQ1 A;  4BJP A;  4PMA A;  4I3J A;  4KUO A;  3DW0 A;  1SHV A;  3JPU A;  1OTE A;  1BSG A;  3BY8 A;  1PYY A;  5F83 A;  3ZFZ A;  1FR1 A;  5J7E A;  4FTX A;  4PKY G;  1PFL A;  3W4Q A;  3E4Q A;  2YKH A;  1K38 A;  3PBS A;  3MFX A;  4PAU A;  1G28 A;  5E43 A;  1ESI A;  2JHE A;  1LT0 A;  1I2W A;  1F5M A;  4R70 A;  3HJK A;  2Y2G A;  3UB6 A;  5CHM A;  1GHI A;  1GSW A;  5L10 A;  4HQA A;  2FZ0 A;  4OPZ A;  2A3U A;  3HCY A;  2B18 A;  2W1T A;  4WZ5 C;  1DY6 A;  3LR4 A;  5EOE A;  4XT2 A;  3OPR A;  3VFH A;  2ZM8 A;  3IX4 A;  1MWT A;  4DXB A;  1GCE A;  3MQ0 A;  4CLC E;  1P0Z A;  2PR6 A;  1V9Z A;  4Y17 A;  2VZW A;  4RQ9 A;  5EVI C;  3FKW A;  3LCE A;  3MKF A;  5K5B A;  4OLD A;  2PR5 A;  3PTE A;  3IF6 B;  5L07 A;  1JWP A;  3KSG A;  4UQI S;  3OZH A;  1LL8 A;  5L2F A;  3BQ8 A;  4O01 A;  2RCX A;  4GS9 B;  4C6Y A;  3NDG A;  1YLT A;  5HWV A;  2XK1 A;  2VGL M;  2OLU A;  3IBR A;  4MMN A;  3A0S A;  3ZQ5 A;  4Y7P A;  2JKT I;  3VP0 A;  2VLG A;  2ZC7 A;  3GR2 A;  3HUM A;  4WEK A;  2WUQ A;  2QHK A;  1XJ6 A;  4II7 A;  3ICY A;  3G2Z A;  2PRF A;  4FH2 A;  4FOF A;  5DTS A;  1PW1 A;  2DNS A;  4KZ9 A;  1BYW A;  4UHU A;  3EOI A;  3S7O A;  2IWD A;  1ES2 A;  3BW6 A;  1TVF A;  4LV3 A;  2J3T C;  4IJG A;  5A93 A;  3UE0 A;  1CQA A;  4ME4 A;  1K54 A;  3CUE A;  3GEC A;  3CLO A;  5HDD A;  2VV8 A;  1MBL A;  2QJ5 A;  4WZ4 A;  4JGR A;  3SS4 A;  1NWZ A;  1LI9 A;  3N8R A;  3QP4 A;  3CAX A;  5AQB A;  4Z9Q A;  2G2W A;  2WAF A;  4EW7 A;  1MWU A;  3E2L A;  4NXB A;  3HUO A;  3VV4 A;  4P87 A;  4JF6 A;  1YT4 A;  4BLM A;  3P01 A;  4YWZ A;  2ZM0 A;  5E2E A;  4R4S A;  1E4D A;  2XH9 A;  4X69 A;  3TOI A;  4X1L A;  1CF0 A;  4OKP A;  3ZCZ A;  1PRQ A;  4LV1 A;  3O3V A;  4ARZ B;  4EBN A;  3ZYT A;  5JYP A;  3VMA A;  5MC7 A;  4KZ8 A;  2X01 A;  1L3L A;  4M4X A;  5EE8 A;  1Y4O A;  3IS2 B;  2V9A A;  1E25 A;  2Z2M B;  5FDH A;  2L1M A;  3LEQ A;  1H3Q A;  3MS6 A;  3UO9 A;  2L0W A;  4WLA A;  3VOY A;  2FFF B;  1NRJ A;  2H0T A;  4LV0 A;  4YIN A;  1GHM A;  2V2F F;  4YFM A;  1OTI A;  1DJA A;  4G3V A;  3T4Q A;  5FL3 A;  2XSS A;  4GJ4 A;  4KQR A;  4H6J B;  1MKM A;  3HLB A;  5TBM A;  3VOL A;  5EV0 A;  2Q9N A;  5CGX A;  1KVL A;  3VP4 A;  3IX3 A;  1SKO B;  2C6W B;  1WYB A;  3QNC A;  3G4P A;  1C3B A;  2JKR M;  4E04 A;  3R7W B;  2VEA A;  1P97 A;  4GHI B;  2VJW A;  3GMW A;  3DWK A;  1XFQ A;  3OCN A;  2E8I A;  3B42 A;  4LEN A;  4XUZ A;  1N9N A;  5HD3 A;  4CLC C;  4OOM A;  4S2M A;  5DKK A;  4YOF A;  5DVA A;  2ZC4 B;  2V1B A;  2H0Y A;  5FA7 A;  4ZRR A;  3M6B A;  5FQJ A;  1XA7 A;  1DRM A;  4UAA A;  4G3K A;  3HVF A;  4KZ6 A;  4FUW A;  1U60 A;  1RP5 A;  2Y2K A;  1ZG6 A;  3FPW A;  1K55 C;  4JGO A;  1D06 A;  1VM1 A;  1BLH A;  3PBN A;  3ZG9 B;  3LR0 A;  3CUE C;  4KG6 A;  3ZG0 A;  4IUK A;  1YMS A;  3LIF A;  2G2U A;  1GA0 A;  4JXV A;  5C5K A;  1PW8 A;  3DTK A;  4CQH A;  4LRX C;  1L0D A;  3L7H A;  3PBQ A;  4U0X A;  1T1B A;  2H5S A;  4EEU A;  1LLB A;  5FQK A;  3IF6 A;  3NOU C;  4X68 A;  3GQZ A;  2Q9M A;  3UB7 A;  3GRJ A;  2A49 A;  2WKH A;  3S7Q A;  3QP8 A;  3BY9 A;  4IVK A;  3T1Q B;  3JVU A;  5HAP A;  3IXD A;  5F69 A;  3OPL A;  1SDE A;  2Z2L B;  3SH7 A;  4FH4 A;  4CPK A;  4K0X A;  4RX3 A;  4ESP A;  2D01 A;  2HDQ A;  3PBO A;  4EER A;  2HDU A;  3MMH A;  3AGD A;  2Y4A A;  1IEM A;  3T4K A;  5L09 A;  3IT9 A;  1MZU A;  1OTB A;  2XFS A;  1TD5 A;  2LB9 A;  2WKE A;  3VE3 A;  3T12 B;  2HPB A;  1BUL A;  1EI5 A;  3ZHH A;  4QHC A;  4BBT A;  4PPR A;  5GLC A;  2ZJ9 A;  2HJ9 C;  3P98 A;  4HHD A;  1HLU P;  2JKR I;  4JGP A;  4ZTK A;  3A3D A;  3UME A;  4HBT A;  5FSR A;  3BYD A;  4OPR A;  5FEF A;  1TS0 A;  2W3F A;  5KSH A;  3IWO A;  1DP6 A;  1FIK A;  1JVJ A;  1Z09 A;  3BRM A;  1O07 A;  5FAQ A;  2HP9 A;  3D72 A;  3T4T A;  1LSW A;  1IYS A;  4MDZ A;  5FQQ A;  5HW3 A;  2PT7 A;  2EWW A;  1O7E A;  4G3W A;  4HH3 A;  3T50 A;  5HAQ A;  3G30 A;  2P9V B;  2JKF A;  2VGJ A;  3W8K A;  5EVE A;  2OAQ 1;  3IWI A;  5EVI D;  4HES A;  4PM7 A;  5HWW A;  4KQD A;  2UV0 E;  1Z6F A;  4IBX A;  3UMD A;  2XR0 A;  1IEL A;  2KX6 A;  4E3O A;  4Q0I A;  4ARZ A;  2BG1 A;  4WZ5 A;  4QB8 A;  2ZC3 B;  3IS2 A;  2Y2P A;  1A0K A;  4S2K A;  5KZH A;  4X56 A;  4N1H A;  4U3T A;  3LYX A;  1JNU A;  3C7V A;  3BLS A;  3A3F A;  2OOL A;  5F1F A;  4EQI A;  1ERM A;  3CG5 A;  4O8G A;  3RH8 B;  1FCN A;  3MBZ A;  5EVI A;  2PD7 A;  3O5Y A;  3WS0 A;  3D4F A;  3TJZ C;  3D3O A;  3GV9 A;  2WKQ A;  5DF7 A;  1VQQ A;  4S2N C;  3V39 A;  3LIB A;  3NCK A;  3KSH A;  2XEP A;  5EM1 A;  5G4Z A;  2DMW A;  5L8M A;  2L4R A;  4H6J A;  4EXO A;  2VGK A;  5G4Y A;  3RXX A;  2OAP 1;  2J3T D;  1NYM A;  3H7W A;  5DTK A;  3A0V A;  5E2F A;  1TF1 A;  2ZOH A;  1SKO A;  1FSY A;  1NLY A;  2WKR A;  2YKF A;  5EFW A;  1FSW A;  3B3X A;  1DP9 A;  3K3D A;  4Z1W A;  3BLM A;  4GHI A;  2W3G A;  4IBR A;  1YMX A;  5HX9 A;  1YKD A;  1XJ3 A;  4HBU A;  3C8C A;  1ONH A;  1G5U A;  5FAS A;  4Y0U A;  1OJ5 A;  2WKP A;  4S2P A;  2ZMV A;  1NLZ A;  2VA0 A;  5HFO A;  3C5A A;  1P9W A;  3UDI A;  1K6S A;  2QMI A;  3CZD A;  3W2Z A;  4BL3 A;  3UPN A;  3G32 A;  3WWX A;  4F3L B;  3VSL A;  2XD5 A;  3UN7 A;  5GL9 A;  1BUE A;  3LO7 A;  3TRC A;  3S4X A;  1BLP A;  2GNX A;  3PXP A;  1H5X A;  4IUH A;  2W3E A;  2P08 A;  2QPN A;  3O86 A;  5CEC A;  3ZVW A;  4L9F A;  1PWD A;  4JPM A;  3KYQ A;  1OPX A;  4KQO A;  3G2Y A;  1CI8 A;  4HP4 A;  1QME A;  3QP1 A;  1BZA A;  4QJG A;  4HY8 A;  4NG2 A;  4EV4 A;  1JTG A;  2V0U A;  5FAO A;  3PHY A;  1YLZ A;  1PI4 A;  3FWL A;  3KSI A;  3KSF A;  1HVB A;  1ZHH B;  4R4R A;  1KVM A;  4BL2 A;  1IKG A;  2JKG A;  3SOI A;  5HL6 A;  5HDC A;  4FD8 A;  4KUK A;  3N6I A;  4JF5 A;  5FI2 A;  3FZC A;  1WYC A;  1K4F A;  2QZ6 A;  2ZL1 B;  3V50 A;  4CLC D;  4O7D A;  2Y2Q A;  4EBL A;  4EUZ A;  2Y79 A;  1G68 A;  1UGU A;  3VP3 A;  1S67 L;  1YLY A;  5AVE A;  4E3N A;  1TS6 A;  3V5M A;  1W8Y A;  2RL3 A;  3BFF A;  3MXS A;  1M6K A;  4Q8I A;  3CJM A;  1YPR A;  1W5D A;  3M6H A;  1G6A A;  2VV7 A;  4MNR A;  2WGW B;  2EWV A;  3UB9 A;  4WYY A;  3MR0 A;  3NOT C;  1WA9 A;  4L9G A;  1TDG A;  4OVD A;  5F1G A;  2ZM2 A;  4CLC A;  3BWL A;  2P9V A;  4MLL A;  1XJ4 A;  4B4Z A;  4WBG A;  2R9W A;  5G18 A;  2B5R A;  3ZVT A;  1S1Z A;  2NUP C;  2Y2I A;  3IXH A;  4OPQ A;  4E3L A;  5BOH A;  3QP2 A;  2A24 B;  1VET A;  4D60 A;  1MPL A;  3MZF A;  1K55 A;  4EWF A;  1KGE A;  1KGF A;  3NUL A;  1ERO A;  4DF6 A;  2V8F A;  3N8L A;  5DKL A;  2Y2L A;  2Y2H A;  5CTM A;  3IXG A;  4HJ4 A;  4RYE A;  3MQO A;  2QJ7 A;  4Y5F A;  2XFT A;  1XGI A;  4GDB A;  5DFY A;  1BTL A;  4I38 A;  4WEL A;  3WRZ A;  3MXQ A;  3ZDJ A;  5I5L A;  4JLF A;  3LIA A;  1MWR A;  2V1A A;  1XPB A;  5M19 A;  1D1J A;  5A90 A;  4WMC D;  4NEE D;  4GDN A;  2ZC6 B;  1NYY A;  3MSH A;  2EXB A;  2OLV A;  1S4R A;  2Z6D A;  4BBU A;  2HV1 A;  2J8Y A;  3MXR A;  5FI6 A;  3CWF A;  4NXE A;  4KZA A;  2ZQC A;  1RGY A;  4OON A;  3S22 A;  3IHB A;  3HLG A;  1V9Y A;  1W79 A;  3LID A;  3DWZ A;  3Q7V B;  1ZTU A;  3U2A A;  3SZT A;  2W3D A;  4E3J A;  3PR6 A;  3TE8 A;  4LRZ E;  4WMC A;  2WKI A;  5CED A;  4X1M A;  4MBK A;  1KGG A;  5CGW A;  2JN7 A;  1VEU B;  1LL5 A;  4Q0H A;  3KYZ A; 
#chains in the Genus database with same CATH homology
 3QP6 A;  5L07 A;  3QP2 A;  2Q0O A;  3QP4 A;  4Y13 A;  3QP5 A;  1L3L A;  2AVX A;  3IX4 A;  4LFU A;  4LGW A;  5L10 A;  2UV0 E;  3IX3 A;  3IX8 A;  3QP1 A;  1H0M A;  5L09 A;  4Y17 A;  4NG2 A;  3QP8 A;  4Y15 A;  3JPU A;  3SZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...