4OONA

Crystal structure of pbp1a in complex with compound 17 ((4z,8s,11e,14s)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2h-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid)
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
746
structure length
502
Chain Sequence
PLKVYSEDGKLISEFGEMTPELNAPYIAEMARAEMVGRYGSEAYTEGYKVITTVRSDLQNAASQSVRDGLIDYDQRHGYRGPETRLPGQTRDAWLKHLGQQRSIGGLEPAIVTQVEKSGIMVMTRDGKEEAVTWDSMKWARPFLSNNSMGPMPRQPADVAQAGDQIRVQRQEDGTLRFVQIPAAQSALISLDPKDGAIRSLVGGFSFEQSNYNRAIQAKRQPGSSFKPFIYSAALDNGFTAASLVNDAPIVFVDEYLTFLGPIPLREALYKSRNMVSIRVLQGLGIERAISYITKFGFQRDELPRNFSLALGTATVTPMEIAGAWSVFANGGYKVNPYVIERIESRDGQVLYQANPPRVPVEPTPAERIIDARTAYIMTSMLQDVIKRGTGRRALALKRTDLAGKTGTTNDSKDGWFSGYNSDYVTSVWVGFDQPETLGRREYGGTVALPIWIRYMGFALKDKPMHTMAEPPGIVSLRIDPVTGRSAAPGTPGAYFEMFKNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Siderophore receptor-mediated uptake of lactivicin analogues in gram-negative bacteria.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transferase/transferase inhibitor
molecule keywords Penicillin-binding protein 1A
total genus 149
structure length 502
sequence length 746
ec nomenclature ec 2.4.1.129: Peptidoglycan glycosyltransferase.
pdb deposition date 2014-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
A PF00912 Transgly Transglycosylase
A PF17092 PCB_OB Penicillin-binding protein OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4oonA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oonA02
2P9VA 2ZC5B 3CF5A 4LFCQ 1NJIC 2JA7G 3M4QA 3U50C 1B70B 2UUCL 4X65Q 4ID4A 4JXGA 2WGVA 1MWSA 1VQNA 2ZC4B 1NTGA 3STBD 5IYDG 4O0AA 1S0WA 2HIVA 3V39A 3AFPA 4R3BA 2AWOA 1YLTA 3FHWA 4JV5L 3MXNB 2EFUA 3SS3A 3BZKA 3H0GH 2XFSA 4MZ9A 1VQLA 4HBTA 4OVDA 4K0KL 1M1KC 1L2SA 4Y0UA 3IHBA 4X64L 4DR5Q 4DE1A 1C3BA 5AQ7A 4P72A 2ZJPA 3HOZG 4B3MQ 2WB1G 4TQUS 1FR6A 3NI9A 4X53A 1OXVA 1XMQL 3ZGAB 4OPRA 3GO5A 3M3YH 4X68A 2VY3A 4JLFA 2NN6I 3ZHHA 1XMOL 3VFHA 1PHJA 4NXNL 2ZQ7A 4Z9QA 3RLNA 1JJCB 1Q81C 2E2HH 4RVAA 4OOMA 1GVPA 2XH9A 4OOLA 1Z9FA 3A0JA 4DUZL 4DV3L 3F1ZA 1WCMG 4S2KA 5C44G 3LY4A 3CMZA 3OCNA 4BXXH 1JJ2A 3N8RA 5FQIA 4DV1Q 4DUYQ 4B88A 2BG1A 1BT5A 1E1OA 3WS2A 2LSSA 4GNXB 2GVAA 5CHJA 1HVBA 3BFGA 1E25A 5KZHA 4GS3A 3G2YA 4DR7L 3GVBA 3D0FA 3G31A 3CAMA 1J5EL 5EAYA 3S2HH 1YLPA 4LF4L 2H10A 2A49A 4GNXC 4QD4A 4QJGA 1XPOA 2WK0A 1VQ4A 1P8LA 4GLXA 5CHUA 2F4VQ 3ZJYC 1Q12A 4JI6L 3VDYA 5CHMA 4DF6A 3KJPA 2UXBL 1PVOA 4QHCA 4JI8L 2ZM0A 2VUMG 4B3TQ 3S15H 5IYDH 2K5HA 5FJ8H 3ER0A 2VGJA 3BRMA 3PUXA 1N9BA 4DR7Q 3NC8A 1GD7A 3PF5A 5F83A 4PZ7A 4DV7L 3T1HL 4IJHA 4X6TA 2RL3A 2HDUA 4DV0Q 4X62L 1PYYA 3C7VA 2VQEQ 1VQ9A 4JI5Q 2H5XA 4PM8A 4BLMA 3IT9A 4QL5A 1FCNA 1X65A 2V1CC 1MKIA 2WGIA 4C3JH 3PAGA 1BLCA 3HOVG 1TDLA 2E2JH 2ALYB 5HAQA 3TOIA 2OQKA 4DV4Q 3G34A 4LFAL 1SROA 3K0XA 4KI0A 3QNBA 2VQEL 3CCEA 1QVFA 2HDSA 3Q7VB 1K56A 3W4PA 5IHVA 3J80i 4LF4Q 4MBHA 2NZHA 4S2PA 4GNUA 2DCFA 4DKIA 3EBEA 2HDRA 1LYLA 1Y1VG 4JXSA 3I2ZA 1K54A 2XTIA 5DF8A 1SCWA 5JJLA 2WYXA 2MNAA 1L0FA 2ATWA 1XNRL 1FVIA 4JI2Q 4H02A 2CCZA 4UP7A 3N8LA 4UAAA 3DW0A 1KDWA 1MY8A 4LF5L 1KGGA 1IYOA 1W79A 4AYBG 4NXML 1A63A 5C0XJ 5IYCG 3NCKA 4IO9A 1XA7A 2Y2HA 2I0QA 1Y1VH 5CERA 2WAQG 1QVGA 1LI9A 1FQGA 1WYDA 2AWNA 1N34L 4FH2A 2HP9A 1S40A 3IXGA 3A3JA 4WZ5C 5CXWA 1L0DA 4RYEA 1PW1A 2BA1A 2AKWB 3VSKA 4CJNA 1G6AA 1KL9A 4XUZA 2EXBA 2BH2A 4A3DG 4UP9A 1ZG4A 3EQVA 2FFYA 3LY3A 4LENA 4LF6Q 3DTMA 3Q81A 3S2DH 2XGTA 1VQGA 3PBTA 4JBKA 1KE0A 5DTTA 3KDFA 1PH7A 4R3JA 3CD6A 5DVAA 3S1QH 4MLLA 4GB7A 1N36L 2R6GA 4XXRA 2XGNA 3BLMA 4QJFA 5E2GA 1QVCA 1JE5A 1X9NA 2IX0A 2WKEA 2ZJRA 4BENA 1MIUA 3PF4A 1RL2A 4WJ4A 4B3RQ 4BD0A 1P16A 2DGYA 2EQSA 4JOIC 2JBFA 4DNIA 4GZBA 2Y2IA 3SH7A 1L0GA 1O07A 1S6RA 4OPYA 5E2HA 5IWAQ 4K0XA 1IYSA 3CXCA 4X55A 3DWZA 4OH0A 4HJ5A 5IP7H 4BXXG 5HW3A 5EPHA 1XX2A 4LF7L 4KHPQ 2A19A 1K25A 2CKZB 3FKWA 3PUWA 3NBLA 1UE5A 5GLAA 3S14H 4JI4Q 1X3EA 3CC2A 2WKIA 1HZAA 2WADA 5C3EH 1TWHH 5FAPA 3CCQA 4KG6A 5M19A 4R4IA 4DR2L 3C4OA 2JE5A 4WZ4A 3N6IA 4ZJ1A 4DK6C 2Y0SE 1Q7YC 4AYBE 5IYCH 4YCUA 2EX9A 1QUQA 1HH2P 3CQZH 2A8VA 4C2MH 4GN5A 2R92G 2D0OA 2BH8A 4BL3A 4JI8Q 3HOZH 2JA6G 3UPPA 1KDSA 4OPQA 3PIPA 2HHHQ 2OSUA 4GKKQ 2UUAQ 1Y1WH 4LUVA 2RHSB 3BM6A 2J7VA 1E3UD 4BBSG 4M3KA 2YU9H 2E8GA 3H3VH 4BD1A 1SKFA 1PWCA 2OLVA 3N7WA 1WCMH 1H8YA 4DV5L 5J8XA 1CSPA 4JG2A 2EXAA 3LO7A 4C3IH 1CEFA 1YM1A 2JA8H 2V1ZA 1BKBA 3Q07A 1YITA 3DLLA 3JYIA 3O3VA 3GD7A 5LMUL 4R23A 5BR8Q 2Y91A 3VOZA 4DDYA 1K55C 2GVBA 1YQSA 1LLBA 3GDEA 1C9OA 1BBUA 1LM0A 2Y2KA 3RLOA 3NDGA 3L2PA 4A3FG 1KGEA 4JI4L 4OP8A 4LFBL 1G68A 4R4OA 2UXDQ 4S2JA 4DV2Q 1I2WA 1ASYA 3OC2A 4DR6Q 4BBRG 1QMEA 2PQAA 1E24A 1GHPA 4A75A 2R92H 1ERQA 4IFDG 1CKNB 2CWAA 1IBKL 2BLSA 1HR0W 4LUZA 3IHAA 1SFOH 2QPNA 2JA5G 3BFCA 1CKOA 2DUDA 2ZQ8A 4DV5Q 1NXYA 1JJGA 5F82A 5FDHA 1BUEA 1XTDA 3NELA 1MWRA 4EBLA 1I5FA 4MNRA 2WZZA 2KCTA 3PGZA 5KMWA 3FKIG 3N4IA 5D3OA 5HGQA 2K75A 3WWVA 1X55A 2N3SA 2R7DA 1N36Q 1VQHA 4KZ7A 1G6PA 3GTKH 2EIFA 3E2LA 5FASA 3VP0A 2R93H 2ES2A 5TFQA 1Q86C 3IF6A 5CGSA 5JJIA 4X64Q 2K5VA 1E22A 3M85A 5H1SE 3HFZB 4DV2L 5HAPA 1Y1WG 1YNXA 4S2OA 1YJWA 1JT8A 4GD8A 1JWVA 4JF6A 3ZG7B 3HKZE 3ZG8B 5CGXA 4UPAA 1B8AA 4MNOA 3WRTA 5TR7A 1CK3A 4NK3A 1X6OA 4IFDI 4K91A 3H3VI 4A3CG 4RG1A 5BR8L 1QZHA 4YY3Q 4JI7L 1IELA 1TEMA 4C75A 3DM3A 1L1OC 1EFWA 3HLWA 1ONHA 4OXPA 1PH8A 4S2LA 3M7NA 2IHEA 5GAEC 5EVID 1BTLA 1XMQQ 1Z47A 4MEZA 5M3MG 3BEBA 3CCMA 2IWBA 1VQQA 5GAGC 4DR6L 4C3QA 1TWFH 3WWXA 5IYBG 1TWAH 3PV0A 2QZ6A 3IH8A 3UY6A 2UXCL 3G6EA 3RR5A 4A3LG 3A5ZB 1SRUA 2QMIA 4PG3A 3CCSA 5DF7A 3ITBA 5C4JH 1NY0A 4OQIA 5JYOA 4JI0L 3Q7ZA 3CPWA 2ZJ9A 2XLNA 4OOYA 1FSYA 3HOVH 3CMAA 2A3UA 2CWPA 3GTLH 4JC0A 4ZTKA 2OWOA 1YVCA 4DV1L 2DNSA 1FCOA 2I5LX 4UY8C 1EROA 3V50A 3PUYA 4DE0A 1K9MC 4IPHA 4R4SA 4JI0Q 5E2EA 4S2NA 3ZVTA 2L15A 4JYAQ 1MXOA 2C5WB 1Y54A 3K80C 4FSFA 4OWXB 5EOEA 3C4PA 1Q8KA 1IYQA 3L7ZC 5E43A 3OPPA 4C3HH 1X56A 1SN8A 4YWLA 5IP9G 4OLGA 1LI0A 1NBWA 3C7UA 3LGJA 4LFAQ 3KLWA 4GOPC 4GKJL 2CFMA 3J80c 3TRZA 4ZAMA 4X6AH 1VQPA 2PQAB 4GN2A 4DXCA 1ESUA 3HLFA 1PZPA 1D7QA 1WFQA 1PYBA 3LEZA 2WB1E 2PU4A 2UWXA 4YHHL 3S1YA 2R7FA 3W1BA 4DR2Q 4YY3L 1V9PA 5EVIC 3KF6A 3RZOH 1RGYA 2N49A 3O88A 3PAEA 3I56A 4B3SL 2JEAI 1DJCA 2Y0SG 1IBLQ 3G35A 1XPUA 3MBZA 2I72A 2XEPA 3OYYA 1MJCA 5GAHC 4BBSH 1PH3A 2ZM8A 1FJGQ 1VQOA 1I2SA 1M6KA 4KZBA 5HARA 2DRWA 4X66L 3K8AA 5CEDA 2C35B 4LW1A 2A1AA 2JA6H 5GHZA 3BLSA 1K83H 3I4NH 1KVMA 1GA9A 3KF8B 3J81j 1BLHA 1R9TH 3E0EA 3IF5A 2ZC7A 2ZQ9A 1TDGA 4WEJA 3NBHB 2ZM6Q 1ES4A 2JC7A 1N9WA 4KZ9A 4WBGA 4DRTA 3IRBA 1DY6A 1GO3E 2JEBI 3CJMA 4WM9A 1D8LA 3CP0A 4FH4A 3W8KA 3CC7A 3PIOA 4XTCS 1TWCH 3G48A 1YLZA 3MKEA 3AGDA 1WYBA 4A3MH 5KSHA 3FKVA 4A3GG 4JBFA 4NXMQ 5GROA 4GOPB 1QUQB 1K4FA 3PUZA 3U4VA 3WS5A 4P85A 4A3KH 4KZ8A 2Z0SA 3KOJA 2OQ0A 1VQKA 2WAFA 1DJAA 4IBRA 3RJUA 4GKJQ 2OV5A 3CCLA 1KD1C 1JVJA 4K0WA 1NRFA 4HEFA 1HJPA 4JI6Q 1AH9A 3JAMi 3BYDA 3VP4A 1NZUA 1PW8A 4GN4B 1VQ5A 3HLGA 3ERSX 4IVIA 4EBNA 3EN2A 1JWZA 4WYYA 3UDFA 3S17H 5IP9H 3OCLA 5AQ9A 5IYBH 5FJ8G 1L2FA 1LL5A 2I5HA 2CQOA 2LXJA 3HBRA 5FI6A 4DE2A 1PH1A 4LFBQ 2D62A 5GADC 3HOWH 4IBXA 3J7ZC 3BU2A 5A93A 2V20A 4JBWA 1G291 4DR3L 2VUMH 1YMSA 3MXRA 1GA0A 1SE8A 2JK8A 3PTEA 3SH8A 4A3DH 4YCVA 3HOXH 1MWTA 5FSRA 4K0KQ 4U0TA 1W8YA 3I4OA 1N8RC 1KHIA 4KLKA 4DAYB 2ZTCA 2JE6I 3HKZG 4L5QA 4DAMA 4YFMA 4Y7NH 3MXSA 3M6HA 4B3ML 4PM7A 2IX1A 1W2BA 5LMNL 2P9VB 1KXLA 4A3LH 4UHUA 1L1OA 1VQJA 1HR0Q 1PH4A 3AQQA 4X66Q 5IY0A 4A3IG 2NN6G 4JCVE 3KF6B 5CEBA 1L0EA 5F1GA 1UWVA 5DF9A 1H8ZA 2YTXA 5HAIA 5HL1A 3WS4A 4OLDA 1IBKQ 3ULPA 1SDNA 2CC1A 1GM5A 1X54A 3PO3H 2Y2MA 2ZQCA 3TG9A 3UN7A 1HNWL 4QY6A 1PA6A 4E3KA 1IZ6A 1VQDA 2D0PA 5CRFA 4JBJA 3G4PA 1RCJA 3HLDA 3Q8DA 4GKKL 3A3DA 2YV5A 1WI5A 4N92A 4KENB 4S2NC 2WUQA 2XF3A 4A3FH 3HOWG 2JA7H 2JJQA 1B7YB 3UE1A 5GL9A 5M1AA 5IP7G 1WYCA 1I6HH 1I94L 5FAOA 4ME3A 1M40A 2ZQAA 5ELOA 1Q2QA 2EX8A 3FYZA 3F2CA 1K38A 2Y2NA 5FLXc 4P87A 3FKIH 2R7ZH 1OTCA 2EX6A 3MFDA 1Q1EA 2YYZA 4BY1H 1HNZQ 1XNRQ 4A3EH 3S1RH 4PM6A 4KZ6A 3HREA 5E7NA 4QY5A 2ZC6B 4KQOA 3GTGH 1YBYA 3WS0A 1L1OB 3PCOB 1K6RA 1EWIA 1KGFA 1SHVA 4R4RA 3ZFZA 1UE6A 4OO1I 4Y0TA 4XUXA 4DR1Q 4L0LA 4CPKA 1N33L 4ZJ3A 1HR0L 1V1QA 3RLFA 4JI7Q 1GKHA 4JKTA 4IJLA 1XGIA 5LMUQ 4ZJ2A 4LF8Q 3S22A 4DV0L 5L2FA 4POGA 2XK1A 3A3IA 3PBSA 4LF9L 1ESIA 3MKFA 1NYMA 1YLWA 5BOHA 3CG5A 3GV9A 1AE3A 4JI1Q 5EOOA 1K0RA 4FD8A 4DV6Q 4FDBA 3S4XA 1U5KA 4QIWE 3F2BA 4DPGA 3HUNA 1BZAA 4BY7H 4BY1G 2E5LL 2UUAL 4JI3L 1O7IA 3NDEA 5AQBA 4HIMA 5F1FA 1OMEA 1I5QA 4LCLA 4WMCD 3JC66 2Y55A 1HNXL 3T1HQ 3U58A 3TS2A 5IWAL 4JXVA 1VQIA 5EVIA 2UUBQ 4IVKA 3GRJA 5C0XI 4JI3Q 2E5LQ 1O7EA 3BJUA 3NY4A 4U3TA 4OQHA 5EVIB 4JXWA 1IKGA 1J6QA 4YWKA 3FP9A 3V5MA 3ZG5A 1FR1A 5HY6A 4EWFA 2PBYA 1QZGA 4P75A 1GHIA 3M9BA 2HT1A 3ITAA 3IXBA 2OTJA 4BA1I 1ES3A 2K52A 4LF9Q 4Y7PA 1HNXQ 3UDGA 3A3EA 1YLYA 5FATA 4OONA 2Q2TA 4PMAA 2Y2QA 5M3FG 3L0OA 2UUCQ 1XA1A 4ZDXA 4EX5A 5C3EG 4LF7Q 3PSIA 3Q7VA 1PH9A 1FGUA 1S3OA 1U60A 3G4SA 3IF6C 3HL9A 3GR2A 4DKAC 4KHZA 1NZOA 1WJJA 3AYHB 4DV3Q 3M6BA 4L5TA 2X02A 4GOGA 1VQBA 4H8RA 3MZFA 2IWDA 4JI5L 1Z6FA 4A3JH 1NMFA 1W5DA 1PFSA 4L5SA 2B5RA 5FA7A 3IWQA 5FQ9A 1C0AA 2H0TA 5CECA 3GTPH 1VS0A 2K4KA 5AJ3L 3NIAA 2ID0A 2HQLA 5IE8A 5M5YH 5U47A 3RXWA 4LWCA 2NZOA 1EIFA 4BQMA 3RN5A 4DE3A 5E2FA 3BZCA 3V3RA 1XP4A 3GTJH 4E3MA 5A90A 4R1GA 2VQFQ 4APVA 3S24A 3GTCA 5I94A 4IPCA 1CUKA 2Q2IA 5LMNW 5GHXA 1IBMQ 1EUJA 1KC8C 1A62A 4IPDA 1HTZA 5M3MH 1MWUA 2WP8J 2PMZE 4JYAL 2MQHA 3OPLA 1HZCA 2ZM6L 3CMEA 2JA9A 2GN5A 2MO0A 3U4ZA 1KAWA 1IYPA 2K5NA 3UE3A 4QY7A 3TSGA 4YWMA 5GHYA 3P09A 3S1MH 2JCHA 1N34Q 3EQUA 1YHBA 1YLJA 1NMGA 3LCEA 4QGUA 1EIYB 1ZG6A 4KG2A 2BA0A 5HX9A 1BLSA 3ISGA 3B6YA 2ZTDA 1XPRA 1Q46A 3G32A 1VQMA 1HNWQ 2Q2UA 5FI2A 3UDXA 3M4PA 3K7AH 2HHHL 3F8TA 4E3IA 3CW2C 4EBPA 1DGSA 3VSLA 3PBRA 2R93G 3BFDA 2ZLYA 4R0QA 2P74A 3UO9A 4R4CA 4BJPA 3CC4A 4HJ9A 1CI9A 1SR3A 2VGKA 1JMCA 3FZCA 4WJ3M 4BY7G 3VOYA 4OQ0A 5AJ3Q 4KHPL 2OCEA 1EQQA 1V43A 3OTOL 4E3NA 1BVSA 4NETA 3STBC 3Q1FA 1TWGH 2F4VL 5K36G 3J81c 3D31A 1N32L 2RHQB 4IPGA 1Q82C 1BULA 4QB8A 2AMCB 2HDQA 1Y14B 1CKMA 3H0GG 4MBKA 4GN3B 4UA7A 1ALQA 1VQ7A 4LV3A 2ZQDA 1A8VA 3ZCZA 4P6BA 3AFQA 5AQAA 1K3RA 3SS5A 2Q9MA 5FAQA 2Y2LA 2XD1A 3K81C 5A91A 3ULLA 1TVFA 4P74A 1IBML 3G2ZA 4OKPA 3NENA 3IH9A 2ZM2A 1IXRA 3HOYH 4HJ8A 2OLUA 4HIOA 1BLPA 1A0IA 2QGQA 3V3SA 4WZ5A 1OXTA 1W3SA 4DUZQ 3M2KA 4OQGA 4DR4L 4DR5L 4B4XA 4DK3C 3W5OA 1PWDA 3PBQA 4YINA 2N8NA 4Q8IA 5JEAG 1SMXA 1K73C 2VNUD 1LTLA 2PU2A 1YIJA 3SGIA 3HKSA 2H0YA 4QU3A 1VQEA 3P98A 2R7ZG 4LV0A 4RA7A 2ASBA 3HLBA 1RIPA 2VQFL 3CPFA 2HP5A 3WRZA 3AGFA 4IOAA 3QHYA 2Y2JA 2HPBA 4JPMA 5JYPA 2RCXA 3PO2G 2R9WA 2PNHA 1VM1A 3OPRA 4A3KG 4KG5A 5GLBA 2WGWA 2IHFA 1JB7A 3IQAA 4C6YA 4N1HA 4PM9A 1GCEA 1W8QA 3S16H 4J15A 4HESA 3GTQH 1AXBA 4AIMA 2VZAA 4RX3A 3O86A 2AHOB 5FQJA 1T9HA 1J9MA 3KJOA 3A3FA 2HP6A 1MKHA 3M2JA 2WGWB 3HLCA 2PI2E 3Q82A 3NEMA 1KE3A 4KZ5A 4JF4A 2WAEA 1M90C 3OPHA 3UNWA 4DR1L 1FSWA 2MO1A 4DXBA 5CTNA 3ZG9B 2F52A 4POFA 1KVLA 3BECA 1WE4A 2RCNA 5GLDA 5C4XH 4E6WA 3JAMc 4Y0OA 1BSGA 4TVAB 1K57A 4LF8L 4S2IA 2IT1A 2ZC3B 4B3SQ 3ZDJA 4RX2A 5EE8A 4B3RL 3RZDH 3I7FA 2UXDL 4X62Q 4DV6L 1PIOA 3W1GA 1XJVA 1XNQQ 3GTMH 4L5RC 3IWIA 4PZ6A 2Z2MB 4A5RA 1PI5A 2EX2A 1VQAA 1FJGL 1JTGA 5M5WH 4DR4Q 4N1XA 3VFFA 1IL2A 1PH6A 1TXYA 1OXXK 5EUAA 2R9XA 3PBOA 3W4QA 4IFDJ 4A93H 1PV4A 2WKHA 2XDMA 4OP5A 3I4MG 4O7DA 2E2IH 1IEMA 3MZEA 4A76A 4MTNA 1JTDA 1I3QH 2NVXH 4RMFA 3RXXA 1IKIA 4PMWA 4P0MA 4N9KA 2ZTEA 2NVTH 1YJNA 2JA5H 3KFUA 4X69A 1ES5A 3HUOA 1YHQA 1I50H 3W4OA 2VW9A 2JQOA 2KHIA 4R4QA 3UPNA 4B3TL 1EYGA 5CTMA 5FQMA 3PO2H 4NPSA 1EQRA 4ALPA 3WS1A 1DJBA 4GD6A 1L0WA 3IXDA 2E8IA 5ELNA 1XPBA 4D2OA 3D4FA 4A3IH 1E3PA 1XXMA 5HFOA 2IWCA 1K54C 2Q9NA 5M5XH 1VQFA 3ULJA 4GNXA 2EXDA 1Q1BA 3TQYA 3MEFA 4KQQA 1VQ6A 4E3OA 1K4EA 4A4IA 5GLCA 2VL6A 2UXBQ 4NB3A 1YMXA 2V2FF 1H95A 3DWKA 2ZJQA 1VCIA 1HNZL 4KQRA 4U0XA 5DTKA 1ASZA 2GDNA 5G18A 1E1TA 1LUZA 1YI2A 2G2WA 1OXUA 5M18A 3GTOH 2I5MX 4A3GH 4LNQA 4A3JG 3ICEA 4OO1G 2KBNA 4KZ3A 5DLQE 1I94Q 4PZ8A 4BBRH 2B3GA 3SOIA 2WAQE 2Y2OA 4UA9A 2X01A 4GOPA 3RN2A 5EVLA 4P73A 1X3GA 3F2DA 3KDFB 4A3BH 2ZMAA 4FCFA 4GDBA 1U0LA 1CEGA 4DV4L 4AQYL 3O87A 1PZOA 3UPOA 4B4ZA 4EV4A 4X65L 3BFFA 3E9HA 3I4NG 2UU9L 5FLMH 3I4MH 2C6WB 4E3LA 4A3EG 1IYJB 2K14A 2J9OA 1CSQA 5JJKA 1K56D 4HIKA 2XD5A 1UE1A 4Y52H 1PH5A 1YHAA 3CZDA 1AE2A 4GKUA 4OWWB 4DR3Q 2KCMA 3J7A5 4JBMA 1LL9A 3N8SA 4LF6L 4LFCL 1S72A 3I55A 1HZBA 4A3MG 5TGFA 1HZOA 2IY5B 2NVQH 1K57C 4UP8A 3VMAA 5FQKA 4KZ4A 2KHJA 3HUMA 2Y2PA 3A5UA 4HIDA 4E6XA 1XGJA 2XFTA 3VP3A 3HOXG 2FXQA 2B63H 5CGWA 3G30A 2B63G 1E3UA 1W7FA 3H15A 4JI2L 1KIXA 4HBUA 1C7YA 4QQBX 1G51A 2XQZA 4OX9Q 2FFFB 2H5SA 3AGEA 4GLAC 2G2UA 3ZVWA 1ERMA 3M4OH 2UUBL 4A93G 1PH2A 3CCVA 4JOIA 1GHMA 2K50A 3BFEA 3MZDA 4EQIA 1KQSA 4MBFA 4R1JA 3OZHA 3CCJA 3IF6B 2Z2LB 3B3XA 1VQ8A 3UE0A 3HOUG 2ZD8A 4EQ5A 4ZBEA 1HZ9A 3A74A 3HOUH 1E4DA 4E3JA 5C44H 2VS1A 2KENA 2LXKA 2WZXA 3OW2A 1ZKJA 3IWOA 3S1NH 5C4XG 2EFXA 4OPZA 2UU9Q 1PI4A 1RP5A 5FI7A 1SDEA 3T1YQ 1SLJA 1KRSA 1YJ9A 1XNQL 3ZG0A 4LF5Q 5A92A 1EI5A 1NE3A 4LUOA 4KZAA 1KRTA 5FLMG 2Z6KC 3I7JA 1N4OA 2NVYH 4WMCA 5C0XG 4WELA 2YTVA 1ONGA 2MFIA 4S2MA 1VQCA 4JI1L 5M3FH 3J81i 4N9LA 3HVFA 3HOYG 4OWTB 3FV7A 1MBLA 3TEHB 2Z6KA 3G71A 2PI2A 3TS0A 4LCMA 5J3BA 3RNUA 3HLEA 2Y4AA 1N33Q 3ZNTA 4BA2I 4DV7Q 4BL2A 3PO3G 2B29A 4YHHQ 3E9IA 3PUVA 1NYYA 3ZNYA 4GLVB 3T1YL 2N78A 3GSGA 3K7UC 4X56A 1FL0A 2WFWA 2YTYA 3TREA 4OX9L 1YT4A 3QNCA 4AQYQ 3AEVA 1EOVA 3UDIA 2Y2GA 1N32Q 2RF4A 1H5XA 3GQZA 1UE7A 2XR0A 1PYSB 2JA8G 3SH9A 3PBNA 3C5AA 1EWZA 5JEAJ 4UA6A 3IXHA 4PM5A 1J5EQ 1CI8A 3VP1A 4DDSA 2F3IA 3VP2A 4P71A 1FCMA 2Y59A 1RGZA 3GMWA 4A3BG 4F94A 1XKZA 1KE4A 1K8GA 1FOFA 1PWGA 1LHYA 3SS4A 1MJEA 1IBLL 4HJAA 1XMOQ 2X71A 4YCWA 5IT9c 3FWLA 1WOCA 3KYHC 2QEXA 2QA4A 3OTOQ 4JV5Q 4EUZA 1JWPA 1MPLA 1YZ6A 5FQQA 4A3CH 4GDNA 4O2DA 2Q2HA 4WEKA 4LV2A 4PPRA 1NY4A 1CKNA 1K55A 2J8YA 2OTLA 3CCRA 1NJ4A 1BBWA 3EIVA 4NXNQ 1E7ZA 1K6SA 4HJ7A 1ES2A 2HIXA 1QMFA 1OXSC 5EECA 2UXCQ 4DUYL 4XIGS 2J9PA 1HD8A 1ZC2A 3E2KA 5GQOA 4R4TA 4JF5A 1X3FA 4IOCA 4LV1A 4IEDA 1Q2PA 4AH6A 5LMNQ 5DTSA 5KSCA 1UEBA 1YEZA 1K8AC 3CCUA
chains in the Genus database with same CATH superfamily
3W2DA 2IX3A 5A2QE 3PO2B 2P9VA 3HCYA 3NQIA 2ZC5B 3CF5A 4LFCQ 1NJIC 2JA7G 3M4QA 3U50C 1B70B 1J3WA 4IJGA 3I73A 2JN4A 4YWZA 2UUCL 4X65Q 4ID4A 2JA5B 4JXGA 2WGVA 3G6JB 4GJ4A 1MWSA 3DHQA 1VQNA 3DTEA 2ZC4B 2L0WA 4AFIA 1ENCA 1B1ZA 1NTGA 3STBD 5IYDG 4NEED 3H91A 4O0AA 1STHA 1S0WA 2HIVA 3V39A 3AFPA 4R3BA 2AWOA 4UDUC 3UMEA 2JP1A 1YLTA 3UB9A 3FHWA 2M1CA 4JV5L 3MXNB 2EFUA 2F0DA 3S7OA 3SS3A 3BZKA 1B9MA 3B47A 3H0GH 1CM9A 2XFSA 4KUOA 4MZ9A 1FNWA 1VQLA 2A5HA 4HBTA 4OVDA 4K0KL 4EUVA 4K8JA 1M1KC 3L9AX 5AFWA 1L2SA 1YSPA 4Y0UA 3VE3A 1TS6A 3R4KA 3IHBA 4X64L 4DR5Q 2Z6DA 4HNBA 3VA7A 1WTXA 1RDPD 1S1ZA 1C3BA 4ZK9B 1X0OA 4DE1A 1LSXA 4P72A 2ZJPA 5AQ7A 5TBMA 3HOZG 4Q0FA 5EM1A 2PR5A 3SEBA 4B3MQ 2WB1G 4TQUS 1FR6A 2QYBA 3NI9A 3L3OC 1OXVA 4DFAA 2JA7B 4X53A 1XMQL 3NOPC 3ZGAB 3Q24A 1JICA 2MHVA 4CJ1B 1VB6A 1EYCA 4OPRA 5KGUA 3GO5A 3M3YH 2O9AA 2OAP1 1KOUA 1FYCA 2WB1B 3CU7A 2VY3A 3ND9A 2VGLM 4X68A 4JLFA 5EKKA 2QKIC 3J81L 2NN6I 4HMJA 1C8CA 1XMOL 3VFHA 3ZHHA 4BBUA 1PHJA 3CHWP 2PZTA 1KNAA 4NXNL 1P9RA 4IUKA 2ZQ7A 1TQOA 3IFDA 1DOKA 4Z9QA 3NTKA 3TZUA 3RLNA 1W63M 1JJCB 2PD8A 1Q81C 5IU1A 2E2HH 4RVAA 4OOMA 3I90A 1GVPA 2BE5D 2NYZD 2XH9A 4OOLA 4UAIA 1SBBB 1Z9FA 3A0JA 4DUZL 4X1LA 1PFNA 2EY1A 3ITPA 4DV3L 4KJNA 3F1ZA 1WCMG 4S2KA 5C44G 3LY4A 3CMZA 4Y7NB 3T4AC 3OCNA 4BXXH 1JJ2A 3N8RA 5FQIA 2EY2A 3E3XA 4DV1Q 4DUYQ 3EEHA 4B88A 2BG1A 1BT5A 1E1OA 4UQIS 3WS2A 2LSSA 1SKOA 2P04A 4GNXB 5J3WA 2GVAA 5CHJA 1D06A 3VR5A 1HVBA 3BFGA 1BO0A 4G7OC 1E25A 5KZHA 4GS3A 1LO5D 3G2YA 3UB7A 4DR7L 3GVBA 5C44B 1H8MA 3D0FA 2R78A 3G31A 3CAMA 2A68D 5M3FB 1J5EL 1NCVA 2PDRA 5EAYA 1EZ6A 4RGMA 3S2HH 4NP5A 1ZXTA 3PIP3 1TY2A 4V190 1YLPA 4R70A 3CRKC 3E4OA 4LF4L 2H10A 2A49A 4GNXC 4QD4A 2K6AA 1XPOA 4QJGA 3OOCA 2WK0A 1VQ4A 1P8LA 2VXWA 4GLXA 2Z4IA 3RD4A 3MXNA 2EZVA 5CHUA 2F4VQ 5KEEA 2ZL1B 3ZJYC 3RTYA 5IS1A 1Q12A 2SNMA 1EQVA 3VDYA 4JI6L 4GHIB 5CHMA 4L63B 4DF6A 5ELFA 2XRSD 5EPKA 3ICYA 2B2UA 3KJPA 2UXBL 1PVOA 4QHCA 1QWYA 4JI8L 1HLUP 2ZM0A 4RGOS 4B3TQ 2VUMG 4C1NI 3S15H 5IYDH 2K5HA 5FJ8H 2F0NA 3ER0A 2VGJA 3BRMA 3PUXA 5DAUA 1N9BA 4DR7Q 2ZBBA 3CPTB 3NC8A 1Y4OA 5F6AA 4IALA 4UEYA 1GD7A 3PF5A 3OMGA 1RODA 1SZVA 5F83A 3VV4A 4PZ7A 3RMHA 2MGSA 4HCSA 4IJHA 4DV7L 3T1HL 1D2BA 3T12B 1JWUD 1WTWA 4X6TA 2RL3A 2HDUA 4DV0Q 4X62L 1PYYA 3C7VA 2R92B 3LI9A 4YIJA 1UNSA 2VQEQ 5CBAE 1MC0A 3A3IA 1P9WA 1QOHA 2O2LD 2GA4B 1DYQA 1VQ9A 4IUVA 4JI5Q 1QG7A 1R4PB 1R9TB 1LV9A 1STBA 2H5XA 1TS8A 4PM8A 4BLMA 3IT9A 3D8GA 4QL5A 4HSPA 4DAPA 1FCNA 1X65A 2V1CC 3E5SA 1MKIA 2VGLS 2WGIA 4X3UA 2RDHA 4OL7A 4C3JH 1SKOB 4KKSA 1JNUA 3PAGA 1BLCA 3HOVG 1TDLA 2F0SA 2KEDA 3VYSA 2E2JH 5AVEA 1S1YA 2ALYB 1PRQA 3TOIA 5HAQA 2OQKA 1V9YA 4DV4Q 3G34A 2WKQA 1MZUA 4LFAL 1T1BA 1DXMA 1F77A 1SROA 1Z09A 1B44D 3J7AF 3K0XA 4KI0A 1H9SB 3QNBA 5D3IB 2VQEL 3CCEA 1Q3LA 1QVFA 2HDSA 1K56A 3Q7VB 3W4PA 3TP8A 5CBEE 3J80i 4ZRZA 4LF4Q 5IHVA 4MBHA 2NZHA 1IW7D 4S2PA 1AZQA 1GSVA 1TWCB 4FXDA 4GNUA 2DCFA 4DKIA 3EBEA 4PV1C 2JA8B 4HIAA 4P6ZS 2HDRA 1HFGA 1LYLA 5E4XA 1Y1VG 5EGTA 1EIHA 1SMYD 2FJ2A 2XSCA 2M7VA 4JXSA 2A74C 3I2ZA 3SK4A 3LIFA 2NUCA 5CORA 2HDMA 3D4DA 1K54A 2XTIA 5DF8A 1SCWA 1LT3D 5JJLA 2WYXA 2MNAA 1L0FA 2ATWA 1XNRL 1FVIA 4JI2Q 4H02A 5C5MA 2CCZA 3IKJA 4UP7A 3N8LA 4UAAA 3DW0A 3MF0A 1JR0D 1KDWA 1MY8A 2M9VA 4LF5L 1KGGA 1IYOA 4HP9A 5HDSA 3O13A 1W79A 2LMCB 1D5MC 1CTMA 3SXHA 4AYBG 1BYWA 4NXML 1A63A 5C0XJ 5IYCG 3NCKA 4IO9A 4HHDA 1XA7A 2Y2HA 4IUHA 2I0QA 5D14A 5I9PA 1Y1VH 1L0XB 2AUKA 2V0UA 2EXZA 5CERA 2WAQG 1QVGA 1LI9A 5EFWA 1FQGA 1WYDA 2AWNA 5JPNC 1N34L 4FH2A 4D60A 4QPRA 2HP9A 4ZKCB 5CGKA 5A2QL 1S40A 3TMEA 3IXGA 1S67L 4O0PA 3A3JA 4WZ5C 2F1MA 5TJJA 2QDBA 5CXWA 1L0DA 2F3WA 1XYIA 4RYEA 1PW1A 3NE5B 2BA1A 4DAYA 2AKWB 3S1MB 3MQQA 3VSKA 2KHSA 2EYFA 4CJNA 2INWA 2W1TB 2F0LA 4ZUJA 5F5YA 1SE3A 4A3BB 1G6AA 1PZID 2HQEA 4NMZA 1K83B 2EPBA 1KL9A 1GJXA 4KQDA 4XUZA 2EXBA 2BH2A 4A3DG 1F9RA 4UP9A 1ZG4A 3EQVA 1XXGA 2FFYA 1RCVD 4JK1C 3LY3A 5IGBA 4N8X1 2RSNA 4LENA 3F1OA 4LF6Q 3DTMA 2RDGA 2LKVA 3OBFA 1NSNS 3Q81A 3S2DH 3LGOA 2BE5C 2XGTA 1VQGA 1LTGD 1T5EA 5EKLA 3PBTA 2M00A 2OF1A 4JBKA 1KE0A 5DTTA 3KDFA 2AQ2B 1PH7A 1QJOA 1D5ZC 3CD6A 4R3JA 3VR3A 4GZYC 2O9BA 5M9OA 5DVAA 3S1QH 4MLLA 1BCPB 4NXFA 4GB7A 1N36L 2R6GA 4XXRA 1IW7C 3VYUA 4J6HA 2XGNA 3BLMA 4QJFA 5E2GA 1QVCA 1JE5A 1X9NA 5C3XA 2IX0A 2WKEA 2ZJRA 4BENA 1MIUA 3QO2A 2O5JC 2NVQB 1J9OA 1EEFD 4CDCC 3PF4A 1RL2A 3FPUB 4WJ4A 5G4ZA 2B2VA 3I8ZA 4B3RQ 4BD0A 1P16A 5CV9A 1W6KA 2DGYA 5T1GA 4OIJA 2EQSA 1CZWA 1QNKA 3CUEA 4JOIC 2JBFA 3KO6A 4DNIA 1PZJD 3CLOA 3M3YB 4H0LC 2Y2IA 4GZBA 3SH7A 1L0GA 1OT9A 1O07A 1S6RA 4OPYA 5E2HA 5IWAQ 5HPIA 2Z9HA 3LIBA 4HEDA 1I4QA 1IKLA 5L37A 1IYSA 4K0XA 3CXCA 4X55A 5IGGA 3BYTB 3DWZA 3TDQA 1LABA 3HP3A 4OH0A 4XYQA 4HJ5A 2F0UA 2CH4A 5IP7H 4BXXG 1GSWA 3KK7A 3K5MA 5EPHA 5HW3A 1XX2A 4LF7L 1G2SA 2L55A 2A19A 4KHPQ 5HDDA 1K25A 3UB5P 2CKZB 3FKWA 3PUWA 3NBLA 3T1XA 1K3BC 1UE5A 5GLAA 3S14H 4JI4Q 4KD4A 3K0YA 1I50B 2VZWA 3X3NA 1X3EA 1BUVT 3CC2A 2WKIA 1I4PA 1HZAA 2WADA 1FNVA 4RA8A 4RH6A 5C3WA 5C3EH 1TWHH 5FAPA 2B39A 2DY7A 3CCQA 2PYRA 4DA2A 2RDFA 4KG6A 4RGTA 4CJ2C 3HOVB 4R9WA 3SK5A 5M19A 1KNEA 3MFYA 1LT6D 2A6HC 4R4IA 3S2HB 4DR2L 3C4OA 2JE5A 4WZ4A 3N6IA 2B2TA 4ZJ1A 3FVQA 4DK6C 5JVG3 1XFQA 4B9OA 4A93B 1SNQA 4H13C 3F1PB 2Y0SE 4G3VA 1Q7YC 3IX4A 1HFNA 4KN4C 4AYBE 5IYCH 4YCUA 2WINB 1GOZA 2HCIA 3KSHA 2EX9A 3EWKA 1QUQA 1HH2P 3CQZH 1A3UA 1BDOA 1CQVA 4JGPA 3V96A 2A8VA 2Z6BA 4C2MH 4GN5A 2R92G 1TS4A 2D0OA 1UWNX 2BH8A 5ELDA 1I6HB 1D1JA 4BL3A 4B9WA 4JI8Q 2EJGC 1MI2A 3HOZH 2JA6G 3UPPA 2EWWA 1KDSA 4OPQA 4RCOA 3PIPA 2HHHQ 2OSUA 3T16A 5FO8B 2UUAQ 1Y1WH 4GKKQ 4LUVA 1CJFA 2RHSB 1QILA 1Y28A 3BM6A 3QP2A 2Y79A 4HH2A 2J7ZA 2J7VA 1E3UD 4BBSG 5C0XH 4F7XA 4M3KA 2YU9H 2E8GA 1JCKB 2EYOA 3OPOA 2XVSA 4C56C 3T1QB 3H3VH 2CVRA 4HJ3A 3NBHA 2IL8A 4BD1A 3EROA 2XWBB 3JAML 1SKFA 1PWCA 3NXWA 1LTBD 2OLVA 3N7WA 1WCMH 1H8YA 1TS5A 4DV5L 2KCNA 5J8XA 1CSPA 4JG2A 2EXAA 3LO7A 1KAAA 2O5IC 3KLRA 2QILA 4C3IH 4Y13A 1CEFA 1YM1A 2JA8H 2V1ZA 1BKBA 3Q07A 1YITA 3DLLA 4A3JB 3MQOA 3JYIA 3O3VA 4M1UB 1N9LA 2QCPX 3GD7A 4C3HB 5LMUL 4PMBA 3C1EA 5BR8Q 1EL0A 1TS0A 1ZHHB 2QHKA 2Y91A 4CDDC 1OTAA 2YKFA 3VOZA 4DDYA 1RTOA 2PYKA 1LT0A 1K55C 4I3AA 2GVBA 1YQSA 1LLBA 3GDEA 4Q5VA 3HJKA 4OELB 5CV6A 1C9OA 3BWLA 1BBUA 1LM0A 3FPWA 4ODGA 3P7NA 1XJ4A 2Y2KA 4H7BA 4C2MB 3RLOA 3OSOA 4XT2A 4ARZB 3NDGA 3L2PA 4A3FG 1KGEA 4JI4L 3EVQA 3JVVA 4L9FA 1XWEA 1LSVA 1CA6A 4LFBL 1G68A 4R4OA 2UXDQ 4OP8A 4DV2Q 1I2WA 1ASYA 1E2VA 4N9TA 2A24B 3MQ0A 4S2JA 4EESA 4XXEA 2NVXB 1PNEA 1VDZA 3OC2A 4MDZA 4DR6Q 2NTSA 2NB0A 2W3EA 4LK1C 3H9WA 4U673 4BBRG 3C46A 3MFXA 4BBTA 2E2DC 2L9HA 1QNUA 4ZLTF 1QMEA 2PQAA 1E24A 1GHPA 3H7WB 4A75A 5DJTA 2R92H 1ERQA 4IFDG 1CKNB 2CWAA 1IBKL 2BLSA 1HR0W 4LUZA 3IHAA 4E04A 1LL8A 2SOBA 1SFOH 3X3MA 3NULA 3VYRA 2QPNA 2KA7A 3F1NA 3MJQA 2JA5G 3BFCA 1CKOA 5DM63 2DUDA 3N52A 3QOLA 1YSQA 2O99A 2ZQ8A 4IN3A 1EQTA 4DV5Q 5FKAC 2O4XA 1NXYA 4ID6A 3OW7A 1JJGA 5F82A 1XJ6A 3R2IA 5FDHA 4NW2A 4GLQA 1BUEA 1SXTA 1XTDA 3NELA 1MWRA 4EBLA 2H1EA 1I5FA 3OHXC 4QB4A 4MNRA 2QJ7A 3BYYB 1AWIA 2WZZA 2KCTA 2D2CC 3PGZA 3EQLC 5KMWA 3FKIG 3N4IA 1WTRA 3GTMB 3EOIA 5D3OA 5HGQA 2OOLA 1I4XA 2L5TA 2K75A 3WWVA 2NUPC 1X55A 2N3SA 2R7DA 1N36Q 1VQHA 4KZ7A 1G6PA 3GTKH 2EIFA 3E2LA 3K3CA 4CLCE 5FASA 1IYVA 3VP0A 2R93H 2ES2A 4BY1B 5HL6A 5KIZA 2QKPA 5TFQA 2L0CA 1Q86C 1GUNA 1SNPA 2A69D 2J4XA 3P1HA 5JJIA 1GUTA 3IF6A 5CGSA 4X64Q 2K5VA 2SEBD 1E22A 3M85A 5H1SE 3HFZB 1G91A 4PKYG 1SDFA 3K5LA 1K0KA 4WF0A 4DV2L 3LYXA 3WOEA 5HAPA 5EQ0A 4Y15A 2IW3A 4RAUC 1Y1WG 4XQNA 2NWGA 1S4ZA 1O7LA 1YNXA 4S2OA 1PRTD 1YJWA 3PO3B 1JT8A 1STEA 1XJ2A 4GD8A 5E3FA 2HD3A 2F0JA 5A35A 1JWVA 4JF6A 3ZG7B 3DM1A 3HKZE 3ZG8B 2A73B 5CGXA 1LTRD 4UPAA 1PLFA 3NOTC 3PHYA 1SYGA 1B8AA 1EW0A 1XFNA 3QP4A 4MNOA 4J1MA 3WRTA 5TR7A 1NR4A 5EBDA 1CK3A 4NK3A 1X6OA 3LR5A 4PMCA 4IFDI 4K91A 3H3VI 5K5BA 1TVXA 4A3CG 4RG1A 5BR8L 3AB9A 1QZHA 4YY3Q 1YPRA 3MFGA 4JI7L 1IELA 1HQRD 5DNFA 1F2KA 3DM3A 2BCOA 4ZCKA 1TEMA 5TBMB 1L1OC 1EFWA 3HLWA 1LACA 5K36H 2F0WA 2J3WA 1ONHA 1SYFA 3DEOA 4OXPA 4P2CB 1PH8A 4S2LA 3M7NA 1Q90A 2A68C 1G8ZD 2IHEA 5GAEC 2N88A 2AUJD 2V1AA 3K3DA 3HS0C 5EVID 1EOTA 1UUPA 3OIPA 1BTLA 3EGXC 1XMQQ 1Z47A 4MEZA 1JC7A 3H09A 2PMZB 5M3MG 3BEBA 2F0EA 3CCMA 2IWBA 4KHVA 4K14A 3TW8A 1A3TA 2KLIA 1VQQA 3A54A 5GAGC 4DR6L 3HZXA 3QR8A 4C3QA 1TWFH 3WWXA 2DNEA 4RHSA 5IYBG 1TWAH 3PV0A 1YAXA 2QZ6A 5BN4A 5IT5A 2FHTA 3IH8A 2UXCL 2VKSA 3UY6A 3G6EA 3RR5A 1NRJA 2XA7M 4PQXA 5M3MB 4A3LG 1P0ZA 3A5ZB 1VEUB 2MJ6A 1SRUA 2MP1A 4PG3A 2QMIA 2ZT9C 3U9OA 3CCSA 5DF7A 3VYTA 3ITBA 2RA4A 5JPMC 5C4JH 3KYZA 1NY0A 4I39A 1PRTC 4R6LA 4OQIA 5JYOA 4JI0L 3Q7ZA 3WDNA 4LAAA 2TMPA 3CPWA 2ZJ9A 2XLNA 2N55A 5LHY1 4OOYA 3HOVH 5J22A 4RWSC 3CMAA 1FSYA 2A3UA 2CWPA 3GTLH 4JC0A 4ZTKA 2OWOA 3QP8A 1BBXC 1YVCA 4DV1L 5FEFA 1C4QA 4Z1WA 1RJTA 4IURA 2DNSA 1FCOA 1M8AA 1HTLD 2I5LX 4UY8C 1EROA 3V50A 3PUYA 4DE0A 4V0BA 1K9MC 4YOFA 4Q0HA 4IPHA 3DXJC 1ONLA 1SJHD 2Q8RE 4XQQA 4JI0Q 3CUEC 1X3PA 1HA5A 4R4SA 4K08A 4EQOA 3G7LA 5E2EA 1IL8A 3BZDB 1CHQD 1SEBD 1F2ZA 4S2NA 3BDLA 3ZVTA 4KN7C 2L15A 4I3IA 4JYAQ 1MXOA 4KY7A 2C5WB 1Y54A 3K80C 4FSFA 4OWXB 5EOEA 3RZDB 3HOXB 4EEPA 1SYBA 3C4PA 3MS6A 1Q8KA 1IYQA 1ET6A 3S9WA 3L7ZC 1OTIA 5MC7A 5FOBB 5E43A 3OPPA 4C3HH 1X56A 4LRXC 3FC7A 4LFUA 1SN8A 4YWLA 5EVEA 5IP9G 1A2TA 1OTBA 5K5PA 3OWEB 4OLGA 2FINB 4ZUIA 1NBWA 1LI0A 4LRZE 3C7UA 2Q8TA 2PRFA 1CT1D 3LGJA 1WTOA 4LFAQ 3KLWA 1KDAA 4GOPC 4GKJL 3J81E 2CFMA 3J80c 3TRZA 4ZAMA 3NWSA 2K5DA 3A0SA 2EY5A 4DNRB 1S5DD 1WTPA 4X6AH 1VQPA 1Z7TA 2PQAB 3H7WA 4GN2A 4DXCA 1ESUA 3S14B 3HLFA 2VLGA 1PZPA 1D7QA 1WFQA 2NTTA 1PYBA 3KUPA 4X3KA 3E6ZX 5CC4A 3LEZA 5ISRA 2WB1E 1EY0A 2PU4A 2UWXA 4YHHL 3S1YA 2R7FA 2JYOA 3W1BA 4DR2Q 4YY3L 1V9PA 5IT9L 5EVIC 1MKMA 3KF6A 3RZOH 1RGYA 2N49A 5KYLA 1AN8A 3O88A 3PAEA 3I56A 4B3SL 3OWFA 2JEAI 3MXQA 4HY8A 1DJCA 2Y0SG 4KJOA 1IBLQ 3BQAA 4BWGB 1S5BD 2V9AA 3G35A 1XPUA 3HKZB 5C4JB 3MBZA 3GV6A 2I72A 2XEPA 4DXGA 3OYYA 1Y69U 3KLSA 3TN2A 1MJCA 2VB3X 5GAHC 4DGZA 1OT6A 2W1RA 1SNCA 2WV6D 3HEJA 4HP4A 4QWOA 3UE6A 4BBSH 1PH3A 2XWJB 5KRUA 5EJWA 1FJGQ 2ZM8A 4K6DA 2HZ5A 1VQOA 1RKNA 4HN7A 5E4WC 2G9HD 1I2SA 1M6KA 2EJFC 3C38A 3DBAA 4KZBA 3NP8A 5HARA 2DRWA 4ESPA 2B63B 4DAVA 4X66L 3K8AA 5CEDA 2JXMB 2C35B 2QEJC 1D1KA 4LW1A 3LR0A 2A1AA 2JA6H 2LFNA 2B02A 5GHZA 2B2YC 3QG1A 3BLSA 4HH3A 3BDCA 1K83H 3PIO3 3I4NH 1KVMA 1GA9A 4GCZA 3KF8B 2D02A 3J81j 1BLHA 1R9TH 3E0EA 5L8MA 3IF5A 2ZC7A 4EU0A 2ZQ9A 3NTHA 1TDGA 4GHIA 3NBHB 4WEJA 2ZM6Q 1ES4A 2JC7A 5M5YB 1N9WA 5CYUA 4KZ9A 1K28A 1ET9A 4WBGA 3NPPA 3IRBA 4O42A 4DRTA 3M4OB 4HAEA 1DY6A 1TS2A 2X6LA 1GO3E 2JEBI 3CJMA 4WM9A 4FP5D 2B2YA 1D8LA 3CP0A 5IGFA 2J3TD 4Q0JA 4FH4A 3W8KA 1B4OA 3CC7A 3J7AV 3DTIA 1IFQA 3PIOA 3TP7A 2ACGA 4DXFA 2PZWA 1TWCH 4XTCS 3G48A 1YLZA 3LIEA 3MKEA 2FH5A 3AGDA 4RCNA 5D3DA 1WYBA 4A3MH 2I46A 3TBIB 1ODVA 5KSHA 1E2ZA 3FKVA 2SDFA 4A3GG 4IUUA 4NXMQ 4JBFA 5GROA 4GOPB 1QUQB 1K4FA 3PUZA 3U4VA 4TKOB 1F9QA 3WS5A 1CK1A 4P85A 3GECA 4A3KH 5DJUA 4KZ8A 1GUWA 2Z0SA 5FEGA 3KOJA 2OQ0A 2XRQD 1ICFB 1VQKA 2WAFA 4BY7B 1DJAA 3NJAA 4IBRA 3RJUA 4GKJQ 2OV5A 3CCLA 1KD1C 1A15A 1JVJA 4K0WA 1A2UA 3D4WA 1K8MA 1NRFA 4HR7B 4HEFA 1HJPA 2KECA 4OGQC 4JI6Q 1AH9A 1S5CD 1XX8A 1OTEA 5ELEA 1GSXA 3VR6A 3M4YA 3JAMi 3AU7A 3BYDA 2R93B 1OPXA 2PBDP 5EBCA 3VP4A 1NZUA 1N9NA 1PW8A 4GN4B 3GTKB 1VQ5A 4A3MB 1H3QA 4DN0A 3HLGA 3E0JA 2JKRI 3ERSX 4IVIA 4EBNA 3EN2A 4M8AA 1JWZA 2BASA 1L0YB 2K7SA 4J8QA 5KYIA 2ICEC 4WYYA 3UDFA 3S17H 2OAQ1 2PO4A 1STGA 5BN5A 5IP9H 3OCLA 5IYBH 1ILQA 3MXGA 5AQ9A 4MTKA 5FJ8G 4CKEA 2CMNA 3B42A 1L2FA 1LL5A 2O0YA 3T4SA 2I5HA 3I4MB 2CQOA 2LXJA 3HBRA 4NXGA 5FI6A 1NUCA 1LTID 4DE2A 1E0BA 5LL6X 1PH1A 1KLGD 3DWPA 2D62A 4LFBQ 4PNYA 5GADC 3HOWH 2DMWA 4IBXA 4RGNA 3T4QA 3JAME 1CA5A 3J7ZC 5BN3A 3BU2A 3J80E 4DK0A 3RH8B 3KLSX 5A93A 2V20A 4JBWA 1G291 4DR3L 3T51B 3P75A 4GS9B 2VUMH 1SYDA 5FK9C 3CI6A 1YMSA 4QIWB 3TP6A 2A6HD 3MXRA 2V0WA 2EA9A 2JHEA 1GA0A 4ARZA 4B9XA 4ULLA 4KKUA 1SE8A 1JWSD 2JK8A 3GP7A 4E6IA 1WTQA 3GTLB 3PTEA 5C5KA 3SH8A 4UHVA 5NUCA 2K01A 3MC0B 4A3DH 4YCVA 2PYPA 3IS2B 3O5YA 5E1FA 3HOXH 1MWTA 5AVFA 5FSRA 3LX0A 1BNZA 4F3LA 2B2VC 4K0KQ 1PZKD 4U0TA 1W8YA 3I4OA 2VX8A 1N8RC 1R4QB 1KHIA 4KLKA 1S5ED 4BBRB 4DAYB 4MN3A 3QP1A 4RKLA 2ZTCA 2JE6I 2KEEA 3HKZG 4L5QA 4DAMA 4YFMA 4KY6A 3ONAB 4Y7NH 3I4LA 4EGVA 1T1AA 3M6HA 2Y0SB 3MXSA 4B3ML 5HWVA 4EVOA 4IUTA 1IKMA 4PM7A 2IX1A 2RQXA 1W2BA 5LMNL 3CKIB 4X25A 2P9VB 3K5OA 1KXLA 3BY8A 3Q6SA 4A3LH 2E2HB 1L1OA 1VQJA 1HR0Q 1BCPF 4UHUA 1PH4A 3AQQA 4EETB 1BQQT 3NTIA 4X66Q 1DP8A 5IY0A 1D6EC 4A3IG 1N9OA 3C8CA 2NN6G 2QDLA 4JCVE 1HPCA 3KF6B 2EJMA 4BS9A 1PRTF 2ZXOA 4NXEA 3T4LA 5CEBA 1L0EA 2EYLA 1UWVA 3NSWA 2HV1A 3MR0A 5F1GA 2W3DA 4RFBA 1YNNC 5DF9A 2GX5A 1H0MA 1H8ZA 2YTXA 4MN6A 1PTOC 2UV0E 5HAIA 3MHBA 3GQBA 5HL1A 4CHTB 2YKHA 4OLDA 3WS4A 4WL9A 2K03A 4X3SA 3A0RA 1IBKQ 3ULPA 1RD9D 1NAPA 1SDNA 2CC1A 1GM5A 1X54A 3PO3H 4ME4A 5KNCA 2W0NA 2Y2MA 3T53B 2ZQCA 3TG9A 1MBYA 3UN7A 2A69C 4N8FA 5KNDA 2KVMA 1HNWL 4QY6A 1PA6A 4E3KA 5ELBA 1IZ6A 3LR4A 2WKRA 1VQDA 1EY9A 2D0PA 2KOIA 3LFVA 5CRFA 1MSGA 4JBJA 4A3DB 1RF2D 3G4PA 1RCJA 3H82A 3CAXA 3HLDA 3Q8DA 4MHEA 2B8FA 2R3ZA 1WI5A 2YV5A 4GKKL 3A3DA 3JPUA 4N92A 2RVLA 2B2WC 3H3VC 4KENB 4S2NC 4EW7A 2VB2X 4CBVA 1DP6A 2WUQA 3H6MA 2XF3A 4A3FH 2E2IB 1BCPD 1TWHB 3P20A 5C3EB 1OO9B 3HOWG 3FPVA 2JA7H 2JJQA 3T1RA 1DRMA 1B7YB 3H94A 5C4HA 4JVZA 5DFXA 3UE1A 5GL9A 1BF4A 5M1AA 5IP7G 3QOJA 3BVGA 1B50A 2RBMA 1WYCA 4P6ZM 1I6HH 1I94L 3U4LP 5FAOA 4ME3A 5JVH3 1M40A 1DOLA 2ZQAA 5ELOA 1Q2QA 2EX8A 3NUCA 3FYZA 3F2CA 1K38A 3ULFA 2Y2NA 5FLXc 4P87A 3FKIH 2R7ZH 4QCLA 3J7YW 2G9DA 5HGTA 1OTCA 4FYDA 2EX6A 2B2WA 1VMCA 3QP5A 3MFDA 3KSGA 3R2TA 2Q8IB 3PMFA 2A2LA 1Q1EA 4I65A 2NUTC 2YYZA 4G3WA 4BY1H 1HNZQ 3CITA 5FDSA 1XNRQ 4A3EH 4R8NA 4WORA 3S1RH 1HCZA 2L11A 4PM6A 4KZ6A 3HREA 5E7NA 4QY5A 3GTQB 2ZC6B 4KQOA 3MWYW 3GTGH 4QMGA 4FF2A 5L10A 4BWIA 2F4IA 1YBYA 4CDEC 1L1OB 3PCOB 1K6RA 3WS0A 1EWIA 1KGFA 1SHVA 4EQNA 4R4RA 1UE6A 2K2NA 3PR6A 3ZFZA 1RTNA 2F0GA 2PAVP 1Y8OB 4OO1I 4L9EA 4Y0TA 4XUXA 4DR1Q 4L0LA 4CPKA 1N33L 4A3KB 4FNFA 3TP5A 1HR0L 1V1QA 3RLFA 4JI7Q 4ZJ3A 1GKHA 1T5XD 4JKTA 2X6GA 4IJLA 1STAA 2P7JA 1XGIA 5LMUQ 2XIWA 4ZJ2A 4LF8Q 4C75A 3S22A 1ILPA 4DV0L 5L2FA 2EWVA 2WAQB 4POGA 2KOLA 2XK1A 1A0KA 2PR6A 1B53A 1SNMA 4LF9L 1ESIA 4WRDA 3PBSA 3M7GA 3MKFA 3A7AB 1TWGB 1NYMA 1YLWA 5BOHA 2JKGA 5IODA 1JOOA 5J39A 1YNJD 3OMCA 4FXGC 3MEHA 3CG5A 3GV9A 1AE3A 3WOFA 3KSIA 1FNUA 4KMUC 2IJ0A 4JI1Q 5EOOA 1K0RA 3EEAA 4FD8A 4IHQA 4DV6Q 1SYCA 4FDBA 3S4XA 1U5KA 4QIWE 3F2BA 4DPGA 1KDCA 1AZPA 1AP0A 2F0QA 2TSSA 3HUNA 1BZAA 2OEOA 4BY7H 4BY1G 2E5LL 2UUAL 4JI3L 1O7IA 3NDEA 5AQBA 1GUOA 4HIMA 5F1FA 2RSOA 1OMEA 3EA6A 1DCZA 4LMQD 1I5QA 2BDOA 4LCLA 3K5NA 4WMCD 4CLCA 3JC66 3R8BA 2Y55A 4WFN3 1AFPA 1HNXL 3T1HQ 4WJWA 3U58A 5IWAL 3TS2A 4JXVA 2CQAA 1VQIA 5JJZA 5EVIA 4FO2A 1P97A 5M5WB 2UUBQ 1ESRA 4IVKA 3GV3A 3GRJA 5C0XI 4JI3Q 3VOLA 3P01A 3ZYYX 2E5LQ 1O7EA 3BJUA 3NY4A 1STZA 4U3TA 5J4EA 1PXUA 1KDBA 4OQHA 5EVIB 4JXWA 1SE2A 1IKGA 1J6QA 4YWKA 3FP9A 3V5MA 3ZG5A 1FR1A 3BDOA 5HY6A 3MSHA 4LRYC 4EWFA 2PBYA 3GTGB 1QZGA 4P75A 1GHIA 3M9BA 2KDKA 2HT1A 3SK8A 3ITAA 4TRDA 2E76C 3ZQ5A 3N6RA 3IXBA 2OTJA 4BA1I 1C48A 2K52A 3HOUB 1ES3A 2QW7A 2JKFA 4KV6A 2ZMVA 4LF9Q 3FEWX 3G6OA 1HNXQ 4Y7PA 1IOUA 2G5DA 4N9PA 3UDGA 3A3EA 2XN9C 1BCPC 4QUFA 1FILA 3T4JA 4L8JA 5JAVA 3CRLC 2G7UA 2PD7A 1YLYA 5FATA 4OONA 2Q2TA 3D3RA 4PMAA 2Y2QA 5M3FG 3L0OA 5COYA 3LEQA 3K57A 3UB8A 2UUCQ 1XA1A 3HJIA 4ZAIA 3OOVA 4ZDXA 4EX5A 5C3EG 3HOWB 4LF7Q 3PSIA 3Q7VA 5I9OA 1PH9A 1FGUA 1S3OA 3RUZA 1U60A 4KUKA 2NVYB 3G4SA 3IF6C 3HL9A 3GR2A 1VEUA 4DKAC 1AW7A 4B08A 2VV8A 4MCWA 5DEHA 3LI8A 4KHZA 1NZOA 1WJJA 3AYHB 4DV3Q 3M6BA 4L5TA 2X02A 4GOGA 4JGRA 1M4VA 2B8GA 1U4LA 1VQBA 4H8RA 4FF4A 3MZFA 2F0FA 5TSSA 4JI5L 5IGDA 1Z6FA 4A3JH 2IWDA 2ZXRA 3T13A 1NMFA 4DNTB 1F2YA 4JGOA 4ABNA 2VUMB 1PFSA 4L5SA 1W5DA 5ELCA 2B5RA 3GDIA 5FA7A 3BY9A 1G5UA 3IWQA 5FQ9A 3VR4A 2NBFA 2XROA 1C0AA 4H6JB 1MGSA 2H0TA 5CV7A 5CECA 2BTFP 3GTPH 4LPZA 1VS0A 2K4KA 5AJ3L 3K59A 1NLYA 3NIAA 1UAPA 1ZYRD 2ID0A 2HQLA 5IE8A 5M5YH 4UQIM 1UGUA 4LWCA 5U47A 3RXWA 2K28A 1EY5A 5EV0A 3KBXA 2NZOA 4X3TA 1EIFA 4BQMA 4II7A 3RN5A 1O80A 4DE3A 1TD5A 4MN7A 5E2FA 3BZCA 3V3RA 1O7YA 2FZ0A 2ENBA 3FG8A 1XP4A 3S7PA 5L07A 3T4OA 3GTJH 4E3MA 5A90A 4R1GA 1CF0A 3MXUA 2VQFQ 4APVA 3S24A 3GTCA 4ME5A 5I94A 4IPCA 1CUKA 2Q2IA 5LMNW 4H6JA 5GHXA 1IBMQ 1EUJA 1G6ZA 1KC8C 2IA2A 1A62A 3DWAA 3I70A 2Y8HA 4IPDA 3QP6A 1HTZA 1ICWA 2Z4HA 1K0SA 3P7JA 3QJYA 3CQZB 5M3MH 1MWUA 2WP8J 2Q0OA 2PMZE 1VF5C 4DF7A 4JYAL 2QF7A 2MQHA 1S66L 1WCMB 4CDFC 4ZYSA 3OPLA 1HZCA 2ZM6L 3CMEA 2JA9A 2GN5A 3TSSA 2MO0A 3U4ZA 1F5MA 1KAWA 1ML0D 3DMUA 1IYPA 1O7ZA 2K5NA 5I2YA 4HQAA 3UE3A 4QY7A 3TSGA 4YWMA 5CV8A 4OEMB 5GHYA 3P09A 1O78A 2BOSA 3S1MH 1ESFA 2JCHA 3IX8A 4HTHA 4WUJA 1N34Q 3EQUA 1YHBA 1MD2D 2ZMFA 1YLJA 2AVXA 3MVVA 1NMGA 3LCEA 4QGUA 1EIYB 2XNAC 1ZG6A 2MJ8A 2V8FA 4KG2A 3KYEA 2BA0A 5HX9A 5IT9E 1BLSA 3ISGA 1DZ1A 3BVZA 3B6YA 2ZTDA 4BBVA 1XPRA 3BG3A 1Q46A 1KLUD 3MXPA 4HSVA 3G32A 5FO9B 1VQMA 1HNWQ 1S4SA 1UEAB 2JKTI 2Q2UA 5FI2A 1PTOD 1F9SA 3UDXA 3M4PA 3K7AH 3A56A 3F8TA 2HHHL 3CW2C 2WKCA 3RFBA 3GTJB 4E3IA 4EBPA 1DGSA 4CKBA 1Y8NB 3D3OA 3VSLA 1T18A 3PBRA 1X32A 2R93G 3LIDA 1HA6A 3BFDA 1VETB 1EY4A 1NNXA 2EE1A 2ZLYA 4NKLA 2P74A 4R0QA 3UO9A 3C3LA 4R4CA 2QJ5A 4BJPA 3Q22A 4HJ9A 3CC4A 1CI9A 3A8IE 1SR3A 3D9YA 2B95A 2VGKA 1JMCA 3FZCA 1A3VA 4WJ3M 4BY7G 3VOYA 4OQ0A 5AJ3Q 1STYA 4KHPL 2OCEA 4FXKC 1EQQA 1V43A 3A55A 3OTOL 2ZXPA 4RQ9A 3S1QB 2VV6A 4MN5A 1BVSA 4NETA 3STBC 4E3NA 2GJ3A 3Q1FA 1TWGH 2F4VL 1Z6HA 5K36G 3J81c 3Q23A 4FF3A 2HJ9C 1B2TA 4U68A 3D31A 1N32L 2RHQB 4IPGA 1Q82C 4F8MA 2OXPA 1BULA 2AMCB 3NECA 2E74C 2E75C 2HDQA 1Y14B 1CKMA 2PW5A 2K05A 3H0GG 4GN3B 3RZOB 4MBKA 1ALQA 4UA7A 2PW7A 1VQ7A 4LV3A 4Q0IA 4CLCD 5I2XA 2ZQDA 4GW9A 1Q8IA 1A8VA 3ZCZA 4P6BA 3AFQA 5AQAA 3V2TA 1K3RA 1B9NA 2Q9MA 3LR3A 3SS5A 5FAQA 2Y2LA 2XD1A 3K81C 5A91A 3ULLA 3E4QA 4A3GB 1TVFA 4MIUA 4P74A 4I7ZC 1IBML 3G2ZA 1YNND 1H9MA 3GTPB 4OKPA 2K33A 4XQJA 1H9KA 3NENA 4OHJA 3IH9A 2I9VA 1HRJA 2ZM2A 4O8GA 4JW0A 1IXRA 1T1CA 1STNA 4NG2A 4CJ0B 3HOYH 4R38A 3NQTA 4HJ8A 2OLUA 4HIOA 2F03A 1BLPA 1A0IA 2QGQA 4HJ4A 3FDTA 4ETXA 1EWHA 1PTOH 4WZ5A 2M7UA 3V3SA 1EWCA 1OXTA 1W3SA 4DUZQ 1DONA 3M2KA 4R23A 4OQGA 4DR4L 3T56B 4DR5L 4B4XA 4DK3C 3W5OA 1PWDA 2EY6A 3KSFA 3PBQA 4YINA 2N8NA 4C3JG 4Q8IA 3UI2A 4K6LA 1SMYC 1SMXA 5JEAG 1K73C 3MZ5A 1T19A 1SNOA 5T1IA 2VNUD 1LTLA 2PU2A 1YIJA 3SGIA 5IOCA 4I5SA 3HKSA 2H0YA 4LJZC 1VQEA 4QU3A 3P98A 2R7ZG 4LV0A 1TR5A 4RA7A 2ASBA 2XSSA 3HLBA 1CQFA 1RIPA 2RKSA 3CPFA 4AYBB 2VQFL 2HP5A 3WRZA 3AGFA 3URYA 1I4GA 1I6VC 4IOAA 1QCBD 4ZQ3A 2VK3A 3SK6A 2Y2JA 2JSOA 3QHYA 1OJGA 2HPBA 1LTSD 2W3HA 4JPMA 5JYPA 1NWZA 2RCXA 1HXYD 3PO2G 4K5WA 1WTVA 2KX6A 1ACFA 2R9WA 5L09A 2C9OA 2PNHA 2FMMA 1VM1A 3OPRA 4A3KG 4KG5A 5GLBA 5C6AA 2WGWA 3R7WA 2XRNA 1FIKA 2IHFA 1JB7A 1YNJC 3IQAA 4C6YA 3KX0X 4N1HA 1VMPA 2QWSA 4PM9A 4M4XA 2K32A 2EVBA 1GCEA 1W8QA 4XYOA 3S16H 2ICIA 2NVTB 4KK7A 1JOKA 2EDGA 3H82B 4J15A 4HESA 2J3TC 3GTQH 4Z9CB 1AXBA 1Y1VB 3NWTA 4AIMA 2JKRM 2VZAA 4LGWA 3FMCA 1ZEQX 1WD1A 4RX3A 1TWAB 3O86A 1Y1WB 2AHOB 5FQJA 5G3LF 1T9HA 4WLAA 1J9MA 2K31A 3BVMA 2X69A 3KJOA 3A3FA 4C1NK 2HP6A 2VA0A 4DMZA 1MKHA 3M2JA 2WGWB 3HLCA 2PI2E 3Q82A 3A8JE 4K8IA 3NEMA 3PQIA 1KE3A 4KZ5A 4JF4A 2WAEA 1M90C 3KYQA 5LL6S 2F0VA 3OPHA 2EYHA 4CLCB 3UNWA 5F68A 1EU3A 4DR1L 3ZYTA 1FSWA 2MO1A 1ZTUA 4DXBA 5CTNA 3ZG9B 2F52A 2IWHA 4POFA 1NR2A 1KVLA 3BECA 2DN8A 2OWJA 5EPLA 3NBIA 1WE4A 3K2NA 1EFID 1SFOB 2RCNA 3MMHA 5C4XH 5GLDA 4E6WA 3OLOA 4WN5A 1PTOB 5CX7A 3JAMc 3V67A 2YU9B 4Y0OA 1BR9A 1BSGA 4TVAB 5IGEA 1K57A 3L9KA 3C1FA 4LF8L 3E4PA 4S2IA 1FD7D 1FR3A 2IT1A 2ZC3B 4B3SQ 3ZDJA 4RX2A 1U4MA 5EE8A 4B3RL 1D7EA 2NN6H 1J8IA 5DKKA 3RZDH 3I7FA 2UXDL 4XT1B 4CLCC 1HQMC 4X62Q 1XJ3A 3PYPA 4DV6L 1PIOA 5F69A 3W1GA 1XJVA 1XNQQ 3GTMH 5FL3A 5HWWA 4L5RC 3IWIA 4P0MA 4PZ6A 2R7ZB 2Z2MB 2CH4W 4TSSA 4JGQA 2LS01 4A5RA 1PI5A 2BDNA 4DU9A 2EX2A 5IGCA 1QE6A 1WVLA 1PFBA 1H9RA 1VQAA 4PHTA 1F98A 3SW1A 1FJGL 1JTGA 5M5WH 4DR4Q 4N1XA 1ZKOA 3OIQA 2O9CA 3VFFA 1DJRD 1IL2A 3SZTA 1PH6A 1TXYA 1OXXK 5EUAA 2R9XA 2DJFC 2VJWA 3PBOA 3J80L 2D9UA 4IFDJ 3W4QA 1V1OA 4A93H 1EYDA 4K5XA 1PV4A 2WKHA 1BXTA 2XDMA 4LLOB 4OP5A 1MHWC 4F3LB 3I4MG 4O7DA 4A3FB 2E2IH 2F0TA 1IEMA 3MZEA 3SDZA 4A76A 5C4XB 2CW0C 4HOIA 4MTNA 1JTDA 1I3QH 2NVXH 3A7LA 4RMFA 4CKCA 2V4DA 2EYMA 3EJIA 3RXXA 1IKIA 4PMWA 1HUNA 2WKPA 4N9KA 1B3QA 2ZTEA 3LWUA 2NVTH 3S16B 1YJNA 2JA5H 1I4RA 3KFUA 2PQEA 4KKTA 4X69A 1UWPX 5D65A 1ES5A 3IBJA 3HUOA 1YHQA 1I50H 3W4OA 2VW9A 5HD3A 2JQOA 2KHIA 4R4QA 3UPNA 4B3TL 3T4TA 5M5XB 1EYGA 5CTMA 1EZ8A 3PO2H 4NPSA 5CMDA 1JOQA 5FQMA 1EQRA 4ALPA 3WS1A 2F0KA 1DJBA 4GD6A 1L0WA 2LB9A 3IXDA 1EEID 2E8IA 2HJEA 4B93A 4K2LA 1IYUA 4FUWA 3NHHA 5ELNA 2KUMA 1XPBA 2JKTM 4D2OA 3SE0A 3SVMA 5KNBA 3IFTA 3D4FA 1PFLA 2J0TD 4A3IH 3DUZA 1E3PA 1XXMA 5HFOA 2IWCA 2SNSA 2F0PA 5HURA 3U9SA 1K54C 2Q9NA 5M5XH 1VQFA 3ULJA 4GNXA 2EXDA 2HDLA 1Q1BA 1EIGA 5HDCA 2EYPA 3B33A 3TE8A 3DAVA 3S7QA 2CHBD 3TQYA 2VV7A 2Z1CA 3MEFA 4KQQA 1VQ6A 4E3OA 1DOMA 1K4EA 4A4IA 5GLCA 2VL6A 1G6OA 4XDXA 2UXBQ 1CI3M 4F87A 4NB3A 1YMXA 2V2FF 1H95A 3W3AA 3DWKA 3K6OA 2ZJQA 1VCIA 2KQ3A 1HNZL 4KQRA 4U0XA 5DTKA 1SJED 3S7NA 1ASZA 2GDNA 5G18A 1E1TA 4Y2FA 1LUZA 2PCFB 2F0OA 3KBGA 4A3IB 1YI2A 2G2WA 1OXUA 3HOZB 4G3KA 5M18A 5FO7B 1GUSA 5FLXL 3GTOH 2I5MX 1PFMA 3U2AA 3MTSA 4KTAA 4A3GH 4LNQA 4A3JG 3ICEA 2K04A 2C5CA 3D6CA 2E8JA 1ENAA 2ZOIA 2KBNA 4OO1G 4KZ3A 5DLQE 1I94Q 4L9GA 2RCFA 4PZ8A 4BBRH 2B3GA 4C3IB 3SOIA 2WAQE 2Y2OA 4UA9A 1ZYRC 2GZAA 3LICA 3E0YA 1SNDA 1F9PA 4JPBW 4XT3B 4GOPA 3RN2A 3S17B 5EVLA 2X01A 1HTPA 4P73A 1CFMA 1X3GA 3F2DA 4G7ZC 4OIKA 3KDFB 1V9ZA 1LT5D 2PT7A 1I3QB 4A3BH 2ZMAA 3E98A 4A3EB 3S1RB 1V8QA 2L1BA 4FCFA 1U4PA 5HPFA 4GDBA 5G4YA 3UB6A 1U0LA 1CEGA 4IQZA 4DV4L 2NZ1D 4G7HC 4AQYL 4S3SA 3O87A 4HJ6A 2WACA 1PZOA 3FPPA 4Y17A 1GUGA 4BMWA 4L6TB 5EKIA 3UPOA 4B4ZA 2K7VA 3F1NB 3UMDA 3Q0AA 1OTDA 4EV4A 4FOFA 1D1IA 1W6JA 4X65L 1SE4A 3BFFA 3E9HA 3I4NG 2UU9L 5FLMH 1HUMA 4NKPA 3I4MH 4ZKBB 4KD3A 2C6WB 4E3LA 4A3EG 1IYJB 4PKYA 4EEUA 4DJ2A 2K14A 2J9OA 2GNXA 5IIFA 1CSQA 4O1NA 5JJKA 5HSQA 1K56D 4HIKA 5J1ZA 1GHJA 2XD5A 1DD2A 5A8BA 1UE1A 4Y52H 1PH5A 2EYJA 2LY7A 5F2DA 1YHAA 3CZDA 1SAPA 1AE2A 4XT2B 4GKUA 4C3IG 3CHBD 3L7HA 1CQAA 2DNCA 2R61A 4OWWB 1LLRD 4DR3Q 1G2TA 2KCMA 4R3AA 1G28A 3J7A5 5HWTA 4JBMA 1LL9A 1JB3A 1I4HA 3N8SA 4Y3IA 1II3A 4LF6L 2E2JB 1KTKA 3S1NB 4LFCL 1S72A 2Z6CA 4H44C 3I55A 1HZBA 4A3MG 5TGFA 1CHPD 2MUYA 1PYWD 1HZOA 4PAUA 1FGBD 2IY5B 4YNRA 3LWEA 1HHVA 2NVQH 1K57C 4UP8A 3FRPB 3ERQA 3VMAA 2HGVA 3W2ZA 3IL8A 5FQKA 3V05A 1JE4A 1E2WA 4KZ4A 3TRCA 2KHJA 3CPTA 3HUMA 1TY0A 5DFYA 1AEXA 3K7AB 3A5UA 4CGYB 2Y2PA 3I4NB 4HIDA 2A6ED 4E6XA 2F0MA 3QB3A 2JA6B 1XGJA 2XFTA 3F1PA 3VP3A 3HOXG 2FXQA 3S2DB 2B63H 1F2MA 3JVUA 5CGWA 3CWFA 3G30A 2B63G 1E3UA 1W7FA 1GXDC 3VR2A 3H15A 1KIXA 3K58A 4JI2L 1DP9A 2K1BA 4RHRA 4IFDH 4BBSB 4HBUA 1C7YA 4QQBX 1H9SA 3SHLA 1G51A 2XQZA 4OX9Q 2FFFB 4NXBA 2H5SA 4O01A 3LNNA 3AGEA 1B3AA 4GLAC 4QF4A 2G2UA 1F9IA 3HG9A 1ERMA 4GS9A 3ZVWA 1KABA 3M4OH 2UUBL 4A93G 5C5LA 1PMRA 1PH2A 4QB8A 5I6WA 3CCVA 2W3FA 3DWQA 2PNRC 4JOIA 2K50A 1GHMA 3BFEA 3MZDA 3NHQA 1KQSA 4MBFA 4EQIA 4R1JA 1XTCD 2H4OA 3OZHA 3CCJA 1WD0A 3IF6B 4OO1H 3DEPA 2Z2LB 4ZRRA 3B3XA 4FF1A 3T1SA 1VQ8A 1X3QA 3UE0A 3HOUG 2ZD8A 2HCCA 4EQ5A 4ZBEA 1HZ9A 3A74A 3HOUH 3I72A 1LTTD 1E4DA 2D01A 5CR3A 4E3JA 3QWNA 1TS7A 4IUPA 1EY8A 5C44H 2VS1A 2KENA 2M2LA 2LXKA 2B18A 3OW2A 3R3OA 1ZKJA 3S1NH 2WZXA 3MAQA 5C4XG 2EFXA 3IWOA 1WA9A 4OPZA 2V1BA 3TJZC 2UU9Q 2W3GA 3VE4A 1PI4A 5KIXA 3C2PA 1PTOF 1RP5A 5FI7A 1SDEA 5CV4A 3T1YQ 3BJNA 5AJGA 2WKDA 1SLJA 1KRSA 1YJ9A 1XNQL 3ZG0A 1S4RA 4LF5Q 5A92A 1PDQA 1EI5A 3A0VA 5HZHA 2F0HA 1NE3A 1GHKA 4LUOA 2B2TC 4KZAA 1KRTA 5FLXE 3LIAA 4R8IA 4NDXA 5FLMG 2Z6KC 2PPBC 3SR1A 3I7JA 5LBRA 4FVMA 1N4OA 3IBRA 4ETZA 3IS2A 3HOYB 1TS3A 2NVYH 4WMCA 3NOUC 5C0XG 4WELA 2YTVA 1ONGA 2DY8A 2MFIA 4S2MA 2W27A 1VQCA 2K5WA 4JI1L 5M3FH 2HUGA 3D4RA 1VF7A 4ILWA 3J81i 2A24A 4N9LA 3HVFA 2WIIB 3HOYG 1VHMA 4OWTB 3FV7A 3F1OB 1A6XA 1MBLA 1ENFA 1EY7A 1EY6A 2OT2A 2LB5A 4MMNA 3TEHB 2Z6KA 4HCEA 3G71A 2PI2A 2L4RA 4CQHA 3TS0A 3IX3A 4LCMA 5J3BA 4EERA 3RNUA 3HGBA 2B2UC 3HLEA 2VEAA 3DTKA 2Y4AA 4RKBA 1N33Q 3ZNTA 1WTHA 4BA2I 4DV7Q 4I38A 4BL2A 3R93A 3PO3G 2B29A 2F3VA 4YHHQ 4K5VA 3E9IA 3PUVA 1NYYA 4X1MA 3TZDA 1NLZA 4Y5FA 2D5DA 2IPKD 1VETA 3ZNYA 4GLVB 3S15B 3T1YL 1YKDA 2N78A 1F2LA 2W1TA 2ZL1A 3K7UC 3C30A 3GSGA 1FL0A 2ZOHA 1TF1A 2J80A 4X56A 1BOSA 2WFWA 3EGDC 2YTYA 2KJXA 1TT2A 3TREA 4OX9L 1YT4A 4AQYQ 1LSWA 3AEVA 3QNCA 1EOVA 3ND8A 3UDIA 4C3JB 2V8CA 2Y2GA 1N32Q 3KF8A 2RF4A 2OWHA 1H5XA 1JQYD 3GQZA 1SYEA 1UE7A 2MPMA 1PYSB 2XR0A 2JA8G 3SH9A 1K8OA 3PBNA 4EQPA 3C5AA 1EWZA 5JEAJ 2EOTA 2FFKB 4UA6A 5G3LD 1U4RA 2FMCA 3T50A 3IXHA 2PZUA 3NK9A 1MSHA 4PM5A 1J5EQ 1CI8A 3VP1A 4DDSA 2F3IA 3VP2A 2P08A 1D5XC 2KCCA 5JEAH 4F88A 4P71A 1FCMA 2Y59A 2L4NA 1RGZA 3GMWA 5HD5A 2I07B 4A3BG 3VA5A 4F94A 3A8KE 1XKZA 4I3JA 1KE4A 3T4KA 5DKLA 1K8GA 1FOFA 2F0IA 1QB5D 1JORA 3MA2B 4KY5A 1LT4D 5I4DA 1PWGA 3IAYA 1LHYA 3BW6A 1LTAD 3EFXD 4I7AA 3SS4A 1MJEA 4G4KA 2K5QA 1IBLL 5J7EA 3GTOB 4HJAA 1XMOQ 2X71A 5DM73 3H0GB 4YCWA 5IT9c 1TIID 3FWLA 4IUNA 1EU4A 2AQ1B 1WOCA 3KYHC 2QEXA 2QA4A 3OTOQ 4HMIA 4JV5Q 4FTXA 4HI4A 4EUZA 1OJ5A 3D72A 4G57A 4IUQA 1JWPA 1MPLA 3C2WA 5JOBA 1YZ6A 5FQQA 3F2UA 2PHYA 3AMUA 4A3CH 1DM0B 4GDNA 4DN4M 4O2DA 3R7WB 2Q2HA 3BS1A 1EYAA 4WEKA 1W63Q 4QUCA 4LV2A 2H28A 4PPRA 1PRTB 1NY4A 1L3LA 1CKNA 5I6YA 1K55A 2J8YA 2OTLA 3CCRA 1NJ4A 1BBWA 3EIVA 4NXNQ 1E7ZA 2AQ3B 1K6SA 4DK1A 4HJ7A 4C3HG 3I3CA 2P5ZX 1TKWB 1ES2A 2HIXA 1H9JA 2L12A 1SSOA 1QMFA 1IHZA 1OXSC 5EECA 4EXOA 2XA7S 2UXCQ 4DUYL 1TU2B 4XIGS 1HD8A 1ZC2A 2J9PA 3E2KA 2JN7A 1RHPA 2Z8LA 1Y8PB 4R4TA 5GQOA 4JF5A 4IZ8A 1TWFB 1X3FA 5EPJA 4IOCA 5CV5A 4LV1A 3LUQA 2HF6A 1Q2PA 4IEDA 4AH6A 1JWMD 4K2KA 1V1PA 5LMNQ 2A6EC 3I91A 3PXPA 1S5FD 2L1MA 3QIAA 3BQ8A 4EQ1A 2DJGC 5DTSA 1CZGA 2CW0D 5KSCA 3D6WA 3HRZC 3FKIB 5C4ZA 1UEBA 1U9RA 4DJ3A 1YEZA 1K8AC 5EM0A 3CCUA 1V1PB 5I5LA
chains in the Genus database with same CATH topology
2P9VA 2ZC5B 3CF5A 4LFCQ 1NJIC 2JA7G 3M4QA 3U50C 1B70B 2UUCL 4X65Q 4ID4A 4JXGA 2WGVA 1MWSA 1VQNA 2ZC4B 1NTGA 3STBD 5IYDG 4O0AA 1S0WA 2HIVA 3V39A 3AFPA 4R3BA 2AWOA 1YLTA 3FHWA 4JV5L 3MXNB 2EFUA 3SS3A 3BZKA 3H0GH 2XFSA 4MZ9A 1VQLA 4HBTA 4OVDA 4K0KL 1M1KC 1L2SA 4Y0UA 3IHBA 4X64L 4DR5Q 4DE1A 1C3BA 5AQ7A 4P72A 2ZJPA 3HOZG 4B3MQ 2WB1G 4TQUS 1FR6A 3NI9A 4X53A 1OXVA 1XMQL 3ZGAB 4OPRA 3GO5A 3M3YH 4X68A 2VY3A 4JLFA 2NN6I 3ZHHA 1XMOL 3VFHA 1PHJA 4NXNL 2ZQ7A 4Z9QA 3RLNA 1JJCB 1Q81C 2E2HH 4RVAA 4OOMA 1GVPA 2XH9A 4OOLA 1Z9FA 3A0JA 4DUZL 4DV3L 3F1ZA 1WCMG 4S2KA 5C44G 3LY4A 3CMZA 3OCNA 4BXXH 1JJ2A 3N8RA 5FQIA 4DV1Q 4DUYQ 4B88A 2BG1A 1BT5A 1E1OA 3WS2A 2LSSA 4GNXB 2GVAA 5CHJA 1HVBA 3BFGA 1E25A 5KZHA 4GS3A 3G2YA 4DR7L 3GVBA 3D0FA 3G31A 3CAMA 1J5EL 5EAYA 3S2HH 1YLPA 4LF4L 2H10A 2A49A 4GNXC 4QD4A 4QJGA 1XPOA 2WK0A 1VQ4A 1P8LA 4GLXA 5CHUA 2F4VQ 3ZJYC 1Q12A 4JI6L 3VDYA 5CHMA 4DF6A 3KJPA 2UXBL 1PVOA 4QHCA 4JI8L 2ZM0A 2VUMG 4B3TQ 3S15H 5IYDH 2K5HA 5FJ8H 3ER0A 2VGJA 3BRMA 3PUXA 1N9BA 4DR7Q 3NC8A 1GD7A 3PF5A 5F83A 4PZ7A 4DV7L 3T1HL 4IJHA 4X6TA 2RL3A 2HDUA 4DV0Q 4X62L 1PYYA 3C7VA 2VQEQ 1VQ9A 4JI5Q 2H5XA 4PM8A 4BLMA 3IT9A 4QL5A 1FCNA 1X65A 2V1CC 1MKIA 2WGIA 4C3JH 3PAGA 1BLCA 3HOVG 1TDLA 2E2JH 2ALYB 5HAQA 3TOIA 2OQKA 4DV4Q 3G34A 4LFAL 1SROA 3K0XA 4KI0A 3QNBA 2VQEL 3CCEA 1QVFA 2HDSA 3Q7VB 1K56A 3W4PA 5IHVA 3J80i 4LF4Q 4MBHA 2NZHA 4S2PA 4GNUA 2DCFA 4DKIA 3EBEA 2HDRA 1LYLA 1Y1VG 4JXSA 3I2ZA 1K54A 2XTIA 5DF8A 1SCWA 5JJLA 2WYXA 2MNAA 1L0FA 2ATWA 1XNRL 1FVIA 4JI2Q 4H02A 2CCZA 4UP7A 3N8LA 4UAAA 3DW0A 1KDWA 1MY8A 4LF5L