4OONA

Crystal structure of pbp1a in complex with compound 17 ((4z,8s,11e,14s)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2h-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid)
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
746
structure length
502
Chain Sequence
PLKVYSEDGKLISEFGEMTPELNAPYIAEMARAEMVGRYGSEAYTEGYKVITTVRSDLQNAASQSVRDGLIDYDQRHGYRGPETRLPGQTRDAWLKHLGQQRSIGGLEPAIVTQVEKSGIMVMTRDGKEEAVTWDSMKWARPFLSNNSMGPMPRQPADVAQAGDQIRVQRQEDGTLRFVQIPAAQSALISLDPKDGAIRSLVGGFSFEQSNYNRAIQAKRQPGSSFKPFIYSAALDNGFTAASLVNDAPIVFVDEYLTFLGPIPLREALYKSRNMVSIRVLQGLGIERAISYITKFGFQRDELPRNFSLALGTATVTPMEIAGAWSVFANGGYKVNPYVIERIESRDGQVLYQANPPRVPVEPTPAERIIDARTAYIMTSMLQDVIKRGTGRRALALKRTDLAGKTGTTNDSKDGWFSGYNSDYVTSVWVGFDQPETLGRREYGGTVALPIWIRYMGFALKDKPMHTMAEPPGIVSLRIDPVTGRSAAPGTPGAYFEMFKNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Penicillin-binding protein 1A
publication title Siderophore receptor-mediated uptake of lactivicin analogues in gram-negative bacteria.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
total genus 149
structure length 502
sequence length 746
ec nomenclature ec 2.4.1.129: Peptidoglycan glycosyltransferase.
pdb deposition date 2014-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
A PF00912 Transgly Transglycosylase
A PF17092 PCB_OB Penicillin-binding protein OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4oonA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oonA02
4H8RA 1E1TA 4P0MA 2ZM6L 4X65Q 2WB1E 1VQDA 2WGWB 1Y1VG 2NVYH 1L0GA 3IWQA 2XD1A 3K8AA 1XA7A 2R93G 1NY4A 2E8IA 2VGKA 1QUQA 3G71A 4K91A 3SH8A 4P73A 4NB3A 5HFOA 1VQIA 1K83H 3H0GG 5FAOA 2WGWA 1GHPA 1SDNA 4JXVA 1Q2PA 4EQIA 1I50H 2R6GA 4PG3A 3A5UA 3CCLA 1IYJB 1VQHA 2OTJA 1MJCA 1YHAA 1S72A 3U4ZA 4X6TA 1SKFA 3PAEA 2DNSA 5CTMA 5FJ8G 2K5HA 2XR0A 5BOHA 2QGQA 3HUOA 3S22A 4QY5A 1YLJA 1PFSA 1KGGA 1Y1WG 1X54A 4AYBG 4YHHL 5AJ3Q 4LNQA 1KC8C 5DTSA 4LFBQ 3WS0A 4DAYB 3OW2A 2WP8J 2BA1A 1HZAA 2LXKA 3FKWA 2VGJA 5KSHA 4YCUA 1K6RA 3A3IA 1PHJA 1DJCA 4OWXB 4LF4L 2JA8H 1HVBA 4WZ4A 1LL9A 5A91A 1VQBA 1OXUA 4HBUA 4A3DH 3TOIA 3G4SA 4EBNA 4Y0TA 2OWOA 4JI4L 4IPCA 4MNOA 4JI3Q 2VNUD 2PI2E 5JYPA 2V20A 1NRFA 1EFWA 5HAPA 4DE3A 4DV2Q 3GQZA 3JAMi 2YTYA 3G2YA 4DV5L 3B6YA 5C0XG 1K57A 5IT9c 4XUZA 3OCNA 3I4OA 3GRJA 1OXXK 4X65L 2HQLA 3BM6A 1KD1C 4GN3B 2L15A 2IY5B 1A62A 1J6QA 1E7ZA 1OXSC 4GN5A 1S3OA 1FSWA 1Q1BA 1S40A 1CSPA 2WYXA 1Q46A 3J81c 4HJ5A 2I5LX 3A3JA 3AQQA 2Y2KA 3P09A 4OPZA 4QY7A 4JI0Q 3KFUA 3S16H 2OQKA 4A75A 2J7VA 3V3SA 2OTLA 1MBLA 2XLNA 1IELA 5HL1A 2OV5A 4R23A 1HNZL 1NJIC 3WRTA 3OPPA 3MBZA 3G30A 2I72A 1EQRA 4LWCA 1ESIA 3UDFA 3CXCA 2PU4A 2CC1A 1QVGA 1XGJA 3MZFA 5E2EA 3CCSA 3BLMA 1DGSA 2UUAQ 3L2PA 3OYYA 5IHVA 4LFBL 5C3EH 3VP1A 3E2LA 4GS3A 3J7A5 3V50A 2HDSA 1XNQQ 1UE7A 3S1RH 1TWHH 4DK6C 2A8VA 4S2NC 4R1JA 5JJLA 2HHHL 4R0QA 4DXCA 1LUZA 2KENA 1IEMA 1UWVA 4R4CA 4AIMA 1BUEA 2IHEA 4YINA 1Y54A 1R9TH 3ERSX 3OTOQ 3AYHB 4P6BA 2N8NA 3M6BA 4DV1L 4UP9A 4BD0A 3A0JA 3OZHA 1VQAA 3PBRA 2RCNA 1WFQA 3CCQA 1NZUA 3FZCA 5GHXA 4Q8IA 4DV4L 1VQJA 2Q9MA 5EPHA 3A3FA 1G68A 5BR8Q 2HDRA 1VQFA 4GOPC 4JKTA 4DDSA 1NMGA 1VQEA 3IHAA 3UPNA 4H02A 1ASZA 2FFFB 4UY8C 4OQGA 1S6RA 4BA2I 3RXXA 2OCEA 5JYOA 4LFAQ 1PH2A 1H5XA 3HLBA 3HLFA 4LV2A 4KZ5A 1HZOA 4KENB 4Z9QA 5FLMH 2B5RA 4JI0L 3RXWA 4P74A 5HW3A 4A3JH 3T1HQ 1VQOA 3VFHA 1P8LA 4HIDA 5DF7A 3DLLA 5E2HA 2MNAA 3BZCA 1B7YB 1VQNA 4OOYA 3W1GA 4LF8Q 3I4MH 2GN5A 5GLAA 4BY1H 4JI1L 1K9MC 5FAPA 3HOZG 2IWDA 4DR2L 2UUAL 1NJ4A 4R1GA 2VQFQ 1Q81C 2YU9H 1Q2QA 3JYIA 4P72A 1KQSA 1MJEA 3EQVA 5TGFA 5CXWA 4IJHA 2QZ6A 4L5TA 3CPFA 4PMAA 4MEZA 1C7YA 4YCVA 2IX1A 4S2NA 4L5SA 3RN5A 5GLCA 3G35A 4OQHA 4GOPB 1Q7YC 5C0XJ 1JT8A 2R92H 2QPNA 4P75A 2H0TA 3OTOL 4WMCA 2RHQB 4IPDA 5FSRA 4GLXA 3GTJH 3VOYA 3QNCA 2R7ZH 5TR7A 3RZOH 3MEFA 2JA7H 4P71A 4N1HA 4DV7Q 5BR8L 1Z47A 4OQ0A 4ZTKA 1BKBA 1TWGH 2JA5G 4GOPA 1OXTA 2GDNA 3HKSA 1YLYA 2H5XA 1BVSA 4LF6Q 1YLWA 2WKIA 4IPGA 2WAQE 3C4PA 3QNBA 1JTGA 3I7FA 1HR0Q 1ZC2A 3ISGA 5C4XG 4LFAL 3UDXA 4NXMQ 2F3IA 4JBFA 2PNHA 1GCEA 3I4NH 4JI7Q 1W8YA 4PM6A 2RHSB 3S1QH 4OH0A 2Y2IA 2X02A 5FQMA 3FKIG 4N9KA 2Y2NA 5HX9A 5CHUA 4EBPA 1ES2A 2XD5A 4NETA 1C9OA 3T1HL 3MXNB 4CPKA 4A5RA 2B29A 4JOIC 4EX5A 3HUMA 4OPYA 4NXNQ 3DW0A 3EQUA 2HP9A 3OCLA 4N9LA 4QGUA 1H8YA 2K5VA 1ONGA 3B3XA 1K4FA 4GDBA 4L0LA 4IEDA 2UWXA 5HAIA 1WCMG 3I56A 2B63H 1BLHA 2AKWB 2JA6G 5IP9G 4YY3Q 3MKEA 1BULA 1FQGA 3KLWA 1PH8A 2VQFL 2HDUA 3G6EA 2Z2MB 5C4JH 1W5DA 2ZC4B 4B4XA 2XF3A 1J5EL 1GVPA 1W2BA 1FSYA 3UNWA 1KAWA 4UPAA 4GLVB 3PUWA 3CCUA 2R7FA 1N36Q 4LENA 1KE0A 4X68A 1NTGA 3HOXH 1PIOA 4HBTA 4LFCL 1L2SA 4PMWA 1EOVA 4IBRA 4E3NA 2CKZB 1TWAH 2BG1A 4LF5Q 4B3TL 4JF6A 4GB7A 4OPRA 2A3UA 4DV6Q 1FOFA 3AGFA 4KG6A 1IYPA 1I3QH 1PH5A 2WB1G 1Q12A 2YYZA 1CK3A 3DWZA 3VSKA 4DV7L 4N1XA 5IYCH 2BH2A 4GKJQ 1NBWA 4DR3Q 2PBYA 3MXSA 2Y2GA 3NEMA 4LF6L 5GQOA 1PVOA 3HLEA 2EQSA 2Y2OA 3H3VH 3BFEA 1HR0L 5H1SE 1RGYA 2NVXH 1W3SA 2K52A 4JI7L 4X64Q 3ZVWA 1WYDA 1ES3A 3RLFA 3JAMc 4LCLA 1N9BA 4WMCD 2J8YA 3IF6C 1G6AA 5LMUQ 4O0AA 1NYMA 2AMCB 1Q86C 4A93G 4JOIA 4KHZA 2ZJQA 1X3FA 4MZ9A 1YT4A 3PSIA 2G2UA 1PH4A 1B70B 1X55A 5IWAQ 4B3MQ 3CD6A 1KGFA 4BY7G 4GLAC 1PI4A 4YY3L 3HOYH 2ZM2A 3VMAA 3T1YL 4A3GH 4OX9Q 2QMIA 4LV3A 1K56A 1V1QA 1WE4A 3LEZA 1OXVA 3OC2A 3SGIA 3HVFA 3CJMA 2XTIA 3SOIA 3CP0A 1K38A 1QVFA 1NZOA 1HD8A 1N36L 3A74A 3CC7A 3PV0A 4UA9A 4IVKA 2XQZA 2EX6A 2Q2IA 4DK3C 2VUMG 2Z2LB 4LF5L 2ZQ9A 5CHMA 1MIUA 2E2JH 4FCFA 1K4EA 2VS1A 3C4OA 5I94A 4DV6L 4FH2A 1A63A 1AE2A 2UUBQ 5FAQA 3W4PA 1CSQA 5EAYA 4QJGA 3Q82A 2ZM8A 5KZHA 1N33Q 3A5ZB 1K25A 4A3BG 4BBSG 2NN6I 1IYSA 1FJGL 3K0XA 1YJNA 3IF6B 3IXDA 1RCJA 2JC7A 1M90C 1O7IA 3N7WA 2OLUA 3UE3A 3S1NH 4DV3Q 4S2IA 4BD1A 3STBC 5E2FA 4O7DA 3PGZA 1L1OC 2Z6KA 4S2PA 3NY4A 4AQYQ 4BJPA 4K0KL 1G51A 3IQAA 2Y2JA 3CCJA 1KRSA 1KE3A 1U60A 1MWSA 2H10A 4B4ZA 3IXGA 3VOZA 4KZ3A 4C3IH 3LY3A 1VQ8A 3HBRA 4KZ6A 4RYEA 2NZOA 3HOUH 2Q9NA 3CPWA 1GD7A 3LCEA 2VZAA 3GV9A 3IH8A 1DJBA 5IWAL 4B3ML 3W8KA 4A3EH 4POFA 2ZC6B 2N3SA 1GHIA 1LTLA 1MKIA 4JG2A 1M40A 2IWCA 2ZC5B 4GNXC 2D62A 4JI6Q 2OLVA 3UN7A 4QY6A 4X69A 3E9IA 1J9MA 1CKOA 4J15A 3E2KA 4DRTA 4APVA 1N34Q 1V43A 2GVBA 4DKIA 1PH3A 4Y52H 5CHJA 3PO2G 5DF8A 1X6OA 3L0OA 2F4VQ 4OO1G 1JWPA 4KLKA 4JBWA 1PZOA 1UE1A 5FA7A 1SHVA 3GTMH 4JF4A 2WAEA 4JPMA 5AQ9A 4E6XA 4HJ7A 4S2KA 2RF4A 4PZ7A 1LI9A 1K56D 1L1OB 1N33L 4R4SA 4A3LG 4E3JA 1JTDA 4RX3A 5HAQA 4IO9A 3H3VI 1Y1VH 1YEZA 3DWKA 2UU9Q 4B3RL 1MWRA 1QVCA 1N32Q 1CKNB 1O7EA 4ALPA 3M4OH 4PM5A 4DV3L 4LW1A 4POGA 2R93H 4R4RA 2Y0SG 3SS5A 4EV4A 2ZJPA 1BLPA 1VQ6A 1LHYA 1FR1A 1H95A 3N6IA 4ZJ1A 5DTKA 1PA6A 4AQYL 3H0GH 1FL0A 4QB8A 1XTDA 1BBUA 4JXGA 3G48A 2R9XA 3SH7A 4OXPA 1CKMA 2ZTEA 3Q1FA 1CKNA 2V1CC 3V3RA 4GNXB 2Y4AA 2B3GA 5FJ8H 1D8LA 2V1ZA 5FQJA 3GTGH 2WFWA 3RLOA 3SS4A 4KZAA 1NY0A 2Y91A 5LMNQ 3PBNA 1YHQA 1BLCA 3HKZG 2ZQAA 3CC2A 1X9NA 5IYDG 1LL5A 3PBQA 2XGNA 1P16A 3N8RA 3D31A 1Y1WH 3GTCA 4QU3A 1WJJA 4NPSA 5FI6A 4HIKA 2EX9A 1XPRA 1GHMA 4JI6L 4GNXA 4A3KG 2ZTCA 1BLSA 3KF8B 4BXXG 1X65A 3RLNA 5CGWA 1XMOQ 5AJ3L 3TS2A 3UE0A 3G31A 5CGSA 2Y2QA 2MO0A 1E25A 2OSUA 3PIPA 4OWWB 3ZG7B 3ZNYA 2F4VL 1EUJA 2HT1A 3LGJA 3HLCA 1XX2A 2FXQA 4JI3L 2ZM0A 3CMEA 4JC0A 1EWIA 3PF5A 2WAFA 1HTZA 3KF6B 4UA6A 3GTPH 3C7VA 1JB7A 2WAQG 3S24A 4DV2L 3HFZB 4YWKA 4P85A 2DCFA 1PYYA 4A3FG 1K6SA 2UU9L 3EIVA 2K4KA 3GTQH 4HESA 5EECA 4BENA 4LV1A 1XPUA 4DNIA 3M7NA 4PZ8A 3FKVA 3PUYA 3FHWA 2ES2A 3ZHHA 1IBKQ 4U0TA 3KF6A 4ZJ2A 4A3CG 4QHCA 2UXCQ 1SN8A 2I0QA 1VQGA 1VQLA 1E4DA 4OP5A 3K7AH 1QZGA 4X56A 3M6HA 4IPHA 3CF5A 1AE3A 5M3MG 4JBMA 2K50A 5AQ7A 3ZDJA 4DR1Q 5HARA 1YI2A 1HR0W 4RX2A 1UEBA 4DE2A 1TXYA 5IP7G 3PIOA 2EFXA 4WELA 5LMNL 1IYOA 4IFDG 2DUDA 4GN4B 1SCWA 1LI0A 4QJFA 4DXBA 5JEAG 1K8GA 4Y0UA 1K0RA 3BEBA 4DKAC 2EFUA 1QMFA 4GKUA 4XIGS 4JI5Q 2EIFA 4KZ7A 3STBD 2JBFA 3KJPA 3P98A 3UO9A 4IVIA 2WGVA 3VP2A 2JEAI 3CZDA 4KI0A 3GSGA 1HJPA 3L7ZC 4OLGA 3N8SA 2X01A 4JI8Q 1L0EA 4OOMA 1XNQL 5IY0A 5EUAA 3BJUA 3G34A 2ZJRA 3LO7A 1BSGA 3OPRA 2AWOA 1KVMA 3HL9A 3UDGA 1V9PA 3VSLA 2ZQ7A 5M5YH 4UA7A 3Q7VB 2R9WA 4KQOA 1VQPA 4PPRA 1GA0A 5M3FG 4UHUA 5TFQA 1KE4A 3BECA 2Y2HA 4QD4A 4MBKA 1E3PA 4LUOA 3F8TA 2Y2LA 4E3LA 5AQBA 3MZEA 3PUVA 3PO3G 1TDGA 1MXOA 4E3IA 2VL6A 2HPBA 3AFPA 3TQYA 2E8GA 3C5AA 1VS0A 1JE5A 1AXBA 5EOOA 1SRUA 1L0DA 4RG1A 1HZCA 4DR1L 5M19A 1YLZA 4GD8A 3IWIA 4B88A 4MTNA 4UP8A 1MWTA 4YWMA 2ZLYA 3TG9A 2Y2PA 2RL3A 4OONA 4GD6A 4KZ8A 4Y7PA 3CAMA 2D0PA 3HOZH 3HLWA 1HNWQ 5IYBG 4BBRG 3O87A 5GADC 4JI5L 4OP8A 4LF8L 1IL2A 4S2LA 2H0YA 3NBLA 4X66Q 1KXLA 3FP9A 3TRZA 4HIMA 4FDBA 1XJVA 1RIPA 3M3YH 4M3KA 2XK1A 4DUZQ 2NVTH 5J3BA 1BTLA 1FGUA 3F2DA 3M4PA 3WS5A 2DRWA 3NENA 1U5KA 1XA1A 1VM1A 3AGDA 3AGEA 3OPHA 3PAGA 4EWFA 2IHFA 5C44G 3D0FA 3S15H 1CEFA 3HLGA 3MZDA 5G18A 2NVQH 4R4TA 3HLDA 5C0XI 1YHBA 2KCTA 3AFQA 2KCMA 4WJ4A 2PQAB 1IBLQ 5ELOA 1L0WA 1KGEA 3IF5A 2JA5H 1H8ZA 4BL2A 1VQ4A 5GLDA 4P87A 2ZC3B 5HY6A 4JF5A 1I94Q 4WEKA 4WBGA 2KHJA 3U50C 1TEMA 1WI5A 1PZPA 3UPPA 4OPQA 5C4XH 3CC4A 3HOVG 1N4OA 3IXHA 1JWZA 4O2DA 3GO5A 2Q2HA 4B3RQ 4A3MG 1HZ9A 2YV5A 1WOCA 1BT5A 4IBXA 3FKIH 4GOGA 1OMEA 5FQKA 1VQ5A 3PCOB 1XP4A 2ATWA 4NXML 4IFDJ 4U3TA 3GTLH 1FVIA 1FCMA 2FFYA 5JEAJ 4A3IG 4OLDA 2MQHA 3NI9A 4WZ5C 4KZ4A 2VW9A 3M2KA 2E2HH 2KBNA 1L0FA 3WS4A 1WCMH 1FR6A 3J80i 1B8AA 1TWFH 5GLBA 2Q2UA 3O88A 4NXNL 2JA6H 5IP9H 3ITBA 1HNWL 1VQMA 1T9HA 2VY3A 1PV4A 4DR6Q 3HOWG 4KZBA 3E9HA 5GL9A 3PTEA 3WRZA 2ZJ9A 3VDYA 4C3JH 4X66L 3FV7A 3NDEA 4HJ9A 4C3HH 4QL5A 1LYLA 2C6WB 2AHOB 4ME3A 2P74A 2Q2TA 4F94A 2J9PA 4FSFA 2JE5A 3KYHC 4KG2A 2I5HA 1YIJA 5GHZA 2JQOA 1N8RC 4X62Q 3GMWA 4QQBX 3KDFB 2ZD8A 4LUVA 5FATA 4Y7NH 1BZAA 3C7UA 4HJAA 1IBLL 1PWCA 3NIAA 3ZG8B 4IJLA 3WWXA 1DY6A 1I94L 4YHHQ 1YLPA 2UUCQ 1KVLA 2HDQA 3KDFA 4JYAQ 2N49A 1IYQA 3BFCA 1XNRQ 3FYZA 4GKJL 2WKHA 1PH1A 4DR3L 1NE3A 3K81C 3E0EA 5DVAA 2R7DA 1YJWA 1CI8A 1IBMQ 1A8VA 2ZTDA 1VQQA 1A0IA 2HIVA 2JK8A 2EXBA 3VFFA 2JA8G 4DR5Q 1SE8A 1EIFA 4X64L 1TVFA 2A49A 2ZQCA 3W4QA 4A93H 4A3DG 5CTNA 3S4XA 3RZDH 3NC8A 1E1OA 1MWUA 5E43A 4WZ5A 3VP3A 3GD7A 4A76A 1YLTA 4BA1I 1SLJA 5GAHC 3CCVA 5E2GA 5LMUL 4OOLA 3IF6A 3ZG9B 4DV5Q 1QUQB 4DAMA 1PH9A 4BY7H 1BBWA 3TEHB 1K55C 1ONHA 1YNXA 3IRBA 4DUYQ 4DR6L 3IWOA 1GO3E 3A3EA 1ZG6A 2HIXA 2QEXA 1SROA 2XGTA 3NCKA 4RA7A 4WEJA 3VP4A 3IHBA 3A3DA 4OX9L 5FQIA 5LMNW 3ULPA 1I5FA 2Y2MA 1U0LA 2VUMH 1ESUA 2WUQA 3VP0A 4YWLA 4X62L 4DR7Q 3BFDA 1N9WA 1ZKJA 2HP5A 1UE6A 1HNZQ 4L5RC 1PYBA 3U4VA 1RP5A 1WYCA 1Q82C 2CFMA 4GNUA 4B3SQ 2P9VB 2V2FF 2XH9A 5M5XH 2IX0A 4LF7Q 1Z6FA 2CCZA 3ZJYC 4EQ5A 1VCIA 2QA4A 3ZNTA 4A3BH 4BBSH 3CQZH 4OVDA 2ZMAA 1ERMA 5DLQE 2UUCL 4WYYA 2UUBL 4JYAL 1L2FA 3WS2A 1XNRL 1VQKA 5GROA 3GDEA 1YM1A 3G4PA 2I5MX 2WGIA 2P9VA 2J9OA 5M5WH 1SFOH 3UE1A 2HHHQ 3WS1A 1IBML 5C3EG 1SDEA 3PUZA 1XKZA 1TDLA 4E3MA 3CCRA 3SH9A 4PM7A 4PM9A 3H15A 4DR5L 2JA9A 5GAGC 5JJKA 4DV1Q 1L1OA 1E3UA 2UXBQ 1GKHA 4DV4Q 1YMXA 1IKIA 3M2JA 3RN2A 1W7FA 1TWCH 3UDIA 2UXDQ 1Q1EA 5DTTA 1K55A 4EUZA 1E24A 4DUYL 4TVAB 1ASYA 1VQ9A 3HREA 3BFGA 1GM5A 1HNXQ 5FI2A 5KSCA 4JBJA 5A90A 4X55A 4ZBEA 5FQ9A 5HGQA 1HH2P 4R3JA 3RR5A 1Y14B 1FCNA 1DJAA 1D7QA 4YCWA 3W5OA 3PO2H 4DR7L 3K80C 1N34L 1W79A 1SMXA 4YFMA 5FLMG 4A4IA 2G2WA 3NBHB 5CEBA 4B3SL 4A3JG 1EYGA 4BL3A 2OQ0A 4DV0Q 4ZAMA 4FD8A 4JI1Q 3Q81A 4LF7L 4C75A 4IOCA 4A3LH 4DR2Q 3JC66 2EXAA 2C35B 5GAEC 5M1AA 3S1MH 5CERA 4C3QA 1PH6A 2N78A 1KHIA 3IXBA 4L5QA 3I4MG 1XPBA 3F1ZA 2MFIA 1EI5A 1W8QA 4BY1G 2Y59A 4JCVE 4K0WA 3F2BA 1WYBA 4WM9A 3WWVA 1ES4A 3ZCZA 1YVCA 3N4IA 3SS3A 3ER0A 1EROA 1K54C 4R3BA 3J7ZC 1JMCA 1I5QA 3D4FA 2A19A 1SR3A 1N32L 2VQEQ 4AYBE 1I6HH 1KIXA 5EVIC 3K7UC 4IOAA 3EN2A 2LXJA 2XFTA 1MKHA 2UXBL 1EWZA 4S2JA 3ZG5A 4KQRA 2JE6I 2R92G 5ELNA 5GHYA 1KDSA 2K14A 1XMQQ 3ZG0A 5IYDH 2UXDL 3NDGA 4Y0OA 2R7ZG 1PH7A 2Z0SA 1I2WA 2JA7G 1HNXL 3GR2A 1YMSA 5J8XA 1Z9FA 4A3KH 4BLMA 1YJ9A 4BXXH 3Q07A 4DF6A 4QIWE 4CJNA 2NN6G 3S14H 1JJGA 2Y0SE 3GTOH 2X71A 3J80c 3RNUA 1E3UD 1YZ6A 4NK3A 3I4NG 2PU2A 1XGIA 1XMOL 1M1KC 4C2MH 5CECA 3I55A 2D0OA 2H5SA 1PW1A 3O86A 3PUXA 4FH4A 4MLLA 1YITA 3TREA 4DV0L 2YTXA 3ZFZA 4DPGA 2RCXA 3HUNA 4MBHA 4D2OA 4UAAA 4PM8A 3QHYA 4E6WA 1IKGA 4JXWA 3HKZE 4KQQA 4A3FH 4DDYA 2E2IH 2B63G 1M6KA 3MKFA 5L2FA 1MPLA 5U47A 5EVIB 1J5EQ 4XTCS 1O07A 3BU2A 2MO1A 3CG5A 2EX2A 1ZG4A 3ZGAB 3PF4A 2LSSA 5FLXc 2WADA 2WKEA 4ZDXA 1JJ2A 2YTVA 4A3CH 4JV5Q 1K54A 5JJIA 2VQEL 4LFCQ 4HIOA 3J81j 3UY6A 3PBOA 3CCEA 1S0WA 1YQSA 1JWVA 3Q7VA 3GVBA 4B3TQ 2ALYB 4GDNA 1IBKL 5M3MH 5EVIA 4KZ9A 3PBTA 3CMZA 2UXCL 2BLSA 3HOXG 3W4OA 4MBFA 5EOEA 2K5NA 3IH9A 5IP7H 1XMQL 4XUXA 2CWPA 1C3BA 3TSGA 2Y55A 1KL9A 4LV0A 3J81i 1XXMA 1VQCA 3BYDA 5CRFA 2IT1A 3N8LA 4S2MA 5A93A 3O3VA 5D3OA 5IYCG 1GA9A 1PW8A 5M18A 1QMEA 4XXRA 1PWDA 1NXYA 3ITAA 3S17H 2BA0A 1NMFA 4HJ8A 4AH6A 2GVAA 4EBLA 4DE0A 5E7NA 5F1GA 4OO1I 1CUKA 2EXDA 3M85A 1KDWA 4RMFA 3NELA 3IT9A 4C6YA 4GKKQ 1FCOA 1X3EA 4E3OA 3GTKH 1EQQA 4JI8L 5A92A 1X56A 2C5WB 3F2CA 4RVAA 1LM0A 1NYYA 4OKPA 3LY4A 1K8AC 5CEDA 3Q7ZA 5M3FH 4ID4A 3T1YQ 1CI9A 4U0XA 5IE8A 2E5LQ 1VQ7A 2CQOA 4ZJ3A 4R4IA 2WZZA 3Q8DA 5EVLA 1G6PA 2F52A 3EBEA 3HOYG 4KHPQ 4X53A 2JEBI 4A3GG 1C0AA 4E3KA 3PO3H 3TS0A 3U58A 4JV5L 3BRMA 1QZHA 1IZ6A 5DF9A 4R4OA 4LF9Q 4OWTB 1OTCA 2ZQ8A 5FASA 3AEVA 2PQAA 3BLSA 1X3GA 3ULLA 1K73C 1HZBA 3ZVTA 1JVJA 5AQAA 4JI2Q 3I2ZA 1K3RA 2JCHA 1XPOA 2CWAA 1YBYA 4DR4Q 3M4QA 1PYSB 2NZHA 3BZKA 3W1BA 3KJOA 3OPLA 5IYBH 4BBRH 1RL2A 1FJGQ 5KMWA 3FWLA 2XDMA 2HP6A 4OQIA 2ZM6Q 5FI7A 4PZ6A 2Z6KC 5K36G 2A1AA 2ZQDA 4K0XA 1ERQA 1ES5A 3ICEA 3G32A 2DGYA 5EVID 4K0KQ 3PBSA 3ULJA 1KRTA 1I2SA 4TQUS 3DM3A 3MXRA 2EX8A 2ID0A 4MNRA 5C44H 1IXRA 4GKKL 4UP7A 3DTMA 1ALQA 4DUZL 1MY8A 3V5MA 3RJUA 1E22A 3M9BA 4BQMA 5F83A 4LUZA 3KOJA 5FQQA 2PMZE 3S1YA 5CGXA 4WJ3M 3CMAA 4DE1A 3CCMA 4X6AH 4JXSA 2XFSA 3HOUG 2E5LL 1LLBA 2KHIA 1AH9A 3MFDA 2WZXA 4R4QA 3S2DH 1PI5A 4A3EG 3HOVH 4KHPL 4LCMA 1G291 1PWGA 2XEPA 2ZC7A 4A3MH 4GN2A 2AWNA 3CW2C 1CEGA 4JLFA 4N92A 1JJCB 4LF9L 3V39A 4LF4Q 3BFFA 3I7JA 4A3IH 4JBKA 4KG5A 1RGZA 4S2OA 2K75A 4GZBA 5EE8A 4JI2L 1UE5A 4JI4Q 5F1FA 4IFDI 1Q8KA 3UPOA 4DR4L 4HEFA 2JJQA 2BH8A 5F82A 3S2HH 1EIYB 2ASBA 2PI2A 3G2ZA 5FDHA 2IWBA 3HOWH 2WK0A 1K57C
chains in the Genus database with same CATH superfamily
2IW3A 4H8RA 2R78A 1E1TA 5COYA 4ARZB 2K32A 4P0MA 1II3A 2ZM6L 4X65Q 1TY0A 2WB1E 1VQDA 4O1NA 3UI2A 1G2TA 2WGWB 1D06A 5C5LA 1Y1VG 2NVYH 4NKLA 4EQPA 1L0GA 5ELBA 4PAUA 4R9WA 3IWQA 3MWYW 1ZYRD 2RA4A 1XTCD 2JA8B 2I46A 2Z1CA 2XD1A 2ZMVA 3K8AA 1LTSD 1XA7A 3C2PA 4CLCB 3TP7A 2R93G 1NY4A 4A3DB 2E8IA 2VGKA 1JORA 3BJNA 4ARZA 1QUQA 3G71A 4K91A 3SH8A 4P73A 2IJ0A 1IYVA 4CJ2C 1Q8IA 4NB3A 5HFOA 1VQIA 1K83H 1NLYA 3H0GG 5FAOA 2WGWA 1R4PB 1GHPA 1SDNA 4JXVA 1Q2PA 4EQIA 5TBMA 1I50H 2R6GA 4PG3A 3A5UA 3CCLA 1IYJB 1VQHA 3NE5B 1EY9A 1MJCA 2OTJA 1YHAA 1FIKA 1S72A 4RWSC 1BNZA 1EEID 1Y1VB 3DTIA 3U4ZA 1A0KA 4X6TA 1SKFA 3PAEA 4CLCA 4UDUC 2DNSA 2P7JA 5A2QL 5CTMA 5FJ8G 1Y8PB 4K5VA 2E8JA 2K5HA 5KGUA 2XR0A 4I38A 2EOTA 2QGQA 5BOHA 2J80A 3HUOA 3S22A 4HMJA 4LJZC 2R93B 1H9SB 1SYBA 4K6LA 4HOIA 5DNFA 3TW8A 1HUNA 3KSIA 4QY5A 1YLJA 1PFSA 1KGGA 3LI9A 5I9OA 5HURA 5C4HA 1Y1WG 1VMCA 1X54A 3H0GB 1QWYA 4AYBG 4YHHL 3A56A 5AJ3Q 1KC8C 4LNQA 4LFBQ 4I3IA 4DAYB 5DTSA 2NZ1D 5CR3A 1SKOB 2V8FA 3WS0A 1KDBA 2WP8J 2BA1A 1HZAA 2LXKA 4JW0A 3OW2A 1OTDA 4YCUA 2VGJA 1K6RA 3FKWA 5G4YA 1EWHA 3A3IA 3GP7A 1LABA 1PHJA 3KLSA 1DJCA 4OWXB 4LF4L 2JA8H 1HVBA 4WZ4A 4X3TA 1LL9A 2JKFA 5A91A 1H9SA 5IT9L 3S16B 1VQBA 3GTGB 1OXUA 3A0VA 4HBUA 4A3DH 4HI4A 3TOIA 3G4SA 2HV1A 2W3EA 2B2UA 5EQ0A 4EBNA 4Y0TA 5G3LD 2OWOA 4NXBA 3DEPA 4G57A 4IPCA 4MNOA 4JI4L 4JI3Q 2VNUD 3OPOA 2PI2E 5JYPA 2L5TA 2V20A 2F0GA 1NRFA 1EFWA 1JE4A 2AVXA 5LBRA 2XIWA 1ML0D 1PNEA 5HAPA 2JN7A 2F0UA 4DE3A 3NOUC 5LL6S 4DV2Q 3FMCA 1EU3A 5DAUA 3V2TA 5A2QE 3J81L 3GQZA 3JAMi 3NTHA 2OWHA 2YTYA 5IU1A 3G2YA 1ENFA 4DV5L 3B6YA 5C0XG 1K57A 5CV4A 1PZJD 5IT9c 3DAVA 4B08A 4XUZA 3OCNA 3I4OA 3GRJA 1OXXK 4X65L 4IJGA 2AUKA 2HQLA 3BM6A 1KD1C 4GN3B 2L15A 4HY8A 2A69D 3QB3A 4XQNA 2IY5B 1CZGA 1GHJA 1A62A 1J6QA 1KLUD 4MMNA 1E7ZA 1OXSC 3S1RB 3AU7A 1IHZA 4GN5A 3RD4A 1S3OA 1FSWA 1GUTA 2O9CA 1Q1BA 1S40A 1N9LA 1CSPA 3MXPA 2QCPX 4G4KA 3MAQA 1Q46A 2WYXA 4ZAIA 3N52A 3J81c 4HJ5A 3PHYA 4XT2A 4BBVA 2I5LX 1LSWA 1DM0B 2EJGC 3A3JA 1R9TB 3AQQA 3H09A 4FP5D 2Y2KA 3P09A 1LL8A 4QY7A 2JXMB 4JI0Q 4OPZA 3KFUA 3BVZA 3S16H 1XFNA 2OQKA 4A75A 4NXGA 3NP8A 4CLCE 1P9RA 2J7VA 3V3SA 2OTLA 1MBLA 2XLNA 1K0SA 1IELA 5ELCA 1EYAA 5HL1A 2OV5A 3KYQA 4R23A 5FEGA 1HNZL 1NJIC 3WRTA 3OPPA 2EYOA 3MBZA 1I4PA 2X69A 4U673 2PHYA 3JPUA 5JJZA 2Z9HA 3GQBA 4Y15A 5HPIA 3G30A 3LR5A 2MJ6A 3QWNA 2I72A 1TD5A 1EQRA 4K2KA 1P0ZA 1V9ZA 1XJ4A 3SZTA 4LWCA 4R3AA 1ESIA 2O0YA 5IGFA 1EIGA 3UDFA 1SSOA 3CXCA 2PU4A 4L9GA 4Q0IA 2CC1A 2YKFA 1QVGA 1XGJA 2L1MA 5HD5A 3BWLA 3MZFA 5E2EA 3U9SA 3CCSA 3B47A 4FVMA 2Q8IB 3BLMA 1DGSA 3C1EA 4KN7C 2UUAQ 5J22A 1YSQA 3L2PA 3OYYA 4O8GA 5IHVA 4LFBL 3UMEA 5C3EH 3VP1A 3E2LA 4GS3A 5CV6A 1LT5D 3J7A5 3V50A 2HDSA 1XNQQ 1UE7A 3S1RH 1TWHH 4DK6C 2A8VA 3D8GA 3LIDA 4S2NC 4I5SA 1B3AA 2PAVP 3MR0A 4R1JA 5JJLA 2HHHL 4R0QA 4DXCA 4B9OA 2VX8A 1WTRA 4UEYA 1LUZA 2KENA 1ZXTA 2DY8A 1NLZA 1K3BC 4G7ZC 1IEMA 5HGTA 1UWVA 4R4CA 3DWPA 4AIMA 1RDPD 2IHEA 3MFYA 1BUEA 4MCWA 4YINA 1Y54A 3D3RA 4CLCD 1R9TH 3KUPA 5KIZA 3ERSX 3OTOQ 4F7XA 3IBJA 3AYHB 4HAEA 4P6BA 3BDLA 2N8NA 1O78A 2A5HA 3C38A 4DV1L 3M6BA 4UP9A 4BD0A 3A0JA 3OZHA 3PR6A 4JGOA 1VQAA 1YKDA 3I4MB 4I65A 5J3WA 3PBRA 2RCNA 1WFQA 3CCQA 1MD2D 1NZUA 3L3OC 1AFPA 3FZCA 4DV4L 5GHXA 1VQJA 4Q8IA 1I6VC 4RGTA 1NNXA 4CJ1B 2Q9MA 5EPHA 3A3FA 1G68A 3B33A 5BR8Q 3TE8A 2HDRA 1VQFA 4GOPC 4OELB 2O5JC 5HDDA 4JKTA 4DDSA 3QR8A 1EU4A 2YU9B 1NMGA 1VQEA 3QOLA 3SK6A 1QJOA 4X3SA 1WTVA 3IHAA 1BUVT 3T4KA 4HJ3A 3UPNA 1L0XB 2EY1A 4H02A 2PDRA 1NR2A 4WF0A 4WL9A 2EPBA 1ASZA 2FFFB 4DN0A 4UY8C 4OQGA 2BE5D 1S6RA 3CKIB 4BA2I 3RXXA 2OCEA 3BDOA 4ZUJA 1HTPA 4J6HA 5JYOA 3I70A 4LFAQ 3X3NA 1PH2A 4XDXA 2VZWA 1H5XA 3HLBA 3SK8A 3HLFA 5FKAC 1TQOA 5L10A 3V05A 4LV2A 4KZ5A 5FO8B 1HZOA 3EGXC 4KENB 1A2TA 1T18A 2CH4A 4Z9QA 5MC7A 5M5YB 5FLMH 1EY0A 2NBFA 2B5RA 2ZL1B 4JI0L 3RXWA 2EDGA 4FF2A 1M4VA 4P74A 5HW3A 4A3JH 3T1HQ 1EY6A 2BDOA 3QP8A 1VQOA 2WKQA 3R2TA 3VFHA 3GTJB 2R7ZB 1P8LA 3QJYA 4HIDA 1K57C 2KDKA 3RZOB 5DF7A 3DLLA 5E2HA 2XWBB 5EKIA 2CW0C 2MNAA 3BZCA 5FLXL 1BF4A 1HRJA 4P6ZM 1B7YB 1VQNA 2E76C 1LSXA 3W1GA 4OOYA 3NTKA 3WDNA 5CGKA 4LF8Q 5EBDA 3I4MH 2XSSA 3SR1A 4ZLTF 2GN5A 3DM1A 2WKPA 1R4QB 2BOSA 2OXPA 3OLOA 5GLAA 2ZL1A 3IFDA 4BY1H 4JI1L 1K9MC 2A74C 5FAPA 3HOZG 2IWDA 4DR2L 1ICWA 3J80E 2UUAL 1NJ4A 2KECA 3TDQA 4R1GA 2VQFQ 1Q81C 1TS5A 2YU9H 1Q2QA 1TS2A 2A6HC 1WTOA 3OIPA 4P72A 4TRDA 1KQSA 3JYIA 3PXPA 1MJEA 3EQVA 5TGFA 3S7OA 2EYJA 5CXWA 4IJHA 2QZ6A 5K5PA 4L5TA 5EBCA 1EYDA 3I4NB 2FH5A 3S1QB 3CPFA 4PMAA 4MEZA 1C7YA 4YCVA 4EVOA 2IX1A 4K08A 4S2NA 3D4WA 1I4GA 3P7JA 4L5SA 2F0OA 1KTKA 2NTTA 3RN5A 5GLCA 3G35A 3H3VC 4OQHA 5CBEE 4GOPB 1Q7YC 5C0XJ 1JT8A 2R92H 2K6AA 2QPNA 3HOZB 4P75A 2EWVA 3I3CA 1HLUP 2H0TA 4KK7A 4UHVA 2QDBA 3OTOL 2A6EC 4B9WA 2MUYA 2RHQB 4IPDA 4WMCA 5FSRA 4CQHA 5IS1A 1A2UA 3EGDC 2IA2A 1SAPA 5EPJA 4GLXA 3FPUB 3I73A 3GTJH 3VOYA 3QNCA 2R7ZH 2QDLA 5TR7A 3IL8A 3J7AF 1B53A 3RZOH 5FLXE 3MEFA 2B2VC 4ZQ3A 2JA7H 4P71A 4N1HA 4DV7Q 5BR8L 1Z47A 4OQ0A 4ZTKA 2QF7A 1BKBA 1TWGH 5E1FA 4HP4A 2JA5G 4GOPA 5DFXA 1OXTA 5IODA 5JEAH 4WFN3 3HKSA 2GDNA 1YLYA 3SK4A 2W1RA 1SJED 1KLGD 1PTOH 2H5XA 1BVSA 4LF6Q 4ID6A 3CITA 1HHVA 1YLWA 2B8FA 3ZDJA 2WKIA 1BO0A 5DFYA 2NN6H 4IPGA 1OO9B 3OSOA 1UEAB 2WAQE 5D3IB 3C4PA 3QNBA 1JTGA 3I7FA 2NTSA 1HR0Q 1ZC2A 3ISGA 3UB9A 5EFWA 3UB7A 3KLRA 5C4XG 1HXYD 4LFAL 3UDXA 4NXMQ 2F3IA 2CMNA 4PMBA 2DMWA 2JKGA 2W3GA 2PNHA 2NB0A 4JBFA 4XYQA 3S15B 1LO5D 1GCEA 3I4NH 2G9HD 4JI7Q 1W8YA 4PM6A 2RHSB 3S1QH 3K58A 2Y2IA 2X02A 4OH0A 1HQRD 1OPXA 5FQMA 4IUNA 3FKIG 2O4XA 4N9KA 1FNWA 1YNNC 2Y2NA 4HJ6A 4WN5A 5HX9A 5CHUA 4R70A 5E4XA 4EBPA 2A24A 1ES2A 2QHKA 3QOJA 1BCPF 4C1NI 2XD5A 1C9OA 2A73B 3T1HL 4NETA 3MXNB 4CPKA 1DP9A 4A5RA 2JA5B 3F1PB 2B29A 4JOIC 4NEED 5FDSA 4EX5A 5T1IA 3HUMA 4OPYA 4NXNQ 1F9RA 3DW0A 3EQUA 2HP9A 3VA7A 3OCLA 4N9LA 4QGUA 1H8YA 2K5VA 3EQLC 1I3QB 2L0CA 4PNYA 3NJAA 1ONGA 2WACA 3B3XA 1K4FA 3K2NA 4GDBA 4L0LA 1H9JA 4IEDA 2UWXA 5HAIA 2EY5A 1WCMG 2LS01 3I56A 2B63H 1LT3D 5J7EA 4HSVA 1BLHA 5ELEA 2AKWB 3MXGA 2O9BA 4KD4A 4EQNA 3Q22A 4MN3A 5IP9G 2JA6G 1I4RA 4JGQA 4H44C 3ICYA 4YY3Q 3MKEA 1JICA 5AFWA 3FKIB 2L0WA 1BULA 1FQGA 3KLWA 1KOUA 1PH8A 2VQFL 2HDUA 3G6EA 2KHSA 1X3QA 4QMGA 2Z2MB 5F69A 2PR5A 3HCYA 5C4JH 1W5DA 1RTNA 2ZC4B 2NVXB 2XF3A 4B4XA 1X0OA 1J5EL 1YPRA 3GTLB 1GVPA 3L9AX 1W2BA 4C3HG 2M00A 1FSYA 4DNRB 4K6DA 1TY2A 3H94A 3MTSA 1SNMA 3NULA 3UNWA 3Q6SA 1KAWA 4UPAA 4GLVB 3PUWA 3CCUA 2HCIA 2R7FA 1N36Q 4LENA 4OIKA 3D9YA 3VA5A 2NYZD 3ULFA 3FPPA 2Z6DA 1KE0A 4X68A 1WCMB 1NTGA 3FRPB 3HOXH 1TS4A 1G28A 4G3WA 1V1PA 1PIOA 4XT1B 4HBTA 4LFCL 1FNUA 1JWSD 1L2SA 1OT6A 4PMWA 2PT7A 1BYWA 1U4PA 1EZ6A 2JKTI 1EOVA 2JP1A 4IBRA 1JNUA 4E3NA 4OIJA 2CKZB 1TWAH 2BG1A 4LF5Q 4B3TL 1AZQA 3VV4A 4MHEA 4JF6A 2L12A 3QP4A 1ZKOA 4GB7A 3D6CA 1UUPA 4OPRA 2A3UA 4DV6Q 1PRTF 4FXKC 1FOFA 3R3OA 3AGFA 1NSNS 4KG6A 2WINB 4C3JB 1IYPA 1I3QH 1PH5A 2WB1G 3LR4A 1Q12A 2RKSA 2YYZA 1CK3A 3DWZA 3VSKA 4DV7L 4N1XA 3JAML 3HOYB 1SYFA 5IYCH 3G6OA 2BH2A 2OOLA 4GKJQ 1NBWA 2F3WA 4N8FA 4DR3Q 1MZUA 4J1MA 1S1ZA 2IWHA 1T5EA 2PBYA 3MXSA 4I3JA 2Y2GA 3NEMA 4LF6L 5GQOA 5LHY1 1SJHD 1E0BA 1F2YA 1PVOA 2VGLM 3HLEA 2EQSA 3K5NA 1LTAD 1XJ6A 5KIXA 4ODGA 3E3XA 2A2LA 2LMCB 3H3VH 2Y2OA 1HR0L 4E6IA 3BFEA 5H1SE 1RTOA 1RGYA 2NVXH 3T4OA 1HCZA 1W3SA 2K52A 2EYLA 2EY6A 4JI7L 4X64Q 3ZVWA 1D1JA 2K33A 2SNMA 1WYDA 1ES3A 3RLFA 3JAMc 1PDQA 1VDZA 4LCLA 1N9BA 4WMCD 2J8YA 1HFNA 3M4OH 5A35A 2XRNA 3IF6C 1G6AA 4H7BA 1F77A 5LMUQ 1N9OA 3D3OA 2O9AA 2E2JB 4XQQA 4O0AA 1NYMA 1G2SA 2AMCB 3C46A 5AJGA 2LY7A 1Q86C 4A93G 4JOIA 3DWQA 3TBIB 4KHZA 3CWFA 4K8JA 3E98A 5AVEA 2ZJQA 4LRYC 1X3FA 4MZ9A 1YT4A 3PSIA 3R4KA 2WKDA 1OTEA 3BW6A 4DJ3A 2D5DA 2G2UA 1PH4A 3EJIA 2B2TC 1B70B 1X55A 5IWAQ 4B3MQ 3CD6A 1NRJA 1KGFA 1STHA 4BY7G 4PKYG 4DJ2A 1G6ZA 4GLAC 1PI4A 1LV9A 4QF4A 3QP6A 4YY3L 3HOYH 2VKSA 2ZM2A 3VMAA 1WTXA 1QE6A 3T1YL 4A3GH 2QJ5A 4OX9Q 2QJ7A 2QMIA 4LV3A 1SZVA 4LFUA 1K56A 1V1QA 1WE4A 3LEZA 1OXVA 5F5YA 3OC2A 2PW5A 3BVMA 3SGIA 2F3VA 1S66L 2WKCA 1TS8A 3CJMA 3HVFA 2XTIA 5J4EA 3SOIA 4X1MA 3CP0A 3VR2A 1K38A 3C8CA 1OT9A 1WVLA 3QO2A 3A54A 4BS9A 5JAVA 4DAVA 1WD0A 1QVFA 1HD8A 1NZOA 1N36L 4Y2FA 3A74A 3CC7A 3LFVA 3PV0A 3S7QA 4UA9A 3I90A 4IVKA 1CI3M 2XQZA 2EX6A 2XNAC 2Q2IA 1IYUA 4DK3C 2VUMG 2J4XA 2Z2LB 4EERA 4LF5L 3OBFA 1O7ZA 4C3IB 2ZQ9A 5CHMA 1MIUA 4KY5A 3KLSX 2E2JH 3F1OA 1SYGA 1K4EA 4FCFA 3HOUB 1XWEA 5G4ZA 2VS1A 3C4OA 5I94A 2A68C 4DV6L 1MGSA 4FH2A 5IGGA 1A63A 3IX8A 2OEOA 1AE2A 1Y69U 2UUBQ 4KMUC 3T51B 5FAQA 3W4PA 1CHQD 4A3EB 2UV0E 1JB3A 3E6ZX 1CSQA 5EAYA 3QP1A 4QJGA 3Q82A 2ZM8A 5KZHA 1N33Q 1WTPA 5HPFA 2HDLA 4K2LA 2G5DA 3A5ZB 1K25A 2D02A 2A6HD 4A3BG 4BBSG 4LK1C 2NN6I 4TSSA 5K36H 1IYSA 3KYZA 5HD3A 4DXFA 2HJEA 1FJGL 1PFNA 3K0XA 1YJNA 3IF6B 1STNA 3IXDA 2VEAA 1RCJA 2JC7A 1QG7A 4X25A 2K5WA 1M90C 1O7IA 3N7WA 2OLUA 1W6JA 2B2WC 3UE3A 3S1NH 4DV3Q 1D5ZC 2P08A 4S2IA 4BD1A 3STBC 5E2FA 4O7DA 1ENAA 3PGZA 1L1OC 1T1BA 1J8IA 2Z6KA 3FDTA 4Y13A 4S2PA 4OGQC 4O0PA 5M5XB 1O7YA 3NY4A 4AQYQ 2QWSA 3BY8A 4UAIA 5IGBA 4K0KL 3E0YA 2A6ED 4PQXA 3MFXA 3CRLC 1G51A 3IQAA 2F0IA 2Y2JA 3CCJA 1KRSA 1KE3A 1U60A 1MWSA 1DONA 2H10A 4BBSB 4B4ZA 4XQJA 3IXGA 4LGWA 3VOZA 1DP8A 4KZ3A 3GTMB 1VEUB 5J39A 4C3IH 3LY3A 1VQ8A 4JVZA 1YAXA 3HBRA 4HH2A 4KZ6A 4LLOB 1IL8A 4RYEA 2NZOA 3HOUH 3MS6A 2Q9NA 3CPWA 1GD7A 2PRFA 1C8CA 1I4QA 3BQ8A 3LCEA 2VZAA 3GV9A 3IH8A 1DJBA 5IWAL 4B3ML 2BASA 1SE4A 1TKWB 3W8KA 4IUHA 2B2YC 4IUVA 1YNJC 4LAAA 5DJTA 3HS0C 4A3EH 4POFA 2ZC6B 2N3SA 1ET9A 1GHIA 1LTLA 1MKIA 3HP3A 1LTTD 4JG2A 5ISRA 1M40A 2XSCA 2DJGC 2IWCA 2ZC5B 3M4OB 4KUKA 1B50A 4GNXC 3DWAA 2D62A 2KCNA 5KEEA 5KNBA 4JI6Q 2OLVA 3UN7A 4QY6A 1DOLA 4X69A 4EETB 4ME5A 1ZTUA 3E9IA 1J9MA 4FF3A 2F0SA 1YNND 1CKOA 3HEJA 1DYQA 4J15A 1JOOA 2K5DA 3E2KA 4DNTB 4DRTA 4APVA 1N34Q 1V43A 4N8X1 2V0WA 4ZYSA 4EU0A 3K5LA 1DOKA 2GVBA 1VMPA 3SHLA 3HJKA 4DKIA 1U9RA 3BY9A 1LSVA 1PH3A 2FHTA 2PNRC 4Y52H 4GS9B 1ONLA 2VJWA 5CHJA 1U4MA 3SK5A 5FK9C 3PO2G 1UWPX 5DF8A 5I9PA 1X6OA 3L0OA 2CH4W 2F4VQ 2Y8HA 4OO1G 1JWPA 4KLKA 5HL6A 5JVH3 3ZQ5A 1BQQT 4JBWA 1PZOA 1ESFA 4HR7B 2VV7A 1UE1A 5FA7A 1SHVA 2F0DA 3GTMH 4QUFA 4JF4A 2WAEA 4JPMA 1GUNA 5AQ9A 4E6XA 4HJ7A 4DAYA 1SKOA 4S2KA 2RF4A 4PZ7A 4JPBW 1K56D 1LI9A 1L1OB 2GX5A 1MSHA 1N33L 1Y1WB 4HJ4A 1OTIA 4GHIB 4A3LG 4Q0JA 4R4SA 4E3JA 2F0NA 4AYBB 1JTDA 4RX3A 2H4OA 5HAQA 4IO9A 1F9IA 2HJ9C 3H3VI 1Y1VH 5HSQA 3D4RA 1YEZA 3DWKA 4G3KA 1PZKD 2ICIA 4RH6A 2UU9Q 4B3RL 1MWRA 1QVCA 1DRMA 1S5BD 3TZUA 3F2UA 2EWWA 3QP2A 5I2YA 1N32Q 1CKNB 1O7EA 1NAPA 2KEEA 5EJWA 3R93A 2L1BA 3VR3A 4DV3L 4LW1A 4ALPA 3C1FA 4POGA 4PM5A 2R93H 3LIAA 4R4RA 2Y0SG 3SS5A 4J8QA 3CUEC 3MXQA 4EV4A 4ZUIA 3J7YW 2ZJPA 1BLPA 1VQ6A 1LHYA 1TR5A 1FR1A 1H95A 2J7ZA 3N6IA 2RCFA 4GHIA 1PA6A 5DTKA 4ZJ1A 1Y8OB 4AQYL 4EEPA 1H9RA 3H0GH 1FL0A 2F0WA 4EQ1A 4QB8A 1XTDA 1BBUA 4RQ9A 4JXGA 3G48A 1MHWC 4CBVA 2QKPA 2R9XA 2SDFA 2F0MA 4OXPA 3SH7A 1PFMA 1CKMA 2LFNA 4E04A 3RMHA 2ZTEA 1SMYC 3Q1FA 5EKLA 4XT3B 1CKNA 2V1CC 4ZKCB 5IT9E 4KY6A 1EL0A 3V3RA 4GNXB 5JOBA 5FOBB 2Y4AA 2B3GA 5FJ8H 1D8LA 2V1ZA 2W27A 3GTGH 5FQJA 1H0MA 2WFWA 2DNEA 1D1IA 3RLOA 4KZAA 4F8MA 4MN6A 1D5MC 3D4DA 3SS4A 2F0VA 1NY0A 2Y91A 3S7NA 4QIWB 5LMNQ 5IOCA 3GTPB 2Q0OA 3PBNA 1YHQA 1BLCA 3HKZG 2Y0SB 2EJFC 3CC2A 2L11A 1X9NA 5IYDG 1SNOA 2K2NA 2ZQAA 1LL5A 3PBQA 3VE3A 4IUUA 2XGNA 4R6LA 1P16A 2SEBD 3GTQB 3N8RA 3D31A 1Y1WH 3GTCA 3P7NA 4QU3A 4HN7A 1WJJA 1MKMA 1UNSA 3W2ZA 3KBXA 4NPSA 3J81E 3OOCA 4HIKA 5FI6A 2EX9A 1XPRA 1GHMA 4JI6L 4GNXA 4A3KG 1F9QA 2ZTCA 1BLSA 1TU2B 3KF8B 4BXXG 2J3WA 1X65A 3RLNA 3S9WA 5CGWA 1EY8A 4ULLA 2PZUA 4R38A 2JKRI 2NUPC 1XMOQ 2HF6A 5AJ3L 3TS2A 3UE0A 4RAUC 4RHRA 5KNDA 3KO6A 4HIAA 1KNAA 3G31A 3K7AB 4R8NA 4B9XA 5CGSA 1STBA 2Y2QA 3EEHA 2MO0A 1E25A 1QNKA 4FUWA 3HZXA 1W63Q 2OSUA 3T4JA 1CT1D 3PIPA 4OWWB 1SE2A 1Y28A 3ZG7B 3ZNYA 3A0SA 2F4VL 1EUJA 1AWIA 1PMRA 2HT1A 3LGJA 3KF8A 3HLCA 1XX2A 2XWJB 2HD3A 2FXQA 2M1CA 4JI3L 3K3DA 2ZM0A 3CMEA 4JC0A 2M7UA 1EWIA 2K5QA 5JPMC 3PF5A 1CK1A 2WAFA 1O7LA 2HUGA 1Z09A 1BCPC 1HTZA 3KF6B 4UA6A 3GTPH 1WTQA 1JB7A 3C7VA 2WAQG 3S24A 4DV2L 4M4XA 3TMEA 4HTHA 2K1BA 3HFZB 4YWKA 2DCFA 1PYYA 3LICA 4P85A 3UMDA 3GTOB 4A3FG 3DEOA 3DUZA 4ZCKA 3EIVA 2UU9L 1K6SA 2K4KA 3GTQH 2FMCA 4HESA 2SNSA 3T13A 5AVFA 1B9MA 5EECA 4BENA 3TP8A 4EGVA 4LV1A 2OF1A 1XPUA 4DNIA 1T1AA 1I4XA 3M7NA 4PZ8A 3FPVA 3FKVA 3PUYA 3FHWA 2ES2A 1S1YA 3NPPA 3ZHHA 1YSPA 3SE0A 1IBKQ 4U0TA 2RDGA 3KF6A 4ZJ2A 2X6GA 4A3CG 3HJIA 4QHCA 2UXCQ 3UE6A 2XRSD 1SN8A 2I0QA 1VQGA 1VB6A 2AQ3B 2K7VA 3MQOA 1VQLA 1E4DA 4OP5A 2B39A 4UQIM 2ICEC 3K7AH 1QZGA 4X56A 2V4DA 3M6HA 4IPHA 3W2DA 3CF5A 1AE3A 2A68D 1NWZA 5M3MG 5C4ZA 4JBMA 4FOFA 2K50A 3ND8A 2FMMA 1WTHA 2F03A 1GHKA 4DR1Q 4A3FB 1G6OA 1STAA 5AQ7A 1YI2A 1PRQA 1HR0W 5HARA 4RX2A 3MSHA 1RJTA 1UEBA 3LWUA 4M8AA 4X3KA 4HMIA 3BG3A 1IFQA 1VETB 2HGVA 4DE2A 1TXYA 5IP7G 3PIOA 2EZVA 2EFXA 4WELA 5LMNL 5IT5A 4IURA 1IYOA 1RODA 4IFDG 1H8MA 1XJ3A 2DUDA 4GN4B 1SCWA 1LI0A 3V96A 2FINB 4QJFA 2EYPA 3H91A 5JEAG 1K8GA 4L9FA 4DXBA 1SDFA 4Y0UA 1K0RA 3BEBA 4DKAC 2OT2A 2EFUA 5EM1A 4PMCA 4MTKA 1QMFA 4GKUA 4XIGS 4CKCA 4JI5Q 1PRTC 2EIFA 3M7GA 4KZ7A 3STBD 2JBFA 1JC7A 3KJPA 4Q0HA 4O01A 4G7HC 3P98A 3UO9A 1QCBD 2FFKB 4IVIA 1C48A 1GUSA 2J0TD 2WGVA 3WOFA 3M4YA 5KSHA 1D5XC 4Q5VA 1S5ED 2NUTC 1AW7A 3LNNA 2JEAI 3DBAA 3CZDA 4OHJA 3VP2A 4KI0A 5C5MA 3A0RA 5CV8A 2BTFP 3G6JB 1HJPA 3L7ZC 3GSGA 4OLGA 3KSGA 2M2LA 1LT4D 3N8SA 1BCPB 2X01A 1EFID 4JI8Q 1L0EA 2XA7S 5I6YA 1XNQL 4OOMA 2HCCA 3FC7A 5IY0A 3PMFA 4C56C 5EUAA 4DU9A 3BJUA 3T4LA 3G34A 5L09A 2ZJRA 5EM0A 3LO7A 2XVSA 1BSGA 3OPRA 5IIFA 4GLQA 4X1LA 3EROA 2AWOA 2F0FA 3MEHA 1KVMA 3HL9A 3UDGA 3KSFA 5EPLA 4IUQA 3S7PA 1V9PA 1GUOA 3VSLA 2ZQ7A 3UB6A 3P1HA 3I91A 3VYRA 5M5YH 1OTBA 1TS0A 2R9WA 3Q7VB 4UA7A 3MQ0A 4KQOA 4RFBA 1VQPA 4PPRA 1GA0A 5M3FG 5ELDA 2O99A 4UHUA 4KN4C 5BN5A 5TFQA 1KE4A 3BECA 4P6ZS 1LACA 2Y2HA 3LIFA 4QD4A 3AB9A 2N88A 4MBKA 2X6LA 3X3MA 1F9SA 2BDNA 3NHHA 1XJ2A 1E3PA 4LUOA 3FVQA 3LX0A 4IZ8A 5C6AA 3M3YB 3F8TA 2Y2LA 3NXWA 3DHQA 4E3LA 5AQBA 1ZYRC 5IGEA 3MZEA 2NVTB 1STEA 2KQ3A 3PUVA 3LR0A 3PO3G 2JKTM 3K59A 5L8MA 1TDGA 1AP0A 1MXOA 4E3IA 3A7LA 2INWA 1LTID 3NOTC 2VL6A 2HPBA 3AFPA 3HG9A 2PD7A 4YWZA 1A3TA 1X3PA 2E8GA 3TQYA 3C5AA 1MSGA 1VS0A 1JE5A 3BQAA 5M3FB 1AXBA 1MBYA 4Y5FA 1SRUA 1L0DA 5EOOA 2NVQB 3N6RA 4RG1A 3ND9A 1HZCA 4DR1L 5M19A 1F2MA 1PRTB 3OMGA 4DGZA 1YLZA 3H7WB 4I3AA 3T1XA 2EJMA 4GD8A 1V1OA 3IWIA 4B88A 4MTNA 4UP8A 1MWTA 4YWMA 2ZLYA 3TG9A 2VLGA 3LR3A 2Y2PA 2RL3A 4OONA 4GD6A 3PIP3 4KZ8A 3LYXA 5C3WA 4Y7PA 1GUGA 4NKPA 4CKBA 3CAMA 2D0PA 3GV3A 3HOZH 3HLWA 1HNWQ 5IYBG 4BBRG 3O87A 1SYCA 1GXDC 2H28A 5GADC 4JI5L 4OP8A 4LF8L 2F4IA 1IL2A 5C4XB 4K8IA 3BYYB 4S2LA 4FNFA 1G91A 2Z6CA 2H0YA 3H7WA 3NBLA 4X66Q 1FILA 5CORA 1KXLA 5I2XA 3FP9A 4Q0FA 1E2WA 3TRZA 3I72A 4FDBA 1KDCA 3MXNA 4HIMA 4ZRRA 1XJVA 1LTGD 5HWWA 2KOIA 2PMZB 1RIPA 3M3YH 2P04A 2VK3A 3NECA 2XK1A 4M3KA 4DUZQ 2NVTH 2NUCA 5J3BA 1WA9A 3TRCA 4HNBA 1BTLA 1FGUA 4MN5A 3F2DA 1SMYD 3M4PA 3WS5A 2DRWA 2ZOHA 2LB5A 3NENA 1ZEQX 1SEBD 2PZWA 1U5KA 4AFIA 1XA1A 1VM1A 3LEQA 3AGDA 3AGEA 3OPHA 3PAGA 4EWFA 4TKOB 1S5DD 2IHFA 3T4SA 4KHVA 2E2HB 5C44G 3D0FA 2KLIA 3S15H 1CEFA 1XFQA 3HLGA 3MZDA 5G18A 1A6XA 2NVQH 4R4TA 3HLDA 5C0XI 3HGBA 1TWFB 2KX6A 1YHBA 1T19A 2Y79A 2KCTA 3AFQA 2KCMA 4WJ4A 2JA6B 3DTKA 4KY7A 3LIEA 1W63M 2PQAB 2D2CC 5EGTA 5ELOA 1IBLQ 3MC0B 4Y3IA 2KUMA 3D6WA 5L07A 3BS1A 1L0WA 1RD9D 1KGEA 2F0JA 3IF5A 3TP5A 2JA5H 1H8ZA 3TSSA 4FF4A 4BL2A 1VQ4A 5GLDA 4P87A 2ZC3B 5HY6A 4JF5A 3T1QB 1I94Q 4WEKA 4WBGA 2KHJA 3U50C 4C1NK 3D72A 4DK0A 4C3HB 2K04A 3VR5A 5IGDA 3PIO3 1TEMA 4KQDA 5TJJA 1NCVA 2B2VA 3LIBA 1WI5A 1CQAA 1PZPA 1GJXA 3UPPA 2L4RA 4OPQA 5C4XH 3SDZA 3CC4A 3HOVG 1PYWD 1U4RA 1J9OA 4K5XA 1N4OA 1JWZA 2OAQ1 4O2DA 3IXHA 3GO5A 2Q2HA 3OOVA 3R7WB 4A3MG 3E4OA 5E3FA 4ABNA 3URYA 1HZ9A 2YV5A 1E2ZA 1WOCA 3OIQA 1ILPA 1BT5A 1J3WA 1JWMD 3FKIH 4NDXA 4IBXA 4GOGA 1OMEA 5FQKA 1VQ5A 3PCOB 2V8CA 4Y17A 1XP4A 2ATWA 4NXML 4IFDJ 3VOLA 4U3TA 4K5WA 5E4WC 3GTLH 1FVIA 1FCMA 2FFYA 3KSHA 4EXOA 4Y7NB 5JEAJ 4A3IG 4OLDA 2MQHA 3NI9A 1EWCA 4WZ5C 1RCVD 1V9YA 4KZ4A 2WB1B 1BCPD 2VW9A 3J7AV 3M2KA 4JGPA 4Z1WA 2E2HH 3T1SA 5F2DA 2KBNA 4WRDA 4DN4M 1L0FA 4X3UA 4GW9A 3R7WA 3WS4A 1WCMH 1FR6A 3J80i 3LI8A 2B8GA 1B8AA 1TWFH 5GLBA 2Q2UA 1PFLA 1IKLA 3OW7A 4NXNL 5IP9H 2JA6H 3AMUA 2WKRA 3ITBA 3O88A 4A3MB 1HNWL 4ZRZA 1VQMA 1T9HA 1W6KA 2VY3A 4WJWA 1PV4A 2XROA 1ESRA 4DR6Q 3HOWG 4KZBA 4N9PA 3E9HA 5GL9A 2K31A 3PTEA 3H9WA 3KX0X 3WRZA 2ZJ9A 3VDYA 2M7VA 2AQ1B 2G9DA 4C3JH 4X66L 3FV7A 3NDEA 4HJ9A 3OHXC 4C3HH 4QWOA 2L4NA 3T16A 3JAME 1I4HA 4QL5A 4WLAA 1LYLA 3MFGA 1Y8NB 5BN4A 5JVG3 2C6WB 2AHOB 4ME3A 2MHVA 2P74A 1JCKB 2Q2TA 1FYCA 4F94A 2J9PA 4FSFA 2KJXA 1PXUA 2JE5A 3KYHC 4KG2A 1B9NA 2I5HA 3ZYYX 1DCZA 1YIJA 4FF1A 2PYRA 4L63B 5GHZA 2JQOA 2RSNA 4A93B 3EA6A 3Q0AA 1N8RC 1DZ1A 5CYUA 3RZDB 4QUCA 4X62Q 3GV6A 3GMWA 3SEBA 1K8OA 2QEJC 4QQBX 3KDFB 2ZD8A 4LUVA 2IX3A 5FATA 4Y7NH 1P9WA 4KKTA 3NWSA 1BZAA 3C2WA 3O13A 3FPWA 3MF0A 4FXGC 1UWNX 4BY7B 3C7UA 5DJUA 3NHQA 5M9OA 2TSSA 5FO9B 3CLOA 4HJAA 2CW0D 1IBLL 1CTMA 1PWCA 3NIAA 3ZG8B 4IJLA 2PR6A 3WWXA 3BZDB 5I6WA 1DY6A 1PRTD 2SOBA 2YKHA 2GJ3A 4NXEA 1M8AA 1I94L 4NMZA 4YHHQ 1YLPA 5F6AA 1S67L 1A15A 2UUCQ 1KVLA 2HDQA 3KDFA 3KBGA 4JYAQ 3DTEA 2N49A 1IYQA 3NK9A 3BFCA 1XNRQ 3FYZA 2LB9A 1VHMA 1GSXA 2F0PA 4GKJL 2WKHA 1PH1A 4DR3L 1F9PA 1NE3A 3K81C 5TSSA 1ODVA 4PKYA 1KDAA 3E0EA 5DVAA 1S5CD 2RBMA 2R7DA 4RCOA 1YJWA 1DOMA 3NQIA 2B2UC 1EOTA 1CI8A 1EW0A 1IBMQ 1LLRD 2ZTDA 1A8VA 1VQQA 2WIIB 2OWJA 3EVQA 1A0IA 2VUMB 2KVMA 1SYEA 3Q24A 3K0YA 2HIVA 2JK8A 2EXBA 2KCCA 3F1PA 3VFFA 4QCLA 1C4QA 1H9MA 2JA8G 4DR5Q 1SE8A 1TIID 3JVUA 1EIFA 4X64L 1TVFA 2A49A 2ZQCA 3W4QA 4A93H 2VB3X 4KTAA 4PHTA 4A3DG 5CTNA 3S4XA 3RZDH 2PYPA 1JWUD 5EKKA 1E1OA 1MWUA 3NC8A 5E43A 4WZ5A 4BWIA 3VP3A 3GD7A 4A76A 1YLTA 3CI6A 4BA1I 1SLJA 5GAHC 3CCVA 2XN9C 5E2GA 5LMUL 2EA9A 4OOLA 3IF6A 3TZDA 3ZG9B 4DV5Q 1QUQB 2M9VA 2V1AA 3NQTA 4DAMA 1PH9A 2PQEA 3CQZB 4A3BB 1JR0D 4BY7H 2TMPA 1BBWA 3TEHB 1K55C 1ONHA 4L9EA 1YNXA 2E75C 2I07B 2PZTA 3IRBA 3CHWP 2KOLA 4DUYQ 4DR6L 5TBMB 1B4OA 4OEMB 1CJFA 3IWOA 3L9KA 2F0LA 1GO3E 2B2TA 3A3EA 1LT6D 1ZG6A 5M5WB 2HIXA 1SFOB 2QEXA 1SROA 2XGTA 1B2TA 2RDHA 3CPTB 3NCKA 4RA7A 4WEJA 4BMWA 3VP4A 3IHBA 3A3DA 5DKKA 4OX9L 5FQIA 1SXTA 5LMNW 3ULPA 1Q3LA 1G8ZD 2K28A 1I5FA 4F87A 1VEUA 2W3HA 4BBTA 1B44D 3L7HA 3K5MA 2Y2MA 5I4DA 2E74C 1D2BA 5F68A 1U0LA 3BVGA 4DXGA 4FYDA 2VUMH 2F0TA 1ESUA 2WUQA 3VP0A 4YWLA 4X62L 4DR7Q 3RTYA 4NW2A 1N9WA 3BFDA 1ZKJA 1OJGA 2HP5A 1UE6A 1HNZQ 4L5RC 3MJQA 1AN8A 1PYBA 3U4VA 1RP5A 3CPTA 3T53B 1WYCA 1Q82C 2CFMA 4CDFC 4YOFA 1EQTA 1AZPA 4GNUA 3A8JE 3OWEB 4B3SQ 2P9VB 2V2FF 1TWCB 5M5XH 2XH9A 5BN3A 2W3DA 3T12B 1NR4A 5KYIA 5C3XA 2IX0A 4DK1A 3P20A 3MVVA 4LF7Q 1Z6FA 2CCZA 3ZJYC 4HQAA 4EQ5A 2B95A 1VCIA 2MP1A 2QA4A 3ZNTA 4A3BH 4BBSH 3OMCA 3CQZH 4CDEC 4OVDA 2ZMAA 5CV9A 1ERMA 2O5IC 3K6OA 4EEUA 5DLQE 2VV8A 2UUCL 4HSPA 1P97A 4WYYA 2UUBL 4JYAL 5CX7A 1L2FA 2JKRM 3WS2A 4RGMA 1XNRL 2R3ZA 1VQKA 5CBAE 5GROA 3GDEA 1YM1A 3G4PA 4HP9A 2ZXRA 2I5MX 3ONAB 2WGIA 3C3LA 2P9VA 4Z9CB 2J9OA 2JN4A 2MJ8A 4GS9A 5M5WH 1SFOH 3UE1A 2HHHQ 5L37A 2DJFC 2ACGA 4KUOA 3WS1A 1IBML 4ETZA 5C3EG 1SDEA 3PUZA 4YNRA 4PV1C 1XKZA 2H1EA 1SNDA 2C9OA 2MGSA 4LMQD 3PO2B 1TDLA 3U4LP 3CAXA 4E3MA 3CCRA 5D65A 3SH9A 4PM7A 2B2WA 3H15A 4PM9A 5HDCA 3DMUA 4DR5L 2JA9A 5GAGC 5JJKA 4DV1Q 1L1OA 4RA8A 3RFBA 1E3UA 3LGOA 3T56B 2R61A 2UXBQ 2EYHA 1CA5A 4DA2A 2RSOA 3ZYTA 1GKHA 4DV4Q 1YMXA 1IKIA 1HUMA 4LRZE 4XT2B 3M2JA 3F1NB 1VF7A 3RN2A 1W7FA 1TWCH 3UDIA 3S1MB 2UXDQ 4RKLA 3RH8B 1V8QA 2I9VA 1Q1EA 5DTTA 5C3EB 1S4RA 1GOZA 1B3QA 3QG1A 1E24A 1K55A 4EUZA 4DUYL 1HQMC 4TVAB 4BWGB 3UB5P 1ASYA 1VQ9A 3HREA 3BFGA 4II7A 1GM5A 1TWHB 1HNXQ 5FI2A 5KSCA 4JBJA 3MXUA 5A90A 4X55A 4ZKBB 2V0UA 2HDMA 4EW7A 4ZBEA 5FQ9A 2B2YA 1HH2P 5HGQA 3K57A 2DY7A 4DFAA 1LTBD 4R3JA 3F1NA 2RVLA 2VV6A 3RR5A 1F5MA 4M1UB 3PYPA 2DN8A 1CA6A 3QP5A 5EPKA 1I6HB 2F0HA 1S4ZA 3B42A 1Y14B 1FCNA 2K01A 1DJAA 1D7QA 4YCWA 3NSWA 3E4QA 5FO7B 2PW7A 3W5OA 1EZ8A 3MHBA 1K28A 3PO2H 4DR7L 2L55A 4RCNA 3K80C 3R8BA 4OO1H 1N34L 1W79A 2GNXA 1SMXA 2KEDA 5CV7A 4A4IA 5FLMG 4HEDA 2G2WA 4YFMA 3NBHB 5CEBA 1STZA 4YIJA 5I5LA 4B3SL 1ET6A 3HKZB 4A3JG 1EYGA 4BL3A 2OQ0A 4RHSA 4DV0Q 1S5FD 4ZAMA 2PO4A 4FD8A 1PZID 1IOUA 4JI1Q 3Q81A 4LF7L 3A8IE 1TVXA 2ZOIA 4C75A 4IOCA 1PFBA 4DR2Q 4A3LH 1JQYD 3JC66 2EXAA 2C35B 5GAEC 5M1AA 1SE3A 3EWKA 3S1MH 2C5CA 4G3VA 5CERA 3T4QA 1H3QA 4C3QA 1PH6A 2N78A 3V67A 1E2VA 4H6JB 1KHIA 3IXBA 4L5QA 4A3KB 3I4MG 1Z6HA 1ACFA 1XPBA 3F1ZA 2MFIA 5C0XH 1EI5A 4BY1G 1W8QA 2Y59A 4JCVE 3NBHA 4K0WA 3F2BA 1WYBA 4WM9A 3SW1A 5J1ZA 2OAP1 3P01A 3WWVA 3NUCA 2J3TC 1PTOC 3S14B 1ES4A 3ZCZA 1YVCA 3N4IA 1FR3A 2K03A 3SS3A 3ER0A 1EROA 1K54C 4R3BA 4A3JB 3J7ZC 3A8KE 2FJ2A 1JMCA 1I5QA 2A19A 3D4FA 1SNPA 1SR3A 1N32L 2VQEQ 4CDDC 4B93A 4AYBE 2QW7A 4EESA 1I6HH 4H6JA 1N9NA 4C2MB 1SYDA 1KIXA 3EEAA 5EVIC 3K7UC 1UAPA 4DMZA 2ZBBA 4IOAA 3EN2A 2LXJA 3CUEA 2PPBC 4EUVA 2XFTA 1MKHA 3A55A 3FG8A 2UXBL 1EWZA 4S2JA 3ZG5A 4KQRA 1FD7D 2JE6I 4BY1B 2ZXOA 2R92G 1HA5A 1TF1A 5ELNA 1QOHA 5GHYA 1KDSA 2K14A 1DJRD 1XMQQ 3ZG0A 2WAQB 2Z4IA 1HA6A 2EYFA 3J80L 5IYDH 2UXDL 3NDGA 2E2IB 5FL3A 4Y0OA 2NWGA 4CKEA 2CQAA 2R7ZG 4BJPA 1PH7A 4HHDA 3NWTA 4MDZA 2CVRA 3TN2A 3ERQA 2Z0SA 1I2WA 2RQXA 1OJ5A 4GCZA 2JA7G 5NUCA 1HNXL 1QNUA 2L9HA 4RGNA 2XA7M 3GR2A 1YMSA 5J8XA 3GECA 1Z9FA 4A3KH 1STYA 4BLMA 3IFTA 2VXWA 1YJ9A 4BXXH 5KRUA 3SVMA 3Q07A 4G7OC 3CU7A 4R8IA 1MI2A 4DF6A 2EYMA 4QIWE 2AQ2B 4I7ZC 2NN6G 4CJNA 2Q8TA 4U68A 2R92B 2PYKA 2K05A 1BDOA 3S14H 1JJGA 2Y0SE 3GTOH 2X71A 3J80c 3RNUA 1E3UD 4NXFA 2GA4B 1YZ6A 4CDCC 5M3MB 1TS7A 2D01A 1VETA 2HZ5A 2ZMFA 4NK3A 4KV6A 3I4NG 2PU2A 1XGIA 2B02A 4IQZA 2V9AA 4IUTA 1XMOL 1M1KC 4ME4A 4C2MH 5CECA 4NP5A 4IUKA 1L0YB 1HPCA 3I55A 2D0OA 2H5SA 1PW1A 2JA7B 1EY4A 3IS2B 3O86A 3PUXA 2O2LD 2RDFA 4FH4A 5C5KA 2W3FA 1KABA 1TWGB 4MLLA 1A3VA 1YITA 1LTRD 3TREA 4DV0L 4UQIS 1ENCA 2YTXA 2LKVA 3ZFZA 4IN3A 4DPGA 2RCXA 3VYSA 3GDIA 4H13C 1D1KA 3HUNA 1PTOB 1X32A 4MBHA 4D2OA 3IBRA 4UAAA 4QB4A 4PM8A 1XXGA 3DXJC 4DAPA 3QHYA 2N55A 1IKGA 4E6WA 3H82B 4MIUA 1RF2D 4JXWA 3HKZE 3QIAA 3TJZC 1F2LA 1YNJD 4A3FH 4KQQA 2E2IH 4DDYA 3WOEA 2B63G 1M6KA 3MKFA 5L2FA 4L8JA 1MPLA 5EV0A 5U47A 1IW7C 5EVIB 1J5EQ 3IS2A 4XTCS 1O07A 2VB2X 2MO1A 3BU2A 3CG5A 1ICFB 2EX2A 3E4PA 1ZG4A 4BBUA 3ZGAB 3PF4A 2LSSA 2WV6D 5FLXc 3S17B 3IX4A 1UGUA 2WADA 2WKEA 2G7UA 2K7SA 4ZDXA 1JJ2A 2YTVA 4A3CH 1ZHHB 2W1TB 4JGRA 4JV5Q 1K54A 5JJIA 3KK7A 4IALA 2VQEL 4LFCQ 4IUPA 3H82A 1TS3A 4HIOA 3J81j 4QPRA 3UY6A 3PBOA 2PCFB 4OL7A 1EYCA 3CCEA 1S0WA 1KNEA 3E0JA 1JWVA 1YQSA 4B3TQ 3GVBA 2ALYB 3Q7VA 4GJ4A 4GDNA 1IBKL 5M3MH 5EVIA 3GTKB 2W0NA 4KZ9A 3LUQA 1D6EC 3PBTA 3CMZA 2XRQD 3BDCA 2UXCL 2B63B 2BLSA 3HOXG 4WORA 4RGOS 5KYLA 3W4OA 4MBFA 3OWFA 3O5YA 5EOEA 3BYTB 2K5NA 5A8BA 3IH9A 5IP7H 1CZWA 1XMQL 4XUXA 2F1MA 3SXHA 2W1TA 2CWPA 4IFDH 1C3BA 3TSGA 3VE4A 2Y55A 1KL9A 5DM63 3E5SA 4LV0A 3J81i 5C4JB 3KYEA 2A24B 3EFXD 1GUWA 1XXMA 5LL6X 1VQCA 3BYDA 5CRFA 4FXDA 5EVEA 4KD3A 2IT1A 3N8LA 2F0QA 4S2MA 1U4LA 5A93A 3O3VA 1OTAA 5D3OA 5IYCG 1GA9A 1PW8A 5M18A 4KKSA 1QMEA 1A3UA 2QKIC 1PTOF 3PO3B 1RHPA 4XYOA 2EE1A 2KA7A 3TP6A 3MMHA 4XXRA 1FNVA 1PWDA 3HOXB 4V190 1NXYA 5DKLA 1JOKA 3T4AC 4FO2A 3ITAA 4ZK9B 3S17H 3I8ZA 3K3CA 2BA0A 2JYOA 1NMFA 4HJ8A 3ITPA 2GVAA 4AH6A 1LT0A 5D14A 1TWAB 4EBLA 1STGA 4DE0A 5E7NA 5F1GA 4OO1I 1CUKA 2EXDA 3M85A 1KDWA 4RMFA 1F2ZA 5ELFA 3UB8A 3NELA 2PBDP 3IT9A 2Z8LA 5K5BA 1BBXC 3C30A 4C6YA 2V1BA 4GKKQ 3CRKC 4F3LB 1FCOA 1X3EA 4E3OA 4EQOA 3GTKH 1EQQA 4JI8L 5A92A 3RUZA 1X56A 2C5WB 1JOQA 5T1GA 3F2CA 4RVAA 1Z7TA 1LM0A 4KJNA 1NYYA 4CHTB 4BBRB 1DXMA 5FEFA 4XXEA 4I39A 4OKPA 3LY4A 1K8AC 3A7AB 5DF9A 5CEDA 3Q7ZA 4HH3A 3U9OA 4DF7A 5M3FH 2PD8A 1H9KA 2VA0A 1V1PB 4ID4A 3T1YQ 2JSOA 1CI9A 3G7LA 1HFGA 5IE8A 1SBBB 4U0XA 4F88A 1SNCA 1DP6A 2E5LQ 1VQ7A 2BCOA 2CQOA 1IKMA 4K14A 4ZJ3A 1GSVA 1Q90A 1FGBD 4R4IA 5DM73 2WZZA 4F3LA 4C3JG 3P75A 3Q8DA 5EVLA 5HDSA 1WD1A 1PLFA 1CM9A 2CHBD 1G6PA 2F52A 3EBEA 4P2CB 3HOYG 4KHPQ 4V0BA 2JEBI 5KNCA 4X53A 4A3GG 1C0AA 4E3KA 4S3SA 4N9TA 5CC4A 3IKJA 3PO3H 2FZ0A 4D60A 2Z4HA 3NOPC 4MN7A 3MQQA 2A69C 1G5UA 3TS0A 3U58A 4JV5L 1F2KA 3BRMA 1QILA 1ILQA 1QZHA 1IZ6A 5JPNC 4ILWA 1EY7A 2EXZA 4R4OA 4OWTB 1OTCA 4LF9Q 1EIHA 5C44B 2ZQ8A 1CFMA 5FASA 5HZHA 3AEVA 1KAAA 2PQAA 1XYIA 3BLSA 1X3GA 3ULLA 1K73C 1HZBA 2Q8RE 2IPKD 3PQIA 1JVJA 4NG2A 5AQAA 3ZVTA 4JI2Q 3I2ZA 1K3RA 2JCHA 1XPOA 2CWAA 4HCSA 3VR4A 2Z6BA 1YBYA 4DR4Q 3M4QA 2GZAA 1T5XD 3IX3A 1PYSB 4A3GB 1QB5D 4O42A 4ESPA 3VYTA 2NZHA 3BZKA 3W1BA 3KJOA 1MC0A 2ZT9C 3OPLA 5CMDA 5IYBH 4BBRH 1D7EA 3VYUA 1EEFD 1RL2A 1FJGQ 4KKUA 5KMWA 3FWLA 2HQEA 2MPMA 1RKNA 3S2DB 2XDMA 1SNQA 3HOVB 2HP6A 2J3TD 1PTOD 4OQIA 3IAYA 2ZM6Q 1DD2A 2D9UA 4PZ6A 5FI7A 1EQVA 2Z6KC 5K36G 2A1AA 2ZQDA 4K0XA 1GSWA 1ERQA 1K8MA 1ES5A 1NUCA 1CQVA 3ICEA 3Q23A 4H0LC 2DGYA 2ZXPA 3G32A 4HCEA 3CHBD 5EVID 3FEWX 4K0KQ 3PBSA 3ULJA 1KRTA 4ETXA 1I2SA 4A3IB 1HTLD 4TQUS 1XX8A 3DM3A 3MXRA 5HWVA 3T50A 3NBIA 3R2IA 2ID0A 2EX8A 3EOIA 4MNRA 3MZ5A 2VGLS 4CJ0B 5C44H 1IXRA 4GKKL 4UP7A 2AUJD 3DTMA 1ALQA 4DUZL 1MY8A 3U2AA 3V5MA 3RJUA 1E22A 1T1CA 3K5OA 3JVVA 3M9BA 4BQMA 5CV5A 3S2HB 5F83A 4RKBA 4LUZA 3KOJA 5HWTA 5FQQA 1F98A 2PMZE 3S1YA 5CGXA 1CHPD 4CLCC 2QYBA 4WJ3M 3H6MA 3CMAA 1WTWA 2JHEA 3HOWB 4DE1A 5DEHA 3CCMA 1BOSA 4C3IG 4X6AH 4JXSA 2EY2A 1CF0A 2XFSA 1Y4OA 3HOUG 2E5LL 3W3AA 1LLBA 2KHIA 2QILA 3S1NB 1AH9A 1EY5A 3MFDA 2IL8A 3F1OB 2WZXA 3HRZC 4R4QA 5D3DA 3VR6A 3LWEA 4A3EG 2NVYB 3S2DH 1PI5A 4KJOA 1B1ZA 3HOVH 4FTXA 3T4TA 4KHPL 1TT2A 4LCMA 1BR9A 1G291 1PWGA 1TS6A 1AEXA 2E2DC 2F0EA 2XEPA 2ZC7A 1S4SA 4A3MH 4GN2A 2AWNA 2P5ZX 3CW2C 1CEGA 4JK1C 4I7AA 4LRXC 4CGYB 1BXTA 4LPZA 4JLFA 4N92A 1JJCB 2F0KA 1L3LA 2ENBA 4LF9L 3V39A 4GZYC 2BE5C 4LF4Q 3BFFA 3I7JA 1K83B 1CQFA 3MA2B 4A3IH 4JBKA 4KG5A 1RGZA 4S2OA 2K75A 2B18A 4GZBA 2EVBA 5EE8A 4WUJA 1I50B 1UE5A 4JI2L 4JI4Q 5F1FA 1Q8KA 5IGCA 4IFDI 3UPOA 5G3LF 3T1RA 3NTIA 4DR4L 2DNCA 4HEFA 2JJQA 2BH8A 5F82A 3S2HH 1K0KA 4IHQA 1EIYB 1O80A 3I4LA 4L6TB 2ASBA 2PI2A 1IW7D 3G2ZA 5FDHA 2IWBA 1VF5C 3HOWH 2WK0A 4B3RQ
chains in the Genus database with same CATH topology
4H8RA 1E1TA 4P0MA 2ZM6L 4X65Q 2WB1E 1VQDA 2WGWB 1Y1VG 2NVYH 1L0GA 3IWQA 2XD1A 3K8AA 1XA7A 2R93G 1NY4A 2E8IA 2VGKA 1QUQA 3G71A 4K91A 3SH8A 4P73A 4NB3A 5HFOA 1VQIA 1K83H 3H0GG 5FAOA 2WGWA 1GHPA 1SDNA 4JXVA 1Q2PA 4EQIA 1I50H 2R6GA 4PG3A 3A5UA 3CCLA 1IYJB 1VQHA 2OTJA 1MJCA 1YHAA 1S72A 3U4ZA 4X6TA 1SKFA 3PAEA 2DNSA 5CTMA 5FJ8G 2K5HA 2XR0A 5BOHA 2QGQA 3HUOA 3S22A 4QY5A 1YLJA 1PFSA 1KGGA 1Y1WG 1X54A 4AYBG 4YHHL 5AJ3Q 4LNQA 1KC8C 5DTSA 4LFBQ 3WS0A 4DAYB 3OW2A 2WP8J 2BA1A 1HZAA 2LXKA 3FKWA 2VGJA 5KSHA 4YCUA 1K6RA 3A3IA 1PHJA 1DJCA 4OWXB 4LF4L 2JA8H 1HVBA 4WZ4A 1LL9A 5A91A 1VQBA 1OXUA 4HBUA 4A3DH 3TOIA 3G4SA 4EBNA 4Y0TA 2OWOA 4JI4L 4IPCA 4MNOA 4JI3Q 2VNUD 2PI2E 5JYPA 2V20A 1NRFA 1EFWA 5HAPA 4DE3A 4DV2Q 3GQZA 3JAMi 2YTYA 3G2YA 4DV5L 3B6YA 5C0XG 1K57A 5IT9c 4XUZA 3OCNA 3I4OA 3GRJA 1OXXK 4X65L 2HQLA 3BM6A 1KD1C 4GN3B 2L15A 2IY5B 1A62A 1J6QA 1E7ZA 1OXSC 4GN5A 1S3OA 1FSWA 1Q1BA 1S40A 1CSPA 2WYXA 1Q46A 3J81c 4HJ5A 2I5LX 3A3JA 3AQQA 2Y2KA 3P09A 4OPZA 4QY7A 4JI0Q 3KFUA 3S16H 2OQKA 4A75A 2J7VA 3V3SA 2OTLA 1MBLA 2XLNA 1IELA 5HL1A 2OV5A 4R23A 1HNZL 1NJIC 3WRTA 3OPPA 3MBZA 3G30A 2I72A 1EQRA 4LWCA 1ESIA 3UDFA 3CXCA 2PU4A 2CC1A 1QVGA 1XGJA 3MZFA 5E2EA 3CCSA 3BLMA 1DGSA 2UUAQ 3L2PA 3OYYA 5IHVA 4LFBL 5C3EH 3VP1A 3E2LA 4GS3A 3J7A5 3V50A 2HDSA 1XNQQ 1UE7A 3S1RH 1TWHH 4DK6C 2A8VA 4S2NC 4R1JA 5JJLA 2HHHL 4R0QA 4DXCA 1LUZA 2KENA 1IEMA 1UWVA 4R4CA 4AIMA 1BUEA 2IHEA 4YINA 1Y54A 1R9TH 3ERSX 3OTOQ 3AYHB 4P6BA 2N8NA 3M6BA 4DV1L 4UP9A 4BD0A 3A0JA 3OZHA 1VQAA 3PBRA 2RCNA 1WFQA 3CCQA 1NZUA 3FZCA 5GHXA 4Q8IA 4DV4L 1VQJA