4UA7A

Ctx-m-14 class a beta-lactamase in complex with a non-covalent inhibitor at sub-angstrom resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
ETSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-14
publication title Ligand-Induced Proton Transfer and Low-Barrier Hydrogen Bond Revealed by X-ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 96
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ua7A00
4R23A 2Y2HA 5AQAA 4N1XA 4ZAMA 4DKIA 1WE4A 2RL3A 1BLHA 3ZG8B 5EVIC 4XXRA 4U0XA 3BFDA 3DWZA 2OLVA 2QMIA 4KZBA 5BOHA 2QPNA 1GA9A 3ITAA 1BLCA 2Y2QA 4OKPA 3EQUA 4KZ3A 5HW3A 3OPPA 2I72A 2XR0A 4S2IA 2HPBA 3GQZA 4N1HA 4X55A 4MLLA 4DE3A 5J8XA 3HUNA 4KZ9A 4JLFA 3IF6B 4ZDXA 5L2FA 3IHAA 4GD8A 5FQIA 2J8YA 1BUEA 2GDNA 5F1GA 1H8ZA 1E4DA 4WMCD 3N8SA 4OP8A 1FCNA 5M1AA 3PAGA 3UE0A 4LENA 3VP4A 1FCMA 4F94A 3NDGA 2Y4AA 3CG5A 5M19A 2EFXA 1LHYA 3PBRA 2DNSA 3G30A 4XUXA 1K6RA 1G68A 1JTGA 2EX8A 2J9OA 1VQQA 3W4OA 1ZKJA 5CECA 4GDNA 4S2KA 1K56A 1YM1A 1HTZA 1LL9A 3HUMA 3LY4A 3HUOA 2IWBA 3VP2A 3QNCA 3BECA 3IH9A 1PWCA 1NXYA 1RP5A 3N8LA 1LI0A 4PM9A 1W7FA 1PI5A 2Y2NA 3FV7A 3ZCZA 4RYEA 4PMAA 5HX9A 2RCXA 5FATA 5TGFA 3ISGA 1KGEA 4YINA 1XXMA 5EE8A 4KQQA 1DJAA 2ZM2A 5FQJA 3MZFA 4EBLA 5FAQA 1PW8A 5FDHA 4HESA 4P0MA 2C6WB 5EVID 3OCNA 4XUZA 3A3IA 1EI5A 3LY3A 4UA6A 5E43A 1MKIA 1PIOA 4C3QA 3OZHA 2ZM0A 2ZM8A 2Y91A 4KG6A 4WM9A 4R1GA 3OPHA 2XD5A 3IF6A 1XPBA 3CZDA 4JF5A 4WZ5C 3IH8A 4Y0UA 5FA7A 3HLCA 4OQHA 4R0QA 5DTTA 2H0TA 3G2YA 2ZQCA 5DVAA 2VGKA 3TSGA 1DY6A 3WS0A 2CC1A 4UHUA 5FI7A 4X56A 3MBZA 3OCLA 1BLPA 4OQIA 1BLSA 3IWQA 4RX3A 3V5MA 1IYSA 2DRWA 2XLNA 2ZQAA 3P09A 2JC7A 1ALQA 4S2NC 5CTNA 3VP0A 5TR7A 1YQSA 3JYIA 1FCOA 1KVMA 2ZC5B 3FKVA 3Q81A 1PWGA 1W79A 1TVFA 2WYXA 2Y59A 3PTEA 1PW1A 2HP6A 1MBLA 4MNRA 2XFTA 1K57A 1MWSA 4S2LA 2C5WB 1XGIA 4WZ4A 1YMSA 2XGNA 1J9MA 4B88A 4IBRA 2R9XA 3O86A 2HDRA 3WS5A 4GN2A 2OLUA 2VGJA 3ZFZA 1K25A 1XA7A 1BULA 2Y2JA 4EQIA 1N4OA 1YLPA 5A92A 4MBFA 2Y2MA 1HZOA 3IQAA 3A3JA 3S4XA 3M6BA 2WKEA 2OV5A 3N7WA 1QMEA 1DJCA 4FCFA 1SDEA 5AQ9A 1JWZA 1N9BA 4EWFA 4IVKA 2Z2LB 4OPRA 5HL1A 1KDWA 3HBRA 4GKUA 4KQOA 4OONA 3AGFA 3NIAA 1M6KA 3Q7VB 3SS4A 5EVIB 4C6YA 1JVJA 4N9KA 1L0FA 1KGFA 3ZG9B 5F82A 3VFHA 3PBSA 3IXHA 2XK1A 3LEZA 4OOYA 2BLSA 3IXBA 3O88A 3G32A 5DTSA 3M2KA 3NI9A 4BJPA 3G4PA 5FAOA 1ONHA 5KMWA 3BLMA 3HLWA 4LCLA 3CJMA 3SH9A 2ZMAA 2Y2PA 1IYOA 5HAQA 4RVAA 3FKWA 4Y0OA 2H10A 5FQMA 1NZUA 1PZPA 5CRFA 5HFOA 2HP5A 2WGWB 3UPNA 1TEMA 2PU2A 4S2MA 3AGEA 1JWPA 2FFFB 4DDYA 1MWRA 4P85A 2ZJ9A 5FASA 1ESIA 5D3OA 5A90A 1NYYA 3FWLA 3ZG7B 1K6SA 4ZJ2A 1Y54A 3S1YA 2WGIA 4OVDA 1ERMA 3V3RA 1XP4A 1ES5A 4IBXA 5FI2A 3B3XA 4LV2A 5A93A 1YLYA 3GV9A 3Q07A 5GLDA 1EWZA 1Z6FA 3N8RA 4Z9QA 5GLCA 4EBNA 3MXSA 1E3UD 3GRJA 4OPQA 4EV4A 4DDSA 2ZQ9A 3OC2A 4M3KA 3WS2A 4JXWA 2R9WA 1L0GA 5U47A 3Q7ZA 4Q8IA 2DCFA 3TOIA 2JBFA 3UDIA 3UDFA 1Q2PA 4QHCA 1KE0A 4GB7A 3Q7VA 3VSKA 2V20A 5EVIA 2ZD8A 1IKIA 2ZQDA 5KSHA 2XQZA 3HLFA 2B5RA 4DXBA 2IWDA 4LV3A 5CXWA 4H8RA 1QMFA 1K54A 4LCMA 3IWOA 3VOYA 3GSGA 1K55A 4IVIA 1XGJA 1MY8A 2WZXA 4B4XA 1IELA 1MWUA 2WAEA 2WKIA 3C4PA 4CJNA 5GLBA 3MFDA 1O7EA 5E2FA 3WRTA 3ITBA 4BD0A 2FFYA 3Q82A 3QHYA 4DE1A 2J9PA 2ZC4B 1GHIA 4S2PA 4PM6A 2WKHA 1H5XA 1MWTA 1PWDA 2EXBA 4WEKA 3ZG5A 2H5SA 5DTKA 1K4FA 1K56D 4OPYA 3UN7A 2OSUA 3E2KA 5CEDA 3SH7A 2X02A 2EFUA 3N6IA 3W8KA 1ES4A 4X6TA 2ZC6B 3ZHHA 4PM5A 4K0XA 4FH4A 5CGWA 2XD1A 1AXBA 3HLDA 3GTCA 1K57C 4PM8A 4UA7A 3A3EA 4JF6A 3M6HA 4QB8A 3NCKA 2Y2OA 4ZJ3A 4P87A 2J7VA 5AQ7A 3GVBA 4R4RA 1NYMA 5AQBA 4KG2A 4RA7A 4GD6A 1L0DA 1SKFA 3IT9A 4OOMA 2ZC7A 4QJGA 4KZ8A 4S2OA 4C75A 4E6XA 5CEBA 5EPHA 4EUZA 1KGGA 2Z2MB 4L0LA 3UNWA 5DF7A 3D4FA 4GDBA 1GHPA 3E2LA 4JBFA 4RX2A 1W8YA 2Y55A 4E3JA 1ESUA 2Y2LA 1YT4A 4HBTA 4DE0A 4KENB 2HDQA 3BRMA 4KG5A 5EOEA 3VSLA 1KE4A 4UAAA 4U0TA 4E3MA 5HAPA 2H0YA 3O87A 1SHVA 4FH2A 4HBUA 1IYQA 1O07A 5F1FA 2WADA 5F83A 1WYBA 4ZJ1A 3UPPA 4OLDA 5HARA 1YLTA 1FR1A 3IXDA 4OQ0A 2EX2A 3HLBA 4N9LA 5DF8A 3BEBA 4R4SA 4BLMA 5I94A 1KVLA 3EQVA 4U3TA 3SOIA 2WGVA 3BYDA 1BTLA 3N4IA 3W4QA 3SS3A 4K91A 1MXOA 2X01A 1G6AA 3IXGA 5CHUA 3UE1A 4A5RA 1M40A 3ZVWA 1EROA 3M2JA 2ZC3B 5HAIA 1PYYA 4WELA 4D2OA 3C7VA 4JF4A 3VOZA 4WMCA 5GLAA 4HEFA 1BSGA 2ZLYA 3LO7A 5DF9A 1GCEA 5EUAA 3ZDJA 2EX6A 2Y2GA 4QY5A 1NRFA 4E3IA 1W8QA 1I5QA 2A49A 1LI9A 1E3UA 2Q9NA 5GHYA 4YFMA 1KE3A 1W5DA 4JXGA 3V39A 5E2EA 2HP9A 4ZBEA 1ZG6A 1MPLA 2IWCA 2V1ZA 3IF5A 2G2WA 3GR2A 1FSWA 3WS1A 4E3KA 4QD4A 2A3UA 4OPZA 4OH0A 1RGZA 3HREA 1ONGA 1CEFA 3ZVTA 1IEMA 3Q1FA 1HVBA 3ZG0A 5EVLA 4IEDA 4OQGA 2QZ6A 2JCHA 2Q9MA 4GZBA 3PBNA 3I7JA 4GOGA 1CI9A 2HDUA 3BFGA 1K54C 5CHJA 1VM1A 4Y0TA 4KZ7A 3PBQA 4LV0A 4BD1A 1K55C 5KSCA 4KZ5A 1BZAA 1E25A 1ERQA 5FQQA 1XA1A 2BG1A 4GNUA 3MKEA 3BM6A 3G34A 2Y2KA 2XEPA 1XKZA 1Q2QA 2PU4A 3G2ZA 3CMZA 3IHBA 1CEGA 2XF3A 3NY4A 1FOFA 3MXRA 4S2JA 4UA9A 1WYCA 4WBGA 1IKGA 1ES2A 3OPLA 3VMAA 2XFSA 4PM7A 2E8IA 2X71A 4QU3A 3UY6A 4CPKA 3IWIA 3TG9A 4K0WA 1TDLA 3IF6C 4X69A 3A3FA 4PPRA 4JXSA 5KZHA 3RXXA 1S0WA 2P9VB 1KDSA 1RGYA 1CK3A 2G2UA 2WGWA 4QY6A 5FQ9A 3WRZA 3G31A 2JE5A 1I2SA 3ZNTA 1FSYA 1XX2A 5GHZA 1PI4A 1BT5A 3HVFA 3WS4A 4E6WA 3VFFA 3ZGAB 4DRTA 3MZDA 5FAPA 3SS5A 5CGXA 3FZCA 3GMWA 5E2GA 4E3NA 3A3DA 3NBLA 4P6BA 3UO9A 4OLGA 4B4ZA 3PBOA 1K4EA 5G18A 5CTMA 3FYZA 1TDGA 4BQMA 4KZAA 2P74A 3BFFA 1GHMA 4JKTA 1ZG4A 3BLSA 4N92A 3RJUA 3HL9A 4E3LA 1ES3A 2V2FF 2XDMA 2ZQ7A 1PZOA 1H8YA 1HD8A 1IYPA 2XH9A 3BFCA 3MZEA 3O3VA 3UDXA 3P98A 5TFQA 1JTDA 3VP3A 5EECA 1NY0A 3C4OA 4MBKA 4ZTKA 4MBHA 3HLGA 3WWXA 4R3BA 4JXVA 3V3SA 5M18A 2EXAA 1FR6A 3OPRA 4OP5A 5CERA 1L2SA 4WZ5A 2UWXA 4X68A 4Y7PA 2WUQA 5CHMA 3AGDA 3UE3A 1NJ4A 1SDNA 3PAEA 2P9VA 2WK0A 3ZNYA 3DW0A 3PBTA 4DF6A 3BFEA 3W4PA 3NDEA 4LV1A 5JYPA 1L0EA 1NZOA 4WEJA 1CI8A 4MEZA 1ZC2A 4O7DA 4S2NA 1DJBA 3NC8A 3QNBA 1SCWA 4OOLA 1YMXA 4X53A 1C3BA 4EBPA 5GL9A 1YLWA 4ID4A 5A91A 3HLEA 1OMEA 3C5AA 1JWVA 3SH8A 3V50A 2EX9A 4DXCA 1YLZA 1YLJA 1S6RA 1U60A 4KQRA 4R3JA 2Y2IA 4FSFA 5JYOA 2ZQ8A 4WYYA 4E3OA 1LL5A 3UPOA 1LLBA 4KZ4A 1GA0A 3LCEA 3DWKA 3C7UA 4JPMA 4NK3A 5FI6A 4BENA 2HDSA 5EOOA 4KZ6A 5GHXA 3S22A 2WZZA 5CGSA 4NETA 3MKFA 4BL2A 4DE2A 5FQKA 5IHVA 1K38A 2WAFA 3VP1A 3G35A 3DTMA 5E2HA 1RCJA 1I2WA 1FQGA 2PBYA 5FSRA 3RXWA 4BL3A 4FD8A
chains in the Genus database with same CATH superfamily
1MC0A 2Y2HA 4DKIA 1WE4A 3MJQA 3BW6A 3ZG8B 4XXRA 3BFDA 4KZBA 2A24A 3QP1A 1L3LA 2QPNA 3ITAA 4OKPA 2I72A 2XR0A 2HPBA 3LFVA 4N1HA 4X55A 4ZRRA 3NOPC 4PAUA 2W3HA 3F1PB 1H8ZA 4OP8A 1YPRA 1FCMA 5M19A 4MMNA 2EFXA 2EX8A 1VQQA 5CECA 2V8CA 1W63M 1PWCA 1RP5A 4PM9A 1W7FA 3TW8A 3DBAA 5HX9A 1OJGA 3ISGA 1W63Q 5EE8A 3KSIA 3LIEA 4KQQA 4EBLA 1CQAA 2GJ3A 5EVID 3D9YA 1YSQA 4UA6A 1OT6A 3ZQ5A 3NOTC 3OPHA 4FUWA 3CZDA 4WZ5C 2GZAA 1T18A 4OQHA 2L4RA 2CC1A 3LIFA 4BBTA 2ZQAA 5CTNA 1N9NA 1FILA 1YQSA 3JYIA 3SZTA 3JVVA 1PWGA 4LRXC 1K0KA 2VGLS 2HP6A 1MBLA 2XFTA 3NJAA 3LR0A 3MXQA 2Z6DA 4LPZA 4Y13A 1YMSA 3GDIA 4IBRA 3EGXC 2NUTC 3ZFZA 1N4OA 1XJ4A 1QMEA 1DJCA 4HJ6A 3QP5A 5IS1A 3JPUA 3F1OA 5AQ9A 1JWZA 4EWFA 2PRFA 4GKUA 3NIAA 4C6YA 4FOFA 4N9KA 5HWVA 3BY8A 2XK1A 3EWKA 4OOYA 5DTSA 5FAOA 3HLWA 2ZMAA 5F6AA 3T4QA 3OLOA 3FKWA 3H82B 1PZPA 5CRFA 2HP5A 4WN5A 3W2ZA 2FFFB 4P85A 5A90A 2AVXA 4ZJ2A 3MFXA 3V3RA 1XP4A 1ES5A 2BTFP 5A93A 4I5SA 5GLCA 3GRJA 4OPQA 2Y8HA 2ZQ9A 3OC2A 1Z09A 4JXWA 5HD3A 1KE0A 3OBFA 5EVIA 2XQZA 4XT2B 2IWDA 2B02A 3A0VA 4LV3A 5CXWA 2OAQ1 4D60A 4HHDA 3UB7A 3PHYA 3LYXA 1K54A 4LCMA 1K55A 2O99A 1XGJA 1MY8A 4GHIA 2M7UA 4B4XA 2K7SA 2VKSA 1MWTA 1D06A 1K56D 4MDZA 2HV1A 3W8KA 3ZHHA 4K0XA 5HWTA 5CGWA 1T1BA 3GTCA 3KSGA 2ZOIA 4PM8A 2PYRA 1OT9A 1NYMA 4RA7A 3IT9A 5FDSA 2ZC7A 4KZ8A 2W1TB 4L0LA 2JN7A 5DF7A 3E2LA 2Y55A 4KUKA 2Y2LA 4HBTA 4KENB 2HDQA 2W3DA 4B9OA 5EFWA 1PRQA 3UB9A 4E3MA 1X0OA 4FH2A 1SHVA 1FR1A 3IXDA 3MF0A 3HLBA 4X25A 4X1MA 4UQIS 4H6JA 1F2KA 3BYDA 3IXGA 4R6LA 3M2JA 3C7VA 1LSWA 3CITA 4JF4A 3VOZA 2QKPA 3PR6A 1KOUA 1BSGA 4E3IA 2Y2GA 2XA7M 1NRFA 4QY5A 3LGOA 3V39A 3B33A 3IBJA 4ZBEA 2V1ZA 2G2WA 1FSWA 2JKTI 1OTIA 2A3UA 5IT5A 4OH0A 1A0KA 1IEMA 1HVBA 5HPFA 1TD5A 4IEDA 3PBNA 4DJ2A 5CHJA 4Y0TA 4LV0A 5KSCA 2PU4A 2XF3A 3C2WA 1ACFA 4PM7A 2E8IA 3IS2A 4Q0JA 4K0WA 3BJNA 1EW0A 3ULFA 2WGWA 5HSQA 5FQ9A 4HJ4A 3G31A 1FSYA 1BT5A 5DKLA 3R4KA 3VFFA 3ZGAB 4DRTA 3U2AA 3MZDA 1MKMA 1G6OA 5FAPA 4B93A 3NBLA 5LBRA 4CLCC 4B4ZA 5CTMA 2PT7A 5EVEA 4KZAA 3F1OB 3BLSA 3RJUA 1ES3A 4R38A 2H28A 2XH9A 3C8CA 3P98A 1NY0A 4ZTKA 2EA9A 3HLGA 4JXVA 3BQAA 2EXAA 3OPRA 1AWIA 3T1XA 1L2SA 4WZ5A 5CHMA 3IBRA 2WK0A 3ZNYA 4DF6A 4LRYC 3W4PA 1WA9A 4WEJA 4MEZA 1T19A 2JKTM 1SCWA 1C3BA 4KQDA 5A91A 3SH8A 3V50A 4DXCA 3NOUC 2Y2IA 2ZQ8A 4WYYA 5G4ZA 4RQ9A 4E3OA 1LL5A 1UGUA 2JKFA 4KZ4A 3LCEA 3DWKA 3C7UA 3LIDA 4HIAA 2PBYA 4BL3A 4YNRA 2EWWA 4GHIB 2RL3A 1BLHA 5EVIC 5J4EA 2QMIA 2VA0A 3EQUA 3OPPA 3S7OA 4GS9A 4S2IA 2O9BA 1GSWA 4JLFA 5FQIA 2J8YA 1BUEA 1FCNA 4LENA 4EEPA 2O9CA 2Y4AA 3CG5A 4BBUA 3LR4A 4I3IA 1K6RA 3VV4A 1ZKJA 4S2KA 1YM1A 1LL9A 3HUMA 3HUOA 3VP2A 3N8LA 3ZCZA 1TS6A 4LLOB 3FV7A 5FATA 5TGFA 3H7WA 1KGEA 4YINA 2WKRA 2QJ7A 4QWOA 2G7UA 5FQJA 5TBMA 5FAQA 5FDHA 5HDCA 4GJ4A 4P0MA 2W3FA 1EI5A 1Y4OA 2YKFA 1MKIA 1PIOA 3BY9A 3OZHA 2Q0OA 4MN5A 3T1RA 3NULA 3IF6A 3IH8A 4G3VA 3HLCA 4JGOA 5DTTA 1VB6A 4UHUA 3OCLA 4IUHA 1BLPA 1BLSA 4RX3A 4S2NC 5TR7A 3IX3A 3Q81A 2WYXA 2Y59A 3MMHA 2Z6CA 1MWSA 5FEFA 2XGNA 4B88A 4CQHA 4EQ1A 1BULA 2Y2JA 3KSFA 4GW9A 4F3LB 1FIKA 1UWPX 1HZOA 3M6BA 2WKEA 1TS8A 2VEAA 3R7WB 3D72A 2Z2LB 3HBRA 4ESPA 3Q7VB 1M6KA 4Y2FA 4P6ZM 1L0FA 1KGFA 4WLAA 3PBSA 3LEZA 3G32A 3M2KA 2QWSA 4BJPA 2JHEA 4E04A 4LCLA 3CJMA 2H10A 1NZUA 2ZL1A 2WGWB 2PU2A 4S2MA 3AGEA 4DDYA 1MWRA 1D7EA 3MR0A 2ZJ9A 3CLOA 1K6SA 2J3TD 1Y54A 3S1YA 4OVDA 3D3OA 4IBXA 1TS0A 1XJ3A 3FG8A 1EWZA 5CX7A 3MXSA 1TF1A 4EV4A 4M3KA 1L0GA 4Q8IA 3FPWA 2JBFA 3UDIA 4QHCA 1IKIA 3DTKA 2D01A 3CPTA 2P04A 1HLUP 3K2NA 2W3GA 3GSGA 4BMWA 2WKIA 1XJ6A 3C4PA 5TJJA 2HGVA 3MFDA 5J3WA 3QHYA 2J9PA 1GHIA 2WKHA 1H5XA 2EXBA 4WEKA 2JKRI 5DTKA 1K4FA 4OPYA 3UN7A 2VLGA 3E2KA 5CEDA 3KYEA 3N6IA 4NEED 4PM5A 4X6TA 1ZHHB 4FH4A 4JF6A 4QB8A 4ZJ3A 2J7VA 4KG2A 1L0DA 4OOMA 3A0SA 4CLCA 2Z2MB 3IX4A 2PYPA 3RFBA 4HY8A 1YT4A 2UV0E 5HZHA 4X1LA 3GECA 3VSLA 2HJ9C 5FL3A 5HAPA 4HBUA 1O07A 2WADA 5F83A 4ZJ1A 2V9AA 5HARA 3S7NA 5DF8A 5HDSA 1G5UA 4R4SA 4BLMA 5I94A 1VETB 2FH5A 3N4IA 4K91A 2X01A 3ZVWA 1EROA 4WELA 1NLYA 4D2OA 3MQQA 2ZLYA 3LO7A 3H7WB 1GCEA 1S1YA 1I5QA 2A49A 3MQOA 1KE3A 3VE4A 3IF5A 5TBMB 2PDRA 3WS1A 4E3KA 3B42A 3E4QA 3LEQA 4OPZA 2KDKA 3G6OA 3ZVTA 5EVLA 2JKRM 3T1QB 2QZ6A 4WF0A 4GOGA 1CI9A 3BFGA 4L9GA 2BG1A 4GNUA 3MKEA 3BM6A 2XEPA 1STZA 1CEGA 3LR5A 4Z1WA 4WBGA 3MXRA 4S2JA 3OPLA 2XFSA 4QU3A 4I3AA 4CPKA 2PR5A 2ZMFA 3IF6C 3A3FA 2KOIA 3RXXA 1S0WA 2P9VB 2VV7A 1KDSA 2G2UA 3WRZA 2JE5A 1XX2A 3HJIA 2Y79A 2O0YA 4Y15A 4IJGA 4JGRA 1OJ5A 1T1AA 4PKYA 5E2GA 4E3NA 4P6BA 4OLGA 3PBOA 1K4EA 5G18A 3FYZA 5FEGA 2L1MA 2W3EA 1GHMA 4JKTA 2LB5A 3HL9A 3F1NA 2ZQ7A 1IYPA 3T1SA 3UDXA 5TFQA 3VP3A 3WWXA 3B47A 1FR6A 4OP5A 2UWXA 4X68A 2A24B 3AGDA 4JGQA 3UE3A 1NJ4A 3PAEA 2FZ0A 3T4OA 1L0EA 1CI8A 4ARZA 4S2NA 3NC8A 2P08A 3TJZC 5GL9A 1YLWA 2B18A 3HLEA 3C5AA 3KYQA 1SKOA 2EX9A 1YLJA 3VE3A 4R3JA 5JYOA 1OTDA 3C38A 4HP9A 2P7JA 4ETXA 1GA0A 4NK3A 3S7QA 2W27A 2WZZA 1JNUA 2XROA 2XA7S 3MKFA 4BL2A 1IFQA 4DE2A 4EETB 1K38A 2WAFA 5E2HA 4HI4A 1GSXA 4FD8A 1S4SA 3CWFA 4R23A 3TE8A 2GX5A 2J3WA 1H8MA 3DWZA 1VEUA 5BOHA 1GA9A 1ZTUA 3LIBA 1F9IA 2Y2QA 5HW3A 4LRZE 3GQZA 4Y5FA 4I3JA 5J8XA 5L2FA 4ZDXA 3IHAA 5HDDA 4GD8A 3QP4A 2W0NA 5F1GA 1E4DA 4WMCD 3N8SA 3UE0A 3PAGA 2OOLA 2HJEA 1LHYA 1JTGA 4M4XA 4GDNA 3BQ8A 1K56A 3LY4A 2PAVP 2IWBA 3QNCA 4CLCB 1LI0A 2Y2NA 3CAXA 4I38A 3PYPA 3UMEA 3QP2A 1S66L 4NKPA 2ZM2A 3MZFA 4NXGA 3OCNA 2VZWA 3A3IA 5E43A 2XSSA 3E4PA 2ZM0A 2ZM8A 2Y91A 4KG6A 4WM9A 4JF5A 3F1PA 4Y0UA 5FA7A 3UMDA 2H0TA 3G2YA 5DVAA 3TSGA 2VGKA 2YKHA 2QHKA 1OTAA 4R3AA 4X56A 4OQIA 3V5MA 1IYSA 3VP0A 2XLNA 3P09A 2I9VA 1FCOA 1KVMA 2ZC5B 3FKVA 1W79A 1NRJA 1OPXA 4MNRA 4WZ4A 2J3TC 1J9MA 2A2LA 2R9XA 2ZOHA 4GN2A 2OLUA 2VGJA 3QP8A 1XA7A 5A92A 4MBFA 3UE6A 1BYWA 3S4XA 2OV5A 3N7WA 1LSVA 3LR3A 4R70A 4OONA 3AGFA 4PKYG 5EVIB 4I39A 3SW1A 3ZG9B 5F82A 3IXHA 3G4PA 1ONHA 3OOVA 3UB6A 1IYOA 3T4KA 4Y0OA 5HFOA 3UPNA 1JWPA 5FASA 5D3OA 1DRMA 3FWLA 3TRCA 3H9WA 3NECA 2WGIA 4LV2A 5DKKA 1YLYA 2MJ6A 3Q07A 5GLDA 4Z9QA 3N8RA 4EBNA 3LI9A 1E3UD 2IA2A 3KX0X 3LI8A 3WS2A 2PBDP 3HJKA 5U47A 3F1NB 5F68A 1P0ZA 1F5MA 1J3WA 4MN7A 1Q2PA 4GB7A 1S67L 3VSKA 2ZQDA 4FTXA 5KSHA 3UB8A 2B5RA 3UB5P 4H8RA 3KYZA 3VOYA 5DJUA 4IVIA 1MWUA 3WRTA 1MZUA 2FFYA 5HL6A 1N9OA 2V1AA 4BD0A 4S2PA 4PM6A 1CF0A 4YWZA 1PWDA 3ZG5A 3CHWP 4PHTA 2OSUA 4H6JB 2X02A 2EFUA 2ZC6B 1SKOB 2XD1A 4Q0HA 3HLDA 1K57C 2B95A 4UA7A 3JVUA 3M6HA 2Y2OA 3P7NA 5AQ7A 4R4RA 3VOLA 5CEBA 1T1CA 4C75A 5EPHA 3L9KA 3T4TA 4GDBA 1GHPA 4RX2A 1W8YA 3DTEA 1ESUA 4DE0A 3BRMA 1VEUB 4UAAA 4U0TA 4EUVA 2K31A 2H0YA 3O87A 5F1FA 1YLTA 1OTEA 2EX2A 2L0WA 3BEBA 4K08A 1KVLA 3EQVA 4U3TA 3SOIA 3W4QA 3IS2B 3UE1A 4YOFA 4II7A 1DP9A 2ZC3B 5HAIA 1S1ZA 3E4OA 4HEFA 5EUAA 5DF9A 1W8QA 2Q9NA 1E3UA 4YFMA 5J7EA 5E2EA 1V9ZA 3LICA 1ZG6A 3GR2A 4QD4A 2M7VA 1CEFA 5AVFA 3Q1FA 4NG2A 4OQGA 2JCHA 5EM1A 3I7JA 2KLIA 2PR6A 3PBQA 4EEUA 1BZAA 1ERQA 1H3QA 1XA1A 2Y2KA 3G2ZA 3CMZA 3IHBA 1FOFA 4UA9A 5K5BA 1SZVA 1ES2A 3VMAA 3UY6A 3IWIA 3T12B 3TG9A 1TDLA 4JXSA 5KZHA 5HWWA 1RGYA 1VHMA 4QY6A 3ZNTA 3T4LA 3C30A 1PI4A 3WS4A 2LB9A 4O8GA 3RH8B 3V67A 5CGXA 3FZCA 3GMWA 3A3DA 1TDGA 2P74A 3BFFA 1ZG4A 1DP6A 1YKDA 4E3LA 2V2FF 3IX8A 4Y3IA 1PZOA 2VJWA 2CMNA 1H8YA 1HD8A 3BFCA 3O3VA 1UWNX 2O9AA 1JTDA 5EECA 3C4OA 4MBHA 4BBVA 4R3BA 2DMWA 5CERA 1LSXA 2E8JA 4DJ3A 1F98A 1SDNA 3DW0A 3PBTA 3BFEA 4GS9B 2XRNA 4LV1A 3PXPA 5DFYA 2VGLM 1NZOA 4O01A 2OWJA 1ZC2A 5MC7A 4QPRA 1CJFA 1YMXA 4OOLA 4X53A 4LFUA 4ID4A 1OMEA 1JWVA 1LL8A 1YLZA 1S6RA 4KQRA 4Y17A 4HJ3A 3CUEC 1LLBA 5FI6A 1OTBA 2HDSA 4KZ6A 5GHXA 5CGSA 3KSHA 3HCYA 4HNBA 5FQKA 3VP1A 3FC7A 3G35A 3EGDC 1FQGA 5AQAA 4N1XA 4ZAMA 4U0XA 3ICYA 2OLVA 1BLCA 4KZ3A 1N9LA 4MLLA 4DE3A 3HUNA 1DP8A 4KZ9A 3IF6B 4AFIA 2R78A 2GDNA 4NXEA 2EWVA 5M1AA 4HH2A 3VP4A 5L8MA 4F94A 3NDGA 5I5LA 3PBRA 2DNSA 3G30A 4XUXA 4ETZA 1G68A 2J9OA 3W4OA 2INWA 1HTZA 3BECA 3IH9A 1NXYA 2PD7A 1PI5A 4RYEA 4PMAA 1XJ2A 2RCXA 1IOUA 1XXMA 3KO6A 2W1RA 3T4SA 1DJAA 1PW8A 4HESA 2C6WB 4XUZA 3LY3A 1ODVA 5L09A 5IU1A 4C3QA 2V0WA 4R1GA 2XD5A 1XPBA 4O0PA 4R0QA 4BQMA 2ZQCA 1DY6A 4JGPA 3WS0A 2PD8A 3A0RA 5FI7A 3MBZA 4WUJA 3IWQA 2DRWA 5L10A 4G3WA 2JC7A 1ALQA 5AJGA 2ZL1B 1TS7A 1TVFA 3T50A 2PHYA 3PTEA 1PW1A 1K57A 4S2LA 2C5WB 1XGIA 2D02A 3O86A 2HDRA 3WS5A 1K25A 2OWHA 4EQIA 1YLPA 3U4LP 2Y2MA 2WKPA 3IQAA 3A3JA 4FCFA 1SDEA 5HL1A 1N9BA 4IVKA 4OPRA 1KDWA 4KQOA 3SS4A 1YAXA 1JVJA 2ZBBA 3VFHA 4DN0A 2WKQA 4UQIM 2OAP1 3CPTB 2BLSA 3IXBA 3O88A 3NI9A 4MCWA 4EU0A 5KMWA 3BLMA 3S7PA 4Q0IA 3SH9A 1LT0A 2Y2PA 5HAQA 4RVAA 5FQMA 2NUPC 5DJTA 1TEMA 4HOIA 2GNXA 1ESIA 1NYYA 3ZG7B 3MS6A 1ERMA 5FI2A 3B3XA 2KX6A 3GV9A 4F3LA 1Z6FA 3FPVA 1YSPA 4DDSA 3R7WA 4DMZA 2R9WA 3Q7ZA 2DCFA 3TOIA 3EEHA 3P01A 3UDFA 4KUOA 3Q7VA 2V20A 2ZD8A 3HLFA 3LIAA 4DXBA 1P9WA 1QMFA 3QP6A 3EOIA 3IWOA 4EW7A 1PFLA 2WZXA 1IELA 2WAEA 4CJNA 5GLBA 1O7EA 5E2FA 4DE1A 3ITBA 3Q82A 2V1BA 2ZC4B 3MQ0A 3NHQA 2H5SA 2V0UA 4NXFA 5L07A 3SH7A 4BWIA 1ES4A 4ME4A 1P9RA 1AXBA 4LGWA 5HD5A 2HF6A 3E98A 3A3EA 3NCKA 4P87A 2VX8A 3RTYA 3GVBA 5AQBA 4GD6A 1SKFA 4L9FA 4E6XA 4S2OA 4EUZA 1KGGA 3UNWA 3LUQA 3D4FA 4JBFA 4E3JA 1D1JA 4KG5A 4MN6A 5EOEA 1KE4A 5DFXA 1H0MA 5HPIA 1IYQA 1WYBA 3UPPA 4OLDA 4OQ0A 4N9LA 5F69A 4UEYA 1PNEA 4GCZA 2WGVA 2BASA 4HP4A 1BTLA 3SS3A 1MXOA 1G6AA 5CHUA 4A5RA 1M40A 5A8BA 1PYYA 4WMCA 5GLAA 3K3CA 2ZMVA 2ACGA 4QJGA 3ZDJA 3T4JA 2EX6A 3K3DA 4IUKA 1LI9A 5GHYA 1W5DA 4JXGA 2HP9A 3CUEA 4EXOA 2IWCA 1MPLA 4HH3A 1RGZA 3HREA 1ONGA 3ZG0A 2V8FA 3EEAA 2Q9MA 4GZBA 2HDUA 1K54C 1VM1A 3DAVA 4KZ7A 4BD1A 1K55C 4KZ5A 1E25A 4L9EA 5FQQA 5EV0A 2K2NA 1G28A 3G34A 1XKZA 1Q2QA 1VETA 4EERA 4WL9A 3NY4A 1Y28A 1WYCA 1IKGA 2J80A 3BWLA 2X71A 4X69A 4PPRA 1XFQA 3H82A 1S4RA 1V9YA 1NLZA 4G3KA 1CK3A 2M1CA 3DTIA 1I2SA 5GHZA 4CLCE 3HVFA 4ARZB 4E6WA 5G4YA 3O5YA 5AVEA 2HZ5A 3SS5A 5KIZA 2VK3A 2VV8A 3UO9A 5C5KA 4N92A 2XDMA 2QYBA 3MZEA 4EESA 1P97A 4XT2A 4MBKA 3CI6A 2QJ5A 3V3SA 5M18A 4NXBA 1GSVA 4Y7PA 2WUQA 4GLQA 2P9VA 3NDEA 5JYPA 3L7HA 3MSHA 4O7DA 4P6ZS 2VV6A 1DJBA 3QNBA 4EBPA 5F5YA 3E0YA 4CLCD 4HQAA 3ZYTA 1U60A 4FSFA 1XFNA 2JKGA 3UPOA 1NWZA 4BENA 4JPMA 5EOOA 3S22A 2W1TA 4NETA 4IHQA 5EM0A 5IHVA 3DTMA 1RCJA 1I2WA 5FSRA 3RXWA
chains in the Genus database with same CATH topology
4R23A 2Y2HA 5AQAA 4N1XA 4ZAMA 4DKIA 1WE4A 2RL3A 1BLHA 3ZG8B 5EVIC 4XXRA 4U0XA 3BFDA 3DWZA 2OLVA 2QMIA 4KZBA 5BOHA 2QPNA 1GA9A 3ITAA 1BLCA 2Y2QA 4OKPA 3EQUA 4KZ3A 5HW3A 3OPPA 2I72A 2XR0A 4S2IA 2HPBA 3GQZA 4N1HA 4X55A 4MLLA 4DE3A 5J8XA 3HUNA 4KZ9A 4JLFA 3IF6B 4ZDXA 5L2FA 3IHAA 4GD8A 5FQIA 2J8YA 1BUEA 2GDNA 5F1GA 1H8ZA 1E4DA 4WMCD 3N8SA 4OP8A 1FCNA 5M1AA 3PAGA 3UE0A 4LENA 3VP4A 1FCMA 4F94A 3NDGA 2Y4AA 3CG5A 5M19A 2EFXA 1LHYA 3PBRA 2DNSA 3G30A 4XUXA 1K6RA 1G68A 1JTGA 2EX8A 2J9OA 1VQQA 3W4OA 1ZKJA 5CECA 4GDNA 4S2KA 1K56A 1YM1A 1HTZA 1LL9A 3HUMA 3LY4A 3HUOA 2IWBA 3VP2A 3QNCA 3BECA 3IH9A 1PWCA 1NXYA 1RP5A 3N8LA 1LI0A 4PM9A 1W7FA 1PI5A 2Y2NA 3FV7A 3ZCZA 4RYEA 4PMAA 5HX9A 2RCXA 5FATA 5TGFA 3ISGA 1KGEA 4YINA 1XXMA 5EE8A 4KQQA 1DJAA 2ZM2A 5FQJA 3MZFA 4EBLA 5FAQA 1PW8A 5FDHA 4HESA 4P0MA 2C6WB 5EVID 3OCNA 4XUZA 3A3IA 1EI5A 3LY3A 4UA6A 5E43A 1MKIA 1PIOA 4C3QA 3OZHA 2ZM0A 2ZM8A 2Y91A 4KG6A 4WM9A 4R1GA 3OPHA 2XD5A 3IF6A 1XPBA 3CZDA 4JF5A 4WZ5C 3IH8A 4Y0UA 5FA7A 3HLCA 4OQHA 4R0QA 5DTTA 2H0TA 3G2YA 2ZQCA 5DVAA 2VGKA 3TSGA 1DY6A 3WS0A 2CC1A 4UHUA 5FI7A 4X56A 3MBZA 3OCLA 1BLPA 4OQIA 1BLSA 3IWQA 4RX3A 3V5MA 1IYSA 2DRWA 2XLNA 2ZQAA 3P09A 2JC7A 1ALQA 4S2NC 5CTNA 3VP0A 5TR7A 1YQSA 3JYIA 1FCOA 1KVMA 2ZC5B 3FKVA 3Q81A 1PWGA 1W79A 1TVFA 2WYXA 2Y59A 3PTEA 1PW1A 2HP6A 1MBLA 4MNRA 2XFTA 1K57A 1MWSA 4S2LA 2C5WB 1XGIA 4WZ4A 1YMSA 2XGNA 1J9MA 4B88A 4IBRA 2R9XA 3O86A 2HDRA 3WS5A 4GN2A 2OLUA 2VGJA 3ZFZA 1K25A 1XA7A 1BULA 2Y2JA 4EQIA 1N4OA 1YLPA 5A92A 4MBFA 2Y2MA 1HZOA 3IQAA 3A3JA 3S4XA 3M6BA 2WKEA 2OV5A 3N7WA 1QMEA 1DJCA 4FCFA 1SDEA 5AQ9A 1JWZA 1N9BA 4EWFA 4IVKA 2Z2LB 4OPRA 5HL1A 1KDWA 3HBRA 4GKUA 4KQOA 4OONA 3AGFA 3NIAA 1M6KA 3Q7VB 3SS4A 5EVIB 4C6YA 1JVJA 4N9KA 1L0FA 1KGFA 3ZG9B 5F82A 3VFHA 3PBSA 3IXHA 2XK1A 3LEZA 4OOYA 2BLSA 3IXBA 3O88A 3G32A 5DTSA 3M2KA 3NI9A 4BJPA 3G4PA 5FAOA 1ONHA 5KMWA 3BLMA 3HLWA 4LCLA 3CJMA 3SH9A 2ZMAA 2Y2PA 1IYOA 5HAQA 4RVAA 3FKWA 4Y0OA 2H10A 5FQMA 1NZUA 1PZPA 5CRFA 5HFOA 2HP5A 2WGWB 3UPNA 1TEMA 2PU2A 4S2MA 3AGEA 1JWPA 2FFFB 4DDYA 1MWRA 4P85A 2ZJ9A 5FASA 1ESIA 5D3OA 5A90A 1NYYA 3FWLA 3ZG7B 1K6SA 4ZJ2A 1Y54A 3S1YA 2WGIA 4OVDA 1ERMA 3V3RA 1XP4A 1ES5A 4IBXA 5FI2A 3B3XA 4LV2A 5A93A 1YLYA 3GV9A 3Q07A 5GLDA 1EWZA 1Z6FA 3N8RA 4Z9QA 5GLCA 4EBNA 3MXSA 1E3UD 3GRJA 4OPQA 4EV4A 4DDSA 2ZQ9A 3OC2A 4M3KA 3WS2A 4JXWA 2R9WA 1L0GA 5U47A 3Q7ZA 4Q8IA 2DCFA 3TOIA 2JBFA 3UDIA 3UDFA 1Q2PA 4QHCA 1KE0A 4GB7A 3Q7VA 3VSKA 2V20A 5EVIA 2ZD8A 1IKIA 2ZQDA 5KSHA 2XQZA 3HLFA 2B5RA 4DXBA 2IWDA 4LV3A 5CXWA 4H8RA 1QMFA 1K54A 4LCMA 3IWOA 3VOYA 3GSGA 1K55A 4IVIA 1XGJA 1MY8A 2WZXA 4B4XA 1IELA 1MWUA 2WAEA 2WKIA 3C4PA 4CJNA 5GLBA 3MFDA 1O7EA 5E2FA 3WRTA 3ITBA 4BD0A 2FFYA 3Q82A 3QHYA 4DE1A 2J9PA 2ZC4B 1GHIA 4S2PA 4PM6A 2WKHA 1H5XA 1MWTA 1PWDA 2EXBA 4WEKA 3ZG5A 2H5SA 5DTKA 1K4FA 1K56D 4OPYA 3UN7A 2OSUA 3E2KA 5CEDA 3SH7A 2X02A 2EFUA 3N6IA 3W8KA 1ES4A 4X6TA 2ZC6B 3ZHHA 4PM5A 4K0XA 4FH4A 5CGWA 2XD1A 1AXBA 3HLDA 3GTCA 1K57C 4PM8A 4UA7A 3A3EA 4JF6A 3M6HA 4QB8A 3NCKA 2Y2OA 4ZJ3A 4P87A 2J7VA 5AQ7A 3GVBA 4R4RA 1NYMA 5AQBA 4KG2A 4RA7A 4GD6A 1L0DA 1SKFA 3IT9A 4OOMA 2ZC7A 4QJGA 4KZ8A 4S2OA 4C75A 4E6XA 5CEBA 5EPHA 4EUZA 1KGGA 2Z2MB 4L0LA 3UNWA 5DF7A 3D4FA 4GDBA 1GHPA 3E2LA 4JBFA 4RX2A 1W8YA 2Y55A 4E3JA 1ESUA 2Y2LA 1YT4A 4HBTA 4DE0A 4KENB 2HDQA 3BRMA 4KG5A 5EOEA 3VSLA 1KE4A 4UAAA 4U0TA 4E3MA 5HAPA 2H0YA 3O87A 1SHVA 4FH2A 4HBUA 1IYQA 1O07A 5F1FA 2WADA 5F83A 1WYBA 4ZJ1A 3UPPA 4OLDA 5HARA 1YLTA 1FR1A 3IXDA 4OQ0A 2EX2A 3HLBA 4N9LA 5DF8A 3BEBA 4R4SA 4BLMA 5I94A 1KVLA 3EQVA 4U3TA 3SOIA 2WGVA 3BYDA 1BTLA 3N4IA 3W4QA 3SS3A 4K91A 1MXOA 2X01A 1G6AA 3IXGA 5CHUA 3UE1A 4A5RA 1M40A 3ZVWA 1EROA 3M2JA 2ZC3B 5HAIA 1PYYA 4WELA 4D2OA 3C7VA 4JF4A 3VOZA 4WMCA 5GLAA 4HEFA 1BSGA 2ZLYA 3LO7A 5DF9A 1GCEA 5EUAA 3ZDJA 2EX6A 2Y2GA 4QY5A 1NRFA 4E3IA 1W8QA 1I5QA 2A49A 1LI9A 1E3UA 2Q9NA 5GHYA 4YFMA 1KE3A 1W5DA 4JXGA 3V39A 5E2EA 2HP9A 4ZBEA 1ZG6A 1MPLA 2IWCA 2V1ZA 3IF5A 2G2WA 3GR2A 1FSWA 3WS1A 4E3KA 4QD4A 2A3UA 4OPZA 4OH0A 1RGZA 3HREA 1ONGA 1CEFA 3ZVTA 1IEMA 3Q1FA 1HVBA 3ZG0A 5EVLA 4IEDA 4OQGA 2QZ6A 2JCHA 2Q9MA 4GZBA 3PBNA 3I7JA 4GOGA 1CI9A 2HDUA 3BFGA 1K54C 5CHJA 1VM1A 4Y0TA 4KZ7A 3PBQA 4LV0A 4BD1A 1K55C 5KSCA 4KZ5A 1BZAA 1E25A 1ERQA 5FQQA 1XA1A 2BG1A 4GNUA 3MKEA 3BM6A 3G34A 2Y2KA 2XEPA 1XKZA 1Q2QA 2PU4A 3G2ZA 3CMZA 3IHBA 1CEGA 2XF3A 3NY4A 1FOFA 3MXRA 4S2JA 4UA9A 1WYCA 4WBGA 1IKGA 1ES2A 3OPLA 3VMAA 2XFSA 4PM7A 2E8IA 2X71A 4QU3A 3UY6A 4CPKA 3IWIA 3TG9A 4K0WA 1TDLA 3IF6C 4X69A 3A3FA 4PPRA 4JXSA 5KZHA 3RXXA 1S0WA 2P9VB 1KDSA 1RGYA 1CK3A 2G2UA 2WGWA 4QY6A 5FQ9A 3WRZA 3G31A 2JE5A 1I2SA 3ZNTA 1FSYA 1XX2A 5GHZA 1PI4A 1BT5A 3HVFA 3WS4A 4E6WA 3VFFA 3ZGAB 4DRTA 3MZDA 5FAPA 3SS5A 5CGXA 3FZCA 3GMWA 5E2GA 4E3NA 3A3DA 3NBLA 4P6BA 3UO9A 4OLGA 4B4ZA 3PBOA 1K4EA 5G18A 5CTMA 3FYZA 1TDGA 4BQMA 4KZAA 2P74A 3BFFA 1GHMA 4JKTA 1ZG4A 3BLSA 4N92A 3RJUA 3HL9A 4E3LA 1ES3A 2V2FF 2XDMA 2ZQ7A 1PZOA 1H8YA 1HD8A 1IYPA 2XH9A 3BFCA 3MZEA 3O3VA 3UDXA 3P98A 5TFQA 1JTDA 3VP3A 5EECA 1NY0A 3C4OA 4MBKA 4ZTKA 4MBHA 3HLGA 3WWXA 4R3BA 4JXVA 3V3SA 5M18A 2EXAA 1FR6A 3OPRA 4OP5A 5CERA 1L2SA 4WZ5A 2UWXA 4X68A 4Y7PA 2WUQA 5CHMA 3AGDA 3UE3A 1NJ4A 1SDNA 3PAEA 2P9VA 2WK0A 3ZNYA 3DW0A 3PBTA 4DF6A 3BFEA 3W4PA 3NDEA 4LV1A 5JYPA 1L0EA 1NZOA 4WEJA 1CI8A 4MEZA 1ZC2A 4O7DA 4S2NA 1DJBA 3NC8A 3QNBA 1SCWA 4OOLA 1YMXA 4X53A 1C3BA 4EBPA 5GL9A 1YLWA 4ID4A 5A91A 3HLEA 1OMEA 3C5AA 1JWVA 3SH8A 3V50A 2EX9A 4DXCA 1YLZA 1YLJA 1S6RA 1U60A 4KQRA 4R3JA 2Y2IA 4FSFA 5JYOA 2ZQ8A 4WYYA 4E3OA 1LL5A 3UPOA 1LLBA 4KZ4A 1GA0A 3LCEA 3DWKA 3C7UA 4JPMA 4NK3A 5FI6A 4BENA 2HDSA 5EOOA 4KZ6A 5GHXA 3S22A 2WZZA 5CGSA 4NETA 3MKFA 4BL2A 4DE2A 5FQKA 5IHVA 1K38A 2WAFA 3VP1A 3G35A 3DTMA 5E2HA 1RCJA 1I2WA 1FQGA 2PBYA 5FSRA 3RXWA 4BL3A 4FD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R23 A;  2Y2H A;  5AQA A;  4N1X A;  4ZAM A;  4DKI A;  1WE4 A;  2RL3 A;  1BLH A;  3ZG8 B;  5EVI C;  4XXR A;  4U0X A;  3BFD A;  3DWZ A;  2OLV A;  2QMI A;  4KZB A;  5BOH A;  2QPN A;  1GA9 A;  3ITA A;  1BLC A;  2Y2Q A;  4OKP A;  3EQU A;  4KZ3 A;  5HW3 A;  3OPP A;  2I72 A;  2XR0 A;  4S2I A;  2HPB A;  3GQZ A;  4N1H A;  4X55 A;  4MLL A;  4DE3 A;  5J8X A;  3HUN A;  4KZ9 A;  4JLF A;  3IF6 B;  4ZDX A;  5L2F A;  3IHA A;  4GD8 A;  5FQI A;  2J8Y A;  1BUE A;  2GDN A;  5F1G A;  1H8Z A;  1E4D A;  4WMC D;  3N8S A;  4OP8 A;  1FCN A;  5M1A A;  3PAG A;  3UE0 A;  4LEN A;  3VP4 A;  1FCM A;  4F94 A;  3NDG A;  2Y4A A;  3CG5 A;  5M19 A;  2EFX A;  1LHY A;  3PBR A;  2DNS A;  3G30 A;  4XUX A;  1K6R A;  1G68 A;  1JTG A;  2EX8 A;  2J9O A;  1VQQ A;  3W4O A;  1ZKJ A;  5CEC A;  4GDN A;  4S2K A;  1K56 A;  1YM1 A;  1HTZ A;  1LL9 A;  3HUM A;  3LY4 A;  3HUO A;  2IWB A;  3VP2 A;  3QNC A;  3BEC A;  3IH9 A;  1PWC A;  1NXY A;  1RP5 A;  3N8L A;  1LI0 A;  4PM9 A;  1W7F A;  1PI5 A;  2Y2N A;  3FV7 A;  3ZCZ A;  4RYE A;  4PMA A;  5HX9 A;  2RCX A;  5FAT A;  5TGF A;  3ISG A;  1KGE A;  4YIN A;  1XXM A;  5EE8 A;  4KQQ A;  1DJA A;  2ZM2 A;  5FQJ A;  3MZF A;  4EBL A;  5FAQ A;  1PW8 A;  5FDH A;  4HES A;  4P0M A;  2C6W B;  5EVI D;  3OCN A;  4XUZ A;  3A3I A;  1EI5 A;  3LY3 A;  4UA6 A;  5E43 A;  1MKI A;  1PIO A;  4C3Q A;  3OZH A;  2ZM0 A;  2ZM8 A;  2Y91 A;  4KG6 A;  4WM9 A;  4R1G A;  3OPH A;  2XD5 A;  3IF6 A;  1XPB A;  3CZD A;  4JF5 A;  4WZ5 C;  3IH8 A;  4Y0U A;  5FA7 A;  3HLC A;  4OQH A;  4R0Q A;  5DTT A;  2H0T A;  3G2Y A;  2ZQC A;  5DVA A;  2VGK A;  3TSG A;  1DY6 A;  3WS0 A;  2CC1 A;  4UHU A;  5FI7 A;  4X56 A;  3MBZ A;  3OCL A;  1BLP A;  4OQI A;  1BLS A;  3IWQ A;  4RX3 A;  3V5M A;  1IYS A;  2DRW A;  2XLN A;  2ZQA A;  3P09 A;  2JC7 A;  1ALQ A;  4S2N C;  5CTN A;  3VP0 A;  5TR7 A;  1YQS A;  3JYI A;  1FCO A;  1KVM A;  2ZC5 B;  3FKV A;  3Q81 A;  1PWG A;  1W79 A;  1TVF A;  2WYX A;  2Y59 A;  3PTE A;  1PW1 A;  2HP6 A;  1MBL A;  4MNR A;  2XFT A;  1K57 A;  1MWS A;  4S2L A;  2C5W B;  1XGI A;  4WZ4 A;  1YMS A;  2XGN A;  1J9M A;  4B88 A;  4IBR A;  2R9X A;  3O86 A;  2HDR A;  3WS5 A;  4GN2 A;  2OLU A;  2VGJ A;  3ZFZ A;  1K25 A;  1XA7 A;  1BUL A;  2Y2J A;  4EQI A;  1N4O A;  1YLP A;  5A92 A;  4MBF A;  2Y2M A;  1HZO A;  3IQA A;  3A3J A;  3S4X A;  3M6B A;  2WKE A;  2OV5 A;  3N7W A;  1QME A;  1DJC A;  4FCF A;  1SDE A;  5AQ9 A;  1JWZ A;  1N9B A;  4EWF A;  4IVK A;  2Z2L B;  4OPR A;  5HL1 A;  1KDW A;  3HBR A;  4GKU A;  4KQO A;  4OON A;  3AGF A;  3NIA A;  1M6K A;  3Q7V B;  3SS4 A;  5EVI B;  4C6Y A;  1JVJ A;  4N9K A;  1L0F A;  1KGF A;  3ZG9 B;  5F82 A;  3VFH A;  3PBS A;  3IXH A;  2XK1 A;  3LEZ A;  4OOY A;  2BLS A;  3IXB A;  3O88 A;  3G32 A;  5DTS A;  3M2K A;  3NI9 A;  4BJP A;  3G4P A;  5FAO A;  1ONH A;  5KMW A;  3BLM A;  3HLW A;  4LCL A;  3CJM A;  3SH9 A;  2ZMA A;  2Y2P A;  1IYO A;  5HAQ A;  4RVA A;  3FKW A;  4Y0O A;  2H10 A;  5FQM A;  1NZU A;  1PZP A;  5CRF A;  5HFO A;  2HP5 A;  2WGW B;  3UPN A;  1TEM A;  2PU2 A;  4S2M A;  3AGE A;  1JWP A;  2FFF B;  4DDY A;  1MWR A;  4P85 A;  2ZJ9 A;  5FAS A;  1ESI A;  5D3O A;  5A90 A;  1NYY A;  3FWL A;  3ZG7 B;  1K6S A;  4ZJ2 A;  1Y54 A;  3S1Y A;  2WGI A;  4OVD A;  1ERM A;  3V3R A;  1XP4 A;  1ES5 A;  4IBX A;  5FI2 A;  3B3X A;  4LV2 A;  5A93 A;  1YLY A;  3GV9 A;  3Q07 A;  5GLD A;  1EWZ A;  1Z6F A;  3N8R A;  4Z9Q A;  5GLC A;  4EBN A;  3MXS A;  1E3U D;  3GRJ A;  4OPQ A;  4EV4 A;  4DDS A;  2ZQ9 A;  3OC2 A;  4M3K A;  3WS2 A;  4JXW A;  2R9W A;  1L0G A;  5U47 A;  3Q7Z A;  4Q8I A;  2DCF A;  3TOI A;  2JBF A;  3UDI A;  3UDF A;  1Q2P A;  4QHC A;  1KE0 A;  4GB7 A;  3Q7V A;  3VSK A;  2V20 A;  5EVI A;  2ZD8 A;  1IKI A;  2ZQD A;  5KSH A;  2XQZ A;  3HLF A;  2B5R A;  4DXB A;  2IWD A;  4LV3 A;  5CXW A;  4H8R A;  1QMF A;  1K54 A;  4LCM A;  3IWO A;  3VOY A;  3GSG A;  1K55 A;  4IVI A;  1XGJ A;  1MY8 A;  2WZX A;  4B4X A;  1IEL A;  1MWU A;  2WAE A;  2WKI A;  3C4P A;  4CJN A;  5GLB A;  3MFD A;  1O7E A;  5E2F A;  3WRT A;  3ITB A;  4BD0 A;  2FFY A;  3Q82 A;  3QHY A;  4DE1 A;  2J9P A;  2ZC4 B;  1GHI A;  4S2P A;  4PM6 A;  2WKH A;  1H5X A;  1MWT A;  1PWD A;  2EXB A;  4WEK A;  3ZG5 A;  2H5S A;  5DTK A;  1K4F A;  1K56 D;  4OPY A;  3UN7 A;  2OSU A;  3E2K A;  5CED A;  3SH7 A;  2X02 A;  2EFU A;  3N6I A;  3W8K A;  1ES4 A;  4X6T A;  2ZC6 B;  3ZHH A;  4PM5 A;  4K0X A;  4FH4 A;  5CGW A;  2XD1 A;  1AXB A;  3HLD A;  3GTC A;  1K57 C;  4PM8 A;  4UA7 A;  3A3E A;  4JF6 A;  3M6H A;  4QB8 A;  3NCK A;  2Y2O A;  4ZJ3 A;  4P87 A;  2J7V A;  5AQ7 A;  3GVB A;  4R4R A;  1NYM A;  5AQB A;  4KG2 A;  4RA7 A;  4GD6 A;  1L0D A;  1SKF A;  3IT9 A;  4OOM A;  2ZC7 A;  4QJG A;  4KZ8 A;  4S2O A;  4C75 A;  4E6X A;  5CEB A;  5EPH A;  4EUZ A;  1KGG A;  2Z2M B;  4L0L A;  3UNW A;  5DF7 A;  3D4F A;  4GDB A;  1GHP A;  3E2L A;  4JBF A;  4RX2 A;  1W8Y A;  2Y55 A;  4E3J A;  1ESU A;  2Y2L A;  1YT4 A;  4HBT A;  4DE0 A;  4KEN B;  2HDQ A;  3BRM A;  4KG5 A;  5EOE A;  3VSL A;  1KE4 A;  4UAA A;  4U0T A;  4E3M A;  5HAP A;  2H0Y A;  3O87 A;  1SHV A;  4FH2 A;  4HBU A;  1IYQ A;  1O07 A;  5F1F A;  2WAD A;  5F83 A;  1WYB A;  4ZJ1 A;  3UPP A;  4OLD A;  5HAR A;  1YLT A;  1FR1 A;  3IXD A;  4OQ0 A;  2EX2 A;  3HLB A;  4N9L A;  5DF8 A;  3BEB A;  4R4S A;  4BLM A;  5I94 A;  1KVL A;  3EQV A;  4U3T A;  3SOI A;  2WGV A;  3BYD A;  1BTL A;  3N4I A;  3W4Q A;  3SS3 A;  4K91 A;  1MXO A;  2X01 A;  1G6A A;  3IXG A;  5CHU A;  3UE1 A;  4A5R A;  1M40 A;  3ZVW A;  1ERO A;  3M2J A;  2ZC3 B;  5HAI A;  1PYY A;  4WEL A;  4D2O A;  3C7V A;  4JF4 A;  3VOZ A;  4WMC A;  5GLA A;  4HEF A;  1BSG A;  2ZLY A;  3LO7 A;  5DF9 A;  1GCE A;  5EUA A;  3ZDJ A;  2EX6 A;  2Y2G A;  4QY5 A;  1NRF A;  4E3I A;  1W8Q A;  1I5Q A;  2A49 A;  1LI9 A;  1E3U A;  2Q9N A;  5GHY A;  4YFM A;  1KE3 A;  1W5D A;  4JXG A;  3V39 A;  5E2E A;  2HP9 A;  4ZBE A;  1ZG6 A;  1MPL A;  2IWC A;  2V1Z A;  3IF5 A;  2G2W A;  3GR2 A;  1FSW A;  3WS1 A;  4E3K A;  4QD4 A;  2A3U A;  4OPZ A;  4OH0 A;  1RGZ A;  3HRE A;  1ONG A;  1CEF A;  3ZVT A;  1IEM A;  3Q1F A;  1HVB A;  3ZG0 A;  5EVL A;  4IED A;  4OQG A;  2QZ6 A;  2JCH A;  2Q9M A;  4GZB A;  3PBN A;  3I7J A;  4GOG A;  1CI9 A;  2HDU A;  3BFG A;  1K54 C;  5CHJ A;  1VM1 A;  4Y0T A;  4KZ7 A;  3PBQ A;  4LV0 A;  4BD1 A;  1K55 C;  5KSC A;  4KZ5 A;  1BZA A;  1E25 A;  1ERQ A;  5FQQ A;  1XA1 A;  2BG1 A;  4GNU A;  3MKE A;  3BM6 A;  3G34 A;  2Y2K A;  2XEP A;  1XKZ A;  1Q2Q A;  2PU4 A;  3G2Z A;  3CMZ A;  3IHB A;  1CEG A;  2XF3 A;  3NY4 A;  1FOF A;  3MXR A;  4S2J A;  4UA9 A;  1WYC A;  4WBG A;  1IKG A;  1ES2 A;  3OPL A;  3VMA A;  2XFS A;  4PM7 A;  2E8I A;  2X71 A;  4QU3 A;  3UY6 A;  4CPK A;  3IWI A;  3TG9 A;  4K0W A;  1TDL A;  3IF6 C;  4X69 A;  3A3F A;  4PPR A;  4JXS A;  5KZH A;  3RXX A;  1S0W A;  2P9V B;  1KDS A;  1RGY A;  1CK3 A;  2G2U A;  2WGW A;  4QY6 A;  5FQ9 A;  3WRZ A;  3G31 A;  2JE5 A;  1I2S A;  3ZNT A;  1FSY A;  1XX2 A;  5GHZ A;  1PI4 A;  1BT5 A;  3HVF A;  3WS4 A;  4E6W A;  3VFF A;  3ZGA B;  4DRT A;  3MZD A;  5FAP A;  3SS5 A;  5CGX A;  3FZC A;  3GMW A;  5E2G A;  4E3N A;  3A3D A;  3NBL A;  4P6B A;  3UO9 A;  4OLG A;  4B4Z A;  3PBO A;  1K4E A;  5G18 A;  5CTM A;  3FYZ A;  1TDG A;  4BQM A;  4KZA A;  2P74 A;  3BFF A;  1GHM A;  4JKT A;  1ZG4 A;  3BLS A;  4N92 A;  3RJU A;  3HL9 A;  4E3L A;  1ES3 A;  2V2F F;  2XDM A;  2ZQ7 A;  1PZO A;  1H8Y A;  1HD8 A;  1IYP A;  2XH9 A;  3BFC A;  3MZE A;  3O3V A;  3UDX A;  3P98 A;  5TFQ A;  1JTD A;  3VP3 A;  5EEC A;  1NY0 A;  3C4O A;  4MBK A;  4ZTK A;  4MBH A;  3HLG A;  3WWX A;  4R3B A;  4JXV A;  3V3S A;  5M18 A;  2EXA A;  1FR6 A;  3OPR A;  4OP5 A;  5CER A;  1L2S A;  4WZ5 A;  2UWX A;  4X68 A;  4Y7P A;  2WUQ A;  5CHM A;  3AGD A;  3UE3 A;  1NJ4 A;  1SDN A;  3PAE A;  2P9V A;  2WK0 A;  3ZNY A;  3DW0 A;  3PBT A;  4DF6 A;  3BFE A;  3W4P A;  3NDE A;  4LV1 A;  5JYP A;  1L0E A;  1NZO A;  4WEJ A;  1CI8 A;  4MEZ A;  1ZC2 A;  4O7D A;  4S2N A;  1DJB A;  3NC8 A;  3QNB A;  1SCW A;  4OOL A;  1YMX A;  4X53 A;  1C3B A;  4EBP A;  5GL9 A;  1YLW A;  4ID4 A;  5A91 A;  3HLE A;  1OME A;  3C5A A;  1JWV A;  3SH8 A;  3V50 A;  2EX9 A;  4DXC A;  1YLZ A;  1YLJ A;  1S6R A;  1U60 A;  4KQR A;  4R3J A;  2Y2I A;  4FSF A;  5JYO A;  2ZQ8 A;  4WYY A;  4E3O A;  1LL5 A;  3UPO A;  1LLB A;  4KZ4 A;  1GA0 A;  3LCE A;  3DWK A;  3C7U A;  4JPM A;  4NK3 A;  5FI6 A;  4BEN A;  2HDS A;  5EOO A;  4KZ6 A;  5GHX A;  3S22 A;  2WZZ A;  5CGS A;  4NET A;  3MKF A;  4BL2 A;  4DE2 A;  5FQK A;  5IHV A;  1K38 A;  2WAF A;  3VP1 A;  3G35 A;  3DTM A;  5E2H A;  1RCJ A;  1I2W A;  1FQG A;  2PBY A;  5FSR A;  3RXW A;  4BL3 A;  4FD8 A; 
#chains in the Genus database with same CATH topology
 1MC0 A;  2Y2H A;  4DKI A;  1WE4 A;  3MJQ A;  3BW6 A;  3ZG8 B;  4XXR A;  3BFD A;  4KZB A;  2A24 A;  3QP1 A;  1L3L A;  2QPN A;  3ITA A;  4OKP A;  2I72 A;  2XR0 A;  2HPB A;  3LFV A;  4N1H A;  4X55 A;  4ZRR A;  3NOP C;  4PAU A;  2W3H A;  3F1P B;  1H8Z A;  4OP8 A;  1YPR A;  1FCM A;  5M19 A;  4MMN A;  2EFX A;  2EX8 A;  1VQQ A;  5CEC A;  2V8C A;  1W63 M;  1PWC A;  1RP5 A;  4PM9 A;  1W7F A;  3TW8 A;  3DBA A;  5HX9 A;  1OJG A;  3ISG A;  1W63 Q;  5EE8 A;  3KSI A;  3LIE A;  4KQQ A;  4EBL A;  1CQA A;  2GJ3 A;  5EVI D;  3D9Y A;  1YSQ A;  4UA6 A;  1OT6 A;  3ZQ5 A;  3NOT C;  3OPH A;  4FUW A;  3CZD A;  4WZ5 C;  2GZA A;  1T18 A;  4OQH A;  2L4R A;  2CC1 A;  3LIF A;  4BBT A;  2ZQA A;  5CTN A;  1N9N A;  1FIL A;  1YQS A;  3JYI A;  3SZT A;  3JVV A;  1PWG A;  4LRX C;  1K0K A;  2VGL S;  2HP6 A;  1MBL A;  2XFT A;  3NJA A;  3LR0 A;  3MXQ A;  2Z6D A;  4LPZ A;  4Y13 A;  1YMS A;  3GDI A;  4IBR A;  3EGX C;  2NUT C;  3ZFZ A;  1N4O A;  1XJ4 A;  1QME A;  1DJC A;  4HJ6 A;  3QP5 A;  5IS1 A;  3JPU A;  3F1O A;  5AQ9 A;  1JWZ A;  4EWF A;  2PRF A;  4GKU A;  3NIA A;  4C6Y A;  4FOF A;  4N9K A;  5HWV A;  3BY8 A;  2XK1 A;  3EWK A;  4OOY A;  5DTS A;  5FAO A;  3HLW A;  2ZMA A;  5F6A A;  3T4Q A;  3OLO A;  3FKW A;  3H82 B;  1PZP A;  5CRF A;  2HP5 A;  4WN5 A;  3W2Z A;  2FFF B;  4P85 A;  5A90 A;  2AVX A;  4ZJ2 A;  3MFX A;  3V3R A;  1XP4 A;  1ES5 A;  2BTF P;  5A93 A;  4I5S A;  5GLC A;  3GRJ A;  4OPQ A;  2Y8H A;  2ZQ9 A;  3OC2 A;  1Z09 A;  4JXW A;  5HD3 A;  1KE0 A;  3OBF A;  5EVI A;  2XQZ A;  4XT2 B;  2IWD A;  2B02 A;  3A0V A;  4LV3 A;  5CXW A;  2OAQ 1;  4D60 A;  4HHD A;  3UB7 A;  3PHY A;  3LYX A;  1K54 A;  4LCM A;  1K55 A;  2O99 A;  1XGJ A;  1MY8 A;  4GHI A;  2M7U A;  4B4X A;  2K7S A;  2VKS A;  1MWT A;  1D06 A;  1K56 D;  4MDZ A;  2HV1 A;  3W8K A;  3ZHH A;  4K0X A;  5HWT A;  5CGW A;  1T1B A;  3GTC A;  3KSG A;  2ZOI A;  4PM8 A;  2PYR A;  1OT9 A;  1NYM A;  4RA7 A;  3IT9 A;  5FDS A;  2ZC7 A;  4KZ8 A;  2W1T B;  4L0L A;  2JN7 A;  5DF7 A;  3E2L A;  2Y55 A;  4KUK A;  2Y2L A;  4HBT A;  4KEN B;  2HDQ A;  2W3D A;  4B9O A;  5EFW A;  1PRQ A;  3UB9 A;  4E3M A;  1X0O A;  4FH2 A;  1SHV A;  1FR1 A;  3IXD A;  3MF0 A;  3HLB A;  4X25 A;  4X1M A;  4UQI S;  4H6J A;  1F2K A;  3BYD A;  3IXG A;  4R6L A;  3M2J A;  3C7V A;  1LSW A;  3CIT A;  4JF4 A;  3VOZ A;  2QKP A;  3PR6 A;  1KOU A;  1BSG A;  4E3I A;  2Y2G A;  2XA7 M;  1NRF A;  4QY5 A;  3LGO A;  3V39 A;  3B33 A;  3IBJ A;  4ZBE A;  2V1Z A;  2G2W A;  1FSW A;  2JKT I;  1OTI A;  2A3U A;  5IT5 A;  4OH0 A;  1A0K A;  1IEM A;  1HVB A;  5HPF A;  1TD5 A;  4IED A;  3PBN A;  4DJ2 A;  5CHJ A;  4Y0T A;  4LV0 A;  5KSC A;  2PU4 A;  2XF3 A;  3C2W A;  1ACF A;  4PM7 A;  2E8I A;  3IS2 A;  4Q0J A;  4K0W A;  3BJN A;  1EW0 A;  3ULF A;  2WGW A;  5HSQ A;  5FQ9 A;  4HJ4 A;  3G31 A;  1FSY A;  1BT5 A;  5DKL A;  3R4K A;  3VFF A;  3ZGA B;  4DRT A;  3U2A A;  3MZD A;  1MKM A;  1G6O A;  5FAP A;  4B93 A;  3NBL A;  5LBR A;  4CLC C;  4B4Z A;  5CTM A;  2PT7 A;  5EVE A;  4KZA A;  3F1O B;  3BLS A;  3RJU A;  1ES3 A;  4R38 A;  2H28 A;  2XH9 A;  3C8C A;  3P98 A;  1NY0 A;  4ZTK A;  2EA9 A;  3HLG A;  4JXV A;  3BQA A;  2EXA A;  3OPR A;  1AWI A;  3T1X A;  1L2S A;  4WZ5 A;  5CHM A;  3IBR A;  2WK0 A;  3ZNY A;  4DF6 A;  4LRY C;  3W4P A;  1WA9 A;  4WEJ A;  4MEZ A;  1T19 A;  2JKT M;  1SCW A;  1C3B A;  4KQD A;  5A91 A;  3SH8 A;  3V50 A;  4DXC A;  3NOU C;  2Y2I A;  2ZQ8 A;  4WYY A;  5G4Z A;  4RQ9 A;  4E3O A;  1LL5 A;  1UGU A;  2JKF A;  4KZ4 A;  3LCE A;  3DWK A;  3C7U A;  3LID A;  4HIA A;  2PBY A;  4BL3 A;  4YNR A;  2EWW A;  4GHI B;  2RL3 A;  1BLH A;  5EVI C;  5J4E A;  2QMI A;  2VA0 A;  3EQU A;  3OPP A;  3S7O A;  4GS9 A;  4S2I A;  2O9B A;  1GSW A;  4JLF A;  5FQI A;  2J8Y A;  1BUE A;  1FCN A;  4LEN A;  4EEP A;  2O9C A;  2Y4A A;  3CG5 A;  4BBU A;  3LR4 A;  4I3I A;  1K6R A;  3VV4 A;  1ZKJ A;  4S2K A;  1YM1 A;  1LL9 A;  3HUM A;  3HUO A;  3VP2 A;  3N8L A;  3ZCZ A;  1TS6 A;  4LLO B;  3FV7 A;  5FAT A;  5TGF A;  3H7W A;  1KGE A;  4YIN A;  2WKR A;  2QJ7 A;  4QWO A;  2G7U A;  5FQJ A;  5TBM A;  5FAQ A;  5FDH A;  5HDC A;  4GJ4 A;  4P0M A;  2W3F A;  1EI5 A;  1Y4O A;  2YKF A;  1MKI A;  1PIO A;  3BY9 A;  3OZH A;  2Q0O A;  4MN5 A;  3T1R A;  3NUL A;  3IF6 A;  3IH8 A;  4G3V A;  3HLC A;  4JGO A;  5DTT A;  1VB6 A;  4UHU A;  3OCL A;  4IUH A;  1BLP A;  1BLS A;  4RX3 A;  4S2N C;  5TR7 A;  3IX3 A;  3Q81 A;  2WYX A;  2Y59 A;  3MMH A;  2Z6C A;  1MWS A;  5FEF A;  2XGN A;  4B88 A;  4CQH A;  4EQ1 A;  1BUL A;  2Y2J A;  3KSF A;  4GW9 A;  4F3L B;  1FIK A;  1UWP X;  1HZO A;  3M6B A;  2WKE A;  1TS8 A;  2VEA A;  3R7W B;  3D72 A;  2Z2L B;  3HBR A;  4ESP A;  3Q7V B;  1M6K A;  4Y2F A;  4P6Z M;  1L0F A;  1KGF A;  4WLA A;  3PBS A;  3LEZ A;  3G32 A;  3M2K A;  2QWS A;  4BJP A;  2JHE A;  4E04 A;  4LCL A;  3CJM A;  2H10 A;  1NZU A;  2ZL1 A;  2WGW B;  2PU2 A;  4S2M A;  3AGE A;  4DDY A;  1MWR A;  1D7E A;  3MR0 A;  2ZJ9 A;  3CLO A;  1K6S A;  2J3T D;  1Y54 A;  3S1Y A;  4OVD A;  3D3O A;  4IBX A;  1TS0 A;  1XJ3 A;  3FG8 A;  1EWZ A;  5CX7 A;  3MXS A;  1TF1 A;  4EV4 A;  4M3K A;  1L0G A;  4Q8I A;  3FPW A;  2JBF A;  3UDI A;  4QHC A;  1IKI A;  3DTK A;  2D01 A;  3CPT A;  2P04 A;  1HLU P;  3K2N A;  2W3G A;  3GSG A;  4BMW A;  2WKI A;  1XJ6 A;  3C4P A;  5TJJ A;  2HGV A;  3MFD A;  5J3W A;  3QHY A;  2J9P A;  1GHI A;  2WKH A;  1H5X A;  2EXB A;  4WEK A;  2JKR I;  5DTK A;  1K4F A;  4OPY A;  3UN7 A;  2VLG A;  3E2K A;  5CED A;  3KYE A;  3N6I A;  4NEE D;  4PM5 A;  4X6T A;  1ZHH B;  4FH4 A;  4JF6 A;  4QB8 A;  4ZJ3 A;  2J7V A;  4KG2 A;  1L0D A;  4OOM A;  3A0S A;  4CLC A;  2Z2M B;  3IX4 A;  2PYP A;  3RFB A;  4HY8 A;  1YT4 A;  2UV0 E;  5HZH A;  4X1L A;  3GEC A;  3VSL A;  2HJ9 C;  5FL3 A;  5HAP A;  4HBU A;  1O07 A;  2WAD A;  5F83 A;  4ZJ1 A;  2V9A A;  5HAR A;  3S7N A;  5DF8 A;  5HDS A;  1G5U A;  4R4S A;  4BLM A;  5I94 A;  1VET B;  2FH5 A;  3N4I A;  4K91 A;  2X01 A;  3ZVW A;  1ERO A;  4WEL A;  1NLY A;  4D2O A;  3MQQ A;  2ZLY A;  3LO7 A;  3H7W B;  1GCE A;  1S1Y A;  1I5Q A;  2A49 A;  3MQO A;  1KE3 A;  3VE4 A;  3IF5 A;  5TBM B;  2PDR A;  3WS1 A;  4E3K A;  3B42 A;  3E4Q A;  3LEQ A;  4OPZ A;  2KDK A;  3G6O A;  3ZVT A;  5EVL A;  2JKR M;  3T1Q B;  2QZ6 A;  4WF0 A;  4GOG A;  1CI9 A;  3BFG A;  4L9G A;  2BG1 A;  4GNU A;  3MKE A;  3BM6 A;  2XEP A;  1STZ A;  1CEG A;  3LR5 A;  4Z1W A;  4WBG A;  3MXR A;  4S2J A;  3OPL A;  2XFS A;  4QU3 A;  4I3A A;  4CPK A;  2PR5 A;  2ZMF A;  3IF6 C;  3A3F A;  2KOI A;  3RXX A;  1S0W A;  2P9V B;  2VV7 A;  1KDS A;  2G2U A;  3WRZ A;  2JE5 A;  1XX2 A;  3HJI A;  2Y79 A;  2O0Y A;  4Y15 A;  4IJG A;  4JGR A;  1OJ5 A;  1T1A A;  4PKY A;  5E2G A;  4E3N A;  4P6B A;  4OLG A;  3PBO A;  1K4E A;  5G18 A;  3FYZ A;  5FEG A;  2L1M A;  2W3E A;  1GHM A;  4JKT A;  2LB5 A;  3HL9 A;  3F1N A;  2ZQ7 A;  1IYP A;  3T1S A;  3UDX A;  5TFQ A;  3VP3 A;  3WWX A;  3B47 A;  1FR6 A;  4OP5 A;  2UWX A;  4X68 A;  2A24 B;  3AGD A;  4JGQ A;  3UE3 A;  1NJ4 A;  3PAE A;  2FZ0 A;  3T4O A;  1L0E A;  1CI8 A;  4ARZ A;  4S2N A;  3NC8 A;  2P08 A;  3TJZ C;  5GL9 A;  1YLW A;  2B18 A;  3HLE A;  3C5A A;  3KYQ A;  1SKO A;  2EX9 A;  1YLJ A;  3VE3 A;  4R3J A;  5JYO A;  1OTD A;  3C38 A;  4HP9 A;  2P7J A;  4ETX A;  1GA0 A;  4NK3 A;  3S7Q A;  2W27 A;  2WZZ A;  1JNU A;  2XRO A;  2XA7 S;  3MKF A;  4BL2 A;  1IFQ A;  4DE2 A;  4EET B;  1K38 A;  2WAF A;  5E2H A;  4HI4 A;  1GSX A;  4FD8 A;  1S4S A;  3CWF A;  4R23 A;  3TE8 A;  2GX5 A;  2J3W A;  1H8M A;  3DWZ A;  1VEU A;  5BOH A;  1GA9 A;  1ZTU A;  3LIB A;  1F9I A;  2Y2Q A;  5HW3 A;  4LRZ E;  3GQZ A;  4Y5F A;  4I3J A;  5J8X A;  5L2F A;  4ZDX A;  3IHA A;  5HDD A;  4GD8 A;  3QP4 A;  2W0N A;  5F1G A;  1E4D A;  4WMC D;  3N8S A;  3UE0 A;  3PAG A;  2OOL A;  2HJE A;  1LHY A;  1JTG A;  4M4X A;  4GDN A;  3BQ8 A;  1K56 A;  3LY4 A;  2PAV P;  2IWB A;  3QNC A;  4CLC B;  1LI0 A;  2Y2N A;  3CAX A;  4I38 A;  3PYP A;  3UME A;  3QP2 A;  1S66 L;  4NKP A;  2ZM2 A;  3MZF A;  4NXG A;  3OCN A;  2VZW A;  3A3I A;  5E43 A;  2XSS A;  3E4P A;  2ZM0 A;  2ZM8 A;  2Y91 A;  4KG6 A;  4WM9 A;  4JF5 A;  3F1P A;  4Y0U A;  5FA7 A;  3UMD A;  2H0T A;  3G2Y A;  5DVA A;  3TSG A;  2VGK A;  2YKH A;  2QHK A;  1OTA A;  4R3A A;  4X56 A;  4OQI A;  3V5M A;  1IYS A;  3VP0 A;  2XLN A;  3P09 A;  2I9V A;  1FCO A;  1KVM A;  2ZC5 B;  3FKV A;  1W79 A;  1NRJ A;  1OPX A;  4MNR A;  4WZ4 A;  2J3T C;  1J9M A;  2A2L A;  2R9X A;  2ZOH A;  4GN2 A;  2OLU A;  2VGJ A;  3QP8 A;  1XA7 A;  5A92 A;  4MBF A;  3UE6 A;  1BYW A;  3S4X A;  2OV5 A;  3N7W A;  1LSV A;  3LR3 A;  4R70 A;  4OON A;  3AGF A;  4PKY G;  5EVI B;  4I39 A;  3SW1 A;  3ZG9 B;  5F82 A;  3IXH A;  3G4P A;  1ONH A;  3OOV A;  3UB6 A;  1IYO A;  3T4K A;  4Y0O A;  5HFO A;  3UPN A;  1JWP A;  5FAS A;  5D3O A;  1DRM A;  3FWL A;  3TRC A;  3H9W A;  3NEC A;  2WGI A;  4LV2 A;  5DKK A;  1YLY A;  2MJ6 A;  3Q07 A;  5GLD A;  4Z9Q A;  3N8R A;  4EBN A;  3LI9 A;  1E3U D;  2IA2 A;  3KX0 X;  3LI8 A;  3WS2 A;  2PBD P;  3HJK A;  5U47 A;  3F1N B;  5F68 A;  1P0Z A;  1F5M A;  1J3W A;  4MN7 A;  1Q2P A;  4GB7 A;  1S67 L;  3VSK A;  2ZQD A;  4FTX A;  5KSH A;  3UB8 A;  2B5R A;  3UB5 P;  4H8R A;  3KYZ A;  3VOY A;  5DJU A;  4IVI A;  1MWU A;  3WRT A;  1MZU A;  2FFY A;  5HL6 A;  1N9O A;  2V1A A;  4BD0 A;  4S2P A;  4PM6 A;  1CF0 A;  4YWZ A;  1PWD A;  3ZG5 A;  3CHW P;  4PHT A;  2OSU A;  4H6J B;  2X02 A;  2EFU A;  2ZC6 B;  1SKO B;  2XD1 A;  4Q0H A;  3HLD A;  1K57 C;  2B95 A;  4UA7 A;  3JVU A;  3M6H A;  2Y2O A;  3P7N A;  5AQ7 A;  4R4R A;  3VOL A;  5CEB A;  1T1C A;  4C75 A;  5EPH A;  3L9K A;  3T4T A;  4GDB A;  1GHP A;  4RX2 A;  1W8Y A;  3DTE A;  1ESU A;  4DE0 A;  3BRM A;  1VEU B;  4UAA A;  4U0T A;  4EUV A;  2K31 A;  2H0Y A;  3O87 A;  5F1F A;  1YLT A;  1OTE A;  2EX2 A;  2L0W A;  3BEB A;  4K08 A;  1KVL A;  3EQV A;  4U3T A;  3SOI A;  3W4Q A;  3IS2 B;  3UE1 A;  4YOF A;  4II7 A;  1DP9 A;  2ZC3 B;  5HAI A;  1S1Z A;  3E4O A;  4HEF A;  5EUA A;  5DF9 A;  1W8Q A;  2Q9N A;  1E3U A;  4YFM A;  5J7E A;  5E2E A;  1V9Z A;  3LIC A;  1ZG6 A;  3GR2 A;  4QD4 A;  2M7V A;  1CEF A;  5AVF A;  3Q1F A;  4NG2 A;  4OQG A;  2JCH A;  5EM1 A;  3I7J A;  2KLI A;  2PR6 A;  3PBQ A;  4EEU A;  1BZA A;  1ERQ A;  1H3Q A;  1XA1 A;  2Y2K A;  3G2Z A;  3CMZ A;  3IHB A;  1FOF A;  4UA9 A;  5K5B A;  1SZV A;  1ES2 A;  3VMA A;  3UY6 A;  3IWI A;  3T12 B;  3TG9 A;  1TDL A;  4JXS A;  5KZH A;  5HWW A;  1RGY A;  1VHM A;  4QY6 A;  3ZNT A;  3T4L A;  3C30 A;  1PI4 A;  3WS4 A;  2LB9 A;  4O8G A;  3RH8 B;  3V67 A;  5CGX A;  3FZC A;  3GMW A;  3A3D A;  1TDG A;  2P74 A;  3BFF A;  1ZG4 A;  1DP6 A;  1YKD A;  4E3L A;  2V2F F;  3IX8 A;  4Y3I A;  1PZO A;  2VJW A;  2CMN A;  1H8Y A;  1HD8 A;  3BFC A;  3O3V A;  1UWN X;  2O9A A;  1JTD A;  5EEC A;  3C4O A;  4MBH A;  4BBV A;  4R3B A;  2DMW A;  5CER A;  1LSX A;  2E8J A;  4DJ3 A;  1F98 A;  1SDN A;  3DW0 A;  3PBT A;  3BFE A;  4GS9 B;  2XRN A;  4LV1 A;  3PXP A;  5DFY A;  2VGL M;  1NZO A;  4O01 A;  2OWJ A;  1ZC2 A;  5MC7 A;  4QPR A;  1CJF A;  1YMX A;  4OOL A;  4X53 A;  4LFU A;  4ID4 A;  1OME A;  1JWV A;  1LL8 A;  1YLZ A;  1S6R A;  4KQR A;  4Y17 A;  4HJ3 A;  3CUE C;  1LLB A;  5FI6 A;  1OTB A;  2HDS A;  4KZ6 A;  5GHX A;  5CGS A;  3KSH A;  3HCY A;  4HNB A;  5FQK A;  3VP1 A;  3FC7 A;  3G35 A;  3EGD C;  1FQG A;  5AQA A;  4N1X A;  4ZAM A;  4U0X A;  3ICY A;  2OLV A;  1BLC A;  4KZ3 A;  1N9L A;  4MLL A;  4DE3 A;  3HUN A;  1DP8 A;  4KZ9 A;  3IF6 B;  4AFI A;  2R78 A;  2GDN A;  4NXE A;  2EWV A;  5M1A A;  4HH2 A;  3VP4 A;  5L8M A;  4F94 A;  3NDG A;  5I5L A;  3PBR A;  2DNS A;  3G30 A;  4XUX A;  4ETZ A;  1G68 A;  2J9O A;  3W4O A;  2INW A;  1HTZ A;  3BEC A;  3IH9 A;  1NXY A;  2PD7 A;  1PI5 A;  4RYE A;  4PMA A;  1XJ2 A;  2RCX A;  1IOU A;  1XXM A;  3KO6 A;  2W1R A;  3T4S A;  1DJA A;  1PW8 A;  4HES A;  2C6W B;  4XUZ A;  3LY3 A;  1ODV A;  5L09 A;  5IU1 A;  4C3Q A;  2V0W A;  4R1G A;  2XD5 A;  1XPB A;  4O0P A;  4R0Q A;  4BQM A;  2ZQC A;  1DY6 A;  4JGP A;  3WS0 A;  2PD8 A;  3A0R A;  5FI7 A;  3MBZ A;  4WUJ A;  3IWQ A;  2DRW A;  5L10 A;  4G3W A;  2JC7 A;  1ALQ A;  5AJG A;  2ZL1 B;  1TS7 A;  1TVF A;  3T50 A;  2PHY A;  3PTE A;  1PW1 A;  1K57 A;  4S2L A;  2C5W B;  1XGI A;  2D02 A;  3O86 A;  2HDR A;  3WS5 A;  1K25 A;  2OWH A;  4EQI A;  1YLP A;  3U4L P;  2Y2M A;  2WKP A;  3IQA A;  3A3J A;  4FCF A;  1SDE A;  5HL1 A;  1N9B A;  4IVK A;  4OPR A;  1KDW A;  4KQO A;  3SS4 A;  1YAX A;  1JVJ A;  2ZBB A;  3VFH A;  4DN0 A;  2WKQ A;  4UQI M;  2OAP 1;  3CPT B;  2BLS A;  3IXB A;  3O88 A;  3NI9 A;  4MCW A;  4EU0 A;  5KMW A;  3BLM A;  3S7P A;  4Q0I A;  3SH9 A;  1LT0 A;  2Y2P A;  5HAQ A;  4RVA A;  5FQM A;  2NUP C;  5DJT A;  1TEM A;  4HOI A;  2GNX A;  1ESI A;  1NYY A;  3ZG7 B;  3MS6 A;  1ERM A;  5FI2 A;  3B3X A;  2KX6 A;  3GV9 A;  4F3L A;  1Z6F A;  3FPV A;  1YSP A;  4DDS A;  3R7W A;  4DMZ A;  2R9W A;  3Q7Z A;  2DCF A;  3TOI A;  3EEH A;  3P01 A;  3UDF A;  4KUO A;  3Q7V A;  2V20 A;  2ZD8 A;  3HLF A;  3LIA A;  4DXB A;  1P9W A;  1QMF A;  3QP6 A;  3EOI A;  3IWO A;  4EW7 A;  1PFL A;  2WZX A;  1IEL A;  2WAE A;  4CJN A;  5GLB A;  1O7E A;  5E2F A;  4DE1 A;  3ITB A;  3Q82 A;  2V1B A;  2ZC4 B;  3MQ0 A;  3NHQ A;  2H5S A;  2V0U A;  4NXF A;  5L07 A;  3SH7 A;  4BWI A;  1ES4 A;  4ME4 A;  1P9R A;  1AXB A;  4LGW A;  5HD5 A;  2HF6 A;  3E98 A;  3A3E A;  3NCK A;  4P87 A;  2VX8 A;  3RTY A;  3GVB A;  5AQB A;  4GD6 A;  1SKF A;  4L9F A;  4E6X A;  4S2O A;  4EUZ A;  1KGG A;  3UNW A;  3LUQ A;  3D4F A;  4JBF A;  4E3J A;  1D1J A;  4KG5 A;  4MN6 A;  5EOE A;  1KE4 A;  5DFX A;  1H0M A;  5HPI A;  1IYQ A;  1WYB A;  3UPP A;  4OLD A;  4OQ0 A;  4N9L A;  5F69 A;  4UEY A;  1PNE A;  4GCZ A;  2WGV A;  2BAS A;  4HP4 A;  1BTL A;  3SS3 A;  1MXO A;  1G6A A;  5CHU A;  4A5R A;  1M40 A;  5A8B A;  1PYY A;  4WMC A;  5GLA A;  3K3C A;  2ZMV A;  2ACG A;  4QJG A;  3ZDJ A;  3T4J A;  2EX6 A;  3K3D A;  4IUK A;  1LI9 A;  5GHY A;  1W5D A;  4JXG A;  2HP9 A;  3CUE A;  4EXO A;  2IWC A;  1MPL A;  4HH3 A;  1RGZ A;  3HRE A;  1ONG A;  3ZG0 A;  2V8F A;  3EEA A;  2Q9M A;  4GZB A;  2HDU A;  1K54 C;  1VM1 A;  3DAV A;  4KZ7 A;  4BD1 A;  1K55 C;  4KZ5 A;  1E25 A;  4L9E A;  5FQQ A;  5EV0 A;  2K2N A;  1G28 A;  3G34 A;  1XKZ A;  1Q2Q A;  1VET A;  4EER A;  4WL9 A;  3NY4 A;  1Y28 A;  1WYC A;  1IKG A;  2J80 A;  3BWL A;  2X71 A;  4X69 A;  4PPR A;  1XFQ A;  3H82 A;  1S4R A;  1V9Y A;  1NLZ A;  4G3K A;  1CK3 A;  2M1C A;  3DTI A;  1I2S A;  5GHZ A;  4CLC E;  3HVF A;  4ARZ B;  4E6W A;  5G4Y A;  3O5Y A;  5AVE A;  2HZ5 A;  3SS5 A;  5KIZ A;  2VK3 A;  2VV8 A;  3UO9 A;  5C5K A;  4N92 A;  2XDM A;  2QYB A;  3MZE A;  4EES A;  1P97 A;  4XT2 A;  4MBK A;  3CI6 A;  2QJ5 A;  3V3S A;  5M18 A;  4NXB A;  1GSV A;  4Y7P A;  2WUQ A;  4GLQ A;  2P9V A;  3NDE A;  5JYP A;  3L7H A;  3MSH A;  4O7D A;  4P6Z S;  2VV6 A;  1DJB A;  3QNB A;  4EBP A;  5F5Y A;  3E0Y A;  4CLC D;  4HQA A;  3ZYT A;  1U60 A;  4FSF A;  1XFN A;  2JKG A;  3UPO A;  1NWZ A;  4BEN A;  4JPM A;  5EOO A;  3S22 A;  2W1T A;  4NET A;  4IHQ A;  5EM0 A;  5IHV A;  3DTM A;  1RCJ A;  1I2W A;  5FSR A;  3RXW A; 
#chains in the Genus database with same CATH homology
 4R23 A;  2Y2H A;  5AQA A;  4N1X A;  4ZAM A;  4DKI A;  1WE4 A;  2RL3 A;  1BLH A;  3ZG8 B;  5EVI C;  4XXR A;  4U0X A;  3BFD A;  3DWZ A;  2OLV A;  2QMI A;  4KZB A;  5BOH A;  2QPN A;  1GA9 A;  3ITA A;  1BLC A;  2Y2Q A;  4OKP A;  3EQU A;  4KZ3 A;  5HW3 A;  3OPP A;  2I72 A;  2XR0 A;  4S2I A;  2HPB A;  3GQZ A;  4N1H A;  4X55 A;  4MLL A;  4DE3 A;  5J8X A;  3HUN A;  4KZ9 A;  4JLF A;  3IF6 B;  4ZDX A;  5L2F A;  3IHA A;  4GD8 A;  5FQI A;  2J8Y A;  1BUE A;  2GDN A;  5F1G A;  1H8Z A;  1E4D A;  4WMC D;  3N8S A;  4OP8 A;  1FCN A;  5M1A A;  3PAG A;  3UE0 A;  4LEN A;  3VP4 A;  1FCM A;  4F94 A;  3NDG A;  2Y4A A;  3CG5 A;  5M19 A;  2EFX A;  1LHY A;  3PBR A;  2DNS A;  3G30 A;  4XUX A;  1K6R A;  1G68 A;  1JTG A;  2EX8 A;  2J9O A;  1VQQ A;  3W4O A;  1ZKJ A;  5CEC A;  4GDN A;  4S2K A;  1K56 A;  1YM1 A;  1HTZ A;  1LL9 A;  3HUM A;  3LY4 A;  3HUO A;  2IWB A;  3VP2 A;  3QNC A;  3BEC A;  3IH9 A;  1PWC A;  1NXY A;  1RP5 A;  3N8L A;  1LI0 A;  4PM9 A;  1W7F A;  1PI5 A;  2Y2N A;  3FV7 A;  3ZCZ A;  4RYE A;  4PMA A;  5HX9 A;  2RCX A;  5FAT A;  5TGF A;  3ISG A;  1KGE A;  4YIN A;  1XXM A;  5EE8 A;  4KQQ A;  1DJA A;  2ZM2 A;  5FQJ A;  3MZF A;  4EBL A;  5FAQ A;  1PW8 A;  5FDH A;  4HES A;  4P0M A;  2C6W B;  5EVI D;  3OCN A;  4XUZ A;  3A3I A;  1EI5 A;  3LY3 A;  4UA6 A;  5E43 A;  1MKI A;  1PIO A;  4C3Q A;  3OZH A;  2ZM0 A;  2ZM8 A;  2Y91 A;  4KG6 A;  4WM9 A;  4R1G A;  3OPH A;  2XD5 A;  3IF6 A;  1XPB A;  3CZD A;  4JF5 A;  4WZ5 C;  3IH8 A;  4Y0U A;  5FA7 A;  3HLC A;  4OQH A;  4R0Q A;  5DTT A;  2H0T A;  3G2Y A;  2ZQC A;  5DVA A;  2VGK A;  3TSG A;  1DY6 A;  3WS0 A;  2CC1 A;  4UHU A;  5FI7 A;  4X56 A;  3MBZ A;  3OCL A;  1BLP A;  4OQI A;  1BLS A;  3IWQ A;  4RX3 A;  3V5M A;  1IYS A;  2DRW A;  2XLN A;  2ZQA A;  3P09 A;  2JC7 A;  1ALQ A;  4S2N C;  5CTN A;  3VP0 A;  5TR7 A;  1YQS A;  3JYI A;  1FCO A;  1KVM A;  2ZC5 B;  3FKV A;  3Q81 A;  1PWG A;  1W79 A;  1TVF A;  2WYX A;  2Y59 A;  3PTE A;  1PW1 A;  2HP6 A;  1MBL A;  4MNR A;  2XFT A;  1K57 A;  1MWS A;  4S2L A;  2C5W B;  1XGI A;  4WZ4 A;  1YMS A;  2XGN A;  1J9M A;  4B88 A;  4IBR A;  2R9X A;  3O86 A;  2HDR A;  3WS5 A;  4GN2 A;  2OLU A;  2VGJ A;  3ZFZ A;  1K25 A;  1XA7 A;  1BUL A;  2Y2J A;  4EQI A;  1N4O A;  1YLP A;  5A92 A;  4MBF A;  2Y2M A;  1HZO A;  3IQA A;  3A3J A;  3S4X A;  3M6B A;  2WKE A;  2OV5 A;  3N7W A;  1QME A;  1DJC A;  4FCF A;  1SDE A;  5AQ9 A;  1JWZ A;  1N9B A;  4EWF A;  4IVK A;  2Z2L B;  4OPR A;  5HL1 A;  1KDW A;  3HBR A;  4GKU A;  4KQO A;  4OON A;  3AGF A;  3NIA A;  1M6K A;  3Q7V B;  3SS4 A;  5EVI B;  4C6Y A;  1JVJ A;  4N9K A;  1L0F A;  1KGF A;  3ZG9 B;  5F82 A;  3VFH A;  3PBS A;  3IXH A;  2XK1 A;  3LEZ A;  4OOY A;  2BLS A;  3IXB A;  3O88 A;  3G32 A;  5DTS A;  3M2K A;  3NI9 A;  4BJP A;  3G4P A;  5FAO A;  1ONH A;  5KMW A;  3BLM A;  3HLW A;  4LCL A;  3CJM A;  3SH9 A;  2ZMA A;  2Y2P A;  1IYO A;  5HAQ A;  4RVA A;  3FKW A;  4Y0O A;  2H10 A;  5FQM A;  1NZU A;  1PZP A;  5CRF A;  5HFO A;  2HP5 A;  2WGW B;  3UPN A;  1TEM A;  2PU2 A;  4S2M A;  3AGE A;  1JWP A;  2FFF B;  4DDY A;  1MWR A;  4P85 A;  2ZJ9 A;  5FAS A;  1ESI A;  5D3O A;  5A90 A;  1NYY A;  3FWL A;  3ZG7 B;  1K6S A;  4ZJ2 A;  1Y54 A;  3S1Y A;  2WGI A;  4OVD A;  1ERM A;  3V3R A;  1XP4 A;  1ES5 A;  4IBX A;  5FI2 A;  3B3X A;  4LV2 A;  5A93 A;  1YLY A;  3GV9 A;  3Q07 A;  5GLD A;  1EWZ A;  1Z6F A;  3N8R A;  4Z9Q A;  5GLC A;  4EBN A;  3MXS A;  1E3U D;  3GRJ A;  4OPQ A;  4EV4 A;  4DDS A;  2ZQ9 A;  3OC2 A;  4M3K A;  3WS2 A;  4JXW A;  2R9W A;  1L0G A;  5U47 A;  3Q7Z A;  4Q8I A;  2DCF A;  3TOI A;  2JBF A;  3UDI A;  3UDF A;  1Q2P A;  4QHC A;  1KE0 A;  4GB7 A;  3Q7V A;  3VSK A;  2V20 A;  5EVI A;  2ZD8 A;  1IKI A;  2ZQD A;  5KSH A;  2XQZ A;  3HLF A;  2B5R A;  4DXB A;  2IWD A;  4LV3 A;  5CXW A;  4H8R A;  1QMF A;  1K54 A;  4LCM A;  3IWO A;  3VOY A;  3GSG A;  1K55 A;  4IVI A;  1XGJ A;  1MY8 A;  2WZX A;  4B4X A;  1IEL A;  1MWU A;  2WAE A;  2WKI A;  3C4P A;  4CJN A;  5GLB A;  3MFD A;  1O7E A;  5E2F A;  3WRT A;  3ITB A;  4BD0 A;  2FFY A;  3Q82 A;  3QHY A;  4DE1 A;  2J9P A;  2ZC4 B;  1GHI A;  4S2P A;  4PM6 A;  2WKH A;  1H5X A;  1MWT A;  1PWD A;  2EXB A;  4WEK A;  3ZG5 A;  2H5S A;  5DTK A;  1K4F A;  1K56 D;  4OPY A;  3UN7 A;  2OSU A;  3E2K A;  5CED A;  3SH7 A;  2X02 A;  2EFU A;  3N6I A;  3W8K A;  1ES4 A;  4X6T A;  2ZC6 B;  3ZHH A;  4PM5 A;  4K0X A;  4FH4 A;  5CGW A;  2XD1 A;  1AXB A;  3HLD A;  3GTC A;  1K57 C;  4PM8 A;  4UA7 A;  3A3E A;  4JF6 A;  3M6H A;  4QB8 A;  3NCK A;  2Y2O A;  4ZJ3 A;  4P87 A;  2J7V A;  5AQ7 A;  3GVB A;  4R4R A;  1NYM A;  5AQB A;  4KG2 A;  4RA7 A;  4GD6 A;  1L0D A;  1SKF A;  3IT9 A;  4OOM A;  2ZC7 A;  4QJG A;  4KZ8 A;  4S2O A;  4C75 A;  4E6X A;  5CEB A;  5EPH A;  4EUZ A;  1KGG A;  2Z2M B;  4L0L A;  3UNW A;  5DF7 A;  3D4F A;  4GDB A;  1GHP A;  3E2L A;  4JBF A;  4RX2 A;  1W8Y A;  2Y55 A;  4E3J A;  1ESU A;  2Y2L A;  1YT4 A;  4HBT A;  4DE0 A;  4KEN B;  2HDQ A;  3BRM A;  4KG5 A;  5EOE A;  3VSL A;  1KE4 A;  4UAA A;  4U0T A;  4E3M A;  5HAP A;  2H0Y A;  3O87 A;  1SHV A;  4FH2 A;  4HBU A;  1IYQ A;  1O07 A;  5F1F A;  2WAD A;  5F83 A;  1WYB A;  4ZJ1 A;  3UPP A;  4OLD A;  5HAR A;  1YLT A;  1FR1 A;  3IXD A;  4OQ0 A;  2EX2 A;  3HLB A;  4N9L A;  5DF8 A;  3BEB A;  4R4S A;  4BLM A;  5I94 A;  1KVL A;  3EQV A;  4U3T A;  3SOI A;  2WGV A;  3BYD A;  1BTL A;  3N4I A;  3W4Q A;  3SS3 A;  4K91 A;  1MXO A;  2X01 A;  1G6A A;  3IXG A;  5CHU A;  3UE1 A;  4A5R A;  1M40 A;  3ZVW A;  1ERO A;  3M2J A;  2ZC3 B;  5HAI A;  1PYY A;  4WEL A;  4D2O A;  3C7V A;  4JF4 A;  3VOZ A;  4WMC A;  5GLA A;  4HEF A;  1BSG A;  2ZLY A;  3LO7 A;  5DF9 A;  1GCE A;  5EUA A;  3ZDJ A;  2EX6 A;  2Y2G A;  4QY5 A;  1NRF A;  4E3I A;  1W8Q A;  1I5Q A;  2A49 A;  1LI9 A;  1E3U A;  2Q9N A;  5GHY A;  4YFM A;  1KE3 A;  1W5D A;  4JXG A;  3V39 A;  5E2E A;  2HP9 A;  4ZBE A;  1ZG6 A;  1MPL A;  2IWC A;  2V1Z A;  3IF5 A;  2G2W A;  3GR2 A;  1FSW A;  3WS1 A;  4E3K A;  4QD4 A;  2A3U A;  4OPZ A;  4OH0 A;  1RGZ A;  3HRE A;  1ONG A;  1CEF A;  3ZVT A;  1IEM A;  3Q1F A;  1HVB A;  3ZG0 A;  5EVL A;  4IED A;  4OQG A;  2QZ6 A;  2JCH A;  2Q9M A;  4GZB A;  3PBN A;  3I7J A;  4GOG A;  1CI9 A;  2HDU A;  3BFG A;  1K54 C;  5CHJ A;  1VM1 A;  4Y0T A;  4KZ7 A;  3PBQ A;  4LV0 A;  4BD1 A;  1K55 C;  5KSC A;  4KZ5 A;  1BZA A;  1E25 A;  1ERQ A;  5FQQ A;  1XA1 A;  2BG1 A;  4GNU A;  3MKE A;  3BM6 A;  3G34 A;  2Y2K A;  2XEP A;  1XKZ A;  1Q2Q A;  2PU4 A;  3G2Z A;  3CMZ A;  3IHB A;  1CEG A;  2XF3 A;  3NY4 A;  1FOF A;  3MXR A;  4S2J A;  4UA9 A;  1WYC A;  4WBG A;  1IKG A;  1ES2 A;  3OPL A;  3VMA A;  2XFS A;  4PM7 A;  2E8I A;  2X71 A;  4QU3 A;  3UY6 A;  4CPK A;  3IWI A;  3TG9 A;  4K0W A;  1TDL A;  3IF6 C;  4X69 A;  3A3F A;  4PPR A;  4JXS A;  5KZH A;  3RXX A;  1S0W A;  2P9V B;  1KDS A;  1RGY A;  1CK3 A;  2G2U A;  2WGW A;  4QY6 A;  5FQ9 A;  3WRZ A;  3G31 A;  2JE5 A;  1I2S A;  3ZNT A;  1FSY A;  1XX2 A;  5GHZ A;  1PI4 A;  1BT5 A;  3HVF A;  3WS4 A;  4E6W A;  3VFF A;  3ZGA B;  4DRT A;  3MZD A;  5FAP A;  3SS5 A;  5CGX A;  3FZC A;  3GMW A;  5E2G A;  4E3N A;  3A3D A;  3NBL A;  4P6B A;  3UO9 A;  4OLG A;  4B4Z A;  3PBO A;  1K4E A;  5G18 A;  5CTM A;  3FYZ A;  1TDG A;  4BQM A;  4KZA A;  2P74 A;  3BFF A;  1GHM A;  4JKT A;  1ZG4 A;  3BLS A;  4N92 A;  3RJU A;  3HL9 A;  4E3L A;  1ES3 A;  2V2F F;  2XDM A;  2ZQ7 A;  1PZO A;  1H8Y A;  1HD8 A;  1IYP A;  2XH9 A;  3BFC A;  3MZE A;  3O3V A;  3UDX A;  3P98 A;  5TFQ A;  1JTD A;  3VP3 A;  5EEC A;  1NY0 A;  3C4O A;  4MBK A;  4ZTK A;  4MBH A;  3HLG A;  3WWX A;  4R3B A;  4JXV A;  3V3S A;  5M18 A;  2EXA A;  1FR6 A;  3OPR A;  4OP5 A;  5CER A;  1L2S A;  4WZ5 A;  2UWX A;  4X68 A;  4Y7P A;  2WUQ A;  5CHM A;  3AGD A;  3UE3 A;  1NJ4 A;  1SDN A;  3PAE A;  2P9V A;  2WK0 A;  3ZNY A;  3DW0 A;  3PBT A;  4DF6 A;  3BFE A;  3W4P A;  3NDE A;  4LV1 A;  5JYP A;  1L0E A;  1NZO A;  4WEJ A;  1CI8 A;  4MEZ A;  1ZC2 A;  4O7D A;  4S2N A;  1DJB A;  3NC8 A;  3QNB A;  1SCW A;  4OOL A;  1YMX A;  4X53 A;  1C3B A;  4EBP A;  5GL9 A;  1YLW A;  4ID4 A;  5A91 A;  3HLE A;  1OME A;  3C5A A;  1JWV A;  3SH8 A;  3V50 A;  2EX9 A;  4DXC A;  1YLZ A;  1YLJ A;  1S6R A;  1U60 A;  4KQR A;  4R3J A;  2Y2I A;  4FSF A;  5JYO A;  2ZQ8 A;  4WYY A;  4E3O A;  1LL5 A;  3UPO A;  1LLB A;  4KZ4 A;  1GA0 A;  3LCE A;  3DWK A;  3C7U A;  4JPM A;  4NK3 A;  5FI6 A;  4BEN A;  2HDS A;  5EOO A;  4KZ6 A;  5GHX A;  3S22 A;  2WZZ A;  5CGS A;  4NET A;  3MKF A;  4BL2 A;  4DE2 A;  5FQK A;  5IHV A;  1K38 A;  2WAF A;  3VP1 A;  3G35 A;  3DTM A;  5E2H A;  1RCJ A;  1I2W A;  1FQG A;  2PBY A;  5FSR A;  3RXW A;  4BL3 A;  4FD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...