4UA7A

Ctx-m-14 class a beta-lactamase in complex with a non-covalent inhibitor at sub-angstrom resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
ETSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-14
publication title Ligand-Induced Proton Transfer and Low-Barrier Hydrogen Bond Revealed by X-ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 96
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ua7A00
3VP2A 1IYSA 4S2KA 3VP3A 1W79A 3IWQA 2WKEA 4MNRA 4PM9A 4OPQA 2FFFB 1YQSA 5FSRA 5EPHA 1M6KA 1K4EA 4DDSA 4JXSA 4OLGA 4X56A 1K57A 3G2YA 3OCNA 4NK3A 3ZNYA 4X69A 5AQAA 3ZFZA 3I7JA 2WUQA 4ZJ2A 5U47A 3BFEA 1Z6FA 4ZTKA 1GCEA 1PWCA 2ZQ9A 4EWFA 3DTMA 3LEZA 4JF4A 3G30A 3FKWA 4ID4A 2Y4AA 5GLCA 3E2LA 4OOYA 4L0LA 4LV2A 2ZQ8A 5D3OA 1XX2A 5EOEA 3QNCA 1HZOA 2I72A 5CEDA 1DJBA 3M2JA 3ITBA 2Y2IA 2ZM0A 5FASA 2Y2JA 3PBOA 4WYYA 2C6WB 2EX6A 3LO7A 1DJCA 4K91A 3DWKA 1SDEA 3UNWA 3TSGA 5CGWA 3BYDA 4XXRA 2XD5A 3HLFA 3Q82A 3AGFA 1MWRA 3MFDA 4MEZA 3S22A 1ERQA 2Y2QA 3PBTA 4F94A 2OSUA 3PTEA 1J9MA 5G18A 5A93A 1XXMA 4BLMA 3NCKA 1BLPA 4IVIA 3IF6A 4DE0A 3UE0A 5FI2A 3BECA 4R0QA 3UDXA 4QU3A 4Y7PA 1XPBA 5E2HA 1MWTA 5DVAA 1QMFA 1YMSA 2V20A 3MZDA 4KZ4A 3WRTA 4S2NA 2OLVA 5EECA 4PM7A 4C6YA 3V3RA 4WEKA 1GHPA 2ZC5B 1KE4A 5CXWA 3SH8A 4DKIA 4DXCA 1G6AA 3MXRA 1I2SA 3M6BA 3OPRA 2WAEA 5FQMA 2RCXA 4KZ6A 5EOOA 2JBFA 3VP1A 4FH2A 3N4IA 1S0WA 1FR1A 3ZCZA 4C3QA 1WYCA 3VSLA 5J8XA 1I5QA 3W8KA 4KZ7A 4N9LA 4YINA 4S2LA 3GMWA 4JPMA 4E3IA 1LI9A 2Y2GA 3HUMA 4NETA 5KSHA 1KE3A 4KQOA 1K6SA 2DCFA 4GOGA 3Q7ZA 1L2SA 5EVIA 3IHBA 1ES5A 2J7VA 3O88A 4HEFA 4IBXA 2Y2NA 1YLTA 3UN7A 1FSYA 3PBNA 3WRZA 2PU4A 1FSWA 4N9KA 3ZHHA 1NJ4A 2UWXA 1GHMA 4R1GA 1O07A 5FI7A 5FQJA 4U0XA 5FAQA 4DF6A 1W8YA 3BFFA 2JCHA 4LENA 2HP9A 1AXBA 5AQ7A 4DE2A 4KZ8A 5EVID 3MKEA 2EFUA 3PBQA 2QMIA 1RGZA 4GD6A 3UPPA 1TVFA 3IF6B 3WS0A 2ZQCA 5IHVA 4BL3A 4RA7A 4Y0UA 1MBLA 1S6RA 3GVBA 3HLWA 1IELA 3G32A 4ZJ3A 5GLBA 4E3NA 5M19A 1GHIA 2EXBA 5FI6A 2QZ6A 3SH7A 4IEDA 1BLHA 1BLSA 1KE0A 3ISGA 2DRWA 3FZCA 3UY6A 3B3XA 1L0GA 2BLSA 3C7UA 1BT5A 3LCEA 1K55A 4KENB 5FAPA 4KZ9A 1NYMA 1JTGA 1LL5A 1TDLA 1WYBA 3SS4A 3TOIA 4D2OA 2ZJ9A 1SCWA 2OLUA 4OOMA 5FQ9A 1MWUA 5HARA 1K6RA 1EWZA 4GKUA 5TR7A 3C7VA 4OP5A 1ESIA 4S2MA 1CK3A 1YLZA 5L2FA 1SDNA 5GHYA 4OQIA 5DTKA 1KDWA 2X02A 1JWPA 3V50A 3FV7A 4S2PA 2J9PA 3IF5A 3O86A 4KZBA 2WYXA 1LHYA 3TG9A 5EVIB 3IHAA 2Y91A 3QHYA 1W8QA 2BG1A 2Y55A 2ZD8A 1PW1A 4WBGA 2WAFA 1BSGA 3HUOA 4HBTA 5M18A 4B88A 1VQQA 2ZQ7A 3IF6C 4JF5A 1KGFA 3HLEA 1HTZA 2XQZA 3A3FA 4OONA 4R23A 1FQGA 3WS1A 3GV9A 1NRFA 3ZVTA 1E25A 1IEMA 4OPZA 3O87A 4S2NC 2XR0A 3VMAA 3UPOA 5CRFA 1XP4A 4QB8A 5E2EA 3Q81A 5FATA 4JXVA 2XDMA 2ZC4B 3V5MA 3M6HA 2XEPA 1ONHA 3Q07A 3G2ZA 4EQIA 1E3UD 3Q7VB 1MWSA 1GA0A 1LI0A 1K4FA 3BLMA 5FAOA 4CPKA 2GDNA 1KVLA 4P0MA 5HAIA 3ZG0A 1JWZA 3BFDA 4LV1A 2Y2MA 1PW8A 1ONGA 2H10A 3A3IA 1NZUA 1G68A 4P6BA 5CTMA 5FQQA 1ZKJA 3AGDA 2WADA 4DE3A 4PM5A 1NZOA 4MBKA 4ZAMA 1HVBA 1QMEA 1ALQA 2P9VA 3VP0A 4WZ5C 3UO9A 3SOIA 5CHUA 3SS3A 3WS4A 3FYZA 3IT9A 5CHJA 2X71A 4OVDA 3LY3A 1DJAA 3G35A 2EX2A 1ZG6A 4N1HA 1N9BA 3SH9A 5FQIA 2VGJA 2EX9A 2OV5A 4JXWA 4QY6A 1RGYA 2ZC7A 3A3JA 4Y0OA 3IQAA 2XFSA 2JC7A 2ZMAA 4BQMA 3EQVA 1IYQA 1PZOA 1BLCA 1N4OA 1IKIA 1MY8A 2Q9NA 4O7DA 5CTNA 1RCJA 2V1ZA 2ZQDA 3HLDA 5FQKA 4KG2A 4WEJA 3V3SA 1K38A 5A91A 1YLWA 4P85A 5GLAA 1E4DA 2WZXA 2Z2LB 4WZ4A 1K55C 3N6IA 2C5WB 1YT4A 4LCLA 1K54C 5M1AA 4CJNA 3OC2A 5KSCA 2HPBA 2EX8A 4OQGA 4E6WA 3W4PA 4BD0A 1TDGA 3IWIA 4MBFA 3VSKA 1MKIA 4R4SA 5JYOA 5GHZA 5HX9A 4E3LA 5EE8A 3C5AA 3OPHA 4DDYA 1MPLA 1VM1A 1FOFA 4XUZA 4KZ3A 2P74A 1KVMA 1NY0A 2V2FF 1LLBA 5GL9A 5CECA 4JF6A 1O7EA 2CC1A 4KG5A 1K57C 3E2KA 2P9VB 3HVFA 5EVLA 1CI9A 4H8RA 1EROA 4OQ0A 3V39A 3W4OA 1CEFA 3BEBA 3JYIA 4X53A 4B4XA 2Z2MB 4MBHA 3RXXA 4GDNA 4LCMA 2HDQA 2H0YA 1GA9A 3GQZA 3Q7VA 1K56D 3CZDA 4IBRA 3RJUA 3UDFA 1WE4A 4RVAA 3N7WA 1ES4A 4FD8A 1K25A 3EQUA 3HLGA 4EUZA 1JTDA 1TEMA 1YM1A 4KZ5A 3QNBA 4XUXA 5DF8A 4KQQA 4RX3A 1YLPA 3OCLA 1XKZA 3ITAA 1KGGA 2EXAA 2WKHA 3GSGA 2IWBA 3HBRA 2WGWA 2J8YA 4KZAA 3NY4A 4QY5A 4R3JA 4K0WA 3W4QA 2G2WA 3FWLA 3MZEA 4B4ZA 1YLYA 1FR6A 3HREA 3VOYA 3S4XA 2ZC3B 3GRJA 4PPRA 4FCFA 1DY6A 3PBRA 4UAAA 3HL9A 3P98A 1CI8A 4GB7A 4Z9QA 3S1YA 2ZC6B 2G2UA 2Y2OA 5KMWA 4GNUA 2R9WA 4OQHA 4P87A 3HUNA 4JBFA 2J9OA 3WS2A 2XF3A 3ZNTA 5HAQA 3O3VA 3NDGA 5CEBA 4OH0A 5A90A 1PI5A 1I2WA 1ESUA 2Q9MA 3UPNA 2HDRA 1E3UA 2XH9A 4BL2A 1YMXA 5A92A 4QHCA 4E3OA 3BFCA 2HDUA 4GD8A 1BUEA 3DWZA 2E8IA 1IYOA 1CEGA 2HDSA 1Y54A 2X01A 1EI5A 3NBLA 2XD1A 2EFXA 5BOHA 1XA1A 3NI9A 1KDSA 5JYPA 4WMCA 2VGKA 1U60A 4DE1A 4QD4A 3HLCA 1BZAA 5CHMA 3C4OA 3VP4A 4ZJ1A 1ES3A 5FA7A 5CERA 1L0FA 3VFHA 3ZG7B 4BJPA 4OPRA 5AQ9A 3ZDJA 5DF7A 4QJGA 1ZG4A 3DW0A 3IXBA 3MBZA 4GDBA 3OPLA 4S2JA 4C75A 4UA9A 5EVIC 4ZDXA 4WMCD 2ZLYA 1PWGA 2WGWB 4OP8A 4X55A 1Q2PA 3ZG5A 3ZG9B 3IXHA 5E2FA 2A3UA 4UA6A 1FCMA 3BFGA 5F82A 1IKGA 4JXGA 1SHVA 3CMZA 4JKTA 1PZPA 3BRMA 4MLLA 4OPYA 4RX2A 5CGSA 2ZM8A 3NDEA 1ERMA 2XLNA 2Y2PA 3G34A 4X6TA 2XK1A 4LV0A 4PMAA 1JVJA 1NXYA 3GR2A 4S2IA 1L0EA 2WK0A 1HD8A 1XGJA 5FDHA 2WGVA 3N8LA 4A5RA 3G4PA 4HESA 4R3BA 3PAEA 4LV3A 3A3DA 4DXBA 4HBUA 2H5SA 4GN2A 4K0XA 3UDIA 5HL1A 4EBPA 1PIOA 4JLFA 1ES2A 1PWDA 3N8SA 3NIAA 5I94A 1NYYA 2FFYA 2R9XA 3OZHA 3PBSA 4PM8A 5F1FA 1FCOA 4OKPA 3AGEA 3ZGAB 1MXOA 4E3KA 4X68A 4M3KA 1XA7A 2XGNA 3D4FA 5KZHA 1SKFA 3SS5A 4U0TA 4FH4A 4WM9A 2DNSA 1H8YA 2PU2A 4Y0TA 3MKFA 3NC8A 4UHUA 1W5DA 5TGFA 4KQRA 3CG5A 4PM6A 1KGEA 2WKIA 1OMEA 3FKVA 5F83A 4KG6A 3ZG8B 5TFQA 3LY4A 1RP5A 1LL9A 1K56A 3OPPA 4S2OA 5DTSA 5AQBA 5GLDA 4WELA 1BULA 3BLSA 5HW3A 4R4RA 2IWCA 1IYPA 4DRTA 4EV4A 4WZ5A 3MZFA 3IH9A 2Y2LA 4U3TA 2JE5A 1XGIA 5EUAA 3PAGA 2Y2HA 3BM6A 1FCNA 4GZBA 2A49A 3Q1FA 1W7FA 2PBYA 3N8RA 3VOZA 3UE1A 4ZBEA 4EBNA 5E43A 4BD1A 2HP5A 5GHXA 1YLJA 1ZC2A 3MXSA 2ZQAA 4N92A 2Y59A 4OOLA 3G31A 5CGXA 4YFMA 5DTTA 1BTLA 1C3BA 3UE3A 4RYEA 4E6XA 5DF9A 3WS5A 2QPNA 1PYYA 5HFOA 5HAPA 3ZVWA 4BENA 1H8ZA 1M40A 5F1GA 4E3MA 1JWVA 2WGIA 4UA7A 3A3EA 2RL3A 3P09A 2HP6A 2B5RA 3GTCA 4Q8IA 4IVKA 2H0TA 1H5XA 1L0DA 3IXDA 4N1XA 3C4PA 3HLBA 4OLDA 2ZM2A 1Q2QA 2Y2KA 1K54A 1PI4A 3WWXA 4EBLA 3IH8A 3M2KA 3CJMA 2IWDA 4FSFA 5E2GA 3VFFA 4E3JA 2XFTA 3IXGA 3IWOA 3RXWA 2WZZA
chains in the Genus database with same CATH superfamily
3VP2A 4MNRA 2FFFB 1F9IA 5EPHA 4JXSA 1K57A 4NK3A 3LFVA 3ZFZA 1TS6A 5HWVA 5HDSA 3BFEA 4RQ9A 3JVUA 3E4PA 1PFLA 2Y4AA 1P97A 4L0LA 2CMNA 4LV2A 5EOEA 4EU0A 1HZOA 2PD8A 3M2JA 4Y15A 2EX6A 1DJCA 4K91A 5IT5A 3BYDA 3HLFA 4MEZA 3S22A 5A8BA 3T50A 3UB9A 3PTEA 1J9MA 5A93A 3CLOA 3L9KA 4BLMA 3IF6A 4YWZA 3BQ8A 3BECA 4QU3A 1YMSA 3WRTA 3S7QA 3FC7A 5EECA 4C6YA 3P01A 1YKDA 1GSVA 1AWIA 1L3LA 3SH8A 5CXWA 4GS9B 4K08A 4HY8A 5EOOA 3VP1A 2JBFA 4FH2A 1CF0A 1S0WA 3JVVA 1I5QA 4KZ7A 5L07A 4S2LA 2NUTC 3GMWA 4E3IA 1LI9A 1KE3A 1K6SA 3Q7ZA 3VOLA 4JGOA 1FSYA 2PU4A 1LSVA 3ZHHA 3KYEA 1O07A 4PAUA 3CAXA 5FAQA 5HL6A 1W8YA 4DF6A 2HP9A 2V8CA 3UPPA 3PBQA 1RGZA 4GD6A 4NG2A 5IHVA 2O99A 4RA7A 3P7NA 3HLWA 4JGRA 5FEGA 5GLBA 4HP4A 1BLSA 3QP2A 3UY6A 1X0OA 3C7UA 5FAPA 3TW8A 3TOIA 4D2OA 5DKKA 2OLUA 4IUHA 2BASA 4GKUA 3LIBA 4OP5A 3U4LP 4OQIA 5EM1A 4HJ6A 4L9FA 3O86A 4II7A 4EQ1A 3QHYA 1W8QA 1PW1A 4ARZA 5M18A 3CHWP 4CLCD 1KGFA 3GV9A 1NRFA 3BQAA 3UPOA 3G6OA 4P6ZS 4QB8A 5C5KA 2O9AA 1E3UD 1K0KA 2OOLA 5FAOA 1K4FA 1KVLA 1JWZA 3C8CA 3R7WB 2Y2MA 1ONGA 2H10A 3D3OA 1NZOA 1HVBA 1ALQA 2P9VA 3CI6A 3TE8A 5CHUA 3WS4A 3FYZA 4WF0A 5CHJA 2X71A 3NJAA 5FEFA 1DP9A 3LY3A 1A0KA 1DJAA 2EX2A 4N1HA 1OJ5A 3LI9A 2VGJA 2OV5A 1RGYA 3T12B 4QWOA 2Y79A 2ZMAA 2ACGA 4CQHA 2VKSA 1PZOA 1N4OA 1MY8A 2Q9NA 4O7DA 5CTNA 2ZL1A 1MZUA 3V3SA 5A91A 4MMNA 3F1PA 2XROA 1YT4A 2JKFA 3W4PA 1TDGA 5GHZA 1YPRA 3KYQA 4E3LA 1S4SA 5EE8A 1VM1A 4CLCC 1KVMA 4JF6A 1CI9A 3V39A 1EROA 1NLYA 1VETA 4R6LA 3JYIA 4X53A 5J4EA 1DRMA 1GA9A 3EGXC 3CZDA 1WE4A 4BMWA 3N7WA 4O01A 1J3WA 3H82B 2W3EA 3T4SA 1TEMA 2VLGA 2ZOIA 2A24A 4KZ5A 4D60A 4NKPA 3C38A 3QNBA 5DF8A 1KGGA 2EXAA 4LFUA 2IWBA 3HBRA 4KZAA 4QY5A 3MR0A 2L1MA 3W4QA 2ZC3B 1G28A 4UAAA 3PBRA 3BJNA 3DTIA 3P98A 4GB7A 4Z9QA 1TS8A 1ZHHB 1V9ZA 4JBFA 2ZBBA 3ZNTA 5CEBA 3CPTA 2Q9MA 2HDRA 2EWWA 1E3UA 3CUEC 1H0MA 1YMXA 5A92A 2B02A 3BWLA 3HJKA 4GD8A 5G4ZA 1WA9A 3DWZA 1EI5A 3NBLA 4HJ3A 2EFXA 2YKHA 4WMCA 4DE1A 3C4OA 4EEPA 5HWTA 2JHEA 3ZDJA 1ZG4A 2P04A 3IXBA 3MBZA 2W1TA 4UA9A 1PWGA 4OP8A 1S1YA 1SKOA 4X55A 3RFBA 3ZG5A 5E2FA 1T1CA 2V0WA 5F82A 4JKTA 3G34A 3U2AA 4S2IA 2M7VA 4WL9A 4YNRA 1XGJA 5FDHA 2WGVA 4A5RA 3G4PA 5FDSA 5J7EA 4HBUA 1S67L 1DP8A 1TD5A 3UDIA 1PIOA 5I5LA 5I94A 2NUPC 1HLUP 3VE4A 4PM8A 2Y8HA 5F1FA 3ZGAB 4E3KA 4X68A 1XA7A 4WM9A 3OBFA 4Y0TA 3MKFA 3UE6A 1S66L 4KQRA 2WKIA 4KG6A 1RP5A 1YSQA 4S2OA 5DTSA 3BW6A 5GLDA 2PHYA 3BLSA 5IS1A 4GHIB 1IYPA 4ETXA 3PAGA 4KUKA 2A49A 4GLQA 3N8RA 3VOZA 3JPUA 4EBNA 4DJ2A 5E43A 4BD1A 2HP5A 1YLJA 4OOLA 5L09A 1BTLA 5DF9A 2QPNA 5HFOA 5KIZA 1T1AA 3ZVWA 4BENA 1H8ZA 1VEUB 2HP6A 2B5RA 2QYBA 3GTCA 1H5XA 1L0DA 1UGUA 4NXGA 3LR3A 2OWJA 3T4JA 5HPIA 3M2KA 3CJMA 1DP6A 4FSFA 4E3JA 3IWOA 2W27A 1IYSA 3IWQA 4LLOB 2VA0A 4PM9A 3T4TA 1YQSA 2PRFA 4X56A 3G2YA 3OCNA 4JGPA 3ZNYA 4EEUA 5AQAA 3I7JA 4ZJ2A 3BY8A 1PWCA 5HSQA 2ZQ9A 4EWFA 4KQDA 2M1CA 4ID4A 4OOYA 2J80A 3PXPA 3QNCA 1ZTUA 2Y2IA 5FASA 3PBOA 2GZAA 3DWKA 3TSGA 5CGWA 2XD5A 3Q82A 5IU1A 5EM0A 4ETZA 3DTEA 5G18A 2J3WA 1LT0A 4XT2A 2XA7M 3UE0A 5FI2A 1MWTA 5DVAA 2V20A 3D72A 3UMEA 4IJGA 4WEKA 1GHPA 2ZC5B 1KE4A 2DMWA 1UWNX 3M6BA 1CJFA 3DTKA 1WYCA 4N9LA 2XSSA 1OJGA 2Y2GA 4KQOA 5EVIA 1ES5A 3O88A 3UN7A 4HEFA 4IBXA 1FSWA 3IX3A 4N9KA 3QP4A 3UB6A 1NJ4A 2R78A 1PRQA 2JCHA 3W2ZA 1AXBA 4KZ8A 3LI8A 3G32A 4ZJ3A 5M19A 2EXBA 5FI6A 1XJ6A 2I9VA 4LPZA 4YOFA 3B3XA 3LCEA 1JTGA 1LL5A 3SS4A 2HGVA 1SCWA 5HARA 3KSGA 5TR7A 1ESIA 3EWKA 1CK3A 1YLZA 5GHYA 4EUVA 2Z6DA 2X02A 3V50A 2J9PA 3TG9A 2UV0E 4Q0IA 2Y55A 4WBGA 3ULFA 3HUOA 1F2KA 3IF6C 4JF5A 4NXFA 3HLEA 2XQZA 5F5YA 4R23A 1OTEA 1E25A 5E2EA 4R3AA 4HP9A 4Y17A 2ZC4B 1VETB 3V5MA 3H9WA 3M6HA 3FPWA 1ONHA 3G2ZA 3GECA 4DN0A 1MWSA 4I3AA 4H6JA 4QPRA 4CPKA 2GDNA 3ZG0A 3EGDC 5FQQA 3AGDA 2WADA 3S7PA 4CLCB 4WZ5C 3SOIA 5HWWA 3SS3A 3IT9A 2PD7A 4OVDA 2W3FA 3G35A 3FPVA 1N9BA 4B93A 5FQIA 2PYRA 4QY6A 4Y0OA 2ZC7A 2XFSA 4F3LA 2VJWA 2JC7A 4BQMA 4GJ4A 3T1RA 3EQVA 1IYQA 5FQKA 2V1BA 5AVFA 5DKLA 4NEED 4IUKA 2Z2LB 2C5WB 4LCLA 1K54C 5M1AA 4CJNA 4E6WA 3VSKA 4ME4A 5JYOA 2A2LA 2L0WA 3OPHA 4DDYA 4XUZA 4KZ3A 1LLBA 4WUJA 1FILA 3E2KA 3HVFA 5TBMB 3BEBA 5HD3A 4FOFA 4HHDA 2Z2MB 4LCMA 3RJUA 2H0YA 3T4QA 3UDFA 4FD8A 3EQUA 3LIDA 2QWSA 4WN5A 4XUXA 4RX3A 3OCLA 3GSGA 3KSHA 2J8YA 3NY4A 4R3JA 2G2WA 4B4ZA 1YLYA 2QHKA 3HREA 4PKYA 4WLAA 3S4XA 4UQIS 2M7UA 4FCFA 1DY6A 3HL9A 1P9RA 4Q0JA 2ZC6B 2G2UA 4GNUA 4OQHA 4P87A 3HUNA 2J9OA 2XF3A 3T4OA 3NDGA 1GSXA 3NOTC 2LB9A 3QP1A 4BL2A 3LEQA 3BFCA 3T1QB 2E8IA 1IYOA 3H7WA 3IS2A 2QKPA 2HDSA 4HI4A 2JKTI 3LICA 1XA1A 2VGKA 1U60A 3CWFA 5LBRA 1BZAA 5CERA 2HJEA 4OPRA 3K3DA 5DF7A 4QJGA 4GDBA 3OPLA 4S2JA 4ZDXA 4WMCD 2ZLYA 1MKMA 2WGWB 3ZQ5A 2HV1A 2A3UA 1PZPA 4OPYA 2V1AA 4RX2A 1G5UA 4LV0A 4PMAA 1JVJA 3VE3A 4LRZE 1XJ4A 5TJJA 3N8LA 1F5MA 3PAEA 1OTAA 4GN2A 3IBRA 3OLOA 3B42A 5HL1A 4EBPA 3NIAA 1LSXA 3AGEA 2XGNA 5KZHA 1SKFA 3SS5A 4R70A 3T4KA 2P7JA 2IA2A 3FKVA 1OMEA 5TFQA 2VX8A 4BBUA 4HQAA 5AQBA 3UMDA 2IWCA 4DRTA 3IH9A 2Y2LA 5EUAA 4GZBA 1W7FA 4HH2A 5G4YA 3UE1A 4ZBEA 2FH5A 3MXSA 4P6ZM 2ZQAA 2Y59A 3G31A 4RYEA 4E6XA 4EW7A 3F1OB 1Y28A 1M40A 1N9LA 4E3MA 2H0TA 3IXDA 1OTBA 3HLBA 3UB5P 1Q2QA 2Y2KA 4E04A 1PI4A 4EBLA 3IH8A 4Y13A 3VFFA 2XFTA 3IXGA 3RXWA 2KLIA 4S2KA 2W1RA 4OPQA 5DJUA 5FSRA 1M6KA 4DDSA 4OLGA 2VV8A 1STZA 4X1MA 1XFNA 3SW1A 4GS9A 4B9OA 1Z6FA 3A0RA 1GCEA 3DTMA 4JF4A 3FKWA 2GX5A 5GLCA 4BBVA 2ZQ8A 4LRXC 2I72A 5CEDA 1DJBA 2FZ0A 2V0UA 4FUWA 2Y2JA 4CLCE 4WYYA 2HJ9C 3DBAA 2C6WB 3NULA 5HDDA 1VB6A 4HIAA 4XXRA 2W3HA 3AGFA 5HDCA 2Y2QA 1UWPX 3PBTA 4F94A 2YKFA 4Q0HA 4HNBA 4IVIA 4R0QA 3UDXA 4Y7PA 2HF6A 4KZ4A 4S2NA 4DKIA 4DXCA 1G6AA 1I2SA 1D1JA 3OPRA 2WAEA 5FQMA 4KZ6A 1EW0A 1FR1A 2VV6A 5J8XA 2J3TD 2XRNA 2W0NA 3B33A 2DCFA 4O0PA 2J7VA 3V67A 1GHMA 2W3DA 4R1GA 5FQJA 1OTDA 5F6AA 3BFFA 4DE2A 1S1ZA 5EVID 2EFUA 1TVFA 3IF6B 4Y0UA 2PR6A 1S6RA 1IELA 4E3NA 2PDRA 2VZWA 3L7HA 4IEDA 1BLHA 5AVEA 3LIEA 3ISGA 2DRWA 1L0GA 2BLSA 1BT5A 3MS6A 1K55A 4KZ9A 1NYMA 1WYBA 1TDLA 4BWIA 2ZJ9A 4OOMA 5HZHA 1K6RA 3C7VA 4R38A 5L2FA 5DTKA 2Z6CA 3T1XA 1KDWA 1JWPA 3FV7A 4S2PA 3IF5A 3QP8A 3MF0A 1LHYA 3HCYA 2Y91A 3MSHA 4EESA 1OPXA 5L8MA 4HBTA 4B88A 1VQQA 4OONA 3GDIA 1HTZA 2QJ5A 4PKYG 1FQGA 3WS1A 1IEMA 3O87A 2XR0A 3VMAA 1XP4A 3PR6A 5FATA 2XEPA 3Q07A 1GA0A 1LI0A 2O9BA 3HJIA 3BFDA 1PW8A 1NZUA 1ZKJA 4DE3A 2JKRI 1QMEA 3A0SA 1T18A 1TF1A 3NECA 4ARZB 2EX9A 3H82A 4HJ4A 1BLCA 1IKIA 1RCJA 2ZQDA 4KG2A 4WEJA 1K38A 1Y4OA 4GCZA 4P85A 1E4DA 2WZXA 4WZ4A 3LIFA 2GJ3A 3IX8A 2VV7A 4G3KA 5KSCA 3OC2A 2K7SA 4G3WA 2EX8A 3C2WA 4MBFA 4MN5A 1MKIA 4R4SA 1S4RA 2PBDP 3C5AA 1MPLA 1FOFA 5GL9A 1NY0A 2V2FF 2W3GA 5CECA 1Z09A 2CC1A 1K57C 2P9VB 5EVLA 3W4OA 4H8RA 1OTIA 2O9CA 3F1NA 3LR5A 4MBHA 4GDNA 2HDQA 3Q7VA 1K56D 4RVAA 4HH3A 1LL8A 5EVEA 3HLGA 3E4QA 1YM1A 2EWVA 2H28A 1XKZA 2ZL1B 2WKHA 3C30A 2GNXA 3LIAA 4G3VA 4K0WA 3UB7A 3FWLA 3KSFA 1FR6A 3VOYA 3F1PB 3GRJA 4PPRA 2PT7A 4NXEA 2R9WA 3WS2A 1YSPA 3O3VA 5A90A 1PI5A 1I2WA 1ESUA 3TJZC 4E3OA 1BUEA 1CEGA 2X01A 2MJ6A 2ZMFA 5BOHA 3MQQA 3NI9A 1KDSA 5JYPA 4QD4A 1F98A 4GW9A 2ZOHA 4BJPA 5AQ9A 2KX6A 2A24B 1OT9A 2WKQA 1Q2PA 4I39A 2JKTM 4GHIA 3IXHA 3BFGA 4Z1WA 4UEYA 1SHVA 3E0YA 4HOIA 3BRMA 4MLLA 5CGSA 2ZM8A 3D9YA 1ERMA 3A0VA 2Y2PA 4X6TA 2XK1A 1D7EA 3GR2A 1MC0A 1ODVA 2WK0A 3CPTB 4R3BA 4HESA 4LV3A 3A3DA 2H5SA 4K0XA 1ES2A 1PWDA 3FG8A 1VEUA 3E98A 4PHTA 2L4RA 4OKPA 2VGLM 3D4FA 3IBJA 4U0TA 4FH4A 1KGEA 3ZG8B 5F83A 5EFWA 5FL3A 4I3IA 1LL9A 1K56A 3OPPA 2W1TB 1SZVA 1SKOB 3RH8B 5HW3A 1OT6A 4M4XA 4WZ5A 1H8MA 3MZFA 2JE5A 1XGIA 2Y2HA 4LRYC 2PBYA 2B95A 2BTFP 2ZMVA 5CGXA 3OOVA 4YFMA 1P9WA 5DTTA 2KDKA 3EEHA 1JWVA 4UA7A 4Q8IA 2ZM2A 4DMZA 1K54A 3WWXA 5E2GA 2WZZA 2PYPA 3VP3A 1W79A 2WKEA 1FIKA 1K4EA 4MCWA 4X69A 1XJ3A 2WUQA 1XJ2A 5U47A 2OAP1 4ZTKA 3LEZA 3G30A 3E2LA 2Q0OA 5D3OA 1XX2A 5K5BA 3ITBA 2ZM0A 2O0YA 4ESPA 3LO7A 1P0ZA 1SDEA 3UNWA 1MWRA 3MFDA 3PYPA 1ERQA 2OSUA 4IHQA 1TS0A 1XXMA 3NCKA 1BLPA 3KSIA 1JNUA 1XFQA 3IX4A 4DE0A 1XPBA 5E2HA 3ZYTA 1QMFA 3MZDA 2OLVA 4PM7A 4AFIA 3V3RA 1H3QA 4KUOA 1D06A 3MXRA 5J3WA 4MN7A 2RCXA 3S7NA 3N4IA 3ZCZA 4C3QA 3VSLA 3W8KA 3MMHA 4YINA 4JPMA 3HUMA 4UQIM 4NETA 5KSHA 4GOGA 1GSWA 1L2SA 3IHBA 4LGWA 4X1LA 3WRZA 2Y2NA 1YLTA 3PBNA 2UWXA 5FI7A 4U0XA 3K2NA 3SZTA 2EA9A 4LENA 5AQ7A 4X25A 3MKEA 3WS0A 2QMIA 2ZQCA 4XT2B 2V8FA 4BL3A 1MBLA 3GVBA 2HZ5A 1NLZA 3MQOA 1GHIA 2QZ6A 3SH7A 2KOIA 1KE0A 1N9NA 3FZCA 1T1BA 4KENB 5FQ9A 1MWUA 1EWZA 2PR5A 3UB8A 1TS7A 4S2MA 3O5YA 1SDNA 3PHYA 3QP6A 3RTYA 4CLCA 4KZBA 2WYXA 3K3CA 5EVIB 3IHAA 1VHMA 1G6OA 3KX0X 2BG1A 2B18A 2ZD8A 3EEAA 2WAFA 1BSGA 3BY9A 2ZQ7A 2D01A 3R4KA 3A3FA 3ICYA 3MQ0A 3ZVTA 3S7OA 3T4LA 4OPZA 5L10A 3VV4A 4S2NC 5CRFA 3Q81A 1W63M 4JXVA 2XDMA 3F1NB 3DAVA 4EQIA 3Q7VB 4FTXA 4NXBA 4Y2FA 3BLMA 5HAIA 4P0MA 2P08A 5DJTA 4LV1A 5CTMA 3A3IA 1G68A 4P6BA 3LUQA 4PM5A 4MBKA 4ZAMA 3VP0A 5TBMA 3UO9A 3CUEA 3TRCA 4MDZA 4I38A 1ZG6A 3SH9A 4JGQA 4JXWA 3A3JA 2V9AA 3IQAA 4EXOA 3NOUC 2JKRM 2OWHA 4Y3IA 2JN7A 3T1SA 5AJGA 4I3JA 2V1ZA 5HPFA 3HLDA 3KYZA 1NRJA 2QJ7A 2INWA 1YLWA 5GLAA 4O8GA 1K55C 3N6IA 2AVXA 2HPBA 4OQGA 4BD0A 4H6JB 3IWIA 5HX9A 4L9GA 1KOUA 2P74A 1O7EA 4KG5A 4OQ0A 1N9OA 1CEFA 2XA7S 3MFXA 4Y5FA 4B4XA 1NWZA 3RXXA 3GQZA 4IBRA 2VK3A 1V9YA 1ES4A 4F3LB 1K25A 4EUZA 1JTDA 3E4OA 3R7WA 4KQQA 1YLPA 2D02A 2G7UA 3ITAA 4L9EA 2WGWA 3KO6A 3MZEA 5MC7A 3S1YA 1CI8A 5KMWA 2Y2OA 5HAQA 4OH0A 4DJ3A 3UPNA 4I5SA 2XH9A 3LR4A 2J3TC 4QHCA 2HDUA 1Y54A 5F69A 2XD1A 1IFQA 2K2NA 3CITA 5DFYA 3HLCA 5CHMA 3VP4A 2E8JA 4ZJ1A 1ES3A 5FA7A 1IOUA 1L0FA 3VFHA 3ZG7B 4BBTA 5DFXA 3QP5A 3DW0A 4MN6A 4C75A 5EVIC 1T19A 3ZG9B 4UA6A 1FCMA 1IKGA 4JXGA 3CMZA 4EETB 3NDEA 5EV0A 2XLNA 1NXYA 1L0EA 2LB5A 1HD8A 2WKPA 4DXBA 3NHQA 1PNEA 3F1OA 4JLFA 3N8SA 1NYYA 1YAXA 2FFYA 3PBSA 2R9XA 3EOIA 3OZHA 4ZRRA 3H7WB 3IS2B 1FCOA 4EERA 1MXOA 4M3KA 2K31A 5HD5A 2DNSA 3LR0A 1H8YA 2PU2A 3NC8A 4UHUA 1W5DA 5TGFA 3CG5A 4PM6A 3LY4A 1ACFA 4WELA 1BULA 4R4RA 3MXQA 4EV4A 4U3TA 1BYWA 3MJQA 3BM6A 1FCNA 3Q1FA 5F68A 3LYXA 3B47A 5GHXA 1ZC2A 4N92A 1LSWA 2VEAA 1C3BA 3UE3A 3LGOA 1W63Q 3WS5A 1PYYA 3NOPC 5HAPA 2PAVP 5F1GA 2WGIA 3A3EA 2RL3A 3P09A 4IVKA 4N1XA 3C4PA 2OAQ1 2WKRA 4OLDA 2JKGA 1CQAA 2VGLS 2IWDA 5CX7A
chains in the Genus database with same CATH topology
3VP2A 1IYSA 4S2KA 3VP3A 1W79A 3IWQA 2WKEA 4MNRA 4PM9A 4OPQA 2FFFB 1YQSA 5FSRA 5EPHA 1M6KA 1K4EA 4DDSA 4JXSA 4OLGA 4X56A 1K57A 3G2YA 3OCNA 4NK3A 3ZNYA 4X69A 5AQAA 3ZFZA 3I7JA 2WUQA 4ZJ2A 5U47A 3BFEA 1Z6FA 4ZTKA 1GCEA 1PWCA 2ZQ9A 4EWFA 3DTMA 3LEZA 4JF4A 3G30A 3FKWA 4ID4A 2Y4AA 5GLCA 3E2LA 4OOYA 4L0LA 4LV2A 2ZQ8A 5D3OA 1XX2A 5EOEA 3QNCA 1HZOA 2I72A 5CEDA 1DJBA 3M2JA 3ITBA 2Y2IA 2ZM0A 5FASA 2Y2JA 3PBOA 4WYYA 2C6WB 2EX6A 3LO7A 1DJCA 4K91A 3DWKA 1SDEA 3UNWA 3TSGA 5CGWA 3BYDA 4XXRA 2XD5A 3HLFA 3Q82A 3AGFA 1MWRA 3MFDA 4MEZA 3S22A 1ERQA 2Y2QA 3PBTA 4F94A 2OSUA 3PTEA 1J9MA 5G18A 5A93A 1XXMA 4BLMA 3NCKA 1BLPA 4IVIA 3IF6A 4DE0A 3UE0A 5FI2A 3BECA 4R0QA 3UDXA 4QU3A 4Y7PA 1XPBA 5E2HA 1MWTA 5DVAA 1QMFA 1YMSA 2V20A 3MZDA 4KZ4A 3WRTA 4S2NA 2OLVA 5EECA 4PM7A 4C6YA 3V3RA 4WEKA 1GHPA 2ZC5B 1KE4A 5CXWA 3SH8A 4DKIA 4DXCA 1G6AA 3MXRA 1I2SA 3M6BA 3OPRA 2WAEA 5FQMA 2RCXA 4KZ6A 5EOOA 2JBFA 3VP1A 4FH2A 3N4IA 1S0WA 1FR1A 3ZCZA 4C3QA 1WYCA 3VSLA 5J8XA 1I5QA 3W8KA 4KZ7A 4N9LA 4YINA 4S2LA 3GMWA 4JPMA 4E3IA 1LI9A 2Y2GA 3HUMA 4NETA 5KSHA 1KE3A 4KQOA 1K6SA 2DCFA 4GOGA 3Q7ZA 1L2SA 5EVIA 3IHBA 1ES5A 2J7VA 3O88A 4HEFA 4IBXA 2Y2NA 1YLTA 3UN7A 1FSYA 3PBNA 3WRZA 2PU4A 1FSWA 4N9KA 3ZHHA 1NJ4A 2UWXA 1GHMA 4R1GA 1O07A 5FI7A 5FQJA 4U0XA 5FAQA 4DF6A 1W8YA 3BFFA 2JCHA 4LENA 2HP9A 1AXBA 5AQ7A 4DE2A 4KZ8A 5EVID 3MKEA 2EFUA 3PBQA 2QMIA 1RGZA 4GD6A 3UPPA 1TVFA 3IF6B 3WS0A 2ZQCA 5IHVA 4BL3A 4RA7A 4Y0UA 1MBLA 1S6RA 3GVBA 3HLWA 1IELA 3G32A 4ZJ3A 5GLBA 4E3NA 5M19A 1GHIA 2EXBA 5FI6A 2QZ6A 3SH7A 4IEDA 1BLHA 1BLSA 1KE0A 3ISGA 2DRWA 3FZCA 3UY6A 3B3XA 1L0GA 2BLSA 3C7UA 1BT5A 3LCEA 1K55A 4KENB 5FAPA 4KZ9A 1NYMA 1JTGA 1LL5A 1TDLA 1WYBA 3SS4A 3TOIA 4D2OA 2ZJ9A 1SCWA 2OLUA 4OOMA 5FQ9A 1MWUA 5HARA 1K6RA 1EWZA 4GKUA 5TR7A 3C7VA 4OP5A 1ESIA 4S2MA 1CK3A 1YLZA 5L2FA 1SDNA 5GHYA 4OQIA 5DTKA 1KDWA 2X02A 1JWPA 3V50A 3FV7A 4S2PA 2J9PA 3IF5A 3O86A 4KZBA 2WYXA 1LHYA 3TG9A 5EVIB 3IHAA 2Y91A 3QHYA 1W8QA 2BG1A 2Y55A 2ZD8A 1PW1A 4WBGA 2WAFA 1BSGA 3HUOA 4HBTA 5M18A 4B88A 1VQQA 2ZQ7A 3IF6C 4JF5A 1KGFA 3HLEA 1HTZA 2XQZA 3A3FA 4OONA 4R23A 1FQGA 3WS1A 3GV9A 1NRFA 3ZVTA 1E25A 1IEMA 4OPZA 3O87A 4S2NC 2XR0A 3VMAA 3UPOA 5CRFA 1XP4A 4QB8A 5E2EA 3Q81A 5FATA 4JXVA 2XDMA 2ZC4B 3V5MA 3M6HA 2XEPA 1ONHA 3Q07A 3G2ZA 4EQIA 1E3UD 3Q7VB 1MWSA 1GA0A 1LI0A 1K4FA 3BLMA 5FAOA 4CPKA 2GDNA 1KVLA 4P0MA 5HAIA 3ZG0A 1JWZA 3BFDA 4LV1A 2Y2MA 1PW8A 1ONGA 2H10A 3A3IA 1NZUA 1G68A 4P6BA 5CTMA 5FQQA 1ZKJA 3AGDA 2WADA 4DE3A 4PM5A 1NZOA 4MBKA 4ZAMA 1HVBA 1QMEA 1ALQA 2P9VA 3VP0A 4WZ5C 3UO9A 3SOIA 5CHUA 3SS3A 3WS4A 3FYZA 3IT9A 5CHJA 2X71A 4OVDA 3LY3A 1DJAA 3G35A 2EX2A 1ZG6A 4N1HA 1N9BA 3SH9A 5FQIA 2VGJA 2EX9A 2OV5A 4JXWA 4QY6A 1RGYA 2ZC7A 3A3JA 4Y0OA 3IQAA 2XFSA 2JC7A 2ZMAA 4BQMA 3EQVA 1IYQA 1PZOA 1BLCA 1N4OA 1IKIA 1MY8A 2Q9NA 4O7DA 5CTNA 1RCJA 2V1ZA 2ZQDA 3HLDA 5FQKA 4KG2A 4WEJA 3V3SA 1K38A 5A91A 1YLWA 4P85A 5GLAA 1E4DA 2WZXA 2Z2LB 4WZ4A 1K55C 3N6IA 2C5WB 1YT4A 4LCLA 1K54C 5M1AA 4CJNA 3OC2A 5KSCA 2HPBA 2EX8A 4OQGA 4E6WA 3W4PA 4BD0A 1TDGA 3IWIA 4MBFA 3VSKA 1MKIA 4R4SA 5JYOA 5GHZA 5HX9A 4E3LA 5EE8A 3C5AA 3OPHA 4DDYA 1MPLA 1VM1A 1FOFA 4XUZA 4KZ3A 2P74A 1KVMA 1NY0A 2V2FF 1LLBA 5GL9A 5CECA 4JF6A 1O7EA 2CC1A 4KG5A 1K57C 3E2KA 2P9VB 3HVFA 5EVLA 1CI9A 4H8RA 1EROA 4OQ0A 3V39A 3W4OA 1CEFA 3BEBA 3JYIA 4X53A 4B4XA 2Z2MB 4MBHA 3RXXA 4GDNA 4LCMA 2HDQA 2H0YA 1GA9A 3GQZA 3Q7VA 1K56D 3CZDA 4IBRA 3RJUA 3UDFA 1WE4A 4RVAA 3N7WA 1ES4A 4FD8A 1K25A 3EQUA 3HLGA 4EUZA 1JTDA 1TEMA 1YM1A 4KZ5A 3QNBA 4XUXA 5DF8A 4KQQA 4RX3A 1YLPA 3OCLA 1XKZA 3ITAA 1KGGA 2EXAA 2WKHA 3GSGA 2IWBA 3HBRA 2WGWA 2J8YA 4KZAA 3NY4A 4QY5A 4R3JA 4K0WA 3W4QA 2G2WA 3FWLA 3MZEA 4B4ZA 1YLYA 1FR6A 3HREA 3VOYA 3S4XA 2ZC3B 3GRJA 4PPRA 4FCFA 1DY6A 3PBRA 4UAAA 3HL9A 3P98A 1CI8A 4GB7A 4Z9QA 3S1YA 2ZC6B 2G2UA 2Y2OA 5KMWA 4GNUA 2R9WA 4OQHA 4P87A 3HUNA 4JBFA 2J9OA 3WS2A 2XF3A 3ZNTA 5HAQA 3O3VA 3NDGA 5CEBA 4OH0A 5A90A 1PI5A 1I2WA 1ESUA 2Q9MA 3UPNA 2HDRA 1E3UA 2XH9A 4BL2A 1YMXA 5A92A 4QHCA 4E3OA 3BFCA 2HDUA 4GD8A 1BUEA 3DWZA 2E8IA 1IYOA 1CEGA 2HDSA 1Y54A 2X01A 1EI5A 3NBLA 2XD1A 2EFXA 5BOHA 1XA1A 3NI9A 1KDSA 5JYPA 4WMCA 2VGKA 1U60A 4DE1A 4QD4A 3HLCA 1BZAA 5CHMA 3C4OA 3VP4A 4ZJ1A 1ES3A 5FA7A 5CERA 1L0FA 3VFHA 3ZG7B 4BJPA 4OPRA 5AQ9A 3ZDJA 5DF7A 4QJGA 1ZG4A 3DW0A 3IXBA 3MBZA 4GDBA 3OPLA 4S2JA 4C75A 4UA9A 5EVIC 4ZDXA 4WMCD 2ZLYA 1PWGA 2WGWB 4OP8A 4X55A 1Q2PA 3ZG5A 3ZG9B 3IXHA 5E2FA 2A3UA 4UA6A 1FCMA 3BFGA 5F82A 1IKGA 4JXGA 1SHVA 3CMZA 4JKTA 1PZPA 3BRMA 4MLLA 4OPYA 4RX2A 5CGSA 2ZM8A 3NDEA 1ERMA 2XLNA 2Y2PA 3G34A 4X6TA 2XK1A 4LV0A 4PMAA 1JVJA 1NXYA 3GR2A 4S2IA 1L0EA 2WK0A 1HD8A 1XGJA 5FDHA 2WGVA 3N8LA 4A5RA 3G4PA 4HESA 4R3BA 3PAEA 4LV3A 3A3DA 4DXBA 4HBUA 2H5SA 4GN2A 4K0XA 3UDIA 5HL1A 4EBPA 1PIOA 4JLFA 1ES2A 1PWDA 3N8SA 3NIAA 5I94A 1NYYA 2FFYA 2R9XA 3OZHA 3PBSA 4PM8A 5F1FA 1FCOA 4OKPA 3AGEA 3ZGAB 1MXOA 4E3KA 4X68A 4M3KA 1XA7A 2XGNA 3D4FA 5KZHA 1SKFA 3SS5A 4U0TA 4FH4A 4WM9A 2DNSA 1H8YA 2PU2A 4Y0TA 3MKFA 3NC8A 4UHUA 1W5DA 5TGFA 4KQRA 3CG5A 4PM6A 1KGEA 2WKIA 1OMEA 3FKVA 5F83A 4KG6A 3ZG8B 5TFQA 3LY4A 1RP5A 1LL9A 1K56A 3OPPA 4S2OA 5DTSA 5AQBA 5GLDA 4WELA 1BULA 3BLSA 5HW3A 4R4RA 2IWCA 1IYPA 4DRTA 4EV4A 4WZ5A 3MZFA 3IH9A 2Y2LA 4U3TA 2JE5A 1XGIA 5EUAA 3PAGA 2Y2HA 3BM6A 1FCNA 4GZBA 2A49A 3Q1FA 1W7FA 2PBYA 3N8RA 3VOZA 3UE1A 4ZBEA 4EBNA 5E43A 4BD1A 2HP5A 5GHXA 1YLJA 1ZC2A 3MXSA 2ZQAA 4N92A 2Y59A 4OOLA 3G31A 5CGXA 4YFMA 5DTTA 1BTLA 1C3BA 3UE3A 4RYEA 4E6XA 5DF9A 3WS5A 2QPNA 1PYYA 5HFOA 5HAPA 3ZVWA 4BENA 1H8ZA 1M40A 5F1GA 4E3MA 1JWVA 2WGIA 4UA7A 3A3EA 2RL3A 3P09A 2HP6A 2B5RA 3GTCA 4Q8IA 4IVKA 2H0TA 1H5XA 1L0DA 3IXDA 4N1XA 3C4PA 3HLBA 4OLDA 2ZM2A 1Q2QA 2Y2KA 1K54A 1PI4A 3WWXA 4EBLA 3IH8A 3M2KA 3CJMA 2IWDA 4FSFA 5E2GA 3VFFA 4E3JA 2XFTA 3IXGA 3IWOA 3RXWA 2WZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VP2 A;  1IYS A;  4S2K A;  3VP3 A;  1W79 A;  3IWQ A;  2WKE A;  4MNR A;  4PM9 A;  4OPQ A;  2FFF B;  1YQS A;  5FSR A;  5EPH A;  1M6K A;  1K4E A;  4DDS A;  4JXS A;  4OLG A;  4X56 A;  1K57 A;  3G2Y A;  3OCN A;  4NK3 A;  3ZNY A;  4X69 A;  5AQA A;  3ZFZ A;  3I7J A;  2WUQ A;  4ZJ2 A;  5U47 A;  3BFE A;  1Z6F A;  4ZTK A;  1GCE A;  1PWC A;  2ZQ9 A;  4EWF A;  3DTM A;  3LEZ A;  4JF4 A;  3G30 A;  3FKW A;  4ID4 A;  2Y4A A;  5GLC A;  3E2L A;  4OOY A;  4L0L A;  4LV2 A;  2ZQ8 A;  5D3O A;  1XX2 A;  5EOE A;  3QNC A;  1HZO A;  2I72 A;  5CED A;  1DJB A;  3M2J A;  3ITB A;  2Y2I A;  2ZM0 A;  5FAS A;  2Y2J A;  3PBO A;  4WYY A;  2C6W B;  2EX6 A;  3LO7 A;  1DJC A;  4K91 A;  3DWK A;  1SDE A;  3UNW A;  3TSG A;  5CGW A;  3BYD A;  4XXR A;  2XD5 A;  3HLF A;  3Q82 A;  3AGF A;  1MWR A;  3MFD A;  4MEZ A;  3S22 A;  1ERQ A;  2Y2Q A;  3PBT A;  4F94 A;  2OSU A;  3PTE A;  1J9M A;  5G18 A;  5A93 A;  1XXM A;  4BLM A;  3NCK A;  1BLP A;  4IVI A;  3IF6 A;  4DE0 A;  3UE0 A;  5FI2 A;  3BEC A;  4R0Q A;  3UDX A;  4QU3 A;  4Y7P A;  1XPB A;  5E2H A;  1MWT A;  5DVA A;  1QMF A;  1YMS A;  2V20 A;  3MZD A;  4KZ4 A;  3WRT A;  4S2N A;  2OLV A;  5EEC A;  4PM7 A;  4C6Y A;  3V3R A;  4WEK A;  1GHP A;  2ZC5 B;  1KE4 A;  5CXW A;  3SH8 A;  4DKI A;  4DXC A;  1G6A A;  3MXR A;  1I2S A;  3M6B A;  3OPR A;  2WAE A;  5FQM A;  2RCX A;  4KZ6 A;  5EOO A;  2JBF A;  3VP1 A;  4FH2 A;  3N4I A;  1S0W A;  1FR1 A;  3ZCZ A;  4C3Q A;  1WYC A;  3VSL A;  5J8X A;  1I5Q A;  3W8K A;  4KZ7 A;  4N9L A;  4YIN A;  4S2L A;  3GMW A;  4JPM A;  4E3I A;  1LI9 A;  2Y2G A;  3HUM A;  4NET A;  5KSH A;  1KE3 A;  4KQO A;  1K6S A;  2DCF A;  4GOG A;  3Q7Z A;  1L2S A;  5EVI A;  3IHB A;  1ES5 A;  2J7V A;  3O88 A;  4HEF A;  4IBX A;  2Y2N A;  1YLT A;  3UN7 A;  1FSY A;  3PBN A;  3WRZ A;  2PU4 A;  1FSW A;  4N9K A;  3ZHH A;  1NJ4 A;  2UWX A;  1GHM A;  4R1G A;  1O07 A;  5FI7 A;  5FQJ A;  4U0X A;  5FAQ A;  4DF6 A;  1W8Y A;  3BFF A;  2JCH A;  4LEN A;  2HP9 A;  1AXB A;  5AQ7 A;  4DE2 A;  4KZ8 A;  5EVI D;  3MKE A;  2EFU A;  3PBQ A;  2QMI A;  1RGZ A;  4GD6 A;  3UPP A;  1TVF A;  3IF6 B;  3WS0 A;  2ZQC A;  5IHV A;  4BL3 A;  4RA7 A;  4Y0U A;  1MBL A;  1S6R A;  3GVB A;  3HLW A;  1IEL A;  3G32 A;  4ZJ3 A;  5GLB A;  4E3N A;  5M19 A;  1GHI A;  2EXB A;  5FI6 A;  2QZ6 A;  3SH7 A;  4IED A;  1BLH A;  1BLS A;  1KE0 A;  3ISG A;  2DRW A;  3FZC A;  3UY6 A;  3B3X A;  1L0G A;  2BLS A;  3C7U A;  1BT5 A;  3LCE A;  1K55 A;  4KEN B;  5FAP A;  4KZ9 A;  1NYM A;  1JTG A;  1LL5 A;  1TDL A;  1WYB A;  3SS4 A;  3TOI A;  4D2O A;  2ZJ9 A;  1SCW A;  2OLU A;  4OOM A;  5FQ9 A;  1MWU A;  5HAR A;  1K6R A;  1EWZ A;  4GKU A;  5TR7 A;  3C7V A;  4OP5 A;  1ESI A;  4S2M A;  1CK3 A;  1YLZ A;  5L2F A;  1SDN A;  5GHY A;  4OQI A;  5DTK A;  1KDW A;  2X02 A;  1JWP A;  3V50 A;  3FV7 A;  4S2P A;  2J9P A;  3IF5 A;  3O86 A;  4KZB A;  2WYX A;  1LHY A;  3TG9 A;  5EVI B;  3IHA A;  2Y91 A;  3QHY A;  1W8Q A;  2BG1 A;  2Y55 A;  2ZD8 A;  1PW1 A;  4WBG A;  2WAF A;  1BSG A;  3HUO A;  4HBT A;  5M18 A;  4B88 A;  1VQQ A;  2ZQ7 A;  3IF6 C;  4JF5 A;  1KGF A;  3HLE A;  1HTZ A;  2XQZ A;  3A3F A;  4OON A;  4R23 A;  1FQG A;  3WS1 A;  3GV9 A;  1NRF A;  3ZVT A;  1E25 A;  1IEM A;  4OPZ A;  3O87 A;  4S2N C;  2XR0 A;  3VMA A;  3UPO A;  5CRF A;  1XP4 A;  4QB8 A;  5E2E A;  3Q81 A;  5FAT A;  4JXV A;  2XDM A;  2ZC4 B;  3V5M A;  3M6H A;  2XEP A;  1ONH A;  3Q07 A;  3G2Z A;  4EQI A;  1E3U D;  3Q7V B;  1MWS A;  1GA0 A;  1LI0 A;  1K4F A;  3BLM A;  5FAO A;  4CPK A;  2GDN A;  1KVL A;  4P0M A;  5HAI A;  3ZG0 A;  1JWZ A;  3BFD A;  4LV1 A;  2Y2M A;  1PW8 A;  1ONG A;  2H10 A;  3A3I A;  1NZU A;  1G68 A;  4P6B A;  5CTM A;  5FQQ A;  1ZKJ A;  3AGD A;  2WAD A;  4DE3 A;  4PM5 A;  1NZO A;  4MBK A;  4ZAM A;  1HVB A;  1QME A;  1ALQ A;  2P9V A;  3VP0 A;  4WZ5 C;  3UO9 A;  3SOI A;  5CHU A;  3SS3 A;  3WS4 A;  3FYZ A;  3IT9 A;  5CHJ A;  2X71 A;  4OVD A;  3LY3 A;  1DJA A;  3G35 A;  2EX2 A;  1ZG6 A;  4N1H A;  1N9B A;  3SH9 A;  5FQI A;  2VGJ A;  2EX9 A;  2OV5 A;  4JXW A;  4QY6 A;  1RGY A;  2ZC7 A;  3A3J A;  4Y0O A;  3IQA A;  2XFS A;  2JC7 A;  2ZMA A;  4BQM A;  3EQV A;  1IYQ A;  1PZO A;  1BLC A;  1N4O A;  1IKI A;  1MY8 A;  2Q9N A;  4O7D A;  5CTN A;  1RCJ A;  2V1Z A;  2ZQD A;  3HLD A;  5FQK A;  4KG2 A;  4WEJ A;  3V3S A;  1K38 A;  5A91 A;  1YLW A;  4P85 A;  5GLA A;  1E4D A;  2WZX A;  2Z2L B;  4WZ4 A;  1K55 C;  3N6I A;  2C5W B;  1YT4 A;  4LCL A;  1K54 C;  5M1A A;  4CJN A;  3OC2 A;  5KSC A;  2HPB A;  2EX8 A;  4OQG A;  4E6W A;  3W4P A;  4BD0 A;  1TDG A;  3IWI A;  4MBF A;  3VSK A;  1MKI A;  4R4S A;  5JYO A;  5GHZ A;  5HX9 A;  4E3L A;  5EE8 A;  3C5A A;  3OPH A;  4DDY A;  1MPL A;  1VM1 A;  1FOF A;  4XUZ A;  4KZ3 A;  2P74 A;  1KVM A;  1NY0 A;  2V2F F;  1LLB A;  5GL9 A;  5CEC A;  4JF6 A;  1O7E A;  2CC1 A;  4KG5 A;  1K57 C;  3E2K A;  2P9V B;  3HVF A;  5EVL A;  1CI9 A;  4H8R A;  1ERO A;  4OQ0 A;  3V39 A;  3W4O A;  1CEF A;  3BEB A;  3JYI A;  4X53 A;  4B4X A;  2Z2M B;  4MBH A;  3RXX A;  4GDN A;  4LCM A;  2HDQ A;  2H0Y A;  1GA9 A;  3GQZ A;  3Q7V A;  1K56 D;  3CZD A;  4IBR A;  3RJU A;  3UDF A;  1WE4 A;  4RVA A;  3N7W A;  1ES4 A;  4FD8 A;  1K25 A;  3EQU A;  3HLG A;  4EUZ A;  1JTD A;  1TEM A;  1YM1 A;  4KZ5 A;  3QNB A;  4XUX A;  5DF8 A;  4KQQ A;  4RX3 A;  1YLP A;  3OCL A;  1XKZ A;  3ITA A;  1KGG A;  2EXA A;  2WKH A;  3GSG A;  2IWB A;  3HBR A;  2WGW A;  2J8Y A;  4KZA A;  3NY4 A;  4QY5 A;  4R3J A;  4K0W A;  3W4Q A;  2G2W A;  3FWL A;  3MZE A;  4B4Z A;  1YLY A;  1FR6 A;  3HRE A;  3VOY A;  3S4X A;  2ZC3 B;  3GRJ A;  4PPR A;  4FCF A;  1DY6 A;  3PBR A;  4UAA A;  3HL9 A;  3P98 A;  1CI8 A;  4GB7 A;  4Z9Q A;  3S1Y A;  2ZC6 B;  2G2U A;  2Y2O A;  5KMW A;  4GNU A;  2R9W A;  4OQH A;  4P87 A;  3HUN A;  4JBF A;  2J9O A;  3WS2 A;  2XF3 A;  3ZNT A;  5HAQ A;  3O3V A;  3NDG A;  5CEB A;  4OH0 A;  5A90 A;  1PI5 A;  1I2W A;  1ESU A;  2Q9M A;  3UPN A;  2HDR A;  1E3U A;  2XH9 A;  4BL2 A;  1YMX A;  5A92 A;  4QHC A;  4E3O A;  3BFC A;  2HDU A;  4GD8 A;  1BUE A;  3DWZ A;  2E8I A;  1IYO A;  1CEG A;  2HDS A;  1Y54 A;  2X01 A;  1EI5 A;  3NBL A;  2XD1 A;  2EFX A;  5BOH A;  1XA1 A;  3NI9 A;  1KDS A;  5JYP A;  4WMC A;  2VGK A;  1U60 A;  4DE1 A;  4QD4 A;  3HLC A;  1BZA A;  5CHM A;  3C4O A;  3VP4 A;  4ZJ1 A;  1ES3 A;  5FA7 A;  5CER A;  1L0F A;  3VFH A;  3ZG7 B;  4BJP A;  4OPR A;  5AQ9 A;  3ZDJ A;  5DF7 A;  4QJG A;  1ZG4 A;  3DW0 A;  3IXB A;  3MBZ A;  4GDB A;  3OPL A;  4S2J A;  4C75 A;  4UA9 A;  5EVI C;  4ZDX A;  4WMC D;  2ZLY A;  1PWG A;  2WGW B;  4OP8 A;  4X55 A;  1Q2P A;  3ZG5 A;  3ZG9 B;  3IXH A;  5E2F A;  2A3U A;  4UA6 A;  1FCM A;  3BFG A;  5F82 A;  1IKG A;  4JXG A;  1SHV A;  3CMZ A;  4JKT A;  1PZP A;  3BRM A;  4MLL A;  4OPY A;  4RX2 A;  5CGS A;  2ZM8 A;  3NDE A;  1ERM A;  2XLN A;  2Y2P A;  3G34 A;  4X6T A;  2XK1 A;  4LV0 A;  4PMA A;  1JVJ A;  1NXY A;  3GR2 A;  4S2I A;  1L0E A;  2WK0 A;  1HD8 A;  1XGJ A;  5FDH A;  2WGV A;  3N8L A;  4A5R A;  3G4P A;  4HES A;  4R3B A;  3PAE A;  4LV3 A;  3A3D A;  4DXB A;  4HBU A;  2H5S A;  4GN2 A;  4K0X A;  3UDI A;  5HL1 A;  4EBP A;  1PIO A;  4JLF A;  1ES2 A;  1PWD A;  3N8S A;  3NIA A;  5I94 A;  1NYY A;  2FFY A;  2R9X A;  3OZH A;  3PBS A;  4PM8 A;  5F1F A;  1FCO A;  4OKP A;  3AGE A;  3ZGA B;  1MXO A;  4E3K A;  4X68 A;  4M3K A;  1XA7 A;  2XGN A;  3D4F A;  5KZH A;  1SKF A;  3SS5 A;  4U0T A;  4FH4 A;  4WM9 A;  2DNS A;  1H8Y A;  2PU2 A;  4Y0T A;  3MKF A;  3NC8 A;  4UHU A;  1W5D A;  5TGF A;  4KQR A;  3CG5 A;  4PM6 A;  1KGE A;  2WKI A;  1OME A;  3FKV A;  5F83 A;  4KG6 A;  3ZG8 B;  5TFQ A;  3LY4 A;  1RP5 A;  1LL9 A;  1K56 A;  3OPP A;  4S2O A;  5DTS A;  5AQB A;  5GLD A;  4WEL A;  1BUL A;  3BLS A;  5HW3 A;  4R4R A;  2IWC A;  1IYP A;  4DRT A;  4EV4 A;  4WZ5 A;  3MZF A;  3IH9 A;  2Y2L A;  4U3T A;  2JE5 A;  1XGI A;  5EUA A;  3PAG A;  2Y2H A;  3BM6 A;  1FCN A;  4GZB A;  2A49 A;  3Q1F A;  1W7F A;  2PBY A;  3N8R A;  3VOZ A;  3UE1 A;  4ZBE A;  4EBN A;  5E43 A;  4BD1 A;  2HP5 A;  5GHX A;  1YLJ A;  1ZC2 A;  3MXS A;  2ZQA A;  4N92 A;  2Y59 A;  4OOL A;  3G31 A;  5CGX A;  4YFM A;  5DTT A;  1BTL A;  1C3B A;  3UE3 A;  4RYE A;  4E6X A;  5DF9 A;  3WS5 A;  2QPN A;  1PYY A;  5HFO A;  5HAP A;  3ZVW A;  4BEN A;  1H8Z A;  1M40 A;  5F1G A;  4E3M A;  1JWV A;  2WGI A;  4UA7 A;  3A3E A;  2RL3 A;  3P09 A;  2HP6 A;  2B5R A;  3GTC A;  4Q8I A;  4IVK A;  2H0T A;  1H5X A;  1L0D A;  3IXD A;  4N1X A;  3C4P A;  3HLB A;  4OLD A;  2ZM2 A;  1Q2Q A;  2Y2K A;  1K54 A;  1PI4 A;  3WWX A;  4EBL A;  3IH8 A;  3M2K A;  3CJM A;  2IWD A;  4FSF A;  5E2G A;  3VFF A;  4E3J A;  2XFT A;  3IXG A;  3IWO A;  3RXW A;  2WZZ A; 
#chains in the Genus database with same CATH topology
 3VP2 A;  4MNR A;  2FFF B;  1F9I A;  5EPH A;  4JXS A;  1K57 A;  4NK3 A;  3LFV A;  3ZFZ A;  1TS6 A;  5HWV A;  5HDS A;  3BFE A;  4RQ9 A;  3JVU A;  3E4P A;  1PFL A;  2Y4A A;  1P97 A;  4L0L A;  2CMN A;  4LV2 A;  5EOE A;  4EU0 A;  1HZO A;  2PD8 A;  3M2J A;  4Y15 A;  2EX6 A;  1DJC A;  4K91 A;  5IT5 A;  3BYD A;  3HLF A;  4MEZ A;  3S22 A;  5A8B A;  3T50 A;  3UB9 A;  3PTE A;  1J9M A;  5A93 A;  3CLO A;  3L9K A;  4BLM A;  3IF6 A;  4YWZ A;  3BQ8 A;  3BEC A;  4QU3 A;  1YMS A;  3WRT A;  3S7Q A;  3FC7 A;  5EEC A;  4C6Y A;  3P01 A;  1YKD A;  1GSV A;  1AWI A;  1L3L A;  3SH8 A;  5CXW A;  4GS9 B;  4K08 A;  4HY8 A;  5EOO A;  3VP1 A;  2JBF A;  4FH2 A;  1CF0 A;  1S0W A;  3JVV A;  1I5Q A;  4KZ7 A;  5L07 A;  4S2L A;  2NUT C;  3GMW A;  4E3I A;  1LI9 A;  1KE3 A;  1K6S A;  3Q7Z A;  3VOL A;  4JGO A;  1FSY A;  2PU4 A;  1LSV A;  3ZHH A;  3KYE A;  1O07 A;  4PAU A;  3CAX A;  5FAQ A;  5HL6 A;  1W8Y A;  4DF6 A;  2HP9 A;  2V8C A;  3UPP A;  3PBQ A;  1RGZ A;  4GD6 A;  4NG2 A;  5IHV A;  2O99 A;  4RA7 A;  3P7N A;  3HLW A;  4JGR A;  5FEG A;  5GLB A;  4HP4 A;  1BLS A;  3QP2 A;  3UY6 A;  1X0O A;  3C7U A;  5FAP A;  3TW8 A;  3TOI A;  4D2O A;  5DKK A;  2OLU A;  4IUH A;  2BAS A;  4GKU A;  3LIB A;  4OP5 A;  3U4L P;  4OQI A;  5EM1 A;  4HJ6 A;  4L9F A;  3O86 A;  4II7 A;  4EQ1 A;  3QHY A;  1W8Q A;  1PW1 A;  4ARZ A;  5M18 A;  3CHW P;  4CLC D;  1KGF A;  3GV9 A;  1NRF A;  3BQA A;  3UPO A;  3G6O A;  4P6Z S;  4QB8 A;  5C5K A;  2O9A A;  1E3U D;  1K0K A;  2OOL A;  5FAO A;  1K4F A;  1KVL A;  1JWZ A;  3C8C A;  3R7W B;  2Y2M A;  1ONG A;  2H10 A;  3D3O A;  1NZO A;  1HVB A;  1ALQ A;  2P9V A;  3CI6 A;  3TE8 A;  5CHU A;  3WS4 A;  3FYZ A;  4WF0 A;  5CHJ A;  2X71 A;  3NJA A;  5FEF A;  1DP9 A;  3LY3 A;  1A0K A;  1DJA A;  2EX2 A;  4N1H A;  1OJ5 A;  3LI9 A;  2VGJ A;  2OV5 A;  1RGY A;  3T12 B;  4QWO A;  2Y79 A;  2ZMA A;  2ACG A;  4CQH A;  2VKS A;  1PZO A;  1N4O A;  1MY8 A;  2Q9N A;  4O7D A;  5CTN A;  2ZL1 A;  1MZU A;  3V3S A;  5A91 A;  4MMN A;  3F1P A;  2XRO A;  1YT4 A;  2JKF A;  3W4P A;  1TDG A;  5GHZ A;  1YPR A;  3KYQ A;  4E3L A;  1S4S A;  5EE8 A;  1VM1 A;  4CLC C;  1KVM A;  4JF6 A;  1CI9 A;  3V39 A;  1ERO A;  1NLY A;  1VET A;  4R6L A;  3JYI A;  4X53 A;  5J4E A;  1DRM A;  1GA9 A;  3EGX C;  3CZD A;  1WE4 A;  4BMW A;  3N7W A;  4O01 A;  1J3W A;  3H82 B;  2W3E A;  3T4S A;  1TEM A;  2VLG A;  2ZOI A;  2A24 A;  4KZ5 A;  4D60 A;  4NKP A;  3C38 A;  3QNB A;  5DF8 A;  1KGG A;  2EXA A;  4LFU A;  2IWB A;  3HBR A;  4KZA A;  4QY5 A;  3MR0 A;  2L1M A;  3W4Q A;  2ZC3 B;  1G28 A;  4UAA A;  3PBR A;  3BJN A;  3DTI A;  3P98 A;  4GB7 A;  4Z9Q A;  1TS8 A;  1ZHH B;  1V9Z A;  4JBF A;  2ZBB A;  3ZNT A;  5CEB A;  3CPT A;  2Q9M A;  2HDR A;  2EWW A;  1E3U A;  3CUE C;  1H0M A;  1YMX A;  5A92 A;  2B02 A;  3BWL A;  3HJK A;  4GD8 A;  5G4Z A;  1WA9 A;  3DWZ A;  1EI5 A;  3NBL A;  4HJ3 A;  2EFX A;  2YKH A;  4WMC A;  4DE1 A;  3C4O A;  4EEP A;  5HWT A;  2JHE A;  3ZDJ A;  1ZG4 A;  2P04 A;  3IXB A;  3MBZ A;  2W1T A;  4UA9 A;  1PWG A;  4OP8 A;  1S1Y A;  1SKO A;  4X55 A;  3RFB A;  3ZG5 A;  5E2F A;  1T1C A;  2V0W A;  5F82 A;  4JKT A;  3G34 A;  3U2A A;  4S2I A;  2M7V A;  4WL9 A;  4YNR A;  1XGJ A;  5FDH A;  2WGV A;  4A5R A;  3G4P A;  5FDS A;  5J7E A;  4HBU A;  1S67 L;  1DP8 A;  1TD5 A;  3UDI A;  1PIO A;  5I5L A;  5I94 A;  2NUP C;  1HLU P;  3VE4 A;  4PM8 A;  2Y8H A;  5F1F A;  3ZGA B;  4E3K A;  4X68 A;  1XA7 A;  4WM9 A;  3OBF A;  4Y0T A;  3MKF A;  3UE6 A;  1S66 L;  4KQR A;  2WKI A;  4KG6 A;  1RP5 A;  1YSQ A;  4S2O A;  5DTS A;  3BW6 A;  5GLD A;  2PHY A;  3BLS A;  5IS1 A;  4GHI B;  1IYP A;  4ETX A;  3PAG A;  4KUK A;  2A49 A;  4GLQ A;  3N8R A;  3VOZ A;  3JPU A;  4EBN A;  4DJ2 A;  5E43 A;  4BD1 A;  2HP5 A;  1YLJ A;  4OOL A;  5L09 A;  1BTL A;  5DF9 A;  2QPN A;  5HFO A;  5KIZ A;  1T1A A;  3ZVW A;  4BEN A;  1H8Z A;  1VEU B;  2HP6 A;  2B5R A;  2QYB A;  3GTC A;  1H5X A;  1L0D A;  1UGU A;  4NXG A;  3LR3 A;  2OWJ A;  3T4J A;  5HPI A;  3M2K A;  3CJM A;  1DP6 A;  4FSF A;  4E3J A;  3IWO A;  2W27 A;  1IYS A;  3IWQ A;  4LLO B;  2VA0 A;  4PM9 A;  3T4T A;  1YQS A;  2PRF A;  4X56 A;  3G2Y A;  3OCN A;  4JGP A;  3ZNY A;  4EEU A;  5AQA A;  3I7J A;  4ZJ2 A;  3BY8 A;  1PWC A;  5HSQ A;  2ZQ9 A;  4EWF A;  4KQD A;  2M1C A;  4ID4 A;  4OOY A;  2J80 A;  3PXP A;  3QNC A;  1ZTU A;  2Y2I A;  5FAS A;  3PBO A;  2GZA A;  3DWK A;  3TSG A;  5CGW A;  2XD5 A;  3Q82 A;  5IU1 A;  5EM0 A;  4ETZ A;  3DTE A;  5G18 A;  2J3W A;  1LT0 A;  4XT2 A;  2XA7 M;  3UE0 A;  5FI2 A;  1MWT A;  5DVA A;  2V20 A;  3D72 A;  3UME A;  4IJG A;  4WEK A;  1GHP A;  2ZC5 B;  1KE4 A;  2DMW A;  1UWN X;  3M6B A;  1CJF A;  3DTK A;  1WYC A;  4N9L A;  2XSS A;  1OJG A;  2Y2G A;  4KQO A;  5EVI A;  1ES5 A;  3O88 A;  3UN7 A;  4HEF A;  4IBX A;  1FSW A;  3IX3 A;  4N9K A;  3QP4 A;  3UB6 A;  1NJ4 A;  2R78 A;  1PRQ A;  2JCH A;  3W2Z A;  1AXB A;  4KZ8 A;  3LI8 A;  3G32 A;  4ZJ3 A;  5M19 A;  2EXB A;  5FI6 A;  1XJ6 A;  2I9V A;  4LPZ A;  4YOF A;  3B3X A;  3LCE A;  1JTG A;  1LL5 A;  3SS4 A;  2HGV A;  1SCW A;  5HAR A;  3KSG A;  5TR7 A;  1ESI A;  3EWK A;  1CK3 A;  1YLZ A;  5GHY A;  4EUV A;  2Z6D A;  2X02 A;  3V50 A;  2J9P A;  3TG9 A;  2UV0 E;  4Q0I A;  2Y55 A;  4WBG A;  3ULF A;  3HUO A;  1F2K A;  3IF6 C;  4JF5 A;  4NXF A;  3HLE A;  2XQZ A;  5F5Y A;  4R23 A;  1OTE A;  1E25 A;  5E2E A;  4R3A A;  4HP9 A;  4Y17 A;  2ZC4 B;  1VET B;  3V5M A;  3H9W A;  3M6H A;  3FPW A;  1ONH A;  3G2Z A;  3GEC A;  4DN0 A;  1MWS A;  4I3A A;  4H6J A;  4QPR A;  4CPK A;  2GDN A;  3ZG0 A;  3EGD C;  5FQQ A;  3AGD A;  2WAD A;  3S7P A;  4CLC B;  4WZ5 C;  3SOI A;  5HWW A;  3SS3 A;  3IT9 A;  2PD7 A;  4OVD A;  2W3F A;  3G35 A;  3FPV A;  1N9B A;  4B93 A;  5FQI A;  2PYR A;  4QY6 A;  4Y0O A;  2ZC7 A;  2XFS A;  4F3L A;  2VJW A;  2JC7 A;  4BQM A;  4GJ4 A;  3T1R A;  3EQV A;  1IYQ A;  5FQK A;  2V1B A;  5AVF A;  5DKL A;  4NEE D;  4IUK A;  2Z2L B;  2C5W B;  4LCL A;  1K54 C;  5M1A A;  4CJN A;  4E6W A;  3VSK A;  4ME4 A;  5JYO A;  2A2L A;  2L0W A;  3OPH A;  4DDY A;  4XUZ A;  4KZ3 A;  1LLB A;  4WUJ A;  1FIL A;  3E2K A;  3HVF A;  5TBM B;  3BEB A;  5HD3 A;  4FOF A;  4HHD A;  2Z2M B;  4LCM A;  3RJU A;  2H0Y A;  3T4Q A;  3UDF A;  4FD8 A;  3EQU A;  3LID A;  2QWS A;  4WN5 A;  4XUX A;  4RX3 A;  3OCL A;  3GSG A;  3KSH A;  2J8Y A;  3NY4 A;  4R3J A;  2G2W A;  4B4Z A;  1YLY A;  2QHK A;  3HRE A;  4PKY A;  4WLA A;  3S4X A;  4UQI S;  2M7U A;  4FCF A;  1DY6 A;  3HL9 A;  1P9R A;  4Q0J A;  2ZC6 B;  2G2U A;  4GNU A;  4OQH A;  4P87 A;  3HUN A;  2J9O A;  2XF3 A;  3T4O A;  3NDG A;  1GSX A;  3NOT C;  2LB9 A;  3QP1 A;  4BL2 A;  3LEQ A;  3BFC A;  3T1Q B;  2E8I A;  1IYO A;  3H7W A;  3IS2 A;  2QKP A;  2HDS A;  4HI4 A;  2JKT I;  3LIC A;  1XA1 A;  2VGK A;  1U60 A;  3CWF A;  5LBR A;  1BZA A;  5CER A;  2HJE A;  4OPR A;  3K3D A;  5DF7 A;  4QJG A;  4GDB A;  3OPL A;  4S2J A;  4ZDX A;  4WMC D;  2ZLY A;  1MKM A;  2WGW B;  3ZQ5 A;  2HV1 A;  2A3U A;  1PZP A;  4OPY A;  2V1A A;  4RX2 A;  1G5U A;  4LV0 A;  4PMA A;  1JVJ A;  3VE3 A;  4LRZ E;  1XJ4 A;  5TJJ A;  3N8L A;  1F5M A;  3PAE A;  1OTA A;  4GN2 A;  3IBR A;  3OLO A;  3B42 A;  5HL1 A;  4EBP A;  3NIA A;  1LSX A;  3AGE A;  2XGN A;  5KZH A;  1SKF A;  3SS5 A;  4R70 A;  3T4K A;  2P7J A;  2IA2 A;  3FKV A;  1OME A;  5TFQ A;  2VX8 A;  4BBU A;  4HQA A;  5AQB A;  3UMD A;  2IWC A;  4DRT A;  3IH9 A;  2Y2L A;  5EUA A;  4GZB A;  1W7F A;  4HH2 A;  5G4Y A;  3UE1 A;  4ZBE A;  2FH5 A;  3MXS A;  4P6Z M;  2ZQA A;  2Y59 A;  3G31 A;  4RYE A;  4E6X A;  4EW7 A;  3F1O B;  1Y28 A;  1M40 A;  1N9L A;  4E3M A;  2H0T A;  3IXD A;  1OTB A;  3HLB A;  3UB5 P;  1Q2Q A;  2Y2K A;  4E04 A;  1PI4 A;  4EBL A;  3IH8 A;  4Y13 A;  3VFF A;  2XFT A;  3IXG A;  3RXW A;  2KLI A;  4S2K A;  2W1R A;  4OPQ A;  5DJU A;  5FSR A;  1M6K A;  4DDS A;  4OLG A;  2VV8 A;  1STZ A;  4X1M A;  1XFN A;  3SW1 A;  4GS9 A;  4B9O A;  1Z6F A;  3A0R A;  1GCE A;  3DTM A;  4JF4 A;  3FKW A;  2GX5 A;  5GLC A;  4BBV A;  2ZQ8 A;  4LRX C;  2I72 A;  5CED A;  1DJB A;  2FZ0 A;  2V0U A;  4FUW A;  2Y2J A;  4CLC E;  4WYY A;  2HJ9 C;  3DBA A;  2C6W B;  3NUL A;  5HDD A;  1VB6 A;  4HIA A;  4XXR A;  2W3H A;  3AGF A;  5HDC A;  2Y2Q A;  1UWP X;  3PBT A;  4F94 A;  2YKF A;  4Q0H A;  4HNB A;  4IVI A;  4R0Q A;  3UDX A;  4Y7P A;  2HF6 A;  4KZ4 A;  4S2N A;  4DKI A;  4DXC A;  1G6A A;  1I2S A;  1D1J A;  3OPR A;  2WAE A;  5FQM A;  4KZ6 A;  1EW0 A;  1FR1 A;  2VV6 A;  5J8X A;  2J3T D;  2XRN A;  2W0N A;  3B33 A;  2DCF A;  4O0P A;  2J7V A;  3V67 A;  1GHM A;  2W3D A;  4R1G A;  5FQJ A;  1OTD A;  5F6A A;  3BFF A;  4DE2 A;  1S1Z A;  5EVI D;  2EFU A;  1TVF A;  3IF6 B;  4Y0U A;  2PR6 A;  1S6R A;  1IEL A;  4E3N A;  2PDR A;  2VZW A;  3L7H A;  4IED A;  1BLH A;  5AVE A;  3LIE A;  3ISG A;  2DRW A;  1L0G A;  2BLS A;  1BT5 A;  3MS6 A;  1K55 A;  4KZ9 A;  1NYM A;  1WYB A;  1TDL A;  4BWI A;  2ZJ9 A;  4OOM A;  5HZH A;  1K6R A;  3C7V A;  4R38 A;  5L2F A;  5DTK A;  2Z6C A;  3T1X A;  1KDW A;  1JWP A;  3FV7 A;  4S2P A;  3IF5 A;  3QP8 A;  3MF0 A;  1LHY A;  3HCY A;  2Y91 A;  3MSH A;  4EES A;  1OPX A;  5L8M A;  4HBT A;  4B88 A;  1VQQ A;  4OON A;  3GDI A;  1HTZ A;  2QJ5 A;  4PKY G;  1FQG A;  3WS1 A;  1IEM A;  3O87 A;  2XR0 A;  3VMA A;  1XP4 A;  3PR6 A;  5FAT A;  2XEP A;  3Q07 A;  1GA0 A;  1LI0 A;  2O9B A;  3HJI A;  3BFD A;  1PW8 A;  1NZU A;  1ZKJ A;  4DE3 A;  2JKR I;  1QME A;  3A0S A;  1T18 A;  1TF1 A;  3NEC A;  4ARZ B;  2EX9 A;  3H82 A;  4HJ4 A;  1BLC A;  1IKI A;  1RCJ A;  2ZQD A;  4KG2 A;  4WEJ A;  1K38 A;  1Y4O A;  4GCZ A;  4P85 A;  1E4D A;  2WZX A;  4WZ4 A;  3LIF A;  2GJ3 A;  3IX8 A;  2VV7 A;  4G3K A;  5KSC A;  3OC2 A;  2K7S A;  4G3W A;  2EX8 A;  3C2W A;  4MBF A;  4MN5 A;  1MKI A;  4R4S A;  1S4R A;  2PBD P;  3C5A A;  1MPL A;  1FOF A;  5GL9 A;  1NY0 A;  2V2F F;  2W3G A;  5CEC A;  1Z09 A;  2CC1 A;  1K57 C;  2P9V B;  5EVL A;  3W4O A;  4H8R A;  1OTI A;  2O9C A;  3F1N A;  3LR5 A;  4MBH A;  4GDN A;  2HDQ A;  3Q7V A;  1K56 D;  4RVA A;  4HH3 A;  1LL8 A;  5EVE A;  3HLG A;  3E4Q A;  1YM1 A;  2EWV A;  2H28 A;  1XKZ A;  2ZL1 B;  2WKH A;  3C30 A;  2GNX A;  3LIA A;  4G3V A;  4K0W A;  3UB7 A;  3FWL A;  3KSF A;  1FR6 A;  3VOY A;  3F1P B;  3GRJ A;  4PPR A;  2PT7 A;  4NXE A;  2R9W A;  3WS2 A;  1YSP A;  3O3V A;  5A90 A;  1PI5 A;  1I2W A;  1ESU A;  3TJZ C;  4E3O A;  1BUE A;  1CEG A;  2X01 A;  2MJ6 A;  2ZMF A;  5BOH A;  3MQQ A;  3NI9 A;  1KDS A;  5JYP A;  4QD4 A;  1F98 A;  4GW9 A;  2ZOH A;  4BJP A;  5AQ9 A;  2KX6 A;  2A24 B;  1OT9 A;  2WKQ A;  1Q2P A;  4I39 A;  2JKT M;  4GHI A;  3IXH A;  3BFG A;  4Z1W A;  4UEY A;  1SHV A;  3E0Y A;  4HOI A;  3BRM A;  4MLL A;  5CGS A;  2ZM8 A;  3D9Y A;  1ERM A;  3A0V A;  2Y2P A;  4X6T A;  2XK1 A;  1D7E A;  3GR2 A;  1MC0 A;  1ODV A;  2WK0 A;  3CPT B;  4R3B A;  4HES A;  4LV3 A;  3A3D A;  2H5S A;  4K0X A;  1ES2 A;  1PWD A;  3FG8 A;  1VEU A;  3E98 A;  4PHT A;  2L4R A;  4OKP A;  2VGL M;  3D4F A;  3IBJ A;  4U0T A;  4FH4 A;  1KGE A;  3ZG8 B;  5F83 A;  5EFW A;  5FL3 A;  4I3I A;  1LL9 A;  1K56 A;  3OPP A;  2W1T B;  1SZV A;  1SKO B;  3RH8 B;  5HW3 A;  1OT6 A;  4M4X A;  4WZ5 A;  1H8M A;  3MZF A;  2JE5 A;  1XGI A;  2Y2H A;  4LRY C;  2PBY A;  2B95 A;  2BTF P;  2ZMV A;  5CGX A;  3OOV A;  4YFM A;  1P9W A;  5DTT A;  2KDK A;  3EEH A;  1JWV A;  4UA7 A;  4Q8I A;  2ZM2 A;  4DMZ A;  1K54 A;  3WWX A;  5E2G A;  2WZZ A;  2PYP A;  3VP3 A;  1W79 A;  2WKE A;  1FIK A;  1K4E A;  4MCW A;  4X69 A;  1XJ3 A;  2WUQ A;  1XJ2 A;  5U47 A;  2OAP 1;  4ZTK A;  3LEZ A;  3G30 A;  3E2L A;  2Q0O A;  5D3O A;  1XX2 A;  5K5B A;  3ITB A;  2ZM0 A;  2O0Y A;  4ESP A;  3LO7 A;  1P0Z A;  1SDE A;  3UNW A;  1MWR A;  3MFD A;  3PYP A;  1ERQ A;  2OSU A;  4IHQ A;  1TS0 A;  1XXM A;  3NCK A;  1BLP A;  3KSI A;  1JNU A;  1XFQ A;  3IX4 A;  4DE0 A;  1XPB A;  5E2H A;  3ZYT A;  1QMF A;  3MZD A;  2OLV A;  4PM7 A;  4AFI A;  3V3R A;  1H3Q A;  4KUO A;  1D06 A;  3MXR A;  5J3W A;  4MN7 A;  2RCX A;  3S7N A;  3N4I A;  3ZCZ A;  4C3Q A;  3VSL A;  3W8K A;  3MMH A;  4YIN A;  4JPM A;  3HUM A;  4UQI M;  4NET A;  5KSH A;  4GOG A;  1GSW A;  1L2S A;  3IHB A;  4LGW A;  4X1L A;  3WRZ A;  2Y2N A;  1YLT A;  3PBN A;  2UWX A;  5FI7 A;  4U0X A;  3K2N A;  3SZT A;  2EA9 A;  4LEN A;  5AQ7 A;  4X25 A;  3MKE A;  3WS0 A;  2QMI A;  2ZQC A;  4XT2 B;  2V8F A;  4BL3 A;  1MBL A;  3GVB A;  2HZ5 A;  1NLZ A;  3MQO A;  1GHI A;  2QZ6 A;  3SH7 A;  2KOI A;  1KE0 A;  1N9N A;  3FZC A;  1T1B A;  4KEN B;  5FQ9 A;  1MWU A;  1EWZ A;  2PR5 A;  3UB8 A;  1TS7 A;  4S2M A;  3O5Y A;  1SDN A;  3PHY A;  3QP6 A;  3RTY A;  4CLC A;  4KZB A;  2WYX A;  3K3C A;  5EVI B;  3IHA A;  1VHM A;  1G6O A;  3KX0 X;  2BG1 A;  2B18 A;  2ZD8 A;  3EEA A;  2WAF A;  1BSG A;  3BY9 A;  2ZQ7 A;  2D01 A;  3R4K A;  3A3F A;  3ICY A;  3MQ0 A;  3ZVT A;  3S7O A;  3T4L A;  4OPZ A;  5L10 A;  3VV4 A;  4S2N C;  5CRF A;  3Q81 A;  1W63 M;  4JXV A;  2XDM A;  3F1N B;  3DAV A;  4EQI A;  3Q7V B;  4FTX A;  4NXB A;  4Y2F A;  3BLM A;  5HAI A;  4P0M A;  2P08 A;  5DJT A;  4LV1 A;  5CTM A;  3A3I A;  1G68 A;  4P6B A;  3LUQ A;  4PM5 A;  4MBK A;  4ZAM A;  3VP0 A;  5TBM A;  3UO9 A;  3CUE A;  3TRC A;  4MDZ A;  4I38 A;  1ZG6 A;  3SH9 A;  4JGQ A;  4JXW A;  3A3J A;  2V9A A;  3IQA A;  4EXO A;  3NOU C;  2JKR M;  2OWH A;  4Y3I A;  2JN7 A;  3T1S A;  5AJG A;  4I3J A;  2V1Z A;  5HPF A;  3HLD A;  3KYZ A;  1NRJ A;  2QJ7 A;  2INW A;  1YLW A;  5GLA A;  4O8G A;  1K55 C;  3N6I A;  2AVX A;  2HPB A;  4OQG A;  4BD0 A;  4H6J B;  3IWI A;  5HX9 A;  4L9G A;  1KOU A;  2P74 A;  1O7E A;  4KG5 A;  4OQ0 A;  1N9O A;  1CEF A;  2XA7 S;  3MFX A;  4Y5F A;  4B4X A;  1NWZ A;  3RXX A;  3GQZ A;  4IBR A;  2VK3 A;  1V9Y A;  1ES4 A;  4F3L B;  1K25 A;  4EUZ A;  1JTD A;  3E4O A;  3R7W A;  4KQQ A;  1YLP A;  2D02 A;  2G7U A;  3ITA A;  4L9E A;  2WGW A;  3KO6 A;  3MZE A;  5MC7 A;  3S1Y A;  1CI8 A;  5KMW A;  2Y2O A;  5HAQ A;  4OH0 A;  4DJ3 A;  3UPN A;  4I5S A;  2XH9 A;  3LR4 A;  2J3T C;  4QHC A;  2HDU A;  1Y54 A;  5F69 A;  2XD1 A;  1IFQ A;  2K2N A;  3CIT A;  5DFY A;  3HLC A;  5CHM A;  3VP4 A;  2E8J A;  4ZJ1 A;  1ES3 A;  5FA7 A;  1IOU A;  1L0F A;  3VFH A;  3ZG7 B;  4BBT A;  5DFX A;  3QP5 A;  3DW0 A;  4MN6 A;  4C75 A;  5EVI C;  1T19 A;  3ZG9 B;  4UA6 A;  1FCM A;  1IKG A;  4JXG A;  3CMZ A;  4EET B;  3NDE A;  5EV0 A;  2XLN A;  1NXY A;  1L0E A;  2LB5 A;  1HD8 A;  2WKP A;  4DXB A;  3NHQ A;  1PNE A;  3F1O A;  4JLF A;  3N8S A;  1NYY A;  1YAX A;  2FFY A;  3PBS A;  2R9X A;  3EOI A;  3OZH A;  4ZRR A;  3H7W B;  3IS2 B;  1FCO A;  4EER A;  1MXO A;  4M3K A;  2K31 A;  5HD5 A;  2DNS A;  3LR0 A;  1H8Y A;  2PU2 A;  3NC8 A;  4UHU A;  1W5D A;  5TGF A;  3CG5 A;  4PM6 A;  3LY4 A;  1ACF A;  4WEL A;  1BUL A;  4R4R A;  3MXQ A;  4EV4 A;  4U3T A;  1BYW A;  3MJQ A;  3BM6 A;  1FCN A;  3Q1F A;  5F68 A;  3LYX A;  3B47 A;  5GHX A;  1ZC2 A;  4N92 A;  1LSW A;  2VEA A;  1C3B A;  3UE3 A;  3LGO A;  1W63 Q;  3WS5 A;  1PYY A;  3NOP C;  5HAP A;  2PAV P;  5F1G A;  2WGI A;  3A3E A;  2RL3 A;  3P09 A;  4IVK A;  4N1X A;  3C4P A;  2OAQ 1;  2WKR A;  4OLD A;  2JKG A;  1CQA A;  2VGL S;  2IWD A;  5CX7 A; 
#chains in the Genus database with same CATH homology
 3VP2 A;  1IYS A;  4S2K A;  3VP3 A;  1W79 A;  3IWQ A;  2WKE A;  4MNR A;  4PM9 A;  4OPQ A;  2FFF B;  1YQS A;  5FSR A;  5EPH A;  1M6K A;  1K4E A;  4DDS A;  4JXS A;  4OLG A;  4X56 A;  1K57 A;  3G2Y A;  3OCN A;  4NK3 A;  3ZNY A;  4X69 A;  5AQA A;  3ZFZ A;  3I7J A;  2WUQ A;  4ZJ2 A;  5U47 A;  3BFE A;  1Z6F A;  4ZTK A;  1GCE A;  1PWC A;  2ZQ9 A;  4EWF A;  3DTM A;  3LEZ A;  4JF4 A;  3G30 A;  3FKW A;  4ID4 A;  2Y4A A;  5GLC A;  3E2L A;  4OOY A;  4L0L A;  4LV2 A;  2ZQ8 A;  5D3O A;  1XX2 A;  5EOE A;  3QNC A;  1HZO A;  2I72 A;  5CED A;  1DJB A;  3M2J A;  3ITB A;  2Y2I A;  2ZM0 A;  5FAS A;  2Y2J A;  3PBO A;  4WYY A;  2C6W B;  2EX6 A;  3LO7 A;  1DJC A;  4K91 A;  3DWK A;  1SDE A;  3UNW A;  3TSG A;  5CGW A;  3BYD A;  4XXR A;  2XD5 A;  3HLF A;  3Q82 A;  3AGF A;  1MWR A;  3MFD A;  4MEZ A;  3S22 A;  1ERQ A;  2Y2Q A;  3PBT A;  4F94 A;  2OSU A;  3PTE A;  1J9M A;  5G18 A;  5A93 A;  1XXM A;  4BLM A;  3NCK A;  1BLP A;  4IVI A;  3IF6 A;  4DE0 A;  3UE0 A;  5FI2 A;  3BEC A;  4R0Q A;  3UDX A;  4QU3 A;  4Y7P A;  1XPB A;  5E2H A;  1MWT A;  5DVA A;  1QMF A;  1YMS A;  2V20 A;  3MZD A;  4KZ4 A;  3WRT A;  4S2N A;  2OLV A;  5EEC A;  4PM7 A;  4C6Y A;  3V3R A;  4WEK A;  1GHP A;  2ZC5 B;  1KE4 A;  5CXW A;  3SH8 A;  4DKI A;  4DXC A;  1G6A A;  3MXR A;  1I2S A;  3M6B A;  3OPR A;  2WAE A;  5FQM A;  2RCX A;  4KZ6 A;  5EOO A;  2JBF A;  3VP1 A;  4FH2 A;  3N4I A;  1S0W A;  1FR1 A;  3ZCZ A;  4C3Q A;  1WYC A;  3VSL A;  5J8X A;  1I5Q A;  3W8K A;  4KZ7 A;  4N9L A;  4YIN A;  4S2L A;  3GMW A;  4JPM A;  4E3I A;  1LI9 A;  2Y2G A;  3HUM A;  4NET A;  5KSH A;  1KE3 A;  4KQO A;  1K6S A;  2DCF A;  4GOG A;  3Q7Z A;  1L2S A;  5EVI A;  3IHB A;  1ES5 A;  2J7V A;  3O88 A;  4HEF A;  4IBX A;  2Y2N A;  1YLT A;  3UN7 A;  1FSY A;  3PBN A;  3WRZ A;  2PU4 A;  1FSW A;  4N9K A;  3ZHH A;  1NJ4 A;  2UWX A;  1GHM A;  4R1G A;  1O07 A;  5FI7 A;  5FQJ A;  4U0X A;  5FAQ A;  4DF6 A;  1W8Y A;  3BFF A;  2JCH A;  4LEN A;  2HP9 A;  1AXB A;  5AQ7 A;  4DE2 A;  4KZ8 A;  5EVI D;  3MKE A;  2EFU A;  3PBQ A;  2QMI A;  1RGZ A;  4GD6 A;  3UPP A;  1TVF A;  3IF6 B;  3WS0 A;  2ZQC A;  5IHV A;  4BL3 A;  4RA7 A;  4Y0U A;  1MBL A;  1S6R A;  3GVB A;  3HLW A;  1IEL A;  3G32 A;  4ZJ3 A;  5GLB A;  4E3N A;  5M19 A;  1GHI A;  2EXB A;  5FI6 A;  2QZ6 A;  3SH7 A;  4IED A;  1BLH A;  1BLS A;  1KE0 A;  3ISG A;  2DRW A;  3FZC A;  3UY6 A;  3B3X A;  1L0G A;  2BLS A;  3C7U A;  1BT5 A;  3LCE A;  1K55 A;  4KEN B;  5FAP A;  4KZ9 A;  1NYM A;  1JTG A;  1LL5 A;  1TDL A;  1WYB A;  3SS4 A;  3TOI A;  4D2O A;  2ZJ9 A;  1SCW A;  2OLU A;  4OOM A;  5FQ9 A;  1MWU A;  5HAR A;  1K6R A;  1EWZ A;  4GKU A;  5TR7 A;  3C7V A;  4OP5 A;  1ESI A;  4S2M A;  1CK3 A;  1YLZ A;  5L2F A;  1SDN A;  5GHY A;  4OQI A;  5DTK A;  1KDW A;  2X02 A;  1JWP A;  3V50 A;  3FV7 A;  4S2P A;  2J9P A;  3IF5 A;  3O86 A;  4KZB A;  2WYX A;  1LHY A;  3TG9 A;  5EVI B;  3IHA A;  2Y91 A;  3QHY A;  1W8Q A;  2BG1 A;  2Y55 A;  2ZD8 A;  1PW1 A;  4WBG A;  2WAF A;  1BSG A;  3HUO A;  4HBT A;  5M18 A;  4B88 A;  1VQQ A;  2ZQ7 A;  3IF6 C;  4JF5 A;  1KGF A;  3HLE A;  1HTZ A;  2XQZ A;  3A3F A;  4OON A;  4R23 A;  1FQG A;  3WS1 A;  3GV9 A;  1NRF A;  3ZVT A;  1E25 A;  1IEM A;  4OPZ A;  3O87 A;  4S2N C;  2XR0 A;  3VMA A;  3UPO A;  5CRF A;  1XP4 A;  4QB8 A;  5E2E A;  3Q81 A;  5FAT A;  4JXV A;  2XDM A;  2ZC4 B;  3V5M A;  3M6H A;  2XEP A;  1ONH A;  3Q07 A;  3G2Z A;  4EQI A;  1E3U D;  3Q7V B;  1MWS A;  1GA0 A;  1LI0 A;  1K4F A;  3BLM A;  5FAO A;  4CPK A;  2GDN A;  1KVL A;  4P0M A;  5HAI A;  3ZG0 A;  1JWZ A;  3BFD A;  4LV1 A;  2Y2M A;  1PW8 A;  1ONG A;  2H10 A;  3A3I A;  1NZU A;  1G68 A;  4P6B A;  5CTM A;  5FQQ A;  1ZKJ A;  3AGD A;  2WAD A;  4DE3 A;  4PM5 A;  1NZO A;  4MBK A;  4ZAM A;  1HVB A;  1QME A;  1ALQ A;  2P9V A;  3VP0 A;  4WZ5 C;  3UO9 A;  3SOI A;  5CHU A;  3SS3 A;  3WS4 A;  3FYZ A;  3IT9 A;  5CHJ A;  2X71 A;  4OVD A;  3LY3 A;  1DJA A;  3G35 A;  2EX2 A;  1ZG6 A;  4N1H A;  1N9B A;  3SH9 A;  5FQI A;  2VGJ A;  2EX9 A;  2OV5 A;  4JXW A;  4QY6 A;  1RGY A;  2ZC7 A;  3A3J A;  4Y0O A;  3IQA A;  2XFS A;  2JC7 A;  2ZMA A;  4BQM A;  3EQV A;  1IYQ A;  1PZO A;  1BLC A;  1N4O A;  1IKI A;  1MY8 A;  2Q9N A;  4O7D A;  5CTN A;  1RCJ A;  2V1Z A;  2ZQD A;  3HLD A;  5FQK A;  4KG2 A;  4WEJ A;  3V3S A;  1K38 A;  5A91 A;  1YLW A;  4P85 A;  5GLA A;  1E4D A;  2WZX A;  2Z2L B;  4WZ4 A;  1K55 C;  3N6I A;  2C5W B;  1YT4 A;  4LCL A;  1K54 C;  5M1A A;  4CJN A;  3OC2 A;  5KSC A;  2HPB A;  2EX8 A;  4OQG A;  4E6W A;  3W4P A;  4BD0 A;  1TDG A;  3IWI A;  4MBF A;  3VSK A;  1MKI A;  4R4S A;  5JYO A;  5GHZ A;  5HX9 A;  4E3L A;  5EE8 A;  3C5A A;  3OPH A;  4DDY A;  1MPL A;  1VM1 A;  1FOF A;  4XUZ A;  4KZ3 A;  2P74 A;  1KVM A;  1NY0 A;  2V2F F;  1LLB A;  5GL9 A;  5CEC A;  4JF6 A;  1O7E A;  2CC1 A;  4KG5 A;  1K57 C;  3E2K A;  2P9V B;  3HVF A;  5EVL A;  1CI9 A;  4H8R A;  1ERO A;  4OQ0 A;  3V39 A;  3W4O A;  1CEF A;  3BEB A;  3JYI A;  4X53 A;  4B4X A;  2Z2M B;  4MBH A;  3RXX A;  4GDN A;  4LCM A;  2HDQ A;  2H0Y A;  1GA9 A;  3GQZ A;  3Q7V A;  1K56 D;  3CZD A;  4IBR A;  3RJU A;  3UDF A;  1WE4 A;  4RVA A;  3N7W A;  1ES4 A;  4FD8 A;  1K25 A;  3EQU A;  3HLG A;  4EUZ A;  1JTD A;  1TEM A;  1YM1 A;  4KZ5 A;  3QNB A;  4XUX A;  5DF8 A;  4KQQ A;  4RX3 A;  1YLP A;  3OCL A;  1XKZ A;  3ITA A;  1KGG A;  2EXA A;  2WKH A;  3GSG A;  2IWB A;  3HBR A;  2WGW A;  2J8Y A;  4KZA A;  3NY4 A;  4QY5 A;  4R3J A;  4K0W A;  3W4Q A;  2G2W A;  3FWL A;  3MZE A;  4B4Z A;  1YLY A;  1FR6 A;  3HRE A;  3VOY A;  3S4X A;  2ZC3 B;  3GRJ A;  4PPR A;  4FCF A;  1DY6 A;  3PBR A;  4UAA A;  3HL9 A;  3P98 A;  1CI8 A;  4GB7 A;  4Z9Q A;  3S1Y A;  2ZC6 B;  2G2U A;  2Y2O A;  5KMW A;  4GNU A;  2R9W A;  4OQH A;  4P87 A;  3HUN A;  4JBF A;  2J9O A;  3WS2 A;  2XF3 A;  3ZNT A;  5HAQ A;  3O3V A;  3NDG A;  5CEB A;  4OH0 A;  5A90 A;  1PI5 A;  1I2W A;  1ESU A;  2Q9M A;  3UPN A;  2HDR A;  1E3U A;  2XH9 A;  4BL2 A;  1YMX A;  5A92 A;  4QHC A;  4E3O A;  3BFC A;  2HDU A;  4GD8 A;  1BUE A;  3DWZ A;  2E8I A;  1IYO A;  1CEG A;  2HDS A;  1Y54 A;  2X01 A;  1EI5 A;  3NBL A;  2XD1 A;  2EFX A;  5BOH A;  1XA1 A;  3NI9 A;  1KDS A;  5JYP A;  4WMC A;  2VGK A;  1U60 A;  4DE1 A;  4QD4 A;  3HLC A;  1BZA A;  5CHM A;  3C4O A;  3VP4 A;  4ZJ1 A;  1ES3 A;  5FA7 A;  5CER A;  1L0F A;  3VFH A;  3ZG7 B;  4BJP A;  4OPR A;  5AQ9 A;  3ZDJ A;  5DF7 A;  4QJG A;  1ZG4 A;  3DW0 A;  3IXB A;  3MBZ A;  4GDB A;  3OPL A;  4S2J A;  4C75 A;  4UA9 A;  5EVI C;  4ZDX A;  4WMC D;  2ZLY A;  1PWG A;  2WGW B;  4OP8 A;  4X55 A;  1Q2P A;  3ZG5 A;  3ZG9 B;  3IXH A;  5E2F A;  2A3U A;  4UA6 A;  1FCM A;  3BFG A;  5F82 A;  1IKG A;  4JXG A;  1SHV A;  3CMZ A;  4JKT A;  1PZP A;  3BRM A;  4MLL A;  4OPY A;  4RX2 A;  5CGS A;  2ZM8 A;  3NDE A;  1ERM A;  2XLN A;  2Y2P A;  3G34 A;  4X6T A;  2XK1 A;  4LV0 A;  4PMA A;  1JVJ A;  1NXY A;  3GR2 A;  4S2I A;  1L0E A;  2WK0 A;  1HD8 A;  1XGJ A;  5FDH A;  2WGV A;  3N8L A;  4A5R A;  3G4P A;  4HES A;  4R3B A;  3PAE A;  4LV3 A;  3A3D A;  4DXB A;  4HBU A;  2H5S A;  4GN2 A;  4K0X A;  3UDI A;  5HL1 A;  4EBP A;  1PIO A;  4JLF A;  1ES2 A;  1PWD A;  3N8S A;  3NIA A;  5I94 A;  1NYY A;  2FFY A;  2R9X A;  3OZH A;  3PBS A;  4PM8 A;  5F1F A;  1FCO A;  4OKP A;  3AGE A;  3ZGA B;  1MXO A;  4E3K A;  4X68 A;  4M3K A;  1XA7 A;  2XGN A;  3D4F A;  5KZH A;  1SKF A;  3SS5 A;  4U0T A;  4FH4 A;  4WM9 A;  2DNS A;  1H8Y A;  2PU2 A;  4Y0T A;  3MKF A;  3NC8 A;  4UHU A;  1W5D A;  5TGF A;  4KQR A;  3CG5 A;  4PM6 A;  1KGE A;  2WKI A;  1OME A;  3FKV A;  5F83 A;  4KG6 A;  3ZG8 B;  5TFQ A;  3LY4 A;  1RP5 A;  1LL9 A;  1K56 A;  3OPP A;  4S2O A;  5DTS A;  5AQB A;  5GLD A;  4WEL A;  1BUL A;  3BLS A;  5HW3 A;  4R4R A;  2IWC A;  1IYP A;  4DRT A;  4EV4 A;  4WZ5 A;  3MZF A;  3IH9 A;  2Y2L A;  4U3T A;  2JE5 A;  1XGI A;  5EUA A;  3PAG A;  2Y2H A;  3BM6 A;  1FCN A;  4GZB A;  2A49 A;  3Q1F A;  1W7F A;  2PBY A;  3N8R A;  3VOZ A;  3UE1 A;  4ZBE A;  4EBN A;  5E43 A;  4BD1 A;  2HP5 A;  5GHX A;  1YLJ A;  1ZC2 A;  3MXS A;  2ZQA A;  4N92 A;  2Y59 A;  4OOL A;  3G31 A;  5CGX A;  4YFM A;  5DTT A;  1BTL A;  1C3B A;  3UE3 A;  4RYE A;  4E6X A;  5DF9 A;  3WS5 A;  2QPN A;  1PYY A;  5HFO A;  5HAP A;  3ZVW A;  4BEN A;  1H8Z A;  1M40 A;  5F1G A;  4E3M A;  1JWV A;  2WGI A;  4UA7 A;  3A3E A;  2RL3 A;  3P09 A;  2HP6 A;  2B5R A;  3GTC A;  4Q8I A;  4IVK A;  2H0T A;  1H5X A;  1L0D A;  3IXD A;  4N1X A;  3C4P A;  3HLB A;  4OLD A;  2ZM2 A;  1Q2Q A;  2Y2K A;  1K54 A;  1PI4 A;  3WWX A;  4EBL A;  3IH8 A;  3M2K A;  3CJM A;  2IWD A;  4FSF A;  5E2G A;  3VFF A;  4E3J A;  2XFT A;  3IXG A;  3IWO A;  3RXW A;  2WZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...