4OONA

Crystal structure of pbp1a in complex with compound 17 ((4z,8s,11e,14s)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2h-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid)
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
746
structure length
502
Chain Sequence
PLKVYSEDGKLISEFGEMTPELNAPYIAEMARAEMVGRYGSEAYTEGYKVITTVRSDLQNAASQSVRDGLIDYDQRHGYRGPETRLPGQTRDAWLKHLGQQRSIGGLEPAIVTQVEKSGIMVMTRDGKEEAVTWDSMKWARPFLSNNSMGPMPRQPADVAQAGDQIRVQRQEDGTLRFVQIPAAQSALISLDPKDGAIRSLVGGFSFEQSNYNRAIQAKRQPGSSFKPFIYSAALDNGFTAASLVNDAPIVFVDEYLTFLGPIPLREALYKSRNMVSIRVLQGLGIERAISYITKFGFQRDELPRNFSLALGTATVTPMEIAGAWSVFANGGYKVNPYVIERIESRDGQVLYQANPPRVPVEPTPAERIIDARTAYIMTSMLQDVIKRGTGRRALALKRTDLAGKTGTTNDSKDGWFSGYNSDYVTSVWVGFDQPETLGRREYGGTVALPIWIRYMGFALKDKPMHTMAEPPGIVSLRIDPVTGRSAAPGTPGAYFEMFKNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein 1A
publication title Siderophore receptor-mediated uptake of lactivicin analogues in gram-negative bacteria.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transferase/transferase inhibitor
total genus 149
structure length 502
sequence length 746
ec nomenclature ec 2.4.1.129: Peptidoglycan glycosyltransferase.
pdb deposition date 2014-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
A PF00912 Transgly Transglycosylase
A PF17092 PCB_OB Penicillin-binding protein OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4oonA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oonA02
2CFMA 3HKSA 4Q8IA 5CERA 3M3YH 4PZ6A 3CF5A 3GRJA 5BR8Q 2RCXA 2E8IA 3CAMA 3WS4A 4MBKA 2R7FA 1MWUA 3PCOB 1EQRA 2PI2A 3ZG5A 4JBMA 2OV5A 1H8YA 1HR0L 3HOXH 3GTJH 3GTLH 1YLPA 1RIPA 3RN5A 3HOWH 1FJGQ 1HNZQ 1QUQB 2R6GA 4X65Q 4AQYL 1BBWA 2VY3A 4A75A 4HIDA 1ES5A 4JF6A 4R1JA 3GSGA 1XNRQ 3BEBA 1A63A 2K14A 1A8VA 1WJJA 2Y0SG 1TWCH 1LL9A 3HUMA 4JLFA 3WWVA 4OLGA 1VQBA 4KQOA 3ZHHA 5F82A 3M6BA 2JC7A 3Q7VB 4OX9Q 5M1AA 4GN4B 1I50H 3UDGA 1W8YA 4A4IA 1J5EL 1K55C 2DRWA 3N4IA 3S17H 3S22A 1IYSA 2UU9L 3WS2A 1G68A 3T1HQ 3W1GA 1PH1A 5ELOA 2VW9A 1PH4A 1CI9A 3M6HA 2B63H 5IWAL 2NN6I 1KE3A 4IVIA 1V1QA 1HVBA 3A3FA 4B3SL 2UXBL 3ZNYA 4XUXA 3KLWA 1H95A 4WMCA 4C75A 4LCMA 3PO3H 4HJ9A 4B3MQ 4QJFA 4Z9QA 1O7IA 1MPLA 5E2GA 1E3UD 4GLVB 1ES4A 5E2FA 2WZZA 4A3KH 3S1MH 2PI2E 4O2DA 4A3GG 1JB7A 5FQQA 3OPHA 3J7A5 4NB3A 1IBMQ 1CSQA 1HZ9A 1YLJA 1I2SA 5C4XG 1ONGA 2JA7H 1S0WA 4FSFA 1C0AA 4JI1L 1J9MA 3LEZA 2Y55A 5IY0A 3HBRA 4OOLA 2OCEA 1IL2A 4YWLA 2K75A 1TVFA 4LV2A 3LCEA 4JCVE 3IWOA 3NELA 2FFYA 2A1AA 2QEXA 3T1YQ 5CEBA 5GLAA 2KENA 2Y2QA 5HL1A 5BOHA 1XX2A 1NYYA 2I5HA 2UUAQ 1KC8C 2K5HA 1K8GA 4NXMQ 2HP9A 3NBHB 2JEAI 1NRFA 3I56A 1N8RC 2WAQE 2ZTDA 2Z0SA 1DJCA 1L1OB 3OTOQ 5EPHA 1X56A 4S2JA 4NPSA 4WEKA 5EVLA 5A90A 3MBZA 1DJAA 3STBC 3IHBA 3CCRA 4R4IA 1R9TH 4OONA 4WZ5C 5DF8A 2GVAA 1HNXQ 2MNAA 4KZ9A 3KF6A 3BLMA 1OXVA 2QA4A 3OC2A 4YHHL 2JCHA 4OPZA 2N49A 4OXPA 3UDXA 2B29A 3G2YA 1Q8KA 5GLCA 1Y1VH 2V2FF 4NXNL 5FAPA 3ZG7B 3OCLA 2ZQ7A 3SS3A 1DY6A 1QMFA 2NZOA 3UY6A 4LF6L 3GTPH 3W4PA 3GQZA 1G291 3C5AA 3V3RA 1LHYA 2Y2IA 4DR7Q 2NN6G 4X62L 3G71A 2ZMAA 3GTCA 4P87A 2Z6KC 3M7NA 2KCTA 3CCJA 1LL5A 5FJ8H 4DE2A 4WJ4A 3LO7A 2QGQA 2ZM6L 4DDYA 2UXCL 3IWIA 1L2SA 4MTNA 3JAMi 1V43A 3PAGA 4MZ9A 2N78A 5LMNQ 3H3VH 4N92A 1KE0A 1SKFA 2OLUA 4LF7Q 3Q7ZA 2PU2A 1I5FA 4DR6L 5M3FH 4PMWA 4H8RA 1YLWA 4LV0A 4RMFA 1N36Q 3W1BA 3WS0A 2BA0A 4JI0Q 1KRSA 1FVIA 3GDEA 3HOVH 1K57C 2HDQA 1IYJB 1ONHA 1GVPA 4EBNA 3D4FA 2YTXA 1XKZA 5GHZA 4PZ8A 1XA7A 4JXVA 2BA1A 1NBWA 4E3NA 1CSPA 5ELNA 3NIAA 5C44G 2NVQH 1LYLA 2ID0A 2XLNA 4LW1A 4A3IG 1MIUA 4R4CA 4BY7G 1Q46A 3ZG0A 1GD7A 2HDUA 3ER0A 4RG1A 2ZC6B 3STBD 4IVKA 2HP6A 4JV5L 3BJUA 5G18A 4DV5L 3VP3A 3PBSA 1PH6A 2IX1A 1EWZA 1UE7A 4DUYQ 5U47A 5GAEC 3CCQA 2WFWA 3CCMA 1NE3A 4GNUA 2K52A 5FATA 3HREA 3OCNA 3O3VA 4IBXA 3ULJA 3IF5A 1VQEA 3RLOA 5KSCA 3PBQA 1EOVA 3GD7A 2Q2IA 1VQHA 3L2PA 2JA5H 3BZCA 2UXDL 1PVOA 2ZM2A 1QZGA 1N34L 4POFA 3U50C 1HR0Q 4AYBE 4OWWB 2B5RA 3AGEA 5M18A 1QZHA 1B7YB 4ZTKA 1KXLA 1MXOA 3LY3A 1PH9A 2R7ZG 4AQYQ 2KBNA 2C6WB 1VQQA 2Q2HA 1IEMA 1XTDA 3RZOH 1K6SA 3IRBA 4ZJ2A 1YJNA 4BBRG 3PBOA 4DR4L 3AGDA 5HX9A 2A49A 4DXCA 3LGJA 3UPNA 2XD1A 4YCWA 3CCLA 1E22A 1EROA 1YITA 2ATWA 4E3JA 4GKUA 1LM0A 1GM5A 4OKPA 2HIXA 3MEFA 1SR3A 3M85A 4P72A 2HDRA 3MKFA 4FCFA 5CTNA 1CKMA 1J5EQ 1E3UA 4EWFA 2UU9Q 1HZAA 1WYBA 3KJOA 1TDLA 4QGUA 4KZ4A 5DTSA 4PG3A 4KQQA 2AWNA 4L5QA 2VUMH 3BU2A 4DF6A 5CTMA 5IWAQ 2XGTA 2L15A 1EIFA 4B3SQ 2UXBQ 3N7WA 4GDBA 3PBNA 4O0AA 5K36G 1BLCA 1YLTA 3CXCA 2Y2PA 2ZQAA 1WYDA 5A93A 4EQ5A 3UE3A 1OXXK 5DF7A 4KG5A 4BD1A 1Z6FA 3I4OA 4A3GH 3BM6A 2DCFA 3VP0A 4P71A 4OP8A 2IY5B 2EX6A 2D0PA 2ZTCA 5C4XH 1CKOA 4N1HA 5E7NA 1CKNA 2G2WA 4Y0TA 4S2KA 3WS5A 4UA6A 1RGYA 4KZ6A 4JI1Q 4E6XA 1X3EA 4MNRA 1K55A 5GAGC 2ZQCA 4O7DA 1Q12A 1QMEA 3PAEA 1VQOA 2WAEA 5EVIC 3JC66 3W4QA 1UE6A 4OP5A 1M1KC 1KE4A 3PGZA 1CI8A 4OQIA 1KGGA 3ZJYC 4DR1L 3UDFA 1K73C 2K5NA 4S2MA 1PH5A 3PF4A 3J81c 1YVCA 3DM3A 3MZFA 3GTQH 4B4XA 5JJKA 3KDFA 2RHQB 3I4NG 1SE8A 3P09A 4IBRA 3Q1FA 1WOCA 1NYMA 1JT8A 4S2PA 3CG5A 4JI2L 5GHYA 4UAAA 2FFFB 4YHHQ 4J15A 4TVAB 3NCKA 3F1ZA 1VQAA 1X3GA 1M6KA 1LTLA 4BD0A 4NXNQ 4DNIA 3BFDA 2ES2A 1A0IA 3BFCA 3VP4A 4LF7L 5FAOA 1PI5A 5FDHA 4LF6Q 3TS0A 5AJ3L 4BBSG 4Y7NH 4QY5A 4L5SA 4C3HH 1K9MC 5EUAA 4HEFA 2WAFA 4BLMA 3CCSA 3SH9A 3MXSA 4X62Q 2MQHA 4A3EG 4IJLA 3VSKA 3K0XA 5EAYA 1PWDA 2J9OA 4LF9L 2OWOA 3CMZA 1CK3A 1FSWA 3ZG8B 2ZM6Q 1XMOL 5GL9A 1L1OC 2UXCQ 1OXUA 3E2LA 4JG2A 3DLLA 1SMXA 2XK1A 1CUKA 3Q8DA 4U3TA 4K0XA 4EBLA 4K0KL 2EX9A 3TRZA 1Q1EA 3EN2A 4S2LA 2Y2GA 1WI5A 3G4SA 2E2HH 1AE3A 5FQIA 4DR6Q 3N8SA 1PWCA 2R9WA 1D7QA 3IXDA 1YT4A 1E1TA 5C44H 1GHMA 3V50A 4AH6A 5EVID 1N4OA 1N33L 4D2OA 1IBLQ 4BY7H 1KAWA 2YV5A 3D31A 4LUZA 2ZQ9A 3DWKA 1KIXA 3FKIG 4JI3L 1NMFA 1PW8A 1I5QA 1XNQL 1BSGA 4KI0A 4JF4A 4JV5Q 4DV5Q 3KF6B 1JJCB 1HH2P 5DVAA 1JWVA 3BFEA 3PF5A 2EQSA 3PO2G 1N32L 4QHCA 3UPOA 2N8NA 2R92G 4OO1I 2XR0A 3BFFA 4EV4A 2IX0A 4HBTA 4ZJ1A 4U0TA 1K4FA 2NVXH 2VQFL 4HESA 4C6YA 2JEBI 3OPLA 3A3IA 4IPDA 3ERSX 1QVGA 3M4QA 3HLFA 2Z2LB 4QU3A 2HT1A 2UXDQ 2R7ZH 4UA9A 1W5DA 3B3XA 3TG9A 3CP0A 3G34A 1GO3E 2HQLA 5C4JH 1N34Q 1ZG4A 1VQIA 2QZ6A 3IF6C 1X54A 4BBRH 4B4ZA 4LF5L 4JI7L 4BXXG 4XUZA 5FI7A 2ZQ8A 3HOZG 1IKGA 1K57A 4LUOA 2JA8G 1VM1A 1FCNA 4JOIC 4KG6A 3VFHA 3CCVA 1L0GA 4A93G 4DR4Q 2PQAA 1L0WA 5FLMG 3NDGA 4UY8C 5IYDG 4YCUA 1RP5A 3FKWA 1L0EA 4X53A 4R0QA 3FYZA 3A3JA 1NMGA 2J8YA 1WFQA 1IBKL 1BKBA 5CHUA 5JYOA 1XPRA 1K56A 4UHUA 3SS4A 1RGZA 2C5WB 3O88A 2K50A 3RNUA 2Q9NA 1BLPA 1O7EA 1C9OA 5A91A 2ZM0A 2LXJA 1PH3A 2Q2TA 1I3QH 1JWZA 2I0QA 5DF9A 3KFUA 1Q2QA 2VNUD 2H5SA 4DV6L 3PBTA 2I5LX 4IEDA 4E3OA 4QD4A 5IYCG 5HGQA 1HZOA 5F1GA 3DW0A 1HTZA 4R23A 4S2OA 2MFIA 2BLSA 4K0WA 3F2CA 3GV9A 4QQBX 3VOYA 4ZBEA 2K5VA 5JEAJ 2Y2MA 3PIPA 1NXYA 4ME3A 1Q81C 2RHSB 1H5XA 4DE1A 1SDEA 2XF3A 2ZM8A 3FV7A 4A3CH 3H15A 1W2BA 4LFAL 4OO1G 2XFSA 4OLDA 3K7UC 3E9HA 2EXBA 2OTLA 4DV0L 5CECA 1UE1A 4WBGA 3WRZA 2F4VL 4R3JA 2RCNA 2H5XA 1VQJA 4DR2L 1NZOA 2J7VA 1W79A 1WYCA 1NZUA 5E2HA 3I4NH 4DR1Q 3G2ZA 3A0JA 4ID4A 4QJGA 5GQOA 4DR5Q 2P9VA 2WADA 2YTYA 2QPNA 3W5OA 1YHAA 3PV0A 3TREA 4WYYA 1VQDA 3PBRA 4BJPA 3N8RA 4A3DG 2ZJRA 1LI0A 1P16A 4JI2Q 3CC2A 4DV2L 2WB1G 4KZ7A 2PNHA 5KZHA 1KGFA 3HKZG 4L5RC 2Q9MA 3GVBA 2V1ZA 1PZOA 3BLSA 1X65A 4BBSH 4IO9A 4X6AH 5FQ9A 2VQEL 5C3EG 3ULPA 1VQLA 1YQSA 3IXGA 1EI5A 1BVSA 3GR2A 4A3EH 3I7JA 5AJ3Q 5E2EA 3QNCA 4HJ7A 4PM7A 2A3UA 3FZCA 1OXSC 2N3SA 4KG2A 1PH7A 1IBLL 1SCWA 2LSSA 5EVIA 1JMCA 3CJMA 4LF9Q 5GLBA 1L2FA 1E7ZA 1TWGH 4KZBA 1L0FA 1CKNB 1SRUA 4YWMA 2EFUA 3H0GG 3GTMH 4GB7A 1XMOQ 1PA6A 4N9KA 5HAPA 3D0FA 3E2KA 3OPPA 3C7UA 4A76A 4A3FG 3FP9A 1VS0A 2ZTEA 1IXRA 4K0KQ 2HPBA 5M3MG 4MBHA 2WGWA 4IPCA 3PUVA 2EXAA 5EECA 1VQKA 4DAMA 4GD8A 1Q82C 5GROA 1KGEA 4ALPA 2JBFA 2E8GA 3ITAA 4S2NA 3U4ZA 1JVJA 3SH7A 1XMQL 2P74A 1B8AA 1N33Q 3FKIH 1NY4A 5IYBG 3NBLA 2Y0SE 3KYHC 4FD8A 2WKEA 3KDFB 1Q2PA 1EFWA 2YU9H 4IJHA 4C2MH 4PM8A 4JI3Q 5CRFA 3PO2H 1XNQQ 3ULLA 2R92H 1J6QA 1NJIC 1H8ZA 3FHWA 4GNXC 4DK3C 5EE8A 2Y2JA 3WS1A 5JJLA 1WE4A 5AQ9A 3PUWA 4UA7A 3SS5A 4IFDI 1N32Q 4DE3A 1XPUA 1GCEA 3GTKH 3N6IA 4GLAC 4P73A 4YCVA 3PTEA 2AHOB 1U5KA 2VQFQ 3VP1A 1BT5A 3AQQA 2WK0A 4LF8L 3K80C 4BXXH 3TSGA 3HOZH 3MFDA 1X3FA 4HIKA 4BENA 4JBKA 1VQ7A 4GOPA 2JA8H 4MBFA 3HOYG 2OSUA 3C4OA 4LF5Q 4JI7Q 4A93H 3ZFZA 1K54C 4DV4L 3ZVTA 2XEPA 1GKHA 4LCLA 5FLMH 1VQMA 4HJ5A 5IYDH 4X66L 1MBLA 3SOIA 2DNSA 4BA2I 2WKIA 4IOAA 2XFTA 5LMNW 1W8QA 3MKEA 4JI5L 1FQGA 1YM1A 5IP7G 3H3VI 2X01A 4QL5A 4BL2A 1IYQA 3G31A 4DK6C 1IBKQ 5FQKA 4JI8L 5EOEA 3ICEA 4PPRA 1X55A 5JEAG 5DTKA 1E4DA 1HNWL 5J3BA 4WMCD 2JA6G 1KVLA 4JXWA 4DE0A 1I94Q 4CJNA 1IKIA 1Y54A 4X56A 1E24A 1S3OA 2PMZE 1MJCA 3RLNA 4Y0OA 3CW2C 2MO0A 2CQOA 4R1GA 5IYCH 5FLXc 1NJ4A 4DUZL 3IF6A 1JTDA 1QVCA 1ASYA 4A3MG 3MZEA 4DV6Q 5GAHC 4PM6A 1XPOA 1S6RA 4UPAA 1EIYB 2K4KA 2WYXA 1ESUA 5CHMA 4JOIA 4S2IA 2IWBA 1PZPA 3A74A 2Y2OA 3U58A 3TQYA 5HAQA 5JJIA 3IH9A 1P8LA 3G32A 1CEFA 3G6EA 2E2IH 2ZD8A 2B3GA 2EX8A 2PBYA 4DR5L 2LXKA 4P74A 3G30A 5F1FA 5FQMA 4E3KA 4LWCA 4MLLA 4OPQA 2AKWB 3GTOH 4LFAQ 3QNBA 2WAQG 4GD6A 4DV0Q 3J81j 1FL0A 4UP7A 4KENB 1IYOA 2PQAB 1K83H 2F4VQ 2JQOA 3ZDJA 4DKIA 4JI6Q 4DR2Q 1KDSA 1Y1WG 4E3IA 4GZBA 4JC0A 2JA9A 1X9NA 3AGFA 3SGIA 1KDWA 5FQJA 5J8XA 3RJUA 3I4MG 4HIOA 3L7ZC 1ESIA 4A3DH 2EX2A 1YJ9A 5IP9G 2OQKA 2V20A 4C3IH 3B6YA 5AQ7A 1HJPA 4MNOA 5DLQE 4DV2Q 1IELA 5C3EH 4ZDXA 3BYDA 3S1RH 1VQGA 4KZ5A 2MO1A 3HLBA 3S1YA 4EQIA 3S4XA 5KSHA 2X71A 1BTLA 2VQEQ 1Z47A 4UP8A 3F2DA 1N9BA 2ZLYA 3ZVWA 3O86A 3RZDH 1PWGA 2CCZA 4E3MA 4OQ0A 1TWFH 4WZ5A 2E2JH 1KHIA 1TWHH 1JTGA 3LY4A 3C7VA 4DDSA 1XGIA 3HUNA 1KQSA 3ZCZA 2I5MX 3SH8A 3H0GH 4A3IH 3JYIA 5E43A 1ERMA 3PIOA 4A3FH 1TXYA 5FAQA 1DJBA 2RL3A 1D8LA 1W7FA 4ZJ3A 1X6OA 3S2HH 1XGJA 4A3LG 5M3MH 1BLSA 2HHHL 3G35A 5GLDA 1Q7YC 2H0TA 3UNWA 5HY6A 3CMEA 1N9WA 4E3LA 2CKZB 1YBYA 4QIWE 3RXWA 4LFBL 1VQ4A 1YNXA 1I2WA 1E3PA 2CWPA 4DV1L 1C7YA 2Z6KA 2YTVA 4RX2A 2VZAA 1ALQA 4YY3L 4B3RQ 5IYBH 3NDEA 1EUJA 1NTGA 5C0XJ 4YWKA 4R4SA 4DXBA 4JYAL 1MY8A 4NK3A 2JA5G 1XMQQ 4KZ8A 5CGXA 4YINA 3TEHB 1PYYA 1S40A 2BH2A 1AXBA 3S1QH 1S72A 2P9VB 3KF8B 1IZ6A 4MEZA 1HZCA 4DV7Q 5DTTA 1G6AA 4X69A 2VL6A 3A3EA 1XJVA 4GDNA 4RA7A 3V39A 5JYPA 1BBUA 1EQQA 2WGIA 1YZ6A 4AYBG 1LLBA 3NC8A 2XGNA 4KQRA 4DR3L 5H1SE 1YLZA 4DPGA 4R4TA 4F94A 4A5RA 2ZC7A 3I2ZA 3UPPA 4LENA 2ZC3B 4GKKL 3VOZA 1OXTA 4JI4Q 3VSLA 4EBPA 3HOYH 3IT9A 1YJWA 4LF8Q 1VQ9A 3ISGA 2AWOA 1VQ6A 3VFFA 1PFSA 2UUCL 4RX3A 3M4PA 1PH2A 5EVIB 2OLVA 3EQUA 1PYBA 4DV4Q 2Q2UA 2VUMG 4OWTB 5TGFA 1I94L 2GVBA 1PI4A 1FR1A 1BULA 1TWAH 2EXDA 4X66Q 1SN8A 1K6RA 3AEVA 4WEJA 4KZAA 2BG1A 4BA1I 5IP7H 2ZC4B 3A5UA 3HLDA 1FSYA 2R9XA 1VQ5A 4BY1G 3UE1A 4JI5Q 2H0YA 2WGWB 3CC7A 1E1OA 2IHEA 1FGUA 3ZGAB 2CC1A 5LMUL 2Y59A 3J7ZC 3HOUG 3S24A 2JA6H 2Y4AA 4JI8Q 3J81i 4GNXA 3UE0A 3K81C 3K8AA 4B3TQ 1FR6A 2UWXA 1JJGA 1HNWQ 4C3QA 5C0XI 1Q86C 4P0MA 1W3SA 2IWDA 4LV3A 1VQCA 3G48A 4JKTA 4P75A 1VQFA 4FDBA 3DTMA 3K7AH 3HVFA 4IPHA 4A3MH 4X68A 4GN3B 4KHPL 3OPRA 4X64L 5CGWA 2EIFA 1BUEA 2WP8J 5F83A 3E9IA 2NVYH 4A3JG 4DUZQ 1ZKJA 1RCJA 3FKVA 5FI2A 3P98A 2JK8A 5I94A 2XH9A 4JBWA 2ZC5B 4X55A 4PM9A 4LF4L 1K54A 2ALYB 5IE8A 4ZAMA 1MWRA 4X6TA 1EYGA 1LI9A 2A8VA 4N1XA 2ZJQA 3O87A 2KHIA 2X02A 1ZC2A 4JI6L 3EIVA 3BRMA 2BH8A 1MWSA 2NZHA 2IWCA 5CXWA 3ITBA 4BQMA 4LFCL 3F2BA 1EWIA 3I55A 1YIJA 1NY0A 1K4EA 3KOJA 1QUQA 3GO5A 1GA9A 4R4RA 2R93G 4GOPB 4N9LA 3HLWA 1SROA 4APVA 2UUBL 2H10A 3MXNB 2RF4A 3CPWA 4R4OA 3V5MA 3VP2A 5M19A 1HZBA 1AE2A 2HIVA 1Y1WH 3EBEA 4IFDJ 1K25A 3IHAA 3CCEA 3AFPA 4PM5A 4DV3L 3S15H 3Q7VA 3PUXA 1XXMA 1OMEA 1PV4A 1K0RA 3I4MH 2E5LQ 2KCMA 1YHQA 4KLKA 1KD1C 1MKIA 3BECA 4DKAC 5IP9H 1YMSA 5CHJA 4KHZA 1PYSB 4EUZA 1VCIA 4A3BG 3OZHA 1UEBA 3DWZA 2GN5A 4GKJL 3PUZA 4QB8A 4JPMA 3ZNTA 2DGYA 1YMXA 4Y52H 3W4OA 4IPGA 3J80c 1WCMG 3M9BA 4QY7A 3E0EA 5CGSA 3AYHB 3IF6B 4EX5A 5L2FA 1G6PA 3IXHA 3TS2A 2GDNA 1Y14B 2Y2KA 3OW2A 5BR8L 4OPRA 1JWPA 1ES3A 4FH2A 4JBJA 5C0XG 1G51A 2AMCB 4B3RL 1TDGA 4L5TA 2YYZA 3WWXA 1U60A 3I7FA 1FJGL 1HNZL 4OOYA 5HAIA 4A3LH 4JXGA 1YLYA 4X65L 4LV1A 2XTIA 3Q07A 3S2DH 3HOXG 4XXRA 2JJQA 3CZDA 2HP5A 1C3BA 3HOWG 1XNRL 1YHBA 4LUVA 5EOOA 4DV7L 2Y91A 4M3KA 1XA1A 3A3DA 2F3IA 4P6BA 3WRTA 2HHHQ 4JXSA 1L0DA 4IOCA 5TR7A 1KL9A 3S16H 4LFBQ 1DGSA 4XTCS 4DV1Q 4GN5A 4YY3Q 4OX9L 3QHYA 2KHJA 4WM9A 1UWVA 1V9PA 1FOFA 4LNQA 3HL9A 3L0OA 4JYAQ 1L1OA 1M40A 4OH0A 4XIGS 4JI4L 3HFZB 2G2UA 3PSIA 1MJEA 2WKHA 4OOMA 3T1HL 2PU4A 5M5XH 2CWAA 3M2KA 1Q1BA 5A92A 2NVTH 4JBFA 2Y2NA 2D62A 1MKHA 3ZG9B 1AH9A 2HDSA 2B63G 2ZQDA 4H02A 4KZ3A 4WELA 2Z2MB 4L0LA 4R3BA 1UE5A 1MWTA 3Q81A 2V1CC 3MXRA 4C3JH 3Q82A 1B70B 4B3ML 4DRTA 4DR3Q 2WZXA 1FCOA 4WZ4A 1ERQA 4Y7PA 4GOGA 3FWLA 4PMAA 3HLGA 4AIMA 3S14H 3VDYA 4GKKQ 3IH8A 2F52A 3PO3G 1QVFA 4UP9A 5GHXA 3BFGA 1TEMA 1BZAA 2XQZA 5FSRA 1ES2A 1IBML 1K38A 1SLJA 4A3KG 4B3TL 2UUCQ 1ZG6A 1ASZA 2XD5A 3HLEA 1M90C 2OQ0A 5TFQA 3CCUA 3G4PA 1Z9FA 2I72A 4FH4A 2VGKA 4BY1H 3HLCA 1OTCA 2ZJ9A 3BZKA 2JA7G 1K56D 4QY6A 3HOUH 3T1YL 4GLXA 4CPKA 2UUAL 1VQPA 3IWQA 5D3OA 4NXML 5HFOA 5LMUQ 2Y2LA 1IYPA 4HJAA 1O07A 3TOIA 4NETA 3NEMA 3OTOL 1SFOH 3VMAA 4GS3A 1PW1A 3GMWA 4JF5A 5FASA 3AFQA 4HBUA 3W8KA 3OYYA 4BL3A 4A3JH 3PUYA 1HNXL 2QMIA 4U0XA 1A62A 4A3CG 1HR0W 1GHIA 3CQZH 4WJ3M 2JE5A 4KHPQ 4X64Q 4YFMA 4IFDG 2D0OA 2R7DA 1YEZA 4PZ7A 3GTGH 1KVMA 5FA7A 3NENA 1PHJA 3U4VA 1SHVA 2ASBA 4LF4Q 1YI2A 3HUOA 3N8LA 1E25A 2ZJPA 3RXXA 1VQ8A 1Y1VG 4OQHA 1K8AC 1KRTA 2FXQA 4DR7L 3IXBA 5HARA 2J9PA 4OVDA 2WB1E 2R93H 2E5LL 2XDMA 3NY4A 3HKZE 3CD6A 4LFCQ 2IT1A 4Y0UA 2Y2HA 3C4PA 5AQAA 4DAYB 3CC4A 5IHVA 4HIMA 2C35B 5M5WH 4RYEA 4HJ8A 1HD8A 3J80i 4S2NC 5KMWA 2UUBQ 4K91A 3S1NH 1PH8A 1K3RA 5LMNL 5FJ8G 1RL2A 1VQNA 2OTJA 4P85A 1T9HA 1BLHA 5CEDA 2VGJA 4R4QA 3EQVA 4RVAA 4OWXB 1N36L 5HW3A 1FCMA 3NI9A 3M4OH 1PIOA 4JI0L 3UN7A 4DV3Q 4OPYA 4GN2A 2A19A 4A3BH 1LUZA 2VS1A 5M3FG 3RN2A 3IQAA 2WUQA 1XPBA 4OQGA 5M5YH 3CMAA 3M2JA 3A5ZB 3HOVG 4GNXB 3MZDA 3KJPA 2IHFA 2EFXA 2WGVA 1GHPA 3UDIA 1SDNA 1JJ2A 4E6WA 5FI6A 4B88A 1WCMH 4GKJQ 3F8TA 2JE6I 1XP4A 1I6HH 5IT9c 5GADC 3RR5A 1GA0A 5AQBA 3RLFA 1U0LA 4DUYL 3V3SA 4GOPC 1CEGA 4TQUS 3JAMc 4POGA 3UO9A 2DUDA 3CPFA 1JE5A
chains in the Genus database with same CATH superfamily
2CFMA 3HKSA 4Q8IA 5CERA 3M3YH 1K28A 4PZ6A 4PKYG 1S4RA 3CF5A 3FKIB 2Q8IB 3GRJA 5BR8Q 2FMMA 2RCXA 1R4PB 5IGFA 4Y5FA 1NAPA 2Z8LA 3URYA 3VR2A 2E8IA 2O2LD 1F9SA 1I6VC 2ICIA 3CAMA 4MBKA 3WS4A 2R7FA 3EJIA 2IPKD 1MWUA 3PCOB 1EQRA 2PI2A 3ZG5A 4JBMA 2OV5A 2YU9B 1H8YA 4K5WA 3SDZA 3K57A 1HR0L 3HOXH 1D6EC 1PYWD 4ZQ3A 4C2MB 3GTJH 3GTLH 1YLPA 3RFBA 1RIPA 5FO7B 4HTHA 4KMUC 3RN5A 5A2QL 3HOWH 1NR4A 2F0VA 1DXMA 5HGTA 4AFIA 1DJRD 5T1IA 3PO2B 1B50A 1FJGQ 1HNZQ 4MN6A 5AJGA 5EPKA 4B93A 5HWVA 1QUQB 1TT2A 2R6GA 4ZKCB 4X65Q 3T53B 4AQYL 2R92B 2FH5A 1BBWA 2W3EA 2VY3A 4UQIM 2A2LA 1HHVA 4O01A 3SHLA 4HIDA 4A75A 1ES5A 4JF6A 2JKTM 4R1JA 3GSGA 4I3IA 4EQOA 3UB8A 1E2WA 1SMYD 3NPPA 1XNRQ 1F9PA 4ZCKA 4CLCB 5CORA 1F9RA 4ID6A 3GTKB 3BEBA 1A63A 2K14A 2WINB 1A8VA 5C3XA 1G6OA 4BWGB 1PTOD 1T5EA 4GHIA 2O9AA 1WJJA 2Y0SG 1SNMA 2PZUA 1STGA 1TWCH 1LL9A 3HUMA 4JLFA 3Q22A 4N9PA 1V9ZA 1DM0B 3D6WA 3WWVA 2PYRA 3VYRA 4OLGA 1VQBA 3T4LA 4KQOA 3HOZB 3ZHHA 5F82A 4CKCA 3M6BA 4HR7B 2WV6D 1I4XA 2JC7A 2NYZD 4X3KA 4OX9Q 3Q7VB 4GN4B 5M1AA 1I50H 2JA8B 3UDGA 1GJXA 2BDOA 1W8YA 4A4IA 3SVMA 2B2YC 2OF1A 1HCZA 4A93B 1J5EL 1K55C 2DRWA 4R8NA 2PW7A 3S17H 3N4IA 4HI4A 3S22A 5L2FA 1IYSA 5HDSA 1GHJA 3BG3A 2UU9L 3WS2A 1G68A 3T1HQ 2HQEA 3W1GA 4EW7A 2RQXA 5COYA 5ELOA 2VW9A 2M2LA 2RCFA 1PH1A 1PH4A 4L6TB 3J7AV 1CI9A 1QB5D 3M6HA 2B63H 5IWAL 2NN6I 1B1ZA 2R61A 1KE3A 2X69A 3BDOA 4IVIA 1V1QA 1HVBA 3A3FA 1LSXA 2A6HC 4B3SL 2EJFC 2F0UA 2ICEC 2UXBL 4X68A 3ZNYA 4XUXA 3KLWA 5IGCA 3BW6A 2F0WA 1H9MA 1H95A 1CI3M 5E3FA 1UWNX 3NP8A 4WMCA 1MSGA 2B2UA 4C75A 4LCMA 2FHTA 3LFVA 2XRSD 3PO3H 2K5DA 4HJ9A 3DHQA 4B3MQ 2KCNA 4QJFA 4Z9QA 1FR3A 1JNUA 1O7IA 5IIFA 1AZQA 1MPLA 5E2GA 1KDBA 4CBVA 1E3UD 4GLVB 1JB3A 1ES4A 5E2FA 2WZZA 2A69C 5IGGA 4A3KH 4IALA 3S1MH 3OMGA 2PI2E 4O2DA 5C4XB 4A3GG 4YOFA 1JB7A 5FQQA 3OPHA 4HCEA 1BDOA 1ILQA 2G9HD 3J7A5 4NB3A 3MSHA 3F1OA 3LNNA 1IBMQ 1HRJA 1CSQA 4J8QA 1HZ9A 1NLZA 2AUJD 1I2SA 1YLJA 1JOOA 5C4XG 1ONGA 2JA7H 1S0WA 1SSOA 4FSFA 1C0AA 4JI1L 4ME4A 3T4OA 1K8OA 1J9MA 3LEZA 4Q0IA 2Y55A 1MI2A 1EU4A 5IY0A 3HBRA 1IYUA 4OOLA 2OCEA 2QILA 1IL2A 1LTBD 3S7PA 2EWVA 3PIP3 4YWLA 3Q0AA 3GECA 2K75A 1TVFA 4LV2A 3LCEA 4BBTA 4LMQD 1QILA 3MHBA 3T1QB 2PDRA 4JCVE 2NWGA 3QP6A 2QKIC 1YAXA 5IU1A 3IWOA 3NELA 2FFYA 3IX4A 2AQ3B 2EOTA 4EGVA 4ULLA 5DJTA 5HWWA 2A1AA 2QEXA 3T1YQ 5CEBA 5GLAA 2KENA 3AB9A 2Y2QA 1KLGD 1SYGA 5HL1A 1DYQA 1SYFA 4HMIA 2P04A 1XX2A 1NYYA 2I5HA 5BOHA 2UUAQ 2E2IB 4DFAA 1KC8C 2K5HA 3QG1A 3D4RA 1K8GA 4NXMQ 2HP9A 3MF0A 4L9GA 3NBHB 2EZVA 2JEAI 1NRFA 3I56A 1N8RC 5FLXE 2WAQE 2ZTDA 2EYLA 1D7EA 1OT9A 2HJEA 2VV6A 2Z0SA 1DJCA 1L1OB 1XX8A 3KK7A 1SJED 3OTOQ 5EPHA 1X56A 4S2JA 4NPSA 4WEKA 1STZA 1SNQA 5EVLA 5A90A 3NXWA 3MBZA 1DJAA 3STBC 4EEUA 1PRTF 2D5DA 3IHBA 1SNPA 3CCRA 4R4IA 3QP4A 1R9TH 4OONA 4WZ5C 5DF8A 4FF2A 4IFDH 4OHJA 2GVAA 1HNXQ 3S7NA 2MNAA 2EY2A 2QWSA 4KZ9A 3TP6A 1K83B 3W2ZA 1VF5C 3KF6A 3BLMA 1OXVA 2QA4A 3OC2A 4YHHL 2JCHA 4OPZA 2N49A 4OXPA 3UDXA 2B29A 4HEDA 4G7HC 3G2YA 1CA6A 1Q8KA 5GLCA 1EQVA 2D02A 3OIPA 3FPWA 1Y1VH 2A6HD 2V2FF 3EOIA 4NXNL 5FAPA 3ZG7B 3J81E 2K28A 5G4ZA 3OCLA 2ZQ7A 3SS3A 3KBXA 1DY6A 1QMFA 3QP5A 2NZOA 3UY6A 1VF7A 4LF6L 3GTPH 3W4PA 2NTSA 5KIXA 3GQZA 1G291 2PPBC 1UWPX 3C5AA 4A3DB 3V3RA 1LHYA 2Y2IA 5L37A 4DR7Q 1UGUA 4UDUC 1JCKB 3KSGA 2WKDA 2HD3A 3OHXC 2NN6G 4X62L 3G71A 4IUTA 5KYLA 3IX8A 3HKZB 1QNKA 4IUUA 4C3IB 2ZMAA 3T1SA 1TS4A 3GTCA 4P87A 2Z6KC 2VV7A 3M7NA 2KCTA 5K5BA 1LT4D 2A69D 4C3HG 3CCJA 1LL5A 4CJ2C 3DEPA 4O1NA 2A5HA 5FJ8H 4DE2A 4WJ4A 2SNSA 3LO7A 5C3EB 2QGQA 2ZM6L 4DDYA 1CT1D 1MD2D 4UHVA 2UXCL 1B53A 2CVRA 4DGZA 3S1RB 2K01A 4B08A 3IWIA 1L2SA 4HSVA 1HQMC 4MTNA 4XYQA 3JAMi 5HDDA 3JPUA 1V43A 2KJXA 2NUCA 3PAGA 4MZ9A 2N78A 5LMNQ 3H3VH 4N92A 1KE0A 1SKFA 2OLUA 4LF7Q 3Q7ZA 3TMEA 5E4WC 3K6OA 5IT9L 4KKSA 2PU2A 1I5FA 4DR6L 1TWFB 5M3FH 4RHRA 4PMWA 2E2JB 4H8RA 1PLFA 1YLWA 4LV0A 4RMFA 4F87A 2M9VA 3W1BA 1N36Q 4LRYC 2BA0A 1DOLA 3WS0A 2B2TC 4JI0Q 1KRSA 2HJ9C 5C44B 1PXUA 1FVIA 1ZYRC 3GDEA 3LEQA 3HOVH 3JAML 1K57C 3H0GB 5KNDA 4A3IB 2HDQA 1IYJB 1ONHA 1GVPA 2EYHA 4EBNA 3D4FA 1BCPC 2YTXA 1XKZA 1I4GA 5GHZA 1LO5D 2VB3X 4PZ8A 1XA7A 1F9IA 2FJ2A 4HJ4A 1VEUA 1LTRD 2BA1A 1NBWA 5I9PA 4JXVA 4KK7A 4E3NA 1CSPA 2XRQD 5ELNA 4ZAIA 5C3WA 5C44G 1MHWC 3NIAA 1FD7D 2NVQH 1EWCA 1LYLA 2ID0A 2XLNA 4LW1A 3S2HB 4A3IG 3VYUA 5M3MB 1MIUA 4QUCA 4R4CA 1RD9D 3EGXC 4BY7G 2W3DA 1Q46A 2XNAC 4FXKC 3ZG0A 1GD7A 2HDUA 2LB5A 1YSQA 3A7LA 1SKOB 2IJ0A 4OEMB 3ER0A 1I4RA 4RG1A 2ZC6B 3STBD 4M4XA 4IVKA 4CJ0B 2HP6A 4JV5L 3BJUA 4NXBA 5G18A 4DV5L 3VP3A 1TS3A 3EEHA 1PH6A 2IX1A 1EWZA 1CK1A 1UE7A 4I7AA 3HGBA 5GAEC 4DUYQ 1Y4OA 2OWHA 3CCQA 3OLOA 2WFWA 3CCMA 1NE3A 4GNUA 2K52A 5F6AA 1UNSA 5FATA 4ZK9B 3HREA 3KUPA 3BY9A 3OCNA 3H3VC 3O3VA 4IBXA 3FDTA 5J3WA 2OT2A 3I91A 4QUFA 3ULJA 3IF5A 1VQEA 3RLOA 2NVXB 3PBQA 5KSCA 1V1PA 3J7AF 1EOVA 3GD7A 1KNEA 4QIWB 3UE6A 2Q2IA 4CKBA 3CAXA 1DP9A 1VQHA 3S1QB 3F1NB 3L2PA 1PFLA 1TVXA 2JA5H 3CITA 3BZCA 5FO8B 3PR6A 2UXDL 2BE5C 1PVOA 3IS2A 5HD3A 4Z1WA 3S7QA 2NBFA 2HCCA 4WUJA 2ZM2A 1QZGA 2O0YA 1N34L 3X3MA 3U50C 4POFA 2BASA 3E0YA 5KYIA 1HR0Q 3FC7A 3NHQA 4AYBE 4OWWB 2B5RA 1EY9A 1X32A 1EY4A 3AGEA 5M18A 1QZHA 1B7YB 4RX3A 1WTWA 4ZTKA 3T13A 1KXLA 1MXOA 1J3WA 3LY3A 3D6CA 1PH9A 2R7ZG 2Z1CA 4DN0A 2CW0C 4AQYQ 2KBNA 2C6WB 1TKWB 1VQQA 1U9RA 2Q2HA 4FXDA 1IEMA 1XTDA 1D06A 2SEBD 5DKLA 3RZOH 1FIKA 1K6SA 3IRBA 4ZJ2A 1KNAA 2KOIA 1YJNA 4BBRG 3PBOA 1IL8A 5I2YA 2B2WA 2EYOA 2ZXPA 4OGQC 3V2TA 1OO9B 4DR4L 1G8ZD 3VR5A 3WOEA 3AGDA 5HX9A 4NXEA 2K04A 3VV4A 1P0ZA 2A49A 4DXCA 3LGJA 2OXPA 1KDAA 2RSOA 1CQFA 1KTKA 4K8IA 4YCWA 1E22A 3CCLA 1PZJD 1BF4A 1EROA 2XD1A 2ENBA 2WKRA 3R2IA 1YITA 2ATWA 1D2BA 1C8CA 3HOYB 4E3JA 1STAA 2QDLA 4GKUA 4NMZA 1LM0A 1B4OA 1GM5A 1H9SA 4OKPA 2HIXA 2E74C 1EYAA 1QE6A 3MEFA 1SR3A 1IYVA 3M85A 3BJNA 4DAPA 4P72A 3H82B 3HG9A 2LFNA 2HDRA 1EY7A 2Q8RE 3MKFA 3UMEA 5EPLA 4FCFA 5CTNA 1CKMA 1J5EQ 1ZYRD 3MJQA 3MA2B 1AWIA 1VDZA 1E3UA 2KA7A 4EWFA 2UU9Q 1HZAA 4ZUJA 3KJOA 1TDLA 1WYBA 1BCPD 1TWAB 1SE3A 4QGUA 2EJMA 4KZ4A 5DTSA 4PG3A 1TY2A 4KQQA 2AWNA 2ZOIA 4L5QA 2VUMH 4HJ6A 3BU2A 2KQ3A 4DF6A 2Z9HA 5CTMA 5IWAQ 2VV8A 2J0TD 3IAYA 2B8GA 2XGTA 2L15A 3OMCA 4HAEA 1EIFA 4B3SQ 2QJ5A 1JC7A 4NXFA 2UXBQ 4D60A 3N7WA 4GDBA 4EETB 3PBNA 4O0AA 5K36G 1TS7A 1BLCA 2F0QA 3DAVA 1YLTA 4IUKA 3CXCA 2Y2PA 4LFUA 5C6AA 1D5XC 3DWPA 3NOTC 2ZQAA 1WYDA 4CLCC 5A93A 4EQ5A 4WF0A 3UE3A 1OXXK 5DF7A 4KG5A 4BD1A 1Z6FA 3I4OA 4EVOA 1RODA 2EPBA 3N52A 4A3GH 2DCFA 3BM6A 3DWQA 3J7YW 3UPNA 3DTIA 3VP0A 4P71A 1TD5A 1U4RA 5L8MA 1HQRD 2BOSA 3DTEA 4OP8A 2X6LA 4WL9A 1W63M 2IY5B 2EX6A 2LKVA 4M1UB 2D0PA 2ZTCA 5C4XH 4C1NK 1S4SA 1T19A 1CKOA 1LV9A 2F0PA 4N1HA 3K7AB 1LL8A 5C5KA 3BWLA 2Q0OA 5E7NA 4A3MB 3K5OA 1CKNA 2G2WA 3E5SA 4Y0TA 2NVYB 3H9WA 4JW0A 4S2KA 2HF6A 4R3AA 2PRFA 3WS5A 3MXGA 4UA6A 1RGYA 4L8JA 4IUHA 4KZ6A 4JI1Q 2W0NA 4MDZA 4KN4C 4E6XA 1X3EA 2B2YA 4MNRA 2CW0D 1K55A 4MCWA 1XYIA 2VXWA 5GAGC 5I6WA 2ZQCA 1WTXA 1L0XB 2V1AA 4IHQA 4O7DA 1ML0D 4XQJA 1Q12A 1QMEA 3PAEA 2EY1A 4GHIB 1BYWA 1VQOA 2K2NA 2WAEA 1RKNA 3MXPA 2MJ8A 3JC66 5EVIC 4IUVA 4NXGA 1Q8IA 3FPVA 1UE6A 4OP5A 3W4QA 1M1KC 1KE4A 3PGZA 5HPIA 1EQTA 1CI8A 4OQIA 1KGGA 3ZJYC 3BVMA 4DR1L 3UDFA 1K73C 2K5NA 4S2MA 1WTVA 4ILWA 1PH5A 1LACA 3PF4A 5C5MA 1CHQD 3J81c 4YNRA 1ENAA 3CHWP 1YVCA 3DM3A 3MZFA 1STHA 3GTQH 4R6LA 4B4XA 2A68C 3T4SA 5JJKA 3KDFA 4OIJA 2RHQB 3I4NG 1SE8A 3P09A 2WKQA 2O99A 3TZUA 3PMFA 2E8JA 4IBRA 3Q1FA 4KD4A 1WOCA 1NYMA 2VGLM 3HP3A 1JT8A 1Y1WB 2HZ5A 4S2PA 4KD3A 3CU7A 4DE3A 3H7WA 1Z7TA 1TS8A 4JI2L 3CG5A 5GHYA 4NDXA 2PO4A 1FYCA 4UAAA 2G7UA 4XT1B 5FDSA 2FFFB 4YHHQ 3CHBD 2MGSA 4J15A 4TVAB 3NCKA 3F1ZA 3SR1A 2Q8TA 3S15B 1VQAA 1X3GA 1M6KA 1LTLA 4BD0A 4BBSB 1S5BD 3I4MB 4N8FA 4NG2A 3D4DA 2RDHA 4DNIA 4NXNQ 1HXYD 1A2UA 3BFDA 2ES2A 1A0IA 3BFCA 3VP4A 2L11A 5IS1A 4LF7L 1II3A 1YNJC 2F0IA 1PI5A 5FAOA 1RCVD 5FDHA 2NN6H 3GV3A 4LF6Q 2K5WA 3CRLC 3TS0A 3T4QA 1SAPA 5AJ3L 4FVMA 4BBSG 4U68A 4Y7NH 3C2WA 4QY5A 4L5SA 4CLCD 5HSQA 4C3HH 1K9MC 3VOLA 1JOQA 2YKFA 1TR5A 5EUAA 3CPTA 1HUMA 4HEFA 2WAFA 4BLMA 3CCSA 3SH9A 2P08A 4X62Q 2MQHA 3MXSA 1JICA 4A3EG 4TKOB 4IJLA 1OTIA 3VSKA 3K0XA 1AEXA 5EAYA 1GSVA 4JGRA 1PWDA 2B95A 2J9OA 4LF9L 1J8IA 1WD1A 1FNWA 1RHPA 5FK9C 5C4ZA 2DJGC 5I2XA 3GQBA 2OWOA 3CMZA 1CK3A 3F1OB 1FSWA 1TS2A 2ZM6Q 3ZG8B 1XMOL 2PT7A 1L1OC 4HN7A 2JP1A 2F0HA 2UXCQ 1PFBA 5GL9A 2XA7M 1OXUA 1GHKA 3E2LA 4JG2A 3DLLA 1SMXA 4P2CB 2XK1A 1CUKA 3Q8DA 4U3TA 4K0XA 4BBVA 4EBLA 3PIO3 4K0KL 2EX9A 3TRZA 3VR6A 1Q1EA 1XFNA 3EN2A 4KQDA 4S2LA 4WN5A 3MTSA 4UEYA 2Y2GA 1WI5A 1SNDA 3DEOA 3IKJA 4RFBA 3G4SA 4F7XA 2E2HH 1AE3A 5FQIA 4DR6Q 5LHY1 3SK8A 2WACA 3RD4A 4B9WA 1PWCA 2R9WA 1D7QA 3IXDA 1YT4A 5I6YA 3N8SA 4EU0A 4WRDA 5C0XH 4LRZE 1E1TA 3T4AC 2L1BA 5C44H 1GHMA 3V50A 4AH6A 3CI6A 3J80E 5EVID 1N4OA 4HH3A 1A3UA 2G9DA 1N33L 1GUOA 4D2OA 1IBLQ 1Q90A 3S2DB 5D14A 4BY7H 1KAWA 2YV5A 3PXPA 1SNCA 3NWTA 3D31A 3BQAA 3F2UA 5KNCA 3MQOA 3W3AA 4LUZA 3I4LA 3B42A 2ZQ9A 5TBMA 3LR3A 3DWKA 1KIXA 4FF3A 3KYEA 3FKIG 5EQ0A 1HA6A 4JI3L 2JSOA 5JVG3 4UQIS 1NMFA 1PW8A 2A68D 4FP5D 2JKGA 4ZRZA 3HZXA 3KLSA 3BVGA 1I5QA 1T1BA 2N88A 1XNQL 1STEA 1ZHHB 1BSGA 4KI0A 1SXTA 4JF4A 4H7BA 4JV5Q 3S16B 4DV5Q 3FG8A 4EERA 3KF6B 1JJCB 1F2MA 4X3TA 1HH2P 1LT6D 5DVAA 4KHVA 1JWVA 3BFEA 3PF5A 1K3BC 4Q0FA 1F2KA 2EQSA 3PO2G 1N32L 4QHCA 3UPOA 3P75A 1IKLA 2N8NA 2R92G 4OO1I 2XR0A 3BFFA 2PD8A 4EV4A 2IX0A 2AUKA 4HBTA 3AMUA 4ZJ1A 4U0TA 3Q23A 1K4FA 2NVXH 2O9BA 2VQFL 4HESA 3BYTB 3TW8A 2JEBI 4C6YA 3OPLA 3A3IA 4GS9A 4IPDA 3ERSX 1QVGA 5EBCA 3M4QA 5M5XB 1YNJD 2Z2LB 1G5UA 2HDMA 3HLFA 2HT1A 4QU3A 3VR3A 2R7ZH 2UXDQ 4UA9A 1W5DA 5JOBA 3B3XA 3TG9A 3CP0A 2IX3A 3G34A 1GO3E 1I4PA 2HQLA 5C4JH 1N34Q 2NVTB 1ZG4A 1VQIA 2QZ6A 3B33A 2O5JC 3IF6C 4I39A 1X54A 4HY8A 4BBRH 4B4ZA 4LF5L 1I4QA 4JI7L 2A73B 4BXXG 4XUZA 5FI7A 2ZQ8A 3HOZG 2M00A 4BMWA 5IOCA 5EJWA 2VX8A 2EDGA 1IKGA 1VHMA 1K57A 1FNUA 4LUOA 2JA8G 1ET6A 3PYPA 3EQLC 1FCNA 1VM1A 1H0MA 4JOIC 4KG6A 3VFHA 4C3JB 3CCVA 1L0GA 4A93G 3L7HA 3P7JA 1EY0A 1SZVA 4DR4Q 1PMRA 2PQAA 3A0VA 1L0WA 1K8MA 5FLMG 3S14B 3NDGA 4UY8C 4EQNA 2J3WA 5IYDG 4YCUA 2H4OA 4XXEA 1RP5A 4HIAA 3FKWA 4L9FA 4P6ZS 5EVEA 4L9EA 4K8JA 4DNRB 4Q5VA 1L0EA 4J6HA 1KOUA 3MQQA 4X53A 5FL3A 4PMBA 4R0QA 3FYZA 5U47A 4B9OA 3A3JA 4P6ZM 2H1EA 1NMGA 3SZTA 2J8YA 1WFQA 4FOFA 1IBKL 3LWEA 1BKBA 1NNXA 1ENFA 1O7YA 5CHUA 2PHYA 5JYOA 5TSSA 1XPRA 1K56A 4KJOA 4UHUA 1VEUB 1OTBA 2CHBD 3A56A 1RF2D 3S9WA 1RGZA 3LUQA 3SS4A 1H3QA 2C5WB 1TS5A 5I4DA 5LL6S 3O88A 4BY1B 1EU3A 1Y8NB 2K50A 3RNUA 2Q9NA 3TRCA 2BCOA 1BLPA 5K36H 2FINB 4RGTA 1O7EA 1D5ZC 1JORA 2C9OA 4CJ1B 1MZUA 3JVVA 1C9OA 5A91A 2ZM0A 1ICWA 2LXJA 1PH3A 1KDCA 2Q2TA 1OTDA 4UAIA 3KSFA 3HOUB 3HEJA 1F2YA 1I3QH 4HQAA 3FVQA 1JWZA 2I0QA 5DF9A 3O13A 3KFUA 2KDKA 1Q2QA 2EYPA 2VNUD 2OAP1 2H5SA 1G2TA 5FLXL 4DV6L 3PBTA 2I5LX 4IEDA 4E3OA 5G3LF 3QOLA 5IODA 1H9JA 2GJ3A 4PMCA 4QD4A 5IYCG 5HGQA 1HZOA 2VJWA 5F1GA 3DW0A 4H44C 1SFOB 1HTZA 2QHKA 3FPUB 3HRZC 1PTOB 1CQAA 1BBXC 1SJHD 2IA2A 3PBSA 4R23A 4S2OA 1V1PB 4CDEC 1MC0A 2MFIA 3QB3A 3U2AA 5AVEA 1ILPA 2BLSA 4K0WA 2RSNA 3F2CA 3GV9A 4QQBX 3IS2B 1Y8OB 3VOYA 4ZBEA 2K5VA 4PHTA 2Z4IA 3I8ZA 4RH6A 1NRJA 5JEAJ 4JGPA 2D01A 2Y2MA 3RMHA 3CQZB 3PIPA 3LIAA 3T1XA 1NXYA 4ME3A 1Q81C 5CBAE 2RHSB 1H5XA 4EESA 4DE1A 4Y3IA 3J81L 1DP6A 1SDEA 1DCZA 2XF3A 3A0SA 1LT5D 2ZM8A 4R70A 3FV7A 4A3CH 3H15A 3KX0X 3GTOB 2UV0E 1W2BA 1CHPD 4LFAL 4OO1G 4RAUC 3GTGB 3BY8A 4F88A 2XFSA 1BXTA 4OLDA 3K7UC 3E9HA 2EXBA 4FUWA 2OTLA 1T18A 2IW3A 4DV0L 5CECA 1UE1A 4WBGA 3WRZA 3EEAA 2F4VL 3C38A 4R3JA 2RCNA 3LIDA 2H5XA 1VQJA 4DR2L 1VMPA 2TMPA 2F0JA 3CUEA 5MC7A 1NZOA 2P7JA 3P1HA 1SE4A 3NQIA 2J7VA 4RWSC 1ZEQX 1AN8A 1W79A 2XN9C 1WYCA 4HCSA 1NZUA 1H9SB 5E2HA 1WA9A 3I4NH 3L9AX 4DR1Q 3G2ZA 5T1GA 5M5WB 3A0JA 4OELB 4ID4A 4QJGA 2DJFC 5GQOA 3K5MA 3T1RA 2QKPA 4DR5Q 2P9VA 3KF8A 2WADA 2YTYA 2L9HA 2XSSA 3TSSA 3GV6A 3S1NB 2WB1B 5IT5A 4KKUA 2QPNA 3W5OA 1YHAA 3PV0A 3TREA 4WYYA 1DRMA 1VQDA 4F8MA 3PBRA 5A35A 4BJPA 3N8RA 4A3DG 2ZJRA 1PNEA 1LI0A 4IZ8A 1P16A 2PR5A 5NUCA 3A7AB 4JI2Q 3CC2A 4DV2L 2WB1G 4KZ7A 3NOPC 2PNHA 5KNBA 2OWJA 5KZHA 2I46A 3HKZG 4C3IG 4L5RC 1KGFA 3M4OB 5JPNC 1PZOA 1ZKOA 2Q9MA 2V1ZA 3BLSA 3GVBA 4ETZA 1EIHA 1X65A 4BBSH 1WTQA 1BO0A 1KABA 4A3BB 4IO9A 5DAUA 4X6AH 5FQ9A 1FILA 3LIFA 2VQEL 5C3EG 3ULPA 1VQLA 1YQSA 5M5YB 3TN2A 3IXGA 1EI5A 1BVSA 3GR2A 4DXFA 3RZDB 4A3EH 2R78A 4GCZA 5AFWA 3I7JA 5AJ3Q 5E2EA 3QNCA 3LGOA 4HJ7A 1TWHB 4PM7A 2A3UA 3FZCA 3K5NA 2EWWA 5F68A 1WCMB 1RJTA 3T50A 1OXSC 1STYA 2N3SA 1S1ZA 1I6HB 1LTID 1PFMA 3EROA 4KG2A 4ABNA 4X1LA 1PH7A 1IBLL 4A3FB 2LSSA 1SCWA 1HPCA 5EVIA 1JMCA 3CJMA 4LF9Q 4HH2A 5GLBA 2EYFA 1B2TA 1L2FA 4BBUA 1E7ZA 1TWGH 4KZBA 1L0FA 4DXGA 1M4VA 1CZWA 1CKNB 1SRUA 1X3QA 4YWMA 1EY6A 2EFUA 5G4YA 3H0GG 3GTMH 4GB7A 1XMOQ 1PA6A 1CFMA 3OPOA 4N9KA 5HAPA 1EYCA 3D0FA 3E2KA 3OPPA 3C7UA 4A76A 1N9OA 4A3FG 1EY8A 3FP9A 2F0EA 1VS0A 5I9OA 5KEEA 1SBBB 2ZTEA 3M3YB 1A2TA 1IXRA 4K0KQ 2HPBA 2B2VC 1YNNC 3H6MA 5F2DA 5M3MG 1O80A 4MBHA 3NE5B 2WGWA 2L4RA 4IPCA 3PUVA 2EXAA 2GX5A 1LSWA 4ZKBB 5EECA 1VQKA 3FPPA 4DAMA 1T5XD 4GD8A 3HOXB 1Q82C 4J1MA 4QB4A 1HUNA 5GROA 1MKMA 1KGEA 2F0SA 5FKAC 4ALPA 5FOBB 2JBFA 2E8GA 3HOWB 2WKPA 2JHEA 3ITAA 4S2NA 3U4ZA 1JVJA 3FRPB 3KYZA 4RA8A 2B2UC 4OIKA 1XMQL 3SH7A 2P74A 1B8AA 5K5PA 2V4DA 3PHYA 1N33Q 3FKIH 3JAME 1NY4A 5IYBG 3NBLA 1CZGA 2Y0SE 5CV5A 1BNZA 2QW7A 3KYHC 2NUTC 4FD8A 1PRTC 4OL7A 2WKEA 3F1PA 3KDFB 1Q2PA 1EFWA 2YU9H 4CLCE 4IJHA 4C2MH 4PM8A 4JI3Q 3LICA 5CRFA 1TWCB 1MSHA 3PO2H 3EFXD 1XNQQ 3ULLA 2VK3A 3H7WB 2R92H 1J6QA 1NJIC 3IFDA 1H8ZA 3T56B 3FHWA 3KLRA 4GNXC 4DK3C 3R7WA 2VZWA 5EE8A 2Y2JA 3WS1A 5JJLA 1WE4A 5AQ9A 3PUWA 4UA7A 2NZ1D 3SS5A 1I50B 2MP1A 3A8KE 4K14A 4TSSA 1XPUA 3GTKH 4IFDI 1N32Q 1GCEA 1TS6A 3D4WA 4ARZA 3N6IA 1FGBD 4RGNA 1T1CA 4GLAC 4P73A 4YCVA 4U673 2O9CA 3PTEA 2HGVA 2AHOB 5BN3A 1U5KA 2VQFQ 2TSSA 3VP1A 1BT5A 2OOLA 3AQQA 3C30A 2WK0A 2EY5A 4LF8L 3K80C 4BXXH 2VB2X 3ULFA 4HHDA 3TSGA 3HOZH 2XRNA 2B63B 2F3VA 4V0BA 5EKLA 2EY6A 3CPTB 3IX3A 3MFDA 1X3FA 4WFN3 4HIKA 2JKRM 4BENA 4JBKA 2L0WA 1VQ7A 3QP2A 3A54A 4GOPA 2JA8H 2NTTA 4MBFA 1FNVA 3HOYG 2OSUA 5I5LA 3C4OA 5CBEE 4M8AA 4LF5Q 4JI7Q 4A93H 3CLOA 1K54C 3WDNA 3ZFZA 4DV4L 1CA5A 4LGWA 2XEPA 1GKHA 3MXNA 1YSPA 4CDFC 3ZVTA 4K08A 4LCLA 5FLMH 1TY0A 1VQMA 1TIID 3QWNA 4HJ5A 5IYDH 4X66L 2KUMA 1MBLA 4KTAA 3PO3B 3SOIA 1L0YB 5CYUA 2DNSA 4BA2I 1SYBA 4MIUA 2WKIA 4JGQA 2K03A 2PCFB 4L63B 4IOAA 2XFTA 3LX0A 4P0MA 5LMNW 1EZ8A 1J9OA 5G3LD 1W8QA 3MKEA 3FMCA 2HV1A 3DXJC 4JI5L 2LB9A 2G5DA 1FQGA 4A3KB 3S1MB 1XFQA 4FTXA 1YM1A 3BDCA 4C1NI 5IP7G 1YNND 3H3VI 2X01A 4QL5A 1LSVA 1C4QA 2JA6B 4BL2A 1IYQA 4DK0A 3G31A 4DK6C 1IBKQ 5FQKA 4JI8L 2ZMFA 5EOEA 3ICEA 3HJIA 4PPRA 1X55A 4Y13A 5JEAG 5DTKA 2JA7B 1E4DA 2DY7A 5J3BA 1PZKD 5J1ZA 2XSCA 1HNWL 2A74C 1GSWA 2AQ2B 4WMCD 2F0NA 2JA6G 1KVLA 4JXWA 3TP5A 4DE0A 1I94Q 4CJNA 1IKIA 1Y54A 4X56A 5TBMB 2IWHA 2VKSA 1E24A 1S3OA 4GJ4A 1T1AA 2PMZE 4HNBA 1MJCA 3RLNA 4HP4A 1S5FD 1A15A 3KO6A 1PRTD 2F1MA 3LI9A 4Y0OA 2W1RA 4I3JA 3CW2C 5DFXA 4K2KA 3SXHA 2MO0A 4FXGC 2CQOA 4R1GA 5IYCH 2W1TA 5FLXc 1NJ4A 4DUZL 3IF6A 1JTDA 1QVCA 3NBIA 1ASYA 4A3MG 3GP7A 3IFTA 3MZEA 1HA5A 4DV6Q 5GAHC 3G6JB 3S7OA 4PM6A 1XPOA 1S6RA 4UPAA 3I90A 1EIYB 5LBRA 4E6IA 2K4KA 5HL6A 4HOIA 3RH8B 2WYXA 1ESUA 5CHMA 3QR8A 4JOIA 5DKKA 5HD5A 5J7EA 5M9OA 3P20A 5KGUA 1VETA 3OOVA 4O42A 4S2IA 2IWBA 4IUNA 4K6LA 3W2DA 3A74A 1PZPA 1S5ED 2Y2OA 1KAAA 1OT6A 3U58A 3TQYA 4GS9B 5HAQA 5JJIA 3IH9A 1R9TB 1P8LA 3G32A 3VA7A 3O5YA 1MBYA 5HDCA 1CEFA 1F77A 5F5YA 4ETXA 3G6EA 2E2IH 2ZD8A 2B3GA 2B8FA 4OO1H 2EX8A 2PBYA 1ESRA 2K1BA 4RKBA 2LXKA 4P74A 4DR5L 1N9NA 2WAQB 2SDFA 1B3AA 2JKTI 3G30A 5IGEA 5EFWA 3KSIA 5F1FA 2VGLS 5FQMA 3BVZA 4E3KA 4LWCA 1Y1VB 4IJGA 4MLLA 4OPQA 2AKWB 3GTOH 4LAAA 4LFAQ 3VYTA 3QNBA 4H6JA 4Y17A 1BCPB 2WAQG 3V05A 5DM73 4GD6A 3VE4A 4XQNA 4DV0Q 3J81j 1FL0A 4UP7A 3CKIB 4KENB 1IYOA 4G57A 2ZBBA 3EGDC 1RTOA 1K83H 2PQAB 2F4VQ 2JQOA 4I38A 3H94A 3ZDJA 2L5TA 3MZ5A 3MFGA 4DK1A 1EW0A 1GSXA 1Z6HA 5AVFA 3U4LP 3ZQ5A 4JI6Q 4DR2Q 1KDSA 4DKIA 1Y1WG 3MFXA 4E3IA 4GZBA 1YPRA 4JC0A 4JGOA 2JA9A 1PDQA 1HFNA 2XWBB 1YKDA 3LR4A 1X9NA 4FF1A 4KUKA 3V67A 4HMJA 3AGFA 4ESPA 2SNMA 1EYDA 3SGIA 1KDWA 3C3LA 5FQJA 2XIWA 5J8XA 1ACFA 3BZDB 3RJUA 1SYCA 3I4MG 2B02A 1NLYA 2L55A 4HIOA 3L7ZC 1ESIA 4A3DH 2EX2A 1YJ9A 2QJ7A 5IP9G 4K5VA 3LYXA 1Y8PB 1BR9A 2OQKA 2V20A 2F03A 4C3IH 3B6YA 1WTPA 5AQ7A 1LTGD 2ZT9C 1D1IA 4K2LA 2MPMA 1L3LA 3G7LA 1HJPA 1SEBD 4MNOA 2RDFA 1E0BA 2XA7S 2K05A 4RCOA 5DLQE 4DV2Q 1IELA 5CV7A 1STBA 5C3EH 4ZDXA 2F0DA 2ZL1A 3BYDA 1AW7A 5CX7A 5KIZA 3S1RH 3J80L 1VQGA 4KZ5A 3HOVB 2MO1A 3TP8A 3HLBA 1V9YA 2J80A 2KCCA 4KY7A 2ZMVA 3K3DA 4PAUA 3S1YA 3S4XA 4EQIA 5KSHA 3DM1A 2X71A 1BTLA 2XWJB 1Z47A 4KKTA 1HTLD 2B2WC 2VQEQ 4UP8A 3F2DA 2A24A 1N9BA 2PYKA 3MC0B 2ZLYA 3ZVWA 3D3OA 1ET9A 3O86A 3L9KA 3RZDH 1PWGA 5CV6A 3NULA 2CCZA 2NVQB 4E3MA 2OEOA 1TWFH 4OQ0A 2JN7A 3R8BA 1DONA 4WZ5A 2E2JH 1KHIA 4C56C 1N9LA 1TWHH 1JTGA 3LY4A 3C7VA 4IURA 4DDSA 1PZID 1XGIA 2Z6CA 2A6EC 3HUNA 3NJAA 3MR0A 4I5SA 1KQSA 3ZCZA 2I5MX 3SH8A 3H0GH 4A3IH 3JYIA 1EWHA 3SK6A 5E43A 1ICFB 4WORA 4GZYC 3PIOA 1ERMA 4A3FH 1TXYA 5FAQA 1DJBA 2KLIA 2RL3A 1D8LA 1W7FA 4ZJ3A 3BQ8A 4YIJA 1X6OA 3TDQA 3S2HH 1XGJA 4A3LG 2H28A 3NTIA 5M3MH 1EOTA 1BLSA 4H13C 1HLUP 4O8GA 1K0SA 2HHHL 4G3KA 3G35A 5GLDA 1Q7YC 3QJYA 2H0TA 4XDXA 3UNWA 1F98A 1NR2A 5HY6A 4BS9A 5EM1A 5L10A 3TE8A 3CMEA 5BN5A 1N9WA 3MXQA 5DFYA 3UB7A 4E3LA 3FEWX 2CKZB 1YBYA 4QIWE 3RXWA 3SW1A 4LFBL 1VQ4A 1YNXA 2JA5B 1I2WA 1E3PA 4F3LA 2CWPA 4DV1L 1C7YA 2Z6KA 4CKEA 2YTVA 1V8QA 4RX2A 2VZAA 1ALQA 1JOKA 4YY3L 1X3PA 4B3RQ 4ZUIA 1LT3D 5IYBH 3NDEA 1NWZA 1B44D 1EUJA 1O7ZA 1NTGA 5C0XJ 4YWKA 4R4SA 4DXBA 4DU9A 2QCPX 4JYAL 2FZ0A 1MY8A 4NK3A 5FEFA 2JA5G 1XMQQ 5LL6X 4KZ8A 1GOZA 5CGXA 4YINA 4CDCC 3TEHB 1PYYA 1S40A 2BH2A 1AXBA 2Y0SB 5D3DA 3RZOB 3S1QH 1S72A 2P9VB 3KF8B 3TBIB 1IZ6A 4MEZA 5C4HA 1HZCA 2Z6DA 3MWYW 3A8JE 5CV9A 5JAVA 4DV7Q 5DTTA 1G6AA 2EVBA 4KN7C 4AYBB 5HPFA 2K5QA 1XJ6A 4X69A 2V8FA 2VL6A 3NTHA 3A3EA 2BDNA 1XJVA 4GDNA 1U4MA 1D1JA 3R3OA 5EKKA 4ZRRA 2B2TA 4RA7A 3UB6A 5A2QE 3V39A 3OBFA 2JKFA 5EV0A 2PAVP 5JYPA 1BBUA 1EQQA 3CWFA 4KV6A 4FNFA 2WGIA 1YZ6A 4KJNA 4AYBG 1LLBA 3NC8A 1F2LA 3D72A 2XGNA 2K7VA 4KQRA 1JWMD 5DJUA 4DR3L 1F9QA 5H1SE 1EZ6A 4DA2A 1YLZA 1GUNA 4DPGA 3IL8A 1K0KA 4R4TA 1D5MC 4A5RA 4F94A 2ZC7A 3I2ZA 3UPPA 2DNCA 4LENA 2ZC3B 4GKKL 3VOZA 1OXTA 1Q3LA 1Y28A 2PQEA 4JI4Q 3ND8A 3VSLA 4EBPA 4C3JG 1A3TA 2WKCA 3HOYH 3DMUA 3MXUA 4X3UA 3NOUC 3IT9A 4MN5A 1YJWA 2F0LA 4LF8Q 4DAYA 2AQ1B 2VUMB 3LR0A 5J39A 1VQ9A 1S1YA 2B2VA 2Z6BA 1U4PA 3ISGA 3A55A 3B47A 1DZ1A 2AWOA 1VQ6A 3VFFA 4QMGA 1PFSA 2UUCL 3NSWA 5L07A 2DNEA 3M4PA 1XJ4A 1PH2A 5CV8A 2PBDP 2OLVA 2QEJC 2A6ED 1NCVA 2L4NA 2VEAA 3EQUA 5EVIB 1PYBA 4DV4Q 2Q2UA 2VUMG 2JXMB 3R4KA 4OWTB 5TGFA 5JVH3 4PV1C 1I94L 4R38A 2GVBA 1PI4A 1FR1A 2F0KA 1BULA 4XT2A 1TWAH 2EXDA 3TP7A 4X66Q 1SN8A 2RVLA 1K6RA 1B9NA 3AEVA 2AVXA 4WEJA 1W6KA 4KZAA 2BG1A 4RGMA 1XXGA 4BA1I 1RTNA 5IP7H 4A3GB 2ZC4B 3A5UA 3HLDA 1FSYA 2R9XA 1VQ5A 4NP5A 3NQTA 2Y8HA 2PNRC 4BY1G 2ZXRA 3PQIA 3UE1A 1EL0A 2LS01 3IBRA 4JI5Q 2H0YA 2WGWB 3QP8A 1DP8A 3TJZC 3CC7A 2EE1A 1E1OA 5JEAH 1BUVT 5EBDA 1CJFA 2IHEA 5E1FA 1FGUA 4FYDA 2CC1A 5LMUL 3ZGAB 4WJWA 1STNA 3J7ZC 2Y59A 4FO2A 3S24A 3HOUG 2JA6H 4G7OC 2Y4AA 3SK4A 3ERQA 4JI8Q 1BCPF 3J81i 5ELCA 4JK1C 4GNXA 3M4YA 4JPBW 3UE0A 3K81C 2R3ZA 3K8AA 2HUGA 4B3TQ 1FR6A 3BS1A 5EM0A 3K5LA 2UWXA 1JJGA 1HNWQ 1A6XA 3ND9A 4C3QA 2GA4B 1JE4A 4RCNA 5C0XI 5EKIA 4LJZC 4KUOA 1Q86C 3MFYA 1W3SA 4A3JB 2IWDA 4LV3A 4O0PA 1W6JA 1VQCA 3G48A 4JKTA 1H9KA 1IFQA 2V1BA 1B9MA 3F1PB 4I3AA 4P75A 1VQFA 1M8AA 4V190 4FDBA 2PMZB 3DTMA 3K7AH 3HVFA 5JPMC 1E2ZA 2RKSA 4IPHA 4GN3B 5ELBA 4A3MH 4KHPL 4X64L 3OPRA 4PKYA 4X1MA 5CGWA 5E4XA 2FMCA 2EIFA 2LY7A 2WP8J 1BUEA 1F5MA 1LT0A 4Y15A 5F83A 3E9IA 2NVYH 2KVMA 4A3JG 3M7GA 3T4KA 1EEFD 4DUZQ 1ZKJA 1RCJA 4XQQA 3FKVA 3HCYA 3TZDA 2JK8A 3P98A 5FI2A 2XH9A 1EFID 4JBWA 5I94A 2ZC5B 4X55A 3UB9A 5J4EA 3R7WB 1EY5A 4PM9A 4LF4L 1K54A 4II7A 2ALYB 5IE8A 4ZAMA 2W3GA 3ITPA 1MWRA 4X6TA 1EYGA 1LI9A 3H09A 1G91A 2A8VA 4ARZB 4IUQA 4N1XA 4YWZA 1GUTA 5HURA 3GTQB 2OAQ1 2ZJQA 3O87A 2KHIA 2KOLA 2X02A 1HTPA 1O78A 2F0FA 1WVLA 1ZC2A 4JI6L 1BOSA 3C8CA 2R93B 3EIVA 2L0CA 3BRMA 2BH8A 2K33A 2NZHA 1MWSA 2IWCA 3ITBA 5CXWA 1BQQT 4BQMA 4LFCL 2VLGA 5HWTA 3F2BA 3K3CA 1HFGA 3VA5A 2BTFP 2GZAA 5CMDA 4BWIA 1EWIA 1XWEA 3I55A 3V96A 1YIJA 1K4EA 1NY0A 3KOJA 1QUQA 2M7UA 2FFKB 3GO5A 1GA9A 4R4RA 2R93G 2F0TA 4GOPB 4N9LA 3CRKC 1SROA 2PW5A 1S5CD 4APVA 2UUBL 3HLWA 1VMCA 2H10A 3E3XA 4CLCA 2J4XA 3T16A 4LK1C 2KX6A 3MXNB 2RF4A 3CPWA 4R4OA 2CMNA 3V5MA 5IGBA 5D65A 2J3TC 3HJKA 3RTYA 3VP2A 5M19A 1HZBA 1JR0D 4MN3A 1AE2A 2KHSA 2HIVA 2RDGA 3C1FA 2ZOHA 3OWEB 1Y1WH 3T4TA 3A8IE 5A8BA 1IW7C 3EBEA 4IFDJ 1K25A 3IHAA 2C5CA 4Y7NB 1GUGA 4I7ZC 3CCEA 4DMZA 4C3HB 3AFPA 3LI8A 4PM5A 4I65A 4DV3L 1AZPA 3S15H 2ACGA 3PUXA 3ZYYX 3Q7VA 4PNYA 1XXMA 1OMEA 1PV4A 1K0RA 2JKRI 4HSPA 2E5LQ 2KCMA 1YHQA 3I4MH 5FEGA 3OOCA 4KLKA 3U9OA 1KD1C 1MKIA 4DKAC 1F2ZA 5IP9H 1OPXA 1YMSA 3BECA 1VB6A 3L3OC 5CHJA 4TRDA 2JN4A 4KHZA 1O7LA 1TU2B 4FF4A 1PYSB 4EUZA 1VCIA 1V1OA 3VR4A 1DD2A 1D1KA 1LLRD 3SE0A 4A3BG 2KECA 3OZHA 5TJJA 1UEBA 3DWZA 3EA6A 5CR3A 2GN5A 4GKJL 4NEED 3PUZA 4QB8A 4EQ1A 3BYYB 4JPMA 2D2CC 1A3VA 2DGYA 4RHSA 3RUZA 1YMXA 3ZNTA 4Y52H 2EYMA 4R9WA 3W4OA 4IPGA 4NKLA 2E2HB 2HCIA 1ENCA 3BDLA 3J80c 1WCMG 3P7NA 3MAQA 2XVSA 3R93A 3M9BA 4RQ9A 3H91A 4QY7A 3E0EA 1AP0A 1E2VA 5CGSA 3OW7A 2W1TB 4QF4A 3AYHB 3IF6B 4EX5A 1KLUD 4RGOS 1G6PA 2V8CA 3TS2A 2RA4A 2GDNA 3IXHA 1S67L 1Y14B 4Y7PA 3IBJA 2JYOA 5ISRA 3OW2A 2Y2KA 4ZYSA 5BR8L 4OPRA 1B3QA 1JWPA 3GDIA 4BY7B 1ES3A 1ZXTA 2B39A 4FH2A 5IGDA 4JBJA 5C0XG 1G51A 4N8X1 3UMDA 3LIBA 1UAPA 2MUYA 2AMCB 2Z4HA 2D9UA 4B3RL 2YKHA 1TDGA 3KSHA 5IT9E 3GTJB 3GTLB 4Q0HA 1VETB 1I4HA 4L5TA 2YYZA 3WWXA 4ME5A 2V9AA 3I70A 1OJ5A 1U60A 2L1MA 3I7FA 4G4KA 2DMWA 3T51B 1HNZL 2F4IA 1FJGL 4A3LH 2GNXA 4OOYA 4JXGA 5HAIA 1YLYA 1UUPA 2N55A 4H0LC 4X65L 4LV1A 2XTIA 3Q07A 1OJGA 3K0YA 5CV4A 3OSOA 1NSNS 3HOXG 3S2DH 4XXRA 4DAVA 2JJQA 3CZDA 4Y2FA 2HP5A 4N9TA 1JWSD 1C3BA 3HOWG 3DWAA 4K6DA 1XNRL 1YHBA 2I07B 4LUVA 4NW2A 5EOOA 4DJ2A 4DV7L 2Y91A 1WTHA 5ELDA 5JJZA 1WD0A 4M3KA 1XA1A 3A3DA 2F3IA 4P6BA 4H6JB 1LTTD 3WRTA 2HHHQ 4JXSA 1L0DA 1G6ZA 4IOCA 5TR7A 4ODGA 3D9YA 2M1CA 1JQYD 2K7SA 1JWUD 2J3TD 1RDPD 2KEDA 1KL9A 3S16H 1OTEA 4LFBQ 4EEPA 1DGSA 3QIAA 4XTCS 4DV1Q 2R7ZB 1IW7D 4CGYB 2F0OA 2INWA 3I73A 4IUPA 4GN5A 4YY3Q 5C4JB 4OX9L 3QHYA 2KHJA 3Q6SA 3U9SA 1UWVA 3NBHA 1X0OA 4WM9A 1V9PA 3MVVA 1FOFA 4DF7A 4LNQA 4WLAA 4BBRB 1OTAA 3L0OA 3HL9A 4JYAQ 1IKMA 2M7VA 1L1OA 1M40A 3S17B 4OH0A 1PRQA 4XIGS 5D3IB 3P01A 4JI4L 3HFZB 2KEEA 2G2UA 3PSIA 1MJEA 2WKHA 2EA9A 3T1HL 1XJ2A 4OOMA 3KLSX 2PU4A 3T4JA 5M5XH 2CWAA 3M2KA 1IOUA 1Q1BA 5A92A 2LMCB 4GW9A 2NVTH 3A0RA 4JBFA 4NKPA 4HJ3A 4GLQA 1U4LA 2Y2NA 1Z09A 2D62A 2W3HA 1MKHA 1QJOA 3ZG9B 1AH9A 3DUZA 3KBGA 2HDSA 2B63G 2ZQDA 4H02A 4KZ3A 4MHEA 4WELA 3ZYTA 1PTOF 2Z2MB 3MQ0A 4L0LA 4R3BA 2VA0A 3EVQA 1CQVA 5EPJA 1UE5A 1MWTA 2ZL1B 5FO9B 3Q81A 2V1CC 3MXRA 4C3JH 3Q82A 1B70B 4B3ML 4DRTA 4DR3Q 2WZXA 1FCOA 4G7ZC 4WZ4A 1ERQA 1W63Q 4GOGA 2EXZA 3FWLA 2PD7A 4PMAA 5CGKA 3HLGA 3I3CA 5AQAA 4AIMA 3S14H 1SYDA 2PZTA 3VDYA 2A24B 4GKKQ 3IH8A 4HP9A 4EXOA 2F52A 1SNOA 4MN7A 3PO3G 1QVFA 4UP9A 2PYPA 4G3VA 5GHXA 3BFGA 4LPZA 4DNTB 3Q24A 1TEMA 1BZAA 1DOMA 2XQZA 1UEAB 3CUEC 4E04A 1S5DD 5FSRA 1QCBD 3E6ZX 3AU7A 3E4PA 1ES2A 3LR5A 1IBML 1LABA 1K38A 1SLJA 1P9RA 2V0WA 3SEBA 4A3KG 1H9RA 1I3QB 4B3TL 3OIQA 2UUCQ 2QYBA 1MGSA 2F0MA 1ZG6A 2W3FA 5F69A 4DJ3A 1CTMA 2P5ZX 4S3SA 1ASZA 2XD5A 3HLEA 1M90C 1QOHA 2OQ0A 5TFQA 2F0GA 3CCUA 3G4PA 4IN3A 5DM63 2QF7A 1Z9FA 4XT3B 2I72A 4FH4A 3LWUA 2VGKA 4BY1H 3HLCA 1OTCA 4QWOA 2ZJ9A 4KY5A 3BZKA 2JA7G 5DNFA 2IL8A 1GUSA 1K56D 3QO2A 1TS0A 4QY6A 3HOUH 2J7ZA 2V0UA 4CQHA 3T1YL 4GLXA 4R8IA 4CPKA 2PR6A 3EWKA 4F3LB 3QOJA 2DN8A 1WTRA 3NUCA 2UUAL 1VQPA 5ELEA 3IWQA 3NWSA 3X3NA 1CF0A 5D3OA 4NXML 5HFOA 5LMUQ 2Y2LA 3NECA 4PQXA 1IYPA 4HJAA 2BE5D 1O07A 3TOIA 3G6OA 5CC4A 4NETA 3K58A 4KY6A 3NEMA 4IQZA 3OTOL 3UB5P 1SFOH 3VMAA 3C46A 1PTOH 4GS3A 2EYJA 2SOBA 3UI2A 1PW1A 3GMWA 4JF5A 5FASA 3AFQA 4HBUA 3W8KA 1EIGA 3OYYA 4RKLA 1SKOA 3NK9A 4BL3A 4A3JH 3PUYA 3NHHA 1HNXL 3QP1A 3T12B 4EUVA 2QMIA 4U0XA 1A62A 3ONAB 3WOFA 4CHTB 1HR0W 4A3CG 1GHIA 3CQZH 4WJ3M 2B18A 2JE5A 4KHPQ 2HDLA 2L12A 4X64Q 2E75C 4YFMA 4IFDG 2D0OA 4CDDC 3ICYA 4LRXC 2R7DA 3MEHA 1QWYA 2PZWA 1AFPA 3VYSA 1YEZA 3DTKA 4PZ7A 3GTGH 1KVMA 5FA7A 3NENA 1PHJA 3U4VA 3I4NB 4X25A 3GTPB 1SHVA 2ASBA 4QPRA 4LF4Q 1YI2A 3HUOA 3N8LA 4G3WA 1E25A 2ZJPA 3RXXA 2NUPC 1VQ8A 5J22A 1Y1VG 3F1NA 1EEID 4OQHA 1LTSD 4MTKA 1KRTA 5KRUA 1K8AC 3C1EA 1GXDC 2FXQA 4DR7L 2I9VA 3IXBA 4MMNA 5HARA 2J9PA 3I72A 5EGTA 4EQPA 4OVDA 2E76C 1SDFA 2WB1E 2R93H 2E5LL 3SK5A 2XDMA 1XTCD 2DY8A 2K6AA 3HKZE 3NY4A 3C2PA 1GUWA 3CD6A 4LFCQ 2IT1A 4Y0UA 1TQOA 2Y2HA 1P9WA 3C4PA 4DAYB 4B9XA 3CC4A 3K59A 3K2NA 4HIMA 2C35B 5IHVA 3JVUA 1SMYC 1S66L 1P97A 5M5WH 4RYEA 4HJ8A 5ELFA 3J80i 2E2DC 1HD8A 4S2NC 2ZXOA 5KMWA 1PTOC 2UUBQ 4K91A 4JVZA 4Z9CB 2CQAA 2F3WA 3S1NH 3DBAA 2CH4W 1PH8A 1K3RA 1R4QB 5LMNL 1C48A 3E98A 5FJ8G 2Y79A 1RL2A 3OWFA 1VQNA 2OTJA 4P85A 4XT2B 1T9HA 3R2TA 1BLHA 4K5XA 2VGJA 5CEDA 1XJ3A 1ONLA 4R4QA 4A3EB 3EQVA 1ESFA 4RVAA 5M3FB 2EJGC 4OWXB 2NB0A 1ZTUA 2MHVA 3VE3A 1N36L 1PRTB 5HW3A 3E4QA 1FCMA 3NI9A 3D3RA 3M4OH 4JI0L 1PIOA 1DOKA 3UN7A 4QCLA 3H82A 4DV3Q 4OPYA 1SYEA 5C5LA 4GN2A 3NTKA 2A19A 1SE2A 2O4XA 3HS0C 4A3BH 1LTAD 1LUZA 2VS1A 5M3FG 3RN2A 1A0KA 3IQAA 2WUQA 3E4OA 1XPBA 3MMHA 3MS6A 4OQGA 1Y69U 1IHZA 5M5YH 3N6RA 2MJ6A 3CMAA 1TWGB 2K32A 2O5IC 3M2JA 1NUCA 1S4ZA 3A5ZB 3HOVG 1ODVA 4GNXB 3MZDA 3KJPA 2IHFA 3GTMB 2EFXA 5DEHA 2WGVA 2WIIB 1GHPA 3UDIA 1SDNA 1JJ2A 5BN4A 4E6WA 4ZLTF 5FI6A 4B88A 1WCMH 1PFNA 2K31A 4GKJQ 3KYQA 3LIEA 3F8TA 2JE6I 1G28A 1I6HH 2X6GA 1XP4A 2XROA 4LLOB 5IT9c 5GADC 4Q0JA 3RR5A 4X3SA 1GA0A 5AQBA 3RLFA 1U0LA 1G2SA 1CM9A 5HZHA 4DUYL 3E0JA 3V3SA 1H8MA 1WTOA 2CH4A 4GOPC 1CEGA 4DN4M 2RBMA 1QG7A 4XYOA 1QNUA 4TQUS 3JAMc 4POGA 2W27A 3UO9A 5L09A 1TF1A 2DUDA 3CPFA 1JE5A 3D8GA 2QDBA
chains in the Genus database with same CATH topology
2CFMA 3HKSA 4Q8IA 5CERA 3M3YH 4PZ6A 3CF5A 3GRJA 5BR8Q 2RCXA 2E8IA 3CAMA 3WS4A 4MBKA 2R7FA 1MWUA 3PCOB 1EQRA 2PI2A 3ZG5A 4JBMA 2OV5A 1H8YA 1HR0L 3HOXH 3GTJH 3GTLH 1YLPA 1RIPA 3RN5A 3HOWH 1FJGQ 1HNZQ 1QUQB 2R6GA 4X65Q 4AQYL 1BBWA 2VY3A 4A75A 4HIDA 1ES5A 4JF6A 4R1JA 3GSGA 1XNRQ 3BEBA 1A63A 2K14A 1A8VA 1WJJA 2Y0SG 1TWCH 1LL9A 3HUMA 4JLFA 3WWVA 4OLGA 1VQBA 4KQOA 3ZHHA 5F82A 3M6BA 2JC7A 3Q7VB 4OX9Q 5M1AA 4GN4B 1I50H 3UDGA 1W8YA 4A4IA 1J5EL 1K55C 2DRWA 3N4IA 3S17H 3S22A 1IYSA 2UU9L 3WS2A 1G68A 3T1HQ 3W1GA 1PH1A 5ELOA 2VW9A 1PH4A 1CI9A 3M6HA 2B63H 5IWAL 2NN6I 1KE3A 4IVIA 1V1QA 1HVBA 3A3FA 4B3SL 2UXBL 3ZNYA 4XUXA 3KLWA 1H95A 4WMCA 4C75A 4LCMA 3PO3H 4HJ9A 4B3MQ 4QJFA 4Z9QA 1O7IA 1MPLA 5E2GA 1E3UD 4GLVB 1ES4A 5E2FA 2WZZA 4A3KH 3S1MH 2PI2E 4O2DA 4A3GG 1JB7A 5FQQA 3OPHA 3J7A5 4NB3A 1IBMQ 1CSQA 1HZ9A 1YLJA 1I2SA 5C4XG 1ONGA 2JA7H 1S0WA 4FSFA 1C0AA 4JI1L 1J9MA 3LEZA 2Y55A 5IY0A 3HBRA 4OOLA 2OCEA 1IL2A 4YWLA 2K75A 1TVFA 4LV2A 3LCEA 4JCVE 3IWOA 3NELA 2FFYA 2A1AA 2QEXA 3T1YQ 5CEBA 5GLAA 2KENA 2Y2QA 5HL1A 5BOHA 1XX2A 1NYYA 2I5HA 2UUAQ 1KC8C 2K5HA 1K8GA 4NXMQ 2HP9A 3NBHB 2JEAI 1NRFA 3I56A 1N8RC 2WAQE 2ZTDA 2Z0SA 1DJCA 1L1OB 3OTOQ 5EPHA 1X56A 4S2JA 4NPSA 4WEKA 5EVLA 5A90A 3MBZA 1DJAA 3STBC 3IHBA 3CCRA 4R4IA 1R9TH 4OONA 4WZ5C 5DF8A 2GVAA 1HNXQ 2MNAA 4KZ9A 3KF6A 3BLMA 1OXVA 2QA4A 3OC2A 4YHHL 2JCHA 4OPZA 2N49A 4OXPA 3UDXA 2B29A 3G2YA 1Q8KA 5GLCA 1Y1VH 2V2FF 4NXNL 5FAPA 3ZG7B 3OCLA 2ZQ7A 3SS3A 1DY6A 1QMFA 2NZOA 3UY6A 4LF6L 3GTPH 3W4PA 3GQZA 1G291 3C5AA 3V3RA 1LHYA 2Y2IA 4DR7Q 2NN6G 4X62L 3G71A 2ZMAA 3GTCA