4UA7A

Ctx-m-14 class a beta-lactamase in complex with a non-covalent inhibitor at sub-angstrom resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
ETSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase CTX-M-14
publication title Ligand-Induced Proton Transfer and Low-Barrier Hydrogen Bond Revealed by X-ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
total genus 96
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ua7A00
2A49A 3PBRA 1KE4A 1O07A 1XX2A 4C6YA 1BTLA 2J8YA 2Y2NA 2ZC5B 4IVIA 5CRFA 4X69A 4KG5A 4X6TA 4O7DA 3HLFA 1XA7A 1PIOA 4JXWA 4MNRA 1BLHA 2WK0A 1DY6A 2PU4A 3VP2A 4DDSA 1HD8A 4JF5A 5E2FA 1KGEA 1MY8A 1ERMA 3IH9A 3UDXA 3OPPA 4DDYA 1L0FA 1SCWA 4WMCA 3GV9A 5DTTA 4WMCD 4WELA 2Y55A 2ZQAA 4JLFA 1QMEA 3VP4A 3JYIA 3UN7A 1LL9A 1JWVA 4ZTKA 4JXGA 2H0YA 3AGEA 3C4OA 3W8KA 3HL9A 5FI7A 5FSRA 2Y2GA 3ZG8B 1GHMA 2WGVA 4S2IA 2HDSA 5DVAA 3VP3A 1MPLA 4CJNA 5FASA 3MZEA 2A3UA 2WAEA 5IHVA 1ZG4A 3HBRA 1JTGA 3FV7A 1SHVA 3C7UA 5GLAA 4UA6A 3WS0A 3WS1A 3ZFZA 5A93A 4D2OA 1K6RA 5A92A 1FSWA 1ONGA 3SS3A 3BM6A 4HBTA 3ISGA 4Z9QA 2GDNA 4B4XA 1ES3A 5GLBA 1ES4A 3IHAA 1TVFA 4ZAMA 1MKIA 1NXYA 1K4EA 2DRWA 5FI2A 1K6SA 3HLGA 4KG6A 3BFFA 4BLMA 5E43A 2Z2MB 3GQZA 4KQQA 3UO9A 3UE0A 3IT9A 2C5WB 2J9PA 4JF4A 2EFUA 4RX3A 3RXWA 4DRTA 4XUZA 2HDUA 2ZQCA 3NDGA 3UPPA 4BD0A 3W4PA 4OQGA 4WZ5C 3WS4A 1PWCA 2XGNA 2X02A 5FI6A 1WYBA 3G30A 1BT5A 4UA9A 5HX9A 4FSFA 2XK1A 4R4SA 3NDEA 3A3IA 4WM9A 2XFSA 3PBSA 5M19A 1JWZA 1W5DA 2OSUA 2V1ZA 2VGKA 4GN2A 2R9WA 2Y4AA 1K54A 4P0MA 1BLSA 3QNCA 3A3FA 2H5SA 5FAQA 1J9MA 1K55A 2XQZA 1FCMA 2EXBA 3HUMA 5FQIA 4OQHA 3Q82A 4ZJ2A 3VOZA 2J9OA 3IHBA 1EROA 3LY3A 5AQ9A 1GHPA 1YLTA 1IEMA 4QJGA 3WWXA 5FDHA 3NBLA 4PM7A 5E2GA 5DF7A 1JTDA 1JWPA 2RCXA 3GTCA 4IVKA 3PBNA 5U47A 3DW0A 4Y7PA 3NY4A 2CC1A 5FQ9A 3A3JA 1GA9A 1H8YA 3UDFA 4ZJ3A 1PYYA 1BLPA 1FR1A 1KE3A 3QHYA 2OV5A 1NYMA 4FH2A 4OLDA 1PI4A 3ZGAB 4E3IA 1L0GA 4PM5A 5GHZA 3SH9A 4F94A 5KSHA 3C7VA 5HFOA 4KZ9A 4OKPA 1SDEA 3CMZA 1YMXA 3PAEA 3ZG5A 5KSCA 2ZQ7A 4FCFA 1GHIA 2IWCA 3ITAA 3OPHA 1FR6A 4PM9A 3UDIA 4L0LA 1DJCA 4DE3A 3BYDA 4MBFA 5CEDA 2WKHA 4DXBA 4K0WA 1SDNA 1H8ZA 5G18A 4P87A 3N6IA 5A91A 4A5RA 3G2ZA 1BLCA 4X56A 2EXAA 4U0XA 4UHUA 1ZC2A 2QMIA 2C6WB 4LV0A 2ZC3B 1O7EA 4FD8A 1CEGA 3P09A 4N9LA 4Q8IA 3RXXA 3ZHHA 1BSGA 5TR7A 4MLLA 2Q9MA 2Y2IA 5HL1A 1YMSA 3ZNYA 3Q7ZA 3Q7VB 2EX6A 3OPRA 2WGWB 4WEKA 4CPKA 1PWGA 3EQUA 4BD1A 4BQMA 4X68A 4EBNA 4EBPA 1LLBA 4E6XA 3OC2A 3TOIA 2HDQA 3IWIA 1GCEA 2WZZA 2ZLYA 5M1AA 4JBFA 4E3NA 5EPHA 3WRZA 4GDBA 5HAQA 3N8LA 2WAFA 2ZM2A 4EQIA 5I94A 4RA7A 4MBKA 3BLSA 3S22A 5CECA 1IYQA 2EX8A 4R3BA 4C3QA 3LY4A 1XGJA 5DF8A 3ZG9B 1YLWA 3SH7A 3ZVTA 2XFTA 2Y2QA 2X71A 4WEJA 4LV2A 5EOEA 2Q9NA 3MKFA 1L0DA 5J8XA 2IWDA 1MXOA 4X53A 3SH8A 3TSGA 1TDLA 1WE4A 5AQBA 5EVLA 2OLVA 1N4OA 4P85A 1RCJA 2V2FF 5GHYA 3VP1A 3PBOA 5EOOA 4UA7A 3HUOA 4H8RA 2HDRA 3G35A 1TDGA 3O87A 1K25A 5E2HA 3IF6B 2P9VB 3V5MA 2WZXA 1C3BA 1VM1A 1W8YA 2DCFA 3N8RA 3TG9A 3W4QA 1XPBA 1M6KA 5DTKA 3O88A 2EFXA 3BLMA 3RJUA 1U60A 2HP5A 3HLCA 3UY6A 4E3JA 4KENB 2JCHA 4LV1A 1LL5A 1ERQA 1LI0A 5FQMA 4EUZA 2WKIA 5HARA 3UNWA 3BEBA 3IXHA 5EVIC 2XH9A 1NZUA 3HLEA 2Y2OA 2V20A 5CGXA 5HAPA 4KQOA 3EQVA 4K0XA 3OCNA 4PMAA 2JE5A 2WGIA 1KVMA 2ZQDA 1ESUA 2RL3A 4QD4A 5CERA 4OVDA 4S2NC 2WUQA 3BECA 4GB7A 5F1GA 1EWZA 4GDNA 2P9VA 3O86A 4KZ8A 5FA7A 3WS5A 4RX2A 1W7FA 5GLCA 1VQQA 1NY0A 3SS5A 1IYOA 5TGFA 1KE0A 1XXMA 3W4OA 1E3UA 1K38A 4KQRA 1FCOA 1E3UD 2EX2A 3A3EA 4OOYA 5E2EA 4OONA 2E8IA 4KZ6A 5CTNA 4GZBA 4Y0TA 3PBTA 1I2SA 4NETA 4B88A 3MZDA 2G2UA 4EV4A 1L2SA 4R3JA 3IF6C 4UAAA 5KMWA 1Y54A 3ZNTA 3MFDA 3WS2A 3HREA 4OQ0A 3VP0A 3Q1FA 3HLBA 3VOYA 5DF9A 1LI9A 4E3KA 3BFDA 3HUNA 4DE2A 4ZDXA 1HZOA 3MKEA 5FQKA 4RVAA 5TFQA 1RGZA 4N1HA 4N1XA 1CK3A 3OPLA 4OOMA 2WADA 3IWOA 1Q2PA 3NC8A 1TEMA 4PM6A 5GHXA 3V39A 3VFFA 4NK3A 3LO7A 2H0TA 1K4FA 3ITBA 1JVJA 1K54C 2XLNA 3S1YA 2QPNA 2BG1A 2JC7A 2OLUA 3IXGA 3IQAA 4B4ZA 1K57A 1K55C 4IEDA 3UPNA 3FKVA 2R9XA 1YLPA 3D4FA 1RP5A 2XDMA 4KZAA 3ZVWA 5AQAA 4ZJ1A 1PW8A 4QHCA 4Y0UA 1XP4A 1MBLA 1XGIA 3CG5A 3HVFA 4JXSA 2EX9A 4RYEA 3A3DA 1I2WA 3N7WA 3HLDA 1Q2QA 3LEZA 3M6HA 3G34A 3V3RA 1LHYA 2ZC7A 2XR0A 4HESA 1K56D 3IWQA 4DKIA 4EWFA 2ZC6B 3GVBA 4K91A 3O3VA 5EVIB 4IBRA 3VMAA 1HTZA 1YLYA 3G4PA 4ZBEA 5CXWA 1M40A 1PI5A 3GRJA 4EBLA 3IXDA 1OMEA 3AGFA 4XXRA 1DJBA 3MZFA 5EE8A 4LV3A 1H5XA 4OLGA 2WKEA 5M18A 1Z6FA 4OPYA 4M3KA 4N9KA 4WBGA 4GD8A 1IYPA 4KZ5A 2B5RA 3FWLA 3DTMA 3Q81A 1XA1A 5FQQA 4KG2A 4DXCA 4C75A 4BL2A 1SKFA 3CZDA 5HW3A 1BULA 4S2JA 1MWUA 5CHMA 3BFEA 1YM1A 4OQIA 1IKIA 1PZOA 2Y91A 3FZCA 3Q7VA 2WGWA 4OPQA 4QY5A 5DTSA 3UE1A 2DNSA 4PPRA 4E3MA 1MWRA 2ZQ8A 4N92A 3WRTA 3ZCZA 5EVIA 3VSKA 2ZQ9A 4QB8A 1XKZA 1AXBA 5EVID 2HP9A 3QNBA 1NYYA 4KZBA 2Y2HA 3M2JA 2XF3A 3GSGA 4WZ5A 5HAIA 1KDWA 2JBFA 5BOHA 5AQ7A 4FH4A 4KZ4A 2X01A 3VFHA 4HBUA 4LCMA 4Y0OA 1NZOA 4BENA 1RGYA 4S2OA 3LCEA 4GD6A 4OOLA 3C5AA 4S2NA 2H10A 1PW1A 1BZAA 1KDSA 4JKTA 4QY6A 4DE0A 2Y59A 4GKUA 3BRMA 3IXBA 4MEZA 4OH0A 1ESIA 3GR2A 5CHJA 4KZ3A 1FOFA 3FKWA 5FAPA 3AGDA 4GNUA 3P98A 3UPOA 3IF5A 3OCLA 1CEFA 4PM8A 5FATA 1FSYA 3IF6A 3N8SA 2Y2PA 1G68A 4S2LA 4BL3A 4LCLA 1ZKJA 2XD1A 5CGSA 1ONHA 1E25A 1ZG6A 4U3TA 4OPZA 3G2YA 2Z2LB 5FQJA 2ZM0A 2FFFB 2J7VA 3GMWA 4U0TA 3G32A 3Q07A 2PU2A 2XEPA 4LENA 2G2WA 3SOIA 4S2KA 1ES2A 1KGFA 1S0WA 4X55A 2IWBA 1NJ4A 1PZPA 3MBZA 5KZHA 4S2MA 1QMFA 1W8QA 1KVLA 5GL9A 2FFYA 3ZG0A 1S6RA 4OP8A 1YT4A 5EUAA 3C4PA 5CGWA 3M2KA 2XD5A 5CTMA 5F83A 1DJAA 1YQSA 5F1FA 3E2KA 1CI8A 2Y2JA 4E3OA 1ES5A 1IELA 3M6BA 1GA0A 2Y2MA 1N9BA 1YLJA 4R23A 2ZMAA 3PAGA 3G31A 5CEBA 4YINA 3HLWA 1FQGA 3IH8A 3NIAA 1G6AA 2ZC4B 3B3XA 3VSLA 1EI5A 4R0QA 4E3LA 2HP6A 4WYYA 5JYPA 1FCNA 1HVBA 4QU3A 4YFMA 3DWKA 4DF6A 4KZ7A 1WYCA 4JPMA 3PTEA 2UWXA 3BFGA 1PWDA 2PBYA 3BFCA 3CJMA 1IYSA 2Y2KA 4OPRA 3V50A 4E6WA 5A90A 2I72A 2ZJ9A 2VGJA 3NCKA 1BUEA 4HEFA 1CI9A 1L0EA 3V3SA 3ZDJA 5D3OA 4DE1A 4WZ4A 1K56A 3E2LA 3FYZA 5FAOA 1I5QA 5L2FA 3S4XA 2P74A 4R4RA 4ID4A 3DWZA 3ZG7B 4XUXA 1E4DA 3NI9A 2WYXA 3SS4A 1ALQA 4R1GA 4P6BA 3I7JA 1MWSA 5GLDA 1IKGA 3N4IA 3PBQA 5F82A 1KGGA 4IBXA 2HPBA 3MXRA 4S2PA 1W79A 5JYOA 3OZHA 3MXSA 5EECA 4OP5A 2QZ6A 2Y2LA 2ZD8A 1MWTA 1YLZA 3UE3A 1K57C 4GOGA 2ZM8A 4JXVA 4JF6A 4MBHA 5CHUA 2BLSA 4BJPA 1NRFA
chains in the Genus database with same CATH superfamily
3PBRA 4X69A 1CJFA 1NWZA 4KG5A 4X6TA 1XA7A 4F3LB 4AFIA 1KGEA 1MY8A 4BMWA 3KO6A 1SCWA 3GV9A 5DTTA 4WELA 2ZQAA 3UN7A 1LL9A 4ZTKA 3UB6A 3UE6A 1YSPA 3W8KA 3HL9A 4FUWA 3QP8A 2XRNA 3VP3A 3R4KA 3MZEA 2A3UA 3FG8A 1N9LA 1ZG4A 3HBRA 5GLAA 2CMNA 5A92A 4E04A 3ISGA 4Z9QA 4DN0A 3IHAA 1NXYA 2DRWA 3CUEA 5E43A 3UO9A 1N9OA 3GQZA 3IT9A 4DRTA 1UGUA 2J80A 2ZOHA 1T1CA 4BD0A 3PXPA 2XGNA 3ULFA 4UA9A 2BTFP 3NDEA 3LR5A 2Y4AA 5L8MA 3KSHA 1BLSA 3QNCA 3A3FA 4LGWA 4NXBA 3Q82A 2J9OA 1W63Q 1A0KA 4Y5FA 1Z09A 5DF7A 2J3TD 4MMNA 4H6JA 5U47A 2JKTI 4ZJ3A 2OV5A 1ODVA 3ZGAB 4E3IA 3VOLA 4F94A 4HJ4A 3PAEA 4I38A 4GHIB 4FCFA 2IWCA 3ITAA 2VEAA 3D72A 1DJCA 4MN6A 1PFLA 5G18A 1F9IA 1X0OA 2QMIA 4FD8A 3PYPA 3CPTA 3DAVA 4Q8IA 2PD8A 1BSGA 1VB6A 5TR7A 2Q9MA 5HL1A 4GS9B 3ZNYA 3Q7ZA 5TBMB 3OC2A 2HDQA 4R6LA 1GCEA 2ZLYA 4WUJA 3HJKA 5EPHA 4MCWA 3TE8A 2VV8A 4ESPA 1ZTUA 5IT5A 4MBKA 1TD5A 1IYQA 4R3BA 3LY4A 3ZG9B 2X71A 4WEJA 4LV2A 5EOEA 2Q9NA 1L0DA 3ZQ5A 1MXOA 1PRQA 3SH8A 3MJQA 3LFVA 4ME4A 1WE4A 4P85A 3VP1A 1TDGA 5E2HA 2XROA 3V5MA 3W4QA 4F3LA 5HPFA 1U60A 2HP5A 3UY6A 3KX0X 4E3JA 2JCHA 5FQMA 2WKIA 5HARA 4EXOA 5EVIC 5L09A 2M1CA 2WGIA 2RL3A 4OVDA 4CQHA 2P9VA 2V0WA 4UQIM 5CX7A 1NY0A 3LICA 4OOYA 3A3EA 2WKRA 4B88A 3IF6C 3T4JA 1Y54A 3Q1FA 3QP6A 5L07A 3NOUC 5HD5A 3MKEA 5FQKA 2V8CA 4RVAA 1CK3A 1FILA 2WADA 1TEMA 2VV6A 4PM6A 3LO7A 2H0TA 4WF0A 2B95A 2QKPA 4IHQA 2BG1A 4B4ZA 4IEDA 3UPNA 2KX6A 2XDMA 2Y79A 5AQAA 2VX8A 3CITA 2K2NA 4JXSA 2EX9A 2W0NA 3UB5P 3G34A 1LHYA 1VHMA 4HESA 3QP4A 4IBRA 4GHIA 1PI5A 4EBLA 4XXRA 1T1AA 5G4YA 4M3KA 1IYPA 3DTMA 3T4LA 4KG2A 2OOLA 5EFWA 4Q0IA 3CZDA 5HW3A 4S2JA 3T1XA 3UB7A 3O5YA 1YM1A 4GS9A 3FZCA 5DTSA 3UE1A 5TBMA 3EWKA 3VSKA 1AXBA 3QNBA 2Y2HA 3M2JA 2XF3A 5DJTA 1KDWA 1H3QA 3IX3A 3VFHA 3LEQA 4HBUA 4LCMA 2PHYA 4Y0OA 1RGYA 4MN7A 4S2OA 3LCEA 4GD6A 4CLCD 1VEUB 4KUKA 3G6OA 4K08A 4MEZA 3LIDA 1ESIA 4KZ3A 1FOFA 5FAPA 4BBTA 3P98A 5F69A 3OCLA 2Q0OA 2OAQ1 5DKKA 4DMZA 3E4OA 2Z6CA 4OPZA 2Z2LB 5FQJA 5HWWA 2XEPA 3LR4A 1UWPX 2W1TA 4I3AA 2IWBA 4S2MA 1DRMA 1KVLA 3ZG0A 4OP8A 1YT4A 1JNUA 2Y2JA 3T4TA 4R23A 2OWJA 4YINA 3HLWA 1FQGA 4GLQA 3DWKA 2I72A 2H28A 2VGJA 4Y2FA 1BUEA 2NUTC 4GW9A 1L0EA 3V3SA 2J3TC 2PRFA 5L2FA 4JGRA 3S4XA 3DWZA 4XUXA 2EWWA 5DJUA 5GLDA 3N4IA 3PBQA 1KGGA 4S2PA 3F1OB 5JYOA 3OZHA 3CWFA 3L9KA 3UE3A 2ZM8A 5CHUA 1NRFA 1P9WA 1O07A 1XX2A 2R78A 4C6YA 2ZC5B 4IVIA 2WKQA 3BJNA 2QWSA 2WK0A 1HD8A 1DP9A 2PDRA 3OPPA 1L0FA 4WMCA 4I3JA 3TW8A 2Y55A 4JLFA 3JYIA 1JWVA 4JXGA 2H0YA 3AGEA 3OOVA 5FSRA 2Y2GA 2HDSA 5DVAA 2WAEA 2PT7A 1JTGA 3IBJA 1SHVA 2HJ9C 3C7UA 3F1PB 3E4PA 3WS0A 5A93A 3CHWP 4D2OA 1FSWA 2LB5A 2QHKA 3OBFA 1OJ5A 1IOUA 4B4XA 1ES3A 2O99A 1ES4A 3OLOA 1TVFA 4ZAMA 1MKIA 1WA9A 3BY9A 2YKFA 5FI2A 4KG6A 1YSQA 2JKGA 4Z1WA 2B02A 2EFUA 3NULA 3RXWA 3D9YA 2HDUA 3NDGA 4XUZA 3W4PA 4OQGA 4WZ5C 4G3WA 5FI6A 3U2AA 2ZBBA 1VEUA 2JKFA 2XK1A 4R4SA 5I5LA 3DTIA 2VGKA 4GN2A 2NUPC 2PR6A 2BASA 1K54A 4Q0HA 2V8FA 3KYEA 5FAQA 1J9MA 1FCMA 5HPIA 4HH3A 4HI4A 4ZJ2A 1MC0A 5F6AA 3S7NA 3LY3A 5IS1A 1IEMA 3NBLA 4PM7A 1JTDA 2RCXA 3GTCA 4Y3IA 3TRCA 3NY4A 3A3JA 1H8YA 1PYYA 1BLPA 3KSGA 4O8GA 3ZYTA 4FH2A 1PI4A 2W1RA 5GHZA 3C7VA 4OKPA 2ZQ7A 3OPHA 3GDIA 3T50A 3BYDA 5CEDA 2WKHA 1XFQA 1SDNA 4P87A 2VLGA 1ZC2A 4EEPA 1O7EA 1CEGA 3P7NA 3ZHHA 4O01A 2V1BA 1PWGA 4BD1A 3BWLA 4EBPA 1LLBA 1DP8A 3MQ0A 4HJ3A 3WRZA 5HAQA 3N8LA 1G6OA 4EQIA 1XGJA 5DF8A 3F1OA 2XFTA 3EEAA 3MKFA 5J8XA 4Q0JA 3JPUA 3TSGA 1TDLA 5K5BA 3FC7A 3PBOA 3C30A 2HDRA 3O87A 1K25A 3IF6B 2P9VB 4FTXA 2WZXA 5HDSA 3TG9A 3IS2A 1XPBA 1M6KA 1XJ6A 3BLMA 3RTYA 1PNEA 2V1AA 3H82B 1LI0A 3EGDC 1TS8A 2D01A 5HAPA 4KQOA 3EQVA 4CLCC 1ESUA 3F1PA 5F1GA 1EWZA 3LIAA 3O86A 1W7FA 1IYOA 5TGFA 1KE0A 1XXMA 1E3UA 1NLYA 1T18A 3S7QA 4KQRA 2E8IA 5CTNA 4GZBA 4Y0TA 1I2SA 3MZDA 2G2UA 1KOUA 4R3JA 4UAAA 3ZNTA 5J4EA 3HREA 3VP0A 3VOYA 1LI9A 3HUNA 3T1QB 4DE2A 4ZDXA 4IUKA 4P6ZS 5TFQA 1LSWA 4LPZA 4N1XA 3OPLA 4HIAA 5GHXA 4NK3A 3EEHA 3T1RA 1S4RA 3IXGA 3FKVA 4KZAA 1PW8A 4QHCA 3CG5A 4WLAA 4RYEA 3A3DA 1Q2QA 2XR0A 1YLYA 3GRJA 3IXDA 1LL8A 3AGFA 4LV3A 4OLGA 4R38A 5M18A 1Z6FA 4OPYA 3GECA 1CF0A 4N9KA 2VA0A 5HDCA 3FWLA 1ZHHB 1XA1A 5FQQA 4DXCA 1SKFA 2OAP1 1BULA 3CLOA 1MWUA 3JVVA 3LI8A 2Y91A 3MFXA 4OPQA 4QY5A 3LIEA 4PPRA 1MWRA 2ZQ8A 5EVIA 4B9OA 5TJJA 4CLCE 3KSFA 2W3DA 4KZBA 1P0ZA 5BOHA 5AQ7A 1FIKA 2M7UA 2O9AA 4BENA 4OOLA 3C5AA 2H10A 2VK3A 1PW1A 3RFBA 2IA2A 4QY6A 3NOTC 2W1TB 3IXBA 4OH0A 4HP4A 1GSVA 5J7EA 5FEGA 3NHQA 4GNUA 4PM8A 1CEFA 1Y28A 1FSYA 3IF6A 4EERA 3B33A 4LCLA 1ZKJA 4U3TA 3H82A 2J3WA 2FFFB 3KYZA 3Q07A 4LENA 3SOIA 1ES2A 1KGFA 2G7UA 1S0WA 1MZUA 2W3HA 3LR0A 1PZPA 3NOPC 1W8QA 5GL9A 2PAVP 4II7A 5CGWA 3M2KA 3E2KA 5HZHA 1OTBA 1CI8A 2A24A 4E3OA 3EOIA 3IBRA 3M6BA 1YLJA 3G31A 3IH8A 1UWNX 3VSLA 2HP6A 3MF0A 4NG2A 4WYYA 1FCNA 4QU3A 4KZ7A 1WYCA 3V67A 2UV0E 2UWXA 5LBRA 3BFGA 2PBYA 1IYSA 4OPRA 2QJ5A 1CI9A 1XJ2A 3QP1A 4WZ4A 1K56A 4WN5A 3D3OA 1S1YA 3NI9A 2W3FA 2WYXA 3SS4A 1OJGA 3I7JA 1MWSA 5AVEA 4IBXA 4EQ1A 1W79A 3MXSA 4OP5A 3ICYA 2QZ6A 2Y2LA 2L4RA 1YLZA 4JXVA 4BJPA 1J3WA 2A49A 1BTLA 4I5SA 4M4XA 5CRFA 4O7DA 1D7EA 3HLFA 5EM0A 1BLHA 3VP2A 4DDSA 5HL6A 4JF5A 5E2FA 5L10A 3BY8A 2VZWA 2VJWA 3DTKA 4DDYA 3SZTA 1TS0A 3VP4A 1QMEA 3IX8A 3UMDA 4HQAA 4LFUA 3C4OA 2WGVA 4CJNA 5F68A 3FV7A 2ZL1B 4UA6A 3ZFZA 1K6RA 4KQDA 3BM6A 4HBTA 3LR3A 1OTAA 1K4EA 4HJ6A 3E0YA 3HLGA 3BFFA 4BLMA 4KQQA 3UE0A 2J9PA 4JF4A 3UPPA 5FL3A 1NLZA 1PWCA 2INWA 5HX9A 4FSFA 3A0VA 3A3IA 3PBSA 1JWZA 2OSUA 2V1ZA 2HV1A 2H5SA 1K55A 1H0MA 2EXBA 3MS6A 3HUMA 5FQIA 4OQHA 3VOZA 4KUOA 3IHBA 4NKPA 1GHPA 5E2GA 3DW0A 4Y7PA 5FQ9A 3LYXA 1GA9A 3UDFA 1OTIA 1KE3A 1NYMA 4ARZB 5KSHA 4P6ZM 1SDEA 1YMXA 3ZG5A 5KSCA 3UDIA 1GHIA 4PM9A 3SW1A 2W27A 4NXEA 4DE3A 3F1NB 4MBFA 1OTEA 4DXBA 4K0WA 3N6IA 3G2ZA 1BLCA 4X56A 2EXAA 4U0XA 4UHUA 2C6WB 2ZC3B 1LT0A 3P09A 2PD7A 2KDKA 5HWTA 1YMSA 2WGWB 4WEKA 4CPKA 3H9WA 4X68A 4EBNA 2LB9A 2W3EA 4E6XA 3TOIA 1VETB 4E3NA 3IS2B 1XJ4A 2WAFA 5I94A 3U4LP 4CLCB 3S22A 5CECA 2EX8A 4C3QA 1YLWA 1D06A 2Y2QA 2HGVA 1S1ZA 4YNRA 2IWDA 4X53A 5AQBA 5GHYA 5KMWA 1N4OA 1RCJA 2V2FF 5EOOA 3HUOA 2DCFA 5MC7A 3O88A 3RJUA 3S7PA 4IJGA 3HLCA 4KENB 4LV1A 1F98A 1ERQA 4EUZA 4IUHA 5KIZA 3UNWA 3BEBA 2XH9A 1NZUA 3HLEA 5HD3A 2Y2OA 1L3LA 1ACFA 4HP9A 4K0XA 4PMAA 3DTEA 2ZQDA 5DKLA 2ZL1A 3FPWA 3FPVA 4S2NC 4GB7A 5FA7A 4RX2A 1YKDA 5GLCA 1VQQA 3SS5A 4HH2A 3W4OA 3MQOA 1K38A 4OONA 5J3WA 3KSIA 4NETA 4X25A 4EV4A 1T19A 1L2SA 1P97A 3T4KA 3MFDA 1F2KA 2WKPA 4OQ0A 5AVFA 4HY8A 3HLBA 3C38A 5DF9A 4E3KA 3BFDA 1HZOA 1TS6A 1G28A 2V0UA 1RGZA 4N1HA 2FH5A 3IWOA 1Q2PA 1GSXA 3VFFA 1K4FA 1JVJA 1K54C 3MXQA 3S1YA 2QPNA 2JC7A 2OLUA 4I3IA 3IQAA 1K57A 2Z6DA 2R9XA 3D4FA 4ETZA 3E98A 3ZVWA 4ZJ1A 1XP4A 3DBAA 4I39A 3HLDA 3M6HA 4JGQA 3E4QA 3V3RA 2ZC7A 1K56D 3IWQA 4DKIA 4ARZA 4EWFA 1N9NA 4NXFA 3O3VA 5EVIB 3VMAA 3G4PA 4ZBEA 1K0KA 1M40A 1OMEA 3F1NA 5EE8A 2P08A 2WKEA 3K3CA 4WBGA 4L9GA 4KZ5A 2B5RA 2I9VA 4EU0A 2XSSA 4BL2A 5CHMA 1CQAA 1OT9A 3BFEA 4BWIA 2VGLS 4OQIA 1IKIA 2WGWA 4WL9A 2L1MA 2DNSA 4R3AA 4E3MA 4N92A 3ZCZA 4QB8A 1XKZA 1DP6A 4EESA 1NYYA 3GSGA 1HLUP 1VETA 1LSVA 2JBFA 5EV0A 1NZOA 4CLCA 3C8CA 5FDSA 1BZAA 4JKTA 2Y59A 3GR2A 3AGDA 2EA9A 2XA7S 3IF5A 4YOFA 3N8SA 1G68A 4S2LA 2A24B 3EGXC 4XT2B 5HSQA 1ONHA 1ZG6A 5A8BA 3HJIA 1AWIA 4X1LA 2J7VA 2PYRA 2HF6A 3CUEC 3RH8B 3LIFA 5HDDA 2K31A 2HZ5A 3QP2A 4JGOA 4G3VA 2FFYA 5EUAA 3C4PA 3T4QA 3A0SA 5CTMA 5F83A 5F1FA 4B93A 3KYQA 1IELA 1GA0A 4O0PA 2Y2MA 1N9BA 3PAGA 2GX5A 1G6AA 3B3XA 4E3LA 1HVBA 4YFMA 1V9ZA 4JPMA 3PTEA 1PWDA 3CJMA 5A90A 3L7HA 2PBDP 2O0YA 3ZDJA 5D3OA 4DE1A 3FYZA 2JHEA 2P74A 2JKRM 3ZG7B 3IX4A 3PR6A 1S4SA 1ALQA 4R1GA 4P6BA 1IKGA 4QWOA 2HPBA 3LI9A 4PKYA 2GJ3A 5EECA 4LRYC 4FOFA 1MWTA 2VKSA 3MQQA 1KE4A 2P04A 2M7VA 2J8YA 2E8JA 2Y2NA 4YWZA 1PIOA 4JXWA 1D1JA 2YKHA 4MNRA 2KOIA 1DY6A 2PU4A 3T1SA 1ERMA 3IH9A 3UDXA 4WMCD 2DMWA 1YAXA 5FI7A 3ZG8B 1GHMA 4S2IA 5FASA 1MPLA 4L9EA 5IHVA 3WS1A 1G5UA 1ONGA 3SS3A 1TF1A 2GDNA 5GLBA 5EVEA 1T1BA 3CAXA 1K6SA 2Z2MB 2C5WB 4RX3A 4EUVA 2ZQCA 3WS4A 3MMHA 2X02A 1WYBA 3G30A 1BT5A 4X1MA 4HOIA 3H7WB 2PR5A 4WM9A 2ZOIA 2XFSA 5M19A 1W5DA 2R9WA 3T4OA 2PYPA 4Y17A 4P0MA 5FEFA 2XQZA 3VV4A 4XT2A 1EROA 2D02A 5AQ9A 1YLTA 5AJGA 4QJGA 3WWXA 5FDHA 1IFQA 3C2WA 1JWPA 4IVKA 3PBNA 4L9FA 3P01A 2CC1A 4LRXC 1S66L 1FR1A 3QHYA 4OLDA 2K7SA 1L0GA 4PM5A 3SH9A 1BYWA 5HFOA 4KZ9A 2EWVA 3CMZA 3T12B 4ZRRA 1OPXA 1FR6A 4L0LA 1SKOB 1H8ZA 5DFYA 5A91A 4A5RA 4DJ2A 1XJ3A 4BBVA 4LV0A 3W2ZA 4N9LA 2VV7A 1NRJA 3RXXA 4MLLA 2Y2IA 4MDZA 1OT6A 3Q7VB 2EX6A 3OPRA 3EQUA 4PHTA 4BQMA 3IWIA 2P7JA 2WZZA 5M1AA 4JBFA 4GDBA 2ZM2A 4RA7A 3BLSA 4ETXA 2L0WA 4GJ4A 3SH7A 3ZVTA 4Y15A 3CI6A 4UEYA 5EVLA 2OLVA 4PAUA 2VGLM 4UA7A 4H8RA 4MN5A 3G35A 1C3BA 1VM1A 1W8YA 3N8RA 5DTKA 3R7WB 2EFXA 2O9BA 1H8MA 5HWVA 1LL5A 3B47A 3LGOA 3IXHA 1EW0A 2W3GA 2HJEA 2V20A 5CGXA 3MR0A 3OCNA 2JE5A 1KVMA 4BBUA 4QD4A 5G4ZA 5CERA 2WUQA 3BECA 4GDNA 4KZ8A 3WS5A 2XA7M 4NEED 4EETB 3VE3A 3K2NA 1FCOA 1E3UD 2EX2A 3NJAA 5E2EA 4KZ6A 3PBTA 2AVXA 3VE4A 2MJ6A 5IU1A 3WS2A 3H7WA 2JKRI 3UB9A 4HNBA 4QPRA 4OOMA 1F5MA 3V39A 3NC8A 2KLIA 3ITBA 2XLNA 1K55C 1YLPA 1RP5A 4GCZA 4R70A 4Y0UA 1GSWA 1MBLA 1XGIA 3HVFA 1I2WA 3N7WA 3LEZA 4D60A 4RQ9A 2ZC6B 3GVBA 4K91A 4G3KA 2JKTM 1HTZA 5CXWA 3S7OA 3NECA 1DJBA 3MZFA 1SKOA 1SZVA 1H5XA 4GD8A 5DFXA 3Q81A 4C75A 4HHDA 2Y8HA 1PZOA 3Q7VA 3WRTA 2ZQ9A 3UMEA 5EVID 2HP9A 1STZA 2JN7A 2QJ7A 4WZ5A 3BW6A 5HAIA 4FH4A 4KZ4A 2X01A 4EEUA 3PHYA 1P9RA 2ZMVA 3T4SA 4S2NA 1KDSA 4EW7A 4DE0A 4GKUA 3BRMA 3B42A 5CHJA 3FKWA 3BQAA 4UQIS 3UPOA 5EM1A 5FATA 3K3DA 2Y2PA 3R7WA 4BL3A 3UB8A 2XD1A 5CGSA 4PKYG 1E25A 3G2YA 4Y13A 3QP5A 2ZM0A 3GMWA 4U0TA 3G32A 2PU2A 2G2WA 3A0RA 3TJZC 4S2KA 4H6JB 4X55A 5C5KA 2ACGA 1NJ4A 3MBZA 5KZHA 3JVUA 1YPRA 1QMFA 4DJ3A 3LIBA 1S6RA 1TS7A 2XD5A 2O9CA 1DJAA 1YQSA 2QYBA 1ES5A 3BQ8A 1V9YA 2A2LA 2ZMAA 1Y4OA 5CEBA 3NIAA 1LSXA 1S67L 2ZC4B 1EI5A 4R0QA 5JYPA 3CPTB 4DF6A 3MSHA 3BFCA 3V50A 2Y2KA 4E6WA 2ZJ9A 3NCKA 4HEFA 4NXGA 2FZ0A 3E2LA 5FAOA 2V9AA 1I5QA 4R4RA 4ID4A 3LUQA 1E4DA 4LRZE 2B18A 5F5YA 2ZMFA 1W63M 5F82A 2GNXA 3MXRA 1XFNA 2OWHA 4JGPA 3HCYA 2ZD8A 1MKMA 2GZAA 1K57C 4GOGA 4JF6A 4MBHA 4LLOB 1OTDA 2BLSA
chains in the Genus database with same CATH topology
2A49A 3PBRA 1KE4A 1O07A 1XX2A 4C6YA 1BTLA 2J8YA 2Y2NA 2ZC5B 4IVIA 5CRFA 4X69A 4KG5A 4X6TA 4O7DA 3HLFA 1XA7A 1PIOA 4JXWA 4MNRA 1BLHA 2WK0A 1DY6A 2PU4A 3VP2A 4DDSA 1HD8A 4JF5A 5E2FA 1KGEA 1MY8A 1ERMA 3IH9A 3UDXA 3OPPA 4DDYA 1L0FA 1SCWA 4WMCA 3GV9A 5DTTA 4WMCD 4WELA 2Y55A 2ZQAA 4JLFA 1QMEA 3VP4A 3JYIA 3UN7A 1LL9A 1JWVA 4ZTKA 4JXGA 2H0YA 3AGEA 3C4OA 3W8KA 3HL9A 5FI7A 5FSRA 2Y2GA 3ZG8B 1GHMA 2WGVA 4S2IA 2HDSA 5DVAA 3VP3A 1MPLA 4CJNA 5FASA 3MZEA 2A3UA 2WAEA 5IHVA 1ZG4A 3HBRA 1JTGA 3FV7A 1SHVA 3C7UA 5GLAA 4UA6A 3WS0A 3WS1A 3ZFZA 5A93A 4D2OA 1K6RA 5A92A 1FSWA 1ONGA 3SS3A 3BM6A 4HBTA 3ISGA 4Z9QA 2GDNA 4B4XA 1ES3A 5GLBA 1ES4A 3IHAA 1TVFA 4ZAMA 1MKIA 1NXYA 1K4EA 2DRWA 5FI2A 1K6SA 3HLGA 4KG6A 3BFFA 4BLMA 5E43A 2Z2MB 3GQZA 4KQQA 3UO9A 3UE0A 3IT9A 2C5WB 2J9PA 4JF4A 2EFUA 4RX3A 3RXWA 4DRTA 4XUZA 2HDUA 2ZQCA 3NDGA 3UPPA 4BD0A 3W4PA 4OQGA 4WZ5C 3WS4A 1PWCA 2XGNA 2X02A 5FI6A 1WYBA 3G30A 1BT5A 4UA9A 5HX9A 4FSFA 2XK1A 4R4SA 3NDEA 3A3IA 4WM9A 2XFSA 3PBSA 5M19A 1JWZA 1W5DA 2OSUA 2V1ZA 2VGKA 4GN2A 2R9WA 2Y4AA 1K54A 4P0MA 1BLSA 3QNCA 3A3FA 2H5SA 5FAQA 1J9MA 1K55A 2XQZA 1FCMA 2EXBA 3HUMA 5FQIA 4OQHA 3Q82A 4ZJ2A 3VOZA 2J9OA 3IHBA 1EROA 3LY3A 5AQ9A 1GHPA 1YLTA 1IEMA 4QJGA 3WWXA 5FDHA 3NBLA 4PM7A 5E2GA 5DF7A 1JTDA 1JWPA 2RCXA 3GTCA 4IVKA 3PBNA 5U47A 3DW0A 4Y7PA 3NY4A 2CC1A 5FQ9A 3A3JA 1GA9A 1H8YA 3UDFA 4ZJ3A 1PYYA 1BLPA 1FR1A 1KE3A 3QHYA 2OV5A 1NYMA 4FH2A 4OLDA 1PI4A 3ZGAB 4E3IA 1L0GA 4PM5A 5GHZA 3SH9A 4F94A 5KSHA 3C7VA 5HFOA 4KZ9A 4OKPA 1SDEA 3CMZA 1YMXA 3PAEA 3ZG5A 5KSCA 2ZQ7A 4FCFA 1GHIA 2IWCA 3ITAA 3OPHA 1FR6A 4PM9A 3UDIA 4L0LA 1DJCA 4DE3A 3BYDA 4MBFA 5CEDA 2WKHA 4DXBA 4K0WA 1SDNA 1H8ZA 5G18A 4P87A 3N6IA 5A91A 4A5RA 3G2ZA 1BLCA 4X56A 2EXAA 4U0XA 4UHUA 1ZC2A 2QMIA 2C6WB 4LV0A 2ZC3B 1O7EA 4FD8A 1CEGA 3P09A 4N9LA 4Q8IA 3RXXA 3ZHHA 1BSGA 5TR7A 4MLLA 2Q9MA 2Y2IA 5HL1A 1YMSA 3ZNYA 3Q7ZA 3Q7VB 2EX6A 3OPRA 2WGWB 4WEKA 4CPKA 1PWGA 3EQUA 4BD1A 4BQMA 4X68A 4EBNA 4EBPA 1LLBA 4E6XA 3OC2A 3TOIA 2HDQA 3IWIA 1GCEA 2WZZA 2ZLYA 5M1AA 4JBFA 4E3NA 5EPHA 3WRZA 4GDBA 5HAQA 3N8LA 2WAFA 2ZM2A 4EQIA 5I94A 4RA7A 4MBKA 3BLSA 3S22A 5CECA 1IYQA 2EX8A 4R3BA 4C3QA 3LY4A 1XGJA 5DF8A 3ZG9B 1YLWA 3SH7A 3ZVTA 2XFTA 2Y2QA 2X71A 4WEJA 4LV2A 5EOEA 2Q9NA 3MKFA 1L0DA 5J8XA 2IWDA 1MXOA 4X53A 3SH8A 3TSGA 1TDLA 1WE4A 5AQBA 5EVLA 2OLVA 1N4OA 4P85A 1RCJA 2V2FF 5GHYA 3VP1A 3PBOA 5EOOA 4UA7A 3HUOA 4H8RA 2HDRA 3G35A 1TDGA 3O87A 1K25A 5E2HA 3IF6B 2P9VB 3V5MA 2WZXA 1C3BA 1VM1A 1W8YA 2DCFA 3N8RA 3TG9A 3W4QA 1XPBA 1M6KA 5DTKA 3O88A 2EFXA 3BLMA 3RJUA 1U60A 2HP5A 3HLCA 3UY6A 4E3JA 4KENB 2JCHA 4LV1A 1LL5A 1ERQA 1LI0A 5FQMA 4EUZA 2WKIA 5HARA 3UNWA 3BEBA 3IXHA 5EVIC 2XH9A 1NZUA 3HLEA 2Y2OA 2V20A 5CGXA 5HAPA 4KQOA 3EQVA 4K0XA 3OCNA 4PMAA 2JE5A 2WGIA 1KVMA 2ZQDA 1ESUA 2RL3A 4QD4A 5CERA 4OVDA 4S2NC 2WUQA 3BECA 4GB7A 5F1GA 1EWZA 4GDNA 2P9VA 3O86A 4KZ8A 5FA7A 3WS5A 4RX2A 1W7FA 5GLCA 1VQQA 1NY0A 3SS5A 1IYOA 5TGFA 1KE0A 1XXMA 3W4OA 1E3UA 1K38A 4KQRA 1FCOA 1E3UD 2EX2A 3A3EA 4OOYA 5E2EA 4OONA 2E8IA 4KZ6A 5CTNA 4GZBA 4Y0TA 3PBTA 1I2SA 4NETA 4B88A 3MZDA 2G2UA 4EV4A 1L2SA 4R3JA 3IF6C 4UAAA 5KMWA 1Y54A 3ZNTA 3MFDA 3WS2A 3HREA 4OQ0A 3VP0A 3Q1FA 3HLBA 3VOYA 5DF9A 1LI9A 4E3KA 3BFDA 3HUNA 4DE2A 4ZDXA 1HZOA 3MKEA 5FQKA 4RVAA 5TFQA 1RGZA 4N1HA 4N1XA 1CK3A 3OPLA 4OOMA 2WADA 3IWOA 1Q2PA 3NC8A 1TEMA 4PM6A 5GHXA 3V39A 3VFFA 4NK3A 3LO7A 2H0TA 1K4FA 3ITBA 1JVJA 1K54C 2XLNA 3S1YA 2QPNA 2BG1A 2JC7A 2OLUA 3IXGA 3IQAA 4B4ZA 1K57A 1K55C 4IEDA 3UPNA 3FKVA 2R9XA 1YLPA 3D4FA 1RP5A 2XDMA 4KZAA 3ZVWA 5AQAA 4ZJ1A 1PW8A 4QHCA 4Y0UA 1XP4A 1MBLA 1XGIA 3CG5A 3HVFA 4JXSA 2EX9A 4RYEA 3A3DA 1I2WA 3N7WA 3HLDA 1Q2QA 3LEZA 3M6HA 3G34A 3V3RA 1LHYA 2ZC7A 2XR0A 4HESA 1K56D 3IWQA 4DKIA 4EWFA 2ZC6B 3GVBA 4K91A 3O3VA 5EVIB 4IBRA 3VMAA 1HTZA 1YLYA 3G4PA 4ZBEA 5CXWA 1M40A 1PI5A 3GRJA 4EBLA 3IXDA 1OMEA 3AGFA 4XXRA 1DJBA 3MZFA 5EE8A 4LV3A 1H5XA 4OLGA 2WKEA 5M18A 1Z6FA 4OPYA 4M3KA 4N9KA 4WBGA 4GD8A 1IYPA 4KZ5A 2B5RA 3FWLA 3DTMA 3Q81A 1XA1A 5FQQA 4KG2A 4DXCA 4C75A 4BL2A 1SKFA 3CZDA 5HW3A 1BULA 4S2JA 1MWUA 5CHMA 3BFEA 1YM1A 4OQIA 1IKIA 1PZOA 2Y91A 3FZCA 3Q7VA 2WGWA 4OPQA 4QY5A 5DTSA 3UE1A 2DNSA 4PPRA 4E3MA 1MWRA 2ZQ8A 4N92A 3WRTA 3ZCZA 5EVIA 3VSKA 2ZQ9A 4QB8A 1XKZA 1AXBA 5EVID 2HP9A 3QNBA 1NYYA 4KZBA 2Y2HA 3M2JA 2XF3A 3GSGA 4WZ5A 5HAIA 1KDWA 2JBFA 5BOHA 5AQ7A 4FH4A 4KZ4A 2X01A 3VFHA 4HBUA 4LCMA 4Y0OA 1NZOA 4BENA 1RGYA 4S2OA 3LCEA 4GD6A 4OOLA 3C5AA 4S2NA 2H10A 1PW1A 1BZAA 1KDSA 4JKTA 4QY6A 4DE0A 2Y59A 4GKUA 3BRMA 3IXBA 4MEZA 4OH0A 1ESIA 3GR2A 5CHJA 4KZ3A 1FOFA 3FKWA 5FAPA 3AGDA 4GNUA 3P98A 3UPOA 3IF5A 3OCLA 1CEFA 4PM8A 5FATA 1FSYA 3IF6A 3N8SA 2Y2PA 1G68A 4S2LA 4BL3A 4LCLA 1ZKJA 2XD1A 5CGSA 1ONHA 1E25A 1ZG6A 4U3TA 4OPZA 3G2YA 2Z2LB 5FQJA 2ZM0A 2FFFB 2J7VA 3GMWA 4U0TA 3G32A 3Q07A 2PU2A 2XEPA 4LENA 2G2WA 3SOIA 4S2KA 1ES2A 1KGFA 1S0WA 4X55A 2IWBA 1NJ4A 1PZPA 3MBZA 5KZHA 4S2MA 1QMFA 1W8QA 1KVLA 5GL9A 2FFYA 3ZG0A 1S6RA 4OP8A 1YT4A 5EUAA 3C4PA 5CGWA 3M2KA 2XD5A 5CTMA 5F83A 1DJAA 1YQSA 5F1FA 3E2KA 1CI8A 2Y2JA 4E3OA 1ES5A 1IELA 3M6BA 1GA0A 2Y2MA 1N9BA 1YLJA 4R23A 2ZMAA 3PAGA 3G31A 5CEBA 4YINA 3HLWA 1FQGA 3IH8A 3NIAA 1G6AA 2ZC4B 3B3XA 3VSLA 1EI5A 4R0QA 4E3LA 2HP6A 4WYYA 5JYPA 1FCNA 1HVBA 4QU3A 4YFMA 3DWKA 4DF6A 4KZ7A 1WYCA 4JPMA 3PTEA 2UWXA 3BFGA 1PWDA 2PBYA 3BFCA 3CJMA 1IYSA 2Y2KA 4OPRA 3V50A 4E6WA 5A90A 2I72A 2ZJ9A 2VGJA 3NCKA 1BUEA 4HEFA 1CI9A 1L0EA 3V3SA 3ZDJA 5D3OA 4DE1A 4WZ4A 1K56A 3E2LA 3FYZA 5FAOA 1I5QA 5L2FA 3S4XA 2P74A 4R4RA 4ID4A 3DWZA 3ZG7B 4XUXA 1E4DA 3NI9A 2WYXA 3SS4A 1ALQA 4R1GA 4P6BA 3I7JA 1MWSA 5GLDA 1IKGA 3N4IA 3PBQA 5F82A 1KGGA 4IBXA 2HPBA 3MXRA 4S2PA 1W79A 5JYOA 3OZHA 3MXSA 5EECA 4OP5A 2QZ6A 2Y2LA 2ZD8A 1MWTA 1YLZA 3UE3A 1K57C 4GOGA 2ZM8A 4JXVA 4JF6A 4MBHA 5CHUA 2BLSA 4BJPA 1NRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A49 A;  3PBR A;  1KE4 A;  1O07 A;  1XX2 A;  4C6Y A;  1BTL A;  2J8Y A;  2Y2N A;  2ZC5 B;  4IVI A;  5CRF A;  4X69 A;  4KG5 A;  4X6T A;  4O7D A;  3HLF A;  1XA7 A;  1PIO A;  4JXW A;  4MNR A;  1BLH A;  2WK0 A;  1DY6 A;  2PU4 A;  3VP2 A;  4DDS A;  1HD8 A;  4JF5 A;  5E2F A;  1KGE A;  1MY8 A;  1ERM A;  3IH9 A;  3UDX A;  3OPP A;  4DDY A;  1L0F A;  1SCW A;  4WMC A;  3GV9 A;  5DTT A;  4WMC D;  4WEL A;  2Y55 A;  2ZQA A;  4JLF A;  1QME A;  3VP4 A;  3JYI A;  3UN7 A;  1LL9 A;  1JWV A;  4ZTK A;  4JXG A;  2H0Y A;  3AGE A;  3C4O A;  3W8K A;  3HL9 A;  5FI7 A;  5FSR A;  2Y2G A;  3ZG8 B;  1GHM A;  2WGV A;  4S2I A;  2HDS A;  5DVA A;  3VP3 A;  1MPL A;  4CJN A;  5FAS A;  3MZE A;  2A3U A;  2WAE A;  5IHV A;  1ZG4 A;  3HBR A;  1JTG A;  3FV7 A;  1SHV A;  3C7U A;  5GLA A;  4UA6 A;  3WS0 A;  3WS1 A;  3ZFZ A;  5A93 A;  4D2O A;  1K6R A;  5A92 A;  1FSW A;  1ONG A;  3SS3 A;  3BM6 A;  4HBT A;  3ISG A;  4Z9Q A;  2GDN A;  4B4X A;  1ES3 A;  5GLB A;  1ES4 A;  3IHA A;  1TVF A;  4ZAM A;  1MKI A;  1NXY A;  1K4E A;  2DRW A;  5FI2 A;  1K6S A;  3HLG A;  4KG6 A;  3BFF A;  4BLM A;  5E43 A;  2Z2M B;  3GQZ A;  4KQQ A;  3UO9 A;  3UE0 A;  3IT9 A;  2C5W B;  2J9P A;  4JF4 A;  2EFU A;  4RX3 A;  3RXW A;  4DRT A;  4XUZ A;  2HDU A;  2ZQC A;  3NDG A;  3UPP A;  4BD0 A;  3W4P A;  4OQG A;  4WZ5 C;  3WS4 A;  1PWC A;  2XGN A;  2X02 A;  5FI6 A;  1WYB A;  3G30 A;  1BT5 A;  4UA9 A;  5HX9 A;  4FSF A;  2XK1 A;  4R4S A;  3NDE A;  3A3I A;  4WM9 A;  2XFS A;  3PBS A;  5M19 A;  1JWZ A;  1W5D A;  2OSU A;  2V1Z A;  2VGK A;  4GN2 A;  2R9W A;  2Y4A A;  1K54 A;  4P0M A;  1BLS A;  3QNC A;  3A3F A;  2H5S A;  5FAQ A;  1J9M A;  1K55 A;  2XQZ A;  1FCM A;  2EXB A;  3HUM A;  5FQI A;  4OQH A;  3Q82 A;  4ZJ2 A;  3VOZ A;  2J9O A;  3IHB A;  1ERO A;  3LY3 A;  5AQ9 A;  1GHP A;  1YLT A;  1IEM A;  4QJG A;  3WWX A;  5FDH A;  3NBL A;  4PM7 A;  5E2G A;  5DF7 A;  1JTD A;  1JWP A;  2RCX A;  3GTC A;  4IVK A;  3PBN A;  5U47 A;  3DW0 A;  4Y7P A;  3NY4 A;  2CC1 A;  5FQ9 A;  3A3J A;  1GA9 A;  1H8Y A;  3UDF A;  4ZJ3 A;  1PYY A;  1BLP A;  1FR1 A;  1KE3 A;  3QHY A;  2OV5 A;  1NYM A;  4FH2 A;  4OLD A;  1PI4 A;  3ZGA B;  4E3I A;  1L0G A;  4PM5 A;  5GHZ A;  3SH9 A;  4F94 A;  5KSH A;  3C7V A;  5HFO A;  4KZ9 A;  4OKP A;  1SDE A;  3CMZ A;  1YMX A;  3PAE A;  3ZG5 A;  5KSC A;  2ZQ7 A;  4FCF A;  1GHI A;  2IWC A;  3ITA A;  3OPH A;  1FR6 A;  4PM9 A;  3UDI A;  4L0L A;  1DJC A;  4DE3 A;  3BYD A;  4MBF A;  5CED A;  2WKH A;  4DXB A;  4K0W A;  1SDN A;  1H8Z A;  5G18 A;  4P87 A;  3N6I A;  5A91 A;  4A5R A;  3G2Z A;  1BLC A;  4X56 A;  2EXA A;  4U0X A;  4UHU A;  1ZC2 A;  2QMI A;  2C6W B;  4LV0 A;  2ZC3 B;  1O7E A;  4FD8 A;  1CEG A;  3P09 A;  4N9L A;  4Q8I A;  3RXX A;  3ZHH A;  1BSG A;  5TR7 A;  4MLL A;  2Q9M A;  2Y2I A;  5HL1 A;  1YMS A;  3ZNY A;  3Q7Z A;  3Q7V B;  2EX6 A;  3OPR A;  2WGW B;  4WEK A;  4CPK A;  1PWG A;  3EQU A;  4BD1 A;  4BQM A;  4X68 A;  4EBN A;  4EBP A;  1LLB A;  4E6X A;  3OC2 A;  3TOI A;  2HDQ A;  3IWI A;  1GCE A;  2WZZ A;  2ZLY A;  5M1A A;  4JBF A;  4E3N A;  5EPH A;  3WRZ A;  4GDB A;  5HAQ A;  3N8L A;  2WAF A;  2ZM2 A;  4EQI A;  5I94 A;  4RA7 A;  4MBK A;  3BLS A;  3S22 A;  5CEC A;  1IYQ A;  2EX8 A;  4R3B A;  4C3Q A;  3LY4 A;  1XGJ A;  5DF8 A;  3ZG9 B;  1YLW A;  3SH7 A;  3ZVT A;  2XFT A;  2Y2Q A;  2X71 A;  4WEJ A;  4LV2 A;  5EOE A;  2Q9N A;  3MKF A;  1L0D A;  5J8X A;  2IWD A;  1MXO A;  4X53 A;  3SH8 A;  3TSG A;  1TDL A;  1WE4 A;  5AQB A;  5EVL A;  2OLV A;  1N4O A;  4P85 A;  1RCJ A;  2V2F F;  5GHY A;  3VP1 A;  3PBO A;  5EOO A;  4UA7 A;  3HUO A;  4H8R A;  2HDR A;  3G35 A;  1TDG A;  3O87 A;  1K25 A;  5E2H A;  3IF6 B;  2P9V B;  3V5M A;  2WZX A;  1C3B A;  1VM1 A;  1W8Y A;  2DCF A;  3N8R A;  3TG9 A;  3W4Q A;  1XPB A;  1M6K A;  5DTK A;  3O88 A;  2EFX A;  3BLM A;  3RJU A;  1U60 A;  2HP5 A;  3HLC A;  3UY6 A;  4E3J A;  4KEN B;  2JCH A;  4LV1 A;  1LL5 A;  1ERQ A;  1LI0 A;  5FQM A;  4EUZ A;  2WKI A;  5HAR A;  3UNW A;  3BEB A;  3IXH A;  5EVI C;  2XH9 A;  1NZU A;  3HLE A;  2Y2O A;  2V20 A;  5CGX A;  5HAP A;  4KQO A;  3EQV A;  4K0X A;  3OCN A;  4PMA A;  2JE5 A;  2WGI A;  1KVM A;  2ZQD A;  1ESU A;  2RL3 A;  4QD4 A;  5CER A;  4OVD A;  4S2N C;  2WUQ A;  3BEC A;  4GB7 A;  5F1G A;  1EWZ A;  4GDN A;  2P9V A;  3O86 A;  4KZ8 A;  5FA7 A;  3WS5 A;  4RX2 A;  1W7F A;  5GLC A;  1VQQ A;  1NY0 A;  3SS5 A;  1IYO A;  5TGF A;  1KE0 A;  1XXM A;  3W4O A;  1E3U A;  1K38 A;  4KQR A;  1FCO A;  1E3U D;  2EX2 A;  3A3E A;  4OOY A;  5E2E A;  4OON A;  2E8I A;  4KZ6 A;  5CTN A;  4GZB A;  4Y0T A;  3PBT A;  1I2S A;  4NET A;  4B88 A;  3MZD A;  2G2U A;  4EV4 A;  1L2S A;  4R3J A;  3IF6 C;  4UAA A;  5KMW A;  1Y54 A;  3ZNT A;  3MFD A;  3WS2 A;  3HRE A;  4OQ0 A;  3VP0 A;  3Q1F A;  3HLB A;  3VOY A;  5DF9 A;  1LI9 A;  4E3K A;  3BFD A;  3HUN A;  4DE2 A;  4ZDX A;  1HZO A;  3MKE A;  5FQK A;  4RVA A;  5TFQ A;  1RGZ A;  4N1H A;  4N1X A;  1CK3 A;  3OPL A;  4OOM A;  2WAD A;  3IWO A;  1Q2P A;  3NC8 A;  1TEM A;  4PM6 A;  5GHX A;  3V39 A;  3VFF A;  4NK3 A;  3LO7 A;  2H0T A;  1K4F A;  3ITB A;  1JVJ A;  1K54 C;  2XLN A;  3S1Y A;  2QPN A;  2BG1 A;  2JC7 A;  2OLU A;  3IXG A;  3IQA A;  4B4Z A;  1K57 A;  1K55 C;  4IED A;  3UPN A;  3FKV A;  2R9X A;  1YLP A;  3D4F A;  1RP5 A;  2XDM A;  4KZA A;  3ZVW A;  5AQA A;  4ZJ1 A;  1PW8 A;  4QHC A;  4Y0U A;  1XP4 A;  1MBL A;  1XGI A;  3CG5 A;  3HVF A;  4JXS A;  2EX9 A;  4RYE A;  3A3D A;  1I2W A;  3N7W A;  3HLD A;  1Q2Q A;  3LEZ A;  3M6H A;  3G34 A;  3V3R A;  1LHY A;  2ZC7 A;  2XR0 A;  4HES A;  1K56 D;  3IWQ A;  4DKI A;  4EWF A;  2ZC6 B;  3GVB A;  4K91 A;  3O3V A;  5EVI B;  4IBR A;  3VMA A;  1HTZ A;  1YLY A;  3G4P A;  4ZBE A;  5CXW A;  1M40 A;  1PI5 A;  3GRJ A;  4EBL A;  3IXD A;  1OME A;  3AGF A;  4XXR A;  1DJB A;  3MZF A;  5EE8 A;  4LV3 A;  1H5X A;  4OLG A;  2WKE A;  5M18 A;  1Z6F A;  4OPY A;  4M3K A;  4N9K A;  4WBG A;  4GD8 A;  1IYP A;  4KZ5 A;  2B5R A;  3FWL A;  3DTM A;  3Q81 A;  1XA1 A;  5FQQ A;  4KG2 A;  4DXC A;  4C75 A;  4BL2 A;  1SKF A;  3CZD A;  5HW3 A;  1BUL A;  4S2J A;  1MWU A;  5CHM A;  3BFE A;  1YM1 A;  4OQI A;  1IKI A;  1PZO A;  2Y91 A;  3FZC A;  3Q7V A;  2WGW A;  4OPQ A;  4QY5 A;  5DTS A;  3UE1 A;  2DNS A;  4PPR A;  4E3M A;  1MWR A;  2ZQ8 A;  4N92 A;  3WRT A;  3ZCZ A;  5EVI A;  3VSK A;  2ZQ9 A;  4QB8 A;  1XKZ A;  1AXB A;  5EVI D;  2HP9 A;  3QNB A;  1NYY A;  4KZB A;  2Y2H A;  3M2J A;  2XF3 A;  3GSG A;  4WZ5 A;  5HAI A;  1KDW A;  2JBF A;  5BOH A;  5AQ7 A;  4FH4 A;  4KZ4 A;  2X01 A;  3VFH A;  4HBU A;  4LCM A;  4Y0O A;  1NZO A;  4BEN A;  1RGY A;  4S2O A;  3LCE A;  4GD6 A;  4OOL A;  3C5A A;  4S2N A;  2H10 A;  1PW1 A;  1BZA A;  1KDS A;  4JKT A;  4QY6 A;  4DE0 A;  2Y59 A;  4GKU A;  3BRM A;  3IXB A;  4MEZ A;  4OH0 A;  1ESI A;  3GR2 A;  5CHJ A;  4KZ3 A;  1FOF A;  3FKW A;  5FAP A;  3AGD A;  4GNU A;  3P98 A;  3UPO A;  3IF5 A;  3OCL A;  1CEF A;  4PM8 A;  5FAT A;  1FSY A;  3IF6 A;  3N8S A;  2Y2P A;  1G68 A;  4S2L A;  4BL3 A;  4LCL A;  1ZKJ A;  2XD1 A;  5CGS A;  1ONH A;  1E25 A;  1ZG6 A;  4U3T A;  4OPZ A;  3G2Y A;  2Z2L B;  5FQJ A;  2ZM0 A;  2FFF B;  2J7V A;  3GMW A;  4U0T A;  3G32 A;  3Q07 A;  2PU2 A;  2XEP A;  4LEN A;  2G2W A;  3SOI A;  4S2K A;  1ES2 A;  1KGF A;  1S0W A;  4X55 A;  2IWB A;  1NJ4 A;  1PZP A;  3MBZ A;  5KZH A;  4S2M A;  1QMF A;  1W8Q A;  1KVL A;  5GL9 A;  2FFY A;  3ZG0 A;  1S6R A;  4OP8 A;  1YT4 A;  5EUA A;  3C4P A;  5CGW A;  3M2K A;  2XD5 A;  5CTM A;  5F83 A;  1DJA A;  1YQS A;  5F1F A;  3E2K A;  1CI8 A;  2Y2J A;  4E3O A;  1ES5 A;  1IEL A;  3M6B A;  1GA0 A;  2Y2M A;  1N9B A;  1YLJ A;  4R23 A;  2ZMA A;  3PAG A;  3G31 A;  5CEB A;  4YIN A;  3HLW A;  1FQG A;  3IH8 A;  3NIA A;  1G6A A;  2ZC4 B;  3B3X A;  3VSL A;  1EI5 A;  4R0Q A;  4E3L A;  2HP6 A;  4WYY A;  5JYP A;  1FCN A;  1HVB A;  4QU3 A;  4YFM A;  3DWK A;  4DF6 A;  4KZ7 A;  1WYC A;  4JPM A;  3PTE A;  2UWX A;  3BFG A;  1PWD A;  2PBY A;  3BFC A;  3CJM A;  1IYS A;  2Y2K A;  4OPR A;  3V50 A;  4E6W A;  5A90 A;  2I72 A;  2ZJ9 A;  2VGJ A;  3NCK A;  1BUE A;  4HEF A;  1CI9 A;  1L0E A;  3V3S A;  3ZDJ A;  5D3O A;  4DE1 A;  4WZ4 A;  1K56 A;  3E2L A;  3FYZ A;  5FAO A;  1I5Q A;  5L2F A;  3S4X A;  2P74 A;  4R4R A;  4ID4 A;  3DWZ A;  3ZG7 B;  4XUX A;  1E4D A;  3NI9 A;  2WYX A;  3SS4 A;  1ALQ A;  4R1G A;  4P6B A;  3I7J A;  1MWS A;  5GLD A;  1IKG A;  3N4I A;  3PBQ A;  5F82 A;  1KGG A;  4IBX A;  2HPB A;  3MXR A;  4S2P A;  1W79 A;  5JYO A;  3OZH A;  3MXS A;  5EEC A;  4OP5 A;  2QZ6 A;  2Y2L A;  2ZD8 A;  1MWT A;  1YLZ A;  3UE3 A;  1K57 C;  4GOG A;  2ZM8 A;  4JXV A;  4JF6 A;  4MBH A;  5CHU A;  2BLS A;  4BJP A;  1NRF A; 
#chains in the Genus database with same CATH topology
 3PBR A;  4X69 A;  1CJF A;  1NWZ A;  4KG5 A;  4X6T A;  1XA7 A;  4F3L B;  4AFI A;  1KGE A;  1MY8 A;  4BMW A;  3KO6 A;  1SCW A;  3GV9 A;  5DTT A;  4WEL A;  2ZQA A;  3UN7 A;  1LL9 A;  4ZTK A;  3UB6 A;  3UE6 A;  1YSP A;  3W8K A;  3HL9 A;  4FUW A;  3QP8 A;  2XRN A;  3VP3 A;  3R4K A;  3MZE A;  2A3U A;  3FG8 A;  1N9L A;  1ZG4 A;  3HBR A;  5GLA A;  2CMN A;  5A92 A;  4E04 A;  3ISG A;  4Z9Q A;  4DN0 A;  3IHA A;  1NXY A;  2DRW A;  3CUE A;  5E43 A;  3UO9 A;  1N9O A;  3GQZ A;  3IT9 A;  4DRT A;  1UGU A;  2J80 A;  2ZOH A;  1T1C A;  4BD0 A;  3PXP A;  2XGN A;  3ULF A;  4UA9 A;  2BTF P;  3NDE A;  3LR5 A;  2Y4A A;  5L8M A;  3KSH A;  1BLS A;  3QNC A;  3A3F A;  4LGW A;  4NXB A;  3Q82 A;  2J9O A;  1W63 Q;  1A0K A;  4Y5F A;  1Z09 A;  5DF7 A;  2J3T D;  4MMN A;  4H6J A;  5U47 A;  2JKT I;  4ZJ3 A;  2OV5 A;  1ODV A;  3ZGA B;  4E3I A;  3VOL A;  4F94 A;  4HJ4 A;  3PAE A;  4I38 A;  4GHI B;  4FCF A;  2IWC A;  3ITA A;  2VEA A;  3D72 A;  1DJC A;  4MN6 A;  1PFL A;  5G18 A;  1F9I A;  1X0O A;  2QMI A;  4FD8 A;  3PYP A;  3CPT A;  3DAV A;  4Q8I A;  2PD8 A;  1BSG A;  1VB6 A;  5TR7 A;  2Q9M A;  5HL1 A;  4GS9 B;  3ZNY A;  3Q7Z A;  5TBM B;  3OC2 A;  2HDQ A;  4R6L A;  1GCE A;  2ZLY A;  4WUJ A;  3HJK A;  5EPH A;  4MCW A;  3TE8 A;  2VV8 A;  4ESP A;  1ZTU A;  5IT5 A;  4MBK A;  1TD5 A;  1IYQ A;  4R3B A;  3LY4 A;  3ZG9 B;  2X71 A;  4WEJ A;  4LV2 A;  5EOE A;  2Q9N A;  1L0D A;  3ZQ5 A;  1MXO A;  1PRQ A;  3SH8 A;  3MJQ A;  3LFV A;  4ME4 A;  1WE4 A;  4P85 A;  3VP1 A;  1TDG A;  5E2H A;  2XRO A;  3V5M A;  3W4Q A;  4F3L A;  5HPF A;  1U60 A;  2HP5 A;  3UY6 A;  3KX0 X;  4E3J A;  2JCH A;  5FQM A;  2WKI A;  5HAR A;  4EXO A;  5EVI C;  5L09 A;  2M1C A;  2WGI A;  2RL3 A;  4OVD A;  4CQH A;  2P9V A;  2V0W A;  4UQI M;  5CX7 A;  1NY0 A;  3LIC A;  4OOY A;  3A3E A;  2WKR A;  4B88 A;  3IF6 C;  3T4J A;  1Y54 A;  3Q1F A;  3QP6 A;  5L07 A;  3NOU C;  5HD5 A;  3MKE A;  5FQK A;  2V8C A;  4RVA A;  1CK3 A;  1FIL A;  2WAD A;  1TEM A;  2VV6 A;  4PM6 A;  3LO7 A;  2H0T A;  4WF0 A;  2B95 A;  2QKP A;  4IHQ A;  2BG1 A;  4B4Z A;  4IED A;  3UPN A;  2KX6 A;  2XDM A;  2Y79 A;  5AQA A;  2VX8 A;  3CIT A;  2K2N A;  4JXS A;  2EX9 A;  2W0N A;  3UB5 P;  3G34 A;  1LHY A;  1VHM A;  4HES A;  3QP4 A;  4IBR A;  4GHI A;  1PI5 A;  4EBL A;  4XXR A;  1T1A A;  5G4Y A;  4M3K A;  1IYP A;  3DTM A;  3T4L A;  4KG2 A;  2OOL A;  5EFW A;  4Q0I A;  3CZD A;  5HW3 A;  4S2J A;  3T1X A;  3UB7 A;  3O5Y A;  1YM1 A;  4GS9 A;  3FZC A;  5DTS A;  3UE1 A;  5TBM A;  3EWK A;  3VSK A;  1AXB A;  3QNB A;  2Y2H A;  3M2J A;  2XF3 A;  5DJT A;  1KDW A;  1H3Q A;  3IX3 A;  3VFH A;  3LEQ A;  4HBU A;  4LCM A;  2PHY A;  4Y0O A;  1RGY A;  4MN7 A;  4S2O A;  3LCE A;  4GD6 A;  4CLC D;  1VEU B;  4KUK A;  3G6O A;  4K08 A;  4MEZ A;  3LID A;  1ESI A;  4KZ3 A;  1FOF A;  5FAP A;  4BBT A;  3P98 A;  5F69 A;  3OCL A;  2Q0O A;  2OAQ 1;  5DKK A;  4DMZ A;  3E4O A;  2Z6C A;  4OPZ A;  2Z2L B;  5FQJ A;  5HWW A;  2XEP A;  3LR4 A;  1UWP X;  2W1T A;  4I3A A;  2IWB A;  4S2M A;  1DRM A;  1KVL A;  3ZG0 A;  4OP8 A;  1YT4 A;  1JNU A;  2Y2J A;  3T4T A;  4R23 A;  2OWJ A;  4YIN A;  3HLW A;  1FQG A;  4GLQ A;  3DWK A;  2I72 A;  2H28 A;  2VGJ A;  4Y2F A;  1BUE A;  2NUT C;  4GW9 A;  1L0E A;  3V3S A;  2J3T C;  2PRF A;  5L2F A;  4JGR A;  3S4X A;  3DWZ A;  4XUX A;  2EWW A;  5DJU A;  5GLD A;  3N4I A;  3PBQ A;  1KGG A;  4S2P A;  3F1O B;  5JYO A;  3OZH A;  3CWF A;  3L9K A;  3UE3 A;  2ZM8 A;  5CHU A;  1NRF A;  1P9W A;  1O07 A;  1XX2 A;  2R78 A;  4C6Y A;  2ZC5 B;  4IVI A;  2WKQ A;  3BJN A;  2QWS A;  2WK0 A;  1HD8 A;  1DP9 A;  2PDR A;  3OPP A;  1L0F A;  4WMC A;  4I3J A;  3TW8 A;  2Y55 A;  4JLF A;  3JYI A;  1JWV A;  4JXG A;  2H0Y A;  3AGE A;  3OOV A;  5FSR A;  2Y2G A;  2HDS A;  5DVA A;  2WAE A;  2PT7 A;  1JTG A;  3IBJ A;  1SHV A;  2HJ9 C;  3C7U A;  3F1P B;  3E4P A;  3WS0 A;  5A93 A;  3CHW P;  4D2O A;  1FSW A;  2LB5 A;  2QHK A;  3OBF A;  1OJ5 A;  1IOU A;  4B4X A;  1ES3 A;  2O99 A;  1ES4 A;  3OLO A;  1TVF A;  4ZAM A;  1MKI A;  1WA9 A;  3BY9 A;  2YKF A;  5FI2 A;  4KG6 A;  1YSQ A;  2JKG A;  4Z1W A;  2B02 A;  2EFU A;  3NUL A;  3RXW A;  3D9Y A;  2HDU A;  3NDG A;  4XUZ A;  3W4P A;  4OQG A;  4WZ5 C;  4G3W A;  5FI6 A;  3U2A A;  2ZBB A;  1VEU A;  2JKF A;  2XK1 A;  4R4S A;  5I5L A;  3DTI A;  2VGK A;  4GN2 A;  2NUP C;  2PR6 A;  2BAS A;  1K54 A;  4Q0H A;  2V8F A;  3KYE A;  5FAQ A;  1J9M A;  1FCM A;  5HPI A;  4HH3 A;  4HI4 A;  4ZJ2 A;  1MC0 A;  5F6A A;  3S7N A;  3LY3 A;  5IS1 A;  1IEM A;  3NBL A;  4PM7 A;  1JTD A;  2RCX A;  3GTC A;  4Y3I A;  3TRC A;  3NY4 A;  3A3J A;  1H8Y A;  1PYY A;  1BLP A;  3KSG A;  4O8G A;  3ZYT A;  4FH2 A;  1PI4 A;  2W1R A;  5GHZ A;  3C7V A;  4OKP A;  2ZQ7 A;  3OPH A;  3GDI A;  3T50 A;  3BYD A;  5CED A;  2WKH A;  1XFQ A;  1SDN A;  4P87 A;  2VLG A;  1ZC2 A;  4EEP A;  1O7E A;  1CEG A;  3P7N A;  3ZHH A;  4O01 A;  2V1B A;  1PWG A;  4BD1 A;  3BWL A;  4EBP A;  1LLB A;  1DP8 A;  3MQ0 A;  4HJ3 A;  3WRZ A;  5HAQ A;  3N8L A;  1G6O A;  4EQI A;  1XGJ A;  5DF8 A;  3F1O A;  2XFT A;  3EEA A;  3MKF A;  5J8X A;  4Q0J A;  3JPU A;  3TSG A;  1TDL A;  5K5B A;  3FC7 A;  3PBO A;  3C30 A;  2HDR A;  3O87 A;  1K25 A;  3IF6 B;  2P9V B;  4FTX A;  2WZX A;  5HDS A;  3TG9 A;  3IS2 A;  1XPB A;  1M6K A;  1XJ6 A;  3BLM A;  3RTY A;  1PNE A;  2V1A A;  3H82 B;  1LI0 A;  3EGD C;  1TS8 A;  2D01 A;  5HAP A;  4KQO A;  3EQV A;  4CLC C;  1ESU A;  3F1P A;  5F1G A;  1EWZ A;  3LIA A;  3O86 A;  1W7F A;  1IYO A;  5TGF A;  1KE0 A;  1XXM A;  1E3U A;  1NLY A;  1T18 A;  3S7Q A;  4KQR A;  2E8I A;  5CTN A;  4GZB A;  4Y0T A;  1I2S A;  3MZD A;  2G2U A;  1KOU A;  4R3J A;  4UAA A;  3ZNT A;  5J4E A;  3HRE A;  3VP0 A;  3VOY A;  1LI9 A;  3HUN A;  3T1Q B;  4DE2 A;  4ZDX A;  4IUK A;  4P6Z S;  5TFQ A;  1LSW A;  4LPZ A;  4N1X A;  3OPL A;  4HIA A;  5GHX A;  4NK3 A;  3EEH A;  3T1R A;  1S4R A;  3IXG A;  3FKV A;  4KZA A;  1PW8 A;  4QHC A;  3CG5 A;  4WLA A;  4RYE A;  3A3D A;  1Q2Q A;  2XR0 A;  1YLY A;  3GRJ A;  3IXD A;  1LL8 A;  3AGF A;  4LV3 A;  4OLG A;  4R38 A;  5M18 A;  1Z6F A;  4OPY A;  3GEC A;  1CF0 A;  4N9K A;  2VA0 A;  5HDC A;  3FWL A;  1ZHH B;  1XA1 A;  5FQQ A;  4DXC A;  1SKF A;  2OAP 1;  1BUL A;  3CLO A;  1MWU A;  3JVV A;  3LI8 A;  2Y91 A;  3MFX A;  4OPQ A;  4QY5 A;  3LIE A;  4PPR A;  1MWR A;  2ZQ8 A;  5EVI A;  4B9O A;  5TJJ A;  4CLC E;  3KSF A;  2W3D A;  4KZB A;  1P0Z A;  5BOH A;  5AQ7 A;  1FIK A;  2M7U A;  2O9A A;  4BEN A;  4OOL A;  3C5A A;  2H10 A;  2VK3 A;  1PW1 A;  3RFB A;  2IA2 A;  4QY6 A;  3NOT C;  2W1T B;  3IXB A;  4OH0 A;  4HP4 A;  1GSV A;  5J7E A;  5FEG A;  3NHQ A;  4GNU A;  4PM8 A;  1CEF A;  1Y28 A;  1FSY A;  3IF6 A;  4EER A;  3B33 A;  4LCL A;  1ZKJ A;  4U3T A;  3H82 A;  2J3W A;  2FFF B;  3KYZ A;  3Q07 A;  4LEN A;  3SOI A;  1ES2 A;  1KGF A;  2G7U A;  1S0W A;  1MZU A;  2W3H A;  3LR0 A;  1PZP A;  3NOP C;  1W8Q A;  5GL9 A;  2PAV P;  4II7 A;  5CGW A;  3M2K A;  3E2K A;  5HZH A;  1OTB A;  1CI8 A;  2A24 A;  4E3O A;  3EOI A;  3IBR A;  3M6B A;  1YLJ A;  3G31 A;  3IH8 A;  1UWN X;  3VSL A;  2HP6 A;  3MF0 A;  4NG2 A;  4WYY A;  1FCN A;  4QU3 A;  4KZ7 A;  1WYC A;  3V67 A;  2UV0 E;  2UWX A;  5LBR A;  3BFG A;  2PBY A;  1IYS A;  4OPR A;  2QJ5 A;  1CI9 A;  1XJ2 A;  3QP1 A;  4WZ4 A;  1K56 A;  4WN5 A;  3D3O A;  1S1Y A;  3NI9 A;  2W3F A;  2WYX A;  3SS4 A;  1OJG A;  3I7J A;  1MWS A;  5AVE A;  4IBX A;  4EQ1 A;  1W79 A;  3MXS A;  4OP5 A;  3ICY A;  2QZ6 A;  2Y2L A;  2L4R A;  1YLZ A;  4JXV A;  4BJP A;  1J3W A;  2A49 A;  1BTL A;  4I5S A;  4M4X A;  5CRF A;  4O7D A;  1D7E A;  3HLF A;  5EM0 A;  1BLH A;  3VP2 A;  4DDS A;  5HL6 A;  4JF5 A;  5E2F A;  5L10 A;  3BY8 A;  2VZW A;  2VJW A;  3DTK A;  4DDY A;  3SZT A;  1TS0 A;  3VP4 A;  1QME A;  3IX8 A;  3UMD A;  4HQA A;  4LFU A;  3C4O A;  2WGV A;  4CJN A;  5F68 A;  3FV7 A;  2ZL1 B;  4UA6 A;  3ZFZ A;  1K6R A;  4KQD A;  3BM6 A;  4HBT A;  3LR3 A;  1OTA A;  1K4E A;  4HJ6 A;  3E0Y A;  3HLG A;  3BFF A;  4BLM A;  4KQQ A;  3UE0 A;  2J9P A;  4JF4 A;  3UPP A;  5FL3 A;  1NLZ A;  1PWC A;  2INW A;  5HX9 A;  4FSF A;  3A0V A;  3A3I A;  3PBS A;  1JWZ A;  2OSU A;  2V1Z A;  2HV1 A;  2H5S A;  1K55 A;  1H0M A;  2EXB A;  3MS6 A;  3HUM A;  5FQI A;  4OQH A;  3VOZ A;  4KUO A;  3IHB A;  4NKP A;  1GHP A;  5E2G A;  3DW0 A;  4Y7P A;  5FQ9 A;  3LYX A;  1GA9 A;  3UDF A;  1OTI A;  1KE3 A;  1NYM A;  4ARZ B;  5KSH A;  4P6Z M;  1SDE A;  1YMX A;  3ZG5 A;  5KSC A;  3UDI A;  1GHI A;  4PM9 A;  3SW1 A;  2W27 A;  4NXE A;  4DE3 A;  3F1N B;  4MBF A;  1OTE A;  4DXB A;  4K0W A;  3N6I A;  3G2Z A;  1BLC A;  4X56 A;  2EXA A;  4U0X A;  4UHU A;  2C6W B;  2ZC3 B;  1LT0 A;  3P09 A;  2PD7 A;  2KDK A;  5HWT A;  1YMS A;  2WGW B;  4WEK A;  4CPK A;  3H9W A;  4X68 A;  4EBN A;  2LB9 A;  2W3E A;  4E6X A;  3TOI A;  1VET B;  4E3N A;  3IS2 B;  1XJ4 A;  2WAF A;  5I94 A;  3U4L P;  4CLC B;  3S22 A;  5CEC A;  2EX8 A;  4C3Q A;  1YLW A;  1D06 A;  2Y2Q A;  2HGV A;  1S1Z A;  4YNR A;  2IWD A;  4X53 A;  5AQB A;  5GHY A;  5KMW A;  1N4O A;  1RCJ A;  2V2F F;  5EOO A;  3HUO A;  2DCF A;  5MC7 A;  3O88 A;  3RJU A;  3S7P A;  4IJG A;  3HLC A;  4KEN B;  4LV1 A;  1F98 A;  1ERQ A;  4EUZ A;  4IUH A;  5KIZ A;  3UNW A;  3BEB A;  2XH9 A;  1NZU A;  3HLE A;  5HD3 A;  2Y2O A;  1L3L A;  1ACF A;  4HP9 A;  4K0X A;  4PMA A;  3DTE A;  2ZQD A;  5DKL A;  2ZL1 A;  3FPW A;  3FPV A;  4S2N C;  4GB7 A;  5FA7 A;  4RX2 A;  1YKD A;  5GLC A;  1VQQ A;  3SS5 A;  4HH2 A;  3W4O A;  3MQO A;  1K38 A;  4OON A;  5J3W A;  3KSI A;  4NET A;  4X25 A;  4EV4 A;  1T19 A;  1L2S A;  1P97 A;  3T4K A;  3MFD A;  1F2K A;  2WKP A;  4OQ0 A;  5AVF A;  4HY8 A;  3HLB A;  3C38 A;  5DF9 A;  4E3K A;  3BFD A;  1HZO A;  1TS6 A;  1G28 A;  2V0U A;  1RGZ A;  4N1H A;  2FH5 A;  3IWO A;  1Q2P A;  1GSX A;  3VFF A;  1K4F A;  1JVJ A;  1K54 C;  3MXQ A;  3S1Y A;  2QPN A;  2JC7 A;  2OLU A;  4I3I A;  3IQA A;  1K57 A;  2Z6D A;  2R9X A;  3D4F A;  4ETZ A;  3E98 A;  3ZVW A;  4ZJ1 A;  1XP4 A;  3DBA A;  4I39 A;  3HLD A;  3M6H A;  4JGQ A;  3E4Q A;  3V3R A;  2ZC7 A;  1K56 D;  3IWQ A;  4DKI A;  4ARZ A;  4EWF A;  1N9N A;  4NXF A;  3O3V A;  5EVI B;  3VMA A;  3G4P A;  4ZBE A;  1K0K A;  1M40 A;  1OME A;  3F1N A;  5EE8 A;  2P08 A;  2WKE A;  3K3C A;  4WBG A;  4L9G A;  4KZ5 A;  2B5R A;  2I9V A;  4EU0 A;  2XSS A;  4BL2 A;  5CHM A;  1CQA A;  1OT9 A;  3BFE A;  4BWI A;  2VGL S;  4OQI A;  1IKI A;  2WGW A;  4WL9 A;  2L1M A;  2DNS A;  4R3A A;  4E3M A;  4N92 A;  3ZCZ A;  4QB8 A;  1XKZ A;  1DP6 A;  4EES A;  1NYY A;  3GSG A;  1HLU P;  1VET A;  1LSV A;  2JBF A;  5EV0 A;  1NZO A;  4CLC A;  3C8C A;  5FDS A;  1BZA A;  4JKT A;  2Y59 A;  3GR2 A;  3AGD A;  2EA9 A;  2XA7 S;  3IF5 A;  4YOF A;  3N8S A;  1G68 A;  4S2L A;  2A24 B;  3EGX C;  4XT2 B;  5HSQ A;  1ONH A;  1ZG6 A;  5A8B A;  3HJI A;  1AWI A;  4X1L A;  2J7V A;  2PYR A;  2HF6 A;  3CUE C;  3RH8 B;  3LIF A;  5HDD A;  2K31 A;  2HZ5 A;  3QP2 A;  4JGO A;  4G3V A;  2FFY A;  5EUA A;  3C4P A;  3T4Q A;  3A0S A;  5CTM A;  5F83 A;  5F1F A;  4B93 A;  3KYQ A;  1IEL A;  1GA0 A;  4O0P A;  2Y2M A;  1N9B A;  3PAG A;  2GX5 A;  1G6A A;  3B3X A;  4E3L A;  1HVB A;  4YFM A;  1V9Z A;  4JPM A;  3PTE A;  1PWD A;  3CJM A;  5A90 A;  3L7H A;  2PBD P;  2O0Y A;  3ZDJ A;  5D3O A;  4DE1 A;  3FYZ A;  2JHE A;  2P74 A;  2JKR M;  3ZG7 B;  3IX4 A;  3PR6 A;  1S4S A;  1ALQ A;  4R1G A;  4P6B A;  1IKG A;  4QWO A;  2HPB A;  3LI9 A;  4PKY A;  2GJ3 A;  5EEC A;  4LRY C;  4FOF A;  1MWT A;  2VKS A;  3MQQ A;  1KE4 A;  2P04 A;  2M7V A;  2J8Y A;  2E8J A;  2Y2N A;  4YWZ A;  1PIO A;  4JXW A;  1D1J A;  2YKH A;  4MNR A;  2KOI A;  1DY6 A;  2PU4 A;  3T1S A;  1ERM A;  3IH9 A;  3UDX A;  4WMC D;  2DMW A;  1YAX A;  5FI7 A;  3ZG8 B;  1GHM A;  4S2I A;  5FAS A;  1MPL A;  4L9E A;  5IHV A;  3WS1 A;  1G5U A;  1ONG A;  3SS3 A;  1TF1 A;  2GDN A;  5GLB A;  5EVE A;  1T1B A;  3CAX A;  1K6S A;  2Z2M B;  2C5W B;  4RX3 A;  4EUV A;  2ZQC A;  3WS4 A;  3MMH A;  2X02 A;  1WYB A;  3G30 A;  1BT5 A;  4X1M A;  4HOI A;  3H7W B;  2PR5 A;  4WM9 A;  2ZOI A;  2XFS A;  5M19 A;  1W5D A;  2R9W A;  3T4O A;  2PYP A;  4Y17 A;  4P0M A;  5FEF A;  2XQZ A;  3VV4 A;  4XT2 A;  1ERO A;  2D02 A;  5AQ9 A;  1YLT A;  5AJG A;  4QJG A;  3WWX A;  5FDH A;  1IFQ A;  3C2W A;  1JWP A;  4IVK A;  3PBN A;  4L9F A;  3P01 A;  2CC1 A;  4LRX C;  1S66 L;  1FR1 A;  3QHY A;  4OLD A;  2K7S A;  1L0G A;  4PM5 A;  3SH9 A;  1BYW A;  5HFO A;  4KZ9 A;  2EWV A;  3CMZ A;  3T12 B;  4ZRR A;  1OPX A;  1FR6 A;  4L0L A;  1SKO B;  1H8Z A;  5DFY A;  5A91 A;  4A5R A;  4DJ2 A;  1XJ3 A;  4BBV A;  4LV0 A;  3W2Z A;  4N9L A;  2VV7 A;  1NRJ A;  3RXX A;  4MLL A;  2Y2I A;  4MDZ A;  1OT6 A;  3Q7V B;  2EX6 A;  3OPR A;  3EQU A;  4PHT A;  4BQM A;  3IWI A;  2P7J A;  2WZZ A;  5M1A A;  4JBF A;  4GDB A;  2ZM2 A;  4RA7 A;  3BLS A;  4ETX A;  2L0W A;  4GJ4 A;  3SH7 A;  3ZVT A;  4Y15 A;  3CI6 A;  4UEY A;  5EVL A;  2OLV A;  4PAU A;  2VGL M;  4UA7 A;  4H8R A;  4MN5 A;  3G35 A;  1C3B A;  1VM1 A;  1W8Y A;  3N8R A;  5DTK A;  3R7W B;  2EFX A;  2O9B A;  1H8M A;  5HWV A;  1LL5 A;  3B47 A;  3LGO A;  3IXH A;  1EW0 A;  2W3G A;  2HJE A;  2V20 A;  5CGX A;  3MR0 A;  3OCN A;  2JE5 A;  1KVM A;  4BBU A;  4QD4 A;  5G4Z A;  5CER A;  2WUQ A;  3BEC A;  4GDN A;  4KZ8 A;  3WS5 A;  2XA7 M;  4NEE D;  4EET B;  3VE3 A;  3K2N A;  1FCO A;  1E3U D;  2EX2 A;  3NJA A;  5E2E A;  4KZ6 A;  3PBT A;  2AVX A;  3VE4 A;  2MJ6 A;  5IU1 A;  3WS2 A;  3H7W A;  2JKR I;  3UB9 A;  4HNB A;  4QPR A;  4OOM A;  1F5M A;  3V39 A;  3NC8 A;  2KLI A;  3ITB A;  2XLN A;  1K55 C;  1YLP A;  1RP5 A;  4GCZ A;  4R70 A;  4Y0U A;  1GSW A;  1MBL A;  1XGI A;  3HVF A;  1I2W A;  3N7W A;  3LEZ A;  4D60 A;  4RQ9 A;  2ZC6 B;  3GVB A;  4K91 A;  4G3K A;  2JKT M;  1HTZ A;  5CXW A;  3S7O A;  3NEC A;  1DJB A;  3MZF A;  1SKO A;  1SZV A;  1H5X A;  4GD8 A;  5DFX A;  3Q81 A;  4C75 A;  4HHD A;  2Y8H A;  1PZO A;  3Q7V A;  3WRT A;  2ZQ9 A;  3UME A;  5EVI D;  2HP9 A;  1STZ A;  2JN7 A;  2QJ7 A;  4WZ5 A;  3BW6 A;  5HAI A;  4FH4 A;  4KZ4 A;  2X01 A;  4EEU A;  3PHY A;  1P9R A;  2ZMV A;  3T4S A;  4S2N A;  1KDS A;  4EW7 A;  4DE0 A;  4GKU A;  3BRM A;  3B42 A;  5CHJ A;  3FKW A;  3BQA A;  4UQI S;  3UPO A;  5EM1 A;  5FAT A;  3K3D A;  2Y2P A;  3R7W A;  4BL3 A;  3UB8 A;  2XD1 A;  5CGS A;  4PKY G;  1E25 A;  3G2Y A;  4Y13 A;  3QP5 A;  2ZM0 A;  3GMW A;  4U0T A;  3G32 A;  2PU2 A;  2G2W A;  3A0R A;  3TJZ C;  4S2K A;  4H6J B;  4X55 A;  5C5K A;  2ACG A;  1NJ4 A;  3MBZ A;  5KZH A;  3JVU A;  1YPR A;  1QMF A;  4DJ3 A;  3LIB A;  1S6R A;  1TS7 A;  2XD5 A;  2O9C A;  1DJA A;  1YQS A;  2QYB A;  1ES5 A;  3BQ8 A;  1V9Y A;  2A2L A;  2ZMA A;  1Y4O A;  5CEB A;  3NIA A;  1LSX A;  1S67 L;  2ZC4 B;  1EI5 A;  4R0Q A;  5JYP A;  3CPT B;  4DF6 A;  3MSH A;  3BFC A;  3V50 A;  2Y2K A;  4E6W A;  2ZJ9 A;  3NCK A;  4HEF A;  4NXG A;  2FZ0 A;  3E2L A;  5FAO A;  2V9A A;  1I5Q A;  4R4R A;  4ID4 A;  3LUQ A;  1E4D A;  4LRZ E;  2B18 A;  5F5Y A;  2ZMF A;  1W63 M;  5F82 A;  2GNX A;  3MXR A;  1XFN A;  2OWH A;  4JGP A;  3HCY A;  2ZD8 A;  1MKM A;  2GZA A;  1K57 C;  4GOG A;  4JF6 A;  4MBH A;  4LLO B;  1OTD A;  2BLS A; 
#chains in the Genus database with same CATH homology
 2A49 A;  3PBR A;  1KE4 A;  1O07 A;  1XX2 A;  4C6Y A;  1BTL A;  2J8Y A;  2Y2N A;  2ZC5 B;  4IVI A;  5CRF A;  4X69 A;  4KG5 A;  4X6T A;  4O7D A;  3HLF A;  1XA7 A;  1PIO A;  4JXW A;  4MNR A;  1BLH A;  2WK0 A;  1DY6 A;  2PU4 A;  3VP2 A;  4DDS A;  1HD8 A;  4JF5 A;  5E2F A;  1KGE A;  1MY8 A;  1ERM A;  3IH9 A;  3UDX A;  3OPP A;  4DDY A;  1L0F A;  1SCW A;  4WMC A;  3GV9 A;  5DTT A;  4WMC D;  4WEL A;  2Y55 A;  2ZQA A;  4JLF A;  1QME A;  3VP4 A;  3JYI A;  3UN7 A;  1LL9 A;  1JWV A;  4ZTK A;  4JXG A;  2H0Y A;  3AGE A;  3C4O A;  3W8K A;  3HL9 A;  5FI7 A;  5FSR A;  2Y2G A;  3ZG8 B;  1GHM A;  2WGV A;  4S2I A;  2HDS A;  5DVA A;  3VP3 A;  1MPL A;  4CJN A;  5FAS A;  3MZE A;  2A3U A;  2WAE A;  5IHV A;  1ZG4 A;  3HBR A;  1JTG A;  3FV7 A;  1SHV A;  3C7U A;  5GLA A;  4UA6 A;  3WS0 A;  3WS1 A;  3ZFZ A;  5A93 A;  4D2O A;  1K6R A;  5A92 A;  1FSW A;  1ONG A;  3SS3 A;  3BM6 A;  4HBT A;  3ISG A;  4Z9Q A;  2GDN A;  4B4X A;  1ES3 A;  5GLB A;  1ES4 A;  3IHA A;  1TVF A;  4ZAM A;  1MKI A;  1NXY A;  1K4E A;  2DRW A;  5FI2 A;  1K6S A;  3HLG A;  4KG6 A;  3BFF A;  4BLM A;  5E43 A;  2Z2M B;  3GQZ A;  4KQQ A;  3UO9 A;  3UE0 A;  3IT9 A;  2C5W B;  2J9P A;  4JF4 A;  2EFU A;  4RX3 A;  3RXW A;  4DRT A;  4XUZ A;  2HDU A;  2ZQC A;  3NDG A;  3UPP A;  4BD0 A;  3W4P A;  4OQG A;  4WZ5 C;  3WS4 A;  1PWC A;  2XGN A;  2X02 A;  5FI6 A;  1WYB A;  3G30 A;  1BT5 A;  4UA9 A;  5HX9 A;  4FSF A;  2XK1 A;  4R4S A;  3NDE A;  3A3I A;  4WM9 A;  2XFS A;  3PBS A;  5M19 A;  1JWZ A;  1W5D A;  2OSU A;  2V1Z A;  2VGK A;  4GN2 A;  2R9W A;  2Y4A A;  1K54 A;  4P0M A;  1BLS A;  3QNC A;  3A3F A;  2H5S A;  5FAQ A;  1J9M A;  1K55 A;  2XQZ A;  1FCM A;  2EXB A;  3HUM A;  5FQI A;  4OQH A;  3Q82 A;  4ZJ2 A;  3VOZ A;  2J9O A;  3IHB A;  1ERO A;  3LY3 A;  5AQ9 A;  1GHP A;  1YLT A;  1IEM A;  4QJG A;  3WWX A;  5FDH A;  3NBL A;  4PM7 A;  5E2G A;  5DF7 A;  1JTD A;  1JWP A;  2RCX A;  3GTC A;  4IVK A;  3PBN A;  5U47 A;  3DW0 A;  4Y7P A;  3NY4 A;  2CC1 A;  5FQ9 A;  3A3J A;  1GA9 A;  1H8Y A;  3UDF A;  4ZJ3 A;  1PYY A;  1BLP A;  1FR1 A;  1KE3 A;  3QHY A;  2OV5 A;  1NYM A;  4FH2 A;  4OLD A;  1PI4 A;  3ZGA B;  4E3I A;  1L0G A;  4PM5 A;  5GHZ A;  3SH9 A;  4F94 A;  5KSH A;  3C7V A;  5HFO A;  4KZ9 A;  4OKP A;  1SDE A;  3CMZ A;  1YMX A;  3PAE A;  3ZG5 A;  5KSC A;  2ZQ7 A;  4FCF A;  1GHI A;  2IWC A;  3ITA A;  3OPH A;  1FR6 A;  4PM9 A;  3UDI A;  4L0L A;  1DJC A;  4DE3 A;  3BYD A;  4MBF A;  5CED A;  2WKH A;  4DXB A;  4K0W A;  1SDN A;  1H8Z A;  5G18 A;  4P87 A;  3N6I A;  5A91 A;  4A5R A;  3G2Z A;  1BLC A;  4X56 A;  2EXA A;  4U0X A;  4UHU A;  1ZC2 A;  2QMI A;  2C6W B;  4LV0 A;  2ZC3 B;  1O7E A;  4FD8 A;  1CEG A;  3P09 A;  4N9L A;  4Q8I A;  3RXX A;  3ZHH A;  1BSG A;  5TR7 A;  4MLL A;  2Q9M A;  2Y2I A;  5HL1 A;  1YMS A;  3ZNY A;  3Q7Z A;  3Q7V B;  2EX6 A;  3OPR A;  2WGW B;  4WEK A;  4CPK A;  1PWG A;  3EQU A;  4BD1 A;  4BQM A;  4X68 A;  4EBN A;  4EBP A;  1LLB A;  4E6X A;  3OC2 A;  3TOI A;  2HDQ A;  3IWI A;  1GCE A;  2WZZ A;  2ZLY A;  5M1A A;  4JBF A;  4E3N A;  5EPH A;  3WRZ A;  4GDB A;  5HAQ A;  3N8L A;  2WAF A;  2ZM2 A;  4EQI A;  5I94 A;  4RA7 A;  4MBK A;  3BLS A;  3S22 A;  5CEC A;  1IYQ A;  2EX8 A;  4R3B A;  4C3Q A;  3LY4 A;  1XGJ A;  5DF8 A;  3ZG9 B;  1YLW A;  3SH7 A;  3ZVT A;  2XFT A;  2Y2Q A;  2X71 A;  4WEJ A;  4LV2 A;  5EOE A;  2Q9N A;  3MKF A;  1L0D A;  5J8X A;  2IWD A;  1MXO A;  4X53 A;  3SH8 A;  3TSG A;  1TDL A;  1WE4 A;  5AQB A;  5EVL A;  2OLV A;  1N4O A;  4P85 A;  1RCJ A;  2V2F F;  5GHY A;  3VP1 A;  3PBO A;  5EOO A;  4UA7 A;  3HUO A;  4H8R A;  2HDR A;  3G35 A;  1TDG A;  3O87 A;  1K25 A;  5E2H A;  3IF6 B;  2P9V B;  3V5M A;  2WZX A;  1C3B A;  1VM1 A;  1W8Y A;  2DCF A;  3N8R A;  3TG9 A;  3W4Q A;  1XPB A;  1M6K A;  5DTK A;  3O88 A;  2EFX A;  3BLM A;  3RJU A;  1U60 A;  2HP5 A;  3HLC A;  3UY6 A;  4E3J A;  4KEN B;  2JCH A;  4LV1 A;  1LL5 A;  1ERQ A;  1LI0 A;  5FQM A;  4EUZ A;  2WKI A;  5HAR A;  3UNW A;  3BEB A;  3IXH A;  5EVI C;  2XH9 A;  1NZU A;  3HLE A;  2Y2O A;  2V20 A;  5CGX A;  5HAP A;  4KQO A;  3EQV A;  4K0X A;  3OCN A;  4PMA A;  2JE5 A;  2WGI A;  1KVM A;  2ZQD A;  1ESU A;  2RL3 A;  4QD4 A;  5CER A;  4OVD A;  4S2N C;  2WUQ A;  3BEC A;  4GB7 A;  5F1G A;  1EWZ A;  4GDN A;  2P9V A;  3O86 A;  4KZ8 A;  5FA7 A;  3WS5 A;  4RX2 A;  1W7F A;  5GLC A;  1VQQ A;  1NY0 A;  3SS5 A;  1IYO A;  5TGF A;  1KE0 A;  1XXM A;  3W4O A;  1E3U A;  1K38 A;  4KQR A;  1FCO A;  1E3U D;  2EX2 A;  3A3E A;  4OOY A;  5E2E A;  4OON A;  2E8I A;  4KZ6 A;  5CTN A;  4GZB A;  4Y0T A;  3PBT A;  1I2S A;  4NET A;  4B88 A;  3MZD A;  2G2U A;  4EV4 A;  1L2S A;  4R3J A;  3IF6 C;  4UAA A;  5KMW A;  1Y54 A;  3ZNT A;  3MFD A;  3WS2 A;  3HRE A;  4OQ0 A;  3VP0 A;  3Q1F A;  3HLB A;  3VOY A;  5DF9 A;  1LI9 A;  4E3K A;  3BFD A;  3HUN A;  4DE2 A;  4ZDX A;  1HZO A;  3MKE A;  5FQK A;  4RVA A;  5TFQ A;  1RGZ A;  4N1H A;  4N1X A;  1CK3 A;  3OPL A;  4OOM A;  2WAD A;  3IWO A;  1Q2P A;  3NC8 A;  1TEM A;  4PM6 A;  5GHX A;  3V39 A;  3VFF A;  4NK3 A;  3LO7 A;  2H0T A;  1K4F A;  3ITB A;  1JVJ A;  1K54 C;  2XLN A;  3S1Y A;  2QPN A;  2BG1 A;  2JC7 A;  2OLU A;  3IXG A;  3IQA A;  4B4Z A;  1K57 A;  1K55 C;  4IED A;  3UPN A;  3FKV A;  2R9X A;  1YLP A;  3D4F A;  1RP5 A;  2XDM A;  4KZA A;  3ZVW A;  5AQA A;  4ZJ1 A;  1PW8 A;  4QHC A;  4Y0U A;  1XP4 A;  1MBL A;  1XGI A;  3CG5 A;  3HVF A;  4JXS A;  2EX9 A;  4RYE A;  3A3D A;  1I2W A;  3N7W A;  3HLD A;  1Q2Q A;  3LEZ A;  3M6H A;  3G34 A;  3V3R A;  1LHY A;  2ZC7 A;  2XR0 A;  4HES A;  1K56 D;  3IWQ A;  4DKI A;  4EWF A;  2ZC6 B;  3GVB A;  4K91 A;  3O3V A;  5EVI B;  4IBR A;  3VMA A;  1HTZ A;  1YLY A;  3G4P A;  4ZBE A;  5CXW A;  1M40 A;  1PI5 A;  3GRJ A;  4EBL A;  3IXD A;  1OME A;  3AGF A;  4XXR A;  1DJB A;  3MZF A;  5EE8 A;  4LV3 A;  1H5X A;  4OLG A;  2WKE A;  5M18 A;  1Z6F A;  4OPY A;  4M3K A;  4N9K A;  4WBG A;  4GD8 A;  1IYP A;  4KZ5 A;  2B5R A;  3FWL A;  3DTM A;  3Q81 A;  1XA1 A;  5FQQ A;  4KG2 A;  4DXC A;  4C75 A;  4BL2 A;  1SKF A;  3CZD A;  5HW3 A;  1BUL A;  4S2J A;  1MWU A;  5CHM A;  3BFE A;  1YM1 A;  4OQI A;  1IKI A;  1PZO A;  2Y91 A;  3FZC A;  3Q7V A;  2WGW A;  4OPQ A;  4QY5 A;  5DTS A;  3UE1 A;  2DNS A;  4PPR A;  4E3M A;  1MWR A;  2ZQ8 A;  4N92 A;  3WRT A;  3ZCZ A;  5EVI A;  3VSK A;  2ZQ9 A;  4QB8 A;  1XKZ A;  1AXB A;  5EVI D;  2HP9 A;  3QNB A;  1NYY A;  4KZB A;  2Y2H A;  3M2J A;  2XF3 A;  3GSG A;  4WZ5 A;  5HAI A;  1KDW A;  2JBF A;  5BOH A;  5AQ7 A;  4FH4 A;  4KZ4 A;  2X01 A;  3VFH A;  4HBU A;  4LCM A;  4Y0O A;  1NZO A;  4BEN A;  1RGY A;  4S2O A;  3LCE A;  4GD6 A;  4OOL A;  3C5A A;  4S2N A;  2H10 A;  1PW1 A;  1BZA A;  1KDS A;  4JKT A;  4QY6 A;  4DE0 A;  2Y59 A;  4GKU A;  3BRM A;  3IXB A;  4MEZ A;  4OH0 A;  1ESI A;  3GR2 A;  5CHJ A;  4KZ3 A;  1FOF A;  3FKW A;  5FAP A;  3AGD A;  4GNU A;  3P98 A;  3UPO A;  3IF5 A;  3OCL A;  1CEF A;  4PM8 A;  5FAT A;  1FSY A;  3IF6 A;  3N8S A;  2Y2P A;  1G68 A;  4S2L A;  4BL3 A;  4LCL A;  1ZKJ A;  2XD1 A;  5CGS A;  1ONH A;  1E25 A;  1ZG6 A;  4U3T A;  4OPZ A;  3G2Y A;  2Z2L B;  5FQJ A;  2ZM0 A;  2FFF B;  2J7V A;  3GMW A;  4U0T A;  3G32 A;  3Q07 A;  2PU2 A;  2XEP A;  4LEN A;  2G2W A;  3SOI A;  4S2K A;  1ES2 A;  1KGF A;  1S0W A;  4X55 A;  2IWB A;  1NJ4 A;  1PZP A;  3MBZ A;  5KZH A;  4S2M A;  1QMF A;  1W8Q A;  1KVL A;  5GL9 A;  2FFY A;  3ZG0 A;  1S6R A;  4OP8 A;  1YT4 A;  5EUA A;  3C4P A;  5CGW A;  3M2K A;  2XD5 A;  5CTM A;  5F83 A;  1DJA A;  1YQS A;  5F1F A;  3E2K A;  1CI8 A;  2Y2J A;  4E3O A;  1ES5 A;  1IEL A;  3M6B A;  1GA0 A;  2Y2M A;  1N9B A;  1YLJ A;  4R23 A;  2ZMA A;  3PAG A;  3G31 A;  5CEB A;  4YIN A;  3HLW A;  1FQG A;  3IH8 A;  3NIA A;  1G6A A;  2ZC4 B;  3B3X A;  3VSL A;  1EI5 A;  4R0Q A;  4E3L A;  2HP6 A;  4WYY A;  5JYP A;  1FCN A;  1HVB A;  4QU3 A;  4YFM A;  3DWK A;  4DF6 A;  4KZ7 A;  1WYC A;  4JPM A;  3PTE A;  2UWX A;  3BFG A;  1PWD A;  2PBY A;  3BFC A;  3CJM A;  1IYS A;  2Y2K A;  4OPR A;  3V50 A;  4E6W A;  5A90 A;  2I72 A;  2ZJ9 A;  2VGJ A;  3NCK A;  1BUE A;  4HEF A;  1CI9 A;  1L0E A;  3V3S A;  3ZDJ A;  5D3O A;  4DE1 A;  4WZ4 A;  1K56 A;  3E2L A;  3FYZ A;  5FAO A;  1I5Q A;  5L2F A;  3S4X A;  2P74 A;  4R4R A;  4ID4 A;  3DWZ A;  3ZG7 B;  4XUX A;  1E4D A;  3NI9 A;  2WYX A;  3SS4 A;  1ALQ A;  4R1G A;  4P6B A;  3I7J A;  1MWS A;  5GLD A;  1IKG A;  3N4I A;  3PBQ A;  5F82 A;  1KGG A;  4IBX A;  2HPB A;  3MXR A;  4S2P A;  1W79 A;  5JYO A;  3OZH A;  3MXS A;  5EEC A;  4OP5 A;  2QZ6 A;  2Y2L A;  2ZD8 A;  1MWT A;  1YLZ A;  3UE3 A;  1K57 C;  4GOG A;  2ZM8 A;  4JXV A;  4JF6 A;  4MBH A;  5CHU A;  2BLS A;  4BJP A;  1NRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...