1TS0A

Structure of the pb1 intermediate from time-resolved laue crystallography
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photoreceptor
molecule keywords Photoactive yellow protein
publication title Visualizing reaction pathways in photoactive yellow protein from nanoseconds to seconds.
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ts0A00
1TS7A 3H82B 1DP8A 3EWKA 1D06A 1WA9A 4LRZE 2QWSA 1VB6A 4PKYG 1NWZA 3C8CA 1KOUA 2VV8A 5J4EA 1OJ5A 1UWPX 2PHYA 1DP9A 4GHIB 4HP9A 1OTIA 1OTAA 1P97A 3NJAA 3IBRA 3F1OB 1Y28A 1S4SA 4DJ3A 4RQ9A 1N9NA 1T18A 3IS2B 3PYPA 4EEUA 1XFQA 1GSXA 5G4ZA 3H82A 2W27A 3LIAA 3GECA 3A0SA 2Z6CA 3GDIA 3LIDA 4GW9A 4WN5A 2Z6DA 1XJ2A 1OT6A 4L9FA 5TBMB 3RH8B 5IS1A 4F3LA 5F69A 1X0OA 3IS2A 3E4PA 1UWNX 3LIEA 4I5SA 3OLOA 3D72A 2WKPA 4R70A 1LSXA 1LSVA 4HNBA 1UGUA 4JGOA 3CWFA 3F1NB 2OWHA 5DJUA 4PKYA 4WF0A 5TBMA 4LRXC 2PYPA 1LT0A 4I3IA 3T50A 3E4QA 4L9GA 2JHEA 1F98A 2L1MA 2VLGA 3MQOA 4HJ4A 2K7SA 1S1ZA 1OTBA 5F68A 2L4RA 1TS0A 3NHQA 1OTEA 2CMNA 1XJ4A 2QKPA 3F1NA 3NOUC 4WLAA 3F1PB 2J80A 2KX6A 3MQQA 1S1YA 3VE3A 3LUQA 4H6JA 5HWWA 4HP4A 3LI9A 5EFWA 3BY9A 4R38A 4L9EA 1DRMA 1OT9A 5HWVA 4EXOA 1EW0A 5DJTA 3MFXA 4BBUA 4NXEA 2PD7A 3H9WA 4I38A 4I39A 4HJ3A 3K3DA 4EQ1A 2D01A 1TS6A 2P7JA 5HWTA 4GHIA 1XJ3A 2V0WA 3H7WB 4B9OA 3PHYA 3RTYA 2ZBBA 2R78A 3BWLA 3F1OA 2D02A 4I3JA 1G28A 2PR5A 2INWA 1F9IA 5G4YA 3A0RA 3UB6A 1LSWA 3C2WA 1XFNA 3KX0X 4LRYC 3SW1A 5J7EA 4YWZA 5J3WA 1S66L 2OOLA 2PD8A 4KUKA 2L0WA 4HOIA 3LICA 5AVFA 3HJKA 4HI4A 1S4RA 5AVEA 3H7WA 5HD3A 4WUJA 3ZQ5A 4NXGA 4R3AA 3P7NA 2KDKA 3ULFA 4MN6A 3E4OA 4BBTA 1S67L 3CAXA 4R6LA 3VOLA 1V9YA 2V9AA 1BYWA 5HZHA 2OWJA 2V1AA 3HJIA 2JN7A 5DKKA 3LIBA 4DJ2A 2WKRA 1N9LA 3MXQA 2ZOIA 5F6AA 4EERA 2EA9A 2PDRA 2HV1A 2QJ7A 4JGQA 2H28A 3BY8A 4GCZA 4HIAA 4K08A 1TS8A 1T1CA 1LL8A 5HDDA 1D7EA 2YKHA 3MJQA 1T19A 2VEAA 2QHKA 4I3AA 4LLOB 1JNUA 5HDSA 5IU1A 2A24B 2BASA 1DP6A 2V1BA 5DKLA 4HJ6A 1T1BA 2VV7A 4LPZA 4KQDA 1XJ6A 4M4XA 4F3LB 1V9ZA 3CLOA 1N9OA 3F1PA 3NOPC 5HDCA 4HH2A 3K3CA 1OTDA 2WKQA 2M1CA 1GSVA 3UB9A 4HY8A 2I9VA 4MN5A 4GS9B 1ODVA 3A0VA 4EEPA 2A24A 2VV6A 4NXFA 1T1AA 3LI8A 3B33A 3UMEA 5A8BA 1OJGA 1GSWA 2V0UA 3UE6A 3ICYA 2B02A 4XT2B 2PR6A 3FG8A 4KUOA 2GJ3A 5HSQA 3VE4A 4GS9A 4BBVA 5KIZA 3NOTC 4EW7A 4HQAA 4HH3A 4HHDA 3LYXA 3UB8A 2QJ5A 3UMDA 2W0NA 5F5YA 5I5LA 4WL9A 3MR0A 4H6JB 4NXBA 3FC7A 4JGPA 4XT2A 2YKFA 2ZOHA 5HD5A 3UB7A 1MZUA 4JGRA 2PYRA 4EETB 1P0ZA 4EESA 3EEHA 3LIFA 4E04A 3G6OA
chains in the Genus database with same CATH superfamily
2Y59A 3EWKA 4E3OA 4WZ5C 3SZTA 3PR6A 3C4PA 4FD8A 4LRZE 1NYYA 2QWSA 1VB6A 1LI9A 4IHQA 3DWKA 4Q0HA 1STZA 1NWZA 1W63M 1KOUA 3KO6A 1MWTA 2PHYA 2ZC6B 4HP9A 3HLFA 1OTIA 1OTAA 3NJAA 2J7VA 2O9AA 2VGKA 1MPLA 1S4SA 3WS1A 4YOFA 3DWZA 5EVIB 5CTNA 5FQJA 2A2LA 2HP5A 5FQKA 4EEUA 5FEFA 2IWCA 5CHUA 5DFXA 3CUEC 3LIAA 4HBUA 3VMAA 3A0SA 4BLMA 3BECA 4DKIA 3MQ0A 1MXOA 3HREA 3O87A 4GW9A 5CEDA 2X01A 4UQIS 3WRZA 4DXBA 5EECA 4KZ8A 4L9FA 3RH8B 4JF5A 5IS1A 1KGFA 4OOLA 4BWIA 5F69A 2V20A 4O01A 1FCOA 2E8JA 2Y2IA 4EQIA 5DVAA 3OZHA 4RVAA 3BRMA 3NDGA 3S7QA 3QHYA 5M18A 2J9PA 1K55C 3HUNA 4CLCB 1LSXA 1BT5A 4HNBA 4Y13A 4K0XA 2I72A 4MNRA 1PI5A 4WF0A 1F2KA 3P09A 4ZJ2A 3IWOA 5TBMA 2ZC5B 4DDYA 3E98A 3QNBA 3N8RA 2FZ0A 4L9GA 3PBSA 1AWIA 3IWQA 5FAOA 4QB8A 2XF3A 3NIAA 4ZRRA 3G4PA 4JF6A 2L4RA 3DTEA 3ZG7B 2CMNA 3F1NA 3W4PA 2JBFA 5FASA 2OAP1 2DNSA 2KX6A 3HBRA 1MBLA 4IVIA 1NRJA 3ZVWA 5J8XA 1BSGA 3MQQA 1KGEA 1E3UD 3G31A 1L2SA 4ID4A 3OPLA 3LFVA 5G18A 4HP4A 4Y5FA 4Y2FA 2DRWA 3DTMA 2MJ6A 2W3DA 4OPQA 3BY9A 4R38A 1ERQA 1KE0A 3HLWA 4UHUA 3D4FA 5DTTA 3DBAA 3TSGA 1LL5A 4C75A 5HWVA 3T1SA 4DXCA 2EFXA 4CQHA 3MXSA 1DY6A 1GA9A 4JLFA 2VX8A 1IYQA 1K0KA 4NXEA 1HD8A 3CUEA 1TS6A 2Q9MA 1I2SA 4GJ4A 1XJ3A 4GDBA 4QD4A 4R3BA 4Y17A 5HAIA 3RTYA 4Y0UA 4Y0TA 2HZ5A 1FQGA 2ZBBA 1YLZA 1PI4A 2P04A 1F9IA 3KSIA 4LV0A 3S7PA 1PWCA 3A0RA 4ZDXA 5C5KA 5GHZA 3GVBA 4OVDA 2ZL1A 1H0MA 3SW1A 5DF9A 1M6KA 4X6TA 1YKDA 2EX6A 3WS5A 3QP2A 2L0WA 4HOIA 5AVEA 1QMFA 3VP4A 1VETA 4R3AA 3VP2A 3T4TA 1BLCA 3P7NA 2KDKA 1ES4A 4MMNA 4BBTA 1L0EA 5F82A 2FFFB 1KE4A 1C3BA 3LEZA 2FH5A 1K56D 3ZDJA 4EBLA 3HJIA 2J9OA 2JN7A 2PU4A 1ONGA 3O3VA 2Y2OA 4DE1A 5HW3A 2V8CA 3LIBA 3M6HA 4DJ2A 1M40A 1E25A 3ZNTA 4EERA 1DJAA 2XK1A 3LO7A 3IXBA 2PDRA 1F5MA 2J8YA 4OKPA 4OPRA 4B88A 3ZCZA 5DTKA 3W2ZA 3W4QA 3NY4A 4HIAA 4S2NA 1RP5A 3MJQA 5L10A 4I3AA 1ES3A 3OPHA 4LLOB 2C6WB 3NECA 1BULA 1NYMA 2A24B 2OLVA 4MDZA 3VP1A 4OQGA 2XD1A 1XX2A 2ZM2A 1WYBA 2NUPC 5HAQA 3ZGAB 4M4XA 1A0KA 1N9OA 4OH0A 1KVMA 2EFUA 3JVVA 2WKQA 4RX2A 1NXYA 3JVUA 3UB9A 1ACFA 4NK3A 4E6XA 5CGXA 4WZ4A 3VP3A 4C3QA 3A0VA 4L0LA 3NC8A 1T1AA 4QWOA 3LI8A 3PBOA 1GHIA 1N9BA 1OJGA 3MBZA 4EU0A 2V0UA 4UA9A 4S2KA 2EWWA 1VQQA 4PPRA 5E2HA 5FAPA 3BFCA 5CECA 2PR6A 2ZC3B 4PHTA 4KUOA 3VOYA 4S2PA 3S7OA 2EX2A 4GNUA 2GNXA 5KIZA 3QP5A 4WYYA 4QJGA 2UWXA 5FQMA 4HQAA 3HLEA 1RCJA 2ZC7A 3IT9A 3NI9A 3QP4A 4BMWA 3UB8A 5EV0A 2W0NA 3PTEA 4KG6A 3IX8A 2YKFA 2ZOHA 1MWUA 5HD5A 4ETZA 4D2OA 4YFMA 5EVID 2PYRA 4EETB 1P0ZA 4EESA 1JWPA 3EEHA 3LIFA 4E04A 3G6OA 2QYBA 4EBNA 1FCMA 2Z2LB 2G2WA 2NUTC 5F1FA 1PZPA 3AGFA 3M2KA 1WA9A 1JTDA 2VV8A 5J4EA 4UQIM 2W3EA 2Y2NA 5HX9A 3UDIA 4E3IA 1RGZA 1SCWA 3T1XA 4OP5A 2QMIA 3LEQA 1FSWA 1EROA 1YSPA 3IS2B 1QMEA 3IF6A 1XFQA 3B42A 3OC2A 5G4ZA 5L07A 3H82A 3CJMA 5AJGA 5GL9A 3MZEA 4CLCD 4F94A 2XRNA 2HGVA 2HJ9C 2ZL1B 1L0FA 2WAFA 4CPKA 5AQ9A 4N9LA 4WN5A 2Z6DA 3N7WA 1OT6A 2B18A 3UNWA 3VP0A 4KENB 1BLPA 1FR6A 3D3OA 2R9WA 5HFOA 1UWNX 3LIEA 4I5SA 4NKPA 4UAAA 4U0TA 4PM6A 3OLOA 4YNRA 1XA1A 3BQ8A 3KYEA 1SDNA 4FH4A 3D72A 4NG2A 4N92A 5A90A 4Q0IA 1LL9A 1CI8A 4JGOA 3C38A 3SS5A 4PKYA 3DW0A 4P0MA 4LV2A 1IYPA 3CITA 5DF8A 2PRFA 1LT0A 1LI0A 4I3IA 3T50A 4B93A 1ZKJA 1L3LA 2JKTM 5TJJA 1NLYA 1EI5A 4HESA 5CX7A 3S22A 4Z9QA 1JWVA 4OLGA 3C4OA 3A3IA 1BLHA 3BW6A 5KSHA 2O99A 1JWZA 5E2GA 3BEBA 3B47A 1OTEA 3MXRA 2VGLM 4NEED 4M3KA 1XJ4A 2HP6A 2J3WA 2QKPA 1MC0A 4E6WA 2J3TC 4PM7A 2P9VA 3LUQA 3UO9A 1WE4A 3BQAA 3EGDC 2M7VA 5L8MA 3M6BA 3LI9A 5EFWA 4S2LA 1NLZA 1TDGA 4HEFA 4G3KA 1XXMA 4KZ9A 1YSQA 2IWDA 4L9EA 1TEMA 4ZAMA 4DN0A 1YM1A 1OT9A 2V1ZA 3V39A 5EOEA 1IYSA 4EXOA 1EW0A 1EWZA 3IF5A 4PMAA 3MFXA 4BBUA 3H9WA 3QP8A 5L2FA 5E43A 2ZQ7A 3E0YA 1SKFA 2D01A 3HCYA 4FUWA 1K57C 2P7JA 4LV1A 3BJNA 2ZMAA 3VFHA 3PAEA 1W8YA 1ONHA 1CF0A 2R78A 3F1OA 4I3JA 4BENA 4IVKA 2PR5A 2INWA 4XUZA 2W1TA 2X71A 3RXXA 5G4YA 3T4KA 3R4KA 5E2FA 1XP4A 1YQSA 3V3SA 3MKFA 3UB6A 3Q82A 1LHYA 2ZQ8A 1W5DA 3Q7ZA 4OQ0A 5EVLA 3GV9A 3N4IA 4IUKA 1XFNA 4LRYC 3HLDA 4YWZA 3A3JA 4KZ6A 3A3DA 4GOGA 2PD8A 3T1RA 3ZG9B 3R7WB 4FTXA 3LICA 5AVFA 4X68A 4KZBA 2HDSA 3H7WA 4PAUA 1RGYA 4WUJA 3ZQ5A 4NXGA 3WS0A 4EWFA 3C7UA 1K38A 3V67A 3ULFA 3E4OA 4R6LA 4XXRA 2HDRA 4ARZA 5M1AA 2V9AA 4WM9A 5HZHA 2ZQAA 1ES5A 3CHWP 2Y2QA 2Y8HA 5EOOA 4KZ5A 3UE1A 1P9WA 2R9XA 1IELA 1S6RA 2WKRA 5FL3A 4PM9A 1N9LA 4IBRA 4R1GA 1H5XA 1Z09A 2GX5A 4UEYA 2XD5A 4YINA 4WMCD 2H0YA 4S2NC 1L0GA 2QJ7A 3K2NA 3IX4A 2H28A 4BL3A 4GCZA 4K08A 4E3LA 3A3FA 3W8KA 1PW8A 4LV3A 2W3HA 3OCNA 4S2JA 2ZC4B 1ESUA 3FKVA 3T4LA 3VSKA 4C6YA 1JNUA 1OPXA 3AGDA 2WK0A 5IU1A 2XA7S 3L7HA 5IHVA 2LB5A 2BASA 1HZOA 1DP6A 5F1GA 3P01A 2V1BA 1XGIA 1ZC2A 5K5BA 4ZBEA 4HJ6A 1T1BA 4OQHA 3S1YA 2VV7A 1XJ6A 2VGLS 3HLCA 2ZJ9A 4U0XA 3CPTA 3F1PA 1ZG4A 3NOPC 5HDCA 2XSSA 1ZG6A 5AQAA 4KG5A 4BQMA 3K3CA 5HARA 4FCFA 1MY8A 3VSLA 1TVFA 4X1MA 4Y15A 4H8RA 4JXSA 1GSVA 3KSFA 1K57A 2VJWA 3M2JA 3Q7VB 2XQZA 4EEPA 1K56A 4R4RA 3CZDA 1CQAA 4MBKA 4NETA 2H10A 4P6ZS 5A8BA 1GSWA 4R0QA 4BL2A 3N8LA 4X25A 3Q1FA 1DJBA 2VZWA 3ICYA 3TOIA 2ZM0A 1TDLA 2B02A 1G68A 3IQAA 3QP6A 3FG8A 4E3NA 2XFSA 2HF6A 1N4OA 2GJ3A 3VE4A 4GS9A 2JKRI 1PIOA 3UPPA 3O5YA 1OMEA 4FSFA 1Y4OA 2Y2PA 2AVXA 5EE8A 3LR3A 2PT7A 4PM8A 1XPBA 2P9VB 4OPZA 3T4QA 3G30A 2WADA 5CXWA 5F5YA 2HP9A 3B3XA 3MR0A 4XT2A 4RYEA 2GZAA 1CK3A 3SH7A 4KZAA 3FWLA 4X69A 3ZHHA 1MZUA 3EEAA 4QY5A 4II7A 4D60A 1TS7A 1DP8A 1VEUA 3T4SA 3LCEA 3C8CA 1TF1A 1W7FA 2FFYA 1OJ5A 1H8MA 2G2UA 1DP9A 3NCKA 4MBFA 3F1OB 3IF6C 2VGJA 5EM0A 4ZJ1A 3ITAA 5U47A 4DJ3A 2XROA 4RQ9A 3TE8A 1T18A 2XH9A 3BFFA 1PWDA 2WAEA 4QPRA 2W27A 4LGWA 4KQOA 5FA7A 3GECA 5IT5A 2ZQCA 4BJPA 2Z6CA 3NDEA 4S2OA 2PAVP 3FKWA 3PBQA 3PBRA 1IFQA 3LIDA 4GDNA 4R3JA 3NBLA 4ME4A 4Y0OA 3D9YA 5TBMB 3TRCA 1W79A 3HL9A 1Z6FA 1YLJA 5EVIA 1X0OA 4LCLA 3WS4A 4WBGA 1H8ZA 3OOVA 3N6IA 4N9KA 2A49A 3Q07A 2HDQA 5CGWA 2VK3A 1NRFA 4OQIA 2G7UA 2ZLYA 3CWFA 3F1NB 5DJUA 4EBPA 4OOYA 3WS2A 2PYPA 5CRFA 2BLSA 3E4QA 1GCEA 1F98A 2VLGA 2DMWA 3MQOA 3BLSA 4JXGA 2Y91A 5CEBA 4UA6A 3MF0A 1KVLA 1OTBA 4AFIA 2BTFP 3IH9A 2JKRM 1TS0A 4EUZA 3NHQA 4K0WA 2XFTA 4E3KA 4WLAA 3F1PB 2IA2A 2J80A 3BM6A 2JE5A 1ZTUA 1S1YA 3UN7A 5FQIA 3S4XA 4KZ7A 4MBHA 4H6JA 5F83A 4O0PA 5HWWA 3ZG0A 2Z2MB 3UDFA 1FOFA 3V50A 5GLDA 3KYQA 4QY6A 3SH9A 5CHJA 1TD5A 2ACGA 3RXWA 3N8SA 2QPNA 1ALQA 4S2MA 5I94A 3HUMA 5DJTA 2H5SA 3LY4A 2V8FA 3JYIA 1IKIA 5HL1A 3O88A 2XGNA 3ISGA 4GB7A 4I38A 5LBRA 3BFGA 5HWTA 4GHIA 5FAQA 3EGXC 1D1JA 4B9OA 3LR0A 3PHYA 1VETB 3KSGA 1K25A 4GN2A 5CTMA 5EPHA 4JXVA 2WGVA 2ZMVA 4UA7A 2WZXA 1LSWA 5JYPA 3GRJA 5KMWA 5FI2A 5D3OA 1W8QA 2IWBA 3KX0X 3HVFA 3I7JA 4DE3A 3FPVA 5J7EA 5GLCA 4P6BA 5J3WA 4FH2A 5FATA 4KUKA 1VHMA 4GD6A 4HI4A 5HD3A 1LLBA 3T4OA 1PNEA 3DTIA 2KOIA 3IXDA 3BFDA 3VOLA 3JPUA 4E3JA 3GSGA 2WYXA 5FQQA 3KYZA 3UB5P 2RL3A 2XA7M 2OWJA 3GMWA 4HBTA 3PAGA 4JXWA 4Q0JA 1HTZA 3MXQA 3U2AA 2ZOIA 5F6AA 4LENA 2HV1A 2OAQ1 2WUQA 3SS3A 1NZUA 4JGQA 4ESPA 3OPPA 1LL8A 4OP8A 2YKHA 3E2KA 5EVEA 4GD8A 1T19A 2VEAA 5DF7A 2QHKA 1MKMA 3G2YA 2ZM8A 4FOFA 1YLWA 4S2IA 1ESIA 2O9CA 3BLMA 4P6ZM 1IEMA 2W1RA 5DKLA 4WEKA 2M7UA 4EUVA 4Q8IA 2PBYA 1YT4A 4LPZA 5DTSA 5FDHA 4KQDA 1DJCA 2XLNA 5FSRA 1V9ZA 3EQUA 2EXBA 1S0WA 2K2NA 1OTDA 1FSYA 1FR1A 2PBDP 2M1CA 4QHCA 2P08A 4K91A 3ZG8B 2I9VA 4MN5A 2WKIA 4ETXA 1ODVA 3MFDA 1SHVA 2A24A 4BD0A 1FCNA 5TFQA 2OLUA 3UMEA 2Y2MA 3EOIA 5A92A 2PU2A 2EWVA 3FPWA 3IHAA 2WGWA 4WMCA 5A93A 5FI7A 2Q0OA 1E3UA 3S7NA 1IKGA 5HSQA 2W3FA 4X1LA 5BOHA 3OPRA 4BBVA 1FIKA 3GTCA 1E4DA 4EW7A 4HHDA 3L9KA 3IXHA 5L09A 5M19A 1GA0A 2C5WB 1PZOA 3A3EA 3SOIA 5CHMA 3C5AA 3VOZA 3ITBA 5I5LA 4X56A 4WL9A 4N1HA 4E3MA 4H6JB 4NXBA 3TJZC 3C30A 4CLCE 1K54A 3OCLA 3FZCA 4JF4A 3RJUA 4GZBA 2XR0A 3IF6B 5FI6A 4IUHA 3DAVA 3H82B 1Q2PA 3GQZA 4U3TA 5KSCA 1KGGA 3G35A 1D06A 2Y2KA 4PKYG 4XUXA 4MCWA 3FYZA 3MZDA 4WZ5A 2DCFA 1UWPX 5CGSA 4GHIB 4EV4A 5EM1A 1P97A 3NULA 1PWGA 2Y2JA 3IBRA 1Y28A 3FV7A 4CJNA 1P9RA 1N9NA 3PYPA 1L0DA 1GSXA 2Y79A 2X02A 2P74A 1W63Q 2JCHA 1SDEA 5FDSA 1Q2QA 1JTGA 3HLGA 2WKEA 3GDIA 3UE3A 2BG1A 2OSUA 2EX9A 1XA7A 1XJ2A 1XGJA 3IXGA 5EVIC 2B5RA 4F3LA 3PXPA 1O7EA 3VV4A 5TR7A 2J3TD 4RX3A 3IS2A 4OPYA 3E4PA 5FQ9A 4X55A 3UE0A 3MKEA 2KLIA 1SKOA 4Y7PA 1G6OA 2WKPA 4R70A 1LSVA 5AQBA 1UGUA 5FEGA 1K55A 1GHMA 2OWHA 3C7VA 1J3WA 3GR2A 4LRXC 5HL6A 4DMZA 3IWIA 4GLQA 2HDUA 3LY3A 4IEDA 4Y3IA 4B4XA 1GHPA 2JHEA 3U4LP 4P85A 2L1MA 2WKHA 4CLCC 3W4OA 5A91A 2VKSA 2HJEA 4HJ4A 2K7SA 3CI6A 1S1ZA 1CI9A 3SS4A 2Y2LA 1SZVA 5F68A 1WYCA 5EUAA 4KQRA 1YLTA 1YLPA 3IHBA 4DRTA 2ZQDA 4ZJ3A 3MSHA 3MMHA 1BTLA 3PBTA 3NOUC 1MWRA 4B4ZA 1MWSA 3WWXA 1AXBA 5HAPA 3VE3A 5GHXA 4P87A 3MZFA 3TG9A 5GLAA 2W1TB 1DRMA 2V2FF 1J9MA 2Q9NA 2ZMFA 3SH8A 5AQ7A 4N1XA 1VM1A 1NJ4A 1CEFA 3P98A 1H8YA 3ZG5A 2EXAA 2PD7A 4I39A 2WGWB 4HJ3A 3K3DA 2CC1A 1BLSA 4EQ1A 2O9BA 2QZ6A 1U60A 2V0WA 3H7WB 3G32A 2VA0A 2EX8A 4X53A 3BWLA 1PFLA 2D02A 1I2WA 1G28A 2Y2GA 4ARZB 3BFEA 4DF6A 4ZTKA 3O86A 4DE2A 1PRQA 3ZVTA 1YMXA 1K4FA 2RCXA 3WRTA 2Y55A 3C2WA 1IYOA 3T12B 1G6AA 3IBJA 2JKTI 1NZOA 4MN7A 1K6SA 1S66L 2LB9A 2OOLA 3LR4A 1CEGA 1KDWA 3HJKA 1S4RA 1XKZA 3UPOA 4JBFA 4MN6A 1S67L 3CAXA 1IOUA 3T1QB 5TGFA 1V9YA 3ZFZA 1BYWA 2GDNA 5KZHA 4G3VA 4Z1WA 2Y4AA 1NY0A 2V1AA 5GHYA 4OONA 5DKKA 3RFBA 4CLCA 5GLBA 1YMSA 3R7WA 2EA9A 3VFFA 1BUEA 5DFYA 5E2EA 2A3UA 2ZQ9A 1Y54A 1YLYA 3CPTB 1ERMA 1KE3A 2K31A 3BY8A 3LR5A 5HPIA 4LFUA 2WZZA 1TS8A 1T1CA 2JKGA 5HDDA 1D7EA 4QU3A 5CERA 4BD1A 3BYDA 3V3RA 1G5UA 2Y2HA 1ES2A 4KZ3A 2UV0E 2XDMA 5HDSA 2H0TA 2OV5A 3V5MA 2HPBA 2JC7A 3HLBA 3IH8A 4DE0A 3QP1A 4F3LB 2E8IA 3CLOA 4O8GA 4PM5A 4GKUA 4HH2A 2ZD8A 3MS6A 1I5QA 4DDSA 4HY8A 2WGIA 2B95A 4GS9B 3CMZA 1SKOB 4O7DA 2XEPA 1H3QA 1YAXA 3TW8A 3UPNA 4NXFA 2VV6A 2O0YA 4MEZA 3CG5A 5JYOA 1YPRA 1O07A 2JKFA 4KG2A 3B33A 4R4SA 4RA7A 3PBNA 1CJFA 2W3GA 4WELA 1KDSA 3HUOA 3LGOA 4OLDA 3UE6A 1K6RA 4XT2B 3QNCA 3Q81A 4JKTA 3G2ZA 4LCMA 3E2LA 3AGEA 4WEJA 3OBFA 3UDXA 3Q7VA 1ZHHB 4MLLA 1PW1A 4G3WA 3G34A 3NOTC 1BZAA 5MC7A 1K4EA 4KZ4A 4HH3A 5HPFA 1FILA 3DTKA 1VEUB 4IJGA 3LYXA 1HLUP 2QJ5A 3UMDA 1K54C 3KSHA 3ZYTA 4OOMA 3FC7A 4JGPA 4JPMA 3UY6A 1JVJA 1MKIA 3EQVA 3T4JA 1HVBA 4IBXA 3UB7A 4JGRA 4R23A 1PYYA 3ZNYA 4A5RA 4KQQA 3IX3A
chains in the Genus database with same CATH topology
1TS7A 3H82B 1DP8A 3EWKA 2NUTC 3PR6A 1D06A 1WA9A 4LRZE 2QWSA 3T4SA 1VB6A 4PKYG 4MCWA 4IHQA 4Q0HA 1STZA 1NWZA 3C8CA 1W63M 1TF1A 1KOUA 2VV8A 3KO6A 5J4EA 1OJ5A 4UQIM 1UWPX 1H8MA 2W3EA 2PHYA 1DP9A 4GHIB 4HP9A 1OTIA 1OTAA 1P97A 3NJAA 2O9AA 3IBRA 3F1OB 1Y28A 1S4SA 4YOFA 1P9RA 4DJ3A 2XROA 4RQ9A 3TE8A 1YSPA 2A2LA 1N9NA 1T18A 3IS2B 3PYPA 4EEUA 4QPRA 1XFQA 3B42A 3OC2A 5DFXA 1GSXA 5G4ZA 3H82A 2W27A 2Y79A 3CUEC 4KQOA 3LIAA 3GECA 5IT5A 5AJGA 3A0SA 4CLCD 2XRNA 1W63Q 2HGVA 2HJ9C 4BJPA 2Z6CA 3UE3A 3GDIA 3MQ0A 3PBQA 3PBRA 1IFQA 3LIDA 4GW9A 4WN5A 2Z6DA 4UQIS 1XJ2A 1OT6A 2B18A 4ME4A 4L9FA 5TBMB 3TRCA 3RH8B 5IS1A 4F3LA 4OOLA 4BWIA 5F69A 3PXPA 3VV4A 4O01A 2J3TD 1X0OA 3D3OA 3IS2A 3OOVA 3E4PA 1UWNX 3LIEA 4I5SA 4NKPA 3S7QA 3OLOA 2KLIA 4YNRA 3BQ8A 4IUHA 1G6OA 4CLCB 3D72A 2WKPA 4R70A 1LSXA 1LSVA 4HNBA 1UGUA 2G7UA 4Q0IA 4JGOA 3CWFA 3F1NB 2OWHA 3C38A 5DJUA 4PKYA 4WF0A 5TBMA 4LRXC 3CITA 5HL6A 4DMZA 4GLQA 2PYPA 3E98A 1LT0A 4I3IA 4Y3IA 3T50A 4B93A 2FZ0A 2JKTM 3E4QA 4L9GA 3PBSA 5TJJA 2JHEA 1F98A 1NLYA 2L1MA 2VLGA 2DMWA 3MQOA 5CX7A 4CLCC 2VKSA 2HJEA 4HJ4A 2K7SA 3CI6A 3MF0A 1S1ZA 1OTBA 5F68A 3BW6A 4ZRRA 5KSHA 2O99A 4AFIA 2L4RA 2JKRM 1TS0A 3NHQA 3B47A 1OTEA 3MMHA 2VGLM 4NEED 2CMNA 1XJ4A 2J3WA 2QKPA 3F1NA 3PBTA 3NOUC 1MC0A 4WLAA 2OAP1 3F1PB 2IA2A 2J80A 2KX6A 2J3TC 1NRJA 1ZTUA 3MQQA 1S1YA 3VE3A 3LUQA 3BQAA 3LFVA 4H6JA 4O0PA 5HWWA 4HP4A 3EGDC 2M7VA 4Y5FA 4Y2FA 5L8MA 2MJ6A 3LI9A 3KYQA 2W3DA 5EFWA 1NLZA 3BY9A 4G3KA 1YSQA 1TD5A 4R38A 2W1TB 4L9EA 1DRMA 3DBAA 4DN0A 1OT9A 5HWVA 2ZMFA 4CQHA 4EXOA 1EW0A 5DJTA 2VX8A 3MFXA 4BBUA 4NXEA 2PD7A 3H9WA 3CUEA 4I38A 4I39A 4HJ3A 3K3DA 5LBRA 3E0YA 2D01A 1TS6A 4EQ1A 3HCYA 2O9BA 2P7JA 5HWTA 4GJ4A 4GHIA 3BJNA 3EGXC 1XJ3A 2V0WA 3H7WB 3LR0A 4B9OA 3PHYA 2VA0A 3RTYA 3KSGA 2ZBBA 2R78A 3BWLA 3F1OA 2D02A 4I3JA 1G28A 2PR5A 2INWA 2P04A 2W1TA 1F9IA 3KSIA 5G4YA 3S7PA 3T4KA 4ARZB 3R4KA 3A0RA 2ZMVA 5C5KA 3UB6A 1LSWA 3C2WA 4IUKA 1XFNA 3KX0X 4LRYC 3SW1A 3IBJA 3FPVA 2JKTI 5J7EA 5DF9A 4YWZA 5J3WA 4MN7A 1YKDA 1S66L 2LB9A 2OOLA 2PD8A 3LR4A 4KUKA 3R7WB 1VHMA 2L0WA 4HOIA 3LICA 5AVFA 3HJKA 4HI4A 1S4RA 5AVEA 3H7WA 5HD3A 4PAUA 3T4OA 4WUJA 3ZQ5A 4NXGA 4R3AA 2KOIA 3T4TA 3P7NA 2KDKA 3V67A 3ULFA 4MN6A 4MMNA 3E4OA 4BBTA 1S67L 3CAXA 4R6LA 3VOLA 1IOUA 4ARZA 1V9YA 2V9AA 1BYWA 5HZHA 4G3VA 2FH5A 3KYZA 4Z1WA 2Y8HA 2XA7M 2OWJA 2V1AA 3HJIA 2JN7A 5DKKA 3RFBA 4CLCA 1P9WA 3LIBA 4Q0JA 4DJ2A 2WKRA 5FL3A 1N9LA 3MXQA 3U2AA 2ZOIA 5F6AA 4EERA 3R7WA 2EA9A 2PDRA 1F5MA 2QYBA 5DFYA 2GX5A 2HV1A 4UEYA 2OAQ1 2QJ7A 3K2NA 3W2ZA 4JGQA 2H28A 2K31A 3BY8A 3LR5A 5HPIA 4GCZA 4HIAA 4K08A 1TS8A 1T1CA 1LL8A 5HDDA 1D7EA 2YKHA 2W3HA 3OCNA 3MJQA 1T19A 2VEAA 2QHKA 1MKMA 4I3AA 3T4LA 4LLOB 1JNUA 1OPXA 5HDSA 5IU1A 2XA7S 4FOFA 2LB5A 2A24B 2BASA 4MDZA 1DP6A 2O9CA 4P6ZM 3P01A 2V1BA 2W1RA 5DKLA 4WEKA 2M7UA 5K5BA 4HJ6A 2NUPC 4EUVA 1T1BA 2VV7A 4LPZA 4KQDA 1XJ6A 4M4XA 4F3LB 2VGLS 1V9ZA 3CLOA 1N9OA 3F1PA 3EQUA 3NOPC 5HDCA 4O8GA 2XSSA 4HH2A 2K2NA 3K3CA 1OTDA 3JVVA 2WKQA 2M1CA 2P08A 1GSVA 3KSFA 3JVUA 3UB9A 2VJWA 4HY8A 2I9VA 4MN5A 4ETXA 4GS9B 1ODVA 3A0VA 1H3QA 1YAXA 4EEPA 3TW8A 4L0LA 2A24A 2VV6A 2O0YA 1T1AA 4NXFA 3LI8A 3PBOA 3B33A 3UMEA 3EOIA 1OJGA 4P6ZS 5A8BA 1GSWA 4EU0A 3PBNA 2V0UA 2W3GA 2EWWA 4WELA 2EWVA 3FPWA 3UE6A 2VZWA 3ICYA 2B02A 4XT2B 2PR6A 3FG8A 2HF6A 4PHTA 4KUOA 3S7NA 3S7OA 2GJ3A 5HSQA 2W3FA 4WEJA 3VE4A 3OBFA 4GS9A 1ZHHB 4BBVA 2GNXA 5KIZA 2JKRI 4G3WA 3NOTC 5MC7A 4EW7A 4HQAA 4HH3A 3O5YA 5HPFA 4HHDA 4FSFA 4IJGA 3LYXA 4BMWA 3LR3A 3UB8A 2PT7A 2QJ5A 3UMDA 2W0NA 3KSHA 3T4QA 3ZYTA 5F5YA 5I5LA 4WL9A 3MR0A 4H6JB 4NXBA 3FC7A 4JGPA 4OOMA 3TJZC 4XT2A 3C30A 4CLCE 2GZAA 2YKFA 2ZOHA 5HD5A 3EQVA 3OCLA 4ETZA 3T4JA 3UB7A 1MZUA 4JGRA 3EEAA 2PYRA 4EETB 1P0ZA 4EESA 3EEHA 3LIFA 4II7A 4E04A 3G6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TS7 A;  3H82 B;  1DP8 A;  3EWK A;  1D06 A;  1WA9 A;  4LRZ E;  2QWS A;  1VB6 A;  4PKY G;  1NWZ A;  3C8C A;  1KOU A;  2VV8 A;  5J4E A;  1OJ5 A;  1UWP X;  2PHY A;  1DP9 A;  4GHI B;  4HP9 A;  1OTI A;  1OTA A;  1P97 A;  3NJA A;  3IBR A;  3F1O B;  1Y28 A;  1S4S A;  4DJ3 A;  4RQ9 A;  1N9N A;  1T18 A;  3IS2 B;  3PYP A;  4EEU A;  1XFQ A;  1GSX A;  5G4Z A;  3H82 A;  2W27 A;  3LIA A;  3GEC A;  3A0S A;  2Z6C A;  3GDI A;  3LID A;  4GW9 A;  4WN5 A;  2Z6D A;  1XJ2 A;  1OT6 A;  4L9F A;  5TBM B;  3RH8 B;  5IS1 A;  4F3L A;  5F69 A;  1X0O A;  3IS2 A;  3E4P A;  1UWN X;  3LIE A;  4I5S A;  3OLO A;  3D72 A;  2WKP A;  4R70 A;  1LSX A;  1LSV A;  4HNB A;  1UGU A;  4JGO A;  3CWF A;  3F1N B;  2OWH A;  5DJU A;  4PKY A;  4WF0 A;  5TBM A;  4LRX C;  2PYP A;  1LT0 A;  4I3I A;  3T50 A;  3E4Q A;  4L9G A;  2JHE A;  1F98 A;  2L1M A;  2VLG A;  3MQO A;  4HJ4 A;  2K7S A;  1S1Z A;  1OTB A;  5F68 A;  2L4R A;  1TS0 A;  3NHQ A;  1OTE A;  2CMN A;  1XJ4 A;  2QKP A;  3F1N A;  3NOU C;  4WLA A;  3F1P B;  2J80 A;  2KX6 A;  3MQQ A;  1S1Y A;  3VE3 A;  3LUQ A;  4H6J A;  5HWW A;  4HP4 A;  3LI9 A;  5EFW A;  3BY9 A;  4R38 A;  4L9E A;  1DRM A;  1OT9 A;  5HWV A;  4EXO A;  1EW0 A;  5DJT A;  3MFX A;  4BBU A;  4NXE A;  2PD7 A;  3H9W A;  4I38 A;  4I39 A;  4HJ3 A;  3K3D A;  4EQ1 A;  2D01 A;  1TS6 A;  2P7J A;  5HWT A;  4GHI A;  1XJ3 A;  2V0W A;  3H7W B;  4B9O A;  3PHY A;  3RTY A;  2ZBB A;  2R78 A;  3BWL A;  3F1O A;  2D02 A;  4I3J A;  1G28 A;  2PR5 A;  2INW A;  1F9I A;  5G4Y A;  3A0R A;  3UB6 A;  1LSW A;  3C2W A;  1XFN A;  3KX0 X;  4LRY C;  3SW1 A;  5J7E A;  4YWZ A;  5J3W A;  1S66 L;  2OOL A;  2PD8 A;  4KUK A;  2L0W A;  4HOI A;  3LIC A;  5AVF A;  3HJK A;  4HI4 A;  1S4R A;  5AVE A;  3H7W A;  5HD3 A;  4WUJ A;  3ZQ5 A;  4NXG A;  4R3A A;  3P7N A;  2KDK A;  3ULF A;  4MN6 A;  3E4O A;  4BBT A;  1S67 L;  3CAX A;  4R6L A;  3VOL A;  1V9Y A;  2V9A A;  1BYW A;  5HZH A;  2OWJ A;  2V1A A;  3HJI A;  2JN7 A;  5DKK A;  3LIB A;  4DJ2 A;  2WKR A;  1N9L A;  3MXQ A;  2ZOI A;  5F6A A;  4EER A;  2EA9 A;  2PDR A;  2HV1 A;  2QJ7 A;  4JGQ A;  2H28 A;  3BY8 A;  4GCZ A;  4HIA A;  4K08 A;  1TS8 A;  1T1C A;  1LL8 A;  5HDD A;  1D7E A;  2YKH A;  3MJQ A;  1T19 A;  2VEA A;  2QHK A;  4I3A A;  4LLO B;  1JNU A;  5HDS A;  5IU1 A;  2A24 B;  2BAS A;  1DP6 A;  2V1B A;  5DKL A;  4HJ6 A;  1T1B A;  2VV7 A;  4LPZ A;  4KQD A;  1XJ6 A;  4M4X A;  4F3L B;  1V9Z A;  3CLO A;  1N9O A;  3F1P A;  3NOP C;  5HDC A;  4HH2 A;  3K3C A;  1OTD A;  2WKQ A;  2M1C A;  1GSV A;  3UB9 A;  4HY8 A;  2I9V A;  4MN5 A;  4GS9 B;  1ODV A;  3A0V A;  4EEP A;  2A24 A;  2VV6 A;  4NXF A;  1T1A A;  3LI8 A;  3B33 A;  3UME A;  5A8B A;  1OJG A;  1GSW A;  2V0U A;  3UE6 A;  3ICY A;  2B02 A;  4XT2 B;  2PR6 A;  3FG8 A;  4KUO A;  2GJ3 A;  5HSQ A;  3VE4 A;  4GS9 A;  4BBV A;  5KIZ A;  3NOT C;  4EW7 A;  4HQA A;  4HH3 A;  4HHD A;  3LYX A;  3UB8 A;  2QJ5 A;  3UMD A;  2W0N A;  5F5Y A;  5I5L A;  4WL9 A;  3MR0 A;  4H6J B;  4NXB A;  3FC7 A;  4JGP A;  4XT2 A;  2YKF A;  2ZOH A;  5HD5 A;  3UB7 A;  1MZU A;  4JGR A;  2PYR A;  4EET B;  1P0Z A;  4EES A;  3EEH A;  3LIF A;  4E04 A;  3G6O A; 
#chains in the Genus database with same CATH topology
 2Y59 A;  3EWK A;  4E3O A;  4WZ5 C;  3SZT A;  3PR6 A;  3C4P A;  4FD8 A;  4LRZ E;  1NYY A;  2QWS A;  1VB6 A;  1LI9 A;  4IHQ A;  3DWK A;  4Q0H A;  1STZ A;  1NWZ A;  1W63 M;  1KOU A;  3KO6 A;  1MWT A;  2PHY A;  2ZC6 B;  4HP9 A;  3HLF A;  1OTI A;  1OTA A;  3NJA A;  2J7V A;  2O9A A;  2VGK A;  1MPL A;  1S4S A;  3WS1 A;  4YOF A;  3DWZ A;  5EVI B;  5CTN A;  5FQJ A;  2A2L A;  2HP5 A;  5FQK A;  4EEU A;  5FEF A;  2IWC A;  5CHU A;  5DFX A;  3CUE C;  3LIA A;  4HBU A;  3VMA A;  3A0S A;  4BLM A;  3BEC A;  4DKI A;  3MQ0 A;  1MXO A;  3HRE A;  3O87 A;  4GW9 A;  5CED A;  2X01 A;  4UQI S;  3WRZ A;  4DXB A;  5EEC A;  4KZ8 A;  4L9F A;  3RH8 B;  4JF5 A;  5IS1 A;  1KGF A;  4OOL A;  4BWI A;  5F69 A;  2V20 A;  4O01 A;  1FCO A;  2E8J A;  2Y2I A;  4EQI A;  5DVA A;  3OZH A;  4RVA A;  3BRM A;  3NDG A;  3S7Q A;  3QHY A;  5M18 A;  2J9P A;  1K55 C;  3HUN A;  4CLC B;  1LSX A;  1BT5 A;  4HNB A;  4Y13 A;  4K0X A;  2I72 A;  4MNR A;  1PI5 A;  4WF0 A;  1F2K A;  3P09 A;  4ZJ2 A;  3IWO A;  5TBM A;  2ZC5 B;  4DDY A;  3E98 A;  3QNB A;  3N8R A;  2FZ0 A;  4L9G A;  3PBS A;  1AWI A;  3IWQ A;  5FAO A;  4QB8 A;  2XF3 A;  3NIA A;  4ZRR A;  3G4P A;  4JF6 A;  2L4R A;  3DTE A;  3ZG7 B;  2CMN A;  3F1N A;  3W4P A;  2JBF A;  5FAS A;  2OAP 1;  2DNS A;  2KX6 A;  3HBR A;  1MBL A;  4IVI A;  1NRJ A;  3ZVW A;  5J8X A;  1BSG A;  3MQQ A;  1KGE A;  1E3U D;  3G31 A;  1L2S A;  4ID4 A;  3OPL A;  3LFV A;  5G18 A;  4HP4 A;  4Y5F A;  4Y2F A;  2DRW A;  3DTM A;  2MJ6 A;  2W3D A;  4OPQ A;  3BY9 A;  4R38 A;  1ERQ A;  1KE0 A;  3HLW A;  4UHU A;  3D4F A;  5DTT A;  3DBA A;  3TSG A;  1LL5 A;  4C75 A;  5HWV A;  3T1S A;  4DXC A;  2EFX A;  4CQH A;  3MXS A;  1DY6 A;  1GA9 A;  4JLF A;  2VX8 A;  1IYQ A;  1K0K A;  4NXE A;  1HD8 A;  3CUE A;  1TS6 A;  2Q9M A;  1I2S A;  4GJ4 A;  1XJ3 A;  4GDB A;  4QD4 A;  4R3B A;  4Y17 A;  5HAI A;  3RTY A;  4Y0U A;  4Y0T A;  2HZ5 A;  1FQG A;  2ZBB A;  1YLZ A;  1PI4 A;  2P04 A;  1F9I A;  3KSI A;  4LV0 A;  3S7P A;  1PWC A;  3A0R A;  4ZDX A;  5C5K A;  5GHZ A;  3GVB A;  4OVD A;  2ZL1 A;  1H0M A;  3SW1 A;  5DF9 A;  1M6K A;  4X6T A;  1YKD A;  2EX6 A;  3WS5 A;  3QP2 A;  2L0W A;  4HOI A;  5AVE A;  1QMF A;  3VP4 A;  1VET A;  4R3A A;  3VP2 A;  3T4T A;  1BLC A;  3P7N A;  2KDK A;  1ES4 A;  4MMN A;  4BBT A;  1L0E A;  5F82 A;  2FFF B;  1KE4 A;  1C3B A;  3LEZ A;  2FH5 A;  1K56 D;  3ZDJ A;  4EBL A;  3HJI A;  2J9O A;  2JN7 A;  2PU4 A;  1ONG A;  3O3V A;  2Y2O A;  4DE1 A;  5HW3 A;  2V8C A;  3LIB A;  3M6H A;  4DJ2 A;  1M40 A;  1E25 A;  3ZNT A;  4EER A;  1DJA A;  2XK1 A;  3LO7 A;  3IXB A;  2PDR A;  1F5M A;  2J8Y A;  4OKP A;  4OPR A;  4B88 A;  3ZCZ A;  5DTK A;  3W2Z A;  3W4Q A;  3NY4 A;  4HIA A;  4S2N A;  1RP5 A;  3MJQ A;  5L10 A;  4I3A A;  1ES3 A;  3OPH A;  4LLO B;  2C6W B;  3NEC A;  1BUL A;  1NYM A;  2A24 B;  2OLV A;  4MDZ A;  3VP1 A;  4OQG A;  2XD1 A;  1XX2 A;  2ZM2 A;  1WYB A;  2NUP C;  5HAQ A;  3ZGA B;  4M4X A;  1A0K A;  1N9O A;  4OH0 A;  1KVM A;  2EFU A;  3JVV A;  2WKQ A;  4RX2 A;  1NXY A;  3JVU A;  3UB9 A;  1ACF A;  4NK3 A;  4E6X A;  5CGX A;  4WZ4 A;  3VP3 A;  4C3Q A;  3A0V A;  4L0L A;  3NC8 A;  1T1A A;  4QWO A;  3LI8 A;  3PBO A;  1GHI A;  1N9B A;  1OJG A;  3MBZ A;  4EU0 A;  2V0U A;  4UA9 A;  4S2K A;  2EWW A;  1VQQ A;  4PPR A;  5E2H A;  5FAP A;  3BFC A;  5CEC A;  2PR6 A;  2ZC3 B;  4PHT A;  4KUO A;  3VOY A;  4S2P A;  3S7O A;  2EX2 A;  4GNU A;  2GNX A;  5KIZ A;  3QP5 A;  4WYY A;  4QJG A;  2UWX A;  5FQM A;  4HQA A;  3HLE A;  1RCJ A;  2ZC7 A;  3IT9 A;  3NI9 A;  3QP4 A;  4BMW A;  3UB8 A;  5EV0 A;  2W0N A;  3PTE A;  4KG6 A;  3IX8 A;  2YKF A;  2ZOH A;  1MWU A;  5HD5 A;  4ETZ A;  4D2O A;  4YFM A;  5EVI D;  2PYR A;  4EET B;  1P0Z A;  4EES A;  1JWP A;  3EEH A;  3LIF A;  4E04 A;  3G6O A;  2QYB A;  4EBN A;  1FCM A;  2Z2L B;  2G2W A;  2NUT C;  5F1F A;  1PZP A;  3AGF A;  3M2K A;  1WA9 A;  1JTD A;  2VV8 A;  5J4E A;  4UQI M;  2W3E A;  2Y2N A;  5HX9 A;  3UDI A;  4E3I A;  1RGZ A;  1SCW A;  3T1X A;  4OP5 A;  2QMI A;  3LEQ A;  1FSW A;  1ERO A;  1YSP A;  3IS2 B;  1QME A;  3IF6 A;  1XFQ A;  3B42 A;  3OC2 A;  5G4Z A;  5L07 A;  3H82 A;  3CJM A;  5AJG A;  5GL9 A;  3MZE A;  4CLC D;  4F94 A;  2XRN A;  2HGV A;  2HJ9 C;  2ZL1 B;  1L0F A;  2WAF A;  4CPK A;  5AQ9 A;  4N9L A;  4WN5 A;  2Z6D A;  3N7W A;  1OT6 A;  2B18 A;  3UNW A;  3VP0 A;  4KEN B;  1BLP A;  1FR6 A;  3D3O A;  2R9W A;  5HFO A;  1UWN X;  3LIE A;  4I5S A;  4NKP A;  4UAA A;  4U0T A;  4PM6 A;  3OLO A;  4YNR A;  1XA1 A;  3BQ8 A;  3KYE A;  1SDN A;  4FH4 A;  3D72 A;  4NG2 A;  4N92 A;  5A90 A;  4Q0I A;  1LL9 A;  1CI8 A;  4JGO A;  3C38 A;  3SS5 A;  4PKY A;  3DW0 A;  4P0M A;  4LV2 A;  1IYP A;  3CIT A;  5DF8 A;  2PRF A;  1LT0 A;  1LI0 A;  4I3I A;  3T50 A;  4B93 A;  1ZKJ A;  1L3L A;  2JKT M;  5TJJ A;  1NLY A;  1EI5 A;  4HES A;  5CX7 A;  3S22 A;  4Z9Q A;  1JWV A;  4OLG A;  3C4O A;  3A3I A;  1BLH A;  3BW6 A;  5KSH A;  2O99 A;  1JWZ A;  5E2G A;  3BEB A;  3B47 A;  1OTE A;  3MXR A;  2VGL M;  4NEE D;  4M3K A;  1XJ4 A;  2HP6 A;  2J3W A;  2QKP A;  1MC0 A;  4E6W A;  2J3T C;  4PM7 A;  2P9V A;  3LUQ A;  3UO9 A;  1WE4 A;  3BQA A;  3EGD C;  2M7V A;  5L8M A;  3M6B A;  3LI9 A;  5EFW A;  4S2L A;  1NLZ A;  1TDG A;  4HEF A;  4G3K A;  1XXM A;  4KZ9 A;  1YSQ A;  2IWD A;  4L9E A;  1TEM A;  4ZAM A;  4DN0 A;  1YM1 A;  1OT9 A;  2V1Z A;  3V39 A;  5EOE A;  1IYS A;  4EXO A;  1EW0 A;  1EWZ A;  3IF5 A;  4PMA A;  3MFX A;  4BBU A;  3H9W A;  3QP8 A;  5L2F A;  5E43 A;  2ZQ7 A;  3E0Y A;  1SKF A;  2D01 A;  3HCY A;  4FUW A;  1K57 C;  2P7J A;  4LV1 A;  3BJN A;  2ZMA A;  3VFH A;  3PAE A;  1W8Y A;  1ONH A;  1CF0 A;  2R78 A;  3F1O A;  4I3J A;  4BEN A;  4IVK A;  2PR5 A;  2INW A;  4XUZ A;  2W1T A;  2X71 A;  3RXX A;  5G4Y A;  3T4K A;  3R4K A;  5E2F A;  1XP4 A;  1YQS A;  3V3S A;  3MKF A;  3UB6 A;  3Q82 A;  1LHY A;  2ZQ8 A;  1W5D A;  3Q7Z A;  4OQ0 A;  5EVL A;  3GV9 A;  3N4I A;  4IUK A;  1XFN A;  4LRY C;  3HLD A;  4YWZ A;  3A3J A;  4KZ6 A;  3A3D A;  4GOG A;  2PD8 A;  3T1R A;  3ZG9 B;  3R7W B;  4FTX A;  3LIC A;  5AVF A;  4X68 A;  4KZB A;  2HDS A;  3H7W A;  4PAU A;  1RGY A;  4WUJ A;  3ZQ5 A;  4NXG A;  3WS0 A;  4EWF A;  3C7U A;  1K38 A;  3V67 A;  3ULF A;  3E4O A;  4R6L A;  4XXR A;  2HDR A;  4ARZ A;  5M1A A;  2V9A A;  4WM9 A;  5HZH A;  2ZQA A;  1ES5 A;  3CHW P;  2Y2Q A;  2Y8H A;  5EOO A;  4KZ5 A;  3UE1 A;  1P9W A;  2R9X A;  1IEL A;  1S6R A;  2WKR A;  5FL3 A;  4PM9 A;  1N9L A;  4IBR A;  4R1G A;  1H5X A;  1Z09 A;  2GX5 A;  4UEY A;  2XD5 A;  4YIN A;  4WMC D;  2H0Y A;  4S2N C;  1L0G A;  2QJ7 A;  3K2N A;  3IX4 A;  2H28 A;  4BL3 A;  4GCZ A;  4K08 A;  4E3L A;  3A3F A;  3W8K A;  1PW8 A;  4LV3 A;  2W3H A;  3OCN A;  4S2J A;  2ZC4 B;  1ESU A;  3FKV A;  3T4L A;  3VSK A;  4C6Y A;  1JNU A;  1OPX A;  3AGD A;  2WK0 A;  5IU1 A;  2XA7 S;  3L7H A;  5IHV A;  2LB5 A;  2BAS A;  1HZO A;  1DP6 A;  5F1G A;  3P01 A;  2V1B A;  1XGI A;  1ZC2 A;  5K5B A;  4ZBE A;  4HJ6 A;  1T1B A;  4OQH A;  3S1Y A;  2VV7 A;  1XJ6 A;  2VGL S;  3HLC A;  2ZJ9 A;  4U0X A;  3CPT A;  3F1P A;  1ZG4 A;  3NOP C;  5HDC A;  2XSS A;  1ZG6 A;  5AQA A;  4KG5 A;  4BQM A;  3K3C A;  5HAR A;  4FCF A;  1MY8 A;  3VSL A;  1TVF A;  4X1M A;  4Y15 A;  4H8R A;  4JXS A;  1GSV A;  3KSF A;  1K57 A;  2VJW A;  3M2J A;  3Q7V B;  2XQZ A;  4EEP A;  1K56 A;  4R4R A;  3CZD A;  1CQA A;  4MBK A;  4NET A;  2H10 A;  4P6Z S;  5A8B A;  1GSW A;  4R0Q A;  4BL2 A;  3N8L A;  4X25 A;  3Q1F A;  1DJB A;  2VZW A;  3ICY A;  3TOI A;  2ZM0 A;  1TDL A;  2B02 A;  1G68 A;  3IQA A;  3QP6 A;  3FG8 A;  4E3N A;  2XFS A;  2HF6 A;  1N4O A;  2GJ3 A;  3VE4 A;  4GS9 A;  2JKR I;  1PIO A;  3UPP A;  3O5Y A;  1OME A;  4FSF A;  1Y4O A;  2Y2P A;  2AVX A;  5EE8 A;  3LR3 A;  2PT7 A;  4PM8 A;  1XPB A;  2P9V B;  4OPZ A;  3T4Q A;  3G30 A;  2WAD A;  5CXW A;  5F5Y A;  2HP9 A;  3B3X A;  3MR0 A;  4XT2 A;  4RYE A;  2GZA A;  1CK3 A;  3SH7 A;  4KZA A;  3FWL A;  4X69 A;  3ZHH A;  1MZU A;  3EEA A;  4QY5 A;  4II7 A;  4D60 A;  1TS7 A;  1DP8 A;  1VEU A;  3T4S A;  3LCE A;  3C8C A;  1TF1 A;  1W7F A;  2FFY A;  1OJ5 A;  1H8M A;  2G2U A;  1DP9 A;  3NCK A;  4MBF A;  3F1O B;  3IF6 C;  2VGJ A;  5EM0 A;  4ZJ1 A;  3ITA A;  5U47 A;  4DJ3 A;  2XRO A;  4RQ9 A;  3TE8 A;  1T18 A;  2XH9 A;  3BFF A;  1PWD A;  2WAE A;  4QPR A;  2W27 A;  4LGW A;  4KQO A;  5FA7 A;  3GEC A;  5IT5 A;  2ZQC A;  4BJP A;  2Z6C A;  3NDE A;  4S2O A;  2PAV P;  3FKW A;  3PBQ A;  3PBR A;  1IFQ A;  3LID A;  4GDN A;  4R3J A;  3NBL A;  4ME4 A;  4Y0O A;  3D9Y A;  5TBM B;  3TRC A;  1W79 A;  3HL9 A;  1Z6F A;  1YLJ A;  5EVI A;  1X0O A;  4LCL A;  3WS4 A;  4WBG A;  1H8Z A;  3OOV A;  3N6I A;  4N9K A;  2A49 A;  3Q07 A;  2HDQ A;  5CGW A;  2VK3 A;  1NRF A;  4OQI A;  2G7U A;  2ZLY A;  3CWF A;  3F1N B;  5DJU A;  4EBP A;  4OOY A;  3WS2 A;  2PYP A;  5CRF A;  2BLS A;  3E4Q A;  1GCE A;  1F98 A;  2VLG A;  2DMW A;  3MQO A;  3BLS A;  4JXG A;  2Y91 A;  5CEB A;  4UA6 A;  3MF0 A;  1KVL A;  1OTB A;  4AFI A;  2BTF P;  3IH9 A;  2JKR M;  1TS0 A;  4EUZ A;  3NHQ A;  4K0W A;  2XFT A;  4E3K A;  4WLA A;  3F1P B;  2IA2 A;  2J80 A;  3BM6 A;  2JE5 A;  1ZTU A;  1S1Y A;  3UN7 A;  5FQI A;  3S4X A;  4KZ7 A;  4MBH A;  4H6J A;  5F83 A;  4O0P A;  5HWW A;  3ZG0 A;  2Z2M B;  3UDF A;  1FOF A;  3V50 A;  5GLD A;  3KYQ A;  4QY6 A;  3SH9 A;  5CHJ A;  1TD5 A;  2ACG A;  3RXW A;  3N8S A;  2QPN A;  1ALQ A;  4S2M A;  5I94 A;  3HUM A;  5DJT A;  2H5S A;  3LY4 A;  2V8F A;  3JYI A;  1IKI A;  5HL1 A;  3O88 A;  2XGN A;  3ISG A;  4GB7 A;  4I38 A;  5LBR A;  3BFG A;  5HWT A;  4GHI A;  5FAQ A;  3EGX C;  1D1J A;  4B9O A;  3LR0 A;  3PHY A;  1VET B;  3KSG A;  1K25 A;  4GN2 A;  5CTM A;  5EPH A;  4JXV A;  2WGV A;  2ZMV A;  4UA7 A;  2WZX A;  1LSW A;  5JYP A;  3GRJ A;  5KMW A;  5FI2 A;  5D3O A;  1W8Q A;  2IWB A;  3KX0 X;  3HVF A;  3I7J A;  4DE3 A;  3FPV A;  5J7E A;  5GLC A;  4P6B A;  5J3W A;  4FH2 A;  5FAT A;  4KUK A;  1VHM A;  4GD6 A;  4HI4 A;  5HD3 A;  1LLB A;  3T4O A;  1PNE A;  3DTI A;  2KOI A;  3IXD A;  3BFD A;  3VOL A;  3JPU A;  4E3J A;  3GSG A;  2WYX A;  5FQQ A;  3KYZ A;  3UB5 P;  2RL3 A;  2XA7 M;  2OWJ A;  3GMW A;  4HBT A;  3PAG A;  4JXW A;  4Q0J A;  1HTZ A;  3MXQ A;  3U2A A;  2ZOI A;  5F6A A;  4LEN A;  2HV1 A;  2OAQ 1;  2WUQ A;  3SS3 A;  1NZU A;  4JGQ A;  4ESP A;  3OPP A;  1LL8 A;  4OP8 A;  2YKH A;  3E2K A;  5EVE A;  4GD8 A;  1T19 A;  2VEA A;  5DF7 A;  2QHK A;  1MKM A;  3G2Y A;  2ZM8 A;  4FOF A;  1YLW A;  4S2I A;  1ESI A;  2O9C A;  3BLM A;  4P6Z M;  1IEM A;  2W1R A;  5DKL A;  4WEK A;  2M7U A;  4EUV A;  4Q8I A;  2PBY A;  1YT4 A;  4LPZ A;  5DTS A;  5FDH A;  4KQD A;  1DJC A;  2XLN A;  5FSR A;  1V9Z A;  3EQU A;  2EXB A;  1S0W A;  2K2N A;  1OTD A;  1FSY A;  1FR1 A;  2PBD P;  2M1C A;  4QHC A;  2P08 A;  4K91 A;  3ZG8 B;  2I9V A;  4MN5 A;  2WKI A;  4ETX A;  1ODV A;  3MFD A;  1SHV A;  2A24 A;  4BD0 A;  1FCN A;  5TFQ A;  2OLU A;  3UME A;  2Y2M A;  3EOI A;  5A92 A;  2PU2 A;  2EWV A;  3FPW A;  3IHA A;  2WGW A;  4WMC A;  5A93 A;  5FI7 A;  2Q0O A;  1E3U A;  3S7N A;  1IKG A;  5HSQ A;  2W3F A;  4X1L A;  5BOH A;  3OPR A;  4BBV A;  1FIK A;  3GTC A;  1E4D A;  4EW7 A;  4HHD A;  3L9K A;  3IXH A;  5L09 A;  5M19 A;  1GA0 A;  2C5W B;  1PZO A;  3A3E A;  3SOI A;  5CHM A;  3C5A A;  3VOZ A;  3ITB A;  5I5L A;  4X56 A;  4WL9 A;  4N1H A;  4E3M A;  4H6J B;  4NXB A;  3TJZ C;  3C30 A;  4CLC E;  1K54 A;  3OCL A;  3FZC A;  4JF4 A;  3RJU A;  4GZB A;  2XR0 A;  3IF6 B;  5FI6 A;  4IUH A;  3DAV A;  3H82 B;  1Q2P A;  3GQZ A;  4U3T A;  5KSC A;  1KGG A;  3G35 A;  1D06 A;  2Y2K A;  4PKY G;  4XUX A;  4MCW A;  3FYZ A;  3MZD A;  4WZ5 A;  2DCF A;  1UWP X;  5CGS A;  4GHI B;  4EV4 A;  5EM1 A;  1P97 A;  3NUL A;  1PWG A;  2Y2J A;  3IBR A;  1Y28 A;  3FV7 A;  4CJN A;  1P9R A;  1N9N A;  3PYP A;  1L0D A;  1GSX A;  2Y79 A;  2X02 A;  2P74 A;  1W63 Q;  2JCH A;  1SDE A;  5FDS A;  1Q2Q A;  1JTG A;  3HLG A;  2WKE A;  3GDI A;  3UE3 A;  2BG1 A;  2OSU A;  2EX9 A;  1XA7 A;  1XJ2 A;  1XGJ A;  3IXG A;  5EVI C;  2B5R A;  4F3L A;  3PXP A;  1O7E A;  3VV4 A;  5TR7 A;  2J3T D;  4RX3 A;  3IS2 A;  4OPY A;  3E4P A;  5FQ9 A;  4X55 A;  3UE0 A;  3MKE A;  2KLI A;  1SKO A;  4Y7P A;  1G6O A;  2WKP A;  4R70 A;  1LSV A;  5AQB A;  1UGU A;  5FEG A;  1K55 A;  1GHM A;  2OWH A;  3C7V A;  1J3W A;  3GR2 A;  4LRX C;  5HL6 A;  4DMZ A;  3IWI A;  4GLQ A;  2HDU A;  3LY3 A;  4IED A;  4Y3I A;  4B4X A;  1GHP A;  2JHE A;  3U4L P;  4P85 A;  2L1M A;  2WKH A;  4CLC C;  3W4O A;  5A91 A;  2VKS A;  2HJE A;  4HJ4 A;  2K7S A;  3CI6 A;  1S1Z A;  1CI9 A;  3SS4 A;  2Y2L A;  1SZV A;  5F68 A;  1WYC A;  5EUA A;  4KQR A;  1YLT A;  1YLP A;  3IHB A;  4DRT A;  2ZQD A;  4ZJ3 A;  3MSH A;  3MMH A;  1BTL A;  3PBT A;  3NOU C;  1MWR A;  4B4Z A;  1MWS A;  3WWX A;  1AXB A;  5HAP A;  3VE3 A;  5GHX A;  4P87 A;  3MZF A;  3TG9 A;  5GLA A;  2W1T B;  1DRM A;  2V2F F;  1J9M A;  2Q9N A;  2ZMF A;  3SH8 A;  5AQ7 A;  4N1X A;  1VM1 A;  1NJ4 A;  1CEF A;  3P98 A;  1H8Y A;  3ZG5 A;  2EXA A;  2PD7 A;  4I39 A;  2WGW B;  4HJ3 A;  3K3D A;  2CC1 A;  1BLS A;  4EQ1 A;  2O9B A;  2QZ6 A;  1U60 A;  2V0W A;  3H7W B;  3G32 A;  2VA0 A;  2EX8 A;  4X53 A;  3BWL A;  1PFL A;  2D02 A;  1I2W A;  1G28 A;  2Y2G A;  4ARZ B;  3BFE A;  4DF6 A;  4ZTK A;  3O86 A;  4DE2 A;  1PRQ A;  3ZVT A;  1YMX A;  1K4F A;  2RCX A;  3WRT A;  2Y55 A;  3C2W A;  1IYO A;  3T12 B;  1G6A A;  3IBJ A;  2JKT I;  1NZO A;  4MN7 A;  1K6S A;  1S66 L;  2LB9 A;  2OOL A;  3LR4 A;  1CEG A;  1KDW A;  3HJK A;  1S4R A;  1XKZ A;  3UPO A;  4JBF A;  4MN6 A;  1S67 L;  3CAX A;  1IOU A;  3T1Q B;  5TGF A;  1V9Y A;  3ZFZ A;  1BYW A;  2GDN A;  5KZH A;  4G3V A;  4Z1W A;  2Y4A A;  1NY0 A;  2V1A A;  5GHY A;  4OON A;  5DKK A;  3RFB A;  4CLC A;  5GLB A;  1YMS A;  3R7W A;  2EA9 A;  3VFF A;  1BUE A;  5DFY A;  5E2E A;  2A3U A;  2ZQ9 A;  1Y54 A;  1YLY A;  3CPT B;  1ERM A;  1KE3 A;  2K31 A;  3BY8 A;  3LR5 A;  5HPI A;  4LFU A;  2WZZ A;  1TS8 A;  1T1C A;  2JKG A;  5HDD A;  1D7E A;  4QU3 A;  5CER A;  4BD1 A;  3BYD A;  3V3R A;  1G5U A;  2Y2H A;  1ES2 A;  4KZ3 A;  2UV0 E;  2XDM A;  5HDS A;  2H0T A;  2OV5 A;  3V5M A;  2HPB A;  2JC7 A;  3HLB A;  3IH8 A;  4DE0 A;  3QP1 A;  4F3L B;  2E8I A;  3CLO A;  4O8G A;  4PM5 A;  4GKU A;  4HH2 A;  2ZD8 A;  3MS6 A;  1I5Q A;  4DDS A;  4HY8 A;  2WGI A;  2B95 A;  4GS9 B;  3CMZ A;  1SKO B;  4O7D A;  2XEP A;  1H3Q A;  1YAX A;  3TW8 A;  3UPN A;  4NXF A;  2VV6 A;  2O0Y A;  4MEZ A;  3CG5 A;  5JYO A;  1YPR A;  1O07 A;  2JKF A;  4KG2 A;  3B33 A;  4R4S A;  4RA7 A;  3PBN A;  1CJF A;  2W3G A;  4WEL A;  1KDS A;  3HUO A;  3LGO A;  4OLD A;  3UE6 A;  1K6R A;  4XT2 B;  3QNC A;  3Q81 A;  4JKT A;  3G2Z A;  4LCM A;  3E2L A;  3AGE A;  4WEJ A;  3OBF A;  3UDX A;  3Q7V A;  1ZHH B;  4MLL A;  1PW1 A;  4G3W A;  3G34 A;  3NOT C;  1BZA A;  5MC7 A;  1K4E A;  4KZ4 A;  4HH3 A;  5HPF A;  1FIL A;  3DTK A;  1VEU B;  4IJG A;  3LYX A;  1HLU P;  2QJ5 A;  3UMD A;  1K54 C;  3KSH A;  3ZYT A;  4OOM A;  3FC7 A;  4JGP A;  4JPM A;  3UY6 A;  1JVJ A;  1MKI A;  3EQV A;  3T4J A;  1HVB A;  4IBX A;  3UB7 A;  4JGR A;  4R23 A;  1PYY A;  3ZNY A;  4A5R A;  4KQQ A;  3IX3 A; 
#chains in the Genus database with same CATH homology
 1TS7 A;  3H82 B;  1DP8 A;  3EWK A;  2NUT C;  3PR6 A;  1D06 A;  1WA9 A;  4LRZ E;  2QWS A;  3T4S A;  1VB6 A;  4PKY G;  4MCW A;  4IHQ A;  4Q0H A;  1STZ A;  1NWZ A;  3C8C A;  1W63 M;  1TF1 A;  1KOU A;  2VV8 A;  3KO6 A;  5J4E A;  1OJ5 A;  4UQI M;  1UWP X;  1H8M A;  2W3E A;  2PHY A;  1DP9 A;  4GHI B;  4HP9 A;  1OTI A;  1OTA A;  1P97 A;  3NJA A;  2O9A A;  3IBR A;  3F1O B;  1Y28 A;  1S4S A;  4YOF A;  1P9R A;  4DJ3 A;  2XRO A;  4RQ9 A;  3TE8 A;  1YSP A;  2A2L A;  1N9N A;  1T18 A;  3IS2 B;  3PYP A;  4EEU A;  4QPR A;  1XFQ A;  3B42 A;  3OC2 A;  5DFX A;  1GSX A;  5G4Z A;  3H82 A;  2W27 A;  2Y79 A;  3CUE C;  4KQO A;  3LIA A;  3GEC A;  5IT5 A;  5AJG A;  3A0S A;  4CLC D;  2XRN A;  1W63 Q;  2HGV A;  2HJ9 C;  4BJP A;  2Z6C A;  3UE3 A;  3GDI A;  3MQ0 A;  3PBQ A;  3PBR A;  1IFQ A;  3LID A;  4GW9 A;  4WN5 A;  2Z6D A;  4UQI S;  1XJ2 A;  1OT6 A;  2B18 A;  4ME4 A;  4L9F A;  5TBM B;  3TRC A;  3RH8 B;  5IS1 A;  4F3L A;  4OOL A;  4BWI A;  5F69 A;  3PXP A;  3VV4 A;  4O01 A;  2J3T D;  1X0O A;  3D3O A;  3IS2 A;  3OOV A;  3E4P A;  1UWN X;  3LIE A;  4I5S A;  4NKP A;  3S7Q A;  3OLO A;  2KLI A;  4YNR A;  3BQ8 A;  4IUH A;  1G6O A;  4CLC B;  3D72 A;  2WKP A;  4R70 A;  1LSX A;  1LSV A;  4HNB A;  1UGU A;  2G7U A;  4Q0I A;  4JGO A;  3CWF A;  3F1N B;  2OWH A;  3C38 A;  5DJU A;  4PKY A;  4WF0 A;  5TBM A;  4LRX C;  3CIT A;  5HL6 A;  4DMZ A;  4GLQ A;  2PYP A;  3E98 A;  1LT0 A;  4I3I A;  4Y3I A;  3T50 A;  4B93 A;  2FZ0 A;  2JKT M;  3E4Q A;  4L9G A;  3PBS A;  5TJJ A;  2JHE A;  1F98 A;  1NLY A;  2L1M A;  2VLG A;  2DMW A;  3MQO A;  5CX7 A;  4CLC C;  2VKS A;  2HJE A;  4HJ4 A;  2K7S A;  3CI6 A;  3MF0 A;  1S1Z A;  1OTB A;  5F68 A;  3BW6 A;  4ZRR A;  5KSH A;  2O99 A;  4AFI A;  2L4R A;  2JKR M;  1TS0 A;  3NHQ A;  3B47 A;  1OTE A;  3MMH A;  2VGL M;  4NEE D;  2CMN A;  1XJ4 A;  2J3W A;  2QKP A;  3F1N A;  3PBT A;  3NOU C;  1MC0 A;  4WLA A;  2OAP 1;  3F1P B;  2IA2 A;  2J80 A;  2KX6 A;  2J3T C;  1NRJ A;  1ZTU A;  3MQQ A;  1S1Y A;  3VE3 A;  3LUQ A;  3BQA A;  3LFV A;  4H6J A;  4O0P A;  5HWW A;  4HP4 A;  3EGD C;  2M7V A;  4Y5F A;  4Y2F A;  5L8M A;  2MJ6 A;  3LI9 A;  3KYQ A;  2W3D A;  5EFW A;  1NLZ A;  3BY9 A;  4G3K A;  1YSQ A;  1TD5 A;  4R38 A;  2W1T B;  4L9E A;  1DRM A;  3DBA A;  4DN0 A;  1OT9 A;  5HWV A;  2ZMF A;  4CQH A;  4EXO A;  1EW0 A;  5DJT A;  2VX8 A;  3MFX A;  4BBU A;  4NXE A;  2PD7 A;  3H9W A;  3CUE A;  4I38 A;  4I39 A;  4HJ3 A;  3K3D A;  5LBR A;  3E0Y A;  2D01 A;  1TS6 A;  4EQ1 A;  3HCY A;  2O9B A;  2P7J A;  5HWT A;  4GJ4 A;  4GHI A;  3BJN A;  3EGX C;  1XJ3 A;  2V0W A;  3H7W B;  3LR0 A;  4B9O A;  3PHY A;  2VA0 A;  3RTY A;  3KSG A;  2ZBB A;  2R78 A;  3BWL A;  3F1O A;  2D02 A;  4I3J A;  1G28 A;  2PR5 A;  2INW A;  2P04 A;  2W1T A;  1F9I A;  3KSI A;  5G4Y A;  3S7P A;  3T4K A;  4ARZ B;  3R4K A;  3A0R A;  2ZMV A;  5C5K A;  3UB6 A;  1LSW A;  3C2W A;  4IUK A;  1XFN A;  3KX0 X;  4LRY C;  3SW1 A;  3IBJ A;  3FPV A;  2JKT I;  5J7E A;  5DF9 A;  4YWZ A;  5J3W A;  4MN7 A;  1YKD A;  1S66 L;  2LB9 A;  2OOL A;  2PD8 A;  3LR4 A;  4KUK A;  3R7W B;  1VHM A;  2L0W A;  4HOI A;  3LIC A;  5AVF A;  3HJK A;  4HI4 A;  1S4R A;  5AVE A;  3H7W A;  5HD3 A;  4PAU A;  3T4O A;  4WUJ A;  3ZQ5 A;  4NXG A;  4R3A A;  2KOI A;  3T4T A;  3P7N A;  2KDK A;  3V67 A;  3ULF A;  4MN6 A;  4MMN A;  3E4O A;  4BBT A;  1S67 L;  3CAX A;  4R6L A;  3VOL A;  1IOU A;  4ARZ A;  1V9Y A;  2V9A A;  1BYW A;  5HZH A;  4G3V A;  2FH5 A;  3KYZ A;  4Z1W A;  2Y8H A;  2XA7 M;  2OWJ A;  2V1A A;  3HJI A;  2JN7 A;  5DKK A;  3RFB A;  4CLC A;  1P9W A;  3LIB A;  4Q0J A;  4DJ2 A;  2WKR A;  5FL3 A;  1N9L A;  3MXQ A;  3U2A A;  2ZOI A;  5F6A A;  4EER A;  3R7W A;  2EA9 A;  2PDR A;  1F5M A;  2QYB A;  5DFY A;  2GX5 A;  2HV1 A;  4UEY A;  2OAQ 1;  2QJ7 A;  3K2N A;  3W2Z A;  4JGQ A;  2H28 A;  2K31 A;  3BY8 A;  3LR5 A;  5HPI A;  4GCZ A;  4HIA A;  4K08 A;  1TS8 A;  1T1C A;  1LL8 A;  5HDD A;  1D7E A;  2YKH A;  2W3H A;  3OCN A;  3MJQ A;  1T19 A;  2VEA A;  2QHK A;  1MKM A;  4I3A A;  3T4L A;  4LLO B;  1JNU A;  1OPX A;  5HDS A;  5IU1 A;  2XA7 S;  4FOF A;  2LB5 A;  2A24 B;  2BAS A;  4MDZ A;  1DP6 A;  2O9C A;  4P6Z M;  3P01 A;  2V1B A;  2W1R A;  5DKL A;  4WEK A;  2M7U A;  5K5B A;  4HJ6 A;  2NUP C;  4EUV A;  1T1B A;  2VV7 A;  4LPZ A;  4KQD A;  1XJ6 A;  4M4X A;  4F3L B;  2VGL S;  1V9Z A;  3CLO A;  1N9O A;  3F1P A;  3EQU A;  3NOP C;  5HDC A;  4O8G A;  2XSS A;  4HH2 A;  2K2N A;  3K3C A;  1OTD A;  3JVV A;  2WKQ A;  2M1C A;  2P08 A;  1GSV A;  3KSF A;  3JVU A;  3UB9 A;  2VJW A;  4HY8 A;  2I9V A;  4MN5 A;  4ETX A;  4GS9 B;  1ODV A;  3A0V A;  1H3Q A;  1YAX A;  4EEP A;  3TW8 A;  4L0L A;  2A24 A;  2VV6 A;  2O0Y A;  1T1A A;  4NXF A;  3LI8 A;  3PBO A;  3B33 A;  3UME A;  3EOI A;  1OJG A;  4P6Z S;  5A8B A;  1GSW A;  4EU0 A;  3PBN A;  2V0U A;  2W3G A;  2EWW A;  4WEL A;  2EWV A;  3FPW A;  3UE6 A;  2VZW A;  3ICY A;  2B02 A;  4XT2 B;  2PR6 A;  3FG8 A;  2HF6 A;  4PHT A;  4KUO A;  3S7N A;  3S7O A;  2GJ3 A;  5HSQ A;  2W3F A;  4WEJ A;  3VE4 A;  3OBF A;  4GS9 A;  1ZHH B;  4BBV A;  2GNX A;  5KIZ A;  2JKR I;  4G3W A;  3NOT C;  5MC7 A;  4EW7 A;  4HQA A;  4HH3 A;  3O5Y A;  5HPF A;  4HHD A;  4FSF A;  4IJG A;  3LYX A;  4BMW A;  3LR3 A;  3UB8 A;  2PT7 A;  2QJ5 A;  3UMD A;  2W0N A;  3KSH A;  3T4Q A;  3ZYT A;  5F5Y A;  5I5L A;  4WL9 A;  3MR0 A;  4H6J B;  4NXB A;  3FC7 A;  4JGP A;  4OOM A;  3TJZ C;  4XT2 A;  3C30 A;  4CLC E;  2GZA A;  2YKF A;  2ZOH A;  5HD5 A;  3EQV A;  3OCL A;  4ETZ A;  3T4J A;  3UB7 A;  1MZU A;  4JGR A;  3EEA A;  2PYR A;  4EET B;  1P0Z A;  4EES A;  3EEH A;  3LIF A;  4II7 A;  4E04 A;  3G6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...