4OONA

Crystal structure of pbp1a in complex with compound 17 ((4z,8s,11e,14s)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2h-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid)
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
746
structure length
502
Chain Sequence
PLKVYSEDGKLISEFGEMTPELNAPYIAEMARAEMVGRYGSEAYTEGYKVITTVRSDLQNAASQSVRDGLIDYDQRHGYRGPETRLPGQTRDAWLKHLGQQRSIGGLEPAIVTQVEKSGIMVMTRDGKEEAVTWDSMKWARPFLSNNSMGPMPRQPADVAQAGDQIRVQRQEDGTLRFVQIPAAQSALISLDPKDGAIRSLVGGFSFEQSNYNRAIQAKRQPGSSFKPFIYSAALDNGFTAASLVNDAPIVFVDEYLTFLGPIPLREALYKSRNMVSIRVLQGLGIERAISYITKFGFQRDELPRNFSLALGTATVTPMEIAGAWSVFANGGYKVNPYVIERIESRDGQVLYQANPPRVPVEPTPAERIIDARTAYIMTSMLQDVIKRGTGRRALALKRTDLAGKTGTTNDSKDGWFSGYNSDYVTSVWVGFDQPETLGRREYGGTVALPIWIRYMGFALKDKPMHTMAEPPGIVSLRIDPVTGRSAAPGTPGAYFEMFKNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein 1A
publication title Siderophore receptor-mediated uptake of lactivicin analogues in gram-negative bacteria.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transferase/transferase inhibitor
total genus 149
structure length 502
sequence length 746
ec nomenclature ec 2.4.1.129: Peptidoglycan glycosyltransferase.
pdb deposition date 2014-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
A PF00912 Transgly Transglycosylase
A PF17092 PCB_OB Penicillin-binding protein OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4oonA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oonA02
2FXQA 3PSIA 4JPMA 1W7FA 4GS3A 1H5XA 2XQZA 1KQSA 3Q7VB 2EXAA 2AWOA 3BZKA 5FQKA 3ZG8B 3W5OA 1XA7A 3CMEA 1KGEA 4UP9A 4O2DA 3IF6B 1A63A 3OTOL 2ALYB 1ZKJA 3D4FA 2BLSA 5FASA 2Y2IA 4K0KL 4LF8Q 4DKAC 1IBLL 1IELA 1LLBA 4YWKA 4JKTA 3BFEA 3I4NG 3CPFA 3V39A 5KSHA 3DWZA 4Y0OA 3ICEA 4OOYA 3MFDA 3ZG7B 4BBSH 1NYMA 2KHIA 4DR5Q 4X6AH 1X6OA 4PZ8A 1YLYA 1EI5A 1VQBA 2Z0SA 3C4OA 1Z47A 2ZC5B 1NY4A 3PBQA 5CHUA 1X54A 4POGA 5FQJA 2F52A 1ERQA 4DPGA 1X56A 5ELNA 5AQAA 3GTPH 4LCMA 1DJBA 4JI5Q 1K83H 3V50A 4O0AA 5EVID 4U0TA 3FKIG 2AWNA 4YWLA 1L0FA 2OSUA 1EQQA 2YYZA 1VQGA 2A19A 4OQIA 4AYBE 5JEAG 1V9PA 1K54C 4U3TA 4GD6A 1Q1BA 4FCFA 2G2UA 1TVFA 5KSCA 3HLGA 4A3FH 5C3EG 1BLCA 1IBMQ 2WB1E 4JI6L 5IWAL 4JI2L 3MXSA 4P87A 1X3FA 3JC66 4DV6Q 5GQOA 5DF9A 5AJ3L 4IVKA 1A62A 4Q8IA 2NZHA 2RL3A 1UE1A 3SH8A 4KHPL 2HP5A 1K57C 5GADC 3I4NH 3RLFA 1BUEA 4R4TA 4AQYL 1SRUA 5FQMA 4UY8C 1D7QA 2Y2LA 4A3GG 5LMNW 2JEBI 2F4VL 3FYZA 4K91A 2WKIA 4Y52H 4XUXA 2IWBA 3VP1A 1KRSA 5IP9G 1GO3E 4ZJ3A 3ZG5A 4ZAMA 3W4QA 1JWPA 3PUVA 2NZOA 3S22A 3M85A 1E3UA 4H02A 2Y4AA 4NK3A 3OCLA 2JE6I 3MZFA 1CKNA 4R0QA 1XGJA 3GTJH 4HJ9A 4GKKL 4IBXA 3E0EA 3HL9A 3G32A 2OLVA 3NI9A 3TQYA 4A3BH 4OH0A 5C3EH 2QEXA 3HKZG 5F1GA 3AGDA 4DE2A 5IY0A 3ER0A 4GN5A 4QU3A 3ZDJA 4A76A 1BLSA 1WJJA 1AXBA 3PBOA 1XMOL 3A3FA 4P72A 4KQQA 4ZTKA 1ERMA 3N8RA 1ES2A 1PYSB 2JA9A 2DGYA 5M5WH 3PF5A 2JEAI 2WZXA 3GTOH 4S2MA 1QVFA 4UPAA 1CUKA 1CKNB 2Q2IA 1VQ7A 1PH9A 4L5TA 4N1HA 5IP9H 4JI1L 4L5SA 4B88A 4JOIC 1YHQA 4KZAA 3GTGH 4WEKA 3GV9A 2ZQ8A 1I50H 1YLPA 2P9VB 1XXMA 1FQGA 1IYPA 2WGIA 2Y2MA 4A3IG 3Q82A 3CCEA 3IRBA 4GLXA 1CSQA 2VY3A 4NXML 3ZVWA 2QA4A 1W5DA 2YU9H 1FR1A 2JCHA 3RXXA 4HEFA 2ZQ7A 3HLDA 4R4QA 4A3LH 2XD5A 1RCJA 3PO3G 3G35A 3HVFA 3QNBA 2NVQH 4N9KA 3J7A5 3S1MH 4LUOA 1OXSC 3OTOQ 4GNXB 1CI9A 3IHBA 5IP7G 3ITAA 2Q2HA 4DAYB 3GRJA 1KAWA 1O07A 4K0KQ 4A93G 1IBLQ 3QNCA 2XGNA 2GVAA 5M19A 5C4XH 4QD4A 2G2WA 4E3KA 1NTGA 3K0XA 5F1FA 4JI0L 3A5UA 4DRTA 1VQLA 3LY4A 3HFZB 1PH6A 3ZFZA 3RR5A 3U4VA 4PM5A 1KVLA 4WELA 1YVCA 1NRFA 3B6YA 1Q82C 1ALQA 4P85A 1BVSA 4DXCA 1JWZA 3M4QA 1MPLA 4X55A 1KC8C 5HAIA 2YTVA 1Q86C 5GLBA 3UN7A 3J81i 5CGXA 1N4OA 1UWVA 5FAPA 4BJPA 4GKJL 3BECA 1N8RC 2N8NA 2ZQCA 2K5HA 2HPBA 1GHPA 3WRTA 2PMZE 1WCMG 1X9NA 3E9HA 1MY8A 1E24A 1GA0A 2A49A 2ZJ9A 4X66L 4IJHA 4Y0UA 5F83A 4JI6Q 5IWAQ 4BXXG 4JI2Q 3BLMA 5IP7H 4KZBA 3RZOH 2QGQA 3Q8DA 3F2CA 4CPKA 5AJ3Q 5C0XI 3GDEA 4NXNL 2HIXA 2RHSB 3SH7A 3DWKA 1IYJB 2ES2A 4KHPQ 2Y2HA 4AQYQ 1HJPA 3BJUA 4E6WA 1PYYA 3M2JA 5GAGC 3UDIA 2F4VQ 1J5EL 2ZQ9A 4BL3A 1HZCA 3S1RH 4YFMA 4JI7L 4DDSA 5LMNL 3LCEA 1EFWA 2BA0A 2NN6I 3ULPA 3PAEA 1QMEA 3MBZA 4TVAB 4OO1G 1PWGA 1H95A 5FI6A 3RZDH 3GTQH 1RL2A 4KZ3A 3H3VH 2UUBL 1E22A 4IPGA 4KG5A 3I2ZA 1YQSA 4GOPB 4KZ5A 4GKKQ 1WCMH 1PW1A 2R6GA 3O86A 3KF8B 1MXOA 1G51A 1G6AA 1Y54A 2Q2UA 1XGIA 1K56D 3OC2A 1S3OA 2ZJQA 1HNWQ 4OQHA 4BXXH 1WYCA 4LFBL 4QJFA 5TR7A 1QUQA 3CD6A 1BLHA 1WOCA 1U60A 1L0WA 2CWAA 1YJNA 5EVIB 2K14A 1EYGA 1XMOQ 1IXRA 3WS2A 1TWHH 4GLVB 5A92A 3V5MA 2OQKA 4JCVE 3LY3A 4XXRA 1YMSA 5AQBA 4WMCA 3JYIA 3S1QH 1HZOA 3G30A 3KOJA 1B70B 1AE2A 3C7VA 5JYOA 5CTNA 4OPZA 3GTCA 4JI1Q 3J80i 2D0PA 2HDRA 2JA8G 3PTEA 1ESUA 1FSWA 1W8QA 2RCXA 5C4JH 1Z9FA 3I7JA 1VQ5A 1PH3A 1PI5A 3MZDA 4K0WA 1P16A 4NXMQ 3W1BA 3CCVA 1UE6A 1FCOA 2PU4A 4C3QA 1N34L 3N7WA 4OOLA 1K25A 3EBEA 3A3EA 4RA7A 3TEHB 4HIDA 1VCIA 4HIMA 3NBHB 5C0XJ 2OTJA 3UE3A 4HJAA 4WZ4A 3BU2A 1VQEA 1YMXA 3VSLA 4JI0Q 3OPHA 3I7FA 4LUZA 4DAMA 3IF6C 2I5MX 2WZZA 1OXTA 4C75A 4ME3A 5EAYA 4YCWA 3TOIA 4LCLA 1E25A 2PQAA 2Z6KC 3NEMA 1HZ9A 3CF5A 1DJAA 2HDQA 5FSRA 3ZCZA 3IQAA 2ASBA 4A3CG 2X01A 3KLWA 5E2HA 5K36G 1IL2A 4X56A 4BLMA 4KG2A 1MWUA 1PH4A 3IXHA 5IYBH 3G2YA 2JA8H 1MWRA 5CECA 4R4OA 2RHQB 4GKJQ 2WK0A 5EVLA 5A91A 2ZM8A 1XNQL 2AHOB 2VW9A 5M5YH 3STBD 1TEMA 2V20A 4JBMA 3M6HA 2JA6H 2ZM0A 1GD7A 5GAEC 5ELOA 2H5SA 3G48A 4GDNA 3IT9A 2EXBA 3DTMA 3HLCA 1BKBA 1LL5A 4X66Q 4IO9A 4GN2A 3Q7VA 1FJGL 3CXCA 4EBPA 5GAHC 5HARA 4X6TA 1YLJA 4JF5A 1I5FA 4MTNA 4DV7L 1L2SA 1R9TH 3VFHA 2WP8J 4NXNQ 1NMFA 4YY3Q 1J6QA 4BBSG 1K4EA 1YLTA 4UA9A 3QHYA 3GQZA 2Z6KA 1NZOA 4LV1A 4R23A 3LGJA 2QPNA 1J5EQ 4WJ3M 2I72A 3CCJA 4C2MH 5BOHA 4KLKA 3N8LA 1TXYA 4JI7Q 1N33L 2F3IA 5LMNQ 3BRMA 1ONHA 4AYBG 3EQUA 3VOZA 1JWVA 4HJ8A 3M7NA 2BA1A 3GTMH 3NCKA 3L7ZC 1YEZA 2ZTCA 3ULJA 2DRWA 1G6PA 1BBUA 3HUMA 4KI0A 1ESIA 4B4XA 1K9MC 1RGZA 4DV1L 5C44G 4A3JH 1CEGA 2EIFA 3PUWA 2UUBQ 5E7NA 3A74A 1E1TA 3DM3A 4BY1G 4QB8A 4A3FG 2OTLA 1KE0A 3GSGA 4B3SL 4JXGA 2I5LX 1PYBA 5IYCH 3G71A 4AIMA 4FDBA 3CC2A 4JBJA 5KZHA 5HAQA 4RMFA 3N8SA 4LFBQ 4PM8A 2ZMAA 1FL0A 1HR0W 1E1OA 3K7UC 1FCNA 2OLUA 5U47A 4OVDA 1VQDA 3C5AA 2YTYA 3HUNA 4JXSA 4D2OA 4RVAA 2IX0A 2WAQG 1HNXL 4DV3L 3IH9A 3UPPA 5GLCA 5EPHA 4DV5L 1PHJA 4TQUS 3S2DH 3OPLA 1BULA 4A3DH 1WE4A 2EX9A 2ZC6B 3D31A 2GVBA 3VMAA 4RYEA 4JBWA 4R1GA 2ZC7A 1VQJA 2Y2NA 5E43A 2E5LL 1K56A 4DF6A 2B63H 5JJIA 5C44H 3MXNB 4UA6A 1IZ6A 4JYAL 1IBKL 3CCQA 2KCTA 1JB7A 4ALPA 2WADA 1QMFA 4A3BG 3PGZA 4BY1H 2NVXH 1LM0A 1JT8A 5CXWA 1FVIA 4DR7L 2ZLYA 1GM5A 3KJOA 1N34Q 3WS1A 2K5NA 3ZGAB 1UEBA 3PIPA 3A5ZB 3HREA 1Y14B 4YHHL 4IEDA 5BR8L 4LNQA 4BY7G 1E7ZA 2Y0SG 4OLDA 1N36L 2XLNA 4JV5L 5FQIA 1WI5A 2N3SA 1B7YB 4BA2I 4YINA 4GNXC 5GROA 4L5RC 1KE3A 4Y0TA 1YJ9A 3Q81A 1BSGA 1PH2A 3UDFA 4N92A 5FQ9A 3I55A 4FH4A 1M6KA 1K0RA 2Y91A 3IH8A 1D8LA 1S40A 2ZJRA 4B3RL 4LF4Q 3ITBA 5AQ7A 5H1SE 1JTDA 2AMCB 4JF6A 1KE4A 1LTLA 1KRTA 4M3KA 1XNQQ 1PI4A 1JE5A 4DNIA 4A3LG 2UXCL 1QVGA 3A0JA 4DR1L 3H3VI 2P9VA 2OWOA 3O87A 4DE3A 3ULLA 4PZ7A 3GTLH 1HNWL 1FJGQ 5C4XG 2V1CC 1S0WA 3KYHC 5AQ9A 1RIPA 1E3PA 2K75A 5IE8A 4DV7Q 1YJWA 5DTTA 1SMXA 3CG5A 3G4PA 4GN4B 1YT4A 4AH6A 4L5QA 3Q7ZA 3ERSX 5E2FA 4BY7H 3O3VA 4GNXA 2VNUD 2WUQA 4QHCA 1UE5A 4DE0A 4R4SA 4JC0A 1I5QA 1P8LA 1YITA 3ZVTA 4L0LA 5GHYA 4NPSA 3NC8A 3IWQA 4B4ZA 1N33Q 4PMWA 1SROA 2Y2OA 3J7ZC 3CJMA 3KF6B 3WWVA 3UNWA 1C7YA 3BM6A 2BH8A 1Q8KA 1EOVA 2UUCL 1KHIA 4DV4L 3RNUA 4LF7L 3RLNA 4OONA 4DV1Q 4EBLA 4EX5A 3S1NH 2UUAL 1PVOA 2LSSA 1G68A 1NYYA 5GLAA 4OO1I 1JJGA 1WYDA 5G18A 1L1OB 4B3SQ 4FSFA 4LV2A 3WRZA 4P71A 4S2IA 5CEDA 1EWIA 1GA9A 1VQMA 2V1ZA 3V3SA 4X65L 4O7DA 2EFXA 1K8AC 1SHVA 4Z9QA 1I3QH 2WYXA 2KBNA 5KMWA 2C35B 3BZCA 4GOPC 4DE1A 1IYOA 1VQ4A 4N1XA 2EXDA 4WZ5C 3VSKA 3HBRA 1HR0L 4E3NA 4A3KH 1HNXQ 3D0FA 5L2FA 5IT9c 3AEVA 4DV3Q 3S16H 2JE5A 3E9IA 2XFTA 1JJCB 2N78A 3A3IA 1YLZA 1VM1A 5EE8A 1IYSA 4DXBA 4MBFA 4IPDA 4DV5Q 4RX3A 3TRZA 5EVIC 3HKZE 3GD7A 5M18A 1TWGH 4KHZA 2PNHA 2WAEA 5HY6A 1NXYA 4QIWE 4P75A 2E5LQ 3A3JA 3HOYH 2R92G 4APVA 2IWCA 4S2OA 5HGQA 5J3BA 4JYAQ 4DR3L 1IBKQ 5HAPA 2E8GA 1GHMA 5CGSA 1L0GA 3S24A 3IXGA 3RJUA 4LWCA 4DR7Q 4X53A 4ID4A 1NJ4A 3TS0A 1LL9A 4MBHA 4DV2L 4OQGA 3JAMc 4QY7A 1ES4A 1Q81C 4LF9L 3K80C 4YHHQ 4X69A 4GOPA 4YY3L 1CEFA 5BR8Q 3ZG0A 1VQNA 4WZ5A 2ID0A 1N36Q 3CC4A 2HP9A 5TGFA 4JV5Q 3P09A 4KZ4A 2ZM6L 1YHAA 3M4PA 5CRFA 2MFIA 2ZD8A 4MZ9A 1W79A 3CCMA 4JLFA 2UXBL 4OKPA 1M90C 5EOOA 3OCNA 1W8YA 5EVIA 4HBUA 1GCEA 4BBRG 1W2BA 2Q2TA 1XPOA 1VQKA 5CHMA 2H5XA 4B3RQ 1MWSA 2EX6A 1YI2A 3FKWA 1HZAA 3K8AA 2PI2A 2B3GA 3LO7A 1N9WA 4HESA 1Y1VG 4QL5A 5M3FG 5HW3A 4OWTB 1B8AA 2UXCQ 2HDSA 5IHVA 2R92H 3H0GG 4DR1Q 4OLGA 3FV7A 1RGYA 3CCLA 4LV3A 1VQCA 1YM1A 4GNUA 4LFCQ 1QZHA 2R93G 3L2PA 1HD8A 1Q1EA 2IHEA 4C3HH 1H8ZA 4GB7A 2WGVA 4R4CA 2LXJA 2FFYA 3NDEA 3SS3A 3P98A 1TWAH 4OP5A 3PUYA 1K3RA 2X71A 5CGWA 1K55A 1T9HA 2HDUA 1K6SA 3PBRA 4JXVA 2XTIA 5DTSA 2P74A 3AFPA 3NY4A 1KGFA 4MEZA 5FI7A 1EIFA 5IYBG 3PIOA 1L2FA 2PI2E 2BH2A 1IKGA 4IBRA 4BBRH 1X3EA 3OW2A 2XK1A 2ZQAA 3CCRA 1VQ8A 4IFDG 1MBLA 1KGGA 2EX2A 1ASYA 1Q2PA 1ZG4A 5JJKA 3KDFA 1EWZA 2UUCQ 2JA6G 4DV4Q 4LF7Q 2BG1A 1VQAA 1IYQA 3CC7A 1Y1VH 1C9OA 2UUAQ 5M3FH 1YIJA 2CCZA 1Q2QA 5EUAA 4P6BA 2ZJPA 1KDWA 5IYDH 3CW2C 4GOGA 4JI4Q 4FD8A 3EQVA 2EQSA 3H0GH 3KJPA 3F1ZA 4S2PA 4X65Q 1XJVA 3DLLA 4LFAL 3AGFA 4OX9L 4KQRA 1E3UD 3CMAA 2R93H 4KZ8A 3F8TA 2Y55A 2C6WB 3PBSA 4EBNA 2Z2LB 2ZQDA 3AGEA 2H0YA 4P74A 3HLFA 1HR0Q 1PA6A 3F2DA 3KDFB 2WKHA 2UWXA 4LF6L 2MO0A 2A1AA 3FP9A 2H10A 2NN6G 4LF4L 1FGUA 4LUVA 1KDSA 5DTKA 4ZJ2A 1NMGA 4A3JG 4OQ0A 1VQOA 3CQZH 5JJLA 3H15A 2VS1A 4C3IH 2ZC4B 1KL9A 4UP7A 2C5WB 1KD1C 1Y1WH 4GZBA 3HLBA 3EN2A 2R7DA 3DW0A 3MXRA 1PH1A 4DR3Q 5IYCG 1M1KC 4IPHA 1S6RA 3G34A 3VP4A 4GDBA 4PMAA 2VGJA 3UPNA 4DV2Q 5DVAA 4LF9Q 2HT1A 3VP2A 4EV4A 3I56A 2ATWA 4BA1I 3BEBA 2JA7G 2ZC3B 3HLWA 3K81C 1XTDA 1LI9A 3J81j 2DCFA 3SS5A 4POFA 2OCEA 2ZM6Q 4OWXB 4S2KA 2XFSA 3UY6A 1SN8A 1K8GA 4Y7NH 1OMEA 3AFQA 3G4SA 1PH7A 4KQOA 3TSGA 2B29A 4E3LA 2UXBQ 1CI8A 4DR2L 1SKFA 4A3DG 5I94A 3TS2A 3M9BA 1ZG6A 4OXPA 4ZBEA 1MIUA 4UA7A 1A8VA 1V43A 2WB1G 2B63G 3HLEA 4JI8L 1EROA 1X55A 1X65A 4X64L 4Y7PA 1XPRA 2Q9MA 4DDYA 4HIKA 1AH9A 5M3MG 4HJ7A 1XPUA 4OPYA 3S14H 1YNXA 1NJIC 2X02A 2UU9L 1DY6A 4OPQA 3N4IA 4RG1A 2DNSA 1BZAA 1N32L 5CEBA 1SFOH 2QZ6A 2E2HH 4OPRA 3TG9A 4FH2A 3S17H 2JA7H 2Y2GA 2EFUA 4GKUA 3PBNA 5FAOA 4JI3L 2VUMG 3M4OH 4BENA 3S15H 1VQQA 3PO2G 3UO9A 1XP4A 2JK8A 1C3BA 1JVJA 5FDHA 4S2NA 2K4KA 2XR0A 5FQQA 2KENA 4P0MA 2E2IH 4XTCS 1SDNA 4UP8A 3HUOA 3VFFA 1VQHA 4S2JA 3FZCA 3W1GA 1BBWA 1EQRA 1PWDA 3VP3A 4A4IA 3HOXH 1BLPA 1PZOA 3HOVH 3BLSA 3AQQA 1Q12A 3IWOA 3NBLA 1XA1A 1HZBA 1NE3A 4X68A 5FLMG 4WBGA 3RN5A 4C6YA 5M3MH 1XPBA 5JEAJ 3Q1FA 3U4ZA 2NVTH 4A3MG 4ZJ1A 1K4FA 3MKFA 4LFAQ 1I2WA 1XNRL 4GLAC 2N49A 1G291 3OZHA 4MBKA 4OX9Q 5GL9A 4JF4A 5CTMA 4E6XA 4KZ7A 1ASZA 1L1OC 1PIOA 2R9WA 1IEMA 4BL2A 5FATA 4GN3B 3BFDA 2IWDA 1EIYB 4B3ML 4BD1A 3S1YA 3GR2A 2VUMH 2PU2A 1SR3A 1LI0A 1S72A 4MNOA 1HNZL 2NVYH 1WFQA 3G6EA 4LF6Q 2WGWA 4LV0A 3PO2H 3CZDA 3T1YL 1SE8A 5J8XA 2UXDL 4PZ6A 3STBC 4EUZA 2XDMA 2IX1A 1SLJA 3WS0A 2OQ0A 1LHYA 2JBFA 1C0AA 2XEPA 2K52A 1NZUA 4PPRA 4CJNA 4S2LA 4WMCD 2OV5A 3KF6A 5A93A 2RF4A 5DLQE 2WAQE 1E4DA 3MZEA 4DV0L 1MKIA 4UHUA 1K54A 1HH2P 4B3TL 5FLMH 2R7FA 1OXXK 4LFCL 1RP5A 1FR6A 5D3OA 5JYPA 3FKIH 4R3BA 4A3MH 5HL1A 3GO5A 4WEJA 1DGSA 5TFQA 3M6BA 4X62L 1L1OA 2Y2QA 2WGWB 2VQFL 3UDGA 5GLDA 3PUXA 4A3KG 2WKEA 3Q07A 1K57A 1K73C 3IXDA 4DUYL 4JXWA 4JG2A 5FI2A 5CHJA 1DJCA 3S4XA 1L0EA 2FFFB 2D0OA 2I0QA 2ZTDA 4DR2Q 3HOZG 3PCOB 4ZDXA 1OXVA 2PBYA 5FLXc 4A3GH 5HFOA 3W8KA 3SGIA 4DK3C 2CKZB 3HOYG 1PH8A 3CAMA 5DF7A 4JI8Q 1O7EA 2Y0SE 3J81c 1PFSA 2JC7A 1GHIA 1TWFH 3UE0A 1VQ6A 3IF5A 4X64Q 4PM9A 1I94L 5E2GA 4WYYA 4JI4L 5LMUL 3HOWG 2Y2PA 1Q46A 3FKVA 2VZAA 3E2KA 1UE7A 1QZGA 1ES3A 2L15A 3K7AH 3MKEA 1W3SA 1A0IA 1YHBA 4F94A 2UU9Q 3M3YH 3S2HH 1N32Q 4LF5L 5FA7A 3WS5A 2XD1A 3IWIA 3I4MG 3U50C 3RLOA 2JJQA 1K6RA 3PUZA 4JI3Q 2ZTEA 4RX2A 3HOUG 2R7ZG 4P73A 1KVMA 3AYHB 3G2ZA 3CCSA 2J9PA 3HOZH 1H8YA 3C7UA 5CERA 3HKSA 2Z2MB 3PF4A 1XKZA 4HJ5A 4JOIA 1FSYA 4E3IA 2D62A 5M1AA 1CKOA 1TDGA 4IFDI 4MNRA 2YTXA 1K38A 2K50A 3WS4A 4XUZA 2IHFA 2VQEL 3HOWH 4DUZL 4IOCA 4A3IH 1I6HH 5GHZA 1XNRQ 4N9LA 1TDLA 5E2EA 2GN5A 1PWCA 5EECA 2HP6A 3PO3H 4PG3A 2HIVA 4A3EG 2MQHA 1XMQL 1BTLA 1N9BA 4PM7A 1ES5A 2XF3A 2H0TA 4E3MA 2HQLA 4DR4L 3I4MH 2J8YA 1VS0A 2YV5A 1VQ9A 4A93H 1K55C 4B3MQ 3ZHHA 2HHHL 3HOUH 2R7ZH 3MEFA 5GHXA 1HNZQ 4JBKA 3NENA 4HBTA 3T1YQ 4A75A 4QY6A 2UXDQ 1GVPA 3CMZA 1CKMA 2Y59A 2WAFA 3T1HL 3O88A 4LENA 1SCWA 1LYLA 1YLWA 3J80c 1HVBA 3RN2A 4DR6L 1NY0A 5IYDG 3ZNTA 4R1JA 4QGUA 1KIXA 2CC1A 2EX8A 2AKWB 5DF8A 1SDEA 1YBYA 5FAQA 4DV0Q 1MKHA 4YCUA 4B3TQ 3GVBA 3UDXA 3JAMi 2VL6A 4BD0A 3NIAA 3SS4A 4WM9A 4H8RA 4QQBX 3PAGA 1PV4A 4X62Q 4EQIA 2XGTA 4A5RA 4LF8L 2VQFQ 3F2BA 4A3EH 4KZ6A 1JMCA 1OXUA 1U5KA 2A3UA 3IHAA 4DUYQ 1IKIA 3W4PA 1PZPA 4OOMA 2JQOA 4E3OA 2A8VA 3PV0A 4DR5L 2KCMA 1FCMA 2Q9NA 3GMWA 3CCUA 3VP0A 3L0OA 4YWMA 1QVCA 3NELA 4PM6A 3I4OA 4C3JH 3RXWA 4WJ4A 3ZNYA 2K5VA 1Y1WG 2CFMA 4KENB 3OYYA 3GTKH 2B5RA 3W4OA 4IFDJ 3E2LA 4JI5L 3UE1A 1I94Q 4J15A 5LMUQ 2J9OA 1WYBA 2KHJA 1LUZA 1ONGA 2V2FF 1GKHA 1JTGA 1O7IA 1VQPA 2XH9A 1PH5A 1QUQB 5C0XG 3BFFA 2IY5B 1IBML 1YZ6A 3KFUA 3LEZA 1X3GA 3NDGA 4LF5Q 2R9XA 4R4RA 4UAAA 4DV6L 4NB3A 3PBTA 3BFCA 4R3JA 5FJ8G 4K0XA 2VGKA 2RCNA 2WFWA 2MO1A 5HX9A 5A90A 2CWPA 1MJCA 1VQIA 5M5XH 3EIVA 3M2KA 4QY5A 1OTCA 1JJ2A 1U0LA 4HIOA 3ZG9B 2DUDA 4DKIA 3V3RA 3OPPA 1MJEA 1ZC2A 1CK3A 3WWXA 2J7VA 4IVIA 1Z6FA 2JA5G 4MLLA 3B3XA 4E3JA 1KXLA 2E8IA 2E2JH 1V1QA 2GDNA 3BFGA 2IT1A 3CPWA 4NETA 3SOIA 3FHWA 3FWLA 4EQ5A 4KZ9A 3BYDA 1BT5A 1VQFA 4JBFA 5F82A 1FOFA 2CQOA 2VQEQ 1L0DA 1TWCH 4DUZQ 3A3DA 4DK6C 1PW8A 3TREA 4LW1A 3ISGA 1M40A 4IOAA 2I5HA 2QMIA 4XIGS 4YCVA 4BQMA 3VDYA 3IXBA 2MNAA 4IJLA 4GD8A 4QJGA 3OPRA 4U0XA 3N6IA 1XMQQ 2LXKA 1Q7YC 2PQAB 2Y2KA 2Y2JA 4OP8A 4R4IA 1HTZA 4DR4Q 5FJ8H 3G31A 3IF6A 3U58A 4OWWB 5EOEA 2HHHQ 1XX2A 1I2SA 4KG6A 1MWTA 4IPCA 1CSPA 1NBWA 4EWFA 2ZM2A 4S2NC 3ZJYC 3C4PA 3HOXG 1EUJA 3CP0A 2JA5H 3T1HQ 3HOVG 3VOYA 1AE3A 1J9MA 4A3CH 4DR6Q 3SH9A 3UPOA
chains in the Genus database with same CATH superfamily
2FXQA 3PSIA 4JPMA 2EPBA 2SEBD 1W7FA 4GS3A 3S7PA 3Q23A 2LB9A 2EY5A 1PFBA 3NULA 1H5XA 2XQZA 2R61A 1KQSA 3Q7VB 3OLOA 4CDCC 2EXAA 2AWOA 4WFN3 1V8QA 5CBAE 1LTTD 2RVLA 3MEHA 3Q24A 1Y4OA 3BZKA 5FQKA 3ZG8B 3W5OA 4A3JB 2X6GA 1G91A 1XA7A 1SYEA 3CMEA 1KGEA 4UP9A 4O2DA 2C5CA 1ONLA 3FPVA 1OTIA 1S5DD 3IF6B 3LWEA 1S1ZA 1A63A 1BYWA 3OTOL 2LKVA 2ALYB 5KYIA 2B2WA 1S4SA 1ZKJA 5ELEA 3D4FA 1QE6A 2M7UA 2BLSA 1B44D 5FASA 2JKTI 2RCFA 2Y2IA 4K0KL 4LF8Q 4DKAC 1IBLL 1IELA 1LLBA 4TRDA 4YWKA 2K2NA 4JKTA 3BYTB 3BFEA 3I4NG 3CPFA 5NUCA 3TMEA 3JVUA 2EYJA 5AFWA 1P9RA 1JICA 3NK9A 2L1MA 2W3EA 4UQIS 3TW8A 3DWZA 4H6JB 4Y0OA 4KD4A 1D5XC 3ICEA 3EGXC 5F68A 1HQMC 1GHKA 4OOYA 3MFDA 1SFOB 3ZG7B 4BBSH 1C8CA 1NYMA 1PTOD 2KHIA 4DR5Q 2K03A 1X6OA 3S17B 4PZ8A 4X6AH 1YLYA 4DK0A 3P7NA 2F0EA 2M00A 2JA7B 1EI5A 4RGNA 1NSNS 2QDBA 1VQBA 2ENBA 2YKFA 2Z0SA 1JWSD 4Q0JA 3C4OA 1Z47A 2B2VA 2ZC5B 1FR3A 1NY4A 3PBQA 4RGMA 2PYKA 3MA2B 2F0WA 5CHUA 1X54A 4POGA 5FQJA 3JAME 1STYA 3M4OB 2F52A 1ERQA 2GX5A 4DPGA 1X56A 4EEUA 3S15B 1MHWC 5ELNA 3S2DB 2E8JA 5AQAA 1FNUA 3GTPH 4LCMA 1DJBA 4AYBB 3DTKA 4JI5Q 1K83H 1HA6A 3W3AA 3RMHA 4A3DB 2WV6D 3V50A 4HP9A 3IX3A 4O0AA 2JKTM 2P04A 4U0TA 5EVID 2HDMA 2AWNA 3FKIG 4YWLA 1L0FA 2OSUA 1EQQA 3CUEA 2YYZA 3H7WB 1VQGA 2A19A 5K5PA 1XYIA 4AYBE 5JEAG 1V9PA 4OQIA 1K54C 4U3TA 1LT4D 2WB1B 4KY5A 2B63B 4GD6A 1Q1BA 3U9SA 4FCFA 1SYDA 1KDBA 1OT9A 5C44B 2G2UA 1TVFA 3T51B 2ZL1A 5KSCA 3HLGA 4A3FH 5C3EG 1CA5A 1IBMQ 1BLCA 2K6AA 2WB1E 2EOTA 4JI6L 4BY1B 5IWAL 2NVXB 4JI2L 3IAYA 1IW7C 1F2ZA 3MXSA 3W2ZA 4N9TA 4G57A 4P87A 1X3FA 3JC66 4YWZA 4GS9B 4DV6Q 5GQOA 3S7NA 5DF9A 5AJ3L 3SDZA 4IVKA 1A62A 3FG8A 4Q8IA 2NZHA 2RL3A 1UE1A 2NVTB 2Q8TA 3SH8A 1HUMA 4KHPL 2HP5A 1K57C 5GADC 3PMFA 3RLFA 3I4NH 2EYOA 1BUEA 4R4TA 4AQYL 1SRUA 2M2LA 1UUPA 4DAPA 5FQMA 3VE4A 4UY8C 1D7QA 2Y2LA 3HGBA 4A3GG 5KEEA 5LMNW 2JEBI 2Q8IB 2F4VL 5T1GA 3NTIA 1DONA 3FYZA 4K91A 2WKIA 4Y52H 4FXDA 4X1MA 4V0BA 4XUXA 2IWBA 3VP1A 1KRSA 2B18A 5IP9G 1GO3E 2XFTA 4ZJ3A 3ZG5A 4ZAMA 2VGLS 2WAQB 2OAP1 1W6KA 3H9WA 2F0NA 3W4QA 2VUMB 1JWPA 3PUVA 4I39A 4FYDA 2NZOA 4XQQA 3S22A 3M85A 1E3UA 2ZL1B 3MVVA 4H02A 4KJOA 4WUJA 4OEMB 2D9UA 2Y4AA 4NK3A 3OCLA 4OELB 2JE6I 1T1CA 3NHQA 3MZFA 1CKNA 1HXYD 4R0QA 3SEBA 5AVFA 1O80A 3NBIA 1XGJA 2A68D 3GTJH 4HJ9A 2V1AA 2PZTA 1K8MA 4GKKL 4IBXA 5LL6X 3E0EA 3ZYYX 1C48A 5JEAH 3URYA 2LB5A 3HL9A 5DKKA 1WVLA 2A24A 4NEED 3G32A 2KQ3A 4DNTB 5BN4A 2OLVA 1NCVA 3NI9A 2L0WA 1SNPA 3TQYA 2NUTC 4A3BH 3MSHA 5KIZA 1YKDA 4OH0A 3LI9A 5C3EH 1XFNA 4G3VA 2QEXA 3BQ8A 2XIWA 3PHYA 3HKZG 3TP5A 5F1GA 1LACA 1SNQA 1DZ1A 3AGDA 4HY8A 2SNMA 3BG3A 5IY0A 3ER0A 4GN5A 1HHVA 4DE2A 4ETZA 4QU3A 3D3OA 3ZDJA 4A76A 1BLSA 3VR4A 5I6YA 1NR2A 1WJJA 1AXBA 4PQXA 3PBOA 1XMOL 3L9KA 3A3FA 4P72A 4KQQA 4ZTKA 4KKTA 1ERMA 1OTDA 3N8RA 1ES2A 1PYSB 2A73B 4DA2A 2JA9A 1AWIA 2DGYA 5M5WH 3PF5A 2O9CA 1FD7D 2JEAI 3LUQA 2PR6A 2B95A 2WZXA 3GTOH 4S2MA 1QVFA 2XWJB 4K8IA 3I72A 4UPAA 1CUKA 1CKNB 4I3JA 3UMEA 2KEEA 4WORA 5M9OA 1F98A 3A0VA 4NXEA 2Q2IA 1VQ7A 1PH9A 4L5TA 4N1HA 5J4EA 4EVOA 5IP9H 3CHBD 4JI1L 4NKPA 1MBYA 2I07B 4L5SA 5EM0A 4JOIC 4B88A 1YHQA 4KZAA 3GTGH 1DRMA 4WEKA 5JPMC 3GV9A 2ZQ8A 4GHIA 3IS2B 1I50H 1YLPA 3LIFA 2AQ2B 2P9VB 1XXMA 1FQGA 3SK5A 1IYPA 2WGIA 2Y2MA 4F88A 1RF2D 3NWSA 4A3IG 1JOQA 3Q82A 3CCEA 3IRBA 4GLXA 1KNAA 4FXGC 1CSQA 2VY3A 3H6MA 2W3HA 5TBMA 4NXML 4X1LA 2QA4A 3ZVWA 1W5DA 3DHQA 2YU9H 4GZYC 2Q8RE 2W1TA 5EKKA 1FR1A 2AVXA 4HOIA 3FPUB 2JCHA 3RXXA 2LMCB 4HEFA 2ZQ7A 3HLDA 4R4QA 4A3LH 4CDDC 3DWPA 2K28A 1HTPA 2SNSA 3S1NB 1RCJA 2XD5A 3PO3G 3G35A 3HVFA 3QNBA 4CQHA 2NVQH 3HCYA 2LS01 3KLSX 3J7A5 1BXTA 4N9KA 3S1MH 2EY1A 1BOSA 4LUOA 1OXSC 3T16A 3OTOQ 4GNXB 1CI9A 3IHBA 3LYXA 5E4XA 1HLUP 5IP7G 3ITAA 2Q2HA 4DAYB 2EJMA 4X3TA 3P7JA 2FMMA 3GRJA 1KAWA 1O07A 4K0KQ 4A93G 1IBLQ 2WKCA 3QNCA 5C4HA 2XGNA 2GVAA 5M19A 2J3TC 2M1CA 3H82A 3K7AB 5C4XH 4QD4A 2G2WA 4E3KA 1NTGA 1A2TA 2F0QA 3K0XA 1D7EA 1EYCA 5F1FA 4JI0L 3A5UA 1G2TA 1VQLA 4DRTA 2GZAA 3LY4A 3HFZB 1PH6A 3ZFZA 3LIEA 4ZQ3A 2HQEA 3RR5A 1TS6A 3ITPA 3Q22A 3QP1A 1I4QA 2EE1A 3N6RA 5FO7B 3U4VA 4GHIB 1GSXA 1KVLA 4PM5A 2K01A 4WELA 1YVCA 5I2XA 3B6YA 1Q82C 1NRFA 1G6ZA 5L37A 3MZ5A 3SVMA 1ALQA 4R3AA 3DTIA 4P85A 3VA5A 1V1PA 5IOCA 1BVSA 4A3KB 4DXCA 1JWZA 2WKRA 4BQMA 3M4QA 5IGCA 5EQ0A 1MPLA 4X55A 1KC8C 1T1BA 3S16B 5HAIA 2YTVA 1Q86C 2W1TB 5GLBA 1UWNX 3UN7A 1SJED 3J81i 5CGXA 4CHTB 1N4OA 2PYPA 1UWVA 2JN4A 2GJ3A 4I38A 5FAPA 2PMZB 4BJPA 4LMQD 3OWFA 4GKJL 1TWGB 3BECA 1EU4A 2NTTA 3R7WB 1N8RC 2N8NA 2ZQCA 4P6ZS 2K5HA 3K59A 4ZK9B 4X3KA 2HPBA 2IJ0A 1GHPA 3WRTA 2PMZE 1WCMG 1X9NA 2L5TA 3NE5B 3E9HA 1D1KA 1D2BA 3CKIB 2XROA 3HOYB 1F9IA 5FLXL 2D01A 4HMIA 2XA7M 3IX8A 1X32A 1E24A 3A8KE 3SXHA 1MY8A 1GA0A 3CU7A 3NECA 2A49A 2ZJ9A 4X66L 4IJHA 4Y0UA 5F83A 4JI6Q 5IWAQ 4BXXG 2XRSD 4JI2Q 1B50A 5DEHA 3VR5A 1XX8A 2Z6CA 3BLMA 5DM63 5IP7H 4KZBA 3RZOH 2Z9HA 2QGQA 3Q8DA 3F2CA 4CPKA 2NYZD 4ZUJA 1V1PB 5AJ3Q 3IX4A 5C0XI 3K2NA 4KJNA 3NOPC 2KA7A 3GDEA 4NXNL 2HIXA 2RHSB 1DCZA 3SH7A 1D5MC 1IYJB 2ES2A 2KUMA 4KHPQ 3DWKA 1PRQA 2Y2HA 4AQYQ 3C30A 4KUKA 1HJPA 3BJUA 3LIDA 3TDQA 4E6WA 1PYYA 3M2JA 3V05A 5GAGC 3UDIA 5IIFA 2F4VQ 4C3JG 1J5EL 3PR6A 2SOBA 2YKHA 2ZQ9A 1MZUA 4BL3A 1HZCA 3ERQA 3S1RH 3RD4A 4IUKA 1P0ZA 4R6LA 4YFMA 4JI7L 1EOTA 4FTXA 4DDSA 5LMNL 3I4MB 4OGQC 3LCEA 5E4WC 1EFWA 2BA0A 1TR5A 4L8JA 2NN6I 1TS0A 1N9OA 4ARZA 2EYLA 3ULPA 2R7ZB 3PAEA 1QMEA 4QWOA 1EWCA 2O4XA 3MBZA 4TVAB 1PRTD 5A35A 3NUCA 4OO1G 1PWGA 3BQAA 1H95A 5FI6A 3A0SA 3RZDH 3GTQH 1RL2A 4IUTA 4KZ3A 2PW7A 3H3VH 1PTOB 2QCPX 5KYLA 2UUBL 1E22A 4IPGA 2JSOA 5JPNC 5CORA 4KG5A 4EEPA 1IOUA 3I2ZA 5AVEA 1YQSA 1YNJC 1LT5D 3D6WA 4R70A 3F1PB 4GOPB 3Q0AA 4KZ5A 4GKKQ 1WCMH 2L1BA 3QP5A 1OT6A 1PW1A 2R6GA 1S5ED 3O86A 3KF8B 4DXGA 3SK6A 3VOLA 1F2MA 1I6VC 1MXOA 1G51A 3TSSA 1G6AA 1Y54A 2Q2UA 1XGIA 1K56D 2X69A 4OIJA 3GV3A 1SAPA 2VK3A 3A8IE 5CV5A 3OC2A 1I4XA 1S3OA 2TMPA 2ZJQA 3T4KA 5COYA 3MC0B 1HNWQ 2J0TD 4OQHA 3PYPA 4H13C 4BXXH 1WYCA 4LFBL 1WTPA 2F0PA 2KLIA 1HFGA 3T12B 4QJFA 5TR7A 3BJNA 4EXOA 1QUQA 3CD6A 1BLHA 1WOCA 1U60A 1L0WA 2HGVA 5AJGA 2CWAA 1YJNA 5EVIB 2K14A 1EYGA 1XMOQ 1IXRA 3ND8A 3WS2A 1TWHH 1BUVT 3T1RA 4GLVB 2BDNA 5A92A 3V5MA 2OQKA 4JCVE 3LY3A 4XXRA 1XJ4A 1TWAB 2IX3A 1FNVA 2MJ8A 1YMSA 5AQBA 4WMCA 3NTKA 4Y3IA 2BE5C 3JYIA 4KKUA 4WRDA 1EFID 3NSWA 3S1QH 1HZOA 3G30A 2C9OA 3NBHA 2D5DA 1B70B 3KOJA 1ZYRD 1AE2A 3C7VA 5JYOA 3UMDA 5CTNA 4H7BA 4OPZA 3GTCA 4JI1Q 3J80i 1TKWB 2D0PA 3C3LA 2HDRA 1R4PB 2JA8G 3P75A 4TSSA 3PTEA 3I73A 1HA5A 2ACGA 4BBRB 1ESUA 1FSWA 1HRJA 1W8QA 2RCXA 1XTCD 5C4JH 1CQAA 5D3IB 1Z9FA 3QP2A 4OO1H 1VQ5A 3I7JA 2H1EA 4B9OA 3R8BA 1PH3A 1PI5A 3MZDA 2XSSA 3V96A 1PFLA 2EJGC 4K0WA 1P16A 4NXMQ 3W1BA 1VETB 1EZ8A 2XWBB 1P9WA 3CCVA 1UE6A 1FCOA 4IN3A 4IUUA 3NOTC 2PU4A 4HHDA 2K31A 4C3QA 1N34L 3N7WA 3KBGA 4OOLA 3R2TA 3HJKA 1U4RA 3B33A 1K25A 2PO4A 5FL3A 3A54A 3EBEA 3A3EA 4QUCA 4RA7A 3TEHB 1AP0A 4HIDA 1VCIA 2WKDA 4HIMA 3HJIA 4WL9A 3NBHB 5C0XJ 2OTJA 3UE3A 4HJAA 1YSPA 1DD2A 4CLCD 4WZ4A 3BU2A 1VQEA 1YMXA 2R93B 4KHVA 1YNNC 3VSLA 4JI0Q 1Q3LA 1M8AA 2IL8A 5EGTA 3I7FA 3OPHA 4LUZA 4DAMA 3LNNA 3IF6C 2I5MX 5C5MA 1OXTA 2WZZA 4C75A 4ME3A 5EAYA 4XT2A 4YCWA 5A2QL 3TOIA 2WACA 4LCLA 5CYUA 1E25A 4FVMA 2PQAA 2Z6KC 5CV8A 3NEMA 1HQRD 1HZ9A 3CF5A 1IHZA 1DJAA 1EQTA 2HDQA 5FSRA 5HD3A 3ZCZA 3IQAA 3NQIA 2ASBA 4A3CG 2X01A 3KLWA 5E2HA 2QHKA 5K36G 5M5XB 1IL2A 4X56A 2NBFA 4O42A 4BLMA 1XWEA 5EKLA 4KG2A 1MWUA 1MC0A 5MC7A 4O1NA 1PH4A 1STNA 3IXHA 5IYBH 3G2YA 1QB5D 2NUPC 1XFQA 4Y17A 2JA8H 2L4NA 1MWRA 5CECA 2MHVA 4R4OA 2RHQB 4GKJQ 2WK0A 5EVLA 4IFDH 5A91A 3K5MA 1XNQL 2ZM8A 5L09A 2AHOB 2VW9A 3VYSA 5M5YH 3QP6A 3DWQA 3STBD 3QOLA 3CQZB 2RBMA 1TEMA 2V20A 1UNSA 4JBMA 1H8MA 3M6HA 2JA6H 2E2JB 4IHQA 4RKBA 2ZM0A 1CHPD 1GD7A 2F0SA 1Y1WB 5GAEC 1G28A 2HZ5A 5ELOA 2H5SA 3G48A 3ULFA 4GDNA 3IT9A 3V67A 1ODVA 2EXBA 1IYUA 3DTMA 3LR0A 3HLCA 1BKBA 3IBRA 1LL5A 4X66Q 4IO9A 1Y8PB 3WDNA 5DM73 1FJGL 3CXCA 3Q7VA 4F7XA 2B2WC 4GN2A 4EBPA 3BDOA 1LTGD 3C8CA 3KLRA 5GAHC 5HARA 4X6TA 1YLJA 4JF5A 2L9HA 2QKIC 1RHPA 1I5FA 4MTNA 1II3A 4DV7L 2O5JC 2XNAC 1L2SA 3FEWX 1R9TH 4LRYC 3VFHA 2WP8J 2HD3A 4LK1C 1NMFA 2F0UA 1J6QA 2N88A 4YY3Q 4NXNQ 4BBSG 1K4EA 3CHWP 1NR4A 1YLTA 3QHYA 4UA9A 3J81E 1LSXA 3ZYTA 3GQZA 2Z6KA 5EBDA 5C4ZA 3D9YA 1NZOA 4LV1A 5ELFA 1STZA 4UEYA 4K08A 4Y15A 4R23A 4IUHA 1SXTA 2PZWA 1TU2B 1JQYD 2IW3A 2EA9A 3LGJA 2QPNA 1J5EQ 4WJ3M 2I72A 3CCJA 4UAIA 4C2MH 5BOHA 4KLKA 1YAXA 4RH6A 4Y7NB 1TXYA 4CKCA 3N8LA 4JI7Q 1N33L 2A2LA 3C38A 4H6JA 1STAA 2F3IA 5LMNQ 4EQPA 1F9PA 3BRMA 1ONHA 4AYBG 3EQUA 3TJZC 3VOZA 3UB5P 1JWVA 4HJ8A 4HEDA 5K36H 3M7NA 2BA1A 3GTMH 3NCKA 1Z7TA 3L7ZC 1YEZA 1MD2D 2ZTCA 4WF0A 3ULJA 2DRWA 1G6PA 1BBUA 3HUMA 4FOFA 3K3CA 4KI0A 1ESIA 1NLZA 4GJ4A 4B4XA 1K9MC 1RGZA 4DV1L 5C44G 4A3JH 1CEGA 3MJQA 2EIFA 3PUWA 2UUBQ 1STEA 5E7NA 2ZOHA 3A74A 4GLQA 2OWJA 1I4PA 1E1TA 3DM3A 4BY1G 5IT9E 3CUEC 1F9RA 4A3FG 4QB8A 2OTLA 1KE0A 3Q6SA 3F1OA 1LTSD 4OL7A 3GSGA 1VF7A 4B3SL 4JXGA 3M7GA 2I5LX 1PYBA 3AMUA 2G7UA 5IYCH 1SMYD 3G71A 3VA7A 4AIMA 4LFUA 1MGSA 3H7WA 2G5DA 4FDBA 3CC2A 1PZKD 3S14B 4JBJA 2FH5A 5KZHA 1H9JA 5HAQA 4RMFA 4FP5D 4LFBQ 3N8SA 4PM8A 2ZMAA 2PRFA 3VR3A 2B2TC 1FL0A 1HR0W 1K3BC 1E1OA 3K7UC 1G2SA 1FCNA 2OLUA 2PD7A 2NB0A 5U47A 4OVDA 1VQDA 2E2HB 3C5AA 1CZWA 3C46A 4HR7B 2YTYA 4B9WA 2HDLA 4Q0HA 3HUNA 1U4MA 4TKOB 1H0MA 4GS9A 3AU7A 4JXSA 4D2OA 4RVAA 2IX0A 2XSCA 2WAQG 1HNXL 4DV3L 1BBXC 1LT6D 3IH9A 1AEXA 3UPPA 5GLCA 1WTHA 1ICWA 4XXEA 4JW0A 5EPHA 4DV5L 1PHJA 1H9RA 3QR8A 4TQUS 3S2DH 3OPLA 5HGTA 1BULA 3B47A 4Y2FA 4Z1WA 3F1OB 3T4LA 1G5UA 1OTBA 4XYQA 4DN4M 1ESRA 4A3DH 1VMCA 1WE4A 2EX9A 2ZC6B 3D31A 1T5EA 2GVBA 3VMAA 2B8GA 4RYEA 3BZDB 4JBWA 4R1GA 2ZC7A 1VQJA 2Y2NA 5E43A 2L0CA 2EYFA 2E5LL 2E2IB 1K56A 4DF6A 3NTHA 2B63H 3TRCA 5JJIA 5I4DA 4QCLA 2K7VA 5C44H 3MXNB 4KMUC 4UA6A 1IZ6A 4JYAL 1AFPA 1IBKL 3CCQA 2KCTA 1JB7A 2EYPA 1DM0B 4ALPA 2F3WA 4M8AA 2FFKB 3E5SA 1QMFA 2WADA 1EU3A 2Z6DA 3HOXB 1RDPD 4RGOS 3PGZA 4C1NK 4BY1H 2NVXH 3HOVB 1LM0A 4A3BG 4PAUA 1TS7A 3CI6A 1JT8A 3V2TA 1FVIA 5CXWA 4G3WA 2F0KA 3GTPB 4DR7L 2XRQD 2ZLYA 5DFYA 1PYWD 3EQLC 1GM5A 3KJOA 1N34Q 4BS9A 3WS1A 2K5NA 3ZGAB 1CJFA 2EWWA 1KLGD 4Q0FA 3UE6A 2B2TA 5M3MB 4G7ZC 1UEBA 3PIPA 3A5ZB 2WKPA 1Y14B 4YHHL 3HREA 4IEDA 2P7JA 3KUPA 3EGDC 5BR8L 5ELBA 2RSNA 4LNQA 3D3RA 3MS6A 4BY7G 1E7ZA 3FRPB 2VEAA 2Y0SG 4OLDA 2I46A 1N36L 4ZYSA 2XLNA 3J80E 1MKMA 4JV5L 2QKPA 2EY6A 5FQIA 1WI5A 3K0YA 2N3SA 2JN7A 1B7YB 3E4OA 4UQIM 4BA2I 2DY7A 4YINA 4GNXC 4DK1A 5GROA 4L5RC 1KE3A 4Y0TA 3K58A 1YJ9A 2PPBC 2FZ0A 3Q81A 2O2LD 2EYHA 1BSGA 1PH2A 5F6AA 4DN0A 3UDFA 4N92A 5FQ9A 3I55A 1DP8A 4FH4A 1M6KA 4CDFC 1K0RA 2UV0E 2Y91A 3IH8A 1D8LA 3X3NA 4I5SA 5KNDA 4G4KA 2NVYB 1S40A 2ZJRA 4PKYA 4B3RL 4LF4Q 3PO2B 3ITBA 4MN7A 1ZXTA 3QJYA 5AQ7A 5H1SE 1JTDA 2AMCB 3LFVA 4JF6A 1KE4A 4FO2A 1LTLA 3HRZC 2FMCA 3DUZA 2SDFA 3NQTA 1KRTA 1E0BA 4M3KA 5KRUA 1XNQQ 3DEOA 1JE5A 4BWGB 4DNIA 1PI4A 4A3LG 3KYZA 2CW0C 2UXCL 1QVGA 4NXBA 1UAPA 3SE0A 1E2WA 3A0JA 3MTSA 1NRJA 1S4ZA 4DR1L 3IS2A 3QP4A 3H3VI 2P9VA 4CLCA 2OWOA 4YIJA 3NXWA 3MF0A 3O87A 4DE3A 3ULLA 4PZ7A 3GTLH 1K0SA 4HCSA 1XJ3A 1HNWL 1PLFA 2Z4IA 4X3UA 4ZLTF 1FJGQ 5C4XG 4HJ3A 2V1CC 1S0WA 3KYHC 2IA2A 5E3FA 4PHTA 3OPOA 4OIKA 5AQ9A 1RIPA 1E3PA 2K75A 5IE8A 3FKIB 3SHLA 4DV7Q 1YJWA 4A3MB 1EY7A 1L0YB 1SMXA 5DTTA 3CG5A 4MTKA 3G4PA 3A7LA 4GN4B 1GSWA 4AH6A 4L5QA 1YT4A 1WTRA 3ERSX 3Q7ZA 5EPLA 4BY7H 1YNJD 4GNXA 2VNUD 2WUQA 3K57A 3O3VA 3U2AA 4QHCA 3MFYA 4DFAA 1UE5A 4DAYA 2W3FA 4YNRA 4DE0A 1CT1D 4R4SA 4JC0A 1I5QA 2EDGA 1P8LA 2PDRA 5C3EB 4JGOA 1YITA 3ZVTA 4L0LA 4E04A 5GHYA 3LR4A 4NPSA 3NC8A 4HMJA 2A6HC 2RDFA 3IWQA 4B4ZA 5CV9A 4WJWA 1B3QA 2FINB 1N33Q 3VR6A 3DM1A 3UB6A 2CVRA 4PMWA 2PZUA 1SROA 2Y2OA 3T56B 2E74C 3J7ZC 1F2KA 2PT7A 2BDOA 2ICEC 3KF6B 4Z9CB 3WWVA 2XRNA 3CJMA 3UNWA 4CLCB 2MP1A 2GNXA 1C7YA 3C2PA 3BM6A 3MFXA 2BH8A 2KX6A 3NHHA 4A3GB 3GTOB 3VV4A 3QP8A 4PV1C 1Q8KA 1Y8OB 5CR3A 1EOVA 1IKLA 1KHIA 2UUCL 4FF1A 3MXUA 4DV4L 3RNUA 3RLNA 4LF7L 5CMDA 4OONA 4DV1Q 3IBJA 4CLCE 4EX5A 4EBLA 2BE5D 3VR2A 3DEPA 3S1NH 1S5CD 4RGTA 2UUAL 1PVOA 2DY8A 2LSSA 1G68A 1TWFB 2EXZA 1NYYA 1SZVA 5GLAA 1BCPB 2KOLA 4OO1I 2NZ1D 1JJGA 1WYDA 3D4RA 2VJWA 5G18A 1L1OB 4B3SQ 4J1MA 4FSFA 4LV2A 3WRZA 3JPUA 4P71A 1ENFA 4DF7A 1EWIA 1I50B 5C5LA 4S2IA 4UHVA 5CEDA 3LIBA 1BDOA 2A69D 2F0GA 3R7WA 1GA9A 3MQ0A 5HPIA 5JVH3 1VQMA 3CPTA 2V1ZA 2XA7S 5F5YA 4X65L 4O7DA 3V3SA 2EFXA 1STHA 2B39A 1A6XA 3E0JA 3BY9A 1FIKA 3TP7A 2QF7A 4PNYA 5I2YA 1K8AC 1SHVA 3MXQA 1TS2A 4Z9QA 1I3QH 2WYXA 2KBNA 3K5OA 5KMWA 2C35B 1VB6A 3M3YB 4HH3A 4WN5A 4Q5VA 3BZCA 4J6HA 4K2KA 3I4LA 4GOPC 3S2HB 4DE1A 1IYOA 5HZHA 3JVVA 1VQ4A 4N1XA 3S1MB 1VHMA 1CTMA 4I3IA 1HTLD 2EXDA 3VYUA 4WZ5C 2QYBA 3VSKA 1ZEQX 3HBRA 1JWUD 1HR0L 2B8FA 1B53A 4E3NA 4A3KH 1LT0A 1HNXQ 3D0FA 2VV7A 5IT9c 5L2FA 3AEVA 4ME5A 5EJWA 4DV3Q 3E9IA 1STGA 1JJCB 2N78A 3S16H 1ILPA 2JE5A 1YLZA 4R38A 1STBA 4IJGA 1VM1A 5EE8A 1KNEA 1IYSA 4B08A 4DXBA 4PMBA 4MBFA 4IPDA 4DV5Q 1WA9A 4RX3A 2RSOA 5G3LF 4R8IA 3TRZA 2L12A 4QIWB 5EVIC 3HKZE 3GD7A 5M18A 3P20A 1TWGH 3TBIB 4KHZA 1YNND 2QJ7A 3HOZB 2PNHA 4EW7A 1B9MA 4XQJA 3PIO3 1GUGA 3KLSA 2WAEA 5HY6A 1F77A 1NXYA 3CPTB 2QDLA 4P75A 2A6ED 4QIWE 3FVQA 1VF5C 2K33A 3BYYB 3E4QA 2E5LQ 3A3JA 3HOYH 2R92G 4APVA 2IWCA 4S2OA 5HGQA 5J3BA 1TD5A 4JYAQ 4DR3L 1IBKQ 2R3ZA 1BQQT 2E8GA 1H9KA 1LTRD 4DGZA 2PR5A 5HAPA 1LTAD 5FKAC 5C3XA 1GHMA 2KEDA 4HH2A 5CGSA 3S24A 1L0GA 1NNXA 4L9EA 3IXGA 3KBXA 3RJUA 4LWCA 1H9MA 1TQOA 1J8IA 5A8BA 4DR7Q 4X53A 4ID4A 1NJ4A 3TS0A 4JGQA 1UWPX 5DJUA 3HOWB 1LL9A 4MBHA 1B4OA 4DV2L 4OQGA 3JAMc 4C3HG 4QY7A 1ES4A 2W3GA 1Q81C 4LF9L 2F1MA 4B93A 3K80C 3MHBA 4YHHQ 4A3IB 4X69A 3F1PA 4GOPA 2W1RA 4YY3L 1KAAA 4KD3A 1CEFA 1TIID 5BR8Q 3ZG0A 1FILA 3KF8A 1VQNA 1I6HB 4WZ5A 2PQEA 5CGKA 2ID0A 1N36Q 3CC4A 2HP9A 5TGFA 2DNEA 4JV5Q 4FF4A 3LIAA 3P09A 2JKRM 3L3OC 1H9SB 2ZM6L 1P97A 4KZ4A 3PO3B 5IGFA 3RTYA 1YHAA 3M4PA 1D6EC 2K5DA 5CRFA 2MFIA 2ZD8A 4KUOA 2KOIA 4MZ9A 1W79A 2O0YA 3CCMA 4JLFA 1EYAA 2UXBL 4OKPA 3RH8B 1M90C 2AQ1B 1JE4A 3SK8A 3OCNA 1W8YA 5EOOA 1ZKOA 3OW7A 4CKEA 4EQNA 4A93B 4HBUA 5EVIA 1G8ZD 1GCEA 2ZXOA 2HJ9C 2K04A 4BBRG 1W2BA 2Q2TA 3CRKC 1CFMA 1WTQA 1XPOA 3TP8A 1VQKA 1PDQA 5CHMA 1SNMA 3HOUB 2VLGA 1TS4A 2H5XA 3IFTA 2A68C 4B3RQ 2V0WA 2QWSA 1MWSA 2EX6A 1YI2A 3FKWA 3C1EA 2HUGA 3FDTA 1W63M 1HZAA 3QO2A 3K8AA 3G6OA 2PI2A 2B3GA 3LO7A 1SE2A 1N9WA 4HESA 4EERA 1WD0A 1SJHD 1Y1VG 1E2ZA 1QG7A 1KTKA 3QG1A 4QL5A 5M3FG 5HW3A 4OWTB 1B8AA 2UXCQ 3UB8A 1B1ZA 2HDSA 5IHVA 2R92H 1ET6A 1ILQA 4KV6A 4IUPA 5CX7A 3H0GG 4DR1Q 1F2YA 1HUNA 1DOLA 3KSIA 4OLGA 1JC7A 3EEAA 3FV7A 1RGYA 3CCLA 3DAVA 3KO6A 4LV3A 2B02A 1VQCA 1YM1A 3FPPA 4GNUA 4LFCQ 4G7OC 1QZHA 2R93G 1FGBD 1VETA 3L2PA 1HD8A 1Q1EA 3MXGA 2IHEA 4C3HH 4WLAA 5CV4A 3T13A 1H8ZA 4GB7A 3TP6A 2WGVA 1T5XD 4CJ1B 4R4CA 2LXJA 2FFYA 1WCMB 2VA0A 3NDEA 5T1IA 3SS3A 3P98A 1TWAH 3MR0A 1EY4A 4OP5A 3PUYA 1SBBB 3J7YW 4YOFA 1K3RA 3D4DA 2X71A 5CGWA 3IL8A 1K55A 1T9HA 5HURA 2K5QA 1JWMD 1OO9B 4A3EB 2HDUA 1K6SA 3PBRA 4JXVA 2XTIA 5DTSA 2P74A 1J3WA 2JP1A 3AFPA 1CI3M 2L4RA 3NY4A 1KGFA 4MEZA 5FI7A 2WIIB 1OTEA 1EIFA 1L3LA 5IYBG 1F9QA 3PIOA 5HSQA 1L2FA 2PI2E 2BH2A 1IKGA 1GUTA 4IBRA 4BBVA 4BBRH 1X3EA 5C3WA 3OW2A 2XK1A 2OEOA 1JORA 1EY6A 3JAML 2ZQAA 1ESFA 3CCRA 1VQ8A 1FYCA 4IFDG 1MBLA 1KGGA 4LRXC 1CA6A 5L8MA 2EX2A 1ASYA 2NTSA 2F0HA 1Q2PA 3K3DA 2AQ3B 2TSSA 4JK1C 1ZG4A 2CMNA 1S5BD 5JJKA 4C3IG 3BWLA 4LGWA 4C3JB 3KDFA 3F2UA 1EWZA 2E2DC 2UUCQ 2JA6G 4DV4Q 4LF7Q 2BG1A 1VQAA 3PQIA 1IYQA 3CC7A 3B42A 1Y1VH 4QUFA 1C9OA 3BVZA 4PMCA 2F03A 4HSVA 5M3FH 1YIJA 2CCZA 2UUAQ 1Q2QA 1YSQA 4GCZA 4Q0IA 5EUAA 4P6BA 1DP9A 2ZJPA 3GTKB 1KDWA 5IYDH 3CW2C 4GOGA 4JI4Q 4I7AA 4FD8A 4QB4A 2GA4B 3EQVA 4RWSC 3OHXC 3UB9A 3A7AB 2EQSA 1WTOA 3KSFA 3MQQA 4BMWA 3H0GH 3KJPA 2HJEA 3F1ZA 2G9HD 4S2PA 2OXPA 4X65Q 4CKBA 1PZID 4MN3A 1XJVA 3DLLA 3ND9A 4LFAL 3AGFA 4L63B 5LHY1 4OX9L 1K8OA 4HN7A 4KQRA 1E3UD 3CMAA 2R93H 4KZ8A 2FHTA 4HAEA 2BCOA 5JAVA 3F8TA 2Y55A 1M4VA 4RKLA 2C6WB 3PBSA 1TS3A 3I90A 4S3SA 2KCNA 2DNCA 4EBNA 2KVMA 3I8ZA 2Z2LB 2ZQDA 3AGEA 2H0YA 4P74A 3F1NB 4II7A 2A5HA 1GUSA 1O7YA 3HLFA 4DMZA 1EZ6A 4ABNA 4NXGA 1HR0Q 1PA6A 2AUKA 3T4OA 3OSOA 1IW7D 2G9DA 3HEJA 3F2DA 3KDFB 3CWFA 2WKHA 1LT3D 2CHBD 1NWZA 5G4ZA 4X25A 3LEQA 4EQ1A 2UWXA 4LF6L 2ZBBA 5E1FA 2MO0A 3KK7A 4O8GA 2A1AA 3U9OA 3FP9A 2H10A 2NN6G 4LF4L 5EPJA 1CQFA 1SDFA 4IUNA 5FO8B 3NP8A 1WTXA 3OMCA 1FGUA 4LUVA 1KDSA 5DTKA 4ZJ2A 3HS0C 1NMGA 4JGRA 2Z8LA 4A3JG 1VEUB 2I9VA 4OQ0A 4O01A 1VQOA 1TS5A 3CQZH 1I4GA 3H15A 5JJLA 2VS1A 1X0OA 5K5BA 4C3IH 1DP6A 2ZC4B 1D5ZC 3T1SA 1KL9A 4UP7A 3E3XA 2C5WB 1SYBA 1KD1C 4RCNA 4I3AA 1Y1WH 4GZBA 3HLBA 5CC4A 3EN2A 3D8GA 2R7DA 4F3LB 2Q0OA 2Y79A 3DW0A 3MXRA 3GECA 1PH1A 4DR3Q 2QJ5A 2J7ZA 3HZXA 5IYCG 1RTOA 1M1KC 2JA8B 1CZGA 4IPHA 1S6RA 5DFXA 3G34A 3VP4A 5J1ZA 3UB7A 4CDEC 5FLXE 1ENAA 4GDBA 1KDAA 2VGJA 4PMAA 4U68A 3UPNA 4DV2Q 1TWCB 5DVAA 1ML0D 1SNCA 3PXPA 4LF9Q 2HT1A 3L9AX 1UGUA 3VP2A 3I56A 2ATWA 4EV4A 1W63Q 4BA1I 3BEBA 2JA7G 2ZC3B 4MHEA 3HLWA 3PIP3 3K81C 4HTHA 1XTDA 1LI9A 3J81j 2DCFA 5JVG3 3SS5A 1Q90A 4POFA 3LR5A 2OCEA 2ZM6Q 4OWXB 5IGEA 1ENCA 2XFSA 4S2KA 3UY6A 3S7QA 1SN8A 1X3PA 1K8GA 4FXKC 4F8MA 4Y7NH 5F69A 1OMEA 3TE8A 3AFQA 4CBVA 3G4SA 2W3DA 2RA4A 1Z09A 1PH7A 4KQOA 2V4DA 3TSGA 2B29A 4DXFA 1RD9D 4E3LA 2UXBQ 1CI8A 4QF4A 4DR2L 2QEJC 1SKFA 1LSWA 5C6AA 4A3DG 5I94A 1EY8A 3TS2A 3MXPA 3M9BA 2NN6H 1ZG6A 4OXPA 4ZBEA 1MIUA 4UA7A 2RDGA 4XT1B 1A8VA 1A3VA 1V43A 2WB1G 2B63G 1G6OA 1ZHHB 3HLEA 5I6WA 4JI8L 2ZXPA 1EROA 1DYQA 1X55A 5IGBA 4C1NI 5HWTA 3S7OA 5HWWA 5I9PA 3QWNA 4EUVA 1X65A 4X64L 2JA5B 4Y5FA 4Y7PA 1EL0A 1XPRA 2Q9MA 5TJJA 5HPFA 4DDYA 4HIKA 3K5LA 1AH9A 2IWHA 5M3MG 3GTMB 1ET9A 4HJ7A 1JOKA 4RHSA 1XPUA 2OT2A 4OPYA 2CH4A 3S14H 2F0JA 1YNXA 3FPWA 2H4OA 1NJIC 4JGPA 2X02A 4LLOB 2UU9L 1LO5D 2Z4HA 5ISRA 1DY6A 3N4IA 3MXNA 4HP4A 2KCCA 4RG1A 2DNSA 4OPQA 3D4WA 5HDCA 1QILA 1BZAA 3EWKA 5TSSA 1N32L 5CEBA 1SFOH 2QZ6A 2E2HH 4MN5A 3OIQA 4OPRA 3TG9A 5I9OA 4FH2A 3S17H 1RODA 3EVQA 4KK7A 2JA7H 2Y2GA 2EFUA 2PHYA 3NWTA 1RKNA 1ZYRC 3R93A 2B2YA 5LL6S 4GKUA 2BASA 4RCOA 3PBNA 3OOCA 5FAOA 3FMCA 4JI3L 3CAXA 2VUMG 4K2LA 2F0MA 3M4OH 5HL6A 2PW5A 4M4XA 1JCKB 5EV0A 4BENA 3S15H 1A0KA 1VQQA 3PO2G 1EIHA 2J3TD 3UO9A 1SNOA 1BCPF 1XP4A 4ESPA 1K28A 2JK8A 4I7ZC 1C3BA 4BBSB 1JVJA 5FDHA 3MAQA 4S2NA 2K4KA 3TZUA 2XR0A 5FQQA 2HCIA 2KENA 3WOFA 3OOVA 4P0MA 1Z6HA 2E2IH 4XTCS 1N9LA 1SDNA 2INWA 4UP8A 3HUOA 3VFFA 1B2TA 1VQHA 4S2JA 1TS8A 3FZCA 3W1GA 2NWGA 4EGVA 1BBWA 2PNRC 1EQRA 1QNUA 1PWDA 1JR0D 2EY2A 3VP3A 3N52A 5KSHA 4A4IA 3HOXH 1BLPA 1PZOA 3HOVH 3BLSA 4MCWA 3AQQA 4C56C 1CF0A 1Q12A 3IWOA 3NBLA 1XA1A 1A15A 1HZBA 1NE3A 4R8NA 2H28A 4X68A 5FLMG 4WBGA 3RN5A 5DNFA 4C6YA 1K83B 5M3MH 1EY0A 1XPBA 5JEAJ 3Q1FA 4FUWA 4CLCC 3U4ZA 1QOHA 5JOBA 2NVTH 4ODGA 4A3MG 4ZJ1A 1PRTB 1K4FA 1GXDC 3A0RA 4H0LC 4UDUC 3MKFA 3OBFA 1LV9A 2ZXRA 3A56A 4LFAQ 1I2WA 1XNRL 4GLAC 2N49A 1G291 4V190 3OZHA 4OX9Q 4MBKA 5GL9A 4PKYG 1DXMA 2F0OA 2RQXA 1SKOA 3H91A 4J8QA 4JF4A 4IUQA 5CTMA 4KN4C 4E6XA 1X3QA 4IZ8A 1SYFA 4A3FB 1BCPC 2KECA 3AB9A 3UI2A 4KZ7A 5D65A 1L1OC 1ASZA 4U673 1PIOA 2R9WA 1IEMA 4BL2A 3A3IA 5FATA 4GN3B 3BFDA 2IWDA 1EIYB 4B3ML 1D1JA 4BD1A 5FEFA 1CK1A 4X3SA 2J4XA 1S66L 3S1YA 3GR2A 3EFXD 2VUMH 4IUVA 1SR3A 5A2QE 1LI0A 1S72A 2PU2A 3MMHA 3I4NB 4MNOA 5EBCA 1HNZL 2NVYH 3LI8A 1WFQA 3G6EA 4LF6Q 4NXFA 1S67L 2WGWA 3PO2H 3CZDA 3T1YL 4LV0A 1SE8A 4N9PA 4NW2A 2UXDL 1BR9A 5J8XA 2Y8HA 1XJ6A 5CBEE 4PZ6A 2O9AA 3LR3A 3STBC 1N9NA 1A3TA 4EUZA 4ULLA 2XDMA 3T53B 4ZKCB 1SYGA 2IX1A 5G3LD 1SLJA 3QIAA 4EQOA 3WS0A 2OQ0A 1LHYA 2JBFA 1GOZA 1C0AA 3NOUC 1EEFD 2XEPA 2F0LA 1BF4A 2K52A 3ONAB 1NZUA 4PPRA 4CJNA 2F0IA 4S2LA 4WMCD 4E6IA 4EETB 2DJFC 2OV5A 1SKOB 3KF6A 4LPZA 5A93A 2RF4A 1S1YA 1WTVA 5DLQE 2WAQE 3LWUA 1E4DA 3MZEA 2K5WA 4DV0L 2ZT9C 1MKIA 3E98A 1Y8NB 3MWYW 4Y13A 4UHUA 1K54A 1HH2P 4B3TL 5FLMH 2R7FA 5CV6A 1OXXK 4LFCL 3NJAA 1RP5A 4F87A 1FR6A 5D3OA 3VE3A 3LGOA 2VX8A 3KSHA 5JYPA 3FKIH 4R3BA 2ZOIA 4XYOA 1EW0A 2VB2X 4A3MH 3GTJB 1QNKA 4RA8A 5F2DA 4EU0A 5HL1A 3GO5A 2V0UA 4WEJA 1DGSA 1U4PA 3M6BA 1NUCA 5TFQA 4X62L 1L1OA 4CJ2C 2Y2QA 4H44C 1D06A 5DAUA 3I70A 5FDSA 4HCEA 2WGWB 2PD8A 4NP5A 2VQFL 3UDGA 4K5VA 5GLDA 3PUXA 2DMWA 1EY9A 4A3KG 2WKEA 3Q07A 4A3BB 5I5LA 1DOKA 3GTLB 2EJFC 1K57A 4HNBA 5EPKA 3T4TA 1K73C 3IXDA 4DUYL 4JXWA 3VYRA 4JG2A 1PTOF 2L11A 4P2CB 3BS1A 2MUYA 4K6LA 5CHJA 5FI2A 1DJCA 3S4XA 3QOJA 1L0EA 1OJ5A 2FFFB 2D0OA 2I0QA 2ZTDA 5HD5A 4DR2Q 1HPCA 3HOZG 2X6LA 3PCOB 5L07A 4ZDXA 2CQAA 1OXVA 4ZAIA 2PBYA 3EOIA 4BY7B 4NMZA 5FLXc 2Y0SB 3RUZA 3BDLA 4HI4A 4A3GH 5M5WB 5D14A 2VGLM 5HFOA 3W8KA 5KNBA 3SGIA 2VKSA 2HF6A 4DK3C 2CKZB 3HOYG 1PH8A 3CAMA 1IYVA 3X3MA 2KDKA 4JI8Q 1O7EA 5DF7A 2Y0SE 4HIAA 3J81c 1PFSA 2JC7A 2KHSA 1GHIA 1H3QA 3HG9A 1TWFH 3UE0A 2CH4W 1IL8A 1MI2A 1VQ6A 3IF5A 4KQDA 1KABA 1SMYC 4X64Q 3ICYA 3H09A 1I94L 1OTAA 3R3OA 3GTGB 2A24B 4PM9A 4JI4L 1L0XB 1UEAB 4WYYA 5LMUL 3HOWG 3MFGA 2Y2PA 1EYDA 1Q46A 1ICFB 3FKVA 2OF1A 3H94A 2VZAA 3E2KA 1UE7A 1QZGA 1CM9A 1ES3A 2L15A 3K7AH 3MKEA 3NPPA 1W3SA 3I3CA 1OPXA 1YPRA 1GUNA 1A0IA 1YHBA 2V8FA 2UU9Q 2YU9B 4F94A 1PTOC 2JYOA 3M3YH 4KN7C 3S2HH 4ILWA 4MN6A 2F0VA 5IT5A 1N32Q 5E2GA 2D2CC 2EYMA 3LICA 4LF5L 1SSOA 2NVQB 2RDHA 5FA7A 3T50A 1I4RA 3WS5A 3GDIA 2XD1A 3IWIA 1LLRD 3I4MG 3U50C 1XJ2A 4NKLA 3RLOA 1SEBD 2JJQA 4K8JA 1K6RA 5J22A 5D3DA 3PUZA 4JI3Q 2ZTEA 3HKZB 3E0YA 4RX2A 1I4HA 3HOUG 2R7ZG 5C4XB 3H3VC 1R4QB 4KTAA 4P73A 3ZQ5A 1I3QB 3M4YA 3C1FA 1KVMA 4QMGA 1OJGA 2L55A 3AYHB 3G2ZA 2JKRI 3CCSA 2J9PA 1H9SA 3HOZH 1H8YA 3C7UA 5CERA 3A8JE 3HKSA 2Z2MB 3PF4A 4MMNA 2PCFB 1XKZA 4HJ5A 3OIPA 2DJGC 3GQBA 3SR1A 4JOIA 1FSYA 1JB3A 3IFDA 3L7HA 4E3IA 5TBMB 1SNDA 2D62A 1EQVA 5KGUA 4JPBW 4HQAA 5M1AA 1CKOA 2E75C 1Y28A 1TY2A 5KNCA 1EY5A 1TDGA 4IFDI 3J7AV 4MNRA 2YTXA 1K38A 4ZCKA 4NG2A 2K50A 3WS4A 4XUZA 1AN8A 2IHFA 2VQEL 4K5WA 2PAVP 3HOWH 3G7LA 1GJXA 4DUZL 4FF3A 4G7HC 4IOCA 4IURA 4A3IH 1IFQA 4FF2A 2OOLA 1RTNA 3H82B 2QILA 5HDSA 4RFBA 2JXMB 1I6HH 5GHZA 1XNRQ 4N9LA 1VDZA 2IPKD 3BVMA 4XDXA 1TDLA 1BO0A 2D02A 5E2EA 1AZPA 1VMPA 2GN5A 1PWCA 1CHQD 5EECA 2O5IC 2P5ZX 2HP6A 3T4JA 3PO3H 2JKGA 4PG3A 2HIVA 4A3EG 2MQHA 1XMQL 3J7AF 1BTLA 1N9BA 2Z1CA 1EEID 4DU9A 1O78A 4PM7A 1ES5A 2XF3A 1LABA 4ZRZA 4ID6A 1LTID 2H0TA 3J81L 4E3MA 4QPRA 2HQLA 4ZRRA 4DR4L 3I4MH 3RZOB 2F0FA 1VS0A 3BVGA 1LL8A 2J8YA 2YV5A 2OAQ1 1VQ9A 4A93H 1K55C 4B3MQ 2XVSA 3ZHHA 5DKLA 2HHHL 1GUWA 2VV6A 3EEHA 3RFBA 3HOUH 2R7ZH 4HJ6A 3MEFA 5EKIA 1HNZQ 5GHXA 2O99A 2ZMVA 1SE4A 3CLOA 4JBKA 3NENA 5FOBB 1GUOA 4A75A 3T1YQ 4HBTA 4QY6A 2UXDQ 1GVPA 3CMZA 1CKMA 1U4LA 2Y59A 2JHEA 1PTOH 1C4QA 2VZWA 2WAFA 3S1RB 4DJ2A 1LTBD 3T1HL 3O88A 3SW1A 1EIGA 1SCWA 4LENA 1LYLA 2QW7A 1S4RA 1YLWA 4L9GA 3U4LP 3J80c 1HVBA 4AFIA 4IALA 3RN2A 4DR6L 1NY0A 5IYDG 3S9WA 4P6ZM 5IGGA 4R1JA 4QGUA 1KIXA 3ZNTA 5EVEA 1O7LA 3DTEA 2M7VA 3EJIA 2CC1A 2EX8A 2AKWB 4K14A 1F2LA 1PXUA 4N8X1 1YBYA 5IT9L 1Y69U 1SDEA 4DV0Q 3CRLC 3O5YA 5DF8A 5FAQA 3CITA 3RZDB 5L10A 1MKHA 1AW7A 4YCUA 1A2UA 4B3TQ 3GTQB 3GVBA 3IKJA 3UDXA 1FNWA 2R78A 3JAMi 3DXJC 2VL6A 4MIUA 1B9NA 3K5NA 4BD0A 2BTFP 3NIAA 3OWEB 4RAUC 2W27A 2JKFA 3SS4A 1EWHA 1CQVA 4WM9A 3P01A 4QQBX 3PAGA 1PV4A 4H8RA 3T4AC 2R92B 3DWAA 1T1AA 4X62Q 4EQIA 4LRZE 1SYCA 5ELCA 4G3KA 2XGTA 4A5RA 4LF8L 2VQFQ 1DOMA 1NAPA 3F2BA 4K5XA 4A3EH 2O9BA 2V8CA 3KSGA 1JMCA 2HV1A 4KZ6A 3T4SA 3T4QA 3GP7A 1RCVD 3G6JB 2N55A 1OXUA 1U5KA 2A3UA 4ETXA 5G4YA 2RKSA 3IHAA 3O13A 4DUYQ 1IKIA 1QJOA 3DMUA 3EROA 3W4PA 4JVZA 5FEGA 1PZPA 4OOMA 4B9XA 4BBTA 4KY6A 2JQOA 5CV7A 4C3HB 3E6ZX 3LX0A 2BOSA 4E3OA 5EFWA 2MPMA 2A8VA 3PV0A 4DR5L 2KCMA 1Q8IA 5IU1A 4ARZB 1FCMA 2Q9NA 4DAVA 3CCUA 3GMWA 3VP0A 1TWHB 3SK4A 3L0OA 5J7EA 1DJRD 1TF1A 4YWMA 3F1NA 5LBRA 2B2UC 1A3UA 1QVCA 2AUJD 5DJTA 3W2DA 3D72A 3NELA 3BDCA 4PM6A 3I4OA 2EVBA 2KJXA 4C3JH 1PFMA 3RXWA 4WJ4A 1LSVA 3ZNYA 3S1QB 2K5VA 3FC7A 1Y1WG 2P08A 4L9FA 2CFMA 5IGDA 4KENB 1TVXA 4KKSA 2VV8A 3BY8A 4BWIA 3OYYA 2A69C 3A55A 3GTKH 2B5RA 4D60A 5FO9B 3W4OA 4IFDJ 3E2LA 2Z6BA 3KX0X 4JI5L 3UE1A 1I94Q 5J3WA 4J15A 5LMUQ 1PZJD 3P1HA 4NDXA 2KHJA 1IKMA 1T18A 1LUZA 1VEUA 1WYBA 1S5FD 2J9OA 4OHJA 1ONGA 2K7SA 2V2FF 5C4JB 4L6TB 2K32A 1GKHA 3DBAA 3WOEA 1JTGA 1GSVA 1ZTUA 1O7IA 1ACFA 1VQPA 2XH9A 2EWVA 2V1BA 1HCZA 3MQOA 4F3LA 1PH5A 1QUQB 2VXWA 5C0XG 3BFFA 2IY5B 1W6JA 2HCCA 1Y1VB 1IBML 5M3FB 1YZ6A 3KFUA 2OWHA 3KYQA 3KYEA 3LEZA 1X3GA 2FJ2A 4HJ4A 3NDGA 2ICIA 4LF5Q 2R9XA 1PMRA 4ZKBB 4R4RA 4HSPA 4ME4A 4UAAA 5BN5A 4DV6L 2A74C 4R9WA 5J39A 4NB3A 3PBTA 2WINB 3H0GB 3J80L 3BFCA 4R3JA 5FJ8G 4K0XA 2VGKA 4DJ3A 2RCNA 2WFWA 2MO1A 3TZDA 1TT2A 5HX9A 5A90A 2CWPA 1MJCA 1VQIA 5M5XH 1B3AA 3EIVA 3M2KA 4QY5A 1OTCA 1JJ2A 1U0LA 2PBDP 4HIOA 3ZG9B 1U9RA 2XN9C 2DUDA 4ZUIA 2B2UA 3R2IA 4DKIA 3V3RA 3OPPA 2MGSA 4LAAA 4CGYB 1MJEA 3TN2A 2A6EC 1WD1A 2MJ6A 1V1OA 1ZC2A 1PNEA 1CK3A 1AZQA 3WWXA 2J7VA 4IVIA 1Z6FA 2JA5G 1BCPD 1MSGA 5FK9C 4MLLA 5JJZA 1WTWA 1PRTF 1SE3A 3B3XA 4GW9A 4E3JA 3HP3A 1KXLA 1NLYA 2E8IA 2E2JH 1V1QA 5HWVA 2GDNA 3BFGA 2IT1A 3CPWA 4KY7A 1J9OA 3T1QB 1XXGA 4XT3B 4NETA 3SOIA 3FHWA 2LY7A 3FWLA 4EESA 4EQ5A 4KZ9A 1F5MA 3BYDA 3V39A 4MDZA 5KIXA 1BT5A 1VQFA 2F3VA 2VB3X 3GV6A 4JBFA 4I65A 2NUCA 5F82A 1FOFA 5BN3A 2CQOA 2VQEQ 1L0DA 2K05A 1TWCH 4LJZC 4DUZQ 3A3DA 4RQ9A 4DK6C 1PW8A 3TREA 4LW1A 3ISGA 3VYTA 5M5YB 4IOAA 1M40A 1V9ZA 5IS1A 3C2WA 2I5HA 1F9SA 2E76C 1T19A 1BNZA 4XIGS 2LFNA 4YCVA 4C3IB 1K0KA 2PYRA 2QMIA 3VDYA 1RJTA 2ZMFA 3IXBA 2MNAA 3R4KA 4IJLA 4GD8A 2JA6B 2CW0D 1V9YA 2EZVA 5C0XH 5IODA 3E4PA 4QJGA 3OPRA 4U0XA 3N6IA 1XMQQ 1QCBD 2J3WA 2M9VA 4XT2B 2LXKA 2F0TA 1PFNA 4O0PA 1Q7YC 2PQAB 5ELDA 2Y2KA 3I91A 2WKQA 5HDDA 2Y2JA 4OP8A 2K1BA 4R4IA 1HTZA 2B2YC 1QWYA 4DR4Q 4XQNA 1TY0A 5FJ8H 4N8FA 3G31A 3SZTA 3EA6A 3IF6A 4IQZA 1PRTC 3D6CA 3U58A 1JNUA 1JOOA 1R9TB 4OWWB 5EOEA 1KLUD 1KDCA 1MSHA 2HHHQ 3BW6A 5E2FA 2W0NA 4K6DA 3T1XA 1XX2A 2J80A 1I2SA 3QB3A 3K6OA 4KG6A 1MWTA 4M1UB 2V9AA 4IPCA 1CSPA 3OMGA 1E2VA 1GHJA 1NBWA 2F4IA 4EWFA 1HFNA 4CJ0B 2ZM2A 4S2NC 5EM1A 3ZJYC 4C2MB 3C4PA 1D1IA 3HOXG 1EUJA 3CP0A 4DNRB 3T1HQ 2JA5H 3HOVG 1KOUA 2F0DA 5C5KA 1AE3A 2B2VC 3VOYA 4RHRA 1J9MA 4A3CH 4DR6Q 3SH9A 3UPOA 2DN8A 4BBUA 1O7ZA 2A6HD 4FNFA
chains in the Genus database with same CATH topology
2FXQA 3PSIA 4JPMA 1W7FA 4GS3A 1H5XA 2XQZA 1KQSA 3Q7VB 2EXAA 2AWOA 3BZKA 5FQKA 3ZG8B 3W5OA 1XA7A 3CMEA 1KGEA 4UP9A 4O2DA 3IF6B 1A63A 3OTOL 2ALYB 1ZKJA 3D4FA 2BLSA 5FASA 2Y2IA 4K0KL 4LF8Q 4DKAC 1IBLL 1IELA 1LLBA 4YWKA 4JKTA 3BFEA 3I4NG 3CPFA 3V39A 5KSHA 3DWZA 4Y0OA 3ICEA 4OOYA 3MFDA 3ZG7B 4BBSH 1NYMA 2KHIA 4DR5Q 4X6AH 1X6OA 4PZ8A 1YLYA 1EI5A 1VQBA 2Z0SA 3C4OA 1Z47A 2ZC5B 1NY4A 3PBQA 5CHUA 1X54A 4POGA 5FQJA 2F52A 1ERQA 4DPGA 1X56A 5ELNA 5AQAA 3GTPH 4LCMA 1DJBA 4JI5Q 1K83H 3V50A 4O0AA 5EVID 4U0TA 3FKIG 2AWNA 4YWLA 1L0FA 2OSUA 1EQQA 2YYZA 1VQGA 2A19A 4OQIA 4AYBE 5JEAG 1V9PA 1K54C 4U3TA 4GD6A 1Q1BA 4FCFA 2G2UA 1TVFA 5KSCA 3HLGA 4A3FH 5C3EG 1BLCA 1IBMQ 2WB1E 4JI6L 5IWAL 4JI2L 3MXSA 4P87A 1X3FA 3JC66 4DV6Q 5GQOA 5DF9A 5AJ3L 4IVKA 1A62A 4Q8IA 2NZHA 2RL3A 1UE1A 3SH8A 4KHPL 2HP5A 1K57C 5GADC 3I4NH 3RLFA 1BUEA 4R4TA 4AQYL 1SRUA 5FQMA 4UY8C 1D7QA 2Y2LA 4A3GG 5LMNW 2JEBI 2F4VL 3FYZA 4K91A 2WKIA 4Y52H 4XUXA 2IWBA 3VP1A 1KRSA 5IP9G 1GO3E 4ZJ3A 3ZG5A 4ZAMA 3W4QA 1JWPA 3PUVA 2NZOA 3S22A 3M85A 1E3UA 4H02A 2Y4AA 4NK3A 3OCLA 2JE6I 3MZFA 1CKNA 4R0QA 1XGJA 3GTJH 4HJ9A 4GKKL 4IBXA 3E0EA 3HL9A 3G32A 2OLVA 3NI9A 3TQYA 4A3BH 4OH0A 5C3EH 2QEXA 3HKZG 5F1GA 3AGDA 4DE2A 5IY0A 3ER0A 4GN5A 4QU3A 3ZDJA 4A76A 1BLSA 1WJJA 1AXBA 3PBOA 1XMOL 3A3FA 4P72A 4KQQA 4ZTKA 1ERMA 3N8RA 1ES2A 1PYSB 2JA9A 2DGYA 5M5WH 3PF5A 2JEAI 2WZXA 3GTOH 4S2MA 1QVFA 4UPAA 1CUKA 1CKNB 2Q2IA 1VQ7A 1PH9A 4L5TA 4N1HA 5IP9H 4JI1L 4L5SA 4B88A 4JOIC 1YHQA 4KZAA 3GTGH 4WEKA 3GV9A 2ZQ8A 1I50H 1YLPA 2P9VB 1XXMA 1FQGA 1IYPA 2WGIA 2Y2MA 4A3IG 3Q82A 3CCEA