4UA7A

Ctx-m-14 class a beta-lactamase in complex with a non-covalent inhibitor at sub-angstrom resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
ETSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-Induced Proton Transfer and Low-Barrier Hydrogen Bond Revealed by X-ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase CTX-M-14
total genus 96
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ua7A00
1IYQA 5HFOA 4N92A 2Y2MA 4QY5A 5HAQA 1BLSA 2B5RA 3HLDA 3V39A 3VOZA 3ZCZA 3G4PA 3S4XA 3S1YA 1E3UD 1M6KA 3HLBA 1CK3A 1K55C 5EOEA 3TOIA 3LCEA 1YM1A 1PI5A 1YT4A 1EWZA 4JKTA 5FQKA 1XGIA 4BJPA 2HP5A 3ZG5A 5E43A 5F83A 2QMIA 4U0XA 3IQAA 3N8SA 4X53A 2IWDA 3CMZA 4GDNA 4IVKA 5CRFA 2PU4A 3UE0A 3GQZA 3PAGA 1ESIA 1H8YA 4KQRA 4UA6A 3SS4A 4D2OA 4P85A 1BLCA 4KZ5A 3IXGA 1L0GA 1HZOA 3RXXA 4R0QA 4KENB 5CHJA 3IF6B 3M2JA 3ISGA 4BL2A 1QMEA 4S2IA 4K91A 4DE0A 2X01A 1RGYA 4GKUA 4EBNA 4S2JA 3DWZA 2Q9NA 1EROA 4WMCD 2JBFA 3VSLA 2PU2A 4Y0OA 3C4PA 1E4DA 1K57C 3DW0A 3M2KA 4OONA 2J7VA 2V20A 4H8RA 2G2UA 2R9XA 2Z2LB 3MXRA 5KMWA 2A3UA 3G2YA 5GHZA 3SH8A 4PM7A 5JYOA 1HTZA 2WGVA 1LL9A 1Q2PA 2DNSA 2P9VB 4GB7A 4OLDA 4Z9QA 2VGJA 4ZTKA 3OCNA 1ONGA 2ZQCA 3ZVWA 3A3FA 3HVFA 3IH8A 4B88A 5TR7A 3LO7A 1CEFA 3BFCA 3MZEA 4Y0UA 5E2FA 3SS3A 1KGEA 5GHXA 4MEZA 5U47A 2XLNA 2OV5A 4U3TA 2XD1A 1MWSA 2ZM2A 3IHAA 3VFFA 2Y91A 3V3RA 1ERQA 1ALQA 3HLCA 4KZ4A 4UA9A 4WYYA 2FFYA 1XXMA 4XXRA 2I72A 4S2NA 5L2FA 3WRZA 1FCNA 1PW1A 2OSUA 1BLPA 2EX8A 1MKIA 4FH2A 4OPRA 4N1XA 4YINA 3V5MA 3ZG9B 2WAFA 5HAPA 3TG9A 2ZM8A 1XGJA 3NIAA 4WMCA 3IXDA 4MLLA 4PM9A 4P6BA 3UPPA 1C3BA 5M1AA 1RGZA 1NZOA 1W5DA 2WGWB 5I94A 2ZM0A 1ERMA 3Q1FA 5JYPA 5GHYA 4EUZA 4WM9A 2E8IA 3BLSA 4Y7PA 3VP3A 3V3SA 5A93A 3MZFA 1PYYA 5HW3A 5KSHA 3QNCA 5DVAA 3HLGA 4Q8IA 3AGFA 1DJCA 4F94A 2X02A 4S2PA 5E2EA 4LV2A 4DF6A 3SS5A 1LHYA 1K56A 4IEDA 3WS2A 5A92A 5E2GA 3V50A 5FA7A 5HL1A 1EI5A 2ZLYA 5IHVA 1IKIA 3IXHA 4GN2A 4ZJ2A 4O7DA 4DXBA 3LY3A 3O86A 5GLCA 4L0LA 2WKEA 1S6RA 2ZQ9A 3A3EA 5EUAA 2ZQDA 4JLFA 4JXWA 4BD1A 4OKPA 1GHPA 1KE0A 1AXBA 3MXSA 5AQ7A 4IBRA 4E3JA 3BFFA 3CZDA 4KZ6A 5CHUA 4MBFA 5EECA 1FCOA 4BQMA 1XX2A 1BTLA 2J8YA 3G2ZA 4RYEA 4JXSA 4HBUA 1VQQA 1KVMA 4JF4A 3W8KA 2WZZA 4WZ5C 3G34A 4CJNA 4OOMA 3WWXA 1MWTA 2JCHA 3UY6A 2QZ6A 2WUQA 2ZC3B 5A91A 3WS5A 2Y59A 3C7UA 4OOYA 2XGNA 3M6HA 4OOLA 1BLHA 2HPBA 2GDNA 5CTMA 4S2LA 4S2KA 1WE4A 4EBPA 4JXVA 3VP4A 3N7WA 4ZBEA 3PAEA 4X56A 5FASA 3OPLA 2IWCA 3JYIA 3M6BA 5GLAA 3IH9A 5A90A 4FH4A 2RL3A 4ZDXA 2BG1A 2ZC6B 1BULA 1BUEA 2XEPA 3VP1A 1IYSA 5DF7A 4ZJ1A 1L0EA 1RCJA 1MBLA 2J9OA 3GSGA 3NCKA 3PBSA 1YQSA 2V1ZA 4LCLA 4QHCA 3W4QA 4E3OA 2C5WB 1K25A 4KZ7A 1K4FA 1WYBA 4WBGA 5CGXA 1G68A 1ZKJA 2HP6A 1RP5A 2A49A 3CJMA 5FI7A 1O07A 2WZXA 2P9VA 1OMEA 3O88A 4GNUA 3UE1A 2ZC7A 4UHUA 4X6TA 5CERA 3GVBA 3E2KA 1W8QA 3B3XA 4EQIA 3ZNYA 1E3UA 4JBFA 3AGEA 5F1FA 1JVJA 1KGFA 3UDIA 5TFQA 1PI4A 3UNWA 3W4PA 3WS0A 3UPOA 3WS1A 1O7EA 3Q7ZA 5TGFA 2ZQ7A 5KSCA 5AQBA 5EVIC 4R4RA 4X69A 2FFFB 3PBQA 4XUZA 3SH9A 3FV7A 3RJUA 4C3QA 3EQVA 1SHVA 3UE3A 4C75A 4B4XA 1K4EA 1JWZA 1IELA 2EX6A 2Y2NA 2Y2IA 3MKFA 3OPRA 5GL9A 5HAIA 3HUMA 2ZQ8A 4GZBA 3QNBA 5EVIA 3C7VA 2C6WB 3UDXA 3O3VA 1NRFA 1ZG6A 5DTKA 4UAAA 3OPPA 5FI6A 5FDHA 2EXBA 3HUOA 4OVDA 4KQOA 3VP0A 1GA9A 3BFDA 2EFUA 3FYZA 2XF3A 2WADA 4E3LA 1I2WA 2DCFA 2XQZA 4CPKA 4QY6A 4GD6A 1CEGA 1CI8A 1XP4A 1K6SA 4HESA 4B4ZA 2ZJ9A 1YLWA 4PM6A 3Q81A 5CEBA 1W7FA 4BD0A 2Y2LA 4KG6A 1MY8A 3BFEA 3NBLA 4ID4A 2H0TA 1JWVA 3O87A 4JF6A 3PBNA 4XUXA 3UN7A 3WS4A 4KZ8A 2PBYA 1BZAA 3I7JA 3GR2A 4BENA 1ZC2A 4KZBA 1K55A 4R3JA 2WYXA 5DF9A 5EE8A 3C5AA 3UDFA 1SCWA 3LY4A 3ITAA 1NYMA 4MBHA 1FOFA 2XR0A 1XPBA 4NETA 5J8XA 1L0FA 4LV0A 4JPMA 4RVAA 1YMXA 3ZFZA 3GV9A 3CG5A 1NJ4A 1IYPA 1W8YA 4OLGA 4DE1A 3NC8A 2H0YA 1MWUA 4X68A 4R3BA 3IWQA 2OLVA 1TDGA 2QPNA 4HBTA 1FSWA 3PBTA 3NY4A 1H8ZA 4QB8A 4QJGA 3NDGA 1VM1A 5CXWA 4UA7A 4GDBA 1JTGA 4DE2A 3ZHHA 3VFHA 4PMAA 1YLJA 4QU3A 1LI9A 4KG2A 4E3IA 2CC1A 3MKEA 3BFGA 5HX9A 1GHIA 4P87A 4A5RA 3ZGAB 5AQ9A 3VOYA 3IHBA 3A3JA 1BSGA 3ZVTA 4KG5A 3RXWA 4PM8A 1TDLA 1FCMA 4E6XA 5FQJA 2HDUA 2R9WA 3HL9A 4LENA 4E3NA 3BEBA 1ES2A 1ONHA 1FR6A 1YLPA 1YMSA 4OP8A 2Y2JA 4GD8A 1GA0A 4KQQA 1NY0A 4S2NC 5EOOA 2H5SA 5GLBA 3D4FA 2XD5A 3Q07A 4FSFA 2IWBA 1BT5A 5CEDA 2G2WA 1TVFA 2XK1A 3P09A 1XA1A 3LEZA 2HP9A 1LI0A 3IXBA 4M3KA 3IF5A 4IBXA 4FCFA 3N4IA 5BOHA 5F82A 2WKIA 3N8LA 2XH9A 3N8RA 1DJBA 2X71A 4R4SA 5CGWA 3DWKA 5G18A 2ZMAA 3GRJA 1FSYA 4MBKA 1K54C 5FQ9A 4BLMA 5E2HA 2HDSA 3PBOA 3ZG8B 4EWFA 4IVIA 4WEKA 1PW8A 2BLSA 3HUNA 5M19A 3NDEA 3BLMA 4ZJ3A 4Y0TA 3VMAA 3FKWA 4P0MA 4WELA 3S22A 2OLUA 1JWPA 1NYYA 1Y54A 5EVLA 1K57A 4N1HA 4R1GA 4C6YA 4DXCA 3ITBA 5AQAA 4DDSA 4N9LA 2EFXA 4LV1A 1SDNA 5FQQA 5CTNA 1CI9A 3FZCA 3IWOA 3IF6C 4OQ0A 3SH7A 3ZDJA 3HLWA 2Y4AA 3UPNA 4E3MA 5EPHA 3VSKA 4PM5A 5EVIB 1IYOA 2H10A 2Y2PA 5EVID 4K0XA 1DJAA 2UWXA 2WKHA 2Z2MB 3PBRA 2JE5A 4OQIA 1SKFA 3SOIA 1NXYA 4JXGA 4S2MA 1ES5A 5FQMA 5FSRA 3IWIA 3P98A 4FD8A 2ZC5B 1Q2QA 4OPQA 1KE4A 3HLEA 2J9PA 5FI2A 1N4OA 1WYCA 5HARA 5CGSA 1K56D 2HDRA 3E2LA 2ZC4B 4QD4A 4PPRA 4LV3A 1ESUA 4YFMA 2EX9A 5DF8A 1KGGA 1PWDA 1TEMA 4E6WA 4E3KA 4GOGA 1H5XA 3IF6A 5FQIA 1MXOA 1I5QA 3OPHA 3UO9A 1GHMA 3MZDA 2Y2KA 4DDYA 4DRTA 3WRTA 3ZNTA 1PZOA 1JTDA 2RCXA 3TSGA 4K0WA 1L0DA 3BRMA 2XFTA 4KZ3A 3W4OA 3FWLA 1PIOA 3G31A 2Q9MA 1KVLA 3BM6A 4OQHA 5M18A 1PWCA 4R23A 2WGIA 3G35A 5FAOA 1MWRA 1K54A 4BL3A 5FAQA 2Y2HA 1LLBA 1N9BA 3N6IA 1ES3A 1FQGA 4ZAMA 1U60A 4WEJA 5FAPA 3C4OA 2WK0A 4LCMA 5FATA 2EX2A 1LL5A 3A3IA 1KDWA 5DTTA 1HVBA 3G30A 5CHMA 1J9MA 1KE3A 5GLDA 2HDQA 3AGDA 4WZ5A 2XDMA 1YLTA 3BYDA 4OPYA 1S0WA 1FR1A 2VGKA 4JF5A 4OH0A 4OPZA 4RX2A 4WZ4A 1K38A 3IT9A 3VP2A 3PTEA 3MBZA 4EBLA 5KZHA 1YLZA 4S2OA 4KZ9A 4RX3A 3HREA 3G32A 3OCLA 1IKGA 3ZG0A 1ZG4A 1Z6FA 4U0TA 1QMFA 1XA7A 2V2FF 1M40A 3EQUA 3DTMA 3GTCA 2Y2OA 4OQGA 3BECA 3NI9A 1L2SA 3GMWA 4X55A 2ZD8A 3Q7VA 3Q7VB 5DTSA 2ZQAA 2WGWA 3ZG7B 2XFSA 2Y2GA 1ES4A 1I2SA 2EXAA 1IEMA 3HBRA 3OC2A 1SDEA 3Q82A 1XKZA 3HLFA 4OP5A 1PZPA 1K6RA 4KZAA 1KDSA 4N9KA 4HEFA 3OZHA 1PWGA 2Y55A 1W79A 1DY6A 1E25A 4EV4A 4MNRA 1G6AA 2JC7A 3MFDA 1YLYA 5CECA 2WAEA 1MPLA 4RA7A 1HD8A 4DE3A 1NZUA 5D3OA 3A3DA 2DRWA 4NK3A 2P74A 2Y2QA 3QHYA 1GCEA 4DKIA 5F1GA 3FKVA
chains in the Genus database with same CATH superfamily
4HIAA 4QY5A 1BLSA 2B5RA 3ZCZA 3V39A 4FTXA 1IFQA 3S4XA 3S1YA 3HLBA 2HJ9C 1K55C 3TOIA 1S1ZA 2VX8A 3ZG5A 5F83A 2QMIA 4X1MA 4IVKA 3F1PB 3UE0A 4B93A 3GQZA 1H0MA 4X1LA 3RFBA 3SS4A 4P85A 1BLCA 1L0GA 5CHJA 3IF6B 3M2JA 1QMEA 4S2IA 4DE0A 1RGYA 4GKUA 4HI4A 4S2JA 4EBNA 2Q9NA 3ZQ5A 2JBFA 2PU2A 4Y0OA 3C4PA 1K57C 3DW0A 2J7VA 2OAQ1 2R78A 4PKYG 2A3UA 1HTZA 1LL9A 2I9VA 2DNSA 2WGVA 4OLDA 1ONGA 1TF1A 4O8GA 3IH8A 4B88A 3P01A 3VV4A 3FPVA 3E4PA 5HL6A 5E2FA 2HF6A 2XLNA 2OV5A 1XFNA 4JGPA 4U3TA 2XD1A 4KQDA 5IU1A 5KIZA 4KZ4A 3PXPA 2VGLM 3VE4A 2AVXA 2I72A 4S2NA 3WRZA 2KDKA 4GS9B 4FH2A 4OPRA 2WAFA 3NIAA 4NXFA 4G3VA 1RGZA 3IS2B 5TBMB 3CPTA 2D02A 4MN5A 5IT5A 2VK3A 4EUZA 1DP8A 2E8IA 3VP3A 3V3SA 3QNCA 3SW1A 5DVAA 3AGFA 1UWNX 3DTIA 4S2PA 3LIEA 1K56A 3QP2A 5HL1A 4YWZA 1OJGA 3JVUA 1P9WA 5GLCA 2WKEA 1LL8A 2ZQDA 4JLFA 1V9ZA 1UGUA 2K2NA 4IBRA 3F1OB 2JKTI 3NOPC 3T1SA 4BQMA 5MC7A 2J8YA 3OOVA 4JXSA 2PD7A 4UQIM 4HBUA 3QP5A 1VQQA 1KVMA 3QP4A 4II7A 2JCHA 3WS5A 4FOFA 4OOLA 1BLHA 2LB5A 2HPBA 3NJAA 5LBRA 4EBPA 1ACFA 3UB6A 1Z09A 3VP4A 5FASA 3OPLA 4ARZA 5A90A 2RL3A 4ZDXA 2QYBA 1BUEA 5DF7A 1L0EA 2J9OA 3GSGA 1S67L 1YQSA 2V1ZA 1K4FA 4WBGA 2HP6A 1RP5A 2PD8A 1OMEA 3HCYA 3GVBA 3IX8A 4R70A 4EQIA 5F1FA 1X0OA 1JVJA 1KGFA 4NXGA 1PI4A 3UNWA 5I5LA 5KSCA 2GZAA 5AQBA 4R4RA 3MQ0A 3PBQA 2EWWA 3C38A 3SH9A 3MQQA 1SHVA 4B4XA 1JWZA 3HUMA 1YAXA 2C6WB 1BYWA 3KYEA 5DTKA 4UAAA 3OPPA 4KQOA 3VP0A 4WN5A 3UB8A 1I2WA 2DCFA 1VB6A 3UMDA 2ZJ9A 1YLWA 4PM6A 3Q81A 5CEBA 2H28A 4KG6A 3LGOA 3NBLA 4JF6A 1JWVA 3O87A 3PBNA 4XUXA 1D06A 2PBYA 3GR2A 2O9BA 1VETA 4HP9A 3LY4A 3GDIA 4MBHA 1FOFA 2XR0A 4LV0A 4RVAA 3T4KA 3ZYTA 2VZWA 3GV9A 1F5MA 1NJ4A 2HZ5A 1IYPA 1LSVA 4OLGA 3NC8A 4Y5FA 2H0YA 4HNBA 2OLVA 4HBTA 1FSWA 3BY8A 4E04A 3IX4A 3NDGA 5CXWA 3ZHHA 3NECA 4E3IA 2CC1A 2ZBBA 3BFGA 5HX9A 3VOYA 1BSGA 4NKPA 4E6XA 2HDUA 4PHTA 3HL9A 2W3FA 4LRZE 4DE2A 5EOOA 2XD5A 3Q07A 4FSFA 3LR5A 2XK1A 2E8JA 1LI0A 4M3KA 3B33A 2BASA 3IF5A 4FCFA 3N4IA 4CLCE 4Q0IA 2XH9A 5CGWA 1TS8A 1Y28A 4BLMA 2HDSA 5FEGA 4WEKA 1PW8A 2BLSA 4WL9A 3S22A 4R1GA 4DDSA 2EFXA 1SDNA 5FQQA 5CTNA 2L4RA 3SH7A 4E3MA 5EVIB 1IYOA 2Y2PA 4K0XA 1DJAA 2UWXA 2Z2MB 3PBRA 2VA0A 1H3QA 4JGQA 1ES5A 5FSRA 1KE4A 3HLEA 1K56D 4YFMA 3L9KA 1KGGA 1S4SA 1PWDA 4E3KA 4GOGA 3K3CA 1AWIA 1I5QA 3UO9A 2PHYA 2Y2KA 3WRTA 3S7OA 4K0WA 1L0DA 4KZ3A 3G31A 3V67A 5FAQA 1LLBA 4EETB 1U60A 2V1AA 3A3IA 5CHMA 4WZ5A 4RX2A 1S66L 3BYDA 2VGKA 4OPYA 4WZ4A 2KX6A 4PKYA 3MBZA 4RQ9A 4KZ9A 4MMNA 5G4YA 4U0TA 2B18A 2W3HA 3OC2A 4OP5A 3HLFA 4LGWA 2YKFA 5F5YA 2Y55A 1DY6A 3IBRA 3MFDA 2JN7A 2WAEA 4RA7A 1HD8A 4DE3A 3NOTC 3A0VA 3EGXC 4G3WA 2Y2QA 5HFOA 4N92A 2Y2MA 5HAQA 3F1PA 3HLDA 4LLOB 2Q0OA 2VV8A 2GX5A 3KYZA 5DJTA 3G4PA 4Y17A 4KUOA 4DN0A 1MC0A 3LCEA 1YM1A 3T12B 1XGIA 4BJPA 2HP5A 4U0XA 3KSIA 4DMZA 4X53A 3CMZA 1ESIA 1H8YA 2QJ7A 4MN6A 4KZ5A 4F3LA 3IXGA 3RXXA 4R0QA 4BBTA 2X01A 4WMCD 2MJ6A 2V20A 2G2UA 2R9XA 5KMWA 3SH8A 4PM7A 1Q2PA 3FC7A 4HP4A 4Z9QA 4IJGA 2VGJA 3OCNA 3T4QA 1CEFA 5GHXA 4BMWA 3EWKA 1MWSA 3VFFA 2Y91A 2ZL1B 4UA9A 4WYYA 2FFYA 2HV1A 1FCNA 3DTEA 2YKHA 3LR0A 4DJ3A 4ME4A 1XGJA 4WMCA 1NZOA 3U2AA 2ZM0A 4KUKA 3FPWA 1J3WA 3F1NB 5KSHA 1OTIA 3HLGA 3F1OA 4P6ZS 3C2WA 2W3DA 2X02A 1D7EA 4DF6A 4IEDA 3WS2A 2D01A 5IHVA 2M1CA 1VEUB 5EUAA 2ACGA 2J3TD 2JKRM 1GHPA 1KE0A 1AXBA 3MXSA 4O01A 4E3JA 3BJNA 3CZDA 5CHUA 1LSWA 4GLQA 5EECA 4GW9A 1XX2A 5HZHA 4IHQA 1YSQA 1YSPA 3LUQA 2W1RA 3W8KA 4WZ5C 3G34A 4OOMA 2WUQA 2Y59A 5CTMA 1WE4A 3MR0A 4ZBEA 4ZRRA 2IWCA 2BG1A 1G6OA 2XEPA 3VP1A 4BBUA 1SZVA 2G7UA 3NCKA 4QHCA 4E3OA 1ZKJA 2A49A 3CJMA 2WKQA 3O88A 2HJEA 2PT7A 3E2KA 3ZNYA 1E3UA 2FZ0A 3UDIA 3D3OA 1W63M 1NWZA 3W4PA 3R7WB 3A0SA 3WS1A 2W27A 2XSSA 2PRFA 2ZQ7A 1SKOB 2B95A 2A24B 5DKKA 3QP1A 1LSXA 3FV7A 2XROA 1IELA 2Y2IA 2W1TB 1GSWA 4GZBA 2ZQ8A 2O99A 1ZG6A 5FI6A 5FDHA 2EXBA 3BQAA 2EFUA 4R38A 4HOIA 1CEGA 1P9RA 3TW8A 4B4ZA 2HGVA 5DFYA 5G4ZA 3VE3A 2H0TA 3UN7A 3LR4A 1ZC2A 3A0RA 2WYXA 5EE8A 1SCWA 3LIBA 3ITAA 1XPBA 2PYPA 1YMXA 1W8YA 1N9LA 4R3BA 3NY4A 4QB8A 4QJGA 4UA7A 4PMAA 3T4TA 2BTFP 4KG2A 1XFQA 3H7WA 1GHIA 4P87A 3K2NA 3A3JA 2ZOHA 2EA9A 1XJ2A 5FQJA 2R9WA 2OAP1 4LENA 3BEBA 4Y3IA 1OTDA 1ONHA 1FR6A 1YLPA 1YMSA 3K3DA 5EFWA 1JNUA 2Y2JA 1NY0A 4S2NC 3D4FA 4UQIS 2IWBA 4K08A 5CEDA 2G2WA 1TVFA 1OTEA 4HQAA 4NEED 2JKFA 4IBXA 4UEYA 2WKIA 5EV0A 3N8RA 5G18A 1MZUA 4MBKA 5FQ9A 5E2HA 2ZMFA 1NRJA 5M19A 2Z6DA 3NDEA 4ZJ3A 1NYYA 5EVLA 1K57A 5AQAA 3T50A 3EEHA 4N9LA 3UB9A 2JKTM 2XA7M 5J3WA 2O9CA 3ZDJA 3HLWA 2Y4AA 3KYQA 4PM5A 3VSKA 3H82A 5EVID 2W1TA 1SKFA 4EXOA 5DFXA 3P98A 5IS1A 5EM0A 2V8CA 2ZC5B 1Q2QA 4FD8A 4OPQA 1N4OA 1WYCA 2HDRA 2ZC4B 2EX9A 3B42A 1H5XA 1GHMA 1PZOA 3TSGA 3MFXA 3BRMA 2JKGA 2XFTA 1PIOA 1KVLA 4OQHA 1PWCA 1N9BA 4ZAMA 4WEJA 5FAPA 3CUEA 1LL5A 1KDWA 3TE8A 1HVBA 3UMEA 1J9MA 2HDQA 3AGDA 5HWTA 1YLTA 1FR1A 1K38A 4S2OA 3G32A 3OCLA 1IKGA 1ZG4A 1QMFA 2V2FF 3GECA 2Y2OA 4OQGA 4X55A 2ZD8A 2ZQAA 2Y2GA 2EXAA 1IEMA 3Q82A 4AFIA 2OWJA 3OZHA 5J7EA 1G6AA 1YLYA 4P6ZM 2P74A 4CQHA 4EW7A 2FH5A 1W63Q 4XT2A 1TD5A 4Y13A 4I3IA 1E3UD 3L7HA 1CK3A 5EOEA 3CUEC 4JKTA 1YT4A 5FQKA 3N8SA 4PAUA 2PU4A 3PAGA 3LI8A 4KQRA 4D2OA 1HZOA 4BL2A 4I39A 3ISGA 1F9IA 5HDSA 3EEAA 4K91A 1DP9A 5FDSA 1EROA 5HPFA 2Z2LB 3MXRA 3G2YA 2W3EA 4GB7A 2P9VB 4ZTKA 5TR7A 3BFCA 3MZEA 1KGEA 4CLCA 4MEZA 5U47A 4ETZA 1T1BA 2PDRA 4CLCC 3IHAA 3V3RA 1ALQA 3HLCA 3UB5P 1XXMA 4XXRA 4QPRA 4N1XA 4YINA 3TG9A 2L0WA 3BWLA 4HH2A 3IXDA 4MLLA 4I3JA 1ERMA 3Q1FA 5JYPA 5GHYA 3BLSA 1OT9A 4Y7PA 5A93A 3MZFA 1PYYA 1NLZA 4Q8IA 1DJCA 1EW0A 3MSHA 4F94A 5E2EA 4LV2A 3UB7A 3V50A 5FA7A 3G6OA 2QKPA 2ZLYA 3EOIA 3MJQA 3IXHA 4GN2A 4ZJ2A 3O86A 2WKPA 1S6RA 5AJGA 4JXWA 4BD1A 4OKPA 3KSGA 5AQ7A 3TRCA 1FCOA 1PRQA 4RYEA 5AVEA 2VV7A 4JF4A 2WZZA 4BBVA 2P08A 3UY6A 2ZC3B 2J80A 3C30A 3H9WA 4GS9A 3C7UA 2XGNA 4Y15A 3ULFA 5DJUA 4S2LA 5HWWA 4Q0HA 4JXVA 4L9FA 3N7WA 3PAEA 1KOUA 5GLAA 2J3WA 4FH4A 3SZTA 2ZC6B 1BULA 1IYSA 3T4LA 1RCJA 3PBSA 4LCLA 3W4QA 1N9OA 1K25A 3R7WA 4KZ7A 5CGXA 3IBJA 1S1YA 1ODVA 1O07A 4Q0JA 4NXEA 2P9VA 4GNUA 3UE1A 4X6TA 4UHUA 4GHIA 1W8QA 2IA2A 3B3XA 4JBFA 5F69A 3AGEA 3LIAA 2K31A 2ZL1A 5TFQA 5L07A 1T1AA 3WS0A 3UPOA 1TS0A 3CAXA 1YPRA 1PNEA 2KOIA 4X69A 4D60A 3MXQA 1VEUA 4XUZA 3RJUA 3TJZC 2V0WA 4WF0A 3EQVA 4C75A 3CI6A 5L8MA 3BQ8A 5F6AA 2EX6A 2Y2NA 5GL9A 3MKFA 5HAIA 3QNBA 4LPZA 3C7VA 1NRFA 3EGDC 2QJ5A 3HUOA 4OVDA 1G5UA 2PR6A 3BFDA 3FYZA 1F2KA 2XQZA 4CPKA 4QY6A 4GD6A 1CI8A 2XRNA 3OBFA 3T4JA 1W7FA 1TS6A 3BY9A 4CLCD 4BD0A 4ARZB 4KZ8A 3I7JA 4BENA 4KZBA 1K55A 4R3JA 5DF9A 3C5AA 3BW6A 3T1XA 4NETA 1OJ5A 3LYXA 3ZFZA 3CG5A 3MQOA 1TDGA 2QPNA 4HY8A 1Y4OA 1H8ZA 1VM1A 4B9OA 4GDBA 2OWHA 4FUWA 3VFHA 4LRYC 4NXBA 3MKEA 4BWIA 5HDCA 4GHIB 2EWVA 3IS2A 5TBMA 3ZVTA 2WKRA 3QP8A 4KG5A 4PM8A 1FCMA 2UV0E 1GSXA 4E3NA 1ES2A 4OP8A 1GA0A 5GLBA 4EESA 1CJFA 3UE6A 1BT5A 2VKSA 3R4KA 3LEZA 1OTBA 5BOHA 5F82A 2X71A 4R4SA 2O9AA 2ZMAA 3P7NA 3PBOA 3ZG8B 3KX0X 3CLOA 3BLMA 5C5KA 4Y0TA 3VMAA 4P0MA 2L1MA 2K7SA 1JWPA 1Y54A 4HJ4A 4ESPA 2PBDP 4N1HA 4DXCA 1F98A 2VJWA 1V9YA 2QHKA 4EUVA 2NUPC 4H6JB 4R3AA 5FQMA 2M7UA 2J9PA 2A2LA 1G28A 3E2LA 1TEMA 4E6WA 3IF6A 4DRTA 3MZDA 3ZNTA 3W4OA 5L09A 3BM6A 4R23A 2WGIA 5FAOA 4MDZA 1K54A 3N6IA 1ES3A 1FQGA 1WA9A 3C4OA 2WK0A 1XJ4A 4WLAA 5DTTA 3G30A 1KE3A 4XT2B 1S0WA 4OH0A 4HJ6A 2VGLS 5KZHA 4RX3A 4EEPA 3HREA 5EVEA 3E98A 4R6LA 5K5BA 2M7VA 1H8MA 2P04A 3ZG0A 1P97A 3EQUA 1XJ3A 3QP6A 3DTMA 1L2SA 3GMWA 4L9EA 3E0YA 2WGWA 1ES4A 3CITA 1SDEA 3U4LP 1K6RA 2V8FA 4KZAA 1KDSA 1PWGA 4EV4A 5J4EA 2XA7S 1MPLA 2PYRA 5D3OA 3A3DA 2DRWA 3FG8A 3QHYA 4DKIA 3FKVA 2W0NA 1IYQA 2Y79A 3DBAA 3MS6A 4EQ1A 5L10A 3VOZA 3NOUC 1M6KA 1PI5A 3S7NA 1EWZA 4H6JA 5E43A 3E4QA 1OTAA 3IQAA 2IWDA 4GDNA 5CRFA 4MN7A 4UA6A 1STZA 1OT6A 4KENB 1S4RA 3PR6A 1P0ZA 3DWZA 5HSQA 3VSLA 1E4DA 1T1CA 3M2KA 4OONA 4H8RA 4O0PA 5GHZA 1TS7A 2VEAA 5JYOA 2O0YA 3ZVWA 2ZQCA 3A3FA 3HVFA 3LO7A 3DAVA 4Y0UA 1IOUA 4WUJA 3SS3A 5HD3A 2ZM2A 2ZMVA 5FEFA 1ERQA 5HWVA 2VV6A 4EEUA 5L2FA 1PFLA 2OOLA 3HJIA 1PW1A 2OSUA 3KO6A 1BLPA 2EX8A 1MKIA 3V5MA 3ZG9B 5HAPA 3H7WB 2ZM8A 4PM9A 4P6BA 3UPPA 1C3BA 5M1AA 1W5DA 2WGWB 3LFVA 4IUHA 5I94A 4I3AA 5A8BA 3T4SA 4WM9A 5HW3A 1DRMA 4YOFA 3KSHA 1LHYA 5A92A 5E2GA 1EI5A 3CWFA 1IKIA 1T19A 4O7DA 3DTKA 4DXBA 3LY3A 4L0LA 3A3EA 2ZQ9A 3D72A 4GJ4A 4EU0A 2B02A 3BFFA 4KZ6A 3ICYA 4MBFA 1BTLA 3G2ZA 2VLGA 5DKLA 3T1RA 4CJNA 4G3KA 3WWXA 1MWTA 2JHEA 2Z6CA 2QZ6A 5A91A 4OOYA 3M6HA 3NHQA 2GDNA 3T1QB 1VHMA 4S2KA 3H82B 4HH3A 2DMWA 4X56A 1SKOA 4IUKA 3JYIA 3B47A 3M6BA 3IH9A 1D1JA 4ZJ1A 1MBLA 2V0UA 2C5WB 3C8CA 1WYBA 3T4OA 1G68A 2LB9A 5FI7A 2WZXA 4GCZA 2ZC7A 5CERA 5EM1A 3RTYA 3KSFA 1N9NA 1NLYA 2GJ3A 1O7EA 3Q7ZA 5TGFA 4MCWA 3OLOA 5EVIC 2KLIA 2FFFB 3PHYA 4C3QA 3UE3A 4ETXA 1K4EA 3OPRA 5EVIA 3UDXA 3S7PA 3O3VA 1GA9A 2QWSA 2XF3A 2WADA 4E3LA 4F3LB 1XP4A 1K6SA 4HESA 4JGRA 2Y2LA 1MY8A 3BFEA 4ID4A 3WS4A 1OPXA 1BZAA 4L9GA 2INWA 3UDFA 1NYMA 5J8XA 3MF0A 1L0FA 4JPMA 4LRXC 3E4OA 4DE1A 1ZHHB 1MWUA 2J3TC 1XJ6A 4X68A 3IWQA 2PR5A 3MMHA 3JPUA 5F68A 1CF0A 3PBTA 1A0KA 1FIKA 3JVVA 4NG2A 5CX7A 1JTGA 3F1NA 1YLJA 4QU3A 1LI9A 4EERA 4YNRA 3LR3A 3LIDA 4A5RA 2V1BA 3ZGAB 5AQ9A 4Y2FA 3W2ZA 2JKRI 3IHBA 3RXWA 1TDLA 1VETB 4QWOA 4GD8A 4KQQA 1T18A 2H5SA 1L3LA 4CLCB 1K0KA 3PYPA 3P09A 1XA1A 2HP9A 3IXBA 3LIFA 1MKMA 3N8LA 3VOLA 1DJBA 3DWKA 3GRJA 1FSYA 1K54C 4EWFA 4IVIA 3HUNA 3FKWA 4WELA 4I5SA 3IX3A 2OLUA 1FILA 4C6YA 3ITBA 4LV1A 1CI9A 3FZCA 3IWOA 3IF6C 4OQ0A 1UWPX 3UPNA 5EPHA 3S7QA 3RH8B 2H10A 5HD5A 2WKHA 4OQIA 2JE5A 2PAVP 3SOIA 1NXYA 4JXGA 4S2MA 3LICA 3IWIA 5FL3A 1YKDA 5FI2A 5HPIA 5HARA 5CGSA 1LT0A 1HLUP 4PPRA 1ZTUA 1ESUA 4LV3A 4QD4A 5DF8A 3LEQA 5FQIA 1MXOA 3OPHA 4DDYA 4I38A 1JTDA 2RCXA 3FWLA 2Q9MA 2NUTC 4DJ2A 5M18A 3G35A 1MWRA 4HJ3A 4BL3A 2Y2HA 3D9YA 2V9AA 4LCMA 5FATA 2EX2A 4Z1WA 2W3GA 3CHWP 5AVFA 5GLDA 2XDMA 4M4XA 4OPZA 4JF5A 4LFUA 2Y8HA 3IT9A 3PTEA 3O5YA 3VP2A 4EBLA 1YLZA 1Z6FA 2ZOIA 1XA7A 1M40A 3GTCA 4X25A 3LI9A 3NULA 3BECA 2P7JA 3NI9A 1DP6A 1CQAA 5DTSA 3Q7VA 3Q7VB 3CPTB 3ZG7B 2XFSA 1I2SA 3HBRA 2GNXA 4HHDA 1XKZA 1PZPA 4N9KA 4HEFA 1W79A 1E25A 1GSVA 2A24A 4MNRA 2JC7A 5TJJA 5CECA 1NZUA 4NK3A 4JGOA 3HJKA 1GCEA 2CMNA 5F1GA 5HDDA 3SS5A
chains in the Genus database with same CATH topology
1IYQA 5HFOA 4N92A 2Y2MA 4QY5A 5HAQA 1BLSA 2B5RA 3HLDA 3V39A 3VOZA 3ZCZA 3G4PA 3S4XA 3S1YA 1E3UD 1M6KA 3HLBA 1CK3A 1K55C 5EOEA 3TOIA 3LCEA 1YM1A 1PI5A 1YT4A 1EWZA 4JKTA 5FQKA 1XGIA 4BJPA 2HP5A 3ZG5A 5E43A 5F83A 2QMIA 4U0XA 3IQAA 3N8SA 4X53A 2IWDA 3CMZA 4GDNA 4IVKA 5CRFA 2PU4A 3UE0A 3GQZA 3PAGA 1ESIA 1H8YA 4KQRA 4UA6A 3SS4A 4D2OA 4P85A 1BLCA 4KZ5A 3IXGA 1L0GA 1HZOA 3RXXA 4R0QA 4KENB 5CHJA 3IF6B 3M2JA 3ISGA 4BL2A 1QMEA 4S2IA 4K91A 4DE0A 2X01A 1RGYA 4GKUA 4EBNA 4S2JA 3DWZA 2Q9NA 1EROA 4WMCD 2JBFA 3VSLA 2PU2A 4Y0OA 3C4PA 1E4DA 1K57C 3DW0A 3M2KA 4OONA 2J7VA 2V20A 4H8RA 2G2UA 2R9XA 2Z2LB 3MXRA 5KMWA 2A3UA 3G2YA 5GHZA 3SH8A 4PM7A 5JYOA 1HTZA 2WGVA 1LL9A 1Q2PA 2DNSA 2P9VB 4GB7A 4OLDA 4Z9QA 2VGJA 4ZTKA 3OCNA 1ONGA 2ZQCA 3ZVWA 3A3FA 3HVFA 3IH8A 4B88A 5TR7A 3LO7A 1CEFA 3BFCA 3MZEA 4Y0UA 5E2FA 3SS3A 1KGEA 5GHXA 4MEZA 5U47A 2XLNA 2OV5A 4U3TA 2XD1A 1MWSA 2ZM2A 3IHAA 3VFFA 2Y91A 3V3RA 1ERQA 1ALQA 3HLCA 4KZ4A 4UA9A 4WYYA 2FFYA 1XXMA 4XXRA 2I72A 4S2NA 5L2FA 3WRZA 1FCNA 1PW1A 2OSUA 1BLPA 2EX8A 1MKIA 4FH2A 4OPRA 4N1XA 4YINA 3V5MA 3ZG9B 2WAFA 5HAPA 3TG9A 2ZM8A 1XGJA 3NIAA 4WMCA 3IXDA 4MLLA 4PM9A 4P6BA 3UPPA 1C3BA 5M1AA 1RGZA 1NZOA 1W5DA 2WGWB 5I94A 2ZM0A 1ERMA 3Q1FA 5JYPA 5GHYA 4EUZA 4WM9A 2E8IA 3BLSA 4Y7PA 3VP3A 3V3SA 5A93A 3MZFA 1PYYA 5HW3A 5KSHA 3QNCA 5DVAA 3HLGA 4Q8IA 3AGFA 1DJCA 4F94A 2X02A 4S2PA 5E2EA 4LV2A 4DF6A 3SS5A 1LHYA 1K56A 4IEDA 3WS2A 5A92A 5E2GA 3V50A 5FA7A 5HL1A 1EI5A 2ZLYA 5IHVA 1IKIA 3IXHA 4GN2A 4ZJ2A 4O7DA 4DXBA 3LY3A 3O86A 5GLCA 4L0LA 2WKEA 1S6RA 2ZQ9A 3A3EA 5EUAA 2ZQDA 4JLFA 4JXWA 4BD1A 4OKPA 1GHPA 1KE0A 1AXBA 3MXSA 5AQ7A 4IBRA 4E3JA 3BFFA 3CZDA 4KZ6A 5CHUA 4MBFA 5EECA 1FCOA 4BQMA 1XX2A 1BTLA 2J8YA 3G2ZA 4RYEA 4JXSA 4HBUA 1VQQA 1KVMA 4JF4A 3W8KA 2WZZA 4WZ5C 3G34A 4CJNA 4OOMA 3WWXA 1MWTA 2JCHA 3UY6A 2QZ6A 2WUQA 2ZC3B 5A91A 3WS5A 2Y59A 3C7UA 4OOYA 2XGNA 3M6HA 4OOLA 1BLHA 2HPBA 2GDNA 5CTMA 4S2LA 4S2KA 1WE4A 4EBPA 4JXVA 3VP4A 3N7WA 4ZBEA 3PAEA 4X56A 5FASA 3OPLA 2IWCA 3JYIA 3M6BA 5GLAA 3IH9A 5A90A 4FH4A 2RL3A 4ZDXA 2BG1A 2ZC6B 1BULA 1BUEA 2XEPA 3VP1A 1IYSA 5DF7A 4ZJ1A 1L0EA 1RCJA 1MBLA 2J9OA 3GSGA 3NCKA 3PBSA 1YQSA 2V1ZA 4LCLA 4QHCA 3W4QA 4E3OA 2C5WB 1K25A 4KZ7A 1K4FA 1WYBA 4WBGA 5CGXA 1G68A 1ZKJA 2HP6A 1RP5A 2A49A 3CJMA 5FI7A 1O07A 2WZXA 2P9VA 1OMEA 3O88A 4GNUA 3UE1A 2ZC7A 4UHUA 4X6TA 5CERA 3GVBA 3E2KA 1W8QA 3B3XA 4EQIA 3ZNYA 1E3UA 4JBFA 3AGEA 5F1FA 1JVJA 1KGFA 3UDIA 5TFQA 1PI4A 3UNWA 3W4PA 3WS0A 3UPOA 3WS1A 1O7EA 3Q7ZA 5TGFA 2ZQ7A 5KSCA 5AQBA 5EVIC 4R4RA 4X69A 2FFFB 3PBQA 4XUZA 3SH9A 3FV7A 3RJUA 4C3QA 3EQVA 1SHVA 3UE3A 4C75A 4B4XA 1K4EA 1JWZA 1IELA 2EX6A 2Y2NA 2Y2IA 3MKFA 3OPRA 5GL9A 5HAIA 3HUMA 2ZQ8A 4GZBA 3QNBA 5EVIA 3C7VA 2C6WB 3UDXA 3O3VA 1NRFA 1ZG6A 5DTKA 4UAAA 3OPPA 5FI6A 5FDHA 2EXBA 3HUOA 4OVDA 4KQOA 3VP0A 1GA9A 3BFDA 2EFUA 3FYZA 2XF3A 2WADA 4E3LA 1I2WA 2DCFA 2XQZA 4CPKA 4QY6A 4GD6A 1CEGA 1CI8A 1XP4A 1K6SA 4HESA 4B4ZA 2ZJ9A 1YLWA 4PM6A 3Q81A 5CEBA 1W7FA 4BD0A 2Y2LA 4KG6A 1MY8A 3BFEA 3NBLA 4ID4A 2H0TA 1JWVA 3O87A 4JF6A 3PBNA 4XUXA 3UN7A 3WS4A 4KZ8A 2PBYA 1BZAA 3I7JA 3GR2A 4BENA 1ZC2A 4KZBA 1K55A 4R3JA 2WYXA 5DF9A 5EE8A 3C5AA 3UDFA 1SCWA 3LY4A 3ITAA 1NYMA 4MBHA 1FOFA 2XR0A 1XPBA 4NETA 5J8XA 1L0FA 4LV0A 4JPMA 4RVAA 1YMXA 3ZFZA 3GV9A 3CG5A 1NJ4A 1IYPA 1W8YA 4OLGA 4DE1A 3NC8A 2H0YA 1MWUA 4X68A 4R3BA 3IWQA 2OLVA 1TDGA 2QPNA 4HBTA 1FSWA 3PBTA 3NY4A 1H8ZA 4QB8A 4QJGA 3NDGA 1VM1A 5CXWA 4UA7A 4GDBA 1JTGA 4DE2A 3ZHHA 3VFHA 4PMAA 1YLJA 4QU3A 1LI9A 4KG2A 4E3IA 2CC1A 3MKEA 3BFGA 5HX9A 1GHIA 4P87A 4A5RA 3ZGAB 5AQ9A 3VOYA 3IHBA 3A3JA 1BSGA 3ZVTA 4KG5A 3RXWA 4PM8A 1TDLA 1FCMA 4E6XA 5FQJA 2HDUA 2R9WA 3HL9A 4LENA 4E3NA 3BEBA 1ES2A 1ONHA 1FR6A 1YLPA 1YMSA 4OP8A 2Y2JA 4GD8A 1GA0A 4KQQA 1NY0A 4S2NC 5EOOA 2H5SA 5GLBA 3D4FA 2XD5A 3Q07A 4FSFA 2IWBA 1BT5A 5CEDA 2G2WA 1TVFA 2XK1A 3P09A 1XA1A 3LEZA 2HP9A 1LI0A 3IXBA 4M3KA 3IF5A 4IBXA 4FCFA 3N4IA 5BOHA 5F82A 2WKIA 3N8LA 2XH9A 3N8RA 1DJBA 2X71A 4R4SA 5CGWA 3DWKA 5G18A 2ZMAA 3GRJA 1FSYA 4MBKA 1K54C 5FQ9A 4BLMA 5E2HA 2HDSA 3PBOA 3ZG8B 4EWFA 4IVIA 4WEKA 1PW8A 2BLSA 3HUNA 5M19A 3NDEA 3BLMA 4ZJ3A 4Y0TA 3VMAA 3FKWA 4P0MA 4WELA 3S22A 2OLUA 1JWPA 1NYYA 1Y54A 5EVLA 1K57A 4N1HA 4R1GA 4C6YA 4DXCA 3ITBA 5AQAA 4DDSA 4N9LA 2EFXA 4LV1A 1SDNA 5FQQA 5CTNA 1CI9A 3FZCA 3IWOA 3IF6C 4OQ0A 3SH7A 3ZDJA 3HLWA 2Y4AA 3UPNA 4E3MA 5EPHA 3VSKA 4PM5A 5EVIB 1IYOA 2H10A 2Y2PA 5EVID 4K0XA 1DJAA 2UWXA 2WKHA 2Z2MB 3PBRA 2JE5A 4OQIA 1SKFA 3SOIA 1NXYA 4JXGA 4S2MA 1ES5A 5FQMA 5FSRA 3IWIA 3P98A 4FD8A 2ZC5B 1Q2QA 4OPQA 1KE4A 3HLEA 2J9PA 5FI2A 1N4OA 1WYCA 5HARA 5CGSA 1K56D 2HDRA 3E2LA 2ZC4B 4QD4A 4PPRA 4LV3A 1ESUA 4YFMA 2EX9A 5DF8A 1KGGA 1PWDA 1TEMA 4E6WA 4E3KA 4GOGA 1H5XA 3IF6A 5FQIA 1MXOA 1I5QA 3OPHA 3UO9A 1GHMA 3MZDA 2Y2KA 4DDYA 4DRTA 3WRTA 3ZNTA 1PZOA 1JTDA 2RCXA 3TSGA 4K0WA 1L0DA 3BRMA 2XFTA 4KZ3A 3W4OA 3FWLA 1PIOA 3G31A 2Q9MA 1KVLA 3BM6A 4OQHA 5M18A 1PWCA 4R23A 2WGIA 3G35A 5FAOA 1MWRA 1K54A 4BL3A 5FAQA 2Y2HA 1LLBA 1N9BA 3N6IA 1ES3A 1FQGA 4ZAMA 1U60A 4WEJA 5FAPA 3C4OA 2WK0A 4LCMA 5FATA 2EX2A 1LL5A 3A3IA 1KDWA 5DTTA 1HVBA 3G30A 5CHMA 1J9MA 1KE3A 5GLDA 2HDQA 3AGDA 4WZ5A 2XDMA 1YLTA 3BYDA 4OPYA 1S0WA 1FR1A 2VGKA 4JF5A 4OH0A 4OPZA 4RX2A 4WZ4A 1K38A 3IT9A 3VP2A 3PTEA 3MBZA 4EBLA 5KZHA 1YLZA 4S2OA 4KZ9A 4RX3A 3HREA 3G32A 3OCLA 1IKGA 3ZG0A 1ZG4A 1Z6FA 4U0TA 1QMFA 1XA7A 2V2FF 1M40A 3EQUA 3DTMA 3GTCA 2Y2OA 4OQGA 3BECA 3NI9A 1L2SA 3GMWA 4X55A 2ZD8A 3Q7VA 3Q7VB 5DTSA 2ZQAA 2WGWA 3ZG7B 2XFSA 2Y2GA 1ES4A 1I2SA 2EXAA 1IEMA 3HBRA 3OC2A 1SDEA 3Q82A 1XKZA 3HLFA 4OP5A 1PZPA 1K6RA 4KZAA 1KDSA 4N9KA 4HEFA 3OZHA 1PWGA 2Y55A 1W79A 1DY6A 1E25A 4EV4A 4MNRA 1G6AA 2JC7A 3MFDA 1YLYA 5CECA 2WAEA 1MPLA 4RA7A 1HD8A 4DE3A 1NZUA 5D3OA 3A3DA 2DRWA 4NK3A 2P74A 2Y2QA 3QHYA 1GCEA 4DKIA 5F1GA 3FKVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYQ A;  5HFO A;  4N92 A;  2Y2M A;  4QY5 A;  5HAQ A;  1BLS A;  2B5R A;  3HLD A;  3V39 A;  3VOZ A;  3ZCZ A;  3G4P A;  3S4X A;  3S1Y A;  1E3U D;  1M6K A;  3HLB A;  1CK3 A;  1K55 C;  5EOE A;  3TOI A;  3LCE A;  1YM1 A;  1PI5 A;  1YT4 A;  1EWZ A;  4JKT A;  5FQK A;  1XGI A;  4BJP A;  2HP5 A;  3ZG5 A;  5E43 A;  5F83 A;  2QMI A;  4U0X A;  3IQA A;  3N8S A;  4X53 A;  2IWD A;  3CMZ A;  4GDN A;  4IVK A;  5CRF A;  2PU4 A;  3UE0 A;  3GQZ A;  3PAG A;  1ESI A;  1H8Y A;  4KQR A;  4UA6 A;  3SS4 A;  4D2O A;  4P85 A;  1BLC A;  4KZ5 A;  3IXG A;  1L0G A;  1HZO A;  3RXX A;  4R0Q A;  4KEN B;  5CHJ A;  3IF6 B;  3M2J A;  3ISG A;  4BL2 A;  1QME A;  4S2I A;  4K91 A;  4DE0 A;  2X01 A;  1RGY A;  4GKU A;  4EBN A;  4S2J A;  3DWZ A;  2Q9N A;  1ERO A;  4WMC D;  2JBF A;  3VSL A;  2PU2 A;  4Y0O A;  3C4P A;  1E4D A;  1K57 C;  3DW0 A;  3M2K A;  4OON A;  2J7V A;  2V20 A;  4H8R A;  2G2U A;  2R9X A;  2Z2L B;  3MXR A;  5KMW A;  2A3U A;  3G2Y A;  5GHZ A;  3SH8 A;  4PM7 A;  5JYO A;  1HTZ A;  2WGV A;  1LL9 A;  1Q2P A;  2DNS A;  2P9V B;  4GB7 A;  4OLD A;  4Z9Q A;  2VGJ A;  4ZTK A;  3OCN A;  1ONG A;  2ZQC A;  3ZVW A;  3A3F A;  3HVF A;  3IH8 A;  4B88 A;  5TR7 A;  3LO7 A;  1CEF A;  3BFC A;  3MZE A;  4Y0U A;  5E2F A;  3SS3 A;  1KGE A;  5GHX A;  4MEZ A;  5U47 A;  2XLN A;  2OV5 A;  4U3T A;  2XD1 A;  1MWS A;  2ZM2 A;  3IHA A;  3VFF A;  2Y91 A;  3V3R A;  1ERQ A;  1ALQ A;  3HLC A;  4KZ4 A;  4UA9 A;  4WYY A;  2FFY A;  1XXM A;  4XXR A;  2I72 A;  4S2N A;  5L2F A;  3WRZ A;  1FCN A;  1PW1 A;  2OSU A;  1BLP A;  2EX8 A;  1MKI A;  4FH2 A;  4OPR A;  4N1X A;  4YIN A;  3V5M A;  3ZG9 B;  2WAF A;  5HAP A;  3TG9 A;  2ZM8 A;  1XGJ A;  3NIA A;  4WMC A;  3IXD A;  4MLL A;  4PM9 A;  4P6B A;  3UPP A;  1C3B A;  5M1A A;  1RGZ A;  1NZO A;  1W5D A;  2WGW B;  5I94 A;  2ZM0 A;  1ERM A;  3Q1F A;  5JYP A;  5GHY A;  4EUZ A;  4WM9 A;  2E8I A;  3BLS A;  4Y7P A;  3VP3 A;  3V3S A;  5A93 A;  3MZF A;  1PYY A;  5HW3 A;  5KSH A;  3QNC A;  5DVA A;  3HLG A;  4Q8I A;  3AGF A;  1DJC A;  4F94 A;  2X02 A;  4S2P A;  5E2E A;  4LV2 A;  4DF6 A;  3SS5 A;  1LHY A;  1K56 A;  4IED A;  3WS2 A;  5A92 A;  5E2G A;  3V50 A;  5FA7 A;  5HL1 A;  1EI5 A;  2ZLY A;  5IHV A;  1IKI A;  3IXH A;  4GN2 A;  4ZJ2 A;  4O7D A;  4DXB A;  3LY3 A;  3O86 A;  5GLC A;  4L0L A;  2WKE A;  1S6R A;  2ZQ9 A;  3A3E A;  5EUA A;  2ZQD A;  4JLF A;  4JXW A;  4BD1 A;  4OKP A;  1GHP A;  1KE0 A;  1AXB A;  3MXS A;  5AQ7 A;  4IBR A;  4E3J A;  3BFF A;  3CZD A;  4KZ6 A;  5CHU A;  4MBF A;  5EEC A;  1FCO A;  4BQM A;  1XX2 A;  1BTL A;  2J8Y A;  3G2Z A;  4RYE A;  4JXS A;  4HBU A;  1VQQ A;  1KVM A;  4JF4 A;  3W8K A;  2WZZ A;  4WZ5 C;  3G34 A;  4CJN A;  4OOM A;  3WWX A;  1MWT A;  2JCH A;  3UY6 A;  2QZ6 A;  2WUQ A;  2ZC3 B;  5A91 A;  3WS5 A;  2Y59 A;  3C7U A;  4OOY A;  2XGN A;  3M6H A;  4OOL A;  1BLH A;  2HPB A;  2GDN A;  5CTM A;  4S2L A;  4S2K A;  1WE4 A;  4EBP A;  4JXV A;  3VP4 A;  3N7W A;  4ZBE A;  3PAE A;  4X56 A;  5FAS A;  3OPL A;  2IWC A;  3JYI A;  3M6B A;  5GLA A;  3IH9 A;  5A90 A;  4FH4 A;  2RL3 A;  4ZDX A;  2BG1 A;  2ZC6 B;  1BUL A;  1BUE A;  2XEP A;  3VP1 A;  1IYS A;  5DF7 A;  4ZJ1 A;  1L0E A;  1RCJ A;  1MBL A;  2J9O A;  3GSG A;  3NCK A;  3PBS A;  1YQS A;  2V1Z A;  4LCL A;  4QHC A;  3W4Q A;  4E3O A;  2C5W B;  1K25 A;  4KZ7 A;  1K4F A;  1WYB A;  4WBG A;  5CGX A;  1G68 A;  1ZKJ A;  2HP6 A;  1RP5 A;  2A49 A;  3CJM A;  5FI7 A;  1O07 A;  2WZX A;  2P9V A;  1OME A;  3O88 A;  4GNU A;  3UE1 A;  2ZC7 A;  4UHU A;  4X6T A;  5CER A;  3GVB A;  3E2K A;  1W8Q A;  3B3X A;  4EQI A;  3ZNY A;  1E3U A;  4JBF A;  3AGE A;  5F1F A;  1JVJ A;  1KGF A;  3UDI A;  5TFQ A;  1PI4 A;  3UNW A;  3W4P A;  3WS0 A;  3UPO A;  3WS1 A;  1O7E A;  3Q7Z A;  5TGF A;  2ZQ7 A;  5KSC A;  5AQB A;  5EVI C;  4R4R A;  4X69 A;  2FFF B;  3PBQ A;  4XUZ A;  3SH9 A;  3FV7 A;  3RJU A;  4C3Q A;  3EQV A;  1SHV A;  3UE3 A;  4C75 A;  4B4X A;  1K4E A;  1JWZ A;  1IEL A;  2EX6 A;  2Y2N A;  2Y2I A;  3MKF A;  3OPR A;  5GL9 A;  5HAI A;  3HUM A;  2ZQ8 A;  4GZB A;  3QNB A;  5EVI A;  3C7V A;  2C6W B;  3UDX A;  3O3V A;  1NRF A;  1ZG6 A;  5DTK A;  4UAA A;  3OPP A;  5FI6 A;  5FDH A;  2EXB A;  3HUO A;  4OVD A;  4KQO A;  3VP0 A;  1GA9 A;  3BFD A;  2EFU A;  3FYZ A;  2XF3 A;  2WAD A;  4E3L A;  1I2W A;  2DCF A;  2XQZ A;  4CPK A;  4QY6 A;  4GD6 A;  1CEG A;  1CI8 A;  1XP4 A;  1K6S A;  4HES A;  4B4Z A;  2ZJ9 A;  1YLW A;  4PM6 A;  3Q81 A;  5CEB A;  1W7F A;  4BD0 A;  2Y2L A;  4KG6 A;  1MY8 A;  3BFE A;  3NBL A;  4ID4 A;  2H0T A;  1JWV A;  3O87 A;  4JF6 A;  3PBN A;  4XUX A;  3UN7 A;  3WS4 A;  4KZ8 A;  2PBY A;  1BZA A;  3I7J A;  3GR2 A;  4BEN A;  1ZC2 A;  4KZB A;  1K55 A;  4R3J A;  2WYX A;  5DF9 A;  5EE8 A;  3C5A A;  3UDF A;  1SCW A;  3LY4 A;  3ITA A;  1NYM A;  4MBH A;  1FOF A;  2XR0 A;  1XPB A;  4NET A;  5J8X A;  1L0F A;  4LV0 A;  4JPM A;  4RVA A;  1YMX A;  3ZFZ A;  3GV9 A;  3CG5 A;  1NJ4 A;  1IYP A;  1W8Y A;  4OLG A;  4DE1 A;  3NC8 A;  2H0Y A;  1MWU A;  4X68 A;  4R3B A;  3IWQ A;  2OLV A;  1TDG A;  2QPN A;  4HBT A;  1FSW A;  3PBT A;  3NY4 A;  1H8Z A;  4QB8 A;  4QJG A;  3NDG A;  1VM1 A;  5CXW A;  4UA7 A;  4GDB A;  1JTG A;  4DE2 A;  3ZHH A;  3VFH A;  4PMA A;  1YLJ A;  4QU3 A;  1LI9 A;  4KG2 A;  4E3I A;  2CC1 A;  3MKE A;  3BFG A;  5HX9 A;  1GHI A;  4P87 A;  4A5R A;  3ZGA B;  5AQ9 A;  3VOY A;  3IHB A;  3A3J A;  1BSG A;  3ZVT A;  4KG5 A;  3RXW A;  4PM8 A;  1TDL A;  1FCM A;  4E6X A;  5FQJ A;  2HDU A;  2R9W A;  3HL9 A;  4LEN A;  4E3N A;  3BEB A;  1ES2 A;  1ONH A;  1FR6 A;  1YLP A;  1YMS A;  4OP8 A;  2Y2J A;  4GD8 A;  1GA0 A;  4KQQ A;  1NY0 A;  4S2N C;  5EOO A;  2H5S A;  5GLB A;  3D4F A;  2XD5 A;  3Q07 A;  4FSF A;  2IWB A;  1BT5 A;  5CED A;  2G2W A;  1TVF A;  2XK1 A;  3P09 A;  1XA1 A;  3LEZ A;  2HP9 A;  1LI0 A;  3IXB A;  4M3K A;  3IF5 A;  4IBX A;  4FCF A;  3N4I A;  5BOH A;  5F82 A;  2WKI A;  3N8L A;  2XH9 A;  3N8R A;  1DJB A;  2X71 A;  4R4S A;  5CGW A;  3DWK A;  5G18 A;  2ZMA A;  3GRJ A;  1FSY A;  4MBK A;  1K54 C;  5FQ9 A;  4BLM A;  5E2H A;  2HDS A;  3PBO A;  3ZG8 B;  4EWF A;  4IVI A;  4WEK A;  1PW8 A;  2BLS A;  3HUN A;  5M19 A;  3NDE A;  3BLM A;  4ZJ3 A;  4Y0T A;  3VMA A;  3FKW A;  4P0M A;  4WEL A;  3S22 A;  2OLU A;  1JWP A;  1NYY A;  1Y54 A;  5EVL A;  1K57 A;  4N1H A;  4R1G A;  4C6Y A;  4DXC A;  3ITB A;  5AQA A;  4DDS A;  4N9L A;  2EFX A;  4LV1 A;  1SDN A;  5FQQ A;  5CTN A;  1CI9 A;  3FZC A;  3IWO A;  3IF6 C;  4OQ0 A;  3SH7 A;  3ZDJ A;  3HLW A;  2Y4A A;  3UPN A;  4E3M A;  5EPH A;  3VSK A;  4PM5 A;  5EVI B;  1IYO A;  2H10 A;  2Y2P A;  5EVI D;  4K0X A;  1DJA A;  2UWX A;  2WKH A;  2Z2M B;  3PBR A;  2JE5 A;  4OQI A;  1SKF A;  3SOI A;  1NXY A;  4JXG A;  4S2M A;  1ES5 A;  5FQM A;  5FSR A;  3IWI A;  3P98 A;  4FD8 A;  2ZC5 B;  1Q2Q A;  4OPQ A;  1KE4 A;  3HLE A;  2J9P A;  5FI2 A;  1N4O A;  1WYC A;  5HAR A;  5CGS A;  1K56 D;  2HDR A;  3E2L A;  2ZC4 B;  4QD4 A;  4PPR A;  4LV3 A;  1ESU A;  4YFM A;  2EX9 A;  5DF8 A;  1KGG A;  1PWD A;  1TEM A;  4E6W A;  4E3K A;  4GOG A;  1H5X A;  3IF6 A;  5FQI A;  1MXO A;  1I5Q A;  3OPH A;  3UO9 A;  1GHM A;  3MZD A;  2Y2K A;  4DDY A;  4DRT A;  3WRT A;  3ZNT A;  1PZO A;  1JTD A;  2RCX A;  3TSG A;  4K0W A;  1L0D A;  3BRM A;  2XFT A;  4KZ3 A;  3W4O A;  3FWL A;  1PIO A;  3G31 A;  2Q9M A;  1KVL A;  3BM6 A;  4OQH A;  5M18 A;  1PWC A;  4R23 A;  2WGI A;  3G35 A;  5FAO A;  1MWR A;  1K54 A;  4BL3 A;  5FAQ A;  2Y2H A;  1LLB A;  1N9B A;  3N6I A;  1ES3 A;  1FQG A;  4ZAM A;  1U60 A;  4WEJ A;  5FAP A;  3C4O A;  2WK0 A;  4LCM A;  5FAT A;  2EX2 A;  1LL5 A;  3A3I A;  1KDW A;  5DTT A;  1HVB A;  3G30 A;  5CHM A;  1J9M A;  1KE3 A;  5GLD A;  2HDQ A;  3AGD A;  4WZ5 A;  2XDM A;  1YLT A;  3BYD A;  4OPY A;  1S0W A;  1FR1 A;  2VGK A;  4JF5 A;  4OH0 A;  4OPZ A;  4RX2 A;  4WZ4 A;  1K38 A;  3IT9 A;  3VP2 A;  3PTE A;  3MBZ A;  4EBL A;  5KZH A;  1YLZ A;  4S2O A;  4KZ9 A;  4RX3 A;  3HRE A;  3G32 A;  3OCL A;  1IKG A;  3ZG0 A;  1ZG4 A;  1Z6F A;  4U0T A;  1QMF A;  1XA7 A;  2V2F F;  1M40 A;  3EQU A;  3DTM A;  3GTC A;  2Y2O A;  4OQG A;  3BEC A;  3NI9 A;  1L2S A;  3GMW A;  4X55 A;  2ZD8 A;  3Q7V A;  3Q7V B;  5DTS A;  2ZQA A;  2WGW A;  3ZG7 B;  2XFS A;  2Y2G A;  1ES4 A;  1I2S A;  2EXA A;  1IEM A;  3HBR A;  3OC2 A;  1SDE A;  3Q82 A;  1XKZ A;  3HLF A;  4OP5 A;  1PZP A;  1K6R A;  4KZA A;  1KDS A;  4N9K A;  4HEF A;  3OZH A;  1PWG A;  2Y55 A;  1W79 A;  1DY6 A;  1E25 A;  4EV4 A;  4MNR A;  1G6A A;  2JC7 A;  3MFD A;  1YLY A;  5CEC A;  2WAE A;  1MPL A;  4RA7 A;  1HD8 A;  4DE3 A;  1NZU A;  5D3O A;  3A3D A;  2DRW A;  4NK3 A;  2P74 A;  2Y2Q A;  3QHY A;  1GCE A;  4DKI A;  5F1G A;  3FKV A; 
#chains in the Genus database with same CATH topology
 4HIA A;  4QY5 A;  1BLS A;  2B5R A;  3ZCZ A;  3V39 A;  4FTX A;  1IFQ A;  3S4X A;  3S1Y A;  3HLB A;  2HJ9 C;  1K55 C;  3TOI A;  1S1Z A;  2VX8 A;  3ZG5 A;  5F83 A;  2QMI A;  4X1M A;  4IVK A;  3F1P B;  3UE0 A;  4B93 A;  3GQZ A;  1H0M A;  4X1L A;  3RFB A;  3SS4 A;  4P85 A;  1BLC A;  1L0G A;  5CHJ A;  3IF6 B;  3M2J A;  1QME A;  4S2I A;  4DE0 A;  1RGY A;  4GKU A;  4HI4 A;  4S2J A;  4EBN A;  2Q9N A;  3ZQ5 A;  2JBF A;  2PU2 A;  4Y0O A;  3C4P A;  1K57 C;  3DW0 A;  2J7V A;  2OAQ 1;  2R78 A;  4PKY G;  2A3U A;  1HTZ A;  1LL9 A;  2I9V A;  2DNS A;  2WGV A;  4OLD A;  1ONG A;  1TF1 A;  4O8G A;  3IH8 A;  4B88 A;  3P01 A;  3VV4 A;  3FPV A;  3E4P A;  5HL6 A;  5E2F A;  2HF6 A;  2XLN A;  2OV5 A;  1XFN A;  4JGP A;  4U3T A;  2XD1 A;  4KQD A;  5IU1 A;  5KIZ A;  4KZ4 A;  3PXP A;  2VGL M;  3VE4 A;  2AVX A;  2I72 A;  4S2N A;  3WRZ A;  2KDK A;  4GS9 B;  4FH2 A;  4OPR A;  2WAF A;  3NIA A;  4NXF A;  4G3V A;  1RGZ A;  3IS2 B;  5TBM B;  3CPT A;  2D02 A;  4MN5 A;  5IT5 A;  2VK3 A;  4EUZ A;  1DP8 A;  2E8I A;  3VP3 A;  3V3S A;  3QNC A;  3SW1 A;  5DVA A;  3AGF A;  1UWN X;  3DTI A;  4S2P A;  3LIE A;  1K56 A;  3QP2 A;  5HL1 A;  4YWZ A;  1OJG A;  3JVU A;  1P9W A;  5GLC A;  2WKE A;  1LL8 A;  2ZQD A;  4JLF A;  1V9Z A;  1UGU A;  2K2N A;  4IBR A;  3F1O B;  2JKT I;  3NOP C;  3T1S A;  4BQM A;  5MC7 A;  2J8Y A;  3OOV A;  4JXS A;  2PD7 A;  4UQI M;  4HBU A;  3QP5 A;  1VQQ A;  1KVM A;  3QP4 A;  4II7 A;  2JCH A;  3WS5 A;  4FOF A;  4OOL A;  1BLH A;  2LB5 A;  2HPB A;  3NJA A;  5LBR A;  4EBP A;  1ACF A;  3UB6 A;  1Z09 A;  3VP4 A;  5FAS A;  3OPL A;  4ARZ A;  5A90 A;  2RL3 A;  4ZDX A;  2QYB A;  1BUE A;  5DF7 A;  1L0E A;  2J9O A;  3GSG A;  1S67 L;  1YQS A;  2V1Z A;  1K4F A;  4WBG A;  2HP6 A;  1RP5 A;  2PD8 A;  1OME A;  3HCY A;  3GVB A;  3IX8 A;  4R70 A;  4EQI A;  5F1F A;  1X0O A;  1JVJ A;  1KGF A;  4NXG A;  1PI4 A;  3UNW A;  5I5L A;  5KSC A;  2GZA A;  5AQB A;  4R4R A;  3MQ0 A;  3PBQ A;  2EWW A;  3C38 A;  3SH9 A;  3MQQ A;  1SHV A;  4B4X A;  1JWZ A;  3HUM A;  1YAX A;  2C6W B;  1BYW A;  3KYE A;  5DTK A;  4UAA A;  3OPP A;  4KQO A;  3VP0 A;  4WN5 A;  3UB8 A;  1I2W A;  2DCF A;  1VB6 A;  3UMD A;  2ZJ9 A;  1YLW A;  4PM6 A;  3Q81 A;  5CEB A;  2H28 A;  4KG6 A;  3LGO A;  3NBL A;  4JF6 A;  1JWV A;  3O87 A;  3PBN A;  4XUX A;  1D06 A;  2PBY A;  3GR2 A;  2O9B A;  1VET A;  4HP9 A;  3LY4 A;  3GDI A;  4MBH A;  1FOF A;  2XR0 A;  4LV0 A;  4RVA A;  3T4K A;  3ZYT A;  2VZW A;  3GV9 A;  1F5M A;  1NJ4 A;  2HZ5 A;  1IYP A;  1LSV A;  4OLG A;  3NC8 A;  4Y5F A;  2H0Y A;  4HNB A;  2OLV A;  4HBT A;  1FSW A;  3BY8 A;  4E04 A;  3IX4 A;  3NDG A;  5CXW A;  3ZHH A;  3NEC A;  4E3I A;  2CC1 A;  2ZBB A;  3BFG A;  5HX9 A;  3VOY A;  1BSG A;  4NKP A;  4E6X A;  2HDU A;  4PHT A;  3HL9 A;  2W3F A;  4LRZ E;  4DE2 A;  5EOO A;  2XD5 A;  3Q07 A;  4FSF A;  3LR5 A;  2XK1 A;  2E8J A;  1LI0 A;  4M3K A;  3B33 A;  2BAS A;  3IF5 A;  4FCF A;  3N4I A;  4CLC E;  4Q0I A;  2XH9 A;  5CGW A;  1TS8 A;  1Y28 A;  4BLM A;  2HDS A;  5FEG A;  4WEK A;  1PW8 A;  2BLS A;  4WL9 A;  3S22 A;  4R1G A;  4DDS A;  2EFX A;  1SDN A;  5FQQ A;  5CTN A;  2L4R A;  3SH7 A;  4E3M A;  5EVI B;  1IYO A;  2Y2P A;  4K0X A;  1DJA A;  2UWX A;  2Z2M B;  3PBR A;  2VA0 A;  1H3Q A;  4JGQ A;  1ES5 A;  5FSR A;  1KE4 A;  3HLE A;  1K56 D;  4YFM A;  3L9K A;  1KGG A;  1S4S A;  1PWD A;  4E3K A;  4GOG A;  3K3C A;  1AWI A;  1I5Q A;  3UO9 A;  2PHY A;  2Y2K A;  3WRT A;  3S7O A;  4K0W A;  1L0D A;  4KZ3 A;  3G31 A;  3V67 A;  5FAQ A;  1LLB A;  4EET B;  1U60 A;  2V1A A;  3A3I A;  5CHM A;  4WZ5 A;  4RX2 A;  1S66 L;  3BYD A;  2VGK A;  4OPY A;  4WZ4 A;  2KX6 A;  4PKY A;  3MBZ A;  4RQ9 A;  4KZ9 A;  4MMN A;  5G4Y A;  4U0T A;  2B18 A;  2W3H A;  3OC2 A;  4OP5 A;  3HLF A;  4LGW A;  2YKF A;  5F5Y A;  2Y55 A;  1DY6 A;  3IBR A;  3MFD A;  2JN7 A;  2WAE A;  4RA7 A;  1HD8 A;  4DE3 A;  3NOT C;  3A0V A;  3EGX C;  4G3W A;  2Y2Q A;  5HFO A;  4N92 A;  2Y2M A;  5HAQ A;  3F1P A;  3HLD A;  4LLO B;  2Q0O A;  2VV8 A;  2GX5 A;  3KYZ A;  5DJT A;  3G4P A;  4Y17 A;  4KUO A;  4DN0 A;  1MC0 A;  3LCE A;  1YM1 A;  3T12 B;  1XGI A;  4BJP A;  2HP5 A;  4U0X A;  3KSI A;  4DMZ A;  4X53 A;  3CMZ A;  1ESI A;  1H8Y A;  2QJ7 A;  4MN6 A;  4KZ5 A;  4F3L A;  3IXG A;  3RXX A;  4R0Q A;  4BBT A;  2X01 A;  4WMC D;  2MJ6 A;  2V20 A;  2G2U A;  2R9X A;  5KMW A;  3SH8 A;  4PM7 A;  1Q2P A;  3FC7 A;  4HP4 A;  4Z9Q A;  4IJG A;  2VGJ A;  3OCN A;  3T4Q A;  1CEF A;  5GHX A;  4BMW A;  3EWK A;  1MWS A;  3VFF A;  2Y91 A;  2ZL1 B;  4UA9 A;  4WYY A;  2FFY A;  2HV1 A;  1FCN A;  3DTE A;  2YKH A;  3LR0 A;  4DJ3 A;  4ME4 A;  1XGJ A;  4WMC A;  1NZO A;  3U2A A;  2ZM0 A;  4KUK A;  3FPW A;  1J3W A;  3F1N B;  5KSH A;  1OTI A;  3HLG A;  3F1O A;  4P6Z S;  3C2W A;  2W3D A;  2X02 A;  1D7E A;  4DF6 A;  4IED A;  3WS2 A;  2D01 A;  5IHV A;  2M1C A;  1VEU B;  5EUA A;  2ACG A;  2J3T D;  2JKR M;  1GHP A;  1KE0 A;  1AXB A;  3MXS A;  4O01 A;  4E3J A;  3BJN A;  3CZD A;  5CHU A;  1LSW A;  4GLQ A;  5EEC A;  4GW9 A;  1XX2 A;  5HZH A;  4IHQ A;  1YSQ A;  1YSP A;  3LUQ A;  2W1R A;  3W8K A;  4WZ5 C;  3G34 A;  4OOM A;  2WUQ A;  2Y59 A;  5CTM A;  1WE4 A;  3MR0 A;  4ZBE A;  4ZRR A;  2IWC A;  2BG1 A;  1G6O A;  2XEP A;  3VP1 A;  4BBU A;  1SZV A;  2G7U A;  3NCK A;  4QHC A;  4E3O A;  1ZKJ A;  2A49 A;  3CJM A;  2WKQ A;  3O88 A;  2HJE A;  2PT7 A;  3E2K A;  3ZNY A;  1E3U A;  2FZ0 A;  3UDI A;  3D3O A;  1W63 M;  1NWZ A;  3W4P A;  3R7W B;  3A0S A;  3WS1 A;  2W27 A;  2XSS A;  2PRF A;  2ZQ7 A;  1SKO B;  2B95 A;  2A24 B;  5DKK A;  3QP1 A;  1LSX A;  3FV7 A;  2XRO A;  1IEL A;  2Y2I A;  2W1T B;  1GSW A;  4GZB A;  2ZQ8 A;  2O99 A;  1ZG6 A;  5FI6 A;  5FDH A;  2EXB A;  3BQA A;  2EFU A;  4R38 A;  4HOI A;  1CEG A;  1P9R A;  3TW8 A;  4B4Z A;  2HGV A;  5DFY A;  5G4Z A;  3VE3 A;  2H0T A;  3UN7 A;  3LR4 A;  1ZC2 A;  3A0R A;  2WYX A;  5EE8 A;  1SCW A;  3LIB A;  3ITA A;  1XPB A;  2PYP A;  1YMX A;  1W8Y A;  1N9L A;  4R3B A;  3NY4 A;  4QB8 A;  4QJG A;  4UA7 A;  4PMA A;  3T4T A;  2BTF P;  4KG2 A;  1XFQ A;  3H7W A;  1GHI A;  4P87 A;  3K2N A;  3A3J A;  2ZOH A;  2EA9 A;  1XJ2 A;  5FQJ A;  2R9W A;  2OAP 1;  4LEN A;  3BEB A;  4Y3I A;  1OTD A;  1ONH A;  1FR6 A;  1YLP A;  1YMS A;  3K3D A;  5EFW A;  1JNU A;  2Y2J A;  1NY0 A;  4S2N C;  3D4F A;  4UQI S;  2IWB A;  4K08 A;  5CED A;  2G2W A;  1TVF A;  1OTE A;  4HQA A;  4NEE D;  2JKF A;  4IBX A;  4UEY A;  2WKI A;  5EV0 A;  3N8R A;  5G18 A;  1MZU A;  4MBK A;  5FQ9 A;  5E2H A;  2ZMF A;  1NRJ A;  5M19 A;  2Z6D A;  3NDE A;  4ZJ3 A;  1NYY A;  5EVL A;  1K57 A;  5AQA A;  3T50 A;  3EEH A;  4N9L A;  3UB9 A;  2JKT M;  2XA7 M;  5J3W A;  2O9C A;  3ZDJ A;  3HLW A;  2Y4A A;  3KYQ A;  4PM5 A;  3VSK A;  3H82 A;  5EVI D;  2W1T A;  1SKF A;  4EXO A;  5DFX A;  3P98 A;  5IS1 A;  5EM0 A;  2V8C A;  2ZC5 B;  1Q2Q A;  4FD8 A;  4OPQ A;  1N4O A;  1WYC A;  2HDR A;  2ZC4 B;  2EX9 A;  3B42 A;  1H5X A;  1GHM A;  1PZO A;  3TSG A;  3MFX A;  3BRM A;  2JKG A;  2XFT A;  1PIO A;  1KVL A;  4OQH A;  1PWC A;  1N9B A;  4ZAM A;  4WEJ A;  5FAP A;  3CUE A;  1LL5 A;  1KDW A;  3TE8 A;  1HVB A;  3UME A;  1J9M A;  2HDQ A;  3AGD A;  5HWT A;  1YLT A;  1FR1 A;  1K38 A;  4S2O A;  3G32 A;  3OCL A;  1IKG A;  1ZG4 A;  1QMF A;  2V2F F;  3GEC A;  2Y2O A;  4OQG A;  4X55 A;  2ZD8 A;  2ZQA A;  2Y2G A;  2EXA A;  1IEM A;  3Q82 A;  4AFI A;  2OWJ A;  3OZH A;  5J7E A;  1G6A A;  1YLY A;  4P6Z M;  2P74 A;  4CQH A;  4EW7 A;  2FH5 A;  1W63 Q;  4XT2 A;  1TD5 A;  4Y13 A;  4I3I A;  1E3U D;  3L7H A;  1CK3 A;  5EOE A;  3CUE C;  4JKT A;  1YT4 A;  5FQK A;  3N8S A;  4PAU A;  2PU4 A;  3PAG A;  3LI8 A;  4KQR A;  4D2O A;  1HZO A;  4BL2 A;  4I39 A;  3ISG A;  1F9I A;  5HDS A;  3EEA A;  4K91 A;  1DP9 A;  5FDS A;  1ERO A;  5HPF A;  2Z2L B;  3MXR A;  3G2Y A;  2W3E A;  4GB7 A;  2P9V B;  4ZTK A;  5TR7 A;  3BFC A;  3MZE A;  1KGE A;  4CLC A;  4MEZ A;  5U47 A;  4ETZ A;  1T1B A;  2PDR A;  4CLC C;  3IHA A;  3V3R A;  1ALQ A;  3HLC A;  3UB5 P;  1XXM A;  4XXR A;  4QPR A;  4N1X A;  4YIN A;  3TG9 A;  2L0W A;  3BWL A;  4HH2 A;  3IXD A;  4MLL A;  4I3J A;  1ERM A;  3Q1F A;  5JYP A;  5GHY A;  3BLS A;  1OT9 A;  4Y7P A;  5A93 A;  3MZF A;  1PYY A;  1NLZ A;  4Q8I A;  1DJC A;  1EW0 A;  3MSH A;  4F94 A;  5E2E A;  4LV2 A;  3UB7 A;  3V50 A;  5FA7 A;  3G6O A;  2QKP A;  2ZLY A;  3EOI A;  3MJQ A;  3IXH A;  4GN2 A;  4ZJ2 A;  3O86 A;  2WKP A;  1S6R A;  5AJG A;  4JXW A;  4BD1 A;  4OKP A;  3KSG A;  5AQ7 A;  3TRC A;  1FCO A;  1PRQ A;  4RYE A;  5AVE A;  2VV7 A;  4JF4 A;  2WZZ A;  4BBV A;  2P08 A;  3UY6 A;  2ZC3 B;  2J80 A;  3C30 A;  3H9W A;  4GS9 A;  3C7U A;  2XGN A;  4Y15 A;  3ULF A;  5DJU A;  4S2L A;  5HWW A;  4Q0H A;  4JXV A;  4L9F A;  3N7W A;  3PAE A;  1KOU A;  5GLA A;  2J3W A;  4FH4 A;  3SZT A;  2ZC6 B;  1BUL A;  1IYS A;  3T4L A;  1RCJ A;  3PBS A;  4LCL A;  3W4Q A;  1N9O A;  1K25 A;  3R7W A;  4KZ7 A;  5CGX A;  3IBJ A;  1S1Y A;  1ODV A;  1O07 A;  4Q0J A;  4NXE A;  2P9V A;  4GNU A;  3UE1 A;  4X6T A;  4UHU A;  4GHI A;  1W8Q A;  2IA2 A;  3B3X A;  4JBF A;  5F69 A;  3AGE A;  3LIA A;  2K31 A;  2ZL1 A;  5TFQ A;  5L07 A;  1T1A A;  3WS0 A;  3UPO A;  1TS0 A;  3CAX A;  1YPR A;  1PNE A;  2KOI A;  4X69 A;  4D60 A;  3MXQ A;  1VEU A;  4XUZ A;  3RJU A;  3TJZ C;  2V0W A;  4WF0 A;  3EQV A;  4C75 A;  3CI6 A;  5L8M A;  3BQ8 A;  5F6A A;  2EX6 A;  2Y2N A;  5GL9 A;  3MKF A;  5HAI A;  3QNB A;  4LPZ A;  3C7V A;  1NRF A;  3EGD C;  2QJ5 A;  3HUO A;  4OVD A;  1G5U A;  2PR6 A;  3BFD A;  3FYZ A;  1F2K A;  2XQZ A;  4CPK A;  4QY6 A;  4GD6 A;  1CI8 A;  2XRN A;  3OBF A;  3T4J A;  1W7F A;  1TS6 A;  3BY9 A;  4CLC D;  4BD0 A;  4ARZ B;  4KZ8 A;  3I7J A;  4BEN A;  4KZB A;  1K55 A;  4R3J A;  5DF9 A;  3C5A A;  3BW6 A;  3T1X A;  4NET A;  1OJ5 A;  3LYX A;  3ZFZ A;  3CG5 A;  3MQO A;  1TDG A;  2QPN A;  4HY8 A;  1Y4O A;  1H8Z A;  1VM1 A;  4B9O A;  4GDB A;  2OWH A;  4FUW A;  3VFH A;  4LRY C;  4NXB A;  3MKE A;  4BWI A;  5HDC A;  4GHI B;  2EWV A;  3IS2 A;  5TBM A;  3ZVT A;  2WKR A;  3QP8 A;  4KG5 A;  4PM8 A;  1FCM A;  2UV0 E;  1GSX A;  4E3N A;  1ES2 A;  4OP8 A;  1GA0 A;  5GLB A;  4EES A;  1CJF A;  3UE6 A;  1BT5 A;  2VKS A;  3R4K A;  3LEZ A;  1OTB A;  5BOH A;  5F82 A;  2X71 A;  4R4S A;  2O9A A;  2ZMA A;  3P7N A;  3PBO A;  3ZG8 B;  3KX0 X;  3CLO A;  3BLM A;  5C5K A;  4Y0T A;  3VMA A;  4P0M A;  2L1M A;  2K7S A;  1JWP A;  1Y54 A;  4HJ4 A;  4ESP A;  2PBD P;  4N1H A;  4DXC A;  1F98 A;  2VJW A;  1V9Y A;  2QHK A;  4EUV A;  2NUP C;  4H6J B;  4R3A A;  5FQM A;  2M7U A;  2J9P A;  2A2L A;  1G28 A;  3E2L A;  1TEM A;  4E6W A;  3IF6 A;  4DRT A;  3MZD A;  3ZNT A;  3W4O A;  5L09 A;  3BM6 A;  4R23 A;  2WGI A;  5FAO A;  4MDZ A;  1K54 A;  3N6I A;  1ES3 A;  1FQG A;  1WA9 A;  3C4O A;  2WK0 A;  1XJ4 A;  4WLA A;  5DTT A;  3G30 A;  1KE3 A;  4XT2 B;  1S0W A;  4OH0 A;  4HJ6 A;  2VGL S;  5KZH A;  4RX3 A;  4EEP A;  3HRE A;  5EVE A;  3E98 A;  4R6L A;  5K5B A;  2M7V A;  1H8M A;  2P04 A;  3ZG0 A;  1P97 A;  3EQU A;  1XJ3 A;  3QP6 A;  3DTM A;  1L2S A;  3GMW A;  4L9E A;  3E0Y A;  2WGW A;  1ES4 A;  3CIT A;  1SDE A;  3U4L P;  1K6R A;  2V8F A;  4KZA A;  1KDS A;  1PWG A;  4EV4 A;  5J4E A;  2XA7 S;  1MPL A;  2PYR A;  5D3O A;  3A3D A;  2DRW A;  3FG8 A;  3QHY A;  4DKI A;  3FKV A;  2W0N A;  1IYQ A;  2Y79 A;  3DBA A;  3MS6 A;  4EQ1 A;  5L10 A;  3VOZ A;  3NOU C;  1M6K A;  1PI5 A;  3S7N A;  1EWZ A;  4H6J A;  5E43 A;  3E4Q A;  1OTA A;  3IQA A;  2IWD A;  4GDN A;  5CRF A;  4MN7 A;  4UA6 A;  1STZ A;  1OT6 A;  4KEN B;  1S4R A;  3PR6 A;  1P0Z A;  3DWZ A;  5HSQ A;  3VSL A;  1E4D A;  1T1C A;  3M2K A;  4OON A;  4H8R A;  4O0P A;  5GHZ A;  1TS7 A;  2VEA A;  5JYO A;  2O0Y A;  3ZVW A;  2ZQC A;  3A3F A;  3HVF A;  3LO7 A;  3DAV A;  4Y0U A;  1IOU A;  4WUJ A;  3SS3 A;  5HD3 A;  2ZM2 A;  2ZMV A;  5FEF A;  1ERQ A;  5HWV A;  2VV6 A;  4EEU A;  5L2F A;  1PFL A;  2OOL A;  3HJI A;  1PW1 A;  2OSU A;  3KO6 A;  1BLP A;  2EX8 A;  1MKI A;  3V5M A;  3ZG9 B;  5HAP A;  3H7W B;  2ZM8 A;  4PM9 A;  4P6B A;  3UPP A;  1C3B A;  5M1A A;  1W5D A;  2WGW B;  3LFV A;  4IUH A;  5I94 A;  4I3A A;  5A8B A;  3T4S A;  4WM9 A;  5HW3 A;  1DRM A;  4YOF A;  3KSH A;  1LHY A;  5A92 A;  5E2G A;  1EI5 A;  3CWF A;  1IKI A;  1T19 A;  4O7D A;  3DTK A;  4DXB A;  3LY3 A;  4L0L A;  3A3E A;  2ZQ9 A;  3D72 A;  4GJ4 A;  4EU0 A;  2B02 A;  3BFF A;  4KZ6 A;  3ICY A;  4MBF A;  1BTL A;  3G2Z A;  2VLG A;  5DKL A;  3T1R A;  4CJN A;  4G3K A;  3WWX A;  1MWT A;  2JHE A;  2Z6C A;  2QZ6 A;  5A91 A;  4OOY A;  3M6H A;  3NHQ A;  2GDN A;  3T1Q B;  1VHM A;  4S2K A;  3H82 B;  4HH3 A;  2DMW A;  4X56 A;  1SKO A;  4IUK A;  3JYI A;  3B47 A;  3M6B A;  3IH9 A;  1D1J A;  4ZJ1 A;  1MBL A;  2V0U A;  2C5W B;  3C8C A;  1WYB A;  3T4O A;  1G68 A;  2LB9 A;  5FI7 A;  2WZX A;  4GCZ A;  2ZC7 A;  5CER A;  5EM1 A;  3RTY A;  3KSF A;  1N9N A;  1NLY A;  2GJ3 A;  1O7E A;  3Q7Z A;  5TGF A;  4MCW A;  3OLO A;  5EVI C;  2KLI A;  2FFF B;  3PHY A;  4C3Q A;  3UE3 A;  4ETX A;  1K4E A;  3OPR A;  5EVI A;  3UDX A;  3S7P A;  3O3V A;  1GA9 A;  2QWS A;  2XF3 A;  2WAD A;  4E3L A;  4F3L B;  1XP4 A;  1K6S A;  4HES A;  4JGR A;  2Y2L A;  1MY8 A;  3BFE A;  4ID4 A;  3WS4 A;  1OPX A;  1BZA A;  4L9G A;  2INW A;  3UDF A;  1NYM A;  5J8X A;  3MF0 A;  1L0F A;  4JPM A;  4LRX C;  3E4O A;  4DE1 A;  1ZHH B;  1MWU A;  2J3T C;  1XJ6 A;  4X68 A;  3IWQ A;  2PR5 A;  3MMH A;  3JPU A;  5F68 A;  1CF0 A;  3PBT A;  1A0K A;  1FIK A;  3JVV A;  4NG2 A;  5CX7 A;  1JTG A;  3F1N A;  1YLJ A;  4QU3 A;  1LI9 A;  4EER A;  4YNR A;  3LR3 A;  3LID A;  4A5R A;  2V1B A;  3ZGA B;  5AQ9 A;  4Y2F A;  3W2Z A;  2JKR I;  3IHB A;  3RXW A;  1TDL A;  1VET B;  4QWO A;  4GD8 A;  4KQQ A;  1T18 A;  2H5S A;  1L3L A;  4CLC B;  1K0K A;  3PYP A;  3P09 A;  1XA1 A;  2HP9 A;  3IXB A;  3LIF A;  1MKM A;  3N8L A;  3VOL A;  1DJB A;  3DWK A;  3GRJ A;  1FSY A;  1K54 C;  4EWF A;  4IVI A;  3HUN A;  3FKW A;  4WEL A;  4I5S A;  3IX3 A;  2OLU A;  1FIL A;  4C6Y A;  3ITB A;  4LV1 A;  1CI9 A;  3FZC A;  3IWO A;  3IF6 C;  4OQ0 A;  1UWP X;  3UPN A;  5EPH A;  3S7Q A;  3RH8 B;  2H10 A;  5HD5 A;  2WKH A;  4OQI A;  2JE5 A;  2PAV P;  3SOI A;  1NXY A;  4JXG A;  4S2M A;  3LIC A;  3IWI A;  5FL3 A;  1YKD A;  5FI2 A;  5HPI A;  5HAR A;  5CGS A;  1LT0 A;  1HLU P;  4PPR A;  1ZTU A;  1ESU A;  4LV3 A;  4QD4 A;  5DF8 A;  3LEQ A;  5FQI A;  1MXO A;  3OPH A;  4DDY A;  4I38 A;  1JTD A;  2RCX A;  3FWL A;  2Q9M A;  2NUT C;  4DJ2 A;  5M18 A;  3G35 A;  1MWR A;  4HJ3 A;  4BL3 A;  2Y2H A;  3D9Y A;  2V9A A;  4LCM A;  5FAT A;  2EX2 A;  4Z1W A;  2W3G A;  3CHW P;  5AVF A;  5GLD A;  2XDM A;  4M4X A;  4OPZ A;  4JF5 A;  4LFU A;  2Y8H A;  3IT9 A;  3PTE A;  3O5Y A;  3VP2 A;  4EBL A;  1YLZ A;  1Z6F A;  2ZOI A;  1XA7 A;  1M40 A;  3GTC A;  4X25 A;  3LI9 A;  3NUL A;  3BEC A;  2P7J A;  3NI9 A;  1DP6 A;  1CQA A;  5DTS A;  3Q7V A;  3Q7V B;  3CPT B;  3ZG7 B;  2XFS A;  1I2S A;  3HBR A;  2GNX A;  4HHD A;  1XKZ A;  1PZP A;  4N9K A;  4HEF A;  1W79 A;  1E25 A;  1GSV A;  2A24 A;  4MNR A;  2JC7 A;  5TJJ A;  5CEC A;  1NZU A;  4NK3 A;  4JGO A;  3HJK A;  1GCE A;  2CMN A;  5F1G A;  5HDD A;  3SS5 A; 
#chains in the Genus database with same CATH homology
 1IYQ A;  5HFO A;  4N92 A;  2Y2M A;  4QY5 A;  5HAQ A;  1BLS A;  2B5R A;  3HLD A;  3V39 A;  3VOZ A;  3ZCZ A;  3G4P A;  3S4X A;  3S1Y A;  1E3U D;  1M6K A;  3HLB A;  1CK3 A;  1K55 C;  5EOE A;  3TOI A;  3LCE A;  1YM1 A;  1PI5 A;  1YT4 A;  1EWZ A;  4JKT A;  5FQK A;  1XGI A;  4BJP A;  2HP5 A;  3ZG5 A;  5E43 A;  5F83 A;  2QMI A;  4U0X A;  3IQA A;  3N8S A;  4X53 A;  2IWD A;  3CMZ A;  4GDN A;  4IVK A;  5CRF A;  2PU4 A;  3UE0 A;  3GQZ A;  3PAG A;  1ESI A;  1H8Y A;  4KQR A;  4UA6 A;  3SS4 A;  4D2O A;  4P85 A;  1BLC A;  4KZ5 A;  3IXG A;  1L0G A;  1HZO A;  3RXX A;  4R0Q A;  4KEN B;  5CHJ A;  3IF6 B;  3M2J A;  3ISG A;  4BL2 A;  1QME A;  4S2I A;  4K91 A;  4DE0 A;  2X01 A;  1RGY A;  4GKU A;  4EBN A;  4S2J A;  3DWZ A;  2Q9N A;  1ERO A;  4WMC D;  2JBF A;  3VSL A;  2PU2 A;  4Y0O A;  3C4P A;  1E4D A;  1K57 C;  3DW0 A;  3M2K A;  4OON A;  2J7V A;  2V20 A;  4H8R A;  2G2U A;  2R9X A;  2Z2L B;  3MXR A;  5KMW A;  2A3U A;  3G2Y A;  5GHZ A;  3SH8 A;  4PM7 A;  5JYO A;  1HTZ A;  2WGV A;  1LL9 A;  1Q2P A;  2DNS A;  2P9V B;  4GB7 A;  4OLD A;  4Z9Q A;  2VGJ A;  4ZTK A;  3OCN A;  1ONG A;  2ZQC A;  3ZVW A;  3A3F A;  3HVF A;  3IH8 A;  4B88 A;  5TR7 A;  3LO7 A;  1CEF A;  3BFC A;  3MZE A;  4Y0U A;  5E2F A;  3SS3 A;  1KGE A;  5GHX A;  4MEZ A;  5U47 A;  2XLN A;  2OV5 A;  4U3T A;  2XD1 A;  1MWS A;  2ZM2 A;  3IHA A;  3VFF A;  2Y91 A;  3V3R A;  1ERQ A;  1ALQ A;  3HLC A;  4KZ4 A;  4UA9 A;  4WYY A;  2FFY A;  1XXM A;  4XXR A;  2I72 A;  4S2N A;  5L2F A;  3WRZ A;  1FCN A;  1PW1 A;  2OSU A;  1BLP A;  2EX8 A;  1MKI A;  4FH2 A;  4OPR A;  4N1X A;  4YIN A;  3V5M A;  3ZG9 B;  2WAF A;  5HAP A;  3TG9 A;  2ZM8 A;  1XGJ A;  3NIA A;  4WMC A;  3IXD A;  4MLL A;  4PM9 A;  4P6B A;  3UPP A;  1C3B A;  5M1A A;  1RGZ A;  1NZO A;  1W5D A;  2WGW B;  5I94 A;  2ZM0 A;  1ERM A;  3Q1F A;  5JYP A;  5GHY A;  4EUZ A;  4WM9 A;  2E8I A;  3BLS A;  4Y7P A;  3VP3 A;  3V3S A;  5A93 A;  3MZF A;  1PYY A;  5HW3 A;  5KSH A;  3QNC A;  5DVA A;  3HLG A;  4Q8I A;  3AGF A;  1DJC A;  4F94 A;  2X02 A;  4S2P A;  5E2E A;  4LV2 A;  4DF6 A;  3SS5 A;  1LHY A;  1K56 A;  4IED A;  3WS2 A;  5A92 A;  5E2G A;  3V50 A;  5FA7 A;  5HL1 A;  1EI5 A;  2ZLY A;  5IHV A;  1IKI A;  3IXH A;  4GN2 A;  4ZJ2 A;  4O7D A;  4DXB A;  3LY3 A;  3O86 A;  5GLC A;  4L0L A;  2WKE A;  1S6R A;  2ZQ9 A;  3A3E A;  5EUA A;  2ZQD A;  4JLF A;  4JXW A;  4BD1 A;  4OKP A;  1GHP A;  1KE0 A;  1AXB A;  3MXS A;  5AQ7 A;  4IBR A;  4E3J A;  3BFF A;  3CZD A;  4KZ6 A;  5CHU A;  4MBF A;  5EEC A;  1FCO A;  4BQM A;  1XX2 A;  1BTL A;  2J8Y A;  3G2Z A;  4RYE A;  4JXS A;  4HBU A;  1VQQ A;  1KVM A;  4JF4 A;  3W8K A;  2WZZ A;  4WZ5 C;  3G34 A;  4CJN A;  4OOM A;  3WWX A;  1MWT A;  2JCH A;  3UY6 A;  2QZ6 A;  2WUQ A;  2ZC3 B;  5A91 A;  3WS5 A;  2Y59 A;  3C7U A;  4OOY A;  2XGN A;  3M6H A;  4OOL A;  1BLH A;  2HPB A;  2GDN A;  5CTM A;  4S2L A;  4S2K A;  1WE4 A;  4EBP A;  4JXV A;  3VP4 A;  3N7W A;  4ZBE A;  3PAE A;  4X56 A;  5FAS A;  3OPL A;  2IWC A;  3JYI A;  3M6B A;  5GLA A;  3IH9 A;  5A90 A;  4FH4 A;  2RL3 A;  4ZDX A;  2BG1 A;  2ZC6 B;  1BUL A;  1BUE A;  2XEP A;  3VP1 A;  1IYS A;  5DF7 A;  4ZJ1 A;  1L0E A;  1RCJ A;  1MBL A;  2J9O A;  3GSG A;  3NCK A;  3PBS A;  1YQS A;  2V1Z A;  4LCL A;  4QHC A;  3W4Q A;  4E3O A;  2C5W B;  1K25 A;  4KZ7 A;  1K4F A;  1WYB A;  4WBG A;  5CGX A;  1G68 A;  1ZKJ A;  2HP6 A;  1RP5 A;  2A49 A;  3CJM A;  5FI7 A;  1O07 A;  2WZX A;  2P9V A;  1OME A;  3O88 A;  4GNU A;  3UE1 A;  2ZC7 A;  4UHU A;  4X6T A;  5CER A;  3GVB A;  3E2K A;  1W8Q A;  3B3X A;  4EQI A;  3ZNY A;  1E3U A;  4JBF A;  3AGE A;  5F1F A;  1JVJ A;  1KGF A;  3UDI A;  5TFQ A;  1PI4 A;  3UNW A;  3W4P A;  3WS0 A;  3UPO A;  3WS1 A;  1O7E A;  3Q7Z A;  5TGF A;  2ZQ7 A;  5KSC A;  5AQB A;  5EVI C;  4R4R A;  4X69 A;  2FFF B;  3PBQ A;  4XUZ A;  3SH9 A;  3FV7 A;  3RJU A;  4C3Q A;  3EQV A;  1SHV A;  3UE3 A;  4C75 A;  4B4X A;  1K4E A;  1JWZ A;  1IEL A;  2EX6 A;  2Y2N A;  2Y2I A;  3MKF A;  3OPR A;  5GL9 A;  5HAI A;  3HUM A;  2ZQ8 A;  4GZB A;  3QNB A;  5EVI A;  3C7V A;  2C6W B;  3UDX A;  3O3V A;  1NRF A;  1ZG6 A;  5DTK A;  4UAA A;  3OPP A;  5FI6 A;  5FDH A;  2EXB A;  3HUO A;  4OVD A;  4KQO A;  3VP0 A;  1GA9 A;  3BFD A;  2EFU A;  3FYZ A;  2XF3 A;  2WAD A;  4E3L A;  1I2W A;  2DCF A;  2XQZ A;  4CPK A;  4QY6 A;  4GD6 A;  1CEG A;  1CI8 A;  1XP4 A;  1K6S A;  4HES A;  4B4Z A;  2ZJ9 A;  1YLW A;  4PM6 A;  3Q81 A;  5CEB A;  1W7F A;  4BD0 A;  2Y2L A;  4KG6 A;  1MY8 A;  3BFE A;  3NBL A;  4ID4 A;  2H0T A;  1JWV A;  3O87 A;  4JF6 A;  3PBN A;  4XUX A;  3UN7 A;  3WS4 A;  4KZ8 A;  2PBY A;  1BZA A;  3I7J A;  3GR2 A;  4BEN A;  1ZC2 A;  4KZB A;  1K55 A;  4R3J A;  2WYX A;  5DF9 A;  5EE8 A;  3C5A A;  3UDF A;  1SCW A;  3LY4 A;  3ITA A;  1NYM A;  4MBH A;  1FOF A;  2XR0 A;  1XPB A;  4NET A;  5J8X A;  1L0F A;  4LV0 A;  4JPM A;  4RVA A;  1YMX A;  3ZFZ A;  3GV9 A;  3CG5 A;  1NJ4 A;  1IYP A;  1W8Y A;  4OLG A;  4DE1 A;  3NC8 A;  2H0Y A;  1MWU A;  4X68 A;  4R3B A;  3IWQ A;  2OLV A;  1TDG A;  2QPN A;  4HBT A;  1FSW A;  3PBT A;  3NY4 A;  1H8Z A;  4QB8 A;  4QJG A;  3NDG A;  1VM1 A;  5CXW A;  4UA7 A;  4GDB A;  1JTG A;  4DE2 A;  3ZHH A;  3VFH A;  4PMA A;  1YLJ A;  4QU3 A;  1LI9 A;  4KG2 A;  4E3I A;  2CC1 A;  3MKE A;  3BFG A;  5HX9 A;  1GHI A;  4P87 A;  4A5R A;  3ZGA B;  5AQ9 A;  3VOY A;  3IHB A;  3A3J A;  1BSG A;  3ZVT A;  4KG5 A;  3RXW A;  4PM8 A;  1TDL A;  1FCM A;  4E6X A;  5FQJ A;  2HDU A;  2R9W A;  3HL9 A;  4LEN A;  4E3N A;  3BEB A;  1ES2 A;  1ONH A;  1FR6 A;  1YLP A;  1YMS A;  4OP8 A;  2Y2J A;  4GD8 A;  1GA0 A;  4KQQ A;  1NY0 A;  4S2N C;  5EOO A;  2H5S A;  5GLB A;  3D4F A;  2XD5 A;  3Q07 A;  4FSF A;  2IWB A;  1BT5 A;  5CED A;  2G2W A;  1TVF A;  2XK1 A;  3P09 A;  1XA1 A;  3LEZ A;  2HP9 A;  1LI0 A;  3IXB A;  4M3K A;  3IF5 A;  4IBX A;  4FCF A;  3N4I A;  5BOH A;  5F82 A;  2WKI A;  3N8L A;  2XH9 A;  3N8R A;  1DJB A;  2X71 A;  4R4S A;  5CGW A;  3DWK A;  5G18 A;  2ZMA A;  3GRJ A;  1FSY A;  4MBK A;  1K54 C;  5FQ9 A;  4BLM A;  5E2H A;  2HDS A;  3PBO A;  3ZG8 B;  4EWF A;  4IVI A;  4WEK A;  1PW8 A;  2BLS A;  3HUN A;  5M19 A;  3NDE A;  3BLM A;  4ZJ3 A;  4Y0T A;  3VMA A;  3FKW A;  4P0M A;  4WEL A;  3S22 A;  2OLU A;  1JWP A;  1NYY A;  1Y54 A;  5EVL A;  1K57 A;  4N1H A;  4R1G A;  4C6Y A;  4DXC A;  3ITB A;  5AQA A;  4DDS A;  4N9L A;  2EFX A;  4LV1 A;  1SDN A;  5FQQ A;  5CTN A;  1CI9 A;  3FZC A;  3IWO A;  3IF6 C;  4OQ0 A;  3SH7 A;  3ZDJ A;  3HLW A;  2Y4A A;  3UPN A;  4E3M A;  5EPH A;  3VSK A;  4PM5 A;  5EVI B;  1IYO A;  2H10 A;  2Y2P A;  5EVI D;  4K0X A;  1DJA A;  2UWX A;  2WKH A;  2Z2M B;  3PBR A;  2JE5 A;  4OQI A;  1SKF A;  3SOI A;  1NXY A;  4JXG A;  4S2M A;  1ES5 A;  5FQM A;  5FSR A;  3IWI A;  3P98 A;  4FD8 A;  2ZC5 B;  1Q2Q A;  4OPQ A;  1KE4 A;  3HLE A;  2J9P A;  5FI2 A;  1N4O A;  1WYC A;  5HAR A;  5CGS A;  1K56 D;  2HDR A;  3E2L A;  2ZC4 B;  4QD4 A;  4PPR A;  4LV3 A;  1ESU A;  4YFM A;  2EX9 A;  5DF8 A;  1KGG A;  1PWD A;  1TEM A;  4E6W A;  4E3K A;  4GOG A;  1H5X A;  3IF6 A;  5FQI A;  1MXO A;  1I5Q A;  3OPH A;  3UO9 A;  1GHM A;  3MZD A;  2Y2K A;  4DDY A;  4DRT A;  3WRT A;  3ZNT A;  1PZO A;  1JTD A;  2RCX A;  3TSG A;  4K0W A;  1L0D A;  3BRM A;  2XFT A;  4KZ3 A;  3W4O A;  3FWL A;  1PIO A;  3G31 A;  2Q9M A;  1KVL A;  3BM6 A;  4OQH A;  5M18 A;  1PWC A;  4R23 A;  2WGI A;  3G35 A;  5FAO A;  1MWR A;  1K54 A;  4BL3 A;  5FAQ A;  2Y2H A;  1LLB A;  1N9B A;  3N6I A;  1ES3 A;  1FQG A;  4ZAM A;  1U60 A;  4WEJ A;  5FAP A;  3C4O A;  2WK0 A;  4LCM A;  5FAT A;  2EX2 A;  1LL5 A;  3A3I A;  1KDW A;  5DTT A;  1HVB A;  3G30 A;  5CHM A;  1J9M A;  1KE3 A;  5GLD A;  2HDQ A;  3AGD A;  4WZ5 A;  2XDM A;  1YLT A;  3BYD A;  4OPY A;  1S0W A;  1FR1 A;  2VGK A;  4JF5 A;  4OH0 A;  4OPZ A;  4RX2 A;  4WZ4 A;  1K38 A;  3IT9 A;  3VP2 A;  3PTE A;  3MBZ A;  4EBL A;  5KZH A;  1YLZ A;  4S2O A;  4KZ9 A;  4RX3 A;  3HRE A;  3G32 A;  3OCL A;  1IKG A;  3ZG0 A;  1ZG4 A;  1Z6F A;  4U0T A;  1QMF A;  1XA7 A;  2V2F F;  1M40 A;  3EQU A;  3DTM A;  3GTC A;  2Y2O A;  4OQG A;  3BEC A;  3NI9 A;  1L2S A;  3GMW A;  4X55 A;  2ZD8 A;  3Q7V A;  3Q7V B;  5DTS A;  2ZQA A;  2WGW A;  3ZG7 B;  2XFS A;  2Y2G A;  1ES4 A;  1I2S A;  2EXA A;  1IEM A;  3HBR A;  3OC2 A;  1SDE A;  3Q82 A;  1XKZ A;  3HLF A;  4OP5 A;  1PZP A;  1K6R A;  4KZA A;  1KDS A;  4N9K A;  4HEF A;  3OZH A;  1PWG A;  2Y55 A;  1W79 A;  1DY6 A;  1E25 A;  4EV4 A;  4MNR A;  1G6A A;  2JC7 A;  3MFD A;  1YLY A;  5CEC A;  2WAE A;  1MPL A;  4RA7 A;  1HD8 A;  4DE3 A;  1NZU A;  5D3O A;  3A3D A;  2DRW A;  4NK3 A;  2P74 A;  2Y2Q A;  3QHY A;  1GCE A;  4DKI A;  5F1G A;  3FKV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...