4OONA

Crystal structure of pbp1a in complex with compound 17 ((4z,8s,11e,14s)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2h-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid)
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
746
structure length
502
Chain Sequence
b'PLKVYSEDGKLISEFGEMTPELNAPYIAEMARAEMVGRYGSEAYTEGYKVITTVRSDLQNAASQSVRDGLIDYDQRHGYRGPETRLPGQTRDAWLKHLGQQRSIGGLEPAIVTQVEKSGIMVMTRDGKEEAVTWDSMKWARPFLSNNSMGPMPRQPADVAQAGDQIRVQRQEDGTLRFVQIPAAQSALISLDPKDGAIRSLVGGFSFEQSNYNRAIQAKRQPGSSFKPFIYSAALDNGFTAASLVNDAPIVFVDEYLTFLGPIPLREALYKSRNMVSIRVLQGLGIERAISYITKFGFQRDELPRNFSLALGTATVTPMEIAGAWSVFANGGYKVNPYVIERIESRDGQVLYQANPPRVPVEPTPAERIIDARTAYIMTSMLQDVIKRGTGRRALALKRTDLAGKTGTTNDSKDGWFSGYNSDYVTSVWVGFDQPETLGRREYGGTVALPIWIRYMGFALKDKPMHTMAEPPGIVSLRIDPVTGRSAAPGTPGAYFEMFKNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein 1A
publication title Siderophore receptor-mediated uptake of lactivicin analogues in gram-negative bacteria.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transferase/transferase inhibitor
total genus 149
structure length 502
sequence length 746
ec nomenclature ec 2.4.1.129: Peptidoglycan glycosyltransferase.
pdb deposition date 2014-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
A PF00912 Transgly Transglycosylase
A PF17092 PCB_OB Penicillin-binding protein OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4oonA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oonA02
4O0AA 2IHEA 1BUEA 5FSRA 4LF7L 4E3IA 4LUVA 3BRMA 3E9HA 3UPNA 4MNRA 3AGEA 2WZXA 2B63G 3H0GG 1PW8A 3A3JA 1GO3E 1IBKQ 4DV3L 5AQ9A 2LXKA 4POGA 3BZCA 5C4XH 4N9KA 3GO5A 1E25A 2OLUA 2RHSB 1J5EL 4PM7A 1HR0Q 3J81i 4GNXC 4APVA 4S2NA 3OTOQ 3L0OA 5CHUA 1RGYA 1VQLA 3W5OA 1TWAH 5EOOA 1H95A 2YYZA 1IBLQ 3PUVA 4JYAQ 1CI9A 2JE5A 1B70B 1M6KA 4DV4L 1YT4A 1OXUA 5GADC 3KF8B 5GAHC 3TQYA 5IP7H 3C4OA 3KF6B 5IYDH 3HOZH 5GLDA 4WJ3M 2JBFA 2I5HA 4EUZA 4ZAMA 4IFDI 1W8QA 3ERSX 1VQQA 3G32A 2JA5G 4ZJ1A 5J8XA 5M19A 2XD1A 3MKFA 2CFMA 1RIPA 3RZDH 4JF4A 4DR7L 4LFBL 1MJCA 3CCLA 4OX9Q 3F1ZA 2AWOA 1JTGA 1NXYA 1NY4A 1TEMA 4S2IA 4JI2L 3S1NH 4X53A 5LMNL 2QEXA 1YVCA 4E6XA 4IEDA 2XTIA 4BD1A 5EVLA 1K56D 4R4QA 3J81j 1MXOA 2UXBQ 1G6PA 4DE1A 5M3FH 4FSFA 3NDEA 1SDNA 3FKIG 3KF6A 1QMFA 3M9BA 1YJNA 4JXGA 1ES3A 4DV5Q 4A3FH 4YCWA 3PO2G 1M90C 5DF9A 1N9WA 4EWFA 3CD6A 1XNRQ 1JJGA 2PQAB 1PI4A 4DE3A 2Q2TA 4A3MG 3C4PA 2MO0A 3D4FA 3SS5A 3GVBA 1MJEA 5JYPA 5CHMA 2F3IA 2VGKA 4AQYQ 3CCVA 1YLTA 4BY1H 2ATWA 4A4IA 4A5RA 2OQ0A 3KJPA 4WMCD 1TWGH 1BLHA 1BULA 4YHHQ 3NELA 4XXRA 4LF7Q 5GHYA 2HDRA 5LMNW 4FH4A 4JBFA 2NZOA 2KCTA 3J7A5 1LLBA 4LF5Q 4DR1Q 1G68A 1MWSA 2NN6I 1C9OA 2PQAA 1X3GA 3A3IA 4U3TA 2NVQH 1VQMA 5KZHA 1VQKA 4KZ9A 2VW9A 1EYGA 4CJNA 3VDYA 1JWVA 1E1OA 1HJPA 3HOYH 2XDMA 1KGEA 3G6EA 3HOXG 3HOUG 4DV4Q 2XFTA 2VS1A 3UDGA 5IHVA 4YWMA 1PZPA 5IP9H 1EWZA 1PH5A 2VY3A 4B3SL 1LL9A 1X56A 3DLLA 5D3OA 3VFFA 2E8GA 4HJ7A 4N9LA 2N8NA 4GKKL 1N33L 4DE2A 4LFBQ 1Q7YC 5GL9A 4QD4A 1ZKJA 4S2NC 3CMAA 4FD8A 3K81C 3I4NH 2XH9A 3U58A 3VP2A 1I94Q 4JF5A 1WJJA 5FI6A 1VQ6A 3MZEA 4UP9A 1ZG6A 3NIAA 2K14A 3ULJA 2HT1A 3SH7A 3ZG8B 2H0TA 2K4KA 1FQGA 1C0AA 2D0OA 5CGWA 1YQSA 3N8LA 3AGFA 3HLDA 4WELA 4PZ8A 1KVMA 3MXRA 2Q9NA 1YITA 2R9WA 1WYCA 3FKWA 4A3LH 4JBWA 2RHQB 3OCNA 3Q82A 1K55A 1PH4A 4GLAC 1PA6A 3PGZA 1QMEA 1I5FA 1FGUA 1YJWA 1NE3A 4H02A 3TS2A 5IY0A 3WS4A 1K83H 2DNSA 2UXCL 2V1CC 4PM5A 4A3IG 4OPZA 4QB8A 2PNHA 3T1YL 4P74A 3HLCA 3LEZA 1S0WA 1X55A 5IT9c 2G2WA 1PH9A 5H1SE 1YZ6A 2BH8A 4U0TA 2JA6H 1W5DA 2EX9A 4JI5Q 3I7JA 4B3RL 3W8KA 4R4CA 3GV9A 2ZMAA 3S1RH 4C3JH 1UE1A 4H8RA 3PUYA 2YTYA 4D2OA 3NI9A 2VUMH 3GTPH 4O2DA 4KHPL 4RVAA 1EIYB 4X64L 2HQLA 3S2HH 4B3SQ 2UUBQ 3PBTA 4CPKA 1PH1A 3IH9A 1SRUA 3U50C 1ESUA 2Y4AA 2I72A 3NBHB 1KC8C 3MZFA 2YU9H 5E2GA 4DV6L 2I0QA 1MPLA 5AQAA 3O86A 3MXNB 1IKIA 1GKHA 4JKTA 2KHJA 4R1JA 4JI1Q 2WAEA 4HIDA 1YBYA 4LFCQ 3ISGA 4YY3L 1K6RA 3P09A 4AIMA 5F1GA 2EFUA 1CEGA 2VQEL 3AQQA 2D0PA 2XGTA 5CRFA 3NCKA 4KLKA 3S17H 4MBHA 5ELOA 2J9PA 3BFEA 4KZ8A 1V1QA 1KIXA 1IYJB 4JI8L 1ZC2A 3W1BA 1WYBA 5IYBG 5GLCA 2X01A 4BD0A 2ZQ7A 3ZGAB 3HVFA 2F4VL 4IPHA 3MFDA 1WI5A 4JLFA 1OXSC 1S6RA 5CTNA 5FATA 4A3KG 4X66L 4JBKA 4OP8A 4GB7A 4ZTKA 5LMUL 2K5VA 2UXCQ 4OWTB 4U0XA 3VOZA 3IHAA 3T1YQ 2CWPA 3BZKA 3A3DA 3PAEA 5C4XG 1MWTA 3EN2A 1TDGA 3ULLA 3Q07A 4DV1L 3CAMA 4IJHA 1X3EA 5GQOA 4GKJQ 3B6YA 3VSLA 1NYMA 3C7UA 5HGQA 4DR2Q 5JEAJ 1BBUA 1XMQL 1K0RA 5GLAA 1K55C 4DV7L 2H0YA 2QPNA 4QY7A 2E8IA 3I4OA 1PH8A 3PBSA 3E2LA 4MTNA 1Y1VH 1HNXL 3GR2A 3SGIA 1E7ZA 5IP7G 1PH7A 5EAYA 3HOZG 4PMAA 4X64Q 1I5QA 3F8TA 4LUZA 2Q2UA 1D7QA 1YLZA 2Y2HA 3S22A 5C0XJ 1L0GA 1SCWA 3O3VA 3KYHC 1K73C 1PWCA 1K6SA 1NRFA 2XF3A 1IBKL 4HJ5A 1JVJA 3OPPA 2ALYB 4Y7NH 2JCHA 4DV6Q 5F82A 3A3EA 4JI6L 4S2PA 2BA1A 5U47A 1K3RA 4A3CH 1HR0L 3I4MH 3IF5A 1GM5A 2J8YA 3UY6A 2L15A 2Y2OA 4NETA 3OTOL 1VQAA 2A8VA 3ZHHA 1FCMA 4LV2A 2Z2MB 3GTKH 1IBLL 3K80C 4JYAL 4L5TA 3A3FA 1YEZA 4IFDG 2NVXH 1Z9FA 3ITAA 3NY4A 4A3FG 2WUQA 1HZ9A 2NVTH 1JTDA 3V5MA 3UE1A 1G6AA 3M4QA 4PM9A 1ASYA 4JV5L 4JI8Q 3K7AH 4EX5A 3SH9A 5C44H 4JI4L 4KZ3A 1CKMA 4Y0OA 4E3KA 3ZCZA 4WYYA 3G30A 2Z6KA 4BY1G 4YCVA 4X66Q 2CCZA 1GVPA 2EFXA 1ASZA 2Y2NA 4BL3A 1HR0W 1PV4A 4GZBA 1W79A 5LMUQ 3T1HL 2K50A 5BR8L 5HAIA 4OO1I 1NJIC 1JJCB 4WEJA 1AE3A 2ZQAA 4DV5L 1QVFA 4KQRA 2IHFA 3ZG5A 4DV1Q 5FJ8H 1C7YA 3DTMA 2A19A 1RL2A 2RL3A 2Y55A 1LUZA 3G48A 1XNRL 3HLBA 3GTQH 3EQUA 1XMOL 4E3JA 4X69A 2I5LX 1L2FA 3S1YA 3HOYG 2JC7A 4DV7Q 3UN7A 1HTZA 3S15H 1E24A 1CEFA 2IX0A 3HLGA 5FA7A 2Y2GA 2QGQA 5IP9G 2YV5A 1A62A 4PM6A 4DDYA 3SH8A 3QNCA 4YHHL 1XKZA 5AJ3Q 2NN6G 1YNXA 4B3TQ 4OWXB 2GVAA 5M3MH 1VM1A 4OOLA 5FAOA 4LF5L 1XX2A 4DR1L 2Q9MA 5FQ9A 4HBUA 1KVLA 2UUCQ 4JI6Q 3OCLA 3M4PA 1K4EA 3E2KA 3QHYA 1SR3A 4GLXA 1EQRA 1KRTA 2BA0A 1BZAA 5M1AA 3FKVA 2Y91A 4LNQA 4HJAA 4IOCA 1LHYA 2JQOA 4KQOA 1J6QA 3V3RA 3PO3H 1T9HA 4R3BA 1YHQA 1GD7A 1G291 4DR5L 1SFOH 4P71A 5CXWA 2N78A 4JV5Q 1IBML 3G4SA 5HARA 3HBRA 3PF5A 4A3LG 4JI4Q 3OPRA 3CXCA 4UY8C 5FQKA 3M7NA 2QMIA 3CMEA 4OPRA 4DXBA 3GTLH 5ELNA 4JI7Q 2MO1A 2WZZA 2VZAA 2QA4A 1AXBA 1SLJA 2OLVA 1XP4A 2EX2A 1IYPA 4YWKA 2R7FA 3G71A 2J9OA 1HH2P 5FLMH 4S2OA 3VOYA 3TS0A 3RLNA 1I94L 1XA1A 3T1HQ 5IYCH 3UDXA 5BR8Q 5GAEC 3GSGA 1WYDA 2DCFA 1PIOA 3BFGA 2ZC4B 1HZBA 1IL2A 4KZ5A 1ONGA 4BL2A 5EE8A 4OKPA 5G18A 2Y59A 1XMOQ 1RGZA 1BLSA 4OVDA 3BFCA 4BXXG 3PSIA 1X6OA 4OONA 4LCMA 2Z6KC 3W4PA 3AFPA 4IO9A 1LTLA 1U60A 4LV0A 3VSKA 2VUMG 3S16H 4Q8IA 4HIKA 1MKHA 2JJQA 2AHOB 2VNUD 2VGJA 2QZ6A 1L0FA 3CJMA 2OTLA 4KI0A 3W1GA 4OLDA 2J7VA 1K4FA 2Z0SA 3MKEA 4BJPA 3HUNA 4K0WA 1CKNB 2EQSA 3MXSA 3TSGA 4IPCA 2X71A 5DVAA 2P9VB 1S3OA 2Y2MA 4N1HA 3K7UC 4UAAA 4GOGA 1UE7A 1YLWA 4E3LA 3GTJH 4JI5L 1NJ4A 1LI0A 2GVBA 1WOCA 1HD8A 2AKWB 3GRJA 4RX3A 3VP4A 1YJ9A 1K56A 3HLWA 2WB1E 1FR1A 4KZAA 1GHIA 2JEBI 4UHUA 2HDSA 5FQQA 1L1OB 2Y2KA 1DGSA 3V3SA 1LI9A 4DR5Q 1M1KC 2UUBL 1YLYA 1CKNA 1S72A 3OC2A 1IBMQ 5JJLA 2JE6I 5C4JH 4P73A 1W8YA 1DJAA 4K0XA 3G4PA 5BOHA 3AYHB 2HDUA 2Y0SE 4WMCA 4KENB 4QJFA 4A3BH 5FI7A 1O07A 2WGWB 5CEDA 3VFHA 1N4OA 3E9IA 4GLVB 2Y2IA 4JI1L 4EQIA 2N49A 3H0GH 1PH2A 4PZ6A 2C5WB 4LFCL 2IX1A 4ZDXA 1PYBA 1L1OA 3OZHA 5JJIA 4BBRH 3OPHA 1VQGA 3C7VA 4N92A 3KLWA 1QUQB 1EOVA 3Q7VB 4LF4L 1JJ2A 3L7ZC 3PAGA 3DW0A 1G51A 2K75A 2A49A 3NC8A 1KL9A 4NK3A 4WBGA 1TDLA 2EXDA 4KZ6A 2ZJ9A 4JXSA 4OQ0A 1PWGA 1A8VA 2GN5A 2WGWA 4IVKA 2JA7G 2KENA 4ME3A 1YHBA 3LY4A 1GA9A 4QQBX 4P6BA 5GAGC 4WM9A 1CSPA 4DUZQ 1IEMA 4DAYB 2DUDA 2K52A 2ZTCA 4DKIA 1QUQA 3Q7VA 1N34Q 1FJGL 5F83A 4A3CG 3I4MG 1KGGA 4GKJL 1YLPA 4DR3L 1VQNA 1K57A 2FXQA 4O7DA 2HPBA 3STBD 3CCRA 1AE2A 4DR2L 1PH3A 4KG6A 5EECA 3AEVA 3EIVA 4P87A 3JYIA 1SMXA 2R7ZH 5M5WH 4PPRA 4IBXA 4QY6A 3S2DH 3FKIH 3CCMA 4P72A 3HL9A 3GD7A 2AWNA 4PG3A 3NENA 2XK1A 3RXXA 4F94A 1YIJA 5CGSA 1VQ8A 4MNOA 4QJGA 3LCEA 1I6HH 5HFOA 3OW2A 4QGUA 1EQQA 1VCIA 1Y1WH 1SE8A 1L0WA 1YM1A 5HX9A 1EWIA 5F1FA 2WKHA 2V2FF 3M2KA 4C3HH 4LF9Q 4OPYA 2CKZB 5FASA 3UDIA 1MY8A 2WK0A 4BY7H 4IJLA 3GTCA 1PVOA 1ALQA 3ZFZA 4C3IH 2I5MX 1E3UD 3NBLA 5HW3A 1XA7A 4WJ4A 5E43A 3WS0A 1PHJA 3J7ZC 1ES4A 3LY3A 3IXDA 2ZTEA 3W4QA 4ZJ2A 4DE0A 1E3PA 5AQ7A 4RG1A 4AYBE 4IPDA 1D8LA 1ES5A 4GDBA 4LF6L 2R93H 4Y52H 4LF4Q 3ULPA 1Q1EA 2IT1A 2ZC7A 1EROA 3ZNYA 4X68A 3O88A 4LCLA 3RLFA 3HOXH 3BLSA 2OTJA 4OO1G 3IWIA 1MWUA 1KAWA 4FCFA 3IQAA 4OOMA 1PH6A 5FI2A 2Y2JA 1B7YB 1RCJA 2V1ZA 1W2BA 4X62Q 3CC7A 2PI2A 3DM3A 4WZ5A 5M3MG 1XPRA 4N1XA 1IXRA 2DGYA 1PFSA 3V50A 1VQ9A 5E2FA 1Q2QA 2EIFA 1FJGQ 3CW2C 2IWCA 3G2YA 4DR3Q 5K36G 1E3UA 3CZDA 1EI5A 4C2MH 2ZQCA 4KG5A 3ZVTA 2WB1G 4R4IA 4UA6A 3FWLA 1IZ6A 3PO3G 1FSYA 4QY5A 3J80c 1N36L 2BH2A 5IYDG 3ITBA 1IYSA 4A3GH 5CEBA 4JCVE 5AJ3L 1TVFA 4JI0Q 3KJOA 4B3TL 3A5ZB 4JBJA 1CK3A 2HHHQ 1E4DA 3VP3A 1HNZQ 5HL1A 4A3EH 1IYOA 1P16A 3WS2A 3K0XA 1QZGA 2VQFQ 4E3MA 4DR6Q 2ZQ8A 4B3ML 4JI3L 1VQCA 4ALPA 4S2MA 2Y0SG 2UUCL 3HUMA 1IELA 1KGFA 5DTSA 4JOIA 3S4XA 4DV2Q 5FAPA 1K57C 1VQBA 3TG9A 2UWXA 2WAQE 2Z2LB 2UU9L 2BLSA 1O7EA 4YCUA 1H5XA 4C75A 5C0XI 5IYCG 2RCXA 4JXWA 4LW1A 1CI8A 4M3KA 1VQFA 4MBFA 4A93H 2R6GA 3IT9A 4B4ZA 5M3FG 1VS0A 2Q2HA 5E7NA 2EX8A 3WS5A 3IXGA 4IPGA 4LF8Q 1Q1BA 3M4OH 3N4IA 1XTDA 4LF6Q 5CGXA 3WS1A 2LXJA 2C6WB 3U4ZA 4E3OA 1X54A 1QVCA 1K9MC 4X6AH 1XGJA 2B5RA 3D31A 3GMWA 2H5XA 4K0KL 2ZM0A 1WE4A 1JWPA 3MBZA 4BLMA 4A76A 1OMEA 1MIUA 1BVSA 5J3BA 3HREA 4JI7L 1N8RC 4NXMQ 2XGNA 3I56A 3M3YH 2A1AA 1TWHH 4DAMA 4DPGA 3E0EA 4XUXA 2WAFA 2C35B 3ZJYC 2OV5A 3JC66 2HP9A 1GHMA 2F52A 3IF6B 4L5SA 2OSUA 3M85A 4R4TA 5DF7A 2ZC3B 4UA9A 1NY0A 5M18A 2Y2QA 5EOEA 1E22A 1WFQA 3UPOA 3KDFB 4DUYL 2XD5A 2YTXA 5KSHA 3Q7ZA 2Y2PA 4OQGA 1XNQL 2X02A 1N9BA 4BBSH 4GD8A 1NYYA 1N36Q 4EV4A 3V39A 2KBNA 1X9NA 1PYYA 4LFAQ 2A3UA 4S2KA 4WZ5C 1VQJA 1VQ5A 3IF6A 2ZJRA 2WGIA 1A63A 1VQPA 1BLPA 4B3MQ 3SS4A 3A0JA 4JI3Q 3S1QH 2KHIA 1YI2A 2V20A 2R9XA 3N8RA 1B8AA 4R1GA 4A3DH 4LWCA 4GDNA 4EBLA 2K5NA 3PIOA 4A3BG 4LENA 1Z47A 1EFWA 1TWFH 4EBPA 2UU9Q 3KDFA 3I4NG 3IH8A 4POFA 5A91A 3HKSA 3I55A 5A93A 1OXVA 4DXCA 2R92H 4E3NA 2N3SA 2ZM6L 4MZ9A 4EBNA 2NZHA 4BBRG 3IXHA 4AYBG 3HOVH 2XEPA 4ZBEA 4HJ8A 1MWRA 2XLNA 1R9TH 4XIGS 3PIPA 2EXAA 4IFDJ 1VQEA 4GOPB 5JYOA 1VQHA 3G35A 1FR6A 4C3QA 1Q2PA 5CHJA 1Q46A 1K38A 1Q8KA 2EX6A 5CERA 4FDBA 4K0KQ 1FVIA 1I2SA 3ZG0A 2KCMA 4MEZA 4JOIC 1W7FA 4ZJ3A 2ZC6B 4KG2A 4LV1A 4X6TA 5DLQE 3EBEA 4L5RC 2MQHA 2WKEA 3HFZB 4OQIA 5DTKA 2ZC5B 1LL5A 5I94A 3ZG7B 4R0QA 3CCQA 4XTCS 5CECA 3D0FA 4A3JH 5IWAL 2E2HH 4RYEA 4GOPA 4P0MA 1NTGA 2UXDL 2ES2A 4PZ7A 3PUXA 4JXVA 4R4OA 2JA6G 3RR5A 1XXMA 2FFYA 4DR4L 5GROA 2R7ZG 4NB3A 1CSQA 4NPSA 4E6WA 4DUYQ 2ZM8A 1IYQA 4QL5A 1XNQQ 4OH0A 1PI5A 2JA8H 3WWVA 1GHPA 2ZLYA 3VMAA 5C3EH 2XR0A 3I2ZA 4B4XA 2ASBA 1K25A 1Y1WG 3HOWH 1ZG4A 4X65Q 4DUZL 3MZDA 3JAMc 1ERMA 2K5HA 1XPUA 2WFWA 1JE5A 1Y14B 3C5AA 3PBRA 4BY7G 1N34L 2WAQG 4KZBA 4JF6A 1W3SA 3CC2A 5FQJA 5TGFA 1YHAA 3ZVWA 4DKAC 4KZ7A 4GN5A 5HY6A 4HESA 2ZM6Q 4DV3Q 3ZNTA 1KE4A 1VQ7A 4X55A 1A0IA 1OXTA 1SROA 2EXBA 4Y0UA 1J5EQ 3GTMH 2HIXA 3TEHB 4A75A 3M6HA 2R93G 5KSCA 2HDQA 1RP5A 3PBNA 3IF6C 3DWKA 2OQKA 3ER0A 2ZJPA 1PYSB 1WCMH 2P9VA 3Q1FA 4B88A 4LF9L 1MKIA 3NDGA 3UE3A 1TWCH 3TREA 4R3JA 4JPMA 1KHIA 3W4OA 3S14H 1FCOA 4GNUA 1XJVA 3GQZA 2ZJQA 1ONHA 2G2UA 3J80i 3UE0A 3F2CA 2B63H 4UP7A 3P98A 3F2BA 1PWDA 4XUZA 4LUOA 1J9MA 2LSSA 1MBLA 3G34A 1EIFA 1OTCA 3BFDA 4DR7Q 4LV3A 5IWAQ 1I3QH 3RZOH 3ZDJA 3BJUA 1TXYA 3S1MH 4IBRA 2UXDQ 4JI2Q 4BA1I 4WZ4A 4KZ4A 5LMNQ 3L2PA 1N32L 3HKZE 5DF8A 3DWZA 4HBTA 1CKOA 4DR4Q 1UE6A 3RNUA 1Q12A 4OQHA 1HZCA 1UE5A 2PMZE 1VQIA 5GLBA 4DNIA 3N8SA 2D62A 3M2JA 3BEBA 5FAQA 1LM0A 1YMSA 4GN3B 3BLMA 4KHZA 3CP0A 2JA9A 1Y1VG 4BA2I 1VQOA 1BBWA 1KDWA 4OPQA 1GA0A 4A3GG 4X62L 3H15A 1KDSA 4QIWE 3Q81A 1BTLA 2ZD8A 3ICEA 2RF4A 4A3EG 5FDHA 2JA5H 4YWLA 3J81c 2ID0A 4OXPA 2IWBA 4Y0TA 4GOPC 1DJBA 3GDEA 2HP5A 2WKIA 3CCSA 5EVID 3UNWA 1S40A 2IWDA 5EPHA 2GDNA 4NXNL 3WRTA 3I7FA 4JC0A 1SN8A 3PUWA 3AGDA 3IRBA 3CC4A 5KMWA 1X3FA 1SHVA 3OYYA 1K54A 1KQSA 3PV0A 1HNWL 4A93G 2AMCB 5IE8A 5JEAG 3PO2H 3U4VA 4JBMA 1KE3A 3K8AA 4R4SA 3GTOH 4BQMA 5HAPA 4HJ9A 3FV7A 4S2JA 5EVIB 4A3KH 2NVYH 2HP6A 4JI0L 2VL6A 3KFUA 3B3XA 3FYZA 4A3MH 2HHHL 4DDSA 4MBKA 5FQMA 1HNZL 5M5YH 4BXXH 2H10A 5C44G 2VQFL 2XQZA 4DR6L 2B3GA 4KQQA 1AH9A 1JWZA 1NMFA 5C0XG 1Z6FA 1I50H 4DV2L 1L2SA 3WWXA 1NMGA 1K8GA 1VQ4A 5DTTA 2PI2E 1KXLA 3Q8DA 2OWOA 3O87A 4HIOA 2ZQDA 2IY5B 4IOAA 1SDEA 4GKKQ 3WRZA 4IVIA 2HIVA 1E1TA 1BKBA 3PF4A 1N33Q 2BG1A 3HLEA 5TR7A 4DV0L 1UWVA 4L5QA 5EVIA 1ERQA 4LF8L 1IKGA 3H3VI 5FJ8G 4OWWB 1N32Q 2E2IH 3MEFA 5EUAA 2CQOA 5A90A 3HOUH 1X65A 1V43A 1Q82C 1FCNA 1JMCA 4WEKA 4BBSG 4NXML 3FHWA 4S2LA 3IXBA 3CCEA 1KE0A 1PZOA 4GNXB 2R7DA 1LYLA 3H3VH 3N7WA 2WP8J 1QZHA 1NBWA 4P75A 2DRWA 1L1OC 2RCNA 3FZCA 4QU3A 3RLOA 2PU4A 1JB7A 3M6BA 4YFMA 5TFQA 5E2HA 4A3DG 4EQ5A 4NXNQ 5FLXc 2PU2A 4DRTA 2YTVA 1L0DA 2WADA 2R92G 2E5LL 1FOFA 3RXWA 1HNWQ 1VQDA 2ZQ9A 3HOVG 1L0EA 3BM6A 1H8YA 2B29A 3PUZA 3RJUA 4GKUA 3BFFA 2UUAL 3TOIA 4GNXA 5GHZA 4LFAL 1YLJA 4QHCA 2Y2LA 4B3RQ 3G31A 1I2WA 5GHXA 4OP5A 2WGVA 1OXXK 3BYDA 3HLFA 3CCUA 1K8AC 1HZOA 3VP1A 1O7IA 3AFQA 4FH2A 3GTGH 2JA7H 2CC1A 3CCJA 4KHPQ 3LO7A 3NEMA 1EUJA 4GN2A 1BLCA 3CPFA 1FSWA 2XFSA 3CPWA 4R23A 1JT8A 3SOIA 5FLMG 1K54C 1KRSA 4GS3A 1PW1A 4ID4A 4A3IH 2PBYA 1U5KA 3BU2A 4DK3C 1NZOA 1H8ZA 5CTMA 4A3JG 4DV0Q 2FFFB 3LGJA 3CQZH 4Z9QA 3JAMi 3PCOB 2Q2IA 1M40A 2E2JH 4X56A 4P85A 4GN4B 1P8LA 2JEAI 1DJCA 1V9PA 3HKZG 1SKFA 3N6IA 3A5UA 4AH6A 4RMFA 4HEFA 2MNAA 3FP9A 4J15A 5AQBA 1DY6A 4YY3Q 1XPBA 4JG2A 3CG5A 1NZUA 1HZAA 3UDFA 4YINA 2MFIA 2VQEQ 3PBQA 2JA8G 1ESIA 1CUKA 5C3EG 3RN5A 4C6YA 4Y7PA 2P74A 4DK6C 4RX2A 3CF5A 3IWOA 4PMWA 5JJKA 3HOWG 4PM8A 3QNBA 3CMZA 4BENA 2F4VQ 3SS3A 3HUOA 3UPPA 1Y54A 4TVAB 4OX9L 1KD1C 2OCEA 4MLLA 5EVIC 2CWAA 1XPOA 5M5XH 1GCEA 1UEBA 2H5SA 3PBOA 1XGIA 3KOJA 4L0LA 1BSGA 3STBC 3ZG9B 3VP0A 5E2EA 4R4RA 1YMXA 2UXBL 5HAQA 2ZTDA 4TQUS 2E5LQ 4OLGA 2ZM2A 4OOYA 1Q86C 1ES2A 4DF6A 4UPAA 1FL0A 3S24A 3F2DA 3G2ZA 5A92A 4HIMA 1Q81C 3OPLA 3IHBA 4UP8A 2UUAQ 2JK8A 5FQIA 3PTEA 1HVBA 3BECA 4K91A 3A74A 3IWQA 5IYBH 1XMQQ 1U0LA 4X65L 4RA7A 3RN2A 3TRZA 1QVGA 1WCMG 4AQYL 4GD6A 3EQVA 3UO9A 2WYXA 4UA7A 1C3BA 1BT5A 1HNXQ 5L2FA
chains in the Genus database with same CATH superfamily
2ZXOA 4O0AA 2IHEA 1BBXC 1BUEA 3Q22A 2GNXA 2F0MA 2W3DA 4Y2FA 3E5SA 1O80A 5FSRA 4LF7L 4E3IA 4LUVA 3MXQA 3BRMA 4HHDA 1CQFA 4NXEA 3E9HA 4Y3IA 1V8QA 3UPNA 4MNRA 2FMMA 1Y1VB 3AGEA 2PR5A 2D5DA 3CUEC 2WZXA 2B63G 3H0GG 1T1BA 2F0QA 3EA6A 1PW8A 2VX8A 4A3GB 1CQAA 3A3JA 1GO3E 1IBKQ 4DV3L 1IKLA 2A6EC 3I72A 3IL8A 5AQ9A 3IX8A 2LXKA 4FOFA 4FXKC 4POGA 3BZCA 5C4XH 4N9KA 3GO5A 1E25A 2OLUA 2RHSB 4G3VA 1PTOH 1J5EL 1HR0Q 4PM7A 2PZUA 4RA8A 4BWIA 3J81i 4ZAIA 3TP5A 4GNXC 3S7PA 1QOHA 1C8CA 5CV9A 1GXDC 5K36H 4APVA 4S2NA 4Y7NB 4UHVA 4BBVA 3OTOQ 4HJ6A 1KDBA 2A69C 2WINB 3A0SA 3L0OA 3NSWA 4FTXA 5CHUA 1WTWA 1RGYA 3NHQA 5JPMC 3I4MB 1VQLA 1PDQA 3W5OA 3PXPA 2SNMA 2TMPA 1TWAH 5EOOA 1H95A 2YYZA 1IBLQ 3PUVA 1S4SA 4JYAQ 1CI9A 1SE2A 4EGVA 1B70B 2JE5A 1M6KA 2XA7M 4DV4L 1YT4A 5TJJA 1TQOA 1OXUA 5GADC 4X25A 3KF8B 5GAHC 1L0YB 2L9HA 4M8AA 3TQYA 5IP7H 1F9IA 2IPKD 3C4OA 1OT6A 3KF6B 3GTKB 2LB5A 5HD5A 5IYDH 3HOZH 2OEOA 5GLDA 2NVXB 1OJGA 3PIP3 1W6JA 4WJ3M 2JBFA 2I5HA 4EUZA 2B95A 4ZAMA 4IFDI 1W8QA 3P01A 3ERSX 1VQQA 1SXTA 3OIQA 3SEBA 2NVTB 4JVZA 3G32A 2JA5G 1LTTD 4ZJ1A 5J8XA 1SSOA 2XD1A 2CFMA 3MKFA 1RIPA 3RZDH 5M19A 1PLFA 2DJGC 3V05A 2EPBA 4CDDC 4JF4A 4N9PA 4DR7L 4LFBL 1MJCA 3K7AB 5EKIA 4XXEA 3CCLA 4OX9Q 2R78A 3DTIA 3F1ZA 5C44B 2AWOA 1JICA 1JTGA 1QNKA 1NY4A 1NXYA 1TEMA 4S2IA 2JKGA 5KIZA 4JI2L 3S1NH 1WTQA 4X53A 2Z8LA 2XA7S 1VF7A 5LMNL 2VKSA 2QEXA 3QR8A 1YVCA 3TMEA 4E6XA 5DEHA 3VYRA 2FH5A 4IEDA 2XTIA 1H9MA 4OQHA 4BD1A 4M4XA 5J39A 5EVLA 2TSSA 1K56D 4R4QA 3J81j 1MXOA 2W3HA 3M3YB 3R8BA 3KF8A 2UXBQ 1G6PA 5LL6X 4DE1A 5M3FH 4IFDH 3NDEA 2FFKB 2KEEA 3FKIG 3KF6A 1QMFA 3M9BA 1SDNA 4E6IA 1YJNA 3P20A 3J80L 4JXGA 4IUUA 1CTMA 1HNXQ 1ES3A 4DV5Q 4A3FH 4YCWA 2HD3A 3F1OB 2F0IA 5HZHA 3PO2G 1M90C 4ETZA 3OW7A 5HPIA 5DF9A 1AWIA 4PKYG 4C1NK 1N9WA 4R8IA 3CD6A 5I5LA 1XYIA 4EWFA 3LEQA 4IUVA 1XNRQ 1AP0A 2PQAB 4XQJA 1AZPA 2Q2TA 2IW3A 1B53A 1JJGA 1PI4A 4DE3A 4FVMA 1TD5A 2MHVA 4A3MG 3C4PA 4BBUA 2MO0A 3D4FA 2EY6A 2HDLA 3SS5A 4MIUA 4PMCA 3EJIA 3PMFA 1MJEA 2VLGA 3GVBA 5CHMA 5JYPA 2F3IA 4DNTB 3J7AF 1VETB 2VGKA 1LTAD 5I9OA 4AQYQ 3GTQB 3CCVA 1YLTA 3MA2B 4BY1H 2AVXA 2ATWA 4A4IA 4A5RA 1TS5A 2OQ0A 3KJPA 3ND9A 4WMCD 1TWGH 1LTRD 1BLHA 3LFVA 1F2KA 1O7YA 3HP3A 1LV9A 1BULA 4YHHQ 1WA9A 3NELA 2JKTI 4XXRA 4LF7Q 5GHYA 2HDRA 1JB3A 3K5NA 2K04A 3TN2A 3S15B 1STAA 5LMNW 4FH4A 4JBFA 2NZOA 2F3WA 3NOUC 5J22A 1PTOF 3I3CA 2C9OA 2VB3X 5K5BA 1S5BD 3B42A 4HN7A 2KCTA 3J7A5 4DN4M 1LLBA 4LF5Q 4KV6A 3NQTA 3UB5P 4DR1Q 5ELBA 3F1OA 3HGBA 2DNCA 1GUOA 1G68A 5M3MB 2NN6I 1MWSA 4K5XA 5EBDA 2ICIA 4N8X1 2WV6D 3VR5A 5IGBA 1C9OA 2PQAA 2VZWA 1X3GA 4IUNA 3A3IA 4U3TA 5AFWA 1ZXTA 2NVQH 1VQMA 2J7ZA 3FPUB 5KZHA 2WKPA 1VQKA 3A56A 2O4XA 4R70A 2SNSA 2VW9A 4KZ9A 4G4KA 1EYGA 1VETA 1S5DD 3VDYA 3IBRA 4JGOA 4CJNA 1JWVA 1E1OA 1TWFB 3LWUA 1SYGA 2KJXA 1HJPA 2L1BA 2KOIA 3HOYH 5IGFA 2XDMA 1B50A 1KGEA 3G6EA 3HOXG 3HOUG 3K0YA 1V1OA 4DV4Q 2XFTA 1D2BA 2W1RA 3MQQA 2VS1A 3UDGA 2GJ3A 2WACA 1MC0A 5IHVA 4YWMA 3A7AB 1PZPA 2F0HA 3QP8A 4OEMB 5IP9H 2P7JA 4HOIA 2WB1B 1E2VA 1EWZA 1PH5A 2VY3A 1S66L 4B3SL 4NP5A 2WIIB 2NN6H 2NB0A 1LL9A 1X56A 3DLLA 5D3OA 3VFFA 3DTKA 2E8GA 2E8JA 4HJ7A 3PO3B 4GLQA 4N9LA 1MSGA 3D6WA 2N8NA 1TT2A 1EQTA 4GKKL 1SFOB 4D60A 4DK0A 2G9HD 1N33L 4DE2A 4LFBQ 1Q7YC 4FF1A 3C1FA 3FPPA 3K5OA 5JAVA 5IGEA 5GL9A 3ULFA 1LSWA 1E2ZA 2EYPA 5D3DA 4QD4A 3UE6A 4BWGB 1SDFA 1ZKJA 4S2NC 3CMAA 4FD8A 3K81C 5C4ZA 3I4NH 2XH9A 1PFBA 3U58A 1OTAA 2Y0SB 3VP2A 4K2KA 1NNXA 1I94Q 1ODVA 4KTAA 1C4QA 3IS2B 4JF5A 1WJJA 2LS01 2PPBC 1VQ6A 3M7GA 5L37A 3MZEA 5FI6A 4UP9A 1ZG6A 4B9WA 2X6GA 2P08A 3NIAA 2K14A 1ENCA 3ULJA 2HT1A 3SH7A 1G5UA 3ZG8B 2H0TA 1AW7A 2K4KA 1FQGA 4WJWA 3NULA 1C0AA 4MN7A 4I3IA 2D0OA 5CGWA 1YQSA 3N8LA 1D6EC 3AGFA 1LTID 1X32A 2IX3A 1QJOA 3HLDA 4OIKA 4WELA 3RFBA 4PZ8A 1KVMA 3MXRA 4A3JB 2Q9NA 4V0BA 5EJWA 2E2HB 4JGQA 3V67A 4CLCD 1MD2D 5CV7A 3C1EA 1P9RA 2M2LA 1YITA 2R9WA 1LT5D 1EWCA 1WYCA 2L12A 2J80A 3FKWA 2EWWA 1GJXA 4A3LH 5HDCA 3HKZB 1ICFB 4JBWA 2RHQB 3R2TA 3OCNA 3Q82A 1K55A 2B8GA 1PH4A 1EYDA 2M00A 4GLAC 1PA6A 4XT2B 3PGZA 2PMZB 1I5FA 1QMEA 5IODA 1FGUA 4H44C 1F9SA 1YJWA 1OT9A 1NE3A 4H02A 3TS2A 1RTNA 2ZXRA 3CLOA 1STGA 3IS2A 2F0VA 3BYTB 5IY0A 3WS4A 1K83H 2FMCA 4IZ8A 3DM1A 3BY8A 1E2WA 3VYUA 2UV0E 5EM1A 2DNSA 2UXCL 3P1HA 3S16B 2V1CC 5TBMB 4PNYA 4PM5A 2MJ8A 4A3IG 4CLCB 3PYPA 4OPZA 5A2QL 3V96A 2GZAA 4QB8A 2PNHA 3T1YL 1ZHHB 2V0UA 1EL0A 4P74A 3HLCA 3LEZA 1X0OA 1WTHA 1S0WA 1X55A 5IT9c 2ACGA 3C2WA 3N52A 2G2WA 5IT9E 3U9OA 1PH9A 3AMUA 3OOVA 5H1SE 5CV8A 1NLZA 5F68A 1YZ6A 2HQEA 2BH8A 2PBDP 2JA6H 1W5DA 1FNVA 4U0TA 2EX9A 4JI5Q 3I7JA 2H1EA 4B3RL 5HD3A 1CF0A 5AVEA 3W8KA 3L9AX 1D1JA 4R4CA 3GV9A 1NSNS 1CI3M 2ZMAA 2G5DA 3S1RH 1JE4A 4XT2A 1FYCA 3Q0AA 4K8JA 4C3JH 1UE1A 4H8RA 3D4RA 3PUYA 4MCWA 3E4QA 3ZQ5A 4ZQ3A 3MR0A 2E2DC 1SYDA 1W6KA 2YTYA 4IALA 4GJ4A 4QB4A 3NI9A 4D2OA 3BYYB 2VUMH 3GTPH 4O2DA 4KHPL 4RVAA 3VE3A 4KY6A 1EIYB 4RGOS 4X64L 2HQLA 3AB9A 1B3QA 3LICA 2LY7A 3S2HH 4B3SQ 2UUBQ 3PBTA 4CPKA 1PH1A 2XSSA 4CLCA 3IH9A 1SRUA 3NUCA 3U50C 1UUPA 1ESUA 5KGUA 2Y4AA 2I72A 1BO0A 3NBHB 1KC8C 1LTBD 3MZFA 2EYLA 4XYQA 2YU9H 2PZTA 1LABA 1TS8A 2O99A 4KHVA 5E2GA 4DV6L 2I0QA 1MPLA 5AQAA 3O86A 1R4QB 3MXNB 1IKIA 2RCFA 1GKHA 1KDCA 5C4JB 2KQ3A 1V1PB 2QYBA 4ZRRA 4JKTA 4EQ1A 2A68D 5DM63 5FDSA 4I3JA 2KHJA 4R1JA 4JI1Q 4GW9A 2J3TD 1A2UA 2WAEA 4HIDA 1YBYA 1LT4D 4LFCQ 1H9RA 4A3BB 4H6JB 3S14B 3ISGA 4WN5A 2B2WA 4YY3L 1K6RA 3J7AV 2KLIA 5AVFA 3P09A 3ZYYX 4AIMA 5F1GA 2EFUA 3H0GB 1Y69U 1CEGA 3KSFA 2VQEL 3AQQA 1UEAB 2D0PA 2XGTA 1YAXA 5CRFA 3NCKA 4KLKA 3S17H 2WKQA 4MBHA 5ELOA 4R3AA 2J9PA 3K57A 2M1CA 3BFEA 5E1FA 1V1QA 2HJ9C 4KZ8A 1KIXA 1IYJB 1I3QB 3NBHA 4JI8L 1ZC2A 2E74C 2QDBA 3W1BA 1QILA 1WYBA 2F0LA 3T50A 5IYBG 5GLCA 2X01A 4BD0A 1IOUA 2CH4W 4G57A 2ZQ7A 3ZGAB 3HVFA 2F4VL 5I6YA 4IPHA 3MFDA 3O13A 1S5CD 1WI5A 3U2AA 3NWTA 1OTIA 4JLFA 3MXNA 1OXSC 1S6RA 3MXGA 2MGSA 2EYHA 2PHYA 1V1PA 4EVOA 5CTNA 1DXMA 5FATA 4A3KG 4X66L 3T4OA 5JVG3 4I7ZC 4JBKA 1DD2A 4OP8A 1T5EA 4HEDA 4GB7A 2NYZD 4I3AA 3P7JA 5LMUL 4ZTKA 2K5VA 1KNAA 4H6JA 5FLXE 1QG7A 3QOJA 1BQQT 1XFQA 4L63B 1EIHA 2JYOA 2UXCQ 2L55A 4NKLA 4OWTB 4U0XA 4Y13A 3FG8A 3VOZA 3IHAA 1PFNA 3T1YQ 1IYUA 1KOUA 2CWPA 2EY2A 2EJMA 1T1AA 2D9UA 2EZVA 3IAYA 4EERA 3BZKA 3A3DA 3L7HA 3PAEA 3VR2A 5C4XG 3UI2A 1MWTA 4ZUJA 3SW1A 3EN2A 1TDGA 3ULLA 3Q07A 4DV1L 3CAMA 2KCCA 4IJHA 1X3EA 5GQOA 5JJZA 4GKJQ 3B6YA 4LRYC 1NYMA 3VSLA 2L11A 3T1RA 3OWEB 1VMPA 1EEFD 1BXTA 1S5ED 2O2LD 2EA9A 4K5VA 3C7UA 4L9EA 5HGQA 4DR2Q 5EV0A 5JEAJ 2RSOA 1BBUA 3I8ZA 1XMQL 1K0RA 2DY8A 4X1MA 2K32A 5GLAA 1K55C 3BQ8A 4Q0FA 3JVVA 5CV4A 4DV7L 2H0YA 2QPNA 4I5SA 4QY7A 3BZDB 2E8IA 3I4OA 1SNOA 1PH8A 4DK1A 3LX0A 3PBSA 3E2LA 4IN3A 4MTNA 1Y1VH 1HNXL 2R7ZB 3SGIA 1E7ZA 5IP7G 5LHY1 3GR2A 1PH7A 4P2CB 3KSIA 4FO2A 5EAYA 3T4QA 4UEYA 3HOZG 4PMAA 5CMDA 3S2DB 3FKIB 4X64Q 3F8TA 4LUZA 1I5QA 2Q2UA 1D7QA 1YPRA 4UQIM 1YLZA 2Y2HA 1KLGD 4KD3A 3S22A 5C0XJ 2PDRA 1L0GA 1SCWA 3NTHA 1D5MC 3O3VA 1SAPA 1CM9A 3KYHC 1K73C 1PWCA 5J4EA 2OAP1 1K6SA 3GTOB 1NRFA 1RTOA 1D1KA 2XF3A 1KLUD 3A0RA 1IBKL 4MMNA 4HJ5A 1I6HB 1VEUB 1W63Q 3MWYW 1JVJA 3OPPA 1RHPA 2ALYB 4Y7NH 3VA5A 4A3MB 2JCHA 4DV6Q 4HH2A 1Y1WB 5F82A 3A3EA 4JI6L 4S2PA 2BA1A 1RKNA 5U47A 1K3RA 4A3CH 1HR0L 1IFQA 1O78A 3I4MH 1GM5A 3IF5A 2VGLS 2J8YA 4C3HB 3UY6A 2L15A 4Q0JA 2Y2OA 3QO2A 4NETA 1Q90A 4NMZA 3OTOL 3ICYA 2K6AA 3NJAA 1VQAA 3NHHA 4X1LA 4EETB 2A8VA 4BY7B 3ZHHA 1I50B 4X3KA 1K8MA 1K8OA 1FCMA 3LR0A 4LV2A 2Z2MB 4DXGA 3GTKH 1HA5A 1VHMA 4KJNA 1HUMA 1IBLL 3K80C 4UQIS 1U4PA 4JYAL 4L5TA 3A3FA 1YEZA 4IFDG 2NVXH 3D4WA 4F88A 4EEUA 2DN8A 4GZYC 1Z9FA 1NAPA 4DAVA 3ITAA 1M4VA 1HA6A 3NY4A 1AFPA 4A3FG 3TSSA 2WUQA 2HCCA 1YNNC 4I39A 4S3SA 1HZ9A 2NVTH 1U4LA 1JTDA 5HL6A 3V5MA 3UE1A 3MEHA 3M4QA 1G6AA 1ASYA 3BQAA 4PM9A 1JWSD 4CLCC 5T1GA 4JV5L 4JI8Q 5EFWA 2NUPC 3K7AH 2F0JA 4EX5A 4HCSA 3SH9A 3J81L 5C44H 3DHQA 3PHYA 4JI4L 4KZ3A 1JC7A 3RMHA 1CKMA 2XRNA 2R93B 4Y0OA 4E3KA 1PZID 2KECA 3MC0B 1G6ZA 1HUNA 1GSVA 3ZCZA 4WYYA 1SJED 3G30A 2Z6KA 4BY1G 5C0XH 1ICWA 1WD0A 3E6ZX 1GUGA 1OPXA 3EEAA 4YCVA 5C5KA 3G7LA 4X66Q 2CCZA 1GVPA 2EFXA 2LB9A 1ASZA 2G7UA 2Y2NA 4BL3A 3HOXB 1HR0W 2I46A 1PV4A 4GZBA 1W79A 4HTHA 1TKWB 5LMUQ 1PFLA 3E4OA 1B3AA 1S4RA 2Z6CA 2F4IA 3TZUA 3T1HL 2K50A 5BR8L 5HAIA 2BOSA 4OO1I 2B2WC 1NJIC 1ET6A 2N88A 3F1NA 1YKDA 2Q8IB 1NLYA 3H94A 1JJCB 4WEJA 1AE3A 2ZQAA 2ZXPA 4ILWA 3C30A 4DV5L 2HDMA 1QVFA 4KQRA 2IHFA 1UWPX 3UB9A 3ZG5A 4DV1Q 5FJ8H 1C7YA 3Q24A 2A19A 1RL2A 2F0SA 4RKBA 3DTMA 2RL3A 1J3WA 2Y55A 1LUZA 4LRXC 3G48A 3WOFA 1XNRL 3GTQH 3HLBA 3EQUA 5C3XA 3NOTC 2F0DA 1XMOL 4E3JA 4X69A 2I5LX 2MUYA 2Y8HA 2X6LA 1L2FA 2RSNA 3HOYG 3S1YA 2JC7A 4RHRA 4BS9A 5D14A 4DV7Q 3QWNA 3UN7A 5T1IA 1HTZA 3S15H 4OO1H 4FUWA 1E24A 1CEFA 2IX0A 3VYTA 1TY2A 2Y2GA 2QGQA 3H82B 3HLGA 5FA7A 5IP9G 1U4RA 4FF4A 4ZKCB 2YV5A 1A62A 4PM6A 4DDYA 3SH8A 3QNCA 4YHHL 1XKZA 5AJ3Q 2NN6G 5F2DA 1VDZA 2PQEA 1YNXA 4B3TQ 3T12B 2E76C 4OWXB 4HMIA 2GVAA 5M3MH 1VM1A 4QPRA 4RWSC 4OOLA 1F9RA 5FAOA 4LF5L 1XX2A 2W3EA 4DR1L 2Q9MA 5FQ9A 4HBUA 2O9CA 4J1MA 2W0NA 4A3EB 1KVLA 2UUCQ 4JI6Q 4KQDA 3OCLA 1QB5D 3TP6A 1Q8IA 2HJEA 3LIFA 3M4PA 1K4EA 2ZBBA 3E2KA 4K08A 4KD4A 1TS6A 4LGWA 4EESA 3QHYA 1SR3A 4GLXA 1EQRA 1ML0D 1KRTA 5DJUA 3GTGB 1HXYD 3D3OA 2BA0A 1BZAA 4F3LA 5M1AA 3FKVA 2Y91A 2F03A 4KUOA 4LNQA 4HJAA 4IOCA 4LMQD 1LHYA 2F1MA 5EKLA 2JQOA 2QILA 4KQOA 1J6QA 4ABNA 3V3RA 1BCPD 3B47A 3MJQA 2PYKA 1DOKA 3PO3H 1T9HA 4R3BA 3SE0A 1YHQA 1GD7A 1QCBD 3ONAB 5ELCA 5HGTA 1G291 4DR5L 3TJZC 2RDFA 4A93B 1SFOH 3B33A 3DAVA 4P71A 1TVXA 2ZMFA 2OXPA 5CXWA 4Y15A 1LSVA 3K3DA 1CT1D 2N78A 4JV5Q 4WL9A 1E0BA 1S4ZA 1I4GA 1IBML 2E2JB 3G4SA 3TDQA 5HARA 3HBRA 3PF5A 1RODA 4A3LG 4L8JA 5COYA 4JI4Q 3M4OB 3MXUA 3OPRA 3CXCA 1STHA 1VF5C 4UY8C 5FQKA 3CI6A 1N9OA 4FF3A 1HQRD 3M7NA 2QMIA 2BDNA 3CMEA 4OPRA 2VV7A 4DXBA 5BN4A 3GTLH 5ELNA 4JI7Q 2MO1A 2WZZA 2VZAA 3BVMA 5FLXL 1SE4A 2QA4A 1AXBA 1SLJA 4O0PA 2OLVA 2ZMVA 1XP4A 2EX2A 1IYPA 4YWKA 1BCPB 2R7FA 1TS2A 3G71A 2J9OA 1HH2P 2K05A 5FLMH 4S2OA 3VOYA 3TS0A 3RLNA 1I94L 1XA1A 5LL6S 2RBMA 4KUKA 1ACFA 3T1HQ 5IYCH 3UDXA 5BR8Q 5GAEC 1LSXA 3GSGA 1IHZA 5IU1A 1WYDA 1G2TA 2DCFA 4BMWA 1TWHB 1BUVT 2QKIC 2ZOIA 1PIOA 3BFGA 2ZC4B 1HZBA 4HNBA 3JPUA 1IL2A 4KZ5A 2QDLA 3RD4A 2P04A 1ONGA 3T16A 4BL2A 2YKFA 1JOOA 5EE8A 4OKPA 5G18A 1ZYRD 4JGPA 2L0WA 2Y59A 3MFYA 4HAEA 4EQPA 1XMOQ 3UMEA 2JN7A 1RGZA 1BLSA 4OVDA 3BFCA 1K3BC 4BXXG 3KLSX 4HCEA 2CVRA 3PSIA 1X6OA 4LAAA 4OONA 4LCMA 4F8MA 2Z6KC 2G9DA 1AN8A 2L1MA 3MAQA 2JKFA 5KNBA 5HSQA 1F2ZA 3W4PA 3AFPA 4IO9A 5ELEA 1LTLA 1U60A 1I6VC 2K03A 1HHVA 4LV0A 2VUMG 3S16H 3VSKA 4IUKA 4HIKA 1MKHA 4Q8IA 2JJQA 2AHOB 2VNUD 2VGJA 2FINB 2QZ6A 2XNAC 1L0FA 5I2YA 2BDOA 2K7VA 4JW0A 2OTLA 4KI0A 3CJMA 3W1GA 4OLDA 2J7VA 4BBSB 3DMUA 1K4FA 2Z0SA 3MKEA 4N8FA 3R7WB 4BJPA 3HUNA 4K0WA 1CKNB 3I70A 1UAPA 2EQSA 3CWFA 3MXSA 4PV1C 3TSGA 4IPCA 2X71A 2CH4A 1I4XA 4OGQC 5DVAA 4B93A 2P9VB 1QE6A 5FO8B 1S3OA 2Y2MA 4N1HA 3H9WA 3K7UC 5JVH3 3KBGA 2JKRM 4GOGA 4UAAA 1UE7A 1YLWA 4B9XA 4Y17A 2KVMA 3GTJH 3UB6A 4E3LA 1H3QA 4JI5L 3S1QB 5G4YA 3T4AC 1NJ4A 1LI0A 2GVBA 3TBIB 2EXZA 4A3DB 1WOCA 1XX8A 1HD8A 2AKWB 2V1AA 3GRJA 4IHQA 4RX3A 3VP4A 5EKKA 1YJ9A 1K56A 1STBA 3FC7A 1XJ4A 3BWLA 3HLWA 2WB1E 1FR1A 4KZAA 1ZEQX 3QIAA 3D8GA 1GHIA 5KNCA 3EEHA 2JEBI 4OIJA 5KEEA 4UHUA 2HDSA 3MS6A 5FQQA 4ESPA 2R92B 1L1OB 3T4TA 3E0JA 2Y2KA 1DGSA 3V3SA 4KY7A 4WORA 4NXGA 1LI9A 4DR5Q 1SE3A 1M1KC 2UUBL 1YLYA 3R7WA 1CKNA 1S72A 5I4DA 3HOVB 3OC2A 3F1PB 1IBMQ 5BN3A 1R9TB 5JJLA 2JE6I 4V190 3E3XA 1EEID 2M9VA 5C4JH 1JORA 1HFNA 4P73A 3QP1A 1FIKA 1W8YA 1DJAA 4NG2A 4Q0HA 4K0XA 2A6HD 3NXWA 3FPWA 3G4PA 5BOHA 3AYHB 4O8GA 2HDUA 1B4OA 4ME4A 1T5XD 1TWAB 2Y0SE 2F0OA 2PRFA 4WMCA 1CJFA 4KENB 1DP6A 2NTTA 4QJFA 4A3BH 1GSXA 2KCNA 1YSQA 4HH3A 1A3VA 5FI7A 1O07A 2WGWB 1Y8NB 3VFHA 1LTGD 5CEDA 1SYBA 3BVGA 1BDOA 4R38A 1G2SA 4FXGC 1N4OA 3E9IA 4GLVB 2Y2IA 4JI1L 1LT6D 4EQIA 2N49A 5ELDA 1BF4A 3H0GH 4XDXA 1PH2A 4PZ6A 1JNUA 2IWHA 1STNA 3KYZA 2C5WB 4LFCL 1SNMA 5IIFA 2IX1A 4ZDXA 1PYBA 2HV1A 2F0FA 1GUSA 1L1OA 1PRTD 5JJIA 3OZHA 4DJ2A 2K5WA 4BBRH 4NXFA 2F0EA 1MGSA 3VR4A 3KSHA 3OPHA 1VQGA 3C7VA 2Z6BA 4N92A 3FEWX 3KLWA 3F1PA 1QUQB 1EOVA 1I4RA 4MN6A 3Q7VB 4LF4L 1JJ2A 1HTPA 3L7ZC 3HG9A 3PAGA 3DW0A 4G3KA 4LRZE 2W27A 5HDDA 2FZ0A 1CZGA 1G51A 2K75A 3MQOA 2A49A 3NC8A 1KL9A 4NK3A 3VR3A 1WTRA 1TDLA 4WBGA 2K01A 5EPKA 2EXDA 4KZ6A 1DCZA 2A24B 4MDZA 3NK9A 2NWGA 2ZJ9A 1CQVA 3D3RA 2A74C 3IBJA 4JXSA 4OQ0A 1CA6A 1PWGA 1A8VA 3L3OC 2GN5A 4K6DA 2WGWA 4IVKA 2JA7G 2GA4B 3FRPB 2QHKA 2KENA 1TF1A 4ME3A 5FOBB 1YHBA 3ND8A 3LY4A 1GA9A 4OELB 4QQBX 4P6BA 3T4SA 4U68A 5GAGC 1EZ8A 4WM9A 1F77A 2JA8B 4DFAA 1CSPA 4DUZQ 4ZCKA 1IEMA 5C3EB 1DP8A 1MZUA 4DAYB 5CGKA 4QIWB 2DUDA 3L9KA 1EY8A 2K52A 3MFGA 1ONLA 2ZTCA 1N9LA 4HP4A 1ZKOA 4DKIA 2ENBA 3H6MA 4RGNA 3H7WB 1H9JA 3HOWB 1QUQA 4I38A 2IA2A 3Q7VA 1N34Q 1FJGL 5F83A 2PT7A 4A3CG 1XTCD 2KOLA 2B18A 3I4MG 1KGGA 5NUCA 4GKJL 1YLPA 4DR3L 1EW0A 1VQNA 3X3MA 1K57A 2FXQA 4O7DA 2HPBA 3STBD 3AU7A 3CCRA 4YIJA 1AE2A 4DR2L 1PH3A 2A24A 4KG6A 3AEVA 3EIVA 5CX7A 4CGYB 4P87A 5EECA 1P9WA 3JYIA 1SMXA 2R7ZH 5M5WH 4PPRA 2BE5D 1EWHA 4NDXA 4G7OC 2B2TA 2CMNA 1STZA 1LO5D 4IBXA 4QY6A 4WRDA 3QP2A 2F0TA 2L0CA 3FKIH 3CCMA 3S2DH 4P72A 3HL9A 2RKSA 1BOSA 2EYMA 3GD7A 5DKLA 2EY1A 1BCPC 2AWNA 3NENA 4PG3A 2XK1A 5I9PA 3HEJA 3RXXA 1FNUA 3A54A 4EQNA 4F94A 1YIJA 4RH6A 5CGSA 4DN0A 1VQ8A 4ULLA 4MNOA 3CAXA 4QJGA 3BDOA 3LCEA 5TBMA 1I6HH 5HFOA 1PMRA 4ZUIA 3R93A 3OW2A 4QGUA 1EQQA 1VCIA 1B9NA 1Y1WH 1SE8A 1SMYD 3GTMB 5TSSA 1L0WA 1YM1A 5HX9A 1EWIA 5F1FA 2WKHA 2V2FF 3H7WA 2EYJA 3M2KA 1BNZA 4C3HH 3NBIA 4LF9Q 3SR1A 2QJ7A 2RA4A 4OPYA 2CKZB 4U673 5FASA 3UDIA 1MY8A 2WK0A 1DOMA 4BY7H 2ZT9C 5M9OA 4IJLA 1WCMB 2Q0OA 1PVOA 3GTCA 2IJ0A 3A7LA 1ALQA 2YKHA 3ZFZA 1I4HA 2QJ5A 1JR0D 1EQVA 4C3IH 2I5MX 1E3UD 3NBLA 5HW3A 1Y28A 1TWCB 4XYOA 1XA7A 4WJ4A 2XWJB 2QW7A 5KYIA 2DMWA 5E43A 2F0GA 5DFYA 2PD7A 3WS0A 2R61A 1PHJA 4HI4A 4IUHA 3SK4A 3J7ZC 1ES4A 2V0WA 2FHTA 3LY3A 3IXDA 2A6ED 2ZTEA 4QUCA 4CJ0B 3W4QA 2OWHA 4ZJ2A 3U9SA 1E3PA 1EYCA 4DE0A 5AQ7A 2B63B 1B44D 3ITPA 1STYA 4RG1A 4AYBE 4IPDA 3SK8A 1D8LA 5FO7B 1ES5A 1SKOB 4GDBA 4LF6L 2R93H 4Y52H 4LF4Q 3ULPA 1Q1EA 2IT1A 3RZOB 2ZC7A 3MMHA 1WVLA 4XT3B 1EROA 3ZNYA 4X68A 3S1MB 3O88A 4J6HA 4K14A 4LCLA 3RLFA 3HOXH 2J4XA 5CC4A 4N9TA 4X3TA 3E98A 3BLSA 2OTJA 4MTKA 4OO1G 3IWIA 1MWUA 3NQIA 1KAWA 1SYCA 3IQAA 4FCFA 4OOMA 4FNFA 1PH6A 5FI2A 2AUKA 5J3WA 2AQ2B 2Y2JA 1B7YB 4RFBA 1RCJA 2WKDA 1W2BA 3URYA 2V1ZA 4O1NA 1LT3D 4X62Q 1PZKD 3CC7A 2PI2A 5HURA 4TSSA 2XVSA 3T13A 2B2VA 2NUTC 3DM3A 3SDZA 4WZ5A 5M3MG 1XPRA 2K31A 3LIEA 4N1XA 1L0XB 5G3LD 3IKJA 1IXRA 2DGYA 2JXMB 3MQ0A 1PFSA 1WTVA 2JSOA 1GHKA 3V50A 2F0UA 2PW7A 1VQ9A 1SKOA 5DM73 3A0VA 5E2FA 1Q2QA 2EIFA 1X3QA 2JA5B 1FJGQ 3VR6A 3CW2C 4RGMA 2IWCA 3G2YA 4DR3Q 5K36G 1M8AA 2CHBD 3VE4A 1E3UA 1A3UA 3OWFA 4ME5A 5A35A 1D06A 3CZDA 2CW0D 1EI5A 4C2MH 3CUEA 2ZQCA 1ENFA 4EXOA 3C2PA 4X3UA 4KG5A 3ZVTA 1K83B 2V1BA 2MPMA 2WB1G 1FD7D 2CQAA 4R4IA 2VGLM 1SEBD 3FWLA 4IQZA 4UA6A 4DDSA 3IFDA 1IZ6A 4XT1B 4YOFA 2QEJC 3PO3G 1FSYA 4QY5A 3J80c 1N36L 5KIXA 3J80E 2BH2A 5IYDG 3ITBA 2AUJD 5EPJA 5C5LA 1IYSA 4A3GH 5CEBA 4JCVE 5AJ3L 4WUJA 2GX5A 1TVFA 1EY9A 4JI0Q 3KJOA 4B3TL 3A5ZB 3QB3A 4JBJA 1CK3A 2HHHQ 1E4DA 5LBRA 3VP3A 4F7XA 1HNZQ 4A3EH 3PO2B 1T19A 1B2TA 5HL1A 5IS1A 1IYVA 1IYOA 5L8MA 1P16A 4RHSA 3FDTA 3WS2A 3K0XA 3BVZA 4K5WA 1QZGA 3MZ5A 2VQFQ 1S67L 2BTFP 4E3MA 4DR6Q 2ZQ8A 2NVYB 4B3ML 2NZ1D 4JI3L 1VQCA 3DEPA 3GQBA 4ALPA 4S2MA 1JOKA 2Y0SG 5M5YB 2UUCL 3HUMA 1IELA 1KGFA 4HQAA 4JOIA 5DTSA 4EUVA 3S4XA 4DV2Q 2V8CA 5FAPA 5C3WA 4YWZA 1K57C 1VQBA 3TG9A 2UWXA 2WAQE 2Z2LB 3A8IE 2UU9L 2QWSA 2JKTM 4L9GA 4KN7C 3T4LA 2BLSA 1ESFA 1O7EA 3GTPB 2VUMB 1Y8PB 3NTIA 4YCUA 1H5XA 1SZVA 2JHEA 1A2TA 4C75A 2B2TC 2PO4A 5IYCG 1F2YA 5C0XI 2RCXA 4R8NA 5IGDA 3FMCA 4JXWA 4LW1A 3V2TA 1CI8A 1VQFA 2H28A 1SNCA 4CHTB 4A93H 2R6GA 4M3KA 4MBFA 3IT9A 4B4ZA 3DWPA 1VS0A 5M3FG 3A8JE 1DYQA 2Q2HA 1PYWD 5E7NA 2EX8A 3QP5A 3CITA 5JEAH 3IXGA 4IPGA 3WS5A 4LF8Q 4NW2A 4XQNA 5AJGA 1Q1BA 3M4OH 3S7NA 3N4IA 1XTDA 1VMCA 4LF6Q 4PKYA 5CGXA 3WS1A 2LXJA 4KY5A 1PFMA 2B2YA 5FO9B 2C6WB 1F9PA 3U4ZA 1G28A 2O9AA 4E3OA 2PNRC 2RDGA 1X54A 1QVCA 1K9MC 1VEUA 4X6AH 1XGJA 2ZL1B 2B5RA 3LIDA 3WOEA 5K5PA 4G7HC 3EROA 4HP9A 3D31A 3C8CA 1HQMC 3GMWA 2KEDA 2H5XA 2Z4HA 3NP8A 4Z9CB 4K0KL 2ZM0A 1WE4A 3LI8A 2VK3A 2AQ3B 1JWPA 3MBZA 4BLMA 4A76A 1OMEA 3FPVA 1MIUA 1BVSA 5J3BA 2VV8A 2E2IB 3HREA 1ET9A 4JI7L 1N8RC 4NXMQ 1JCKB 2XGNA 1A0KA 3I56A 3M3YH 3HOUB 2A1AA 1ILPA 1TWHH 4DAMA 1OJ5A 1JOQA 1GUTA 4DPGA 2A73B 3E0EA 5DAUA 4XUXA 4CDFC 4WLAA 5J7EA 1NR2A 2WAFA 1G8ZD 2C35B 3ZJYC 1J9OA 2OV5A 3JC66 1D7EA 2HP9A 1GHMA 2O0YA 3LUQA 2F52A 3RH8B 5IGCA 3LR3A 3IF6B 4L5SA 1EOTA 5IT9L 4GS9B 4KKTA 2OSUA 3M85A 4ZKBB 4MHEA 4R4TA 4NKPA 3MF0A 5DF7A 2ZC3B 2VXWA 4LPZA 4UA9A 1NY0A 5M18A 2R3ZA 1CFMA 1TS3A 2Y2QA 3KX0X 5C4HA 5EOEA 4DMZA 1E22A 1SYEA 2W3GA 3KLSA 1WFQA 1TY0A 4KMUC 2PYRA 2ZL1A 4ZYSA 3PR6A 2SOBA 3UPOA 2B02A 5DFXA 2KUMA 4HJ3A 4QMGA 3KDFB 3CHBD 2B8FA 4DUYL 2XD5A 2YTXA 2INWA 2EJFC 1BR9A 1L3LA 1A6XA 5KSHA 3Q7ZA 3NE5B 2PYPA 1V9ZA 2Y2PA 1BYWA 4OQGA 3LWEA 1D5XC 2EDGA 4ZK9B 1XNQL 2X02A 1A3TA 4EW7A 4QUFA 1N9BA 1LACA 4BBSH 4GD8A 3A55A 1WTXA 1NYYA 1N36Q 3UB7A 4EV4A 3V39A 2KBNA 3T1SA 1X9NA 1PYYA 2HUGA 3TP7A 4LFAQ 2A3UA 3K3CA 4CDEC 2B2VC 4S2KA 4WZ5C 1IL8A 4H0LC 3MHBA 2QKPA 1VQJA 5EVEA 5F5YA 5EBCA 4CJ1B 1VQ5A 3GP7A 4BBTA 1SMYC 2ZJRA 3C3LA 3IF6A 2WGIA 3BY9A 1A63A 4LFUA 4JGRA 1VQPA 1ZTUA 2BCOA 1EYAA 4GS9A 5HPFA 3I90A 1UWNX 1BLPA 4B3MQ 3SS4A 3A0JA 4LLOB 2K5QA 4JI3Q 3S1QH 2KHIA 3HS0C 1YI2A 2V20A 2R9XA 3N8RA 1B8AA 1GOZA 4R1GA 4TRDA 4A3DH 4LWCA 3KUPA 4GDNA 4HY8A 3BS1A 4EBLA 2K5NA 4KJOA 3PIOA 3VA7A 4A3BG 4LENA 1Z47A 1EFWA 1TWFH 3QG1A 2XSCA 4EBPA 3CU7A 3KDFA 2UU9Q 2A68C 3I4NG 3IH8A 2ICEC 4POFA 5EM0A 2Z6DA 2EE1A 5A91A 2JA7B 3K5MA 5F69A 3HKSA 2J3TC 1DJRD 3I55A 5A93A 1SYFA 3D9YA 1OXVA 4DXCA 2R92H 4E3NA 2N3SA 2ZM6L 3GECA 4MZ9A 4PQXA 5FEGA 3H82A 3DTEA 4EBNA 1G91A 4CKEA 2NZHA 4BBRG 2F0WA 3F2UA 5A2QE 3IXHA 4AYBG 5CBEE 3HOVH 4ZLTF 2XEPA 4A3IB 4HJ8A 1MWRA 1UGUA 2XLNA 4ZBEA 1R9TH 1H8MA 4XIGS 3PIPA 2EXAA 4IFDJ 3Q6SA 1VQEA 4GOPB 5JYOA 3PIO3 3CPTB 1BCPF 3TE8A 4K6LA 5A8BA 1HCZA 1VQHA 1MKMA 2OOLA 3G35A 3CQZB 1CK1A 1I4PA 1FR6A 4C3QA 1SBBB 1Q2PA 3O5YA 5CHJA 2Z4IA 3OMGA 1Q46A 1STEA 1K38A 1Q8KA 2EX6A 5IGGA 1WTOA 5CERA 4FDBA 4K0KQ 1X3PA 4H13C 4KKSA 3U4LP 1FVIA 1I2SA 3ZG0A 2KCMA 4MEZA 2OT2A 1KNEA 4JOIC 1W7FA 4ZJ3A 3OBFA 2ZC6B 4KG2A 1CA5A 3EGXC 4LV1A 4X6TA 3GV6A 5DLQE 3DWAA 3EBEA 4L5RC 2K7SA 2MQHA 2WKEA 3HFZB 4OQIA 3D72A 5DTKA 2ZC5B 1PZJD 1LL5A 5I94A 5E3FA 1F5MA 4CDCC 4DJ3A 3ZG7B 4R0QA 1ESRA 2LFNA 3CCQA 4XTCS 5CECA 3D0FA 1AEXA 2VEAA 2Y79A 5DNFA 2DY7A 5MC7A 1A15A 4A3JH 5IWAL 2E2HH 4RYEA 4GOPA 3CPTA 4O01A 2QF7A 2B2UA 4P0MA 3KYEA 1G6OA 1KAAA 1MHWC 1NTGA 2UXDL 2ES2A 4PZ7A 5L09A 3CHWP 2OAQ1 2AQ1B 1IW7D 3PUXA 2XN9C 1LT0A 4JXVA 4NXBA 4R4OA 2JA6G 2B2YC 3I4LA 3RR5A 1Z09A 1XXMA 2PZWA 5M5XB 2FFYA 2CW0C 4DR4L 5HWWA 4I65A 4XQQA 1LTSD 5GROA 1MBYA 2R7ZG 1XFNA 4NB3A 5HWTA 1CSQA 4NPSA 4E6WA 4DUYQ 3HZXA 3G6JB 3H09A 4FXDA 4C3JG 5CYUA 2ZM8A 1IYQA 3HCYA 5IT5A 1KDAA 1JWUD 2FJ2A 3HJKA 4QL5A 1XNQQ 4OH0A 1PI5A 4KKUA 2JA8H 4IUQA 3WWVA 1GHPA 4HIAA 5E4XA 2ZLYA 3SZTA 3VMAA 5C3EH 1DZ1A 2XR0A 3I2ZA 4B4XA 1K0SA 5I2XA 2ASBA 4P6ZM 1K25A 3TRCA 1Y1WG 3HOWH 1ZG4A 1GUWA 4X65Q 4DUZL 3MZDA 4II7A 3JAMc 1ERMA 2K5HA 3BW6A 3JAME 3E0YA 4H7BA 4C3HG 1XPUA 1DRMA 2WFWA 2Z9HA 1JE5A 1Y14B 2EVBA 2KA7A 4Y5FA 3UMDA 3C5AA 1GHJA 3PBRA 1EIGA 4RGTA 4Z1WA 4DU9A 4BY7G 1N34L 4CBVA 2NTSA 3MTSA 4CJ2C 5E4WC 2WAQG 4EU0A 2IL8A 3X3NA 1PTOD 4ZRZA 4C3IG 5JPNC 5FL3A 1DONA 4FSFA 4KZBA 4JF6A 1W3SA 3FVQA 3CC2A 1RD9D 4HSVA 5FQJA 4A3KB 5TGFA 2XIWA 3MXPA 1YHAA 3ZVWA 4IURA 4DKAC 3W3AA 4KZ7A 4GN5A 1T1CA 5HY6A 2SEBD 3QJYA 2ZM6Q 4DV3Q 4HESA 3ZNTA 2LMCB 1KE4A 1VQ7A 1T18A 2PD8A 1O7LA 4X55A 3T4JA 1A0IA 1OXTA 3OOCA 1SROA 2EXBA 4P6ZS 4Y0UA 1YNJD 4WF0A 1HFGA 1J5EQ 3GTMH 2F0NA 2HIXA 3NOPC 3TEHB 4A75A 2Q8TA 3M6HA 1SNDA 2R93G 4EQOA 5KSCA 2HDQA 4PHTA 4Q0IA 4PAUA 1RP5A 3PBNA 5C4XB 1TU2B 5ELFA 3IF6C 1PTOB 3DWKA 2OQKA 1Q3LA 3ER0A 3H3VC 2ZJPA 1PYSB 1WCMH 1WTPA 2P9VA 4G3WA 3TW8A 3Q1FA 4B88A 4HJ4A 2DNEA 4LF9L 1MKIA 4C56C 3DUZA 3NDGA 2EJGC 4C1NI 3UE3A 1NR4A 1TWCH 1F98A 3TREA 5D3IB 3EFXD 4R3JA 1LLRD 4R6LA 3HRZC 4JPMA 1KHIA 3SVMA 2MJ6A 2Z1CA 3QP4A 3W4OA 3S14H 1FCOA 4GNUA 1XJVA 3GQZA 3M4YA 2KX6A 2ZJQA 1QWYA 2KHSA 1V9YA 3CRKC 3D4DA 4OL7A 1ONHA 2G2UA 1FGBD 4AFIA 3J80i 3TP8A 3UE0A 3F2CA 2B63H 1NWZA 4UP7A 3P98A 3F2BA 1PWDA 1ILQA 2XWBB 3HOZB 4GHIB 4XUZA 1HPCA 3UB8A 4LUOA 1EY5A 1J9MA 2LSSA 1MBLA 3G34A 1EIFA 4I7AA 1OTCA 2XROA 3BFDA 4ODGA 4DR7Q 1TS4A 1UNSA 3LI9A 4TKOB 4LV3A 5IWAQ 1I3QH 3RZOH 3IX3A 3BJUA 4YNRA 3ZDJA 2WKRA 1GSWA 1TXYA 3S1MH 4JK1C 4IBRA 2UXDQ 3NWSA 2V9AA 4JI2Q 3RZDB 1PRTF 2NBFA 4BA1I 4WZ4A 4KZ4A 5LMNQ 2ZOHA 3L2PA 1N32L 3HKZE 3N6RA 1AZQA 3GTLB 5DF8A 3DWZA 4HBTA 2M7UA 1CKOA 4DR4Q 1UE6A 4DXFA 5CV6A 3S7QA 1S1ZA 1H9KA 1Q12A 4IUTA 1HZCA 1UE5A 3DEOA 2PMZE 4F87A 3RNUA 4X3SA 3S1NB 1VQIA 1W63M 3G6OA 2PCFB 1KABA 5GLBA 4DNIA 3W2DA 2D62A 3M2JA 3N8SA 4B9OA 3BEBA 1MI2A 5KYLA 5FAQA 5DKKA 1LM0A 3R3OA 1R4PB 1YMSA 2VJWA 4GN3B 3BLMA 4KHZA 2B39A 1DP9A 3CP0A 2JA9A 4G7ZC 1Y1VG 3T56B 2XRSD 2BASA 2M7VA 1YNND 1VQOA 1BBWA 4BA2I 1KDWA 4OPQA 1PRTB 1NRJA 3T4KA 5CORA 3CRLC 4B08A 5M3FB 3Q23A 1GA0A 4A3GG 4X62L 3H15A 1KDSA 4CLCE 4GHIA 4QIWE 3Q81A 1F2MA 4O42A 1BTLA 2MP1A 3P75A 4A3FB 2ZD8A 3ICEA 1EY0A 2RF4A 4A3EG 5FDHA 2HZ5A 2JA5H 4YWLA 4WFN3 3QOLA 3J81c 2ID0A 4OXPA 3J81E 2IWBA 4Y0TA 3R2IA 4GOPC 1DJBA 3GDEA 4K8IA 2HP5A 3CCSA 2WKIA 2B2UC 3DXJC 2O9BA 5EVID 3UNWA 3SHLA 1PNEA 5FEFA 1ENAA 1S40A 2IWDA 5EPHA 2GDNA 2KDKA 3RTYA 4ARZB 4NXNL 3WRTA 2JN4A 2SDFA 3I7FA 2J0TD 4JC0A 2A5HA 3KYQA 4BY1B 1SNQA 1SN8A 3PUWA 3AGDA 2OF1A 3IRBA 3CC4A 5KMWA 1X3FA 3OPOA 1SHVA 1EY4A 3IXBA 4IJGA 1TWGB 1DM0B 3OYYA 2QCPX 1K54A 3HJIA 1KQSA 3PV0A 3LNNA 5CV5A 1HNWL 5L07A 1XXGA 2Q8RE 3ERQA 4A93G 3MSHA 3VOLA 2F0KA 1XJ3A 2AMCB 1YSPA 5FK9C 1CHPD 5IE8A 1P0ZA 5JEAG 3PO2H 3U4VA 4JBMA 1KE3A 1II3A 3K8AA 4R4SA 4DAPA 1EU4A 2EY5A 3GTOH 4BQMA 5HAPA 3VYSA 4RKLA 4HJ9A 5FKAC 3FV7A 4S2JA 5EVIB 2HP6A 2NVYH 5J1ZA 4JI0L 2OWJA 2VL6A 1TS0A 3KFUA 3B3XA 4DAYA 4LK1C 3CKIB 4A3MH 2HHHL 3FYZA 5ISRA 4MBKA 4NEED 5FQMA 1HNZL 5M5YH 4BXXH 2H10A 4RCNA 4FF2A 5C44G 2NVQB 3GTJB 2VQFL 2XQZA 4DR6L 2B3GA 3PQIA 4KQQA 2I9VA 3T53B 1AH9A 1GUNA 1JWZA 4ARZA 1OO9B 1NMFA 5C0XG 3W2ZA 1C48A 1Z6FA 5HDSA 1I50H 4DV2L 1O7ZA 1L2SA 3HOYB 1K0KA 3WWXA 1NMGA 1K8GA 5EGTA 1VQ4A 1EY6A 2O5JC 5DTTA 2PI2E 2HF6A 1KXLA 1PXUA 3Q8DA 2DJFC 2WKCA 2OWOA 3O87A 4FYDA 2E75C 3LIBA 1H9SB 4HIOA 2ZQDA 3J7YW 2IY5B 3BDLA 4IOAA 1SDEA 1RDPD 4GKKQ 3WRZA 4EEPA 4IVIA 2HIVA 1E1TA 1BKBA 3K6OA 3PF4A 1J8IA 1N33Q 2BG1A 2VA0A 3HLEA 5TR7A 4DV0L 3TZDA 3KLRA 1UWVA 4L5QA 2A2LA 5EVIA 1ERQA 4LF8L 4KK7A 1IKGA 3H3VI 2C5CA 1Y4OA 5FJ8G 1IW7C 1XJ2A 2RVLA 1ZYRC 4OWWB 1SNPA 1SJHD 2A69D 1N32Q 5CTMA 2EYFA 2E2IH 1OTEA 3MEFA 5EUAA 2CQOA 3K2NA 3I4NB 4QCLA 5A90A 3S7OA 5F6AA 3HOUH 3NTKA 1HRJA 3VV4A 2K5DA 1X65A 1NUCA 1V43A 4Q5VA 1Q82C 1FCNA 1JMCA 1P97A 4WEKA 1U9RA 4LJZC 4BBSG 3LYXA 4NXML 2F3VA 4K2LA 3OLOA 3FHWA 4MN5A 5G4ZA 2L4RA 1H9SA 4UAIA 4DGZA 4BBRB 3R4KA 4S2LA 4RAUC 2HGVA 3MVVA 4AYBB 4L6TB 1FNWA 5KRUA 3CCEA 1KE0A 3JAML 3DBAA 3E4PA 3LIAA 1PZOA 3OIPA 3BDCA 1RF2D 4GNXB 1HLUP 2R7DA 4ID6A 1LYLA 3H3VH 3N7WA 2L5TA 2WP8J 3EWKA 1JQYD 1QZHA 1NBWA 4P75A 2DRWA 1L1OC 2RCNA 3FZCA 5HWVA 4QU3A 5CR3A 3RLOA 3KBXA 2PU4A 1EZ6A 1JB7A 3M6BA 4RQ9A 5G3LF 2PAVP 4DNRB 2V4DA 1OTBA 4YFMA 5TFQA 5E2HA 3RUZA 4IUPA 1Y8OB 1EY7A 5BN5A 1B9MA 4RCOA 4A3DG 4J8QA 1XJ6A 2JKRI 2EOTA 1PTOC 4EQ5A 5D65A 4NXNQ 3H91A 5FLXc 2PU2A 3EQLC 4DRTA 1NCVA 1RJTA 1OTDA 1XWEA 2YTVA 2L4NA 1NZOA 1L0DA 2WADA 2R92G 3DWQA 2E5LL 1FOFA 3RXWA 1HNWQ 1VQDA 3OSOA 1S5FD 2ZQ9A 5KNDA 1YNJC 4OHJA 3HOVG 1L0EA 2EWVA 3BM6A 1H8YA 2B29A 3PUZA 4DA2A 3LGOA 3RJUA 2D02A 4GKUA 3D6CA 3NECA 3BFFA 2UUAL 1I4QA 1D1IA 3TOIA 4GNXA 2RDHA 5GHZA 4LFAL 3K5LA 1YLJA 4QHCA 2Y2LA 2D2CC 3I73A 4B3RQ 2VV6A 3KSGA 3S9WA 3QP6A 4E04A 2O5IC 1F2LA 1I2WA 3G31A 2JP1A 5GHXA 4OP5A 2WGVA 1OXXK 3BYDA 3HLFA 3CCUA 1K8AC 2K28A 2JA6B 1HZOA 2XRQD 4FP5D 3T51B 3JVUA 1FR3A 3VP1A 1O7IA 2A6HC 3GV3A 3AFQA 4FH2A 5M5WB 3GTGH 2JA7H 2CC1A 3C38A 5L10A 3CCJA 3S1RB 4KHPQ 4HSPA 1WD1A 4C3JB 3LO7A 3NEMA 1EUJA 4GN2A 1BLCA 3CPFA 1FSWA 2XFSA 3CPWA 4R23A 3IFTA 1JT8A 5DJTA 4CKCA 3SOIA 5FLMG 4CQHA 1N9NA 2X69A 5CBAE 3EGDC 1K54C 1KRSA 4GS3A 1CHQD 2PW5A 1PW1A 4ID4A 4A3IH 2PBYA 1U4MA 2V8FA 5C5MA 1U5KA 3S2HB 3BU2A 3ZYTA 2EYOA 3BG3A 3OMCA 4DK3C 4KN4C 1PRTC 2LKVA 5EPLA 4HMJA 1TR5A 4A3JG 4DV0Q 5IOCA 1H8ZA 2W1TB 2FFFB 3T1QB 3LGJA 3CQZH 4QF4A 4Z9QA 4MN3A 3JAMi 1S1YA 1EU3A 3PCOB 2Q2IA 1M40A 2E2JH 4X56A 4P85A 4GN4B 1P8LA 2YU9B 2JEAI 1DJCA 3MFXA 1V9PA 3HKZG 1SKFA 3N6IA 3A5UA 4AH6A 4RMFA 1VB6A 4HEFA 2MNAA 2WAQB 4HR7B 3FP9A 2K1BA 3K58A 1KTKA 3EVQA 2RQXA 4J15A 4UDUC 3SK6A 4C3IB 5AQBA 1DY6A 4YY3Q 1XPBA 4JG2A 3CG5A 3K59A 1NZUA 1HZAA 3UDFA 3F1NB 4YINA 2MFIA 2VQEQ 4PMBA 3PBQA 1JWMD 2JA8G 1ESIA 4CKBA 2NUCA 3BJNA 1CUKA 3NPPA 5C3EG 3RN5A 3OHXC 3T1XA 2VB2X 4ETXA 4C6YA 4Y7PA 1D5ZC 4DF7A 2P74A 4DK6C 3LR5A 4RX2A 3CF5A 1PRQA 3EOIA 3IWOA 4PMWA 1CZWA 5JJKA 3HOWG 4PM8A 1QNUA 3S17B 4GCZA 3QNBA 2W1TA 3CMZA 4BENA 2F4VQ 3SS3A 1RCVD 3HUOA 2H4OA 2P5ZX 2F0PA 3UPPA 1TS7A 1Y54A 4TVAB 4OX9L 1K28A 1KD1C 2OCEA 4MLLA 5EVIC 2CWAA 3P7NA 1XPOA 5M5XH 1GCEA 1UEBA 1F9QA 3SK5A 2H5SA 3PBOA 1XGIA 2K2NA 4L9FA 3KOJA 4L0LA 2N55A 1BSGA 1TIID 3STBC 3ZG9B 2HCIA 3IX4A 1EFID 2K33A 3VP0A 5E2EA 4R4RA 1YMXA 5C6AA 1IKMA 2BE5C 2J3WA 2UXBL 5JOBA 1Z7TA 2ZTDA 4TQUS 2E5LQ 5HAQA 4OLGA 2ZM2A 4OOYA 1Q86C 1ES2A 4DF6A 4UPAA 1FL0A 3S24A 3GDIA 2D01A 3KK7A 3F2DA 3G2ZA 5A92A 1HTLD 4HIMA 3KO6A 4QWOA 1Q81C 1H0MA 3OPLA 2I07B 3C46A 4R9WA 3IHBA 4UP8A 2UUAQ 3LR4A 4M1UB 2JK8A 5FQIA 3PTEA 1FILA 1HVBA 3BECA 1B1ZA 4K91A 3I91A 1MSHA 5I6WA 3A74A 2PR6A 3IWQA 5IYBH 1XMQQ 1U0LA 4X65L 3A8KE 1Z6HA 4RA7A 3RN2A 3TRZA 1QVGA 2W3FA 4JPBW 1WCMG 1LL8A 4F3LB 4AQYL 1DOLA 3SXHA 4GD6A 3EQVA 3UO9A 2WYXA 4UA7A 4C2MB 1C3BA 1BT5A 5EQ0A 3WDNA 4A3KH 5L2FA
chains in the Genus database with same CATH topology
4O0AA 2IHEA 1BUEA 5FSRA 4LF7L 4E3IA 4LUVA 3BRMA 3E9HA 3UPNA 4MNRA 3AGEA 2WZXA 2B63G 3H0GG 1PW8A 3A3JA 1GO3E 1IBKQ 4DV3L 5AQ9A 2LXKA 4POGA 3BZCA 5C4XH 4N9KA 3GO5A 1E25A 2OLUA 2RHSB 1J5EL 4PM7A 1HR0Q 3J81i 4GNXC 4APVA 4S2NA 3OTOQ 3L0OA 5CHUA 1RGYA 1VQLA 3W5OA 1TWAH 5EOOA 1H95A 2YYZA 1IBLQ 3PUVA 4JYAQ 1CI9A 2JE5A 1B70B 1M6KA 4DV4L 1YT4A 1OXUA 5GADC 3KF8B 5GAHC 3TQYA 5IP7H 3C4OA 3KF6B 5IYDH 3HOZH 5GLDA 4WJ3M 2JBFA 2I5HA 4EUZA 4ZAMA 4IFDI 1W8QA 3ERSX 1VQQA 3G32A 2JA5G 4ZJ1A 5J8XA 5M19A 2XD1A 3MKFA 2CFMA 1RIPA 3RZDH 4JF4A 4DR7L 4LFBL 1MJCA 3CCLA 4OX9Q 3F1ZA 2AWOA 1JTGA 1NXYA 1NY4A 1TEMA 4S2IA 4JI2L 3S1NH 4X53A 5LMNL 2QEXA 1YVCA 4E6XA 4IEDA 2XTIA 4BD1A 5EVLA 1K56D 4R4QA 3J81j 1MXOA 2UXBQ 1G6PA 4DE1A 5M3FH 4FSFA 3NDEA 1SDNA 3FKIG 3KF6A 1QMFA 3M9BA 1YJNA 4JXGA 1ES3A 4DV5Q 4A3FH 4YCWA 3PO2G 1M90C 5DF9A 1N9WA 4EWFA 3CD6A 1XNRQ 1JJGA 2PQAB 1PI4A 4DE3A 2Q2TA 4A3MG 3C4PA 2MO0A 3D4FA 3SS5A 3GVBA 1MJEA 5JYPA 5CHMA 2F3IA 2VGKA 4AQYQ 3CCVA 1YLTA 4BY1H 2ATWA 4A4IA 4A5RA 2OQ0A 3KJPA 4WMCD 1TWGH 1BLHA 1BULA 4YHHQ 3NELA 4XXRA 4LF7Q 5GHYA 2HDRA 5LMNW 4FH4A 4JBFA 2NZOA 2KCTA 3J7A5 1LLBA 4LF5Q 4DR1Q 1G68A 1MWSA 2NN6I 1C9OA 2PQAA 1X3GA 3A3IA 4U3TA 2NVQH 1VQMA 5KZHA 1VQKA 4KZ9A 2VW9A 1EYGA 4CJNA 3VDYA 1JWVA 1E1OA 1HJPA 3HOYH 2XDMA 1KGEA 3G6EA 3HOXG 3HOUG 4DV4Q 2XFTA 2VS1A 3UDGA 5IHVA 4YWMA 1PZPA 5IP9H 1EWZA 1PH5A 2VY3A 4B3SL 1LL9A 1X56A 3DLLA 5D3OA 3VFFA 2E8GA 4HJ7A 4N9LA 2N8NA 4GKKL 1N33L 4DE2A 4LFBQ 1Q7YC 5GL9A 4QD4A 1ZKJA 4S2NC 3CMAA 4FD8A 3K81C 3I4NH 2XH9A 3U58A 3VP2A 1I94Q 4JF5A 1WJJA 5FI6A 1VQ6A 3MZEA