4OONA

Crystal structure of pbp1a in complex with compound 17 ((4z,8s,11e,14s)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2h-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid)
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
746
structure length
502
Chain Sequence
PLKVYSEDGKLISEFGEMTPELNAPYIAEMARAEMVGRYGSEAYTEGYKVITTVRSDLQNAASQSVRDGLIDYDQRHGYRGPETRLPGQTRDAWLKHLGQQRSIGGLEPAIVTQVEKSGIMVMTRDGKEEAVTWDSMKWARPFLSNNSMGPMPRQPADVAQAGDQIRVQRQEDGTLRFVQIPAAQSALISLDPKDGAIRSLVGGFSFEQSNYNRAIQAKRQPGSSFKPFIYSAALDNGFTAASLVNDAPIVFVDEYLTFLGPIPLREALYKSRNMVSIRVLQGLGIERAISYITKFGFQRDELPRNFSLALGTATVTPMEIAGAWSVFANGGYKVNPYVIERIESRDGQVLYQANPPRVPVEPTPAERIIDARTAYIMTSMLQDVIKRGTGRRALALKRTDLAGKTGTTNDSKDGWFSGYNSDYVTSVWVGFDQPETLGRREYGGTVALPIWIRYMGFALKDKPMHTMAEPPGIVSLRIDPVTGRSAAPGTPGAYFEMFKNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Siderophore receptor-mediated uptake of lactivicin analogues in gram-negative bacteria.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transferase/transferase inhibitor
molecule keywords Penicillin-binding protein 1A
total genus 149
structure length 502
sequence length 746
ec nomenclature ec 2.4.1.129: Peptidoglycan glycosyltransferase.
pdb deposition date 2014-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
A PF00912 Transgly Transglycosylase
A PF17092 PCB_OB Penicillin-binding protein OB-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4oonA03
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4oonA02
4LUVA 4WM9A 4L5SA 3GV9A 3GSGA 1N8RC 3S2DH 3ZDJA 3CPWA 1EWIA 2EIFA 2V2FF 4DAYB 4DUZQ 3IXGA 3L2PA 4GN4B 1NMGA 1XMOQ 3MFDA 1YI2A 4E6XA 3H0GG 4KQOA 3G31A 2K14A 3NI9A 5IT9c 1L2SA 1YLJA 1PYBA 4EV4A 3VP4A 5DF9A 1HTZA 3C7VA 1IYQA 4BD1A 3TEHB 2XGTA 4JI6Q 4WJ3M 4JV5Q 1EI5A 1E4DA 5DF7A 4QHCA 2VQFQ 3MZDA 1E1OA 1HNWL 1K25A 3MEFA 3IF5A 3Q82A 4GN5A 1XX2A 4C75A 5C44H 4QY6A 1KVMA 4WYYA 1ES4A 1ES3A 1XMOL 5F82A 4OOMA 1CKMA 4DKAC 1XA7A 4QY7A 1FGUA 4IFDG 1SDNA 3S1MH 5JJIA 2QEXA 1KE4A 2PI2A 2DNSA 1I5FA 3PO2G 2PI2E 5CECA 5CHJA 3TREA 1O7IA 3TOIA 3HLEA 5HARA 3HOYG 4B3SL 3NIAA 3ZVTA 4LUZA 2PQAA 1KXLA 5FQJA 3UN7A 1QVGA 4IVIA 3BFGA 3G32A 5DF8A 3UNWA 4FH2A 3UDIA 3B3XA 3ITAA 2ZM6L 4JBWA 4RA7A 2EQSA 3S17H 5CTMA 4JI4Q 2ZM2A 5FAQA 3GTJH 3TRZA 1UWVA 3VP1A 1FSWA 1ZG6A 2E8GA 4YHHL 4DV0Q 1S3OA 1Y54A 1AE3A 2WKIA 1QUQB 4A3GH 5TGFA 1UE1A 1VQHA 3NBLA 1IZ6A 4N9KA 4LF7L 4WZ5C 1M6KA 2ZC3B 2NZHA 1YQSA 4MTNA 3OZHA 1YZ6A 4L0LA 1L2FA 2OTLA 1Q8KA 3GR2A 2EX2A 3I4NG 4JKTA 1BBWA 2ZC6B 4M3KA 4KZ7A 1M1KC 3VP0A 4JOIC 1K9MC 2PQAB 1RL2A 2IX1A 4X53A 2WAQE 5J3BA 3HUNA 1JMCA 1NRFA 3VDYA 4DNIA 4X64L 1U5KA 4UA7A 3PUXA 3S16H 4XTCS 2HHHQ 3RNUA 1GD7A 1K57C 1RGYA 3BU2A 2Y2GA 3K81C 1FVIA 3GTQH 1S6RA 3HLFA 5C0XG 1WFQA 2JA7G 4APVA 1HR0W 2EFUA 3PO3H 2EX8A 1XXMA 4IBRA 2XD1A 4DV0L 4DDYA 3PGZA 4P6BA 4E3IA 4PM7A 1PWDA 1EIFA 4H02A 1TXYA 1KHIA 1Q2PA 4MBFA 2ZQDA 1N9WA 3PBNA 3H3VH 4Y0UA 1I2SA 2VZAA 4NXMQ 1K83H 1XKZA 4KG2A 2ZD8A 1PWCA 4OLGA 3IF6A 4Y0OA 3M6BA 5EOOA 1GHIA 3L0OA 4A3BG 1SROA 4YY3L 1TVFA 1IBLQ 3BLSA 4DV1Q 4JPMA 3T1YQ 1XMQL 4X55A 4YCUA 4KG6A 3QNBA 1K54A 2Z0SA 1YLTA 1IYJB 3ZNTA 1YITA 4AIMA 1B8AA 4U3TA 1SHVA 3DWKA 3VSKA 4A3EH 4NXML 4GS3A 2RF4A 3U4ZA 2VQFL 2JA8G 4R4OA 4DV5Q 3AYHB 1IBMQ 3AEVA 2NN6I 3CC4A 1A63A 1J6QA 2MFIA 5G18A 3H3VI 3LGJA 2JA5G 2B29A 3PSIA 1NE3A 3ULPA 4OONA 4DV3L 1MJCA 4DPGA 2UXBL 5JJKA 4A3EG 4DR4L 4R4IA 4DV2Q 5KMWA 5GLDA 1XNRQ 1I6HH 3D0FA 5FQKA 3K8AA 5IP9H 1N36L 4P85A 1LL5A 3IXHA 2L15A 4DR2L 1PYYA 1IXRA 1HVBA 1ASZA 4R0QA 1VM1A 4AYBE 4OQIA 3E9HA 1X9NA 5AQ7A 3S1NH 3MZFA 2LSSA 4QGUA 4UP7A 3I2ZA 1HNXQ 4GKJL 3CW2C 3HLDA 2UXBQ 1A8VA 4Z9QA 4JI6L 1PWGA 1ONGA 2G2UA 4FDBA 2QA4A 1IBML 5M3MH 1HR0Q 1XTDA 2FXQA 2EXAA 2A3UA 4OWXB 3PCOB 1VQ7A 1BSGA 4S2NC 5HX9A 2R93G 2G2WA 3G34A 3PO3G 2A49A 1U60A 5M5WH 3IWIA 2JA6G 3G71A 4U0TA 4DE1A 5HAQA 1I5QA 2EX6A 4OPRA 2R6GA 1R9TH 4BENA 3HOZG 4KQQA 5FA7A 4JXGA 3VFFA 3VFHA 4DE2A 1Q86C 3PUZA 2K75A 3BFCA 1HR0L 3A3EA 4A3LH 2XD5A 1Q81C 1QMFA 3F8TA 2KHIA 2RCNA 3EQVA 3FKWA 2KBNA 3PBRA 1K0RA 4NXNL 1KL9A 3Q8DA 1PH4A 1AXBA 5EVLA 1VQQA 1CK3A 3I4NH 4KZBA 2IWBA 2NZOA 1AH9A 2X02A 4BA2I 2JK8A 1X3EA 1JB7A 5FLXc 1IBKL 2ZC5B 2R7ZH 1DJBA 2WB1G 3CPFA 2WGVA 4B88A 3W4PA 4R4RA 4BY7G 4S2OA 4A93G 4IO9A 5M5XH 4A3GG 3WWXA 5CGWA 4BD0A 4C6YA 4X62L 1VQ4A 2D0OA 4HESA 4C3HH 2N78A 3G4SA 2KENA 3MXRA 2QGQA 2XLNA 3KDFA 2XDMA 5F1FA 2BLSA 1XA1A 3IXDA 3J7ZC 3CXCA 1Q7YC 4LF6Q 4A3FH 2P9VA 3LO7A 1G6AA 3W5OA 1GVPA 5FJ8H 1MIUA 1HZAA 2R92G 4B3TQ 1CKOA 3AGDA 3HOYH 3RLNA 1V43A 4DR3L 4DV1L 4DV4L 3SH9A 4IBXA 2C35B 4P72A 2I0QA 2HHHL 2ZQAA 2VQEL 3VSLA 5GADC 3RZOH 1I94Q 4ZTKA 4RYEA 1Z6FA 4MBKA 1CKNB 4GOGA 1AE2A 1ES2A 4OWWB 1XPRA 4DUZL 2K4KA 3HOXG 4GOPB 4N1HA 2C5WB 1HNWQ 1UEBA 1DJCA 2WFWA 4XXRA 5IY0A 4MBHA 4C2MH 4Y7NH 2GVAA 4DR5Q 2Y2KA 3GO5A 1XNQQ 3C4OA 3AFQA 1Q1BA 4JF4A 1K56D 4LF9L 4JYAL 1EWZA 1SCWA 1MJEA 4BQMA 5FI6A 2Q9MA 5A91A 1K6RA 2JE6I 3WS4A 3JC66 1DY6A 1L1OC 3O86A 4DR3Q 4GNUA 4KZ8A 2ZQCA 3N4IA 5CXWA 5IYBG 5K36G 4A75A 1LYLA 3OPPA 3HOZH 3GDEA 2N3SA 2VNUD 2PBYA 4DR6L 4HIDA 1K8GA 2QMIA 4X65L 1V9PA 4LFBL 1KC8C 1EOVA 2JE5A 4GD6A 3KFUA 3RLFA 3RZDH 3Q07A 4DV4Q 1NTGA 3IT9A 4O0AA 1VQIA 4LENA 5E2HA 1JTDA 2CFMA 3CP0A 3HOVH 1VQEA 3GQZA 5KZHA 2D62A 3BJUA 1XNQL 4JXSA 5FQIA 2NVXH 2HP9A 2YU9H 5ELNA 1K8AC 4DR7Q 2Y2HA 2Q2UA 1PH8A 1HNZQ 3ZGAB 1IKIA 5DTSA 1X54A 1HH2P 1Y1WH 1NXYA 2AWOA 3CD6A 2H5XA 4C3QA 4QY5A 1NBWA 3CCEA 3ITBA 5M5YH 1G68A 5GL9A 3SOIA 1CSPA 1SRUA 1RGZA 3HLWA 2Q2TA 5JYPA 3ER0A 1C9OA 1A62A 4B3RL 1NY0A 1PVOA 3FP9A 1YM1A 4UPAA 3I4MG 4JI3Q 4A76A 1UE7A 3QNCA 2Z6KA 1CI9A 2DRWA 3F2CA 3HREA 3E2LA 1YIJA 4KENB 3C5AA 1GHMA 4R4CA 3PUYA 1L0GA 3FZCA 1I50H 1C3BA 3HKSA 1BLCA 1LTLA 4B4ZA 5IWAQ 1LLBA 4LFAQ 2OTJA 3OPLA 2K5VA 1K4EA 3ZG5A 5EUAA 3TG9A 4KHZA 4WZ5A 1EIYB 3FKIG 3RJUA 2QZ6A 3KF6B 5KSCA 2E2IH 1W8QA 3J80c 1XP4A 2V20A 2R93H 3N8LA 4OKPA 3A5ZB 2K5HA 3SH8A 5AJ3L 4BY1H 3EN2A 4DV7L 1CSQA 1YHBA 2VUMG 5HL1A 4LNQA 2VW9A 5EPHA 1PFSA 4GDNA 1G6PA 3D4FA 1VQCA 1KGGA 3G6EA 4B3RQ 3TQYA 2I5MX 1YHAA 3FHWA 1E25A 4S2MA 4BL2A 4B3MQ 4A3KH 3W4QA 3CAMA 5JJLA 2UU9Q 5FQMA 4DK6C 2OCEA 4H8RA 2VL6A 3N8RA 3V39A 3CMZA 4YY3Q 2OV5A 4JI0Q 4JI7Q 1VQKA 3AGFA 1KRSA 1PW8A 1Q12A 1BLSA 3STBC 5CGSA 3ZJYC 4A3DH 1J5EQ 1TWAH 4DE0A 1VQLA 3M85A 3PIPA 1KGEA 1YLYA 2Y2NA 1SLJA 1NJ4A 5GLCA 4HIMA 3N8SA 4AYBG 3HBRA 1Y1VG 4DR2Q 1K3RA 4DE3A 1FCOA 2ZTEA 5HAPA 3M9BA 3W1GA 5BR8L 1ES5A 4J15A 3U50C 2WUQA 3M4PA 2HDQA 3IXBA 4DV2L 4DR4Q 2V1CC 1K73C 1HNXL 4OP5A 4X56A 2BA0A 1TWHH 1GA0A 5A90A 3HOWG 3BFDA 4OQHA 4PG3A 2XFSA 4K0KL 2XK1A 1T9HA 4A3BH 3HUOA 4JG2A 5IYDG 1CEGA 4E3KA 2GN5A 4DXCA 2ZQ8A 2JA9A 3W4OA 2AMCB 4KQRA 5LMNL 1H95A 2N8NA 1IELA 1PV4A 5FI2A 3KYHC 4FH4A 2NVYH 2WAEA 1YBYA 3N7WA 2ZJRA 2IHFA 4YCWA 1PH2A 3RN2A 4JBJA 1W79A 3M7NA 4OPQA 1O7EA 1SMXA 4JF5A 2R92H 4BY7H 4GKJQ 4ID4A 4BLMA 3RN5A 2WGWA 2E5LQ 3IQAA 2JCHA 2VGKA 4C3IH 2ALYB 1JWZA 1WE4A 4MNRA 1YNXA 4JI4L 2Y91A 2HQLA 4IPGA 4EBNA 3N6IA 1B7YB 2ID0A 4JI1Q 1ASYA 5CHUA 3HOUG 4S2PA 1E1TA 4GNXA 2VS1A 4K0KQ 3ZG7B 4AQYL 4DUYQ 4LF7Q 1JVJA 1LUZA 3UE3A 1N33L 1JE5A 1HJPA 3GTKH 4S2NA 1MY8A 2CWPA 1L0WA 2WKHA 4IOCA 4TVAB 2UXDQ 2ZC7A 3M4QA 1K4FA 2RHQB 4WEKA 1Z9FA 3A3DA 3S4XA 4FCFA 2JEAI 3HL9A 1Q1EA 4K0XA 1WI5A 2JC7A 4DAMA 4X66Q 1VQNA 5A93A 3IH9A 1WCMH 3HKZE 2H5SA 5AJ3Q 5DTKA 4EQIA 1CKNA 3MKEA 3TS0A 4EUZA 1YJ9A 3J80i 3T1HQ 3CCSA 1IEMA 4A5RA 1ERMA 1Y1WG 1E7ZA 1IBKQ 1FQGA 2CC1A 3ULJA 1VQ6A 3A3JA 2HIVA 2H0TA 1K38A 2FFFB 3FKVA 3PBQA 2XGNA 4IPDA 1PH7A 4R4TA 4B3TL 4UP9A 5M3FH 3IWOA 1V1QA 5GROA 1N34L 1KE0A 5GAEC 3PO2H 1X6OA 5E43A 1BKBA 1JJCB 3A74A 2VQEQ 5H1SE 4KI0A 2FFYA 4DDSA 3FWLA 1VS0A 2AKWB 1W2BA 4U0XA 5CEDA 2JBFA 3OTOL 4AQYQ 1M90C 4LV3A 1FR6A 2Z6KC 3AGEA 1WCMG 2LXJA 3OC2A 2K50A 4UAAA 4LFAL 1N32Q 4KLKA 4FSFA 1QUQA 2RCXA 3HOWH 1I94L 1K55C 2PU4A 2UXDL 1XPOA 4EBPA 5F83A 3BM6A 2K5NA 4GKKQ 1XJVA 5IP9G 4PZ6A 1S40A 4KG5A 2IX0A 3OW2A 5C3EH 4LF9Q 3CCJA 2XFTA 3ZHHA 3UDGA 2ASBA 4PMWA 3I7FA 4P73A 2GVBA 5KSHA 4YHHQ 4WZ4A 5IP7H 1KGFA 3AFPA 5C3EG 4LUOA 3S1RH 3V50A 3OPRA 4YWLA 2UU9L 2ZJ9A 4JCVE 1WYBA 1OXVA 5C0XI 3HFZB 5J8XA 4KHPL 2BH2A 3SS5A 1QVCA 3HOUH 5IYCH 1MBLA 2HP5A 4POFA 3S24A 3PF5A 2XH9A 4NXNQ 3HOXH 2UUBQ 1YLWA 5FATA 1C0AA 4XIGS 4JBKA 3NEMA 3EBEA 3G2ZA 1N36Q 4MLLA 4IPHA 3GTOH 3S1YA 2ZQ9A 3CCRA 1PH9A 2WZXA 4X64Q 3ZFZA 3CCMA 1ESUA 1KVLA 4O7DA 2WKEA 4JC0A 3SH7A 1PA6A 1X56A 4X62Q 5HW3A 5M3FG 3OCNA 5FQ9A 2UUAQ 2Y2LA 1L1OA 1G291 5BR8Q 4GN3B 1PH1A 3G35A 4K91A 4WEJA 1MWSA 1O07A 2OQKA 2OWOA 5GHXA 3M3YH 2I72A 4Q8IA 1OXSC 1LI0A 1FCMA 4IJLA 1U0LA 4P87A 2Q2IA 1VQFA 5IYCG 1MPLA 3AQQA 3IF6B 5FAPA 4QIWE 3KF6A 3GMWA 3L7ZC 4GKUA 4OP8A 4ZAMA 2F52A 1GO3E 2Q2HA 1EYGA 1ZG4A 2Y2MA 4A3MG 4X69A 1CI8A 5GAHC 2YTYA 1VQAA 2ZJQA 1C7YA 2CCZA 4DR7L 5EVID 3A3FA 1PI4A 4R1JA 2WYXA 3VOYA 3M4OH 1NY4A 2Z2LB 4NK3A 4P75A 5DVAA 4JI2Q 1SE8A 2ZC4B 2QPNA 4EQ5A 4HJ5A 3G2YA 3SGIA 4LF4Q 2UWXA 3NDEA 5TR7A 4DR5L 3BFEA 4XUZA 3UPNA 1SR3A 3BZCA 2R7DA 4UHUA 2A19A 1L0EA 5JEAG 4Y52H 4DV3Q 4HBUA 1PI5A 4QU3A 2V1ZA 2X01A 4Y0TA 3GTCA 3P09A 4UA9A 3I56A 3W8KA 5FAOA 4YINA 4RVAA 4E3LA 3S22A 4JI1L 4GLXA 1UE6A 3JAMc 4P0MA 1Q2QA 1LM0A 4MZ9A 4LFCQ 4DV7Q 3CJMA 4HEFA 1BUEA 1RCJA 1KDSA 4QJFA 1B70B 5E2EA 2R9WA 5EVIC 4OXPA 3ULLA 2DCFA 1EQQA 4A3FG 4GZBA 4AH6A 4A3KG 3Q1FA 4MNOA 1W3SA 3CC7A 1NZOA 1P16A 2UUCL 3CF5A 4B3ML 3S15H 1VQBA 3HUMA 1GM5A 3HOVG 4HJ9A 3BFFA 1Y14B 4NPSA 2Y2PA 2ZJPA 4WJ4A 4X68A 1I2WA 3UO9A 3ZNYA 5DLQE 3K80C 3J81i 1CUKA 1PH3A 2Y2JA 4IPCA 3O88A 5HGQA 5IYDH 2R7ZG 4A3JH 2CKZB 5IHVA 5GQOA 5GHZA 3FYZA 2WAFA 3FKIH 4B4XA 2CWAA 4OO1G 2RL3A 2KCTA 2B63H 4LFBQ 2R9XA 2JQOA 4IFDJ 2Y4AA 4OPYA 2DGYA 4ZJ3A 1NZUA 1FJGL 1XPUA 1X55A 4JI7L 2I5HA 3MXNB 2I5LX 4A3CH 4LF8Q 4IEDA 3PIOA 1VQDA 1J5EL 3H0GH 3TSGA 3SS4A 5D3OA 4QL5A 4KZ9A 2ZM8A 4DV6Q 4A3IG 3NDGA 4GLAC 1ALQA 3J81c 1VQMA 3DWZA 1VQ5A 3K7UC 4A3MH 2WGWB 4GB7A 3S14H 2Q9NA 3WWVA 3WRZA 3UDFA 4D2OA 1VQOA 1HD8A 3S2HH 3V3SA 1ZKJA 2UXCL 2HPBA 3RXWA 4OPZA 1KD1C 1WYCA 1IYPA 3CMEA 2YTVA 3B6YA 4YFMA 1TWCH 2Y2IA 4S2KA 4JV5L 1TWFH 3PUWA 3KDFB 4BBSG 3K7AH 3CZDA 5GLAA 2OLUA 2WZZA 1L1OB 1IBLL 1YMSA 2H0YA 3JYIA 4BL3A 2PMZE 4OO1I 4NB3A 4OX9Q 4F94A 5LMNQ 1FSYA 3RLOA 2XEPA 4JI5L 1XPBA 4HIKA 1NYYA 1FR1A 1NJIC 5E7NA 3SS3A 4X6AH 1YEZA 4JLFA 4DV5L 4PMAA 4KZ4A 3HLCA 3O87A 1FOFA 3LEZA 2IWCA 1K55A 5U47A 4DRTA 1GHPA 4UP8A 4POGA 3JAMi 3W1BA 3Q7ZA 2XQZA 3LY4A 1YT4A 3BYDA 3GRJA 5HAIA 1TEMA 2EXDA 1E3UD 1H8ZA 4NETA 1MWRA 4KHPQ 1W5DA 1EUJA 4A93H 3F1ZA 4GOPA 4A3CG 4DUYL 2Y0SE 3T1HL 4P74A 3LCEA 1RIPA 3HLGA 3VOZA 1E22A 2D0PA 4KZ3A 2B63G 3KOJA 1KE3A 2N49A 1S72A 1BBUA 1X3GA 4R23A 5CHMA 3KF8B 5BOHA 1PH5A 3ZVWA 4IOAA 3MXSA 5EAYA 3H15A 1VQPA 1S0WA 4CPKA 3Q7VB 3CG5A 4A3JG 1EFWA 3CMAA 1JT8A 4N9LA 5IWAL 5JYOA 4GNXC 3BEBA 2LXKA 3IHAA 4JXVA 5LMUQ 1IYOA 2J8YA 1EQRA 1SFOH 3BLMA 5AQAA 4XUXA 1JWVA 2PNHA 4X66L 1NYMA 1PIOA 3PUVA 3DLLA 4L5QA 3WS2A 4HBTA 4QQBX 4BXXG 2Y2OA 3PTEA 4JBMA 2Y2QA 5GLBA 1RP5A 2OQ0A 3OTOQ 5CTNA 2Y0SG 3S1QH 4ME3A 5HFOA 5FLMG 4IVKA 1KRTA 2A1AA 3O3VA 2J9PA 2J7VA 1YVCA 2JA7H 4JBFA 3CCVA 2KCMA 1PHJA 3OCLA 1PZPA 3J81j 4EX5A 1UE5A 1D7QA 5CRFA 1A0IA 4X65Q 3C7UA 1KAWA 2JEBI 3A0JA 2YTXA 2WGIA 1YJNA 1PW1A 3VP3A 3BECA 4WBGA 4LF4L 3TS2A 1BTLA 4ZBEA 4S2IA 2E8IA 4KZAA 1GA9A 4LW1A 1MWTA 5CERA 2MQHA 5IP7G 1H8YA 4GD8A 4HJ8A 4DK3C 4FD8A 1P8LA 3MBZA 4R3JA 5CEBA 1VQJA 4HJAA 4GKKL 1ESIA 1JJGA 4OWTB 4DKIA 1HNZL 3BZKA 3IHBA 2HT1A 3M2KA 1LI9A 4R3BA 3A3IA 4IJHA 3CC2A 1Q46A 5TFQA 2R7FA 1N32L 4A3LG 2B3GA 1QZHA 1IYSA 1PH6A 1CEFA 4E3NA 4P71A 3WS5A 4EWFA 1WOCA 5FSRA 3VMAA 1MXOA 1KDWA 3GTGH 3NC8A 1OXUA 2ATWA 3J7A5 5EVIA 3ICEA 4DR1L 4UY8C 5C4JH 1QMEA 2E2HH 2VY3A 4E3MA 3ZG0A 2P74A 2ZMAA 4B3SQ 5GAGC 4BBRH 5HY6A 1GKHA 4BBRG 1K6SA 1N33Q 1FCNA 1SKFA 5I94A 1BZAA 5AQBA 4WMCD 1VQ9A 4RMFA 2ZM6Q 2AWNA 4WELA 1YJWA 3BRMA 2EX9A 3HLBA 3DTMA 4BA1I 2IT1A 4BBSH 3V5MA 4JYAQ 4OVDA 3GTLH 3GD7A 2C6WB 1E24A 4E3JA 1N4OA 4OLDA 3PAEA 3A5UA 5IYBH 5EE8A 3PF4A 2BG1A 5L2FA 2CQOA 4JI2L 1WYDA 3G30A 4PM8A 1OXXK 2A8VA 2NVQH 5C4XG 3K0XA 2Z2MB 2MNAA 3PV0A 3IWQA 1TWGH 3PBSA 2E5LL 3NY4A 2UXCQ 3UE1A 2XR0A 2BH8A 5FQQA 3GVBA 1JTGA 1W7FA 4LCLA 2EXBA 2J9OA 3KJPA 2JA5H 2OLVA 4LFCL 1VQGA 1ONHA 4WMCA 5FI7A 4OX9L 3PAGA 4RG1A 4DR1Q 5CGXA 2XTIA 3IRBA 1LHYA 1D8LA 5ELOA 3I55A 2H10A 2IWDA 3NELA 5EVIB 3UPPA 2ZLYA 4A3DG 2HDRA 2KHJA 4BJPA 4R4QA 3WS0A 4GDBA 1I3QH 4C3JH 1K54C 2WAQG 4TQUS 4R1GA 3V3RA 4UA6A 1HZ9A 2MO0A 1KIXA 2HP6A 3STBD 1NMFA 3UDXA 2B5RA 1QZGA 4PPRA 4JI3L 3LY3A 4PZ7A 3NENA 4JI8Q 3ZCZA 4MEZA 3M2JA 2X71A 4RX3A 5M19A 1HZCA 2NN6G 4HIOA 1XGJA 3CCQA 3WS1A 1HZBA 4LV2A 1Q82C 3C4PA 3Q81A 4R4SA 4LF8L 4DXBA 4N1XA 2UUAL 4QJGA 1L0DA 5EOEA 2P9VB 4LF5Q 5LMUL 3D31A 4GOPC 3I7JA 2IHEA 3U58A 3GTPH 3Q7VA 2ZTCA 5A92A 3ISGA 4LCMA 2Y59A 1XNRL 4ALPA 3UE0A 3P98A 4QD4A 1KQSA 4OOYA 4L5TA 2WP8J 5IE8A 3NBHB 3CQZH 1QVFA 2HDSA 4GNXB 1PZOA 4LV1A 1SDEA 2WK0A 2MO1A 5FDHA 4JOIA 4YWKA 3MKFA 1GCEA 2E2JH 5DTTA 3F2DA 1OXTA 1FL0A 1ERQA 4DV6L 3ERSX 1LL9A 3EQUA 3ZG8B 2JA8H 1YHQA 2Y55A 2PU2A 1MWUA 3NCKA 3OPHA 1IKGA 1K57A 3I4OA 2JA6H 1XGIA 1BVSA 3DW0A 4HJ7A 4Y7PA 3IH8A 3UY6A 1EROA 4JI0L 3CCUA 5EECA 5M1AA 2EFXA 5M18A 3G48A 4RX2A 1YMXA 4OH0A 2VGJA 3PBOA 2UUBL 3HVFA 2HDUA 4DF6A 5M3MG 4YCVA 4QB8A 4E3OA 1YLPA 4PM5A 1BLHA 4PM9A 1N9BA 2OSUA 1W8YA 3EIVA 5AQ9A 1G51A 3E0EA 4A4IA 5FLMH 2F4VQ 4KZ6A 3F2BA 3FV7A 2JJQA 3E9IA 4OQGA 3MZEA 1JJ2A 1H5XA 1J9MA 3DM3A 4JI5Q 1WJJA 1JWPA 2YV5A 3ZG9B 2ZM0A 3IF6C 1N34Q 1YLZA 1X65A 4A3IH 3GTMH 4ZDXA 4EBLA 4GLVB 3OYYA 2UUCQ 2HIXA 1TDGA 4X6TA 2WB1E 2AHOB 1X3FA 2WADA 4ZJ1A 2IY5B 1E3UA 1E3PA 1DJAA 5C44G 2F4VL 3M6HA 1Z47A 3RXXA 5E2GA 1OMEA 1PYSB 2ZTDA 1Y1VH 1BT5A 1SN8A 1ZC2A 5LMNW 4OQ0A 1M40A 2ES2A 2RHSB 2BA1A 5F1GA 3I4MH 2K52A 1L0FA 3WRTA 1IL2A 3PBTA 1VQ8A 3VP2A 4DR6Q 2F3IA 3U4VA 2ZQ7A 1MKHA 4N92A 1BLPA 4LF6L 5E2FA 4JXWA 4OOLA 2XF3A 2DUDA 1BULA 1TDLA 3T1YL 1XMQQ 3KJOA 2GDNA 5C4XH 4LV0A 4LWCA 4E6WA 4YWMA 4KZ5A 4IFDI 4S2LA 3HKZG 3RR5A 3QHYA 1FJGQ 2NVTH 4O2DA 4JI8L 1OTCA 3KLWA 4CJNA 4K0WA 1HZOA 2YYZA 4ZJ2A 3E2KA 5C0XJ 4S2JA 4GN2A 3G4PA 3UPOA 3CCLA 2VUMH 1VCIA 5FJ8G 4BY1G 1DGSA 4PM6A 1K56A 1MKIA 5JEAJ 4BXXH 4L5RC 5GHYA 4JF6A 4PZ8A 5FASA 4LF5L
chains in the Genus database with same CATH superfamily
1CT1D 4LUVA 1KABA 3HGBA 4WM9A 4L5SA 3DHQA 3GV9A 1N9NA 3GSGA 1BXTA 2K6AA 1N8RC 5K36H 3QO2A 2J80A 1FYCA 3S2DH 3ZDJA 3CPWA 1EWIA 2EIFA 2V2FF 4DAYB 4DUZQ 3BQAA 3MXQA 4IHQA 1STHA 1S1YA 3IXGA 3TW8A 3L2PA 4GN4B 2B02A 1NMGA 1XMOQ 3MFDA 1YI2A 3BVZA 3H0GG 1ZKOA 4E6XA 4KQOA 3G31A 2K14A 1UUPA 1H0MA 1I50B 3NI9A 5IT9c 1L2SA 2MUYA 1YLJA 3IBJA 3CLOA 1PYBA 4EV4A 4CLCA 2JKFA 1KOUA 1S1ZA 3HEJA 3VP4A 1IW7C 5DF9A 3LX0A 1HTZA 4L9EA 3C7VA 2AUKA 1IYQA 3A0SA 3CWFA 4BD1A 1PRQA 3TEHB 2XGTA 4JI6Q 4WJ3M 1LSXA 2XA7S 4JV5Q 2E76C 1EI5A 1E4DA 4OIKA 1S4RA 3CPTA 5DF7A 4AYBB 4QHCA 2PW7A 3KK7A 2VQFQ 5EM0A 1H9RA 3D4WA 3MZDA 1JNUA 1E1OA 3RFBA 2HGVA 1L0XB 1HNWL 1K25A 3MEFA 3IF5A 3Q82A 3QOLA 4GN5A 4S3SA 1XX2A 3DWAA 1OT6A 4C75A 5J4EA 5C44H 4X25A 4QY6A 1EL0A 3TN2A 3WDNA 1KVMA 4WYYA 1ES4A 1ES3A 1XMOL 5F82A 4OOMA 3VE3A 1CKMA 1O78A 2VEAA 4DKAC 1XA7A 3U9OA 4QY7A 1FGUA 4IFDG 1EYDA 1Z6HA 1SDNA 4Y7NB 2JA8B 1X3PA 4DNRB 4IUQA 2VKSA 3MF0A 1TF1A 3ITPA 2EYLA 5D3IB 2SNMA 4V190 3S1MH 1TS6A 3T1RA 5JJIA 2QEXA 1KE4A 2PI2A 4H0LC 2DNSA 3C2PA 1I5FA 3PO2G 2PI2E 5CECA 5CHJA 3BDCA 1MC0A 3TREA 1O7IA 2I9VA 1WTOA 5G4YA 3TOIA 5D3DA 3HLEA 5CV5A 5HARA 2B2YA 2F0UA 3HOYG 4B3SL 3NIAA 4A3MB 3ZVTA 4LUZA 2PQAA 3V5MA 1KXLA 5FQJA 1EY7A 3RTYA 3MQOA 5IOCA 4I3AA 4CDFC 2VA0A 3UN7A 2LS01 2KEEA 1QVGA 2AUJD 4IVIA 3BFGA 3G32A 4G3VA 5DF8A 3UNWA 4FH2A 3UDIA 4HCSA 3ND9A 3B3XA 1BOSA 3ITAA 1SEBD 2ZM6L 4JBWA 2J3WA 4RA7A 1STAA 1O80A 3LNNA 2EQSA 1MKMA 3S17H 1R4QB 4BBUA 1GSXA 2VV7A 5CTMA 4GW9A 4JI4Q 2ZM2A 5FAQA 3T4LA 4O42A 4ZCKA 3GTJH 3TRZA 1UWVA 3VP1A 1H8MA 1S4ZA 4H7BA 1JCKB 1M8AA 1KLUD 1NWZA 1FSWA 2F0MA 1ZG6A 3BY8A 3UB5P 2E8GA 4YHHL 4DV0Q 3M4OB 4WL9A 4P2CB 2F0FA 1S3OA 4FF4A 2JA5B 1Y54A 4NXGA 4OHJA 1AE3A 2WKIA 2QILA 5HZHA 1QUQB 1T1BA 2B2TC 4A3GH 5TGFA 1UE1A 5A35A 1VQHA 3HCYA 4WUJA 2VJWA 3MQQA 3JPUA 1VEUB 3NBLA 1IZ6A 4N9KA 5I6YA 2MGSA 1N9OA 4LF7L 4WZ5C 1M6KA 2ZC3B 2NZHA 5ISRA 3T4JA 1YQSA 2TMPA 2PR5A 4MTNA 3OZHA 1YZ6A 4L0LA 1L2FA 2OTLA 1Q8KA 1TS8A 1DOLA 2F1MA 3EWKA 3EVQA 4ZKBB 4KTAA 2EX2A 3GR2A 2F0NA 4KD4A 3I4NG 2F0IA 4JKTA 1BBWA 2ZC6B 4M3KA 1SKOB 4KZ7A 1M1KC 3VP0A 4JOIC 1K9MC 3I91A 2PQAB 1RL2A 2JYOA 4N9TA 2IX1A 4X53A 5HL6A 3UMEA 3NP8A 2WAQE 5EGTA 1F2LA 4ZAIA 5J3BA 3HUNA 1JMCA 1NRFA 3VDYA 4DNIA 4E04A 4X64L 5BN3A 1U5KA 2BOSA 5EPKA 3PUXA 3S16H 4UA7A 4XTCS 2HHHQ 2RDHA 1GD7A 3RNUA 1K57C 1RGYA 4OL7A 2EZVA 3OIPA 3BU2A 2Y2GA 1Y8NB 3K81C 1FVIA 3GTQH 1S6RA 4OEMB 3HLFA 1Y8OB 5C0XG 1WFQA 2K32A 2JA7G 3TP5A 3A7AB 1UEAB 3LI8A 4APVA 1YNJD 3TSSA 1GSVA 4KV6A 3T1XA 1HR0W 3GTMB 1II3A 2EFUA 3LR3A 3PO3H 2EX8A 4H13C 4H6JA 1XXMA 4IBRA 2XD1A 2PO4A 5C5LA 4DV0L 5FEGA 1QE6A 4MCWA 2SOBA 4DDYA 4HR7B 2QJ7A 3PGZA 1AWIA 4P6BA 3OPOA 4PV1C 2AQ1B 3OBFA 4E3IA 4PM7A 1PWDA 2IWHA 1EIFA 4H02A 2L5TA 2EJMA 4IUTA 1PNEA 3UB6A 1C4QA 1TXYA 2ZL1B 2KQ3A 2W1TA 1KHIA 1Q2PA 4MBFA 2ZQDA 1N9WA 4PQXA 3H3VH 3PBNA 1EOTA 4Y0UA 1I2SA 3R2IA 2V0UA 1EW0A 1XJ4A 2INWA 3DAVA 2VZAA 5KIZA 4NXMQ 4G7ZC 4Z9CB 5F69A 4PMBA 2W3GA 1K83H 4CKCA 1XKZA 4R70A 3B42A 3NBHA 3IS2A 2ZD8A 4KG2A 1PRTD 3TDQA 1NR4A 3GTQB 4YNRA 1PWCA 1SYBA 3FKIB 4OLGA 3IF6A 4Y0OA 1OTAA 1F2KA 3M6BA 5CC4A 5EOOA 3CQZB 1GHIA 2JSOA 2F0LA 3L0OA 4KQDA 4A3BG 1SROA 4YY3L 2NUCA 1TVFA 3KSGA 3T4KA 1BUVT 2EYMA 1A0KA 1IBLQ 3BLSA 4DV1Q 4JPMA 1F98A 3T1YQ 1XMQL 3MZ5A 3BDLA 4X55A 4YCUA 5KYIA 4BY1B 4KG6A 2K1BA 3QNBA 1K54A 1WTHA 2Z0SA 1YLTA 1IYJB 3KBGA 1U4PA 3ZNTA 1YITA 4AIMA 1B8AA 4U3TA 1PFLA 1BCPF 1SHVA 3DWKA 1LTRD 2NTTA 3VSKA 3E5SA 4ME4A 4A3EH 1H3QA 4JW0A 4NXML 3I3CA 3H94A 1PZKD 4GS3A 2RF4A 3U4ZA 2VQFL 2JA8G 1B2TA 4R4OA 3NQIA 4DV5Q 2EXZA 4D60A 4DJ2A 3AYHB 1IBMQ 3AEVA 3R4KA 4P6ZM 2NN6I 3CC4A 2PYPA 3T1SA 1TS7A 1A63A 5HPIA 1J6QA 2MFIA 5G18A 2B2VC 3H3VI 3LGJA 5JEAH 2JA5G 2ZL1A 2B29A 3PSIA 1IYVA 2KX6A 5DNFA 2VGLM 5L10A 2KECA 3H7WA 2K03A 1NE3A 1T5EA 4LPZA 3ULPA 1CQAA 4OONA 3PYPA 1A3UA 3V2TA 3TBIB 4DV3L 3AMUA 1MJCA 2RBMA 4WORA 1D6EC 5CGKA 4DPGA 3BS1A 2UXBL 5JJKA 1OJ5A 4A3EG 4DR4L 4R4IA 2KA7A 2OF1A 4DV2Q 5FOBB 2W3EA 5KMWA 1YSQA 1T19A 1B1ZA 5GLDA 2B95A 5IT5A 1XNRQ 1I6HH 3D0FA 5FQKA 3K8AA 5IP9H 1N36L 4P85A 1LL5A 3IXHA 4IUPA 2L15A 1LT0A 5D65A 3EEAA 4DR2L 1PYYA 2RKSA 1AZQA 2XRNA 1IXRA 1MSHA 3QIAA 1HVBA 3K7AB 2EE1A 1ASZA 4R0QA 1VM1A 5BN5A 5E3FA 4AYBE 2EY5A 4HMIA 4ZUJA 3FPVA 4OQIA 1FIKA 4RQ9A 5M5WB 2F03A 3E9HA 1X9NA 5AQ7A 1ZYRC 1NUCA 3S1NH 3MZFA 2KHSA 5M3FB 5DFXA 2LSSA 2PNRC 5DM63 1QG7A 4QGUA 4HNBA 4UP7A 3I2ZA 1HNXQ 3HOUB 4GKJL 3CW2C 3HLDA 1STEA 2UXBQ 1GHKA 1HFGA 1A8VA 4Z9QA 2B2UA 1JICA 1O7YA 4JI6L 1PWGA 4PKYG 1ONGA 2G2UA 2K33A 5AFWA 4XT2A 4FDBA 5KNDA 1SDFA 4U673 2QA4A 1IBML 5M3MH 1HR0Q 1XTDA 3T4AC 2FXQA 2QKPA 1JWMD 3QP4A 4F7XA 4B9XA 2A3UA 2EXAA 4OWXB 3PCOB 1VQ7A 1BSGA 2F0WA 4S2NC 5HX9A 2R93G 1A2UA 2G2WA 3G34A 2DNCA 3PO3G 2A49A 3CRKC 1U60A 3LR5A 1EY6A 5M5WH 3IWIA 1S5BD 2JA6G 3G71A 3A7LA 4U0TA 4F87A 4DE1A 2JKRM 5HAQA 5JPMC 4DU9A 2L0WA 4ARZA 2C9OA 1I5QA 2EX6A 1B9NA 5C3EB 1EY9A 2MP1A 4OPRA 1QJOA 2EY1A 2R6GA 1R9TH 4BENA 2NVYB 3HOZG 4KQQA 5FA7A 2YKFA 4JXGA 3GTLB 3VFFA 2B8GA 4R8NA 1WTRA 1Q86C 2D01A 3VFHA 4DE2A 2KOIA 3PUZA 2K75A 4TRDA 3BFCA 1SXTA 1HR0L 3A3EA 4A3LH 2XD5A 2K04A 3EQLC 1Q81C 1TIID 3F8TA 1QMFA 2KHIA 2RCNA 3J7AV 3K0YA 2J3TD 3EQVA 4K08A 1SFOB 3FKWA 3K5MA 2JKRI 1K83B 1HUMA 2KBNA 3PBRA 2IJ0A 1K0RA 1WVLA 4NXNL 1LTAD 2F0KA 1KL9A 2PDRA 3Q8DA 4HJ3A 1PH4A 1AXBA 2G5DA 5EVLA 4I65A 5IIFA 1CK3A 1VQQA 3I4NH 1EYCA 1G2SA 4KZBA 2IWBA 2NZOA 1AH9A 1EU3A 1VHMA 4BA2I 2X02A 3FC7A 4KN7C 2JK8A 1X3EA 1JB7A 5FLXc 3G7LA 1IBKL 2ZC5B 3A0RA 3LGOA 5NUCA 2R7ZH 1DJBA 1ESRA 5G3LD 2WB1G 3CPFA 3DTIA 3S16B 2WGVA 4B88A 3TZUA 2IA2A 3W4PA 1LSVA 1D1JA 2NVXB 4R4RA 3LIEA 1GSWA 4BY7G 4S2OA 1QWYA 4A93G 4IO9A 5M5XH 4A3GG 3WWXA 4NXBA 5FO9B 5CGWA 4BD0A 4C6YA 3CAXA 4X62L 3NXWA 2JA6B 3A8IE 3QP8A 2B2YC 4IJGA 1VQ4A 1ICWA 1QNKA 4QMGA 2D0OA 5I9PA 4HESA 4IQZA 2N78A 4C3HH 2KENA 3VA5A 2QGQA 3G4SA 2JN7A 3MXRA 2B2WC 2XLNA 3KDFA 1BYWA 2XDMA 5F1FA 2L1BA 1MHWC 2BLSA 1XA1A 4RAUC 3IXDA 2IX3A 3J7ZC 3CXCA 1Q7YC 4ETXA 3K59A 4LF6Q 1PDQA 3EA6A 4A3FH 4ZRRA 3AU7A 1NLZA 3I4NB 2P9VA 3LO7A 4XDXA 2BE5D 1G6AA 3KSHA 3W5OA 1GVPA 5FJ8H 2PZTA 5D14A 1MIUA 5IGEA 3I70A 1HZAA 1PRTF 2R92G 1LABA 2NTSA 3BQ8A 4B3TQ 1CKOA 3AGDA 1LTSD 1U4LA 3RLNA 3HOYH 1V43A 5F68A 4DR3L 4DV1L 4DV4L 3SH9A 4IBXA 4KY7A 2C35B 5FDSA 1B9MA 3F1OA 4DFAA 4P72A 3FDTA 2I0QA 1SE2A 2HHHL 2ZQAA 2VQEL 3VSLA 5GADC 3RZOH 5KGUA 2A6HD 3H09A 1SZVA 1I94Q 4ZTKA 2ICEC 1KLGD 4RYEA 1XWEA 1Z6FA 4MBKA 3MS6A 1CKNB 4BBTA 4GOGA 1Y1WB 3LIDA 3T56B 4GHIB 4ARZB 5J3WA 1AE2A 4J6HA 1ES2A 4OWWB 2W3HA 5HDCA 2XSSA 1XPRA 1TS4A 5DM73 1Q3LA 4DUZL 3J80E 2K4KA 3HOXG 4GOPB 4N1HA 2C5WB 1HNWQ 1UEBA 2QF7A 1DJCA 2WFWA 4XXRA 4FYDA 3VR2A 3W2DA 5IY0A 1QILA 4WN5A 1F9QA 4MBHA 4C2MH 5C5KA 4Y7NH 2A6HC 2GVAA 4DR5Q 1D5ZC 2Y2KA 5IODA 4A3IB 3C38A 4P6ZS 3S1QB 4MDZA 3GO5A 4JK1C 1T1CA 4BBVA 1XNQQ 3C4OA 1XXGA 1Q1BA 3AFQA 3H0GB 1L3LA 5KNBA 1W6JA 4JF4A 2VGLS 3VA7A 4GS9B 3PO2B 1H9JA 1K56D 4LF9L 4JYAL 1EWZA 1SCWA 3H7WB 1MJEA 3MTSA 5J22A 3P7NA 5CV8A 1O7LA 4BQMA 5FI6A 2Q9MA 5A91A 2W1TB 4EXOA 1JOOA 3MXUA 1K6RA 4JGQA 1KNAA 2JE6I 2PHYA 3SK4A 3JC66 3WS4A 1DY6A 1L1OC 1XX8A 1CA6A 1EY4A 1QOHA 1LTBD 3O86A 2L9HA 4DR3Q 4DN4M 3S17B 3E6ZX 2XRSD 3NUCA 4GNUA 4LMQD 4KZ8A 2ZQCA 3IX8A 1S5CD 3N4IA 5CXWA 5IYBG 1XFQA 4N8X1 5K36G 4A75A 4GHIA 2K7SA 3HZXA 2F4IA 4I38A 1LYLA 4CLCC 1R9TB 1BDOA 1FNUA 4ZYSA 4Y3IA 2XROA 1ZTUA 3OPPA 3HOZH 3GDEA 3F1NA 5I2XA 2N3SA 2VNUD 2PBYA 1X3QA 4DR6L 4HIDA 1K8GA 5F5YA 2QMIA 3TP8A 4X65L 4O1NA 2CQAA 1V9PA 1ESFA 4LFBL 1KC8C 1EOVA 4L8JA 2JE5A 3C8CA 4GD6A 2I46A 3KFUA 1DOMA 3RLFA 3RZDH 3Q07A 4DV4Q 1NTGA 2A6EC 1DCZA 3OWEB 3IT9A 4JPBW 4O0AA 4KUOA 1IL8A 3Q24A 4DN0A 4I3IA 1CHPD 1VQIA 4FXDA 4LENA 5E2HA 1JTDA 3H82B 5J7EA 2CFMA 1DZ1A 3QP5A 4MN6A 1CZWA 2F0HA 1YKDA 3CP0A 3HOVH 1VQEA 2BTFP 3GQZA 5KZHA 2D62A 1MBYA 3BJUA 1XNQL 4JXSA 3A56A 5FQIA 3HJKA 3MAQA 2NVXH 3S7OA 4I7AA 2HP9A 2YU9H 5ELNA 1ENFA 1HQMC 1K8AC 4DR7Q 2Y2HA 2Q2UA 1PH8A 4UEYA 1KDBA 2BDOA 1I4GA 3VV4A 1HNZQ 3ZGAB 1IKIA 5DTSA 1X54A 1HH2P 3MFGA 1Y1WH 5MC7A 1NXYA 2AWOA 1W6KA 5HWVA 3CD6A 2H5XA 4C3QA 3BYTB 1FNVA 1TY2A 1YNJC 1ET9A 2XNAC 1NBWA 3CCEA 4QY5A 3ITBA 1IKMA 5M5YH 1G68A 5GL9A 1ODVA 3SOIA 2XRQD 3Q0AA 1CSPA 1SRUA 1RGZA 4DMZA 4ODGA 2Q2TA 3HLWA 5JYPA 3D6CA 3ER0A 1A15A 1C9OA 2TSSA 3H3VC 1A62A 4B3RL 1DD2A 1NY0A 2K31A 1PVOA 3M3YB 3FP9A 1LT4D 3J81L 4UPAA 1XTCD 4HSPA 3I4MG 1YM1A 4JI3Q 1D5XC 4C56C 2B8FA 4A76A 2Y79A 1UE7A 3QNCA 2Z6KA 1CI9A 2DRWA 4EETB 3F2CA 3NQTA 2C5CA 3HREA 2M7UA 3E2LA 3PHYA 3DM1A 3FVQA 1YIJA 3C5AA 4KENB 1I3QB 1GHMA 5KEEA 4R4CA 3PUYA 1L0GA 2PD7A 1HQRD 1P0ZA 2ZBBA 3FZCA 1I50H 1LACA 4HSVA 1C3BA 4XT3B 3BG3A 3BJNA 4GJ4A 3HKSA 1BLCA 1LTLA 4B4ZA 3MA2B 4R9WA 3RMHA 2EYOA 1HRJA 1EFID 2F0VA 1SE4A 5IWAQ 4HY8A 1LLBA 4LFAQ 2O4XA 2OTJA 3OPLA 2R61A 3E0JA 4PNYA 1DXMA 2K5VA 3SXHA 4DAPA 1SNPA 4ZKCB 3PIO3 1K4EA 3ZG5A 5EUAA 3TG9A 4KHZA 2LFNA 4WZ5A 4XT2B 3QP2A 2KUMA 1EZ6A 1EIYB 3KLRA 3FKIG 1OTIA 3RJUA 3VR6A 1TR5A 2P5ZX 3KF6B 2QZ6A 5KSCA 2E2IH 1W8QA 2CVRA 5JPNC 3J80c 1XP4A 1TY0A 2CW0D 5JJZA 2V20A 1V8QA 3CUEA 5IGBA 5DJTA 5ELEA 2R93H 3N8LA 3S2HB 1RF2D 1AW7A 4OKPA 5HSQA 2BDNA 3A5ZB 5KRUA 4U68A 2K5HA 3SH8A 5AJ3L 4BY1H 3EN2A 3G6JB 3B33A 4HCEA 4DV7L 2ACGA 5E4XA 1CSQA 1YHBA 4NMZA 2OXPA 2VUMG 5HL1A 4LNQA 2VW9A 2O5JC 2NN6H 5EPHA 1PFSA 3TP7A 1G6PA 3D4FA 4GDNA 2OAP1 4H6JB 2R92B 1VQCA 1KGGA 3G6EA 4B3RQ 4L6TB 2K28A 2O9BA 1BCPB 3TQYA 3LWUA 1KDCA 2I5MX 4UDUC 3MMHA 1YHAA 3FHWA 1E25A 5CBAE 1HLUP 4S2MA 4BL2A 5IT9L 1ENCA 1DP9A 1H9SA 4B3MQ 3NTIA 3MHBA 4WF0A 4A3KH 3SK8A 3W4QA 1CK1A 3CAMA 5JJLA 2UU9Q 5FQMA 4DK6C 4PKYA 1PFMA 4M8AA 2OCEA 4H8RA 3F1OB 5AJGA 4HMJA 5EBDA 1QNUA 2VL6A 1XJ3A 1U4MA 3N8RA 1SYCA 5TJJA 2Y8HA 3V39A 3MEHA 2PZWA 4YY3Q 1HXYD 5I2YA 4JI0Q 3CMZA 2OV5A 4JI7Q 2F0TA 4Q0FA 1VQKA 3AGFA 4IURA 1KRSA 1G28A 1PW8A 4PAUA 1Q12A 1BLSA 2O9CA 1EIGA 1CF0A 3STBC 5CGSA 2LB9A 3ZJYC 2PCFB 5FLXE 4A3DH 1J5EQ 1TWAH 4DE0A 2HQEA 3NE5B 1VQLA 3M85A 3PIPA 1KGEA 4KMUC 2RDGA 3VR5A 1YLYA 2PT7A 5KIXA 3NTHA 5JVG3 2DN8A 4IUHA 2Y2NA 2KVMA 1SLJA 1NJ4A 5C3XA 5GLCA 4HIMA 3N8SA 3V96A 3NPPA 4A93B 2EYJA 3DTKA 4AYBG 3HBRA 1Y1VG 4DR2Q 2FFKB 1K3RA 2V8FA 4DE3A 1FCOA 1EYAA 2ZTEA 2KLIA 4OGQC 4QPRA 2ZOHA 2W3FA 5HAPA 2NB0A 3M9BA 3W1GA 4LRXC 5BR8L 1ES5A 4J15A 2PAVP 3U50C 4ILWA 2WUQA 4ABNA 3M4PA 2V8CA 2HDQA 1TS5A 4DXFA 2H1EA 2VB2X 3IXBA 4DV2L 3C30A 4A3JB 2G7UA 4DR4Q 2V1CC 1K73C 1HNXL 3NULA 1LT6D 2Z8LA 5ELDA 4OP5A 4X56A 2BA0A 4FF1A 4XYQA 3PR6A 1TWHH 3BYYB 1LTGD 1GA0A 4MIUA 5A90A 1YPRA 2B2WA 2O0YA 4BBRB 2AQ2B 2UV0E 2EWVA 4CDCC 2WV6D 3C1EA 3HOWG 3P20A 3BFDA 4OQHA 5HWWA 4PG3A 3DWQA 2XFSA 4K0KL 2XK1A 4N8FA 1T9HA 4FUWA 4A3BH 3HUOA 4JG2A 3OW7A 4RGNA 3RD4A 5IYDG 1CEGA 2GN5A 4E3KA 4CDEC 4DXCA 3D3RA 1A6XA 2EY6A 2V9AA 2ZQ8A 2ZOIA 2A68C 2JA9A 2KJXA 3W4OA 1YNND 2AMCB 4KQRA 5C4ZA 5LMNL 4CQHA 1H95A 1ZHHB 2N8NA 5JOBA 1G91A 1IELA 1PV4A 1LSWA 1NLYA 3KYHC 1OTBA 5FI2A 4NEED 3NJAA 3T4SA 4FH4A 2N88A 2J3TC 2O2LD 2NVYH 2WAEA 1YBYA 1IHZA 3N7WA 4I39A 3SZTA 2GA4B 3NWSA 2IHFA 2ZJRA 1HA5A 5EPJA 4YCWA 4J8QA 1PH2A 1UGUA 1KAAA 2JKTM 3RN2A 4JBJA 1NR2A 1W79A 1ICFB 4X3SA 3U9SA 3M7NA 4DJ3A 4OPQA 2RSOA 2K7VA 2V1AA 1C8CA 3HJIA 1O7EA 1SMXA 4JF5A 2R92H 3ZYYX 3S9WA 4BY7H 3MSHA 1UWNX 1XJ2A 3D3OA 4GKJQ 4ID4A 4BLMA 3RN5A 2WGWA 2ENBA 2E5LQ 4NXEA 3IQAA 2JCHA 3I73A 2VGKA 3D72A 4C3IH 2ALYB 1JWZA 1WE4A 2OWHA 2WKPA 4MNRA 1YNXA 5A2QL 4JI4L 3LYXA 4Q0HA 2Y91A 2HQLA 3L7HA 4IPGA 4EBNA 1WTVA 3N6IA 1B7YB 2ID0A 4JI1Q 4F3LB 2VV6A 1ASYA 4RA8A 5EKLA 1ENAA 3HOUG 4HI4A 4S2PA 5CHUA 2IL8A 5EM1A 2F0PA 1E1TA 1PTOH 4OIJA 3QR8A 4ZUIA 4GNXA 1TWFB 2VS1A 4JVZA 1LLRD 3ZYTA 4K0KQ 1V9ZA 3ZG7B 2QJ5A 2WKDA 4AQYL 2LKVA 4DUYQ 4LF7Q 2F0GA 4CJ1B 1JVJA 2WKQA 4X3KA 1LUZA 3UE3A 1N33L 1JE5A 4IZ8A 3LR0A 1HJPA 3EROA 3GTKH 4S2NA 1MY8A 1AFPA 1LTTD 2CWPA 4A3EB 1L0WA 3R93A 4NXFA 3V67A 2F0EA 2WKHA 4IOCA 4TVAB 2UXDQ 2ZC7A 3MVVA 3M4QA 1K4FA 4CBVA 5C4HA 2RHQB 1GUGA 1K8MA 2HD3A 1Z9FA 1T1AA 4WEKA 3A3DA 1CZGA 4FCFA 2JEAI 3HL9A 3S4XA 1V9YA 1Q1EA 4K0XA 1WI5A 3CPTB 2JN4A 2JC7A 3HKZB 4DAMA 2F3VA 3B47A 2EY2A 3K5OA 5IU1A 4X66Q 1TS0A 5T1GA 1VQNA 5A93A 1K3BC 3SVMA 3ND8A 3IH9A 1I6HB 1WCMH 3HKZE 2H5SA 5AJ3Q 2JKTI 5DTKA 4QB4A 4EQIA 4FF2A 2PBDP 2KCNA 1CKNA 1V1PA 3MKEA 3TS0A 4R8IA 4EUZA 1Y1VB 3OOCA 1GUWA 1YJ9A 3J80i 3HOXB 3T1HQ 2G9HD 5E4WC 3CCSA 2SEBD 5FK9C 1IEMA 4A3BB 2VX8A 1LT3D 4E6IA 2JXMB 4KY5A 2RVLA 4A5RA 5EQ0A 2LB5A 1ERMA 1ET6A 1Y1WG 4F8MA 2FH5A 1E7ZA 1IBKQ 3GTOB 1FQGA 4J1MA 3VR3A 3ULJA 2QDBA 1VQ6A 2CC1A 3A3JA 4LGWA 3GTKB 1Q90A 2HIVA 2H0TA 3JAME 1K38A 2FFFB 3FKVA 1K0SA 4Q0JA 3L3OC 3E98A 3PBQA 1LTID 2J4XA 5FO7B 3EOIA 3N52A 5C5MA 2XGNA 3T50A 4IPDA 1PH7A 4R4TA 4RGOS 4B3TL 3D9YA 1EWCA 1G2TA 3LWEA 5IT9E 2Z1CA 3K5LA 4DAVA 4UP9A 5M3FH 1NCVA 5HGTA 3IWOA 1V1QA 5GROA 1HTLD 1N34L 2A24B 5CV6A 3OSOA 1KE0A 5GAEC 3PO2H 4K2LA 3KF8A 1X6OA 1F9RA 1SYDA 1BKBA 1JJCB 2F0JA 5DFYA 3A74A 5E43A 1WTWA 2VQEQ 2QHKA 4I3JA 2A6ED 3EJIA 3FPPA 5H1SE 2VXWA 4KI0A 2FFYA 4DDSA 3PXPA 2F0SA 1TKWB 3FWLA 1VS0A 2AKWB 5FKAC 4WFN3 1NAPA 2FJ2A 1Y69U 1W2BA 2VV8A 2GNXA 4U0XA 2JBFA 5CEDA 3SK6A 3OTOL 4AQYQ 1M90C 2XSCA 2VUMB 4LV3A 1FR6A 3C2WA 2Z6KC 4BS9A 1FNWA 3AGEA 4UQIM 3R7WA 1WCMG 2LXJA 3Q22A 2K50A 4KHVA 2FZ0A 5IGGA 3OC2A 4UAAA 1F2YA 4KD3A 4KLKA 4RH6A 1ZEQX 5CMDA 1QUQA 4LFAL 1N32Q 2RCXA 3FG8A 2NBFA 3HOWH 2W27A 5FEFA 1I94L 1K55C 2PU4A 3HOZB 1TQOA 4Y5FA 2UXDL 1XPOA 4EBPA 5F83A 3BM6A 2K5NA 3A54A 4GKKQ 1XJVA 5IP9G 4PZ6A 1S40A 4KG5A 2IX0A 1EEID 3OW2A 2F0DA 3H6MA 5C3EH 4LF9Q 2BCOA 5F2DA 1Q8IA 3CCJA 4CKEA 1N9LA 2XFTA 4K5XA 3ZHHA 3UDGA 2ASBA 2E2JB 2HJ9C 2HCIA 3I7FA 4PMWA 3OMGA 3KYEA 4P73A 2GVBA 1ZXTA 2VB3X 5KSHA 4YHHQ 4WZ4A 5IP7H 1KGFA 3AFPA 5C3EG 4LUOA 3S1RH 3V50A 2K5WA 3OPRA 1FD7D 2A69D 2H4OA 4YWLA 4C1NI 3J7YW 2UU9L 2ZJ9A 5A8BA 4JCVE 1MSGA 1WYBA 4HAEA 1OXVA 1Y28A 4GS9A 2A5HA 3L9AX 5C0XI 4HHDA 3HFZB 3CUEC 5J8XA 4KHPL 2BH2A 1I4RA 3EGXC 4ME5A 3SS5A 3LIFA 1SMYC 4O0PA 1QVCA 3HOUH 1YNNC 5IYCH 2PD8A 1MBLA 2HP5A 4POFA 3S24A 3PF5A 2XH9A 2BASA 4NXNQ 3HOXH 2UUBQ 1YLWA 4YOFA 2RA4A 3VOLA 3S7QA 1TT2A 3CHBD 1BCPC 2IPKD 5FATA 1C0AA 3O13A 4XIGS 3A0VA 3E4QA 2WKRA 2L4NA 4JBKA 3NEMA 3EBEA 4G7HC 2NZ1D 1HUNA 3G2ZA 1N36Q 1UWPX 4MLLA 4RCOA 4IPHA 3GTOH 4K5WA 4NW2A 1DONA 3S1YA 4EW7A 2ZQ9A 3MXGA 3TMEA 3CCRA 1PH9A 2WZXA 4X64Q 3LIBA 3ZFZA 1JC7A 2XVSA 4Y13A 3CCMA 1ESUA 1KVLA 5DEHA 4O7DA 2WKEA 4JC0A 1SAPA 3F1NB 3SH7A 1PA6A 2KDKA 1NRJA 1X56A 5IGCA 2HZ5A 5HDDA 1F9PA 1M4VA 4X62Q 5HW3A 5M3FG 3EEHA 3OCNA 2M00A 2UUAQ 2Y2LA 5FQ9A 1L1OA 1G291 5BR8Q 1EY5A 3V05A 3HOYB 2A24A 4GN3B 1PH1A 1F9SA 3G35A 1B4OA 2E2HB 4K91A 1WTXA 4WEJA 1MWSA 1O07A 4ZQ3A 5LBRA 4EERA 3GV3A 1SYGA 2OQKA 5HURA 2OWOA 5GHXA 3M3YH 2I72A 1K28A 2DY8A 4HEDA 3GTGB 4Q8IA 1STNA 1OXSC 1LI0A 3NHQA 1FCMA 3IBRA 4RGMA 4IJLA 2RCFA 1W63M 3NOUC 1U0LA 3DUZA 1VMPA 4P87A 3D8GA 2Q2IA 1VQFA 1RHPA 5IYCG 1MPLA 3AQQA 3IF6B 5FAPA 2OEOA 4QIWE 3KF6A 1GUOA 4B9OA 3GMWA 3L7ZC 4C3IB 1CI3M 4GKUA 4OP8A 5DAUA 4ZAMA 4CGYB 2F52A 1GO3E 1F5MA 2Q2HA 1EYGA 1ZG4A 1KDAA 2EWWA 2Y2MA 4A3MG 4X69A 3UB7A 1CI8A 4C2MB 1A2TA 4NG2A 5IGDA 5GAHC 2HJEA 2YTYA 5I9OA 1VQAA 3SE0A 2ZJQA 3GTJB 2E2IB 1C7YA 2CCZA 3Q23A 4DR7L 5EVID 3CITA 1V1OA 3A3FA 1PI4A 1TD5A 2DJGC 4R1JA 2WYXA 4BWIA 3VOYA 3IL8A 3M4OH 1NY4A 2Z2LB 1SJED 4NK3A 4G7OC 3SR1A 4P75A 1CQFA 4G57A 4KK7A 3LUQA 4X1LA 5DVAA 4JI2Q 1SE8A 3P75A 2QPNA 2ZC4B 4EQ5A 4HJ5A 3G2YA 1VB6A 1RJTA 5F6AA 2XA7M 1CQVA 1RCVD 3S1RB 3SGIA 4HQAA 4LF4Q 4UAIA 4XXEA 2UWXA 3NDEA 5CBEE 5TR7A 3LIAA 1D2BA 1I6VC 4DR5L 2O99A 4ZLTF 3BFEA 5KYLA 4XUZA 3UPNA 1SR3A 3BZCA 3DXJC 4KN4C 2R7DA 4UHUA 2A19A 1L0EA 2FINB 4B08A 5JEAG 1PRTB 4Y52H 2SDFA 4K2KA 1ZYRD 4DV3Q 2P04A 4HBUA 4KJOA 1CM9A 3BWLA 4A3FB 1PI5A 3U2AA 4LLOB 1PXUA 4QU3A 2V1ZA 2X01A 5IGFA 4Y0TA 3R3OA 3GTCA 3P09A 1ML0D 4UA9A 3I56A 3W8KA 5FAOA 4YINA 4RVAA 4E3LA 3S22A 3LI9A 3BVGA 4JI1L 3S7NA 4GLXA 1UE6A 3JAMc 4DK0A 1Y8PB 4C3IG 4P0MA 1Q2QA 1LM0A 4MZ9A 4LFCQ 4DV7Q 3CJMA 4HEFA 2MJ8A 1BUEA 1RCJA 1KDSA 4V0BA 2E74C 3T13A 4QJFA 3CI6A 4TSSA 1B70B 5E2EA 2R9WA 1STYA 5EVIC 4OXPA 3ULLA 5M5XB 2DCFA 1B53A 3GQBA 4GLQA 1EQQA 4A3FG 4GZBA 4HJ4A 1G5UA 4AH6A 3MFXA 3TZDA 5EKIA 4A3KG 3DEPA 1DP6A 1SBBB 3Q1FA 4MNOA 1W3SA 4CDDC 3CC7A 1NZOA 1LL8A 1P16A 2MPMA 4A3DB 2FMMA 2UUCL 3DBAA 2E8JA 1P9RA 3VYRA 3CF5A 3WOFA 4HIAA 4B3ML 3UMDA 3S15H 1VQBA 3HUMA 1NSNS 4RGTA 1GM5A 4HOIA 5C3WA 1S5FD 3HOVG 2J7ZA 2KOLA 4HJ9A 3FPWA 4FOFA 3OWFA 3BFFA 1Y14B 5L07A 4NPSA 3TRCA 1FILA 2Y2PA 2ZJPA 1CJFA 4WJ4A 2YU9B 1PFNA 4X68A 1I2WA 1NNXA 2F3WA 3S2DB 3CRLC 3UO9A 3ZNYA 5DLQE 3K80C 4DK1A 3J81i 3J7AF 1CUKA 2X69A 1PH3A 2Y2JA 4RHSA 4IPCA 1JB3A 4YIJA 2FHTA 5HGQA 4C3JB 5IYDH 3O88A 2R7ZG 4A3JH 4EQ1A 3W2ZA 2CKZB 5IHVA 4DGZA 4C3JG 5FLXL 3DMUA 5GQOA 5GHZA 1WTQA 5EVEA 4CJ0B 1TS3A 3FYZA 2L1MA 3AB9A 2WAFA 2M7VA 3FKIH 4B4XA 2CWAA 4OO1G 3F1PA 4Y17A 2RL3A 1HFNA 5M9OA 2KCTA 2B63H 3NWTA 4LFBQ 2JQOA 5TSSA 4IFDJ 2R9XA 2DGYA 2Y4AA 4QF4A 4OPYA 4ZJ3A 1NZUA 1FJGL 1XPUA 3NOPC 3URYA 5LL6X 1X55A 1H9MA 3S15B 2DNEA 4JI7L 3JVVA 2I5HA 5J1ZA 4MMNA 2A2LA 3G6OA 3P01A 3MXNB 2I5LX 4A3CH 4LF8Q 5CV9A 4I7ZC 4IEDA 2G9DA 3PIOA 2PPBC 2P08A 1VQDA 4JGOA 1J5EL 3H0GH 3TSGA 3SS4A 4XQNA 2D5DA 4O01A 5D3OA 4QL5A 1PLFA 4XQQA 4IUKA 2ZXOA 4KZ9A 4OO1H 4KKTA 2ZM8A 3R2TA 4DV6Q 2HV1A 1S5ED 5ELBA 4A3IG 3NDGA 4GLAC 2QWSA 1ALQA 1AP0A 5CV7A 1DM0B 3J81c 5M3MB 1VQMA 3DWZA 1VQ5A 3K7UC 4A3MH 2WGWB 1PTOD 4RWSC 4DF7A 3S14H 3KO6A 3LEQA 1G8ZD 1DYQA 1UNSA 2PRFA 4GB7A 2Q9NA 4CLCB 3NBIA 3WWVA 3WRZA 2SNSA 4HP9A 4QUFA 3UDFA 4D2OA 2AQ3B 1VQOA 4KKSA 1HD8A 2WINB 3S2HH 3V3SA 1TS2A 1ZKJA 2UXCL 2HPBA 2JKGA 3IFDA 2OOLA 5I6WA 5TBMA 3RXWA 4H44C 4OPZA 1KD1C 1WYCA 3QOJA 1F77A 3QP1A 1IYPA 4EU0A 3CMEA 1T5XD 3FRPB 5DKKA 4L9FA 1XJ6A 2YTVA 3B6YA 4YFMA 5CV4A 3OIQA 4HH3A 1TWCH 2Y2IA 5ELCA 4JV5L 1TWFH 4S2KA 3PUWA 3KDFB 3K57A 4XT1B 4BBSG 3TE8A 3K7AH 2R78A 3S7PA 1QB5D 3T1QB 4WLAA 3CZDA 3KX0X 5GLAA 2QEJC 2OLUA 1IYUA 2WZZA 1L1OB 1IBLL 1YMSA 2H0YA 3JYIA 2GJ3A 5M5YB 3MXPA 1OT9A 4BL3A 2PMZE 3K2NA 4OO1I 4NB3A 4OX9Q 2OT2A 1F9IA 4F94A 1Z09A 5LMNQ 1FSYA 1YSPA 1DOKA 3RLOA 1BQQT 3JAML 4JI5L 2EYPA 1XPBA 2XEPA 2RDFA 3PQIA 4HIKA 3OMCA 1K8OA 1FR1A 1JWSD 1NJIC 5E7NA 1NYYA 1H9KA 5FL3A 2RQXA 3SS3A 4X6AH 3QJYA 1YEZA 4JLFA 1V1PB 3KBXA 4ESPA 4DV5L 4PMAA 4KZ4A 4CHTB 4DA2A 1FOFA 3HLCA 3LEZA 1WA9A 3K3DA 2IWCA 3O87A 4KUKA 1K55A 5U47A 4DRTA 3GV6A 5HD5A 1MD2D 1SYFA 1AN8A 3DWPA 1GHPA 4GCZA 5CYUA 4UP8A 5KNCA 2EPBA 4K8JA 4POGA 3JAMi 1VETA 3W1BA 4EEUA 1EQVA 3HG9A 2XQZA 3Q7ZA 3LY4A 1YT4A 4FF3A 3BYDA 1OPXA 3GRJA 5HAIA 1TEMA 1CTMA 1YAXA 2EXDA 2PZUA 4IUUA 2WB1B 1E3UD 1H8ZA 2K5DA 4NP5A 4NETA 4R38A 1MWRA 4KHPQ 1W5DA 3K5NA 1EUJA 4A93H 2FMCA 3F1ZA 4GOPA 4A3CG 4DUYL 1ACFA 1SNCA 1SNQA 1VMCA 2Y0SE 1T18A 3T1HL 3D4DA 3K3CA 4P74A 1PZID 3LCEA 2EVBA 1RIPA 1JQYD 3HLGA 1TU2B 4XQJA 4HJ6A 3VOZA 4X3UA 4HTHA 1E22A 2D0PA 3KUPA 3P7JA 4KZ3A 4KKUA 3PO3B 2B63G 4JGRA 5HWTA 3KOJA 2N49A 1KE3A 1E2ZA 1LO5D 2JHEA 1S72A 1BBUA 2Q8IB 3T53B 3W3AA 1X3GA 4EQPA 2NUTC 4R23A 3KF8B 5CHMA 5BOHA 1PH5A 3ZVWA 5CR3A 4IOAA 3MXSA 5EAYA 3H15A 2WAQB 1VQPA 1S0WA 1TWHB 1BF4A 5A2QE 2E75C 4CPKA 3SEBA 2PW5A 3Q7VB 3CG5A 1STBA 4A3JG 1H9SB 3JVUA 5AVEA 1EFWA 3CMAA 1JT8A 4N9LA 3QG1A 5IWAL 1MGSA 1RKNA 1SE3A 2D2CC 4GNXC 2CH4W 1RD9D 3BEBA 5JYOA 4IN3A 1JR0D 2L55A 1R4PB 2LXKA 3QWNA 4IUNA 5LMUQ 3IHAA 4JXVA 3MWYW 1IYOA 2J8YA 4K14A 1EQRA 5C4JB 2Z6DA 1SFOH 3BLMA 2WIIB 2W1RA 3E4PA 3X3NA 5AQAA 2QW7A 4XUXA 4X3TA 1JWVA 3R7WB 2PNHA 2VLGA 4X66L 1NYMA 3WOEA 1HTPA 1O7ZA 4QIWB 4CLCE 1PIOA 3PUVA 5EBCA 3DLLA 1IFQA 4MN7A 2DY7A 4NKPA 3F2UA 1BR9A 2X6GA 4L5QA 3E4OA 4HBTA 3WS2A 4QQBX 4EEPA 4Q5VA 4BXXG 2Y2OA 3PMFA 3PTEA 1UAPA 3KSIA 4JBMA 2Y2QA 5GLBA 1ONLA 2OQ0A 3OTOQ 1RP5A 2MJ6A 5CTNA 2Y0SG 3S1QH 4ME3A 1L0YB 1TWAB 5HFOA 3Q6SA 5FLMG 4LK1C 4IVKA 4DAYA 2M9VA 4L63B 3NK9A 1KRTA 1F2MA 1X0OA 2A1AA 3NSWA 1D7EA 3O3VA 3J81E 2J9PA 2J7VA 1YVCA 2Z9HA 4WJWA 5C0XH 2JA7H 3CCVA 3H82A 2KCMA 1PHJA 3OCLA 4JBFA 1PZPA 3J81j 2F0QA 4EX5A 1UE5A 2Z4HA 4K8IA 1D7QA 5CRFA 1A0IA 4HN7A 4X65Q 2D02A 3C7UA 4TKOB 1KAWA 5COYA 3R8BA 5EKKA 2JEBI 2V0WA 2ZMFA 1JE4A 3A0JA 2YTXA 5L09A 2A73B 1YJNA 2WGIA 2EDGA 1PW1A 4EQNA 1VETB 3VP3A 3BECA 3IFTA 5G3LF 4WBGA 4LF4L 1OTEA 3TS2A 4IFDH 1BTLA 4ZBEA 3E0YA 4S2IA 4MN3A 2E8IA 1PTOB 4KZAA 1GA9A 2VK3A 4CLCD 4LW1A 1MWTA 5CERA 4MHEA 2MQHA 5IP7G 1H8YA 4GD8A 3CU7A 4II7A 4HJ8A 1GUNA 4DK3C 4FD8A 1P8LA 1TWCB 4Z1WA 3MBZA 4R3JA 5CEBA 1VQJA 4ETZA 4HJAA 4GKKL 2A68D 4MTKA 1J3WA 1ESIA 1IOUA 1JJGA 1IKLA 3RZOB 2M1CA 4OWTB 4DKIA 1EU4A 1KNEA 2HDLA 1HNZL 5T1IA 3J80L 1D5MC 3BZKA 1P9WA 3FEWX 1SYEA 4ZK9B 4L9GA 3RZDB 2E2DC 1PTOC 2HT1A 3IHBA 3M2KA 1LI9A 3VYUA 4R3BA 3A3IA 2EJGC 4IJHA 3CC2A 1Q46A 1I4HA 5TFQA 2R7FA 2PYRA 1N32L 1W63Q 1OO9B 2B3GA 4A3LG 2OWJA 3TP6A 3C1FA 4RHRA 2JP1A 1QZHA 1IYSA 1PH6A 4R3AA 1CEFA 4E3NA 4P71A 3KLSA 1GJXA 3A8KE 3I8ZA 3WS5A 1WOCA 4EWFA 1K0KA 5FSRA 3VMAA 4FVMA 3CHWP 1MZUA 1MXOA 3QP6A 1KDWA 3GTGH 3NC8A 4UHVA 1OXUA 2ATWA 2K2NA 3J7A5 5EVIA 3ICEA 1D06A 4DR1L 1Y4OA 1AEXA 3GDIA 4UY8C 5C4JH 1QMEA 4NDXA 1ILQA 3NTKA 2E2HH 2VY3A 4E3MA 3ZG0A 2A74C 4G3KA 2P74A 2ZMAA 4B3SQ 5GAGC 4AFIA 1E0BA 2MHVA 4BBRH 4C1NK 5HY6A 1GKHA 5EFWA 4BBRG 4QCLA 2QKIC 1K6SA 3UB9A 3L9KA 4HH2A 4BY7B 3P1HA 1GOZA 1N33Q 1FCNA 1SKFA 4FSFA 5I94A 2LY7A 1BZAA 3E3XA 5AQBA 4IUVA 4WMCD 1DP8A 3D6WA 4RKBA 1KTKA 3DEOA 1VQ9A 1J9OA 4RMFA 4FO2A 2AWNA 2ZM6Q 4WELA 3T51B 1YJWA 1B3QA 3BRMA 2EX9A 3HLBA 5IS1A 3DTMA 1VEUA 1F2ZA 4BA1I 1Z7TA 2IT1A 2W3DA 3KSFA 4BBSH 2L11A 4JYAQ 1SJHD 4O8GA 2PYKA 2Z4IA 3MFYA 3GTLH 4OVDA 4YWZA 4EQOA 1JORA 3GD7A 2C6WB 3OLOA 1E24A 3CKIB 4E3JA 1N4OA 4OLDA 1D1IA 3PAEA 3A5UA 3UB8A 2EOTA 5FO8B 5IYBH 2HCCA 5EE8A 4C3HG 3PF4A 3ONAB 3A8JE 1JOQA 2CQOA 4JI2L 1WYDA 3VYTA 2BG1A 3G30A 5L2FA 4PM8A 4M4XA 4PMCA 2W0NA 3VE4A 1OXXK 2A8VA 2NVQH 3S14B 3I90A 3LR4A 4F88A 5C4XG 3K0XA 2Z2MB 1SNOA 2MNAA 3PV0A 1A3VA 4FXKC 1TWGH 3IWQA 3PBSA 2Y0SB 2E5LL 5EPLA 2JA7B 3NY4A 1GUSA 1VDZA 2UXCQ 4M1UB 2Q0OA 3UE1A 3SDZA 2XR0A 5CX7A 2BH8A 2J0TD 1HA6A 5FQQA 2O9AA 2ZXPA 1P97A 3GVBA 1JTGA 2K5QA 2NYZD 1D1KA 1WD1A 1W7FA 2ZXRA 4LCLA 4A3GB 2EXBA 4DNTB 1STZA 4B93A 5TBMB 1PRTC 1EZ8A 2J9OA 2CW0C 1I4XA 4QWOA 3KJPA 2HDMA 3ERQA 1G6ZA 3UI2A 2JA5H 2NWGA 2OLVA 4IALA 4LFCL 1VQGA 1ONHA 4JGPA 4WMCA 1TVXA 2XIWA 5FI7A 4OX9L 1VF5C 3PIP3 1BCPD 3PAGA 4RG1A 3S1NB 3HRZC 4DR1Q 5CGXA 2XTIA 1FGBD 3D4RA 3IRBA 3FPUB 1D8LA 1E2WA 1LHYA 5ELOA 4MN5A 2B18A 3I55A 5G4ZA 2H10A 2PMZB 2IWDA 2A69C 3OOVA 3NELA 3RUZA 5EVIB 2RSNA 3UPPA 3EFXD 2ZLYA 4K6DA 4A3DG 2HDRA 1STGA 2KHJA 4BJPA 4A3KB 1HHVA 2L4RA 3BZDB 4R4QA 3ZQ5A 3WS0A 4EGVA 4GDBA 1I3QH 4C3JH 2CHBD 3IAYA 2V4DA 4KJNA 1K54C 2EA9A 3MR0A 2WAQG 2WKCA 4TQUS 4R1GA 1SNMA 3T4TA 3V3RA 5L37A 3NECA 4UA6A 2KEDA 1HZ9A 3SK5A 1S4SA 2MO0A 2B63B 1KIXA 3HS0C 2HP6A 3STBD 1SSOA 1NMFA 1B50A 3UDXA 2B5RA 1QZGA 4PPRA 4JI3L 5BN4A 2K05A 3LY3A 2R93B 4PZ7A 3NENA 4JI8Q 2DMWA 3ZCZA 4MEZA 1J8IA 1RODA 5HD3A 3DTEA 3N6RA 2X71A 2OAQ1 3M2JA 4RX3A 5HPFA 5M19A 5JVH3 1HZCA 2NN6G 4HIOA 1GHJA 1XGJA 5DJUA 3CCQA 3WS1A 3M7GA 4EUVA 1HZBA 5EJWA 2P7JA 4LV2A 3EGDC 1Q82C 5E1FA 3C4PA 4B9WA 1BNZA 4RCNA 2L0CA 3Q81A 4LF8L 4R4SA 1E2VA 4K5VA 4N1XA 2EJFC 4DXBA 1XFNA 2UUAL 4QJGA 3MJQA 1S67L 1L0DA 5EOEA 2P9VB 4X1MA 4LF5Q 5LMUL 3D31A 1EY0A 1TWGB 4GOPC 3I7JA 4LFUA 2IHEA 1JOKA 3BVMA 4FP5D 4G4KA 3H91A 1U9RA 3U58A 2X6LA 3GTPH 3VR4A 2B2TA 3Q7VA 2ZTCA 5A92A 2R3ZA 2AVXA 3K58A 2NUPC 5K5BA 1XYIA 3ISGA 4LCMA 3IKJA 2H28A 2Y59A 4CKBA 1XNRL 2N55A 3VYSA 2D9UA 4ALPA 1GXDC 3UE0A 5LHY1 3P98A 4QD4A 4F3LA 1KQSA 4OOYA 4L5TA 5CORA 2WP8J 5I5LA 5IE8A 1FR3A 2Z6BA 3F1PB 3NBHB 3CQZH 1QVFA 3IS2B 2L12A 2HDSA 1DJRD 3M4YA 1S66L 4GNXB 3C3LA 1PZOA 4LV1A 1SDEA 1PFBA 2WK0A 1SNDA 2MO1A 3X3MA 3IX3A 5FDHA 1EWHA 3MC0B 4JOIA 3BDOA 4YWKA 4BBSB 3MKFA 2ZT9C 2E2JH 3HOWB 1GCEA 1JWUD 5DTTA 3F2DA 1OXTA 4DXGA 2IW3A 1FL0A 1ERQA 4R6LA 4DV6L 3ERSX 3MXNA 1LL9A 3EQUA 3ZG8B 4LAAA 2JA8H 1YHQA 2Y55A 5EV0A 2PU2A 1MWUA 2NVTB 3NCKA 3OPHA 4CJ2C 5J39A 1IKGA 4OELB 1K57A 3GTPB 3I4OA 2JA6H 1XGIA 5C4XB 1BVSA 1EY8A 3DW0A 2HF6A 3QB3A 4RFBA 1CFMA 3T16A 4HJ7A 4Y7PA 3IH8A 2XWBB 3UY6A 4C3HB 1EROA 4JI0L 3CCUA 1MI2A 5EECA 1I4PA 5M1AA 2KCCA 2QCPX 4BWGB 1RTNA 2EFXA 5M18A 3G48A 3C46A 4LRYC 1YMXA 4OH0A 4RX2A 3KYZA 2GX5A 2VGJA 3PBOA 3IX4A 3LICA 2UUBL 4ZRZA 3HVFA 1RDPD 3I72A 2HDUA 4DF6A 4WRDA 5M3MG 4YCVA 4QB8A 4E3OA 1YLPA 4EESA 4PM5A 1DRMA 1EIHA 1BO0A 1BLHA 4PM9A 1N9BA 2OSUA 4Y15A 1W8YA 4UQIS 3EIVA 5AQ9A 3SW1A 2EYFA 1I4QA 2XWJB 1G51A 4BMWA 2F0OA 3E0EA 4A4IA 1PTOF 2I07B 2Q8TA 5FLMH 2F4VQ 4KZ6A 1S5DD 5K5PA 3F2BA 3FV7A 2JJQA 3E9IA 4OQGA 2GZAA 1JJ2A 3MZEA 1H5XA 1J9MA 3DM3A 2YKHA 4JI5Q 4I5SA 4QUCA 3A55A 1WJJA 2CMNA 1JWPA 2YV5A 3ZG9B 3HP3A 1GUTA 2ZM0A 1WD0A 3IF6C 1N34Q 1YLZA 1LT5D 1X65A 1SMYD 4A3IH 3GTMH 1G6OA 4ZDXA 4EBLA 3I4LA 4LRZE 4GLVB 3OYYA 2UUCQ 2HIXA 5LL6S 1TDGA 1QCBD 3MQ0A 3T12B 3TJZC 4X6TA 3OHXC 3FMCA 5C6AA 2WB1E 3BY9A 2AHOB 2QDLA 4PHTA 3H9WA 1X3FA 1HCZA 2BE5C 2M2LA 4FNFA 2WADA 4ZJ1A 2IY5B 1RTOA 3U4LP 1A3TA 2XN9C 1E3UA 1E3PA 1DJAA 1SKOA 5C44G 2F4VL 3M6HA 3T4OA 3GP7A 1Z47A 2ICIA 3RXXA 5E2GA 1WCMB 1LV9A 2WACA 4ULLA 1AZPA 1OMEA 1C48A 1PYSB 2O5IC 1ILPA 2ZTDA 1Y1VH 1BT5A 1SN8A 2ZMVA 3NOTC 1ZC2A 5LMNW 4G3WA 4OQ0A 4Q0IA 1M40A 4XYOA 3ULFA 3RH8B 2EYHA 5DKLA 2ES2A 4RKLA 2RHSB 2BA1A 1BBXC 5F1GA 3I4MH 2K52A 1L0FA 3ICYA 3WRTA 1IL2A 2B2VA 3PBTA 1VQ8A 3VP2A 3S1MB 4HP4A 1HPCA 2Z6CA 4DR6Q 2PR6A 2F3IA 3U4VA 2ZQ7A 1MKHA 1B44D 4N92A 5C44B 1OJGA 1BLPA 4LF6L 5E2FA 4JXWA 4OOLA 2XF3A 4LJZC 3BW6A 5AVFA 2DUDA 1BULA 1TDLA 1CA5A 3UE6A 3T1YL 1XMQQ 1OTDA 4ID6A 4KY6A 1WTPA 3KJOA 2GDNA 2LMCB 4NKLA 4Y2FA 4N9PA 5C4XH 4LV0A 4LWCA 2PQEA 4E6WA 3GECA 3KLSX 4YWMA 1IW7D 4KZ5A 2NVQB 1PZJD 4IFDI 4S2LA 2Q8RE 5ELFA 4GZYC 3KYQA 3T4QA 3HKZG 2V1BA 4EVOA 5JAVA 3RR5A 3QHYA 1FJGQ 2NVTH 1VF7A 1X32A 4O2DA 1EQTA 2VZWA 2DJFC 4JI8L 1OTCA 2QYBA 1B3AA 2B39A 4K6LA 3KLWA 3I4MB 4CJNA 4K0WA 1HZOA 1PMRA 2YYZA 5L8MA 1PYWD 4ZJ2A 2K01A 3LFVA 2CH4A 3E2KA 5C0XJ 2R7ZB 2HUGA 4S2JA 4GN2A 3NHHA 3G4PA 3UPOA 3CCLA 3HOVB 3O5YA 2VUMH 1VCIA 5FJ8G 1EEFD 4FTXA 2B2UC 1DGSA 4BY1G 4PM6A 3K6OA 1K56A 1MKIA 1CHQD 5HDSA 5JEAJ 4BXXH 4L5RC 3SHLA 5I4DA 5GHYA 4JF6A 4PZ8A 5FASA 1U4RA 4LF5L 4FXGC
chains in the Genus database with same CATH topology
4LUVA 4WM9A 4L5SA 3GV9A 3GSGA 1N8RC 3S2DH 3ZDJA 3CPWA 1EWIA 2EIFA 2V2FF 4DAYB 4DUZQ 3IXGA 3L2PA 4GN4B 1NMGA 1XMOQ 3MFDA 1YI2A 4E6XA 3H0GG 4KQOA 3G31A 2K14A 3NI9A 5IT9c 1L2SA 1YLJA 1PYBA 4EV4A 3VP4A 5DF9A 1HTZA 3C7VA 1IYQA 4BD1A 3TEHB 2XGTA 4JI6Q 4WJ3M 4JV5Q 1EI5A 1E4DA 5DF7A 4QHCA 2VQFQ 3MZDA 1E1OA 1HNWL 1K25A 3MEFA 3IF5A 3Q82A 4GN5A 1XX2A 4C75A 5C44H 4QY6A 1KVMA 4WYYA 1ES4A 1ES3A 1XMOL 5F82A 4OOMA 1CKMA 4DKAC 1XA7A 4QY7A 1FGUA 4IFDG 1SDNA 3S1MH 5JJIA 2QEXA 1KE4A 2PI2A 2DNSA 1I5FA 3PO2G 2PI2E 5CECA 5CHJA 3TREA 1O7IA 3TOIA 3HLEA 5HARA 3HOYG 4B3SL 3NIAA 3ZVTA 4LUZA 2PQAA 1KXLA 5FQJA 3UN7A 1QVGA 4IVIA 3BFGA 3G32A 5DF8A 3UNWA 4FH2A 3UDIA 3B3XA 3ITAA 2ZM6L 4JBWA 4RA7A 2EQSA 3S17H 5CTMA 4JI4Q 2ZM2A 5FAQA 3GTJH 3TRZA 1UWVA 3VP1A 1FSWA 1ZG6A 2E8GA 4YHHL 4DV0Q 1S3OA 1Y54A 1AE3A 2WKIA 1QUQB 4A3GH 5TGFA 1UE1A 1VQHA 3NBLA 1IZ6A 4N9KA 4LF7L 4WZ5C 1M6KA 2ZC3B 2NZHA 1YQSA 4MTNA 3OZHA 1YZ6A 4L0LA 1L2FA 2OTLA 1Q8KA 3GR2A 2EX2A 3I4NG 4JKTA 1BBWA 2ZC6B 4M3KA 4KZ7A 1M1KC 3VP0A 4JOIC 1K9MC 2PQAB 1RL2A 2IX1A 4X53A 2WAQE 5J3BA 3HUNA 1JMCA 1NRFA 3VDYA 4DNIA 4X64L 1U5KA 4UA7A 3PUXA 3S16H 4XTCS 2HHHQ 3RNUA 1GD7A 1K57C 1RGYA 3BU2A 2Y2GA 3K81C 1FVIA 3GTQH 1S6RA 3HLFA 5C0XG 1WFQA 2JA7G 4APVA 1HR0W 2EFUA 3PO3H 2EX8A 1XXMA 4IBRA 2XD1A 4DV0L 4DDYA 3PGZA 4P6BA 4E3IA 4PM7A 1PWDA 1EIFA 4H02A 1TXYA 1KHIA 1Q2PA 4MBFA 2ZQDA 1N9WA 3PBNA 3H3VH 4Y0UA 1I2SA 2VZAA 4NXMQ 1K83H 1XKZA 4KG2A 2ZD8A 1PWCA 4OLGA 3IF6A 4Y0OA 3M6BA 5EOOA 1GHIA 3L0OA 4A3BG 1SROA 4YY3L 1TVFA 1IBLQ 3BLSA 4DV1Q 4JPMA 3T1YQ 1XMQL 4X55A 4YCUA 4KG6A 3QNBA