1TS0A

Structure of the pb1 intermediate from time-resolved laue crystallography
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Visualizing reaction pathways in photoactive yellow protein from nanoseconds to seconds.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ts0A00
3VE4A 3UB9A 3LICA 3RH8B 3IS2A 4GS9A 1UWPX 2V0UA 4F3LB 2VV6A 4PKYG 5F68A 1LL8A 1D06A 2V0WA 4HNBA 3ULFA 4RQ9A 5EFWA 2ZBBA 2R78A 3C2WA 3UMDA 5IU1A 4GW9A 1P0ZA 3LI9A 4WN5A 2D02A 4I3AA 1VB6A 3CLOA 1T19A 3K3CA 3BY9A 3G6OA 2WKRA 3NOPC 2A24A 3H82B 5DJUA 3EEHA 3MFXA 3F1NA 3UE6A 2BASA 4R6LA 2H28A 4R38A 2KX6A 3E4PA 4EEUA 1ODVA 3T50A 4DJ3A 1S4RA 2P7JA 2W27A 1S67L 3K3DA 4NXFA 2PD8A 2V1AA 2QWSA 4I38A 3EWKA 4HI4A 4EXOA 3F1OA 5I5LA 4GHIB 4HJ4A 2QJ5A 4KUOA 1T18A 5DKLA 4LLOB 3C8CA 2VV8A 3A0SA 4HH2A 1UGUA 2L1MA 4I39A 3A0RA 3ZQ5A 4HY8A 3E4OA 5HD5A 1XJ3A 2ZOIA 1GSXA 2WKPA 4NXBA 2JN7A 3NHQA 2M1CA 2Z6CA 1XFNA 1N9NA 1LT0A 5TBMA 4HHDA 1V9ZA 1DP9A 3UB7A 5HWWA 4JGQA 2L0WA 1EW0A 3HJKA 1GSWA 3LYXA 1F9IA 2I9VA 5AVFA 1XJ2A 1XFQA 3VOLA 4HOIA 3F1PA 4XT2B 3NOTC 2PD7A 2VLGA 4HP9A 4M4XA 4WLAA 5HDCA 5HWTA 2OWJA 4NXGA 1OTIA 4WL9A 1XJ6A 4I5SA 1DRMA 3BWLA 4F3LA 3CAXA 2HV1A 2QKPA 2OOLA 1JNUA 2YKHA 3E4QA 3LIDA 4BBUA 4WF0A 1LSXA 1F98A 1KOUA 1S1YA 1D7EA 3NOUC 4R3AA 1P97A 3MQQA 4EESA 3F1NB 4B9OA 4KUKA 3HJIA 1UWNX 3H7WB 3B33A 3KX0X 4HH3A 2QJ7A 2V1BA 3H82A 4MN5A 1T1AA 1DP6A 1LSVA 4LRZE 1Y28A 4LRYC 3IBRA 3UMEA 4EERA 1OJGA 1V9YA 2B02A 4R70A 4EEPA 2PYPA 4JGPA 3CWFA 3LIAA 4JGRA 4EW7A 4PKYA 3OLOA 4GHIA 3MR0A 2WKQA 4HP4A 4E04A 1OTBA 2VEAA 3LIFA 4WUJA 3ICYA 4K08A 4HJ3A 3PYPA 3UB8A 4H6JB 4KQDA 2YKFA 3VE3A 4EQ1A 3FG8A 3LIBA 5HWVA 1T1CA 3LUQA 2INWA 1TS6A 4I3IA 5HSQA 4YWZA 5AVEA 5G4ZA 3P7NA 5HDSA 3PHYA 3MJQA 3IS2B 4L9FA 4GS9B 3FC7A 1OT6A 3RTYA 5F69A 4EETB 5F5YA 1OT9A 5HDDA 2D01A 1TS8A 3D72A 4HIAA 2PR6A 2PHYA 3A0VA 5F6AA 3BY8A 3LIEA 3SW1A 4XT2A 2K7SA 3GDIA 4LRXC 5HD3A 2OWHA 1XJ4A 2CMNA 2A24B 2VV7A 2J80A 4L9GA 4LPZA 4GCZA 2KDKA 4JGOA 3MQOA 5J4EA 1N9OA 3NJAA 3F1OB 1T1BA 3H7WA 2PDRA 4BBTA 2PR5A 2Z6DA 2W0NA 5DJTA 1NWZA 1WA9A 5J3WA 4DJ2A 5KIZA 1N9LA 3LI8A 4I3JA 1X0OA 5DKKA 1LSWA 4MN6A 1OJ5A 2GJ3A 5A8BA 1OTAA 5IS1A 1OTEA 1TS7A 4L9EA 4HJ6A 3H9WA 1DP8A 5TBMB 2JHEA 2ZOHA 3UB6A 3MXQA 1OTDA 5J7EA 4NXEA 2V9AA 1BYWA 2QHKA 2PYRA 5G4YA 1MZUA 4H6JA 1S1ZA 3GECA 4BBVA 5HZHA 2EA9A 4HQAA 1G28A 3F1PB 1S66L 2L4RA 1GSVA 1S4SA 1TS0A
chains in the Genus database with same CATH superfamily
1U60A 1K55C 5GLDA 3LICA 3RH8B 4JXWA 3IS2A 2V0UA 3BQ8A 5L10A 1E4DA 2P04A 4JBFA 3UNWA 1SZVA 1LL8A 4Y13A 4R1GA 4ZTKA 4HNBA 4QHCA 4BL2A 3PBSA 4GKUA 3BFFA 1HLUP 2J3TC 3UMDA 1A0KA 2K2NA 1YLPA 4GDBA 4OP5A 2D02A 4N9LA 4UA7A 4I3AA 2O0YA 3K3CA 3BFEA 3WS1A 4UQIM 3G6OA 2WKRA 5CERA 3S1YA 1K6SA 3C7VA 3TJZC 2OAQ1 5HL1A 3OC2A 2BASA 3E98A 4BD1A 3IX3A 2XD1A 1TEMA 4E3LA 4R38A 5HPFA 4QB8A 1PI5A 3L7HA 1S67L 3QNBA 1K56D 2H10A 1XA7A 2PD8A 3SH9A 4KZ3A 4I38A 1HTZA 1GHMA 4HI4A 4P85A 5KMWA 1IYQA 3NC8A 5E2EA 4WEKA 3PBNA 3N8LA 5HPIA 2EWWA 3Q7ZA 4KZ8A 3WS2A 1UGUA 3IH8A 5E43A 2J9PA 3HLWA 3E4OA 4FOFA 3Q81A 3FZCA 2GZAA 1G6OA 1FOFA 3NHQA 3LR4A 2XQZA 3UDXA 2M1CA 3PR6A 1N9NA 4CLCD 1LT0A 2A3UA 5TBMA 4HHDA 1LI9A 1V9ZA 1CK3A 2WGWB 1PYYA 4JGQA 1CF0A 1NJ4A 3HREA 2XSSA 4X69A 3QNCA 5K5BA 5HL6A 1GSWA 4R4RA 4R4SA 4P6BA 1YSQA 1F9IA 4BWIA 4OQIA 3VOLA 5CHMA 4KZ4A 4IUHA 1KE0A 2LB5A 3KSFA 2PD7A 3O3VA 2JKRM 2VGLS 4IHQA 3A3DA 3GMWA 5HWTA 2OWJA 3NCKA 1YKDA 4KZAA 1CEGA 4LV0A 1K55A 1OTIA 4WL9A 5CGSA 4I5SA 1O07A 4UA6A 1DRMA 3UPNA 3BWLA 1ONGA 2HV1A 2QKPA 3NDGA 1JNUA 3E4QA 3FKWA 3LIDA 3U2AA 4K0WA 1LSXA 1F98A 1YAXA 2G2UA 1BLSA 1W5DA 3SH7A 1YLTA 5CRFA 2GDNA 1FR1A 3BFDA 3CHWP 3W8KA 3MMHA 4KG2A 3GSGA 3S22A 4B9OA 3RJUA 3G34A 2JKTM 4HH3A 1XGIA 2V1BA 3A3FA 1LL9A 4B4ZA 4LRZE 3MS6A 1K4FA 4LRYC 4KQQA 3IBRA 4MEZA 2HP5A 4WEJA 5FSRA 3M2JA 3ZVTA 4NK3A 3C30A 2E8IA 4RX3A 4Y5FA 5FI6A 2O99A 1ACFA 5A93A 4EUZA 3W2ZA 3LIAA 4PKYA 1W8QA 3T4TA 4FTXA 3MR0A 5EVIC 5EVIB 3KO6A 5TJJA 4Y0UA 3O5YA 3QP1A 2B5RA 4WUJA 3ICYA 3HUOA 4CPKA 4IBRA 4U0XA 2XDMA 1FSWA 3MXSA 5DF9A 2WKIA 2INWA 1TS6A 4I3IA 4JKTA 5GHXA 1RGZA 4RVAA 1MPLA 1JWPA 2J8YA 5G4ZA 2WGWA 4UEYA 4DDYA 4G3WA 5HDSA 3LGOA 1ZHHB 3VP2A 3RTYA 1PI4A 4EETB 1GHPA 2B18A 5FQJA 3SH8A 1OT9A 2V8FA 2V1ZA 3IF5A 1TS8A 3V39A 2FZ0A 2Y2MA 4GOGA 4WZ5A 3BY8A 1CI8A 3ISGA 3SW1A 3ITAA 1NLZA 2J3TD 3G2YA 5CHUA 4LRXC 4D2OA 4S2LA 3RFBA 5FAOA 2OWHA 1XJ4A 3ZG9B 3PAEA 3EEAA 1ES2A 2H0TA 2HJ9C 2VK3A 3HCYA 4OVDA 3HLDA 3OZHA 3MQOA 3QP2A 5F1GA 3E2LA 1EROA 2LB9A 4K0XA 3R4KA 3DBAA 3F1OB 3CPTB 1L0FA 2R9XA 5FQIA 2W0NA 5FDHA 3IXDA 1WA9A 5D3OA 4DJ2A 3GVBA 1FILA 4OPRA 1K4EA 1N9LA 4BJPA 4RA7A 5DF8A 3S7QA 3GTCA 3KYQA 4EV4A 3ITBA 1I5QA 2ZM8A 2J7VA 4WBGA 3LEQA 1OTEA 2IWDA 4HJ6A 3B47A 4FH4A 2R9WA 1BLPA 1K57C 2Y8HA 5EVIA 1OTDA 4NXEA 1MWTA 1JTDA 1YLJA 3VV4A 4A5RA 4YINA 2G2WA 3V3RA 5M18A 4S2JA 1S1ZA 2OLVA 5FEGA 3TG9A 3D3OA 2FFFB 2JC7A 3ZCZA 4OP8A 4WELA 5AQ7A 5KZHA 5FAPA 1WYBA 3CG5A 3WRZA 3Q7VA 3UB9A 2WZXA 5JYPA 3UPOA 3T1QB 4PKYG 3EGXC 5FI2A 2Y4AA 2OLUA 3CZDA 4OPYA 2O9BA 3PBOA 4PPRA 3LCEA 2Y2JA 1SDNA 3MBZA 5TFQA 5GHZA 3T1XA 2MJ6A 2EX9A 5A92A 2H5SA 3A3EA 5IU1A 4GW9A 3LI9A 1ERQA 3SOIA 3KYZA 5FI7A 2ZM2A 3WWXA 1NXYA 3Q07A 1H8MA 3WS0A 1PWDA 2ZMVA 2H28A 1FSYA 3T4SA 1ES4A 3T50A 4DJ3A 4O7DA 3FPWA 3BW6A 4ZJ3A 4EXOA 2A49A 5HX9A 4NG2A 3F1OA 3CPTA 3GR2A 5I5LA 4DMZA 5EOOA 2O9AA 4F94A 2HP6A 2XR0A 2QJ5A 2VX8A 3O86A 4PM7A 1K6RA 3QP6A 1WYCA 1L2SA 1T18A 2BTFP 5EVID 3C38A 3C8CA 4Q0HA 4X68A 1YLZA 4HH2A 3SS4A 3MZEA 4WMCA 1TF1A 3A3JA 1L3LA 4N92A 3U4LP 3UE0A 4OOYA 4EQIA 1I2WA 2Y2KA 1QMEA 5CX7A 1IYPA 2X02A 3VP4A 1DJCA 2ZQDA 1E25A 1GSXA 1NY0A 5CGWA 2QZ6A 4P0MA 2Z6CA 1XFNA 1K57A 4KZ9A 2Y2IA 1DP9A 2P9VB 5GL9A 4S2OA 4DF6A 3JVUA 4OH0A 4E3IA 1PFLA 3OCNA 3LYXA 2W3DA 4IVKA 2ZQCA 4KZ6A 1DY6A 1XFQA 2JCHA 4PMAA 1VEUA 3B42A 4JF5A 4HOIA 2JE5A 1KDSA 4JXVA 2XGNA 3UB5P 1NZOA 3MSHA 3TOIA 3NOTC 2XRNA 5HDCA 2OV5A 4DE3A 4KZBA 3CAXA 3UE3A 1FCOA 2YKHA 2Y91A 3NULA 4BBUA 2XLNA 4WF0A 1RP5A 3V5MA 1OMEA 1KOUA 1YT4A 3NOUC 4GN2A 3GQZA 1P97A 2H0YA 1K54C 2EX2A 4EESA 2WGIA 2Y55A 3F1NB 5EVEA 1L0DA 4KUKA 4PM6A 1RCJA 4S2MA 2Y79A 3B33A 3C7UA 3G4PA 1H8YA 2QJ7A 2DRWA 3HBRA 1SKOB 3AGDA 2HZ5A 3IXBA 3MKFA 1HZOA 3UMEA 3HL9A 4JXGA 4M3KA 2PRFA 4WMCD 4R70A 3GRJA 4PM9A 1PZOA 4JXSA 3BEBA 4CQHA 2GNXA 4EEPA 4UHUA 2UWXA 4JGPA 2ZL1B 1ES3A 2DNSA 4JLFA 4BMWA 1IELA 4R23A 2WKQA 4NEED 1OTBA 4HESA 1O7EA 5IT5A 5F1FA 4K08A 1CI9A 3PYPA 4U0TA 4BL3A 4KQDA 3VE3A 4EQ1A 1RGYA 5HWVA 4OONA 1T1CA 4BENA 3LUQA 4RYEA 4ETXA 5GLCA 4C75A 4YWZA 3IHBA 1W63Q 2P9VA 2XA7M 1PW8A 4ETZA 4MBFA 5TGFA 1W63M 4E3NA 3MJQA 4L9FA 4GS9B 3FC7A 1OT6A 1QMFA 5F69A 3IXGA 5L2FA 5HDDA 1XPBA 1MWRA 4DE2A 5F6AA 3BLMA 3LIEA 4E3MA 2K7SA 2EXAA 1CQAA 3TSGA 4ESPA 5KSCA 3RXWA 5HD3A 1E3UA 2A24B 3OCLA 2ZC3B 2J80A 2HDQA 2Z2MB 4CJNA 4E3KA 2Y2NA 2XFTA 3QHYA 4L9GA 3UDFA 3BYDA 4LPZA 3HVFA 2KDKA 1SCWA 4BQMA 3W4OA 3HLBA 2W3FA 4D60A 1VETB 1T1BA 3JVVA 4DXBA 2V2FF 1KGGA 3OOVA 1TD5A 1MKIA 3LO7A 4Y0TA 5FQ9A 3ZGAB 5I94A 5CTNA 4X53A 3FPVA 2Q9MA 1Y4OA 1X0OA 5DKKA 5TR7A 3ZG7B 3WRTA 2HGVA 1GA9A 5A8BA 1OTAA 2ACGA 2ZL1A 4L9EA 3P01A 1W79A 2PAVP 3H9WA 4GLQA 3UB6A 3MXQA 2OAP1 4OQGA 5J7EA 4B88A 4OQ0A 3G2ZA 4LV1A 3LFVA 1MKMA 4DE0A 4YFMA 3V3SA 5L07A 2Y2GA 3BLSA 3M6BA 4QPRA 3M2KA 2IWCA 3AGFA 1NLYA 4HQAA 1KGFA 3F1PB 4IEDA 2L4RA 1GSVA 1TS0A 4K91A 2ZQ8A 3E0YA 3VE4A 4GS9A 5FDSA 1E3UD 2KLIA 3HLFA 3IXHA 4N9KA 3V50A 4FCFA 5F68A 2Q0OA 1D06A 4QY5A 2XD5A 4DRTA 1MWSA 3MZDA 4MNRA 5DFXA 5EFWA 4E6XA 2R78A 1ES5A 3A3IA 3IF6C 3IF6B 3MQ0A 5AJGA 4X25A 3G35A 4ZJ2A 1P0ZA 2Y2HA 3JPUA 2W3GA 1VB6A 2C6WB 3CLOA 3BY9A 1XP4A 2K31A 5M1AA 3NOPC 4LCMA 2A24A 3VOZA 3H82B 1YMSA 3EEHA 3I7JA 3TRCA 4PAUA 4DN0A 4R6LA 4JPMA 1SDEA 2VA0A 2KX6A 5GLAA 5AQBA 4EEUA 5EV0A 1N9BA 1ODVA 3T12B 1FQGA 3IX4A 2P7JA 4R0QA 4KQOA 3K3DA 1FCMA 4NXFA 5E2GA 2VJWA 1SHVA 2QWSA 1FCNA 4GHIB 4HJ4A 3BM6A 4KG5A 4KUOA 1NRJA 3BRMA 3ZNTA 4G3VA 4UA9A 4ID4A 2RL3A 4LLOB 3TW8A 2VV8A 3A0SA 4P87A 3S7OA 3CUEC 1WE4A 2ZQAA 3S7NA 3BFGA 5EECA 3ZQ5A 1TDLA 3CJMA 4HY8A 1KVMA 1N4OA 5HD5A 1XX2A 3HLCA 3HUMA 2ZJ9A 3EOIA 2EFXA 3K2NA 1YMXA 2JN7A 4O8GA 1KDWA 2EX6A 5FAQA 1G68A 4YNRA 3DW0A 4Z1WA 3VSLA 2P74A 5DTSA 3SS5A 1EW0A 5CGXA 3DTIA 4CLCC 3ZG8B 4CLCB 4YOFA 1BLCA 2I9VA 3ZG5A 5AVFA 2WZZA 2JKGA 5FQKA 3UDIA 4P6ZS 3WS5A 4FSFA 3NDEA 5L8MA 1P9WA 4ZRRA 3BFCA 4OKPA 5GLBA 3F1PA 4XT2B 2PU4A 4HP9A 4M4XA 1J9MA 2XEPA 1XJ6A 3GV9A 4OLDA 2Y2PA 5FQQA 5M19A 4H8RA 2Q9NA 2X71A 2WKEA 1S1YA 2B95A 1K0KA 1H8ZA 2Z2LB 1D7EA 3VSKA 5E2HA 4QWOA 1STZA 4UQIS 3P09A 4S2NC 5HAQA 3HJIA 1IKGA 3H7WB 3NIAA 4N1HA 4U3TA 3KX0X 3H82A 1DP6A 1ALQA 3OBFA 4Y15A 3NY4A 2WAEA 4KZ7A 4GZBA 4LV3A 1OJGA 4X1MA 2B02A 1FIKA 4CLCE 4S2IA 2J3WA 4DE1A 2Y2QA 3Q82A 2PYPA 4S2PA 4ME4A 2Y2OA 1VQQA 2Y2LA 3OLOA 4GHIA 5FL3A 3N4IA 5BOHA 3FYZA 3VFFA 4HP4A 4XUZA 1GCEA 2OSUA 1HVBA 1F2KA 4KZ5A 1LI0A 3LIFA 3S4XA 3CUEA 2KOIA 3PBQA 2W3HA 4JF6A 3QP8A 4H6JB 5E2FA 1Z09A 2YKFA 3FG8A 4ZDXA 3LIBA 3LR5A 3T4LA 3CMZA 5EOEA 1S4SA 1ONHA 4G3KA 5FASA 3UO9A 1NRFA 2P08A 2VGJA 5HSQA 4LENA 3DTEA 5AVEA 2V20A 2XK1A 3P7NA 4IBXA 3PHYA 1MC0A 3BECA 3LY3A 3G32A 1M40A 2M7VA 1KE3A 4OOLA 1ZKJA 2W3EA 3NI9A 3T4KA 3ZFZA 2G7UA 2HF6A 3D72A 4L0LA 2PR6A 1CJFA 1BUEA 4PM8A 3KSGA 3CI6A 5CEDA 2ZM0A 4XT2A 2EFUA 4MDZA 3GDIA 3PBTA 5CEBA 4Y0OA 1S0WA 4EBLA 2IWBA 1JTGA 2ZLYA 1YQSA 1XKZA 4EU0A 5J8XA 3OPHA 3IQAA 2WK0A 4MBKA 3OPLA 1MY8A 2V8CA 4EWFA 4X6TA 3MFDA 5F83A 4GCZA 1G6AA 3HLEA 3SS3A 3O88A 1Q2QA 3FWLA 5EVLA 4KQRA 1BULA 2ZC4B 3T4OA 1ESUA 4S2NA 3VP1A 1BZAA 3H7WA 2Y59A 4FD8A 1L0EA 2PDRA 4Y7PA 2PR5A 2ZD8A 3C4PA 5DJTA 5HAIA 4HBUA 2X01A 5HARA 3NECA 1W8YA 1I2SA 5J3WA 3C4OA 3UE1A 5KIZA 1EI5A 3LI8A 1J3WA 2IA2A 1JWVA 1IYSA 1LSWA 2ZMFA 4MLLA 3MF0A 5CECA 3V67A 5IS1A 1TS7A 1ZG4A 5CXWA 3P98A 1P9RA 1DP8A 2JHEA 4HEFA 3UY6A 5DVAA 4LCLA 2V9AA 5MC7A 4DXCA 2PYRA 1IOUA 4Y2FA 1MZUA 4GNUA 4H6JA 4Z9QA 2XFSA 4GDNA 3GECA 3BJNA 1PWCA 2EA9A 5EPHA 4Y17A 4AFIA 1W7FA 1G28A 1XGJA 3IH9A 2AVXA 3R7WB 5DF7A 3IBJA 4KENB 1YLWA 5HAPA 4QD4A 2HDUA 3T1RA 1UWPX 4C6YA 3ZVWA 4X55A 2EWVA 4F3LB 2VV6A 4WZ5C 1H5XA 2ZQ9A 3ZYTA 2V0WA 3ULFA 1AXBA 4OPZA 5LBRA 4RQ9A 1FR6A 1Y54A 2ZBBA 3C2WA 3B3XA 1H3QA 1NYMA 1LHYA 1K38A 2BG1A 2WADA 4N1XA 4Y3IA 1ESIA 4PHTA 2QYBA 4WN5A 5KSHA 1T19A 3DAVA 2DMWA 1D1JA 4LV2A 3EQVA 3ZNYA 4MMNA 3N7WA 1TDGA 1K54A 5DJUA 3MFXA 2NUTC 4IJGA 3F1NA 3UE6A 4B93A 3FV7A 3IWOA 3E4PA 2PT7A 3MKEA 2UV0E 1G5UA 1CEFA 2O9CA 1S4RA 2W27A 2J9OA 1M6KA 3T1SA 1SKOA 3M6HA 1MBLA 1Q2PA 2V1AA 2I72A 5FEFA 1XXMA 3EWKA 4Q8IA 3HLGA 3DWZA 3DTMA 1S6RA 1YLYA 4PM5A 3D4FA 5F82A 5DKLA 2W1TB 3N8RA 3VP3A 4ZAMA 2QPNA 4GB7A 3QP5A 1LL5A 1PWGA 2L1MA 1NYYA 4I39A 3IWIA 4QY6A 3A0RA 1HD8A 1ZC2A 1XJ3A 2ZOIA 3C5AA 4E6WA 3VOYA 2WKPA 4NXBA 3T4QA 3VFHA 2HP9A 1MWUA 2XH9A 4FUWA 3UB7A 5HWWA 4E3JA 2A2LA 5FATA 4UAAA 5GHYA 3NBLA 2L0WA 1AWIA 3HJKA 3WS4A 5HFOA 1K25A 1XJ2A 1VHMA 4B4XA 3E2KA 3Q7VB 2VGLM 3LR3A 1DJAA 3VMAA 5EUAA 1JVJA 2VLGA 3UPPA 4QU3A 3R7WA 4WLAA 1YSPA 4NXGA 2EXBA 2VZWA 4MBHA 2ZC7A 2JBFA 4LGWA 3PTEA 2VKSA 2ZMAA 3KSHA 4Q0JA 4E3OA 4F3LA 3LEZA 4XUXA 4OOMA 2OOLA 4IVIA 3UN7A 2ZQ7A 3CITA 3SZTA 1BLHA 2JKRI 4WM9A 1KVLA 3O87A 4GD8A 2E8JA 4NKPA 5AQAA 4R3AA 3MQQA 1GHIA 5EM0A 1Z6FA 1IFQA 1UWNX 3W4QA 2M7UA 5C5KA 2WYXA 4MN5A 1T1AA 2W1RA 1LSVA 2HJEA 4BD0A 5A90A 1Y28A 3FKVA 1VETA 4EBNA 5JYOA 1XA1A 4R3JA 1IEMA 1V9YA 5CTMA 5G18A 4EERA 4WZ4A 2JKTI 4ARZB 4GD6A 3CWFA 5DTTA 4JGRA 2FH5A 4EW7A 4R3BA 5L09A 3TE8A 1YM1A 2EX8A 3ZDJA 4E04A 2W1TA 4OLGA 2VEAA 4IUKA 5IHVA 3S7PA 5A91A 5CHJA 3N8SA 3ZHHA 3OPRA 2BLSA 5DFYA 4HJ3A 1GA0A 3UB8A 4DDSA 2ZC5B 1TVFA 2WKHA 4XXRA 2WGVA 1JWZA 4EBPA 4ZJ1A 1IYOA 4JF4A 3VP0A 3RXXA 1PIOA 3PXPA 3D9YA 3Q1FA 4II7A 1DJBA 1VM1A 1C3BA 1IKIA 5HW3A 1VEUB 3IS2B 1BSGA 1H0MA 1EWZA 5F5YA 2HDRA 2D01A 2VGKA 4HIAA 4S2KA 1PW1A 1PNEA 2PHYA 3A0VA 2PBYA 3PBRA 2HPBA 2WAFA 2PU2A 2NUPC 4OPQA 3IX8A 2FFYA 1SKFA 5FQMA 4QJGA 4NETA 4HBTA 2ZC6B 3IF6A 4RX2A 2CMNA 4X1LA 3QP4A 4FH2A 2VV7A 1YPRA 2JKFA 3PAGA 4BLMA 3G31A 2RCXA 3EQUA 4EUVA 1NZUA 4JGOA 5FA7A 4MCWA 2PBDP 4O0PA 5J4EA 1N9OA 3DTKA 1BT5A 1F5MA 5EE8A 3NJAA 5U47A 2QMIA 3MXRA 4BBTA 3T4JA 2Z6DA 1NWZA 3IHAA 4OQHA 2HDSA 4DKIA 2GX5A 4ZBEA 3MZFA 5AQ9A 3L9KA 3KYEA 1ZG6A 1BTLA 4I3JA 1PRQA 3G30A 1K56A 3EGDC 4ARZA 2XROA 4MN6A 5DTKA 1OJ5A 2GJ3A 1KGEA 2CC1A 4MN7A 5EM1A 3ZG0A 3KSIA 3W4PA 1LLBA 1PZPA 4Q0IA 1L0GA 5TBMB 3DWKA 1OPXA 4KG6A 4O01A 2ZOHA 4X56A 3JYIA 4C3QA 4GJ4A 3N6IA 1BYWA 2QHKA 4WYYA 5G4YA 2C5WB 3LY4A 1ERMA 2WUQA 3IT9A 3IWQA 4BBVA 5HZHA 1ZTUA 3AGEA 3BQAA 2XA7S 4LFUA 4CLCA 3LR0A 1KE4A 4P6ZM 1S66L 2DCFA 3HUNA 3OPPA 1MXOA 2XF3A
chains in the Genus database with same CATH topology
3E0YA 3IBJA 3VE4A 3UB9A 3LICA 3RH8B 3IS2A 4GS9A 1UWPX 2V0UA 3BQ8A 2EWVA 4F3LB 2VV6A 2P04A 3EGXC 2KLIA 4PKYG 5F68A 1LL8A 1D06A 3ZYTA 2O9BA 2V0WA 3PBOA 4HNBA 3ULFA 5LBRA 4RQ9A 5DFXA 5EFWA 3PBSA 2ZBBA 2R78A 3C2WA 1H3QA 2MJ6A 2J3TC 3MQ0A 4Y3IA 3UMDA 2K2NA 5AJGA 4PHTA 2QYBA 4GW9A 5IU1A 1P0ZA 3LI9A 4WN5A 2D02A 5KSHA 2W3GA 3KYZA 1VB6A 4I3AA 3CLOA 1T19A 2O0YA 3K3CA 2DMWA 3BY9A 3EQVA 2K31A 4MMNA 3G6OA 4UQIM 2WKRA 3NOPC 2A24A 3H82B 3TJZC 5DJUA 2OAQ1 3EEHA 3MFXA 1H8MA 2NUTC 3TRCA 4IJGA 3OC2A 3F1NA 3UE6A 2BASA 4PAUA 3E98A 4DN0A 4R6LA 2ZMVA 2H28A 2VA0A 4R38A 3T4SA 5HPFA 4B93A 2KX6A 3E4PA 4EEUA 2PT7A 1ODVA 3T50A 4DJ3A 2O9CA 1S4RA 2P7JA 2W27A 3FPWA 4KQOA 1S67L 3K3DA 4NXFA 2PD8A 2VJWA 2V1AA 3BW6A 2QWSA 4I38A 3EWKA 4HI4A 4EXOA 3F1OA 5I5LA 4GHIB 4DMZA 4HJ4A 2O9AA 4WEKA 2QJ5A 2VX8A 4KUOA 1NRJA 1T18A 3PBNA 4G3VA 5DKLA 2W1TB 4LLOB 3C38A 3C8CA 5HPIA 2EWWA 4Q0HA 2VV8A 3TW8A 3A0SA 4HH2A 1UGUA 2L1MA 3S7OA 3CUEC 4I39A 1TF1A 3S7NA 3A0RA 3ZQ5A 4HY8A 3E4OA 5HD5A 1XJ3A 5CX7A 4FOFA 2ZOIA 3EOIA 1GSXA 3K2NA 2GZAA 1G6OA 2WKPA 4NXBA 2JN7A 3NHQA 3LR4A 4O8GA 3T4QA 2M1CA 3PR6A 2Z6CA 1XFNA 1N9NA 4CLCD 1LT0A 5TBMA 4HHDA 1V9ZA 1DP9A 4YNRA 3UB7A 5HWWA 4JGQA 2A2LA 4Z1WA 3JVUA 2L0WA 2XSSA 1EW0A 3HJKA 5K5BA 3OCNA 5HL6A 1GSWA 3LYXA 4CLCC 4CLCB 4YOFA 2W3DA 1YSQA 1F9IA 2I9VA 4BWIA 5AVFA 1XJ2A 1VHMA 4P6ZS 1XFQA 3VOLA 3B42A 4FSFA 4HOIA 2VGLM 3LR3A 5L8MA 1P9WA 4ZRRA 4IUHA 2LB5A 3F1PA 4XT2B 3NOTC 3KSFA 2PD7A 2VLGA 2JKRM 2VGLS 4HP9A 4IHQA 3R7WA 4M4XA 4WLAA 2XRNA 5HDCA 1YSPA 5HWTA 2OWJA 4NXGA 1YKDA 2VZWA 1OTIA 2VKSA 4WL9A 1XJ6A 4I5SA 1DRMA 3BWLA 3KSHA 4Q0JA 4F3LA 3CAXA 2HV1A 2QKPA 4OOMA 3UE3A 2OOLA 1JNUA 2YKHA 3E4QA 3LIDA 3U2AA 3CITA 4BBUA 4WF0A 2JKRI 1LSXA 1F98A 1YAXA 1KOUA 1S1YA 4NKPA 1D7EA 3NOUC 4R3AA 1P97A 3MQQA 4UQIS 1STZA 4EESA 3MMHA 3F1NB 4B9OA 4KUKA 3HJIA 1IFQA 1UWNX 2M7UA 3H7WB 5C5KA 2JKTM 2Y79A 3B33A 3KX0X 4HH3A 2QJ7A 2V1BA 3H82A 4MN5A 1T1AA 1DP6A 2W1RA 1LSVA 2HJEA 4LRZE 1Y28A 4LRYC 3IBRA 3UMEA 3OBFA 4WEJA 4EERA 1OJGA 1V9YA 2B02A 4R70A 4CLCE 2JKTI 3C30A 2J3WA 4Y5FA 4ARZB 2O99A 4CQHA 2GNXA 4EEPA 2PYPA 4JGPA 3CWFA 4ME4A 3W2ZA 3LIAA 2FH5A 4JGRA 4EW7A 4PKYA 3OLOA 4GHIA 5FL3A 3TE8A 4BMWA 3T4TA 3MR0A 2WKQA 4HP4A 4NEED 4E04A 1OTBA 2W1TA 5TJJA 3KO6A 2VEAA 4IUKA 3O5YA 3S7PA 5IT5A 3LIFA 4WUJA 3ICYA 4K08A 5DFYA 3CUEA 4HJ3A 3PYPA 2KOIA 3PBQA 2W3HA 3UB8A 4H6JB 4KQDA 2YKFA 3VE3A 4EQ1A 3FG8A 3LIBA 5HWVA 3LR5A 1T1CA 3T4LA 5DF9A 3LUQA 4ETXA 2INWA 1TS6A 4I3IA 4G3KA 2P08A 5HSQA 4YWZA 5AVEA 5G4ZA 4UEYA 3P7NA 1W63Q 3PXPA 2XA7M 4II7A 4G3WA 5HDSA 4ETZA 3PHYA 1ZHHB 1W63M 1MC0A 3MJQA 3IS2B 4L9FA 4GS9B 3FC7A 1OT6A 2M7VA 3RTYA 4OOLA 2W3EA 5F69A 3T4KA 4EETB 2G7UA 2B18A 5F5YA 2HF6A 1OT9A 5HDDA 2D01A 1TS8A 3D72A 4HIAA 4L0LA 2PR6A 3KSGA 2FZ0A 2PHYA 3A0VA 5F6AA 3CI6A 3BY8A 3LIEA 3SW1A 3PBRA 4XT2A 1NLZA 2J3TD 2NUPC 2K7SA 4MDZA 3GDIA 3PBTA 4LRXC 5HD3A 3RFBA 2OWHA 1XJ4A 4EU0A 2CMNA 2A24B 2VV7A 3EEAA 3OCLA 2HJ9C 2J80A 3HCYA 4L9GA 4LPZA 3EQUA 4EUVA 4GCZA 2KDKA 4JGOA 4MCWA 3MQOA 4O0PA 3T4OA 2W3FA 2LB9A 5J4EA 1N9OA 3R4KA 1F5MA 3NJAA 3DBAA 3F1OB 1T1BA 3H7WA 3JVVA 2PDRA 3OOVA 4BBTA 2PR5A 1TD5A 3T4JA 2Z6DA 2W0NA 5DJTA 1NWZA 1WA9A 5J3WA 2GX5A 3FPVA 4DJ2A 5KIZA 1N9LA 3LI8A 4BJPA 2IA2A 3S7QA 4I3JA 1X0OA 5DKKA 3EGDC 3KYQA 1LSWA 4ARZA 2XROA 4MN6A 1OJ5A 2HGVA 2GJ3A 2ZMFA 3MF0A 5A8BA 1OTAA 4MN7A 3V67A 1OTEA 5IS1A 1TS7A 4L9EA 3P01A 4HJ6A 3KSIA 3B47A 3H9WA 4Q0IA 4GLQA 2Y8HA 1P9RA 1DP8A 5TBMB 1OPXA 4O01A 2JHEA 2ZOHA 3UB6A 3MXQA 1OTDA 2OAP1 5J7EA 4GJ4A 4NXEA 2V9AA 1BYWA 5MC7A 2QHKA 2PYRA 3VV4A 1IOUA 3LFVA 4Y2FA 5G4YA 1MZUA 1MKMA 4H6JA 1S1ZA 3GECA 3BJNA 4QPRA 4BBVA 5HZHA 1ZTUA 2EA9A 1NLYA 3BQAA 3D3OA 2XA7S 4HQAA 4AFIA 1G28A 4CLCA 3LR0A 3F1PB 4P6ZM 4WELA 1S66L 2L4RA 1GSVA 3R7WB 1S4SA 1TS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VE4 A;  3UB9 A;  3LIC A;  3RH8 B;  3IS2 A;  4GS9 A;  1UWP X;  2V0U A;  4F3L B;  2VV6 A;  4PKY G;  5F68 A;  1LL8 A;  1D06 A;  2V0W A;  4HNB A;  3ULF A;  4RQ9 A;  5EFW A;  2ZBB A;  2R78 A;  3C2W A;  3UMD A;  5IU1 A;  4GW9 A;  1P0Z A;  3LI9 A;  4WN5 A;  2D02 A;  4I3A A;  1VB6 A;  3CLO A;  1T19 A;  3K3C A;  3BY9 A;  3G6O A;  2WKR A;  3NOP C;  2A24 A;  3H82 B;  5DJU A;  3EEH A;  3MFX A;  3F1N A;  3UE6 A;  2BAS A;  4R6L A;  2H28 A;  4R38 A;  2KX6 A;  3E4P A;  4EEU A;  1ODV A;  3T50 A;  4DJ3 A;  1S4R A;  2P7J A;  2W27 A;  1S67 L;  3K3D A;  4NXF A;  2PD8 A;  2V1A A;  2QWS A;  4I38 A;  3EWK A;  4HI4 A;  4EXO A;  3F1O A;  5I5L A;  4GHI B;  4HJ4 A;  2QJ5 A;  4KUO A;  1T18 A;  5DKL A;  4LLO B;  3C8C A;  2VV8 A;  3A0S A;  4HH2 A;  1UGU A;  2L1M A;  4I39 A;  3A0R A;  3ZQ5 A;  4HY8 A;  3E4O A;  5HD5 A;  1XJ3 A;  2ZOI A;  1GSX A;  2WKP A;  4NXB A;  2JN7 A;  3NHQ A;  2M1C A;  2Z6C A;  1XFN A;  1N9N A;  1LT0 A;  5TBM A;  4HHD A;  1V9Z A;  1DP9 A;  3UB7 A;  5HWW A;  4JGQ A;  2L0W A;  1EW0 A;  3HJK A;  1GSW A;  3LYX A;  1F9I A;  2I9V A;  5AVF A;  1XJ2 A;  1XFQ A;  3VOL A;  4HOI A;  3F1P A;  4XT2 B;  3NOT C;  2PD7 A;  2VLG A;  4HP9 A;  4M4X A;  4WLA A;  5HDC A;  5HWT A;  2OWJ A;  4NXG A;  1OTI A;  4WL9 A;  1XJ6 A;  4I5S A;  1DRM A;  3BWL A;  4F3L A;  3CAX A;  2HV1 A;  2QKP A;  2OOL A;  1JNU A;  2YKH A;  3E4Q A;  3LID A;  4BBU A;  4WF0 A;  1LSX A;  1F98 A;  1KOU A;  1S1Y A;  1D7E A;  3NOU C;  4R3A A;  1P97 A;  3MQQ A;  4EES A;  3F1N B;  4B9O A;  4KUK A;  3HJI A;  1UWN X;  3H7W B;  3B33 A;  3KX0 X;  4HH3 A;  2QJ7 A;  2V1B A;  3H82 A;  4MN5 A;  1T1A A;  1DP6 A;  1LSV A;  4LRZ E;  1Y28 A;  4LRY C;  3IBR A;  3UME A;  4EER A;  1OJG A;  1V9Y A;  2B02 A;  4R70 A;  4EEP A;  2PYP A;  4JGP A;  3CWF A;  3LIA A;  4JGR A;  4EW7 A;  4PKY A;  3OLO A;  4GHI A;  3MR0 A;  2WKQ A;  4HP4 A;  4E04 A;  1OTB A;  2VEA A;  3LIF A;  4WUJ A;  3ICY A;  4K08 A;  4HJ3 A;  3PYP A;  3UB8 A;  4H6J B;  4KQD A;  2YKF A;  3VE3 A;  4EQ1 A;  3FG8 A;  3LIB A;  5HWV A;  1T1C A;  3LUQ A;  2INW A;  1TS6 A;  4I3I A;  5HSQ A;  4YWZ A;  5AVE A;  5G4Z A;  3P7N A;  5HDS A;  3PHY A;  3MJQ A;  3IS2 B;  4L9F A;  4GS9 B;  3FC7 A;  1OT6 A;  3RTY A;  5F69 A;  4EET B;  5F5Y A;  1OT9 A;  5HDD A;  2D01 A;  1TS8 A;  3D72 A;  4HIA A;  2PR6 A;  2PHY A;  3A0V A;  5F6A A;  3BY8 A;  3LIE A;  3SW1 A;  4XT2 A;  2K7S A;  3GDI A;  4LRX C;  5HD3 A;  2OWH A;  1XJ4 A;  2CMN A;  2A24 B;  2VV7 A;  2J80 A;  4L9G A;  4LPZ A;  4GCZ A;  2KDK A;  4JGO A;  3MQO A;  5J4E A;  1N9O A;  3NJA A;  3F1O B;  1T1B A;  3H7W A;  2PDR A;  4BBT A;  2PR5 A;  2Z6D A;  2W0N A;  5DJT A;  1NWZ A;  1WA9 A;  5J3W A;  4DJ2 A;  5KIZ A;  1N9L A;  3LI8 A;  4I3J A;  1X0O A;  5DKK A;  1LSW A;  4MN6 A;  1OJ5 A;  2GJ3 A;  5A8B A;  1OTA A;  5IS1 A;  1OTE A;  1TS7 A;  4L9E A;  4HJ6 A;  3H9W A;  1DP8 A;  5TBM B;  2JHE A;  2ZOH A;  3UB6 A;  3MXQ A;  1OTD A;  5J7E A;  4NXE A;  2V9A A;  1BYW A;  2QHK A;  2PYR A;  5G4Y A;  1MZU A;  4H6J A;  1S1Z A;  3GEC A;  4BBV A;  5HZH A;  2EA9 A;  4HQA A;  1G28 A;  3F1P B;  1S66 L;  2L4R A;  1GSV A;  1S4S A;  1TS0 A; 
#chains in the Genus database with same CATH topology
 1U60 A;  1K55 C;  5GLD A;  3LIC A;  3RH8 B;  4JXW A;  3IS2 A;  2V0U A;  3BQ8 A;  5L10 A;  1E4D A;  2P04 A;  4JBF A;  3UNW A;  1SZV A;  1LL8 A;  4Y13 A;  4R1G A;  4ZTK A;  4HNB A;  4QHC A;  4BL2 A;  3PBS A;  4GKU A;  3BFF A;  1HLU P;  2J3T C;  3UMD A;  1A0K A;  2K2N A;  1YLP A;  4GDB A;  4OP5 A;  2D02 A;  4N9L A;  4UA7 A;  4I3A A;  2O0Y A;  3K3C A;  3BFE A;  3WS1 A;  4UQI M;  3G6O A;  2WKR A;  5CER A;  3S1Y A;  1K6S A;  3C7V A;  3TJZ C;  2OAQ 1;  5HL1 A;  3OC2 A;  2BAS A;  3E98 A;  4BD1 A;  3IX3 A;  2XD1 A;  1TEM A;  4E3L A;  4R38 A;  5HPF A;  4QB8 A;  1PI5 A;  3L7H A;  1S67 L;  3QNB A;  1K56 D;  2H10 A;  1XA7 A;  2PD8 A;  3SH9 A;  4KZ3 A;  4I38 A;  1HTZ A;  1GHM A;  4HI4 A;  4P85 A;  5KMW A;  1IYQ A;  3NC8 A;  5E2E A;  4WEK A;  3PBN A;  3N8L A;  5HPI A;  2EWW A;  3Q7Z A;  4KZ8 A;  3WS2 A;  1UGU A;  3IH8 A;  5E43 A;  2J9P A;  3HLW A;  3E4O A;  4FOF A;  3Q81 A;  3FZC A;  2GZA A;  1G6O A;  1FOF A;  3NHQ A;  3LR4 A;  2XQZ A;  3UDX A;  2M1C A;  3PR6 A;  1N9N A;  4CLC D;  1LT0 A;  2A3U A;  5TBM A;  4HHD A;  1LI9 A;  1V9Z A;  1CK3 A;  2WGW B;  1PYY A;  4JGQ A;  1CF0 A;  1NJ4 A;  3HRE A;  2XSS A;  4X69 A;  3QNC A;  5K5B A;  5HL6 A;  1GSW A;  4R4R A;  4R4S A;  4P6B A;  1YSQ A;  1F9I A;  4BWI A;  4OQI A;  3VOL A;  5CHM A;  4KZ4 A;  4IUH A;  1KE0 A;  2LB5 A;  3KSF A;  2PD7 A;  3O3V A;  2JKR M;  2VGL S;  4IHQ A;  3A3D A;  3GMW A;  5HWT A;  2OWJ A;  3NCK A;  1YKD A;  4KZA A;  1CEG A;  4LV0 A;  1K55 A;  1OTI A;  4WL9 A;  5CGS A;  4I5S A;  1O07 A;  4UA6 A;  1DRM A;  3UPN A;  3BWL A;  1ONG A;  2HV1 A;  2QKP A;  3NDG A;  1JNU A;  3E4Q A;  3FKW A;  3LID A;  3U2A A;  4K0W A;  1LSX A;  1F98 A;  1YAX A;  2G2U A;  1BLS A;  1W5D A;  3SH7 A;  1YLT A;  5CRF A;  2GDN A;  1FR1 A;  3BFD A;  3CHW P;  3W8K A;  3MMH A;  4KG2 A;  3GSG A;  3S22 A;  4B9O A;  3RJU A;  3G34 A;  2JKT M;  4HH3 A;  1XGI A;  2V1B A;  3A3F A;  1LL9 A;  4B4Z A;  4LRZ E;  3MS6 A;  1K4F A;  4LRY C;  4KQQ A;  3IBR A;  4MEZ A;  2HP5 A;  4WEJ A;  5FSR A;  3M2J A;  3ZVT A;  4NK3 A;  3C30 A;  2E8I A;  4RX3 A;  4Y5F A;  5FI6 A;  2O99 A;  1ACF A;  5A93 A;  4EUZ A;  3W2Z A;  3LIA A;  4PKY A;  1W8Q A;  3T4T A;  4FTX A;  3MR0 A;  5EVI C;  5EVI B;  3KO6 A;  5TJJ A;  4Y0U A;  3O5Y A;  3QP1 A;  2B5R A;  4WUJ A;  3ICY A;  3HUO A;  4CPK A;  4IBR A;  4U0X A;  2XDM A;  1FSW A;  3MXS A;  5DF9 A;  2WKI A;  2INW A;  1TS6 A;  4I3I A;  4JKT A;  5GHX A;  1RGZ A;  4RVA A;  1MPL A;  1JWP A;  2J8Y A;  5G4Z A;  2WGW A;  4UEY A;  4DDY A;  4G3W A;  5HDS A;  3LGO A;  1ZHH B;  3VP2 A;  3RTY A;  1PI4 A;  4EET B;  1GHP A;  2B18 A;  5FQJ A;  3SH8 A;  1OT9 A;  2V8F A;  2V1Z A;  3IF5 A;  1TS8 A;  3V39 A;  2FZ0 A;  2Y2M A;  4GOG A;  4WZ5 A;  3BY8 A;  1CI8 A;  3ISG A;  3SW1 A;  3ITA A;  1NLZ A;  2J3T D;  3G2Y A;  5CHU A;  4LRX C;  4D2O A;  4S2L A;  3RFB A;  5FAO A;  2OWH A;  1XJ4 A;  3ZG9 B;  3PAE A;  3EEA A;  1ES2 A;  2H0T A;  2HJ9 C;  2VK3 A;  3HCY A;  4OVD A;  3HLD A;  3OZH A;  3MQO A;  3QP2 A;  5F1G A;  3E2L A;  1ERO A;  2LB9 A;  4K0X A;  3R4K A;  3DBA A;  3F1O B;  3CPT B;  1L0F A;  2R9X A;  5FQI A;  2W0N A;  5FDH A;  3IXD A;  1WA9 A;  5D3O A;  4DJ2 A;  3GVB A;  1FIL A;  4OPR A;  1K4E A;  1N9L A;  4BJP A;  4RA7 A;  5DF8 A;  3S7Q A;  3GTC A;  3KYQ A;  4EV4 A;  3ITB A;  1I5Q A;  2ZM8 A;  2J7V A;  4WBG A;  3LEQ A;  1OTE A;  2IWD A;  4HJ6 A;  3B47 A;  4FH4 A;  2R9W A;  1BLP A;  1K57 C;  2Y8H A;  5EVI A;  1OTD A;  4NXE A;  1MWT A;  1JTD A;  1YLJ A;  3VV4 A;  4A5R A;  4YIN A;  2G2W A;  3V3R A;  5M18 A;  4S2J A;  1S1Z A;  2OLV A;  5FEG A;  3TG9 A;  3D3O A;  2FFF B;  2JC7 A;  3ZCZ A;  4OP8 A;  4WEL A;  5AQ7 A;  5KZH A;  5FAP A;  1WYB A;  3CG5 A;  3WRZ A;  3Q7V A;  3UB9 A;  2WZX A;  5JYP A;  3UPO A;  3T1Q B;  4PKY G;  3EGX C;  5FI2 A;  2Y4A A;  2OLU A;  3CZD A;  4OPY A;  2O9B A;  3PBO A;  4PPR A;  3LCE A;  2Y2J A;  1SDN A;  3MBZ A;  5TFQ A;  5GHZ A;  3T1X A;  2MJ6 A;  2EX9 A;  5A92 A;  2H5S A;  3A3E A;  5IU1 A;  4GW9 A;  3LI9 A;  1ERQ A;  3SOI A;  3KYZ A;  5FI7 A;  2ZM2 A;  3WWX A;  1NXY A;  3Q07 A;  1H8M A;  3WS0 A;  1PWD A;  2ZMV A;  2H28 A;  1FSY A;  3T4S A;  1ES4 A;  3T50 A;  4DJ3 A;  4O7D A;  3FPW A;  3BW6 A;  4ZJ3 A;  4EXO A;  2A49 A;  5HX9 A;  4NG2 A;  3F1O A;  3CPT A;  3GR2 A;  5I5L A;  4DMZ A;  5EOO A;  2O9A A;  4F94 A;  2HP6 A;  2XR0 A;  2QJ5 A;  2VX8 A;  3O86 A;  4PM7 A;  1K6R A;  3QP6 A;  1WYC A;  1L2S A;  1T18 A;  2BTF P;  5EVI D;  3C38 A;  3C8C A;  4Q0H A;  4X68 A;  1YLZ A;  4HH2 A;  3SS4 A;  3MZE A;  4WMC A;  1TF1 A;  3A3J A;  1L3L A;  4N92 A;  3U4L P;  3UE0 A;  4OOY A;  4EQI A;  1I2W A;  2Y2K A;  1QME A;  5CX7 A;  1IYP A;  2X02 A;  3VP4 A;  1DJC A;  2ZQD A;  1E25 A;  1GSX A;  1NY0 A;  5CGW A;  2QZ6 A;  4P0M A;  2Z6C A;  1XFN A;  1K57 A;  4KZ9 A;  2Y2I A;  1DP9 A;  2P9V B;  5GL9 A;  4S2O A;  4DF6 A;  3JVU A;  4OH0 A;  4E3I A;  1PFL A;  3OCN A;  3LYX A;  2W3D A;  4IVK A;  2ZQC A;  4KZ6 A;  1DY6 A;  1XFQ A;  2JCH A;  4PMA A;  1VEU A;  3B42 A;  4JF5 A;  4HOI A;  2JE5 A;  1KDS A;  4JXV A;  2XGN A;  3UB5 P;  1NZO A;  3MSH A;  3TOI A;  3NOT C;  2XRN A;  5HDC A;  2OV5 A;  4DE3 A;  4KZB A;  3CAX A;  3UE3 A;  1FCO A;  2YKH A;  2Y91 A;  3NUL A;  4BBU A;  2XLN A;  4WF0 A;  1RP5 A;  3V5M A;  1OME A;  1KOU A;  1YT4 A;  3NOU C;  4GN2 A;  3GQZ A;  1P97 A;  2H0Y A;  1K54 C;  2EX2 A;  4EES A;  2WGI A;  2Y55 A;  3F1N B;  5EVE A;  1L0D A;  4KUK A;  4PM6 A;  1RCJ A;  4S2M A;  2Y79 A;  3B33 A;  3C7U A;  3G4P A;  1H8Y A;  2QJ7 A;  2DRW A;  3HBR A;  1SKO B;  3AGD A;  2HZ5 A;  3IXB A;  3MKF A;  1HZO A;  3UME A;  3HL9 A;  4JXG A;  4M3K A;  2PRF A;  4WMC D;  4R70 A;  3GRJ A;  4PM9 A;  1PZO A;  4JXS A;  3BEB A;  4CQH A;  2GNX A;  4EEP A;  4UHU A;  2UWX A;  4JGP A;  2ZL1 B;  1ES3 A;  2DNS A;  4JLF A;  4BMW A;  1IEL A;  4R23 A;  2WKQ A;  4NEE D;  1OTB A;  4HES A;  1O7E A;  5IT5 A;  5F1F A;  4K08 A;  1CI9 A;  3PYP A;  4U0T A;  4BL3 A;  4KQD A;  3VE3 A;  4EQ1 A;  1RGY A;  5HWV A;  4OON A;  1T1C A;  4BEN A;  3LUQ A;  4RYE A;  4ETX A;  5GLC A;  4C75 A;  4YWZ A;  3IHB A;  1W63 Q;  2P9V A;  2XA7 M;  1PW8 A;  4ETZ A;  4MBF A;  5TGF A;  1W63 M;  4E3N A;  3MJQ A;  4L9F A;  4GS9 B;  3FC7 A;  1OT6 A;  1QMF A;  5F69 A;  3IXG A;  5L2F A;  5HDD A;  1XPB A;  1MWR A;  4DE2 A;  5F6A A;  3BLM A;  3LIE A;  4E3M A;  2K7S A;  2EXA A;  1CQA A;  3TSG A;  4ESP A;  5KSC A;  3RXW A;  5HD3 A;  1E3U A;  2A24 B;  3OCL A;  2ZC3 B;  2J80 A;  2HDQ A;  2Z2M B;  4CJN A;  4E3K A;  2Y2N A;  2XFT A;  3QHY A;  4L9G A;  3UDF A;  3BYD A;  4LPZ A;  3HVF A;  2KDK A;  1SCW A;  4BQM A;  3W4O A;  3HLB A;  2W3F A;  4D60 A;  1VET B;  1T1B A;  3JVV A;  4DXB A;  2V2F F;  1KGG A;  3OOV A;  1TD5 A;  1MKI A;  3LO7 A;  4Y0T A;  5FQ9 A;  3ZGA B;  5I94 A;  5CTN A;  4X53 A;  3FPV A;  2Q9M A;  1Y4O A;  1X0O A;  5DKK A;  5TR7 A;  3ZG7 B;  3WRT A;  2HGV A;  1GA9 A;  5A8B A;  1OTA A;  2ACG A;  2ZL1 A;  4L9E A;  3P01 A;  1W79 A;  2PAV P;  3H9W A;  4GLQ A;  3UB6 A;  3MXQ A;  2OAP 1;  4OQG A;  5J7E A;  4B88 A;  4OQ0 A;  3G2Z A;  4LV1 A;  3LFV A;  1MKM A;  4DE0 A;  4YFM A;  3V3S A;  5L07 A;  2Y2G A;  3BLS A;  3M6B A;  4QPR A;  3M2K A;  2IWC A;  3AGF A;  1NLY A;  4HQA A;  1KGF A;  3F1P B;  4IED A;  2L4R A;  1GSV A;  1TS0 A;  4K91 A;  2ZQ8 A;  3E0Y A;  3VE4 A;  4GS9 A;  5FDS A;  1E3U D;  2KLI A;  3HLF A;  3IXH A;  4N9K A;  3V50 A;  4FCF A;  5F68 A;  2Q0O A;  1D06 A;  4QY5 A;  2XD5 A;  4DRT A;  1MWS A;  3MZD A;  4MNR A;  5DFX A;  5EFW A;  4E6X A;  2R78 A;  1ES5 A;  3A3I A;  3IF6 C;  3IF6 B;  3MQ0 A;  5AJG A;  4X25 A;  3G35 A;  4ZJ2 A;  1P0Z A;  2Y2H A;  3JPU A;  2W3G A;  1VB6 A;  2C6W B;  3CLO A;  3BY9 A;  1XP4 A;  2K31 A;  5M1A A;  3NOP C;  4LCM A;  2A24 A;  3VOZ A;  3H82 B;  1YMS A;  3EEH A;  3I7J A;  3TRC A;  4PAU A;  4DN0 A;  4R6L A;  4JPM A;  1SDE A;  2VA0 A;  2KX6 A;  5GLA A;  5AQB A;  4EEU A;  5EV0 A;  1N9B A;  1ODV A;  3T12 B;  1FQG A;  3IX4 A;  2P7J A;  4R0Q A;  4KQO A;  3K3D A;  1FCM A;  4NXF A;  5E2G A;  2VJW A;  1SHV A;  2QWS A;  1FCN A;  4GHI B;  4HJ4 A;  3BM6 A;  4KG5 A;  4KUO A;  1NRJ A;  3BRM A;  3ZNT A;  4G3V A;  4UA9 A;  4ID4 A;  2RL3 A;  4LLO B;  3TW8 A;  2VV8 A;  3A0S A;  4P87 A;  3S7O A;  3CUE C;  1WE4 A;  2ZQA A;  3S7N A;  3BFG A;  5EEC A;  3ZQ5 A;  1TDL A;  3CJM A;  4HY8 A;  1KVM A;  1N4O A;  5HD5 A;  1XX2 A;  3HLC A;  3HUM A;  2ZJ9 A;  3EOI A;  2EFX A;  3K2N A;  1YMX A;  2JN7 A;  4O8G A;  1KDW A;  2EX6 A;  5FAQ A;  1G68 A;  4YNR A;  3DW0 A;  4Z1W A;  3VSL A;  2P74 A;  5DTS A;  3SS5 A;  1EW0 A;  5CGX A;  3DTI A;  4CLC C;  3ZG8 B;  4CLC B;  4YOF A;  1BLC A;  2I9V A;  3ZG5 A;  5AVF A;  2WZZ A;  2JKG A;  5FQK A;  3UDI A;  4P6Z S;  3WS5 A;  4FSF A;  3NDE A;  5L8M A;  1P9W A;  4ZRR A;  3BFC A;  4OKP A;  5GLB A;  3F1P A;  4XT2 B;  2PU4 A;  4HP9 A;  4M4X A;  1J9M A;  2XEP A;  1XJ6 A;  3GV9 A;  4OLD A;  2Y2P A;  5FQQ A;  5M19 A;  4H8R A;  2Q9N A;  2X71 A;  2WKE A;  1S1Y A;  2B95 A;  1K0K A;  1H8Z A;  2Z2L B;  1D7E A;  3VSK A;  5E2H A;  4QWO A;  1STZ A;  4UQI S;  3P09 A;  4S2N C;  5HAQ A;  3HJI A;  1IKG A;  3H7W B;  3NIA A;  4N1H A;  4U3T A;  3KX0 X;  3H82 A;  1DP6 A;  1ALQ A;  3OBF A;  4Y15 A;  3NY4 A;  2WAE A;  4KZ7 A;  4GZB A;  4LV3 A;  1OJG A;  4X1M A;  2B02 A;  1FIK A;  4CLC E;  4S2I A;  2J3W A;  4DE1 A;  2Y2Q A;  3Q82 A;  2PYP A;  4S2P A;  4ME4 A;  2Y2O A;  1VQQ A;  2Y2L A;  3OLO A;  4GHI A;  5FL3 A;  3N4I A;  5BOH A;  3FYZ A;  3VFF A;  4HP4 A;  4XUZ A;  1GCE A;  2OSU A;  1HVB A;  1F2K A;  4KZ5 A;  1LI0 A;  3LIF A;  3S4X A;  3CUE A;  2KOI A;  3PBQ A;  2W3H A;  4JF6 A;  3QP8 A;  4H6J B;  5E2F A;  1Z09 A;  2YKF A;  3FG8 A;  4ZDX A;  3LIB A;  3LR5 A;  3T4L A;  3CMZ A;  5EOE A;  1S4S A;  1ONH A;  4G3K A;  5FAS A;  3UO9 A;  1NRF A;  2P08 A;  2VGJ A;  5HSQ A;  4LEN A;  3DTE A;  5AVE A;  2V20 A;  2XK1 A;  3P7N A;  4IBX A;  3PHY A;  1MC0 A;  3BEC A;  3LY3 A;  3G32 A;  1M40 A;  2M7V A;  1KE3 A;  4OOL A;  1ZKJ A;  2W3E A;  3NI9 A;  3T4K A;  3ZFZ A;  2G7U A;  2HF6 A;  3D72 A;  4L0L A;  2PR6 A;  1CJF A;  1BUE A;  4PM8 A;  3KSG A;  3CI6 A;  5CED A;  2ZM0 A;  4XT2 A;  2EFU A;  4MDZ A;  3GDI A;  3PBT A;  5CEB A;  4Y0O A;  1S0W A;  4EBL A;  2IWB A;  1JTG A;  2ZLY A;  1YQS A;  1XKZ A;  4EU0 A;  5J8X A;  3OPH A;  3IQA A;  2WK0 A;  4MBK A;  3OPL A;  1MY8 A;  2V8C A;  4EWF A;  4X6T A;  3MFD A;  5F83 A;  4GCZ A;  1G6A A;  3HLE A;  3SS3 A;  3O88 A;  1Q2Q A;  3FWL A;  5EVL A;  4KQR A;  1BUL A;  2ZC4 B;  3T4O A;  1ESU A;  4S2N A;  3VP1 A;  1BZA A;  3H7W A;  2Y59 A;  4FD8 A;  1L0E A;  2PDR A;  4Y7P A;  2PR5 A;  2ZD8 A;  3C4P A;  5DJT A;  5HAI A;  4HBU A;  2X01 A;  5HAR A;  3NEC A;  1W8Y A;  1I2S A;  5J3W A;  3C4O A;  3UE1 A;  5KIZ A;  1EI5 A;  3LI8 A;  1J3W A;  2IA2 A;  1JWV A;  1IYS A;  1LSW A;  2ZMF A;  4MLL A;  3MF0 A;  5CEC A;  3V67 A;  5IS1 A;  1TS7 A;  1ZG4 A;  5CXW A;  3P98 A;  1P9R A;  1DP8 A;  2JHE A;  4HEF A;  3UY6 A;  5DVA A;  4LCL A;  2V9A A;  5MC7 A;  4DXC A;  2PYR A;  1IOU A;  4Y2F A;  1MZU A;  4GNU A;  4H6J A;  4Z9Q A;  2XFS A;  4GDN A;  3GEC A;  3BJN A;  1PWC A;  2EA9 A;  5EPH A;  4Y17 A;  4AFI A;  1W7F A;  1G28 A;  1XGJ A;  3IH9 A;  2AVX A;  3R7W B;  5DF7 A;  3IBJ A;  4KEN B;  1YLW A;  5HAP A;  4QD4 A;  2HDU A;  3T1R A;  1UWP X;  4C6Y A;  3ZVW A;  4X55 A;  2EWV A;  4F3L B;  2VV6 A;  4WZ5 C;  1H5X A;  2ZQ9 A;  3ZYT A;  2V0W A;  3ULF A;  1AXB A;  4OPZ A;  5LBR A;  4RQ9 A;  1FR6 A;  1Y54 A;  2ZBB A;  3C2W A;  3B3X A;  1H3Q A;  1NYM A;  1LHY A;  1K38 A;  2BG1 A;  2WAD A;  4N1X A;  4Y3I A;  1ESI A;  4PHT A;  2QYB A;  4WN5 A;  5KSH A;  1T19 A;  3DAV A;  2DMW A;  1D1J A;  4LV2 A;  3EQV A;  3ZNY A;  4MMN A;  3N7W A;  1TDG A;  1K54 A;  5DJU A;  3MFX A;  2NUT C;  4IJG A;  3F1N A;  3UE6 A;  4B93 A;  3FV7 A;  3IWO A;  3E4P A;  2PT7 A;  3MKE A;  2UV0 E;  1G5U A;  1CEF A;  2O9C A;  1S4R A;  2W27 A;  2J9O A;  1M6K A;  3T1S A;  1SKO A;  3M6H A;  1MBL A;  1Q2P A;  2V1A A;  2I72 A;  5FEF A;  1XXM A;  3EWK A;  4Q8I A;  3HLG A;  3DWZ A;  3DTM A;  1S6R A;  1YLY A;  4PM5 A;  3D4F A;  5F82 A;  5DKL A;  2W1T B;  3N8R A;  3VP3 A;  4ZAM A;  2QPN A;  4GB7 A;  3QP5 A;  1LL5 A;  1PWG A;  2L1M A;  1NYY A;  4I39 A;  3IWI A;  4QY6 A;  3A0R A;  1HD8 A;  1ZC2 A;  1XJ3 A;  2ZOI A;  3C5A A;  4E6W A;  3VOY A;  2WKP A;  4NXB A;  3T4Q A;  3VFH A;  2HP9 A;  1MWU A;  2XH9 A;  4FUW A;  3UB7 A;  5HWW A;  4E3J A;  2A2L A;  5FAT A;  4UAA A;  5GHY A;  3NBL A;  2L0W A;  1AWI A;  3HJK A;  3WS4 A;  5HFO A;  1K25 A;  1XJ2 A;  1VHM A;  4B4X A;  3E2K A;  3Q7V B;  2VGL M;  3LR3 A;  1DJA A;  3VMA A;  5EUA A;  1JVJ A;  2VLG A;  3UPP A;  4QU3 A;  3R7W A;  4WLA A;  1YSP A;  4NXG A;  2EXB A;  2VZW A;  4MBH A;  2ZC7 A;  2JBF A;  4LGW A;  3PTE A;  2VKS A;  2ZMA A;  3KSH A;  4Q0J A;  4E3O A;  4F3L A;  3LEZ A;  4XUX A;  4OOM A;  2OOL A;  4IVI A;  3UN7 A;  2ZQ7 A;  3CIT A;  3SZT A;  1BLH A;  2JKR I;  4WM9 A;  1KVL A;  3O87 A;  4GD8 A;  2E8J A;  4NKP A;  5AQA A;  4R3A A;  3MQQ A;  1GHI A;  5EM0 A;  1Z6F A;  1IFQ A;  1UWN X;  3W4Q A;  2M7U A;  5C5K A;  2WYX A;  4MN5 A;  1T1A A;  2W1R A;  1LSV A;  2HJE A;  4BD0 A;  5A90 A;  1Y28 A;  3FKV A;  1VET A;  4EBN A;  5JYO A;  1XA1 A;  4R3J A;  1IEM A;  1V9Y A;  5CTM A;  5G18 A;  4EER A;  4WZ4 A;  2JKT I;  4ARZ B;  4GD6 A;  3CWF A;  5DTT A;  4JGR A;  2FH5 A;  4EW7 A;  4R3B A;  5L09 A;  3TE8 A;  1YM1 A;  2EX8 A;  3ZDJ A;  4E04 A;  2W1T A;  4OLG A;  2VEA A;  4IUK A;  5IHV A;  3S7P A;  5A91 A;  5CHJ A;  3N8S A;  3ZHH A;  3OPR A;  2BLS A;  5DFY A;  4HJ3 A;  1GA0 A;  3UB8 A;  4DDS A;  2ZC5 B;  1TVF A;  2WKH A;  4XXR A;  2WGV A;  1JWZ A;  4EBP A;  4ZJ1 A;  1IYO A;  4JF4 A;  3VP0 A;  3RXX A;  1PIO A;  3PXP A;  3D9Y A;  3Q1F A;  4II7 A;  1DJB A;  1VM1 A;  1C3B A;  1IKI A;  5HW3 A;  1VEU B;  3IS2 B;  1BSG A;  1H0M A;  1EWZ A;  5F5Y A;  2HDR A;  2D01 A;  2VGK A;  4HIA A;  4S2K A;  1PW1 A;  1PNE A;  2PHY A;  3A0V A;  2PBY A;  3PBR A;  2HPB A;  2WAF A;  2PU2 A;  2NUP C;  4OPQ A;  3IX8 A;  2FFY A;  1SKF A;  5FQM A;  4QJG A;  4NET A;  4HBT A;  2ZC6 B;  3IF6 A;  4RX2 A;  2CMN A;  4X1L A;  3QP4 A;  4FH2 A;  2VV7 A;  1YPR A;  2JKF A;  3PAG A;  4BLM A;  3G31 A;  2RCX A;  3EQU A;  4EUV A;  1NZU A;  4JGO A;  5FA7 A;  4MCW A;  2PBD P;  4O0P A;  5J4E A;  1N9O A;  3DTK A;  1BT5 A;  1F5M A;  5EE8 A;  3NJA A;  5U47 A;  2QMI A;  3MXR A;  4BBT A;  3T4J A;  2Z6D A;  1NWZ A;  3IHA A;  4OQH A;  2HDS A;  4DKI A;  2GX5 A;  4ZBE A;  3MZF A;  5AQ9 A;  3L9K A;  3KYE A;  1ZG6 A;  1BTL A;  4I3J A;  1PRQ A;  3G30 A;  1K56 A;  3EGD C;  4ARZ A;  2XRO A;  4MN6 A;  5DTK A;  1OJ5 A;  2GJ3 A;  1KGE A;  2CC1 A;  4MN7 A;  5EM1 A;  3ZG0 A;  3KSI A;  3W4P A;  1LLB A;  1PZP A;  4Q0I A;  1L0G A;  5TBM B;  3DWK A;  1OPX A;  4KG6 A;  4O01 A;  2ZOH A;  4X56 A;  3JYI A;  4C3Q A;  4GJ4 A;  3N6I A;  1BYW A;  2QHK A;  4WYY A;  5G4Y A;  2C5W B;  3LY4 A;  1ERM A;  2WUQ A;  3IT9 A;  3IWQ A;  4BBV A;  5HZH A;  1ZTU A;  3AGE A;  3BQA A;  2XA7 S;  4LFU A;  4CLC A;  3LR0 A;  1KE4 A;  4P6Z M;  1S66 L;  2DCF A;  3HUN A;  3OPP A;  1MXO A;  2XF3 A; 
#chains in the Genus database with same CATH homology
 3E0Y A;  3IBJ A;  3VE4 A;  3UB9 A;  3LIC A;  3RH8 B;  3IS2 A;  4GS9 A;  1UWP X;  2V0U A;  3BQ8 A;  2EWV A;  4F3L B;  2VV6 A;  2P04 A;  3EGX C;  2KLI A;  4PKY G;  5F68 A;  1LL8 A;  1D06 A;  3ZYT A;  2O9B A;  2V0W A;  3PBO A;  4HNB A;  3ULF A;  5LBR A;  4RQ9 A;  5DFX A;  5EFW A;  3PBS A;  2ZBB A;  2R78 A;  3C2W A;  1H3Q A;  2MJ6 A;  2J3T C;  3MQ0 A;  4Y3I A;  3UMD A;  2K2N A;  5AJG A;  4PHT A;  2QYB A;  4GW9 A;  5IU1 A;  1P0Z A;  3LI9 A;  4WN5 A;  2D02 A;  5KSH A;  2W3G A;  3KYZ A;  1VB6 A;  4I3A A;  3CLO A;  1T19 A;  2O0Y A;  3K3C A;  2DMW A;  3BY9 A;  3EQV A;  2K31 A;  4MMN A;  3G6O A;  4UQI M;  2WKR A;  3NOP C;  2A24 A;  3H82 B;  3TJZ C;  5DJU A;  2OAQ 1;  3EEH A;  3MFX A;  1H8M A;  2NUT C;  3TRC A;  4IJG A;  3OC2 A;  3F1N A;  3UE6 A;  2BAS A;  4PAU A;  3E98 A;  4DN0 A;  4R6L A;  2ZMV A;  2H28 A;  2VA0 A;  4R38 A;  3T4S A;  5HPF A;  4B93 A;  2KX6 A;  3E4P A;  4EEU A;  2PT7 A;  1ODV A;  3T50 A;  4DJ3 A;  2O9C A;  1S4R A;  2P7J A;  2W27 A;  3FPW A;  4KQO A;  1S67 L;  3K3D A;  4NXF A;  2PD8 A;  2VJW A;  2V1A A;  3BW6 A;  2QWS A;  4I38 A;  3EWK A;  4HI4 A;  4EXO A;  3F1O A;  5I5L A;  4GHI B;  4DMZ A;  4HJ4 A;  2O9A A;  4WEK A;  2QJ5 A;  2VX8 A;  4KUO A;  1NRJ A;  1T18 A;  3PBN A;  4G3V A;  5DKL A;  2W1T B;  4LLO B;  3C38 A;  3C8C A;  5HPI A;  2EWW A;  4Q0H A;  2VV8 A;  3TW8 A;  3A0S A;  4HH2 A;  1UGU A;  2L1M A;  3S7O A;  3CUE C;  4I39 A;  1TF1 A;  3S7N A;  3A0R A;  3ZQ5 A;  4HY8 A;  3E4O A;  5HD5 A;  1XJ3 A;  5CX7 A;  4FOF A;  2ZOI A;  3EOI A;  1GSX A;  3K2N A;  2GZA A;  1G6O A;  2WKP A;  4NXB A;  2JN7 A;  3NHQ A;  3LR4 A;  4O8G A;  3T4Q A;  2M1C A;  3PR6 A;  2Z6C A;  1XFN A;  1N9N A;  4CLC D;  1LT0 A;  5TBM A;  4HHD A;  1V9Z A;  1DP9 A;  4YNR A;  3UB7 A;  5HWW A;  4JGQ A;  2A2L A;  4Z1W A;  3JVU A;  2L0W A;  2XSS A;  1EW0 A;  3HJK A;  5K5B A;  3OCN A;  5HL6 A;  1GSW A;  3LYX A;  4CLC C;  4CLC B;  4YOF A;  2W3D A;  1YSQ A;  1F9I A;  2I9V A;  4BWI A;  5AVF A;  1XJ2 A;  1VHM A;  4P6Z S;  1XFQ A;  3VOL A;  3B42 A;  4FSF A;  4HOI A;  2VGL M;  3LR3 A;  5L8M A;  1P9W A;  4ZRR A;  4IUH A;  2LB5 A;  3F1P A;  4XT2 B;  3NOT C;  3KSF A;  2PD7 A;  2VLG A;  2JKR M;  2VGL S;  4HP9 A;  4IHQ A;  3R7W A;  4M4X A;  4WLA A;  2XRN A;  5HDC A;  1YSP A;  5HWT A;  2OWJ A;  4NXG A;  1YKD A;  2VZW A;  1OTI A;  2VKS A;  4WL9 A;  1XJ6 A;  4I5S A;  1DRM A;  3BWL A;  3KSH A;  4Q0J A;  4F3L A;  3CAX A;  2HV1 A;  2QKP A;  4OOM A;  3UE3 A;  2OOL A;  1JNU A;  2YKH A;  3E4Q A;  3LID A;  3U2A A;  3CIT A;  4BBU A;  4WF0 A;  2JKR I;  1LSX A;  1F98 A;  1YAX A;  1KOU A;  1S1Y A;  4NKP A;  1D7E A;  3NOU C;  4R3A A;  1P97 A;  3MQQ A;  4UQI S;  1STZ A;  4EES A;  3MMH A;  3F1N B;  4B9O A;  4KUK A;  3HJI A;  1IFQ A;  1UWN X;  2M7U A;  3H7W B;  5C5K A;  2JKT M;  2Y79 A;  3B33 A;  3KX0 X;  4HH3 A;  2QJ7 A;  2V1B A;  3H82 A;  4MN5 A;  1T1A A;  1DP6 A;  2W1R A;  1LSV A;  2HJE A;  4LRZ E;  1Y28 A;  4LRY C;  3IBR A;  3UME A;  3OBF A;  4WEJ A;  4EER A;  1OJG A;  1V9Y A;  2B02 A;  4R70 A;  4CLC E;  2JKT I;  3C30 A;  2J3W A;  4Y5F A;  4ARZ B;  2O99 A;  4CQH A;  2GNX A;  4EEP A;  2PYP A;  4JGP A;  3CWF A;  4ME4 A;  3W2Z A;  3LIA A;  2FH5 A;  4JGR A;  4EW7 A;  4PKY A;  3OLO A;  4GHI A;  5FL3 A;  3TE8 A;  4BMW A;  3T4T A;  3MR0 A;  2WKQ A;  4HP4 A;  4NEE D;  4E04 A;  1OTB A;  2W1T A;  5TJJ A;  3KO6 A;  2VEA A;  4IUK A;  3O5Y A;  3S7P A;  5IT5 A;  3LIF A;  4WUJ A;  3ICY A;  4K08 A;  5DFY A;  3CUE A;  4HJ3 A;  3PYP A;  2KOI A;  3PBQ A;  2W3H A;  3UB8 A;  4H6J B;  4KQD A;  2YKF A;  3VE3 A;  4EQ1 A;  3FG8 A;  3LIB A;  5HWV A;  3LR5 A;  1T1C A;  3T4L A;  5DF9 A;  3LUQ A;  4ETX A;  2INW A;  1TS6 A;  4I3I A;  4G3K A;  2P08 A;  5HSQ A;  4YWZ A;  5AVE A;  5G4Z A;  4UEY A;  3P7N A;  1W63 Q;  3PXP A;  2XA7 M;  4II7 A;  4G3W A;  5HDS A;  4ETZ A;  3PHY A;  1ZHH B;  1W63 M;  1MC0 A;  3MJQ A;  3IS2 B;  4L9F A;  4GS9 B;  3FC7 A;  1OT6 A;  2M7V A;  3RTY A;  4OOL A;  2W3E A;  5F69 A;  3T4K A;  4EET B;  2G7U A;  2B18 A;  5F5Y A;  2HF6 A;  1OT9 A;  5HDD A;  2D01 A;  1TS8 A;  3D72 A;  4HIA A;  4L0L A;  2PR6 A;  3KSG A;  2FZ0 A;  2PHY A;  3A0V A;  5F6A A;  3CI6 A;  3BY8 A;  3LIE A;  3SW1 A;  3PBR A;  4XT2 A;  1NLZ A;  2J3T D;  2NUP C;  2K7S A;  4MDZ A;  3GDI A;  3PBT A;  4LRX C;  5HD3 A;  3RFB A;  2OWH A;  1XJ4 A;  4EU0 A;  2CMN A;  2A24 B;  2VV7 A;  3EEA A;  3OCL A;  2HJ9 C;  2J80 A;  3HCY A;  4L9G A;  4LPZ A;  3EQU A;  4EUV A;  4GCZ A;  2KDK A;  4JGO A;  4MCW A;  3MQO A;  4O0P A;  3T4O A;  2W3F A;  2LB9 A;  5J4E A;  1N9O A;  3R4K A;  1F5M A;  3NJA A;  3DBA A;  3F1O B;  1T1B A;  3H7W A;  3JVV A;  2PDR A;  3OOV A;  4BBT A;  2PR5 A;  1TD5 A;  3T4J A;  2Z6D A;  2W0N A;  5DJT A;  1NWZ A;  1WA9 A;  5J3W A;  2GX5 A;  3FPV A;  4DJ2 A;  5KIZ A;  1N9L A;  3LI8 A;  4BJP A;  2IA2 A;  3S7Q A;  4I3J A;  1X0O A;  5DKK A;  3EGD C;  3KYQ A;  1LSW A;  4ARZ A;  2XRO A;  4MN6 A;  1OJ5 A;  2HGV A;  2GJ3 A;  2ZMF A;  3MF0 A;  5A8B A;  1OTA A;  4MN7 A;  3V67 A;  1OTE A;  5IS1 A;  1TS7 A;  4L9E A;  3P01 A;  4HJ6 A;  3KSI A;  3B47 A;  3H9W A;  4Q0I A;  4GLQ A;  2Y8H A;  1P9R A;  1DP8 A;  5TBM B;  1OPX A;  4O01 A;  2JHE A;  2ZOH A;  3UB6 A;  3MXQ A;  1OTD A;  2OAP 1;  5J7E A;  4GJ4 A;  4NXE A;  2V9A A;  1BYW A;  5MC7 A;  2QHK A;  2PYR A;  3VV4 A;  1IOU A;  3LFV A;  4Y2F A;  5G4Y A;  1MZU A;  1MKM A;  4H6J A;  1S1Z A;  3GEC A;  3BJN A;  4QPR A;  4BBV A;  5HZH A;  1ZTU A;  2EA9 A;  1NLY A;  3BQA A;  3D3O A;  2XA7 S;  4HQA A;  4AFI A;  1G28 A;  4CLC A;  3LR0 A;  3F1P B;  4P6Z M;  4WEL A;  1S66 L;  2L4R A;  1GSV A;  3R7W B;  1S4S A;  1TS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...