4UA7A

Ctx-m-14 class a beta-lactamase in complex with a non-covalent inhibitor at sub-angstrom resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
b'ETSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-14
publication title Ligand-Induced Proton Transfer and Low-Barrier Hydrogen Bond Revealed by X-ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 96
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ua7A00
1SHVA 1MWRA 4QY5A 1K57C 4N9KA 2V1ZA 5GLCA 3FZCA 3HUOA 2DNSA 1Q2PA 4BJPA 3OPHA 4FH4A 4XUXA 2OLVA 4X6TA 2QMIA 1JWVA 1FCOA 4KZ8A 5D3OA 5FQKA 3IH9A 4X68A 5AQ7A 2Y2JA 3NDGA 5CEBA 1Q2QA 4KZ6A 3GSGA 2EX2A 4JF6A 3ZGAB 3G35A 2R9WA 3GV9A 1FCMA 3AGDA 5JYPA 3PBTA 3Q07A 4S2IA 1L0GA 1K54C 3BRMA 4E3KA 3PAEA 2P9VB 3LCEA 1DY6A 2WADA 3G30A 3AGFA 4LENA 1DJAA 3I7JA 3BYDA 2HDSA 3FKVA 2ZD8A 1W7FA 1ZG6A 4N1XA 5GHXA 4E3LA 5U47A 4UA9A 3V50A 3JYIA 2H0TA 3UDXA 3N8SA 3Q1FA 1E25A 1ERQA 3GMWA 4JXWA 4O7DA 5JYOA 4OPZA 1YT4A 3C7UA 4BLMA 2R9XA 4EUZA 3G2ZA 2I72A 4UA7A 2HDRA 3BFDA 3Q7VA 1I5QA 1PW1A 3O86A 1SKFA 3PTEA 5EVIB 1U60A 4RYEA 3ZG0A 5FAOA 2FFYA 5CERA 4R3BA 2XEPA 4R0QA 3HLEA 1C3BA 4OVDA 3ZNYA 4B4XA 4PM7A 5I94A 1IYSA 4KZBA 3VP1A 3S22A 3S4XA 1WYCA 3N7WA 2XD5A 2EX8A 1W79A 5CRFA 1VQQA 2ZQCA 3FWLA 1JVJA 1K56A 2Y91A 4S2NC 3GTCA 2XGNA 1LLBA 4UAAA 2IWBA 5HAQA 3WRZA 3IXDA 3M2KA 4OLGA 3N4IA 1NXYA 3UPPA 5CTMA 3BFGA 2Y2OA 1FR1A 3NI9A 3C4OA 1YLTA 4U3TA 3BM6A 3QHYA 5EVIC 3GVBA 5DF7A 4WMCD 4WZ5A 4QU3A 1WE4A 3UN7A 2Q9NA 3VP3A 1GHPA 2WYXA 3OCLA 2WKHA 1NRFA 1XKZA 4EV4A 1LI0A 1M6KA 2WUQA 2HDQA 3IXHA 1H8YA 5TR7A 3LEZA 4R4RA 2ZM8A 3DTMA 4LV0A 5CXWA 2WKIA 3MKEA 5FDHA 2WGWA 3LY4A 2ZMAA 3NBLA 2JBFA 1MKIA 3V3RA 4DE2A 1PZPA 2IWDA 1HTZA 1S0WA 4X53A 4OP5A 1EROA 2ZQ7A 3E2KA 4HBUA 4E3MA 2C5WB 4OQGA 5F1GA 2OSUA 4DDSA 4FD8A 3S1YA 1JWZA 5DTTA 5EVID 3VP4A 3C4PA 2J7VA 2WGVA 3WS1A 1OMEA 1PWCA 4S2OA 3VP2A 4DDYA 4U0TA 1W8YA 3PBNA 4PM9A 5CTNA 3ZHHA 5M19A 2ZM0A 1CEGA 1GHMA 3N6IA 1CEFA 4P87A 5FA7A 2E8IA 3G31A 4C6YA 1FSYA 3O88A 4DE1A 4GD6A 3A3FA 4DE3A 3VSKA 4N9LA 1PWDA 1YMSA 4FH2A 3ZG5A 4JLFA 2Y59A 3FKWA 3PAGA 3HLBA 3SH7A 5M18A 4KZAA 3A3DA 4X56A 4DXCA 3B3XA 5HFOA 1TEMA 2HP5A 5FAQA 4HEFA 4N1HA 3BFFA 4JXSA 5AQ9A 4IVIA 4Y0OA 5HW3A 4R23A 2H10A 3RXWA 4PPRA 3E2LA 4QD4A 1ES5A 1LL9A 5J8XA 4RA7A 1HD8A 4LV2A 4KZ7A 1PWGA 2BLSA 1YLYA 4MBFA 3M6HA 4E6WA 3MKFA 3NCKA 1K4EA 4S2KA 2ZM2A 3RXXA 4X55A 3HLWA 4WZ4A 1W5DA 3Q7VB 5CHMA 2XFTA 2X71A 4KENB 1ALQA 3BFEA 1KE3A 1YM1A 2J8YA 1K25A 2G2UA 2J9PA 3UPOA 2XD1A 4QJGA 3AGEA 4WEJA 2JE5A 4OOMA 3LY3A 4K0XA 1GHIA 2Y2LA 3BFCA 2ZLYA 1JWPA 3HLFA 2Z2LB 2Y2PA 5CGXA 2RCXA 3EQVA 5FQ9A 2XH9A 1IYQA 3MXRA 3ZFZA 3FV7A 4K0WA 4OQHA 1O07A 2Y2IA 2X02A 1BT5A 3BLMA 5FQQA 4R4SA 1XXMA 4H8RA 4ID4A 5HL1A 4P85A 3HBRA 3C7VA 4A5RA 2WK0A 1FR6A 5CHUA 3ITBA 1IEMA 1K4FA 4E3JA 3MBZA 3HLDA 4EQIA 2WAEA 5CECA 4GD8A 5KSCA 4YFMA 4GNUA 1MWUA 1K55A 2WAFA 3PBOA 1TVFA 3ITAA 2HPBA 5HARA 2FFFB 1ERMA 5IHVA 3HL9A 4ZJ3A 1PZOA 4WMCA 4UA6A 1SDNA 3LO7A 1G68A 2WGWB 4KZ9A 4OQIA 4P0MA 3UNWA 3RJUA 3UE1A 4D2OA 3A3EA 3P98A 2V2FF 2ZC5B 3ZDJA 2C6WB 3HVFA 2G2WA 3NY4A 4C3QA 4F94A 5FI6A 1BLHA 3VP0A 3BECA 3M6BA 4PMAA 4R1GA 1KGGA 3IXGA 4WZ5C 1RCJA 4E6XA 1XP4A 2Y2HA 4EBLA 2H5SA 3Q82A 4FCFA 5A91A 2Q9MA 3IWOA 4R3JA 5GLBA 5FAPA 2ZQDA 3IWIA 1PI5A 3ZNTA 4DKIA 1AXBA 1FSWA 5CGSA 4YINA 4K91A 5FI2A 4OONA 1MWTA 3UPNA 3IH8A 4IBRA 4ZJ1A 1K6RA 5TFQA 3UDIA 1ES3A 4GOGA 4QY6A 2JC7A 4L0LA 1Y54A 4ZAMA 1YLWA 1YLZA 2VGKA 3BLSA 3UE0A 1GCEA 1ONHA 1XPBA 3W8KA 1SDEA 3V3SA 2Y55A 1NJ4A 2ZC7A 5A90A 4S2JA 5DVAA 5TGFA 1MPLA 5DTSA 1XGJA 1MXOA 2ZQ9A 3IHAA 3C5AA 4KQQA 1KDWA 3NIAA 1E3UD 3O87A 3CMZA 4S2MA 3MXSA 4GZBA 4XXRA 1FCNA 4JKTA 5EOOA 4XUZA 2GDNA 5EVLA 1BLCA 3W4QA 4EWFA 4MLLA 4JF4A 3MFDA 4Y0UA 5FI7A 4KZ4A 3UO9A 2VGJA 4WBGA 1IKGA 1ONGA 4UHUA 5EE8A 3DWZA 5A93A 4WELA 4KQOA 1MBLA 2XLNA 4CJNA 1BUEA 1KDSA 3GQZA 4OPQA 3SH9A 3SS5A 1EWZA 4MEZA 1ZG4A 5FATA 4GN2A 4QB8A 4RX3A 4HESA 3UY6A 1J9MA 1G6AA 3GR2A 3IF6B 3PBRA 4WM9A 4IEDA 2V20A 3G2YA 4MBKA 3VOYA 1IELA 3DWKA 4B4ZA 5A92A 1KE4A 2XR0A 4LCMA 1DJCA 3HLGA 2A3UA 3P09A 5EUAA 4BQMA 1S6RA 2OLUA 3O3VA 1KE0A 1KVLA 2EX6A 3ZG9B 2EXAA 3WS0A 1XA1A 5HX9A 1K6SA 3SS4A 5E2HA 4RVAA 1XGIA 4E3NA 4M3KA 1BLSA 4DF6A 4LCLA 2XK1A 3CZDA 5GLAA 4GDBA 5DF9A 4RX2A 1QMEA 3GRJA 3HUNA 1IYOA 2ZJ9A 1MWSA 3EQUA 1LHYA 1PW8A 3IF6A 3WS2A 3N8RA 1DJBA 1GA9A 3N8LA 5GL9A 2A49A 5DTKA 1SCWA 2DRWA 3ISGA 1NZUA 3OPRA 3IF6C 1MY8A 3IT9A 1YMXA 1ZKJA 4MNRA 4NK3A 3TOIA 3OZHA 2HP6A 2Y2QA 5G18A 1K54A 3SOIA 2ZQ8A 3CJMA 1BSGA 4KZ3A 1YQSA 4EBNA 3Q7ZA 5KMWA 2IWCA 3G34A 4Y0TA 1K38A 3OPLA 4S2LA 5EOEA 4P6BA 2EFXA 3NC8A 1CI9A 4JPMA 4DRTA 1CI8A 1XA7A 4N92A 5FQMA 3VFFA 5F83A 4EBPA 2Y2NA 1M40A 4ZJ2A 5FQIA 5BOHA 1QMFA 2EXBA 5AQBA 3HREA 4FSFA 5E2GA 1PIOA 4ZTKA 2ZC3B 4ZBEA 3FYZA 4BD1A 4Z9QA 2PBYA 2Y4AA 4GB7A 2WKEA 3MZFA 1BLPA 2XDMA 1JTGA 1FOFA 4KQRA 2J9OA 4KZ5A 2JCHA 1HVBA 4Q8IA 3G4PA 2Z2MB 4GDNA 4KG5A 3PBQA 1Z6FA 2PU4A 3NDEA 1K55C 2P9VA 3OCNA 1ES2A 4KG2A 3SS3A 4B88A 1TDLA 4OP8A 3G32A 5E43A 5EPHA 3BEBA 3V5MA 5CGWA 1ESUA 5F1FA 5KSHA 1KGEA 1L0EA 4BENA 4OQ0A 5FASA 2XF3A 3M2JA 3TG9A 3ZVWA 4OPRA 3UDFA 2DCFA 3A3IA 3HLCA 3ZG7B 1XX2A 4OH0A 3SH8A 3VOZA 3IF5A 4PM6A 4S2NA 3OPPA 2RL3A 3W4OA 4E3IA 1ZC2A 1ES4A 2ZQAA 4JXVA 3TSGA 2Y2MA 1NZOA 2PU2A 5E2FA 2WZZA 1HZOA 4OLDA 5EECA 4BL2A 2X01A 1NYYA 3Q81A 3WRTA 4LV1A 1KVMA 4DXBA 1LL5A 2HP9A 5GLDA 1BTLA 3D4FA 3IXBA 4E3OA 1L0FA 5EVIA 1TDGA 5E2EA 1NYMA 4S2PA 1O7EA 2EFUA 3DW0A 1K56D 4PM8A 1CK3A 3MZDA 5FQJA 3IWQA 1E4DA 1IYPA 4JXGA 4LV3A 4WEKA 5DF8A 1E3UA 4DE0A 1L2SA 2Y2GA 1ESIA 3V39A 1N4OA 4KG6A 5HAIA 1YLJA 2ZC4B 3QNBA 3PBSA 3VMAA 3WS5A 4CPKA 2QPNA 4JBFA 3ZVTA 3ZCZA 2CC1A 1I2WA 3HUMA 1RGYA 1FQGA 1BULA 5FSRA 4Y7PA 1VM1A 4IBXA 2XQZA 1KGFA 1N9BA 5GHZA 4U0XA 4NETA 5CEDA 5CHJA 5AQAA 1PYYA 1L0DA 2Y2KA 2UWXA 2XFSA 1RP5A 3IHBA 1JTDA 4QHCA 4ZDXA 4IVKA 4X69A 1W8QA 4WYYA 3W4PA 4C75A 1IKIA 1EI5A 3A3JA 1RGZA 2ZC6B 2EX9A 1I2SA 3WWXA 5HAPA 3CG5A 4OPYA 2BG1A 4MBHA 4OOLA 2P74A 1GA0A 3WS4A 3OC2A 4GKUA 3VFHA 4BL3A 1WYBA 1YLPA 5F82A 4PM5A 1LI9A 2QZ6A 1PI4A 1NY0A 4OKPA 1H5XA 2H0YA 2WZXA 2WGIA 1H8ZA 2B5RA 3IQAA 3UE3A 3MZEA 4OOYA 3QNCA 3ZG8B 4JF5A 5KZHA 1K57A 4BD0A 2HDUA 4HBTA 5L2FA 5GHYA 3VSLA 2OV5A 5M1AA 1BZAA
chains in the Genus database with same CATH superfamily
1XFQA 1K57C 2V1ZA 5GLCA 1Q2PA 2OLVA 1NWZA 5IS1A 3CWFA 3IH9A 1SZVA 3NDGA 5K5BA 1Q2QA 2QKPA 2GX5A 4JF6A 5HDCA 2JKTM 2R9WA 3AGDA 1L0GA 4E3KA 4NEED 3IBRA 2W1RA 3AGFA 2W3HA 3FKVA 4O0PA 1W7FA 4N1XA 5GHXA 3C8CA 4UA9A 3JYIA 2H0TA 2YKFA 5DFXA 4JXWA 3CLOA 3DTKA 2W27A 4UA7A 2HDRA 5FAOA 1ZHHB 4Y2FA 5F68A 4KZBA 3S22A 3S4XA 5HWTA 3LICA 3A0VA 5CRFA 4X1MA 1JVJA 3QP8A 2PR6A 4OLGA 3N4IA 1XFNA 3KYZA 2Y2OA 1FR1A 3C4OA 3MS6A 5EVIC 5DF7A 4WZ5A 4QU3A 3UN7A 2Q9NA 2WYXA 4EV4A 3T1XA 4G3VA 5TJJA 3LEZA 4R4RA 2WKIA 1F5MA 5DKLA 3CUEC 2ZMAA 1MKIA 2IWDA 4HQAA 4X53A 2HGVA 2ZQ7A 3E2KA 4E3MA 2C5WB 5F1GA 2OSUA 4DDSA 3ZYTA 3VP4A 4YWZA 3LR0A 2J7VA 2MJ6A 3WS1A 1PWCA 2Z6DA 2VX8A 4YNRA 4DE1A 3B47A 4DE3A 3LR5A 4N9LA 2PRFA 3NOPC 4JLFA 3U2AA 1S1YA 4NXFA 1MC0A 3F1PB 1TEMA 1T1BA 1SKOA 2FZ0A 2H10A 4QD4A 5G4YA 1ES5A 3MR0A 1TF1A 2HV1A 4EXOA 1YLYA 4R38A 3PYPA 4E6WA 3EWKA 1FILA 2ZM2A 4BWIA 4KENB 1ALQA 3P01A 1KE3A 3UPOA 2J9PA 5F6AA 2XD1A 4AFIA 3T1SA 1JWPA 3HLFA 2Y2PA 5CGXA 2W3FA 4HOIA 4L9GA 5L07A 1TS7A 4K0WA 4OQHA 2HZ5A 5FQQA 2M7VA 4ID4A 3HBRA 3C7VA 4A5RA 1FR6A 4HP4A 3EGXC 5CECA 4MN6A 4GD8A 1H0MA 2PAVP 3HL9A 1PZOA 1OTIA 4WMCA 1OT9A 2JKFA 1SDNA 3LO7A 4YOFA 1G68A 4P0MA 3UE1A 4D2OA 3T1QB 3KSFA 3P98A 3ZDJA 2C6WB 4C3QA 4F94A 1ZTUA 3GDIA 4R1GA 4E6XA 1WA9A 4FCFA 2Q9MA 2VLGA 3IWOA 3DTEA 3IWIA 5CGSA 1JNUA 3BWLA 4UEYA 2JKGA 1W63M 4GOGA 4CLCD 4L0LA 3KO6A 2P7JA 1GCEA 1ONHA 2I9VA 2Y55A 3BJNA 5A90A 5DVAA 4WUJA 1EW0A 5DTSA 3IHAA 4KQQA 3O87A 2GNXA 4JKTA 1H8MA 3W4QA 3UO9A 2VGJA 4WELA 1MBLA 2XLNA 1KDSA 3GQZA 4H6JB 4RX3A 1J9MA 1G6AA 4Q0JA 3DBAA 3G2YA 2J3WA 3DWKA 4B4ZA 2OLUA 3O3VA 2EX6A 1XA1A 1K6SA 3H7WB 5E2HA 2JKRI 4RVAA 2EWVA 3NOTC 3CZDA 4GDBA 5DF9A 3HUNA 3MXQA 1IYOA 1OT6A 3T4OA 3NECA 1LHYA 1VHMA 3CI6A 3OZHA 2Y2QA 3BY8A 4M4XA 4K08A 3CJMA 1BSGA 2KLIA 3KSGA 3OPLA 4LRXC 4P6BA 2LB5A 4DRTA 1CI8A 1XA7A 5FQMA 3LI9A 1OTAA 1M40A 3PHYA 3GECA 3HREA 4ZTKA 2Y4AA 4GB7A 3UB5P 1IOUA 2J9OA 2JCHA 4Q8IA 4ME4A 3G4PA 5DJUA 2PU4A 1K55C 4KG2A 1TDLA 1YKDA 3MMHA 1YPRA 2K2NA 3ZVWA 3SZTA 3ZG7B 5L09A 4IJGA 2V0UA 2PU2A 3KYQA 2WZZA 4BL2A 1VB6A 2X01A 5GLDA 3TRCA 1BTLA 3D4FA 4E3OA 1BYWA 2LB9A 5EVIA 2EFUA 3MZDA 2V9AA 5DF8A 3T12B 1E3UA 4GHIA 1N4OA 4E04A 3R7WA 3QNBA 3CUEA 4MN7A 4GLQA 4I3JA 3ZCZA 2CC1A 3HUMA 1RGYA 1P0ZA 1KGFA 5CHJA 2Y2KA 2P08A 3IHBA 1JTDA 4ZDXA 4IVKA 1W8QA 2K7SA 2ZC6B 1I2SA 3IS2A 5HAPA 3U4LP 3CG5A 4OPYA 2BG1A 5J4EA 4MBHA 5HD5A 3WS4A 2WKRA 2OAQ1 5IU1A 4PM5A 1LI9A 4PHTA 3MJQA 1UWPX 1H8ZA 2V8CA 4HBTA 4IUKA 2OV5A 3UMEA 4KG5A 1MWRA 4N9KA 2CMNA 3HUOA 2DNSA 3TJZC 4FH4A 4O01A 2QMIA 4X68A 2Y2JA 2QJ7A 2VKSA 1K0KA 2J3TC 3GV9A 5JYPA 3PBTA 3Q07A 4JGQA 4S2IA 1K54C 3PAEA 2P9VB 3LCEA 1DY6A 4LENA 2W0NA 2HDSA 2VZWA 5U47A 3L7HA 1F98A 3UDXA 3N8SA 4KUKA 3TE8A 1E25A 1ERQA 5L10A 4O7DA 2KX6A 3C7UA 2R9XA 4CLCB 3Q7VA 3O86A 1SKFA 3KSIA 3PTEA 4PAUA 3ZG0A 5CERA 4R3BA 4GS9A 4PKYA 1VEUA 1G28A 3ZNYA 3F1NA 4HJ3A 4PM7A 1IYSA 2OWHA 1WYCA 3N7WA 2EX8A 3VE3A 3QP5A 3FWLA 1K56A 2Y91A 5HAQA 4NKPA 3IXDA 4LFUA 1G5UA 1Z09A 4Y13A 3MQQA 3T4LA 3QHYA 3OCLA 1NRFA 1LI0A 4DMZA 2WUQA 3DTMA 5CXWA 2OAP1 5FDHA 3LY4A 4BBVA 3NBLA 3V3RA 2EA9A 4DE2A 1HTZA 4OP5A 2HJEA 4HBUA 4DN0A 3BW6A 4IHQA 1XJ2A 5EVID 2WGVA 1SKOB 4DDYA 3T4JA 4PM9A 3ZHHA 3UB8A 1LSWA 4MMNA 5M19A 3N6IA 1CEFA 3K3DA 4WN5A 3S7QA 3A3FA 1V9ZA 2IA2A 4FTXA 3ZG5A 3H82B 4CLCE 2W3EA 3IBJA 5FAQA 3CITA 1N9NA 1S66L 3F1OA 2PT7A 1KOUA 4JXSA 5AQ9A 4IVIA 4Y0OA 5HW3A 4R23A 4KZ7A 1NLZA 2BLSA 3LGOA 2O9AA 3MKFA 4S2KA 5AVEA 3HLWA 2XFTA 2X71A 5HDDA 3IX3A 1PNEA 5A8BA 3HJIA 4LGWA 3T4SA 3AGEA 4K0XA 1GHIA 2Y2LA 3BFCA 1T18A 2Z2LB 3EQVA 1IYQA 3MXRA 3ZFZA 1D7EA 1GSXA 2X02A 1BT5A 3BLMA 4XT2B 4R4SA 5HL1A 4P85A 5HWWA 4JGRA 3ITBA 1LT0A 3MBZA 3LI8A 4EQIA 2V8FA 5KSCA 1K55A 2WAFA 1TVFA 2HPBA 2FFFB 2VV6A 5IHVA 4HJ6A 4L9EA 5TBMA 2WGWB 4LRZE 4NG2A 3BQ8A 2ZC5B 4UQIS 3VP0A 3BECA 4ESPA 3IXGA 1XP4A 4Z1WA 1LSXA 3DAVA 3O5YA 4DKIA 1AXBA 4R6LA 1FSWA 4YINA 2Q0OA 1MWTA 3UPNA 2B18A 3IH8A 1K6RA 5TFQA 3UE0A 3BLSA 1XGJA 3C5AA 1KDWA 4XXRA 5EOOA 5EVLA 1BLCA 1X0OA 4Y0UA 4BBUA 2D01A 1ONGA 3DWZA 3SH9A 3SS5A 3UE6A 4MEZA 4QB8A 1Y4OA 3PBRA 2V20A 3ICYA 3LFVA 4ZRRA 5EUAA 2XA7S 4DXBA 3ZG9B 1KE0A 1VETB 5HX9A 2XA7M 4E3NA 1XGIA 2W1TB 1BLSA 3OOVA 1DRMA 3GRJA 1MWSA 1PW8A 3IF6A 1GA9A 2A49A 5DTKA 1SCWA 2DRWA 1NZUA 3OPRA 3IT9A 1MY8A 3TOIA 1YMXA 4MNRA 2HP6A 5G18A 3SOIA 1K54A 2VV8A 2ZQ8A 1YQSA 3Q7ZA 5KMWA 1CI9A 4JPMA 2W3DA 4EBPA 1QMFA 2EXBA 2Y8HA 5FL3A 5E2GA 3SW1A 2PBYA 1ACFA 1JTGA 1FOFA 4KQRA 2D02A 4KZ5A 3BQAA 4NXEA 3PBQA 2Z6CA 3NDEA 4B88A 4X1LA 3G32A 5EPHA 3BEBA 3UB9A 5F1FA 1ESUA 5KSHA 5DFYA 3TG9A 1UGUA 2WKPA 1XX2A 4OH0A 3SH8A 2EWWA 5J3WA 1ZC2A 2ZQAA 4GJ4A 4JXVA 3T4QA 1NZOA 3EEHA 5EV0A 1NYYA 3C2WA 4S2PA 2ZL1B 1LL8A 2QHKA 3MQOA 1IYPA 3JPUA 4P6ZS 2HF6A 3V39A 1L3LA 4KG6A 2ZC4B 4JGOA 4CPKA 3LIAA 1FQGA 4R70A 5FSRA 1S67L 1VM1A 2XQZA 1PYYA 1L0DA 3CAXA 3G6OA 1P97A 4ARZB 3K3CA 1IKIA 2JHEA 2VGLS 1Y28A 3LIFA 2VGLM 4GKUA 1WYBA 2A24B 2WKQA 2GJ3A 4GCZA 1NY0A 3L9KA 2H0YA 3UE3A 3IQAA 2JKTI 3QNCA 5KZHA 4HJ4A 1K57A 4BD0A 4EUVA 5GHYA 3VSLA 4DF6A 5HWVA 3FZCA 1F9IA 3OPHA 4XUXA 4X6TA 2O99A 1JWVA 4KZ8A 5D3OA 5FQKA 4WL9A 4KZ6A 3T4TA 4ETXA 2EX2A 3ZGAB 2ZOHA 5I5LA 1DJAA 5EVEA 3BYDA 3QP2A 2ZD8A 4MDZA 1ZG6A 5AVFA 4GS9B 3V50A 3LIDA 3F1NB 3D72A 3GMWA 1YT4A 3E98A 3T4KA 3G2ZA 3BFDA 1I5QA 1PW1A 1U60A 4RYEA 2V0WA 2XEPA 1C3BA 4OVDA 4B4XA 3VP1A 3H9WA 3ULFA 2QJ5A 4O8GA 2INWA 1P9RA 1W79A 1DP9A 2IWBA 2XGNA 3JVUA 3WRZA 3M2KA 1NXYA 3UPPA 4CLCC 5EFWA 4HH2A 2FH5A 1OPXA 3BFGA 3NI9A 1YLTA 3BM6A 4WMCD 1GHPA 2WKHA 1XKZA 3VE4A 2M1CA 2HDQA 3MF0A 3IXHA 1H8YA 5TR7A 4F3LB 1YSQA 3MFXA 2JBFA 1PZPA 2B02A 4OQGA 3S1YA 1OTEA 1JWZA 5DTTA 5J7EA 2ACGA 3C4PA 3LEQA 3VP2A 3TW8A 4U0TA 1W8YA 3NJAA 3PBNA 5CTNA 2ZM0A 1CEGA 1S1ZA 2E8IA 3MQ0A 4GD6A 1YMSA 4FH2A 3PAGA 3HLBA 3SH7A 5M18A 4KZAA 3LIBA 2H28A 3A3DA 2PDRA 4DXCA 3B33A 1YSPA 5HFOA 3T1RA 2HP5A 4N1HA 5EM1A 4PPRA 1HD8A 3E0YA 5FEFA 1PWGA 4MBFA 3M6HA 4RQ9A 5AJGA 1G6OA 5HDSA 2OOLA 3RXXA 4WZ4A 1W5DA 1XJ6A 4H6JA 2J8YA 1S4SA 4KQDA 3LR3A 4QJGA 4KUOA 4OOMA 3LY3A 5FDSA 3H7WA 3UB7A 1PRQA 5FQ9A 2XH9A 3FV7A 2Y2IA 1XXMA 1ODVA 2ZOIA 1XJ3A 3UMDA 3HLDA 3FPVA 2VA0A 4GNUA 4II7A 3ITAA 1ERMA 4MCWA 4ZJ3A 1CJFA 1H3QA 3UNWA 4X25A 4DJ2A 3K2NA 3HVFA 5FI6A 1BLHA 1IFQA 4DJ3A 4NXBA 2JN7A 1KGGA 1DP8A 1RCJA 2BASA 4EBLA 5A91A 3LUQA 5GLBA 5FAPA 2PBDP 1OJGA 1PI5A 3LIEA 4K91A 4IBRA 4ZJ1A 3UDIA 4QY6A 1Y54A 4ZAMA 2VGKA 3W8KA 1SDEA 3V3SA 1NJ4A 2PYRA 2ZC7A 1XJ4A 3FG8A 1MXOA 2ZQ9A 2VEAA 1E3UD 4S2MA 4EERA 3MXSA 4GZBA 4I39A 2GDNA 4R3AA 4MLLA 4JF4A 3LYXA 3MFDA 5FI7A 1IKGA 4UHUA 5EE8A 4CJNA 3CPTA 1BUEA 1EWZA 1ZG4A 4Q0HA 5FATA 4QPRA 3UB6A 3GR2A 2J80A 3IF6B 4WM9A 3A0SA 4MBKA 1IELA 5A92A 3B42A 4LCMA 5HZHA 3HLGA 3P09A 5BOHA 1KVLA 2EXAA 3WS0A 2YKHA 1TS6A 3SS4A 3E4PA 4M3KA 1A0KA 4LCLA 2XK1A 2VJWA 5GLAA 4RX2A 2ZJ9A 1DJBA 5GL9A 3KX0X 4NK3A 4L9FA 2JKRM 2ZMVA 1MKMA 2IWCA 4B9OA 4Y0TA 3NC8A 1LSVA 5F83A 3PR6A 2VV7A 4FSFA 2ZC3B 2WKEA 3MZFA 1BLPA 3T50A 5IT5A 1HVBA 2Z2MB 2P9VA 3OCNA 3SS3A 4OP8A 1OTBA 3V5MA 5CGWA 3R4KA 5FASA 2XF3A 3M2JA 2DCFA 3HLCA 4UQIM 4PM6A 3OPPA 2RL3A 3D9YA 3W4OA 5L8MA 3TSGA 2Y2MA 5E2FA 4I5SA 4OLDA 1HZOA 3S7NA 4CLCA 3WRTA 4LV1A 1KVMA 1LL5A 1D1JA 2HP9A 1L0FA 1TDGA 1NYMA 1O7EA 3E4QA 3DW0A 1K56D 2VK3A 3VV4A 4EQ1A 2UV0E 3IWQA 4G3WA 3NULA 4WEKA 1ESIA 1PFLA 5HAIA 1YLJA 4WLAA 2OWJA 3PBSA 1N9LA 1UWNX 3VMAA 4JBFA 3ZVTA 1I2WA 3FPWA 5DKKA 1BULA 4Y7PA 1CQAA 4IBXA 1N9BA 2DMWA 4U0XA 5GHZA 4Y17A 5AQAA 2UWXA 2L1MA 4QHCA 4EEUA 4C75A 4FOFA 5LBRA 3A3JA 5EM0A 3WWXA 2EX9A 4OOLA 2P74A 1GA0A 2QYBA 3OC2A 4HIAA 2QZ6A 3JVVA 1H5XA 1MZUA 2B5RA 3MZEA 2NUPC 2XSSA 3ZG8B 2HDUA 4BL3A 1SHVA 4QY5A 4BJPA 1FCOA 5AQ7A 5CEBA 1V9YA 3GSGA 3D3OA 3H82A 3G35A 4CQHA 1FCMA 3BRMA 2WADA 3G30A 4LPZA 2A2LA 3I7JA 2V1BA 1AWIA 2BTFP 4E3LA 5C5KA 3Q1FA 5JYOA 4OPZA 3PXPA 4BLMA 1YAXA 4EUZA 2I72A 3IX4A 3RFBA 3HCYA 2O9BA 5EVIB 4WF0A 2FFYA 2PR5A 4R0QA 3HLEA 5I94A 3RTYA 4GHIB 2XD5A 3R7WB 1TD5A 2GZAA 1VQQA 2HJ9C 2ZQCA 4S2NC 3GTCA 4UAAA 1LLBA 2PHYA 3RH8B 4HI4A 5CTMA 4XT2A 3ZQ5A 4U3TA 3OBFA 3GVBA 1WE4A 3VP3A 5MC7A 4P6ZM 1J3WA 1M6KA 3IS2B 2ZM8A 4LV0A 4JGPA 2O9CA 3LR4A 3MKEA 2WGWA 1S0WA 4HH3A 1EROA 4LLOB 4FD8A 2O0YA 2M7UA 1OMEA 4S2OA 2KOIA 3C38A 4EU0A 1GHMA 5FA7A 4P87A 4C6YA 3G31A 1FSYA 3O88A 3S7PA 3VSKA 1PWDA 2Y59A 3FKWA 4EESA 4X56A 3B3XA 4G3KA 4HEFA 3BFFA 3RXWA 3E2LA 1LL9A 5J8XA 4RA7A 3S7OA 5HL6A 4LV2A 5FEGA 2V1AA 3IX8A 3NCKA 1K4EA 4PKYG 3DTIA 1T19A 3F1PA 4X55A 5CHMA 3Q7VB 1TS0A 5F5YA 3BFEA 1YM1A 1K25A 2G2UA 1VEUB 3QP1A 3QP4A 4WEJA 2JE5A 1TS8A 3VOLA 2K31A 3NOUC 1VETA 4GW9A 1CF0A 2ZLYA 5CX7A 2XRNA 2RCXA 2W1TA 3OLOA 2J3TD 1O07A 4H8RA 4IUHA 2WK0A 3P7NA 5CHUA 1IEMA 1K4FA 4E3JA 2WAEA 4YFMA 1MWUA 3QP6A 2ZMFA 3PBOA 5HARA 4NXGA 4UA6A 2PYPA 4KZ9A 4OQIA 3RJUA 2NUTC 3A3EA 2V2FF 2G2WA 3NY4A 3A0RA 5HPFA 5HD3A 4ETZA 2PD7A 3M6BA 4PMAA 2E8JA 4WZ5C 1NLYA 2Y2HA 2H5SA 3Q82A 5DJTA 4R3JA 1OJ5A 2ZQDA 1NRJA 3ZNTA 5FI2A 1STZA 4OONA 3CHWP 1P9WA 1ES3A 2JC7A 4HNBA 1YLWA 1YLZA 4EEPA 1XPBA 3CPTB 4S2JA 3F1OB 5TGFA 1MPLA 3NIAA 3CMZA 1D06A 1FCNA 4LRYC 4XUZA 3W2ZA 2ZL1A 5G4ZA 4EWFA 5HSQA 4KZ4A 4WBGA 5A93A 4KQOA 2P04A 4OPQA 2XROA 3BY9A 4GN2A 4HESA 3UY6A 4IEDA 5KIZA 3VOYA 1KE4A 2XR0A 3KYEA 1DJCA 4BBTA 1DP6A 2A3UA 4BQMA 1S6RA 3EEAA 1N9OA 4ARZA 3MSHA 2G7UA 3KSHA 2KDKA 1QMEA 3EQUA 3WS2A 3N8RA 3N8LA 3EGDC 4QWOA 3ISGA 2A24A 3FC7A 3IF6C 1ZKJA 2R78A 1HLUP 4KZ3A 4EBNA 3G34A 1K38A 4EW7A 4S2LA 5EOEA 2EFXA 2PD8A 4N92A 5TBMB 4I3IA 3VFFA 4HHDA 2Y2NA 4ZJ2A 5FQIA 5AQBA 4Y5FA 1PIOA 4ZBEA 3FYZA 4BD1A 4Z9QA 3NHQA 2XDMA 1OTDA 4GDNA 1Z6FA 1ES2A 2L0WA 5E43A 4I38A 1KGEA 1L0EA 4BENA 3HJKA 4OQ0A 4OPRA 4FUWA 4Y15A 3UDFA 3A3IA 3VOZA 3IF5A 4S2NA 4E3IA 2B95A 1ES4A 4Y3IA 5EECA 3Q81A 3IXBA 5E2EA 3E4OA 2Y79A 4PM8A 1T1AA 1CK3A 3EOIA 5FQJA 1E4DA 4JXGA 4LV3A 4DE0A 1L2SA 2Y2GA 1F2KA 3WS5A 2QPNA 2QWSA 1FIKA 2L4RA 1GSWA 4BMWA 3C30A 4NETA 5CEDA 5HPIA 2XFSA 2ZBBA 1RP5A 4X69A 3W4PA 4WYYA 1EI5A 5F69A 1S4RA 1RGZA 1W63Q 4HY8A 4HP9A 1GSVA 4F3LA 3VFHA 1T1CA 1YLPA 5F82A 1PI4A 4I3AA 4D60A 4OKPA 2AVXA 3V67A 2WZXA 2WGIA 4OOYA 2W3GA 4JF5A 4Q0IA 4EETB 5L2FA 4B93A 4MN5A 5M1AA 1BZAA
chains in the Genus database with same CATH topology
1SHVA 1MWRA 4QY5A 1K57C 4N9KA 2V1ZA 5GLCA 3FZCA 3HUOA 2DNSA 1Q2PA 4BJPA 3OPHA 4FH4A 4XUXA 2OLVA 4X6TA 2QMIA 1JWVA 1FCOA 4KZ8A 5D3OA 5FQKA 3IH9A 4X68A 5AQ7A 2Y2JA 3NDGA 5CEBA 1Q2QA 4KZ6A 3GSGA 2EX2A 4JF6A 3ZGAB 3G35A 2R9WA 3GV9A 1FCMA 3AGDA 5JYPA 3PBTA 3Q07A 4S2IA 1L0GA 1K54C 3BRMA 4E3KA 3PAEA 2P9VB 3LCEA 1DY6A 2WADA 3G30A 3AGFA 4LENA 1DJAA 3I7JA 3BYDA 2HDSA 3FKVA 2ZD8A 1W7FA 1ZG6A 4N1XA 5GHXA 4E3LA 5U47A 4UA9A 3V50A 3JYIA 2H0TA 3UDXA 3N8SA 3Q1FA 1E25A 1ERQA 3GMWA 4JXWA 4O7DA 5JYOA 4OPZA 1YT4A 3C7UA 4BLMA 2R9XA 4EUZA 3G2ZA 2I72A 4UA7A 2HDRA 3BFDA 3Q7VA 1I5QA 1PW1A 3O86A 1SKFA 3PTEA 5EVIB 1U60A 4RYEA 3ZG0A 5FAOA 2FFYA 5CERA 4R3BA 2XEPA 4R0QA 3HLEA 1C3BA 4OVDA 3ZNYA 4B4XA 4PM7A 5I94A 1IYSA 4KZBA 3VP1A 3S22A 3S4XA 1WYCA 3N7WA 2XD5A 2EX8A 1W79A 5CRFA 1VQQA 2ZQCA 3FWLA 1JVJA 1K56A 2Y91A 4S2NC 3GTCA 2XGNA 1LLBA 4UAAA 2IWBA 5HAQA 3WRZA 3IXDA 3M2KA 4OLGA 3N4IA 1NXYA 3UPPA 5CTMA 3BFGA 2Y2OA 1FR1A 3NI9A 3C4OA 1YLTA 4U3TA 3BM6A 3QHYA 5EVIC 3GVBA 5DF7A 4WMCD 4WZ5A 4QU3A 1WE4A 3UN7A 2Q9NA 3VP3A 1GHPA 2WYXA 3OCLA 2WKHA 1NRFA 1XKZA 4EV4A 1LI0A 1M6KA 2WUQA 2HDQA 3IXHA 1H8YA 5TR7A 3LEZA 4R4RA 2ZM8A 3DTMA 4LV0A 5CXWA 2WKIA 3MKEA 5FDHA 2WGWA 3LY4A 2ZMAA 3NBLA 2JBFA 1MKIA 3V3RA 4DE2A 1PZPA 2IWDA 1HTZA 1S0WA 4X53A 4OP5A 1EROA 2ZQ7A 3E2KA 4HBUA 4E3MA 2C5WB 4OQGA 5F1GA 2OSUA 4DDSA 4FD8A 3S1YA 1JWZA 5DTTA 5EVID 3VP4A 3C4PA 2J7VA 2WGVA 3WS1A 1OMEA 1PWCA 4S2OA 3VP2A 4DDYA 4U0TA 1W8YA 3PBNA 4PM9A 5CTNA 3ZHHA 5M19A 2ZM0A 1CEGA 1GHMA 3N6IA 1CEFA 4P87A 5FA7A 2E8IA 3G31A 4C6YA 1FSYA 3O88A 4DE1A 4GD6A 3A3FA 4DE3A 3VSKA 4N9LA 1PWDA 1YMSA 4FH2A 3ZG5A 4JLFA 2Y59A 3FKWA 3PAGA 3HLBA 3SH7A 5M18A 4KZAA 3A3DA 4X56A 4DXCA 3B3XA 5HFOA 1TEMA 2HP5A 5FAQA 4HEFA 4N1HA 3BFFA 4JXSA 5AQ9A 4IVIA 4Y0OA 5HW3A 4R23A 2H10A 3RXWA 4PPRA 3E2LA 4QD4A 1ES5A 1LL9A 5J8XA 4RA7A 1HD8A 4LV2A 4KZ7A 1PWGA 2BLSA 1YLYA 4MBFA 3M6HA 4E6WA 3MKFA 3NCKA 1K4EA 4S2KA 2ZM2A 3RXXA 4X55A 3HLWA 4WZ4A 1W5DA 3Q7VB 5CHMA 2XFTA 2X71A 4KENB 1ALQA 3BFEA 1KE3A 1YM1A 2J8YA 1K25A 2G2UA 2J9PA 3UPOA 2XD1A 4QJGA 3AGEA 4WEJA 2JE5A 4OOMA 3LY3A 4K0XA 1GHIA 2Y2LA 3BFCA 2ZLYA 1JWPA 3HLFA 2Z2LB 2Y2PA 5CGXA 2RCXA 3EQVA 5FQ9A 2XH9A 1IYQA 3MXRA 3ZFZA 3FV7A 4K0WA 4OQHA 1O07A 2Y2IA 2X02A 1BT5A 3BLMA 5FQQA 4R4SA 1XXMA 4H8RA 4ID4A 5HL1A 4P85A 3HBRA 3C7VA 4A5RA 2WK0A 1FR6A 5CHUA 3ITBA 1IEMA 1K4FA 4E3JA 3MBZA 3HLDA 4EQIA 2WAEA 5CECA 4GD8A 5KSCA 4YFMA 4GNUA 1MWUA 1K55A 2WAFA 3PBOA 1TVFA 3ITAA 2HPBA 5HARA 2FFFB 1ERMA 5IHVA 3HL9A 4ZJ3A 1PZOA 4WMCA 4UA6A 1SDNA 3LO7A 1G68A 2WGWB 4KZ9A 4OQIA 4P0MA 3UNWA 3RJUA 3UE1A 4D2OA 3A3EA 3P98A 2V2FF 2ZC5B 3ZDJA 2C6WB 3HVFA 2G2WA 3NY4A 4C3QA 4F94A 5FI6A 1BLHA 3VP0A 3BECA 3M6BA 4PMAA 4R1GA 1KGGA 3IXGA 4WZ5C 1RCJA 4E6XA 1XP4A 2Y2HA 4EBLA 2H5SA 3Q82A 4FCFA 5A91A 2Q9MA 3IWOA 4R3JA 5GLBA 5FAPA 2ZQDA 3IWIA 1PI5A 3ZNTA 4DKIA 1AXBA 1FSWA 5CGSA 4YINA 4K91A 5FI2A 4OONA 1MWTA 3UPNA 3IH8A 4IBRA 4ZJ1A 1K6RA 5TFQA 3UDIA 1ES3A 4GOGA 4QY6A 2JC7A 4L0LA 1Y54A 4ZAMA 1YLWA 1YLZA 2VGKA 3BLSA 3UE0A 1GCEA 1ONHA 1XPBA 3W8KA 1SDEA 3V3SA 2Y55A 1NJ4A 2ZC7A 5A90A 4S2JA 5DVAA 5TGFA 1MPLA 5DTSA 1XGJA 1MXOA 2ZQ9A 3IHAA 3C5AA 4KQQA 1KDWA 3NIAA 1E3UD 3O87A 3CMZA 4S2MA 3MXSA 4GZBA 4XXRA 1FCNA 4JKTA 5EOOA 4XUZA 2GDNA 5EVLA 1BLCA 3W4QA 4EWFA 4MLLA 4JF4A 3MFDA 4Y0UA 5FI7A 4KZ4A 3UO9A 2VGJA 4WBGA 1IKGA 1ONGA 4UHUA 5EE8A 3DWZA 5A93A 4WELA 4KQOA 1MBLA 2XLNA 4CJNA 1BUEA 1KDSA 3GQZA 4OPQA 3SH9A 3SS5A 1EWZA 4MEZA 1ZG4A 5FATA 4GN2A 4QB8A 4RX3A 4HESA 3UY6A 1J9MA 1G6AA 3GR2A 3IF6B 3PBRA 4WM9A 4IEDA 2V20A 3G2YA 4MBKA 3VOYA 1IELA 3DWKA 4B4ZA 5A92A 1KE4A 2XR0A 4LCMA 1DJCA 3HLGA 2A3UA 3P09A 5EUAA 4BQMA 1S6RA 2OLUA 3O3VA 1KE0A 1KVLA 2EX6A 3ZG9B 2EXAA 3WS0A 1XA1A 5HX9A 1K6SA 3SS4A 5E2HA 4RVAA 1XGIA 4E3NA 4M3KA 1BLSA 4DF6A 4LCLA 2XK1A 3CZDA 5GLAA 4GDBA 5DF9A 4RX2A 1QMEA 3GRJA 3HUNA 1IYOA 2ZJ9A 1MWSA 3EQUA 1LHYA 1PW8A 3IF6A 3WS2A 3N8RA 1DJBA 1GA9A 3N8LA 5GL9A 2A49A 5DTKA 1SCWA 2DRWA 3ISGA 1NZUA 3OPRA 3IF6C 1MY8A 3IT9A 1YMXA 1ZKJA 4MNRA 4NK3A 3TOIA 3OZHA 2HP6A 2Y2QA 5G18A 1K54A 3SOIA 2ZQ8A 3CJMA 1BSGA 4KZ3A 1YQSA 4EBNA 3Q7ZA 5KMWA 2IWCA 3G34A 4Y0TA 1K38A 3OPLA 4S2LA 5EOEA 4P6BA 2EFXA 3NC8A 1CI9A 4JPMA 4DRTA 1CI8A 1XA7A 4N92A 5FQMA 3VFFA 5F83A 4EBPA 2Y2NA 1M40A 4ZJ2A 5FQIA 5BOHA 1QMFA 2EXBA 5AQBA 3HREA 4FSFA 5E2GA 1PIOA 4ZTKA 2ZC3B 4ZBEA 3FYZA 4BD1A 4Z9QA 2PBYA 2Y4AA 4GB7A 2WKEA 3MZFA 1BLPA 2XDMA 1JTGA 1FOFA 4KQRA 2J9OA 4KZ5A 2JCHA 1HVBA 4Q8IA 3G4PA 2Z2MB 4GDNA 4KG5A 3PBQA 1Z6FA 2PU4A 3NDEA 1K55C 2P9VA 3OCNA 1ES2A 4KG2A 3SS3A 4B88A 1TDLA 4OP8A 3G32A 5E43A 5EPHA 3BEBA 3V5MA 5CGWA 1ESUA 5F1FA 5KSHA 1KGEA 1L0EA 4BENA 4OQ0A 5FASA 2XF3A 3M2JA 3TG9A 3ZVWA 4OPRA 3UDFA 2DCFA 3A3IA 3HLCA 3ZG7B 1XX2A 4OH0A 3SH8A 3VOZA 3IF5A 4PM6A 4S2NA 3OPPA 2RL3A 3W4OA 4E3IA 1ZC2A 1ES4A 2ZQAA 4JXVA 3TSGA 2Y2MA 1NZOA 2PU2A 5E2FA 2WZZA 1HZOA 4OLDA 5EECA 4BL2A 2X01A 1NYYA 3Q81A 3WRTA 4LV1A 1KVMA 4DXBA 1LL5A 2HP9A 5GLDA 1BTLA 3D4FA 3IXBA 4E3OA 1L0FA 5EVIA 1TDGA 5E2EA 1NYMA 4S2PA 1O7EA 2EFUA 3DW0A 1K56D 4PM8A 1CK3A 3MZDA 5FQJA 3IWQA 1E4DA 1IYPA 4JXGA 4LV3A 4WEKA 5DF8A 1E3UA 4DE0A 1L2SA 2Y2GA 1ESIA 3V39A 1N4OA 4KG6A 5HAIA 1YLJA 2ZC4B 3QNBA 3PBSA 3VMAA 3WS5A 4CPKA 2QPNA 4JBFA 3ZVTA 3ZCZA 2CC1A 1I2WA 3HUMA 1RGYA 1FQGA 1BULA 5FSRA 4Y7PA 1VM1A 4IBXA 2XQZA 1KGFA 1N9BA 5GHZA 4U0XA 4NETA 5CEDA 5CHJA 5AQAA 1PYYA 1L0DA 2Y2KA 2UWXA 2XFSA 1RP5A 3IHBA 1JTDA 4QHCA 4ZDXA 4IVKA 4X69A 1W8QA 4WYYA 3W4PA 4C75A 1IKIA 1EI5A 3A3JA 1RGZA 2ZC6B 2EX9A 1I2SA 3WWXA 5HAPA 3CG5A 4OPYA 2BG1A 4MBHA 4OOLA 2P74A 1GA0A 3WS4A 3OC2A 4GKUA 3VFHA 4BL3A 1WYBA 1YLPA 5F82A 4PM5A 1LI9A 2QZ6A 1PI4A 1NY0A 4OKPA 1H5XA 2H0YA 2WZXA 2WGIA 1H8ZA 2B5RA 3IQAA 3UE3A 3MZEA 4OOYA 3QNCA 3ZG8B 4JF5A 5KZHA 1K57A 4BD0A 2HDUA 4HBTA 5L2FA 5GHYA 3VSLA 2OV5A 5M1AA 1BZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SHV A;  1MWR A;  4QY5 A;  1K57 C;  4N9K A;  2V1Z A;  5GLC A;  3FZC A;  3HUO A;  2DNS A;  1Q2P A;  4BJP A;  3OPH A;  4FH4 A;  4XUX A;  2OLV A;  4X6T A;  2QMI A;  1JWV A;  1FCO A;  4KZ8 A;  5D3O A;  5FQK A;  3IH9 A;  4X68 A;  5AQ7 A;  2Y2J A;  3NDG A;  5CEB A;  1Q2Q A;  4KZ6 A;  3GSG A;  2EX2 A;  4JF6 A;  3ZGA B;  3G35 A;  2R9W A;  3GV9 A;  1FCM A;  3AGD A;  5JYP A;  3PBT A;  3Q07 A;  4S2I A;  1L0G A;  1K54 C;  3BRM A;  4E3K A;  3PAE A;  2P9V B;  3LCE A;  1DY6 A;  2WAD A;  3G30 A;  3AGF A;  4LEN A;  1DJA A;  3I7J A;  3BYD A;  2HDS A;  3FKV A;  2ZD8 A;  1W7F A;  1ZG6 A;  4N1X A;  5GHX A;  4E3L A;  5U47 A;  4UA9 A;  3V50 A;  3JYI A;  2H0T A;  3UDX A;  3N8S A;  3Q1F A;  1E25 A;  1ERQ A;  3GMW A;  4JXW A;  4O7D A;  5JYO A;  4OPZ A;  1YT4 A;  3C7U A;  4BLM A;  2R9X A;  4EUZ A;  3G2Z A;  2I72 A;  4UA7 A;  2HDR A;  3BFD A;  3Q7V A;  1I5Q A;  1PW1 A;  3O86 A;  1SKF A;  3PTE A;  5EVI B;  1U60 A;  4RYE A;  3ZG0 A;  5FAO A;  2FFY A;  5CER A;  4R3B A;  2XEP A;  4R0Q A;  3HLE A;  1C3B A;  4OVD A;  3ZNY A;  4B4X A;  4PM7 A;  5I94 A;  1IYS A;  4KZB A;  3VP1 A;  3S22 A;  3S4X A;  1WYC A;  3N7W A;  2XD5 A;  2EX8 A;  1W79 A;  5CRF A;  1VQQ A;  2ZQC A;  3FWL A;  1JVJ A;  1K56 A;  2Y91 A;  4S2N C;  3GTC A;  2XGN A;  1LLB A;  4UAA A;  2IWB A;  5HAQ A;  3WRZ A;  3IXD A;  3M2K A;  4OLG A;  3N4I A;  1NXY A;  3UPP A;  5CTM A;  3BFG A;  2Y2O A;  1FR1 A;  3NI9 A;  3C4O A;  1YLT A;  4U3T A;  3BM6 A;  3QHY A;  5EVI C;  3GVB A;  5DF7 A;  4WMC D;  4WZ5 A;  4QU3 A;  1WE4 A;  3UN7 A;  2Q9N A;  3VP3 A;  1GHP A;  2WYX A;  3OCL A;  2WKH A;  1NRF A;  1XKZ A;  4EV4 A;  1LI0 A;  1M6K A;  2WUQ A;  2HDQ A;  3IXH A;  1H8Y A;  5TR7 A;  3LEZ A;  4R4R A;  2ZM8 A;  3DTM A;  4LV0 A;  5CXW A;  2WKI A;  3MKE A;  5FDH A;  2WGW A;  3LY4 A;  2ZMA A;  3NBL A;  2JBF A;  1MKI A;  3V3R A;  4DE2 A;  1PZP A;  2IWD A;  1HTZ A;  1S0W A;  4X53 A;  4OP5 A;  1ERO A;  2ZQ7 A;  3E2K A;  4HBU A;  4E3M A;  2C5W B;  4OQG A;  5F1G A;  2OSU A;  4DDS A;  4FD8 A;  3S1Y A;  1JWZ A;  5DTT A;  5EVI D;  3VP4 A;  3C4P A;  2J7V A;  2WGV A;  3WS1 A;  1OME A;  1PWC A;  4S2O A;  3VP2 A;  4DDY A;  4U0T A;  1W8Y A;  3PBN A;  4PM9 A;  5CTN A;  3ZHH A;  5M19 A;  2ZM0 A;  1CEG A;  1GHM A;  3N6I A;  1CEF A;  4P87 A;  5FA7 A;  2E8I A;  3G31 A;  4C6Y A;  1FSY A;  3O88 A;  4DE1 A;  4GD6 A;  3A3F A;  4DE3 A;  3VSK A;  4N9L A;  1PWD A;  1YMS A;  4FH2 A;  3ZG5 A;  4JLF A;  2Y59 A;  3FKW A;  3PAG A;  3HLB A;  3SH7 A;  5M18 A;  4KZA A;  3A3D A;  4X56 A;  4DXC A;  3B3X A;  5HFO A;  1TEM A;  2HP5 A;  5FAQ A;  4HEF A;  4N1H A;  3BFF A;  4JXS A;  5AQ9 A;  4IVI A;  4Y0O A;  5HW3 A;  4R23 A;  2H10 A;  3RXW A;  4PPR A;  3E2L A;  4QD4 A;  1ES5 A;  1LL9 A;  5J8X A;  4RA7 A;  1HD8 A;  4LV2 A;  4KZ7 A;  1PWG A;  2BLS A;  1YLY A;  4MBF A;  3M6H A;  4E6W A;  3MKF A;  3NCK A;  1K4E A;  4S2K A;  2ZM2 A;  3RXX A;  4X55 A;  3HLW A;  4WZ4 A;  1W5D A;  3Q7V B;  5CHM A;  2XFT A;  2X71 A;  4KEN B;  1ALQ A;  3BFE A;  1KE3 A;  1YM1 A;  2J8Y A;  1K25 A;  2G2U A;  2J9P A;  3UPO A;  2XD1 A;  4QJG A;  3AGE A;  4WEJ A;  2JE5 A;  4OOM A;  3LY3 A;  4K0X A;  1GHI A;  2Y2L A;  3BFC A;  2ZLY A;  1JWP A;  3HLF A;  2Z2L B;  2Y2P A;  5CGX A;  2RCX A;  3EQV A;  5FQ9 A;  2XH9 A;  1IYQ A;  3MXR A;  3ZFZ A;  3FV7 A;  4K0W A;  4OQH A;  1O07 A;  2Y2I A;  2X02 A;  1BT5 A;  3BLM A;  5FQQ A;  4R4S A;  1XXM A;  4H8R A;  4ID4 A;  5HL1 A;  4P85 A;  3HBR A;  3C7V A;  4A5R A;  2WK0 A;  1FR6 A;  5CHU A;  3ITB A;  1IEM A;  1K4F A;  4E3J A;  3MBZ A;  3HLD A;  4EQI A;  2WAE A;  5CEC A;  4GD8 A;  5KSC A;  4YFM A;  4GNU A;  1MWU A;  1K55 A;  2WAF A;  3PBO A;  1TVF A;  3ITA A;  2HPB A;  5HAR A;  2FFF B;  1ERM A;  5IHV A;  3HL9 A;  4ZJ3 A;  1PZO A;  4WMC A;  4UA6 A;  1SDN A;  3LO7 A;  1G68 A;  2WGW B;  4KZ9 A;  4OQI A;  4P0M A;  3UNW A;  3RJU A;  3UE1 A;  4D2O A;  3A3E A;  3P98 A;  2V2F F;  2ZC5 B;  3ZDJ A;  2C6W B;  3HVF A;  2G2W A;  3NY4 A;  4C3Q A;  4F94 A;  5FI6 A;  1BLH A;  3VP0 A;  3BEC A;  3M6B A;  4PMA A;  4R1G A;  1KGG A;  3IXG A;  4WZ5 C;  1RCJ A;  4E6X A;  1XP4 A;  2Y2H A;  4EBL A;  2H5S A;  3Q82 A;  4FCF A;  5A91 A;  2Q9M A;  3IWO A;  4R3J A;  5GLB A;  5FAP A;  2ZQD A;  3IWI A;  1PI5 A;  3ZNT A;  4DKI A;  1AXB A;  1FSW A;  5CGS A;  4YIN A;  4K91 A;  5FI2 A;  4OON A;  1MWT A;  3UPN A;  3IH8 A;  4IBR A;  4ZJ1 A;  1K6R A;  5TFQ A;  3UDI A;  1ES3 A;  4GOG A;  4QY6 A;  2JC7 A;  4L0L A;  1Y54 A;  4ZAM A;  1YLW A;  1YLZ A;  2VGK A;  3BLS A;  3UE0 A;  1GCE A;  1ONH A;  1XPB A;  3W8K A;  1SDE A;  3V3S A;  2Y55 A;  1NJ4 A;  2ZC7 A;  5A90 A;  4S2J A;  5DVA A;  5TGF A;  1MPL A;  5DTS A;  1XGJ A;  1MXO A;  2ZQ9 A;  3IHA A;  3C5A A;  4KQQ A;  1KDW A;  3NIA A;  1E3U D;  3O87 A;  3CMZ A;  4S2M A;  3MXS A;  4GZB A;  4XXR A;  1FCN A;  4JKT A;  5EOO A;  4XUZ A;  2GDN A;  5EVL A;  1BLC A;  3W4Q A;  4EWF A;  4MLL A;  4JF4 A;  3MFD A;  4Y0U A;  5FI7 A;  4KZ4 A;  3UO9 A;  2VGJ A;  4WBG A;  1IKG A;  1ONG A;  4UHU A;  5EE8 A;  3DWZ A;  5A93 A;  4WEL A;  4KQO A;  1MBL A;  2XLN A;  4CJN A;  1BUE A;  1KDS A;  3GQZ A;  4OPQ A;  3SH9 A;  3SS5 A;  1EWZ A;  4MEZ A;  1ZG4 A;  5FAT A;  4GN2 A;  4QB8 A;  4RX3 A;  4HES A;  3UY6 A;  1J9M A;  1G6A A;  3GR2 A;  3IF6 B;  3PBR A;  4WM9 A;  4IED A;  2V20 A;  3G2Y A;  4MBK A;  3VOY A;  1IEL A;  3DWK A;  4B4Z A;  5A92 A;  1KE4 A;  2XR0 A;  4LCM A;  1DJC A;  3HLG A;  2A3U A;  3P09 A;  5EUA A;  4BQM A;  1S6R A;  2OLU A;  3O3V A;  1KE0 A;  1KVL A;  2EX6 A;  3ZG9 B;  2EXA A;  3WS0 A;  1XA1 A;  5HX9 A;  1K6S A;  3SS4 A;  5E2H A;  4RVA A;  1XGI A;  4E3N A;  4M3K A;  1BLS A;  4DF6 A;  4LCL A;  2XK1 A;  3CZD A;  5GLA A;  4GDB A;  5DF9 A;  4RX2 A;  1QME A;  3GRJ A;  3HUN A;  1IYO A;  2ZJ9 A;  1MWS A;  3EQU A;  1LHY A;  1PW8 A;  3IF6 A;  3WS2 A;  3N8R A;  1DJB A;  1GA9 A;  3N8L A;  5GL9 A;  2A49 A;  5DTK A;  1SCW A;  2DRW A;  3ISG A;  1NZU A;  3OPR A;  3IF6 C;  1MY8 A;  3IT9 A;  1YMX A;  1ZKJ A;  4MNR A;  4NK3 A;  3TOI A;  3OZH A;  2HP6 A;  2Y2Q A;  5G18 A;  1K54 A;  3SOI A;  2ZQ8 A;  3CJM A;  1BSG A;  4KZ3 A;  1YQS A;  4EBN A;  3Q7Z A;  5KMW A;  2IWC A;  3G34 A;  4Y0T A;  1K38 A;  3OPL A;  4S2L A;  5EOE A;  4P6B A;  2EFX A;  3NC8 A;  1CI9 A;  4JPM A;  4DRT A;  1CI8 A;  1XA7 A;  4N92 A;  5FQM A;  3VFF A;  5F83 A;  4EBP A;  2Y2N A;  1M40 A;  4ZJ2 A;  5FQI A;  5BOH A;  1QMF A;  2EXB A;  5AQB A;  3HRE A;  4FSF A;  5E2G A;  1PIO A;  4ZTK A;  2ZC3 B;  4ZBE A;  3FYZ A;  4BD1 A;  4Z9Q A;  2PBY A;  2Y4A A;  4GB7 A;  2WKE A;  3MZF A;  1BLP A;  2XDM A;  1JTG A;  1FOF A;  4KQR A;  2J9O A;  4KZ5 A;  2JCH A;  1HVB A;  4Q8I A;  3G4P A;  2Z2M B;  4GDN A;  4KG5 A;  3PBQ A;  1Z6F A;  2PU4 A;  3NDE A;  1K55 C;  2P9V A;  3OCN A;  1ES2 A;  4KG2 A;  3SS3 A;  4B88 A;  1TDL A;  4OP8 A;  3G32 A;  5E43 A;  5EPH A;  3BEB A;  3V5M A;  5CGW A;  1ESU A;  5F1F A;  5KSH A;  1KGE A;  1L0E A;  4BEN A;  4OQ0 A;  5FAS A;  2XF3 A;  3M2J A;  3TG9 A;  3ZVW A;  4OPR A;  3UDF A;  2DCF A;  3A3I A;  3HLC A;  3ZG7 B;  1XX2 A;  4OH0 A;  3SH8 A;  3VOZ A;  3IF5 A;  4PM6 A;  4S2N A;  3OPP A;  2RL3 A;  3W4O A;  4E3I A;  1ZC2 A;  1ES4 A;  2ZQA A;  4JXV A;  3TSG A;  2Y2M A;  1NZO A;  2PU2 A;  5E2F A;  2WZZ A;  1HZO A;  4OLD A;  5EEC A;  4BL2 A;  2X01 A;  1NYY A;  3Q81 A;  3WRT A;  4LV1 A;  1KVM A;  4DXB A;  1LL5 A;  2HP9 A;  5GLD A;  1BTL A;  3D4F A;  3IXB A;  4E3O A;  1L0F A;  5EVI A;  1TDG A;  5E2E A;  1NYM A;  4S2P A;  1O7E A;  2EFU A;  3DW0 A;  1K56 D;  4PM8 A;  1CK3 A;  3MZD A;  5FQJ A;  3IWQ A;  1E4D A;  1IYP A;  4JXG A;  4LV3 A;  4WEK A;  5DF8 A;  1E3U A;  4DE0 A;  1L2S A;  2Y2G A;  1ESI A;  3V39 A;  1N4O A;  4KG6 A;  5HAI A;  1YLJ A;  2ZC4 B;  3QNB A;  3PBS A;  3VMA A;  3WS5 A;  4CPK A;  2QPN A;  4JBF A;  3ZVT A;  3ZCZ A;  2CC1 A;  1I2W A;  3HUM A;  1RGY A;  1FQG A;  1BUL A;  5FSR A;  4Y7P A;  1VM1 A;  4IBX A;  2XQZ A;  1KGF A;  1N9B A;  5GHZ A;  4U0X A;  4NET A;  5CED A;  5CHJ A;  5AQA A;  1PYY A;  1L0D A;  2Y2K A;  2UWX A;  2XFS A;  1RP5 A;  3IHB A;  1JTD A;  4QHC A;  4ZDX A;  4IVK A;  4X69 A;  1W8Q A;  4WYY A;  3W4P A;  4C75 A;  1IKI A;  1EI5 A;  3A3J A;  1RGZ A;  2ZC6 B;  2EX9 A;  1I2S A;  3WWX A;  5HAP A;  3CG5 A;  4OPY A;  2BG1 A;  4MBH A;  4OOL A;  2P74 A;  1GA0 A;  3WS4 A;  3OC2 A;  4GKU A;  3VFH A;  4BL3 A;  1WYB A;  1YLP A;  5F82 A;  4PM5 A;  1LI9 A;  2QZ6 A;  1PI4 A;  1NY0 A;  4OKP A;  1H5X A;  2H0Y A;  2WZX A;  2WGI A;  1H8Z A;  2B5R A;  3IQA A;  3UE3 A;  3MZE A;  4OOY A;  3QNC A;  3ZG8 B;  4JF5 A;  5KZH A;  1K57 A;  4BD0 A;  2HDU A;  4HBT A;  5L2F A;  5GHY A;  3VSL A;  2OV5 A;  5M1A A;  1BZA A; 
#chains in the Genus database with same CATH topology
 1XFQ A;  1K57 C;  2V1Z A;  5GLC A;  1Q2P A;  2OLV A;  1NWZ A;  5IS1 A;  3CWF A;  3IH9 A;  1SZV A;  3NDG A;  5K5B A;  1Q2Q A;  2QKP A;  2GX5 A;  4JF6 A;  5HDC A;  2JKT M;  2R9W A;  3AGD A;  1L0G A;  4E3K A;  4NEE D;  3IBR A;  2W1R A;  3AGF A;  2W3H A;  3FKV A;  4O0P A;  1W7F A;  4N1X A;  5GHX A;  3C8C A;  4UA9 A;  3JYI A;  2H0T A;  2YKF A;  5DFX A;  4JXW A;  3CLO A;  3DTK A;  2W27 A;  4UA7 A;  2HDR A;  5FAO A;  1ZHH B;  4Y2F A;  5F68 A;  4KZB A;  3S22 A;  3S4X A;  5HWT A;  3LIC A;  3A0V A;  5CRF A;  4X1M A;  1JVJ A;  3QP8 A;  2PR6 A;  4OLG A;  3N4I A;  1XFN A;  3KYZ A;  2Y2O A;  1FR1 A;  3C4O A;  3MS6 A;  5EVI C;  5DF7 A;  4WZ5 A;  4QU3 A;  3UN7 A;  2Q9N A;  2WYX A;  4EV4 A;  3T1X A;  4G3V A;  5TJJ A;  3LEZ A;  4R4R A;  2WKI A;  1F5M A;  5DKL A;  3CUE C;  2ZMA A;  1MKI A;  2IWD A;  4HQA A;  4X53 A;  2HGV A;  2ZQ7 A;  3E2K A;  4E3M A;  2C5W B;  5F1G A;  2OSU A;  4DDS A;  3ZYT A;  3VP4 A;  4YWZ A;  3LR0 A;  2J7V A;  2MJ6 A;  3WS1 A;  1PWC A;  2Z6D A;  2VX8 A;  4YNR A;  4DE1 A;  3B47 A;  4DE3 A;  3LR5 A;  4N9L A;  2PRF A;  3NOP C;  4JLF A;  3U2A A;  1S1Y A;  4NXF A;  1MC0 A;  3F1P B;  1TEM A;  1T1B A;  1SKO A;  2FZ0 A;  2H10 A;  4QD4 A;  5G4Y A;  1ES5 A;  3MR0 A;  1TF1 A;  2HV1 A;  4EXO A;  1YLY A;  4R38 A;  3PYP A;  4E6W A;  3EWK A;  1FIL A;  2ZM2 A;  4BWI A;  4KEN B;  1ALQ A;  3P01 A;  1KE3 A;  3UPO A;  2J9P A;  5F6A A;  2XD1 A;  4AFI A;  3T1S A;  1JWP A;  3HLF A;  2Y2P A;  5CGX A;  2W3F A;  4HOI A;  4L9G A;  5L07 A;  1TS7 A;  4K0W A;  4OQH A;  2HZ5 A;  5FQQ A;  2M7V A;  4ID4 A;  3HBR A;  3C7V A;  4A5R A;  1FR6 A;  4HP4 A;  3EGX C;  5CEC A;  4MN6 A;  4GD8 A;  1H0M A;  2PAV P;  3HL9 A;  1PZO A;  1OTI A;  4WMC A;  1OT9 A;  2JKF A;  1SDN A;  3LO7 A;  4YOF A;  1G68 A;  4P0M A;  3UE1 A;  4D2O A;  3T1Q B;  3KSF A;  3P98 A;  3ZDJ A;  2C6W B;  4C3Q A;  4F94 A;  1ZTU A;  3GDI A;  4R1G A;  4E6X A;  1WA9 A;  4FCF A;  2Q9M A;  2VLG A;  3IWO A;  3DTE A;  3IWI A;  5CGS A;  1JNU A;  3BWL A;  4UEY A;  2JKG A;  1W63 M;  4GOG A;  4CLC D;  4L0L A;  3KO6 A;  2P7J A;  1GCE A;  1ONH A;  2I9V A;  2Y55 A;  3BJN A;  5A90 A;  5DVA A;  4WUJ A;  1EW0 A;  5DTS A;  3IHA A;  4KQQ A;  3O87 A;  2GNX A;  4JKT A;  1H8M A;  3W4Q A;  3UO9 A;  2VGJ A;  4WEL A;  1MBL A;  2XLN A;  1KDS A;  3GQZ A;  4H6J B;  4RX3 A;  1J9M A;  1G6A A;  4Q0J A;  3DBA A;  3G2Y A;  2J3W A;  3DWK A;  4B4Z A;  2OLU A;  3O3V A;  2EX6 A;  1XA1 A;  1K6S A;  3H7W B;  5E2H A;  2JKR I;  4RVA A;  2EWV A;  3NOT C;  3CZD A;  4GDB A;  5DF9 A;  3HUN A;  3MXQ A;  1IYO A;  1OT6 A;  3T4O A;  3NEC A;  1LHY A;  1VHM A;  3CI6 A;  3OZH A;  2Y2Q A;  3BY8 A;  4M4X A;  4K08 A;  3CJM A;  1BSG A;  2KLI A;  3KSG A;  3OPL A;  4LRX C;  4P6B A;  2LB5 A;  4DRT A;  1CI8 A;  1XA7 A;  5FQM A;  3LI9 A;  1OTA A;  1M40 A;  3PHY A;  3GEC A;  3HRE A;  4ZTK A;  2Y4A A;  4GB7 A;  3UB5 P;  1IOU A;  2J9O A;  2JCH A;  4Q8I A;  4ME4 A;  3G4P A;  5DJU A;  2PU4 A;  1K55 C;  4KG2 A;  1TDL A;  1YKD A;  3MMH A;  1YPR A;  2K2N A;  3ZVW A;  3SZT A;  3ZG7 B;  5L09 A;  4IJG A;  2V0U A;  2PU2 A;  3KYQ A;  2WZZ A;  4BL2 A;  1VB6 A;  2X01 A;  5GLD A;  3TRC A;  1BTL A;  3D4F A;  4E3O A;  1BYW A;  2LB9 A;  5EVI A;  2EFU A;  3MZD A;  2V9A A;  5DF8 A;  3T12 B;  1E3U A;  4GHI A;  1N4O A;  4E04 A;  3R7W A;  3QNB A;  3CUE A;  4MN7 A;  4GLQ A;  4I3J A;  3ZCZ A;  2CC1 A;  3HUM A;  1RGY A;  1P0Z A;  1KGF A;  5CHJ A;  2Y2K A;  2P08 A;  3IHB A;  1JTD A;  4ZDX A;  4IVK A;  1W8Q A;  2K7S A;  2ZC6 B;  1I2S A;  3IS2 A;  5HAP A;  3U4L P;  3CG5 A;  4OPY A;  2BG1 A;  5J4E A;  4MBH A;  5HD5 A;  3WS4 A;  2WKR A;  2OAQ 1;  5IU1 A;  4PM5 A;  1LI9 A;  4PHT A;  3MJQ A;  1UWP X;  1H8Z A;  2V8C A;  4HBT A;  4IUK A;  2OV5 A;  3UME A;  4KG5 A;  1MWR A;  4N9K A;  2CMN A;  3HUO A;  2DNS A;  3TJZ C;  4FH4 A;  4O01 A;  2QMI A;  4X68 A;  2Y2J A;  2QJ7 A;  2VKS A;  1K0K A;  2J3T C;  3GV9 A;  5JYP A;  3PBT A;  3Q07 A;  4JGQ A;  4S2I A;  1K54 C;  3PAE A;  2P9V B;  3LCE A;  1DY6 A;  4LEN A;  2W0N A;  2HDS A;  2VZW A;  5U47 A;  3L7H A;  1F98 A;  3UDX A;  3N8S A;  4KUK A;  3TE8 A;  1E25 A;  1ERQ A;  5L10 A;  4O7D A;  2KX6 A;  3C7U A;  2R9X A;  4CLC B;  3Q7V A;  3O86 A;  1SKF A;  3KSI A;  3PTE A;  4PAU A;  3ZG0 A;  5CER A;  4R3B A;  4GS9 A;  4PKY A;  1VEU A;  1G28 A;  3ZNY A;  3F1N A;  4HJ3 A;  4PM7 A;  1IYS A;  2OWH A;  1WYC A;  3N7W A;  2EX8 A;  3VE3 A;  3QP5 A;  3FWL A;  1K56 A;  2Y91 A;  5HAQ A;  4NKP A;  3IXD A;  4LFU A;  1G5U A;  1Z09 A;  4Y13 A;  3MQQ A;  3T4L A;  3QHY A;  3OCL A;  1NRF A;  1LI0 A;  4DMZ A;  2WUQ A;  3DTM A;  5CXW A;  2OAP 1;  5FDH A;  3LY4 A;  4BBV A;  3NBL A;  3V3R A;  2EA9 A;  4DE2 A;  1HTZ A;  4OP5 A;  2HJE A;  4HBU A;  4DN0 A;  3BW6 A;  4IHQ A;  1XJ2 A;  5EVI D;  2WGV A;  1SKO B;  4DDY A;  3T4J A;  4PM9 A;  3ZHH A;  3UB8 A;  1LSW A;  4MMN A;  5M19 A;  3N6I A;  1CEF A;  3K3D A;  4WN5 A;  3S7Q A;  3A3F A;  1V9Z A;  2IA2 A;  4FTX A;  3ZG5 A;  3H82 B;  4CLC E;  2W3E A;  3IBJ A;  5FAQ A;  3CIT A;  1N9N A;  1S66 L;  3F1O A;  2PT7 A;  1KOU A;  4JXS A;  5AQ9 A;  4IVI A;  4Y0O A;  5HW3 A;  4R23 A;  4KZ7 A;  1NLZ A;  2BLS A;  3LGO A;  2O9A A;  3MKF A;  4S2K A;  5AVE A;  3HLW A;  2XFT A;  2X71 A;  5HDD A;  3IX3 A;  1PNE A;  5A8B A;  3HJI A;  4LGW A;  3T4S A;  3AGE A;  4K0X A;  1GHI A;  2Y2L A;  3BFC A;  1T18 A;  2Z2L B;  3EQV A;  1IYQ A;  3MXR A;  3ZFZ A;  1D7E A;  1GSX A;  2X02 A;  1BT5 A;  3BLM A;  4XT2 B;  4R4S A;  5HL1 A;  4P85 A;  5HWW A;  4JGR A;  3ITB A;  1LT0 A;  3MBZ A;  3LI8 A;  4EQI A;  2V8F A;  5KSC A;  1K55 A;  2WAF A;  1TVF A;  2HPB A;  2FFF B;  2VV6 A;  5IHV A;  4HJ6 A;  4L9E A;  5TBM A;  2WGW B;  4LRZ E;  4NG2 A;  3BQ8 A;  2ZC5 B;  4UQI S;  3VP0 A;  3BEC A;  4ESP A;  3IXG A;  1XP4 A;  4Z1W A;  1LSX A;  3DAV A;  3O5Y A;  4DKI A;  1AXB A;  4R6L A;  1FSW A;  4YIN A;  2Q0O A;  1MWT A;  3UPN A;  2B18 A;  3IH8 A;  1K6R A;  5TFQ A;  3UE0 A;  3BLS A;  1XGJ A;  3C5A A;  1KDW A;  4XXR A;  5EOO A;  5EVL A;  1BLC A;  1X0O A;  4Y0U A;  4BBU A;  2D01 A;  1ONG A;  3DWZ A;  3SH9 A;  3SS5 A;  3UE6 A;  4MEZ A;  4QB8 A;  1Y4O A;  3PBR A;  2V20 A;  3ICY A;  3LFV A;  4ZRR A;  5EUA A;  2XA7 S;  4DXB A;  3ZG9 B;  1KE0 A;  1VET B;  5HX9 A;  2XA7 M;  4E3N A;  1XGI A;  2W1T B;  1BLS A;  3OOV A;  1DRM A;  3GRJ A;  1MWS A;  1PW8 A;  3IF6 A;  1GA9 A;  2A49 A;  5DTK A;  1SCW A;  2DRW A;  1NZU A;  3OPR A;  3IT9 A;  1MY8 A;  3TOI A;  1YMX A;  4MNR A;  2HP6 A;  5G18 A;  3SOI A;  1K54 A;  2VV8 A;  2ZQ8 A;  1YQS A;  3Q7Z A;  5KMW A;  1CI9 A;  4JPM A;  2W3D A;  4EBP A;  1QMF A;  2EXB A;  2Y8H A;  5FL3 A;  5E2G A;  3SW1 A;  2PBY A;  1ACF A;  1JTG A;  1FOF A;  4KQR A;  2D02 A;  4KZ5 A;  3BQA A;  4NXE A;  3PBQ A;  2Z6C A;  3NDE A;  4B88 A;  4X1L A;  3G32 A;  5EPH A;  3BEB A;  3UB9 A;  5F1F A;  1ESU A;  5KSH A;  5DFY A;  3TG9 A;  1UGU A;  2WKP A;  1XX2 A;  4OH0 A;  3SH8 A;  2EWW A;  5J3W A;  1ZC2 A;  2ZQA A;  4GJ4 A;  4JXV A;  3T4Q A;  1NZO A;  3EEH A;  5EV0 A;  1NYY A;  3C2W A;  4S2P A;  2ZL1 B;  1LL8 A;  2QHK A;  3MQO A;  1IYP A;  3JPU A;  4P6Z S;  2HF6 A;  3V39 A;  1L3L A;  4KG6 A;  2ZC4 B;  4JGO A;  4CPK A;  3LIA A;  1FQG A;  4R70 A;  5FSR A;  1S67 L;  1VM1 A;  2XQZ A;  1PYY A;  1L0D A;  3CAX A;  3G6O A;  1P97 A;  4ARZ B;  3K3C A;  1IKI A;  2JHE A;  2VGL S;  1Y28 A;  3LIF A;  2VGL M;  4GKU A;  1WYB A;  2A24 B;  2WKQ A;  2GJ3 A;  4GCZ A;  1NY0 A;  3L9K A;  2H0Y A;  3UE3 A;  3IQA A;  2JKT I;  3QNC A;  5KZH A;  4HJ4 A;  1K57 A;  4BD0 A;  4EUV A;  5GHY A;  3VSL A;  4DF6 A;  5HWV A;  3FZC A;  1F9I A;  3OPH A;  4XUX A;  4X6T A;  2O99 A;  1JWV A;  4KZ8 A;  5D3O A;  5FQK A;  4WL9 A;  4KZ6 A;  3T4T A;  4ETX A;  2EX2 A;  3ZGA B;  2ZOH A;  5I5L A;  1DJA A;  5EVE A;  3BYD A;  3QP2 A;  2ZD8 A;  4MDZ A;  1ZG6 A;  5AVF A;  4GS9 B;  3V50 A;  3LID A;  3F1N B;  3D72 A;  3GMW A;  1YT4 A;  3E98 A;  3T4K A;  3G2Z A;  3BFD A;  1I5Q A;  1PW1 A;  1U60 A;  4RYE A;  2V0W A;  2XEP A;  1C3B A;  4OVD A;  4B4X A;  3VP1 A;  3H9W A;  3ULF A;  2QJ5 A;  4O8G A;  2INW A;  1P9R A;  1W79 A;  1DP9 A;  2IWB A;  2XGN A;  3JVU A;  3WRZ A;  3M2K A;  1NXY A;  3UPP A;  4CLC C;  5EFW A;  4HH2 A;  2FH5 A;  1OPX A;  3BFG A;  3NI9 A;  1YLT A;  3BM6 A;  4WMC D;  1GHP A;  2WKH A;  1XKZ A;  3VE4 A;  2M1C A;  2HDQ A;  3MF0 A;  3IXH A;  1H8Y A;  5TR7 A;  4F3L B;  1YSQ A;  3MFX A;  2JBF A;  1PZP A;  2B02 A;  4OQG A;  3S1Y A;  1OTE A;  1JWZ A;  5DTT A;  5J7E A;  2ACG A;  3C4P A;  3LEQ A;  3VP2 A;  3TW8 A;  4U0T A;  1W8Y A;  3NJA A;  3PBN A;  5CTN A;  2ZM0 A;  1CEG A;  1S1Z A;  2E8I A;  3MQ0 A;  4GD6 A;  1YMS A;  4FH2 A;  3PAG A;  3HLB A;  3SH7 A;  5M18 A;  4KZA A;  3LIB A;  2H28 A;  3A3D A;  2PDR A;  4DXC A;  3B33 A;  1YSP A;  5HFO A;  3T1R A;  2HP5 A;  4N1H A;  5EM1 A;  4PPR A;  1HD8 A;  3E0Y A;  5FEF A;  1PWG A;  4MBF A;  3M6H A;  4RQ9 A;  5AJG A;  1G6O A;  5HDS A;  2OOL A;  3RXX A;  4WZ4 A;  1W5D A;  1XJ6 A;  4H6J A;  2J8Y A;  1S4S A;  4KQD A;  3LR3 A;  4QJG A;  4KUO A;  4OOM A;  3LY3 A;  5FDS A;  3H7W A;  3UB7 A;  1PRQ A;  5FQ9 A;  2XH9 A;  3FV7 A;  2Y2I A;  1XXM A;  1ODV A;  2ZOI A;  1XJ3 A;  3UMD A;  3HLD A;  3FPV A;  2VA0 A;  4GNU A;  4II7 A;  3ITA A;  1ERM A;  4MCW A;  4ZJ3 A;  1CJF A;  1H3Q A;  3UNW A;  4X25 A;  4DJ2 A;  3K2N A;  3HVF A;  5FI6 A;  1BLH A;  1IFQ A;  4DJ3 A;  4NXB A;  2JN7 A;  1KGG A;  1DP8 A;  1RCJ A;  2BAS A;  4EBL A;  5A91 A;  3LUQ A;  5GLB A;  5FAP A;  2PBD P;  1OJG A;  1PI5 A;  3LIE A;  4K91 A;  4IBR A;  4ZJ1 A;  3UDI A;  4QY6 A;  1Y54 A;  4ZAM A;  2VGK A;  3W8K A;  1SDE A;  3V3S A;  1NJ4 A;  2PYR A;  2ZC7 A;  1XJ4 A;  3FG8 A;  1MXO A;  2ZQ9 A;  2VEA A;  1E3U D;  4S2M A;  4EER A;  3MXS A;  4GZB A;  4I39 A;  2GDN A;  4R3A A;  4MLL A;  4JF4 A;  3LYX A;  3MFD A;  5FI7 A;  1IKG A;  4UHU A;  5EE8 A;  4CJN A;  3CPT A;  1BUE A;  1EWZ A;  1ZG4 A;  4Q0H A;  5FAT A;  4QPR A;  3UB6 A;  3GR2 A;  2J80 A;  3IF6 B;  4WM9 A;  3A0S A;  4MBK A;  1IEL A;  5A92 A;  3B42 A;  4LCM A;  5HZH A;  3HLG A;  3P09 A;  5BOH A;  1KVL A;  2EXA A;  3WS0 A;  2YKH A;  1TS6 A;  3SS4 A;  3E4P A;  4M3K A;  1A0K A;  4LCL A;  2XK1 A;  2VJW A;  5GLA A;  4RX2 A;  2ZJ9 A;  1DJB A;  5GL9 A;  3KX0 X;  4NK3 A;  4L9F A;  2JKR M;  2ZMV A;  1MKM A;  2IWC A;  4B9O A;  4Y0T A;  3NC8 A;  1LSV A;  5F83 A;  3PR6 A;  2VV7 A;  4FSF A;  2ZC3 B;  2WKE A;  3MZF A;  1BLP A;  3T50 A;  5IT5 A;  1HVB A;  2Z2M B;  2P9V A;  3OCN A;  3SS3 A;  4OP8 A;  1OTB A;  3V5M A;  5CGW A;  3R4K A;  5FAS A;  2XF3 A;  3M2J A;  2DCF A;  3HLC A;  4UQI M;  4PM6 A;  3OPP A;  2RL3 A;  3D9Y A;  3W4O A;  5L8M A;  3TSG A;  2Y2M A;  5E2F A;  4I5S A;  4OLD A;  1HZO A;  3S7N A;  4CLC A;  3WRT A;  4LV1 A;  1KVM A;  1LL5 A;  1D1J A;  2HP9 A;  1L0F A;  1TDG A;  1NYM A;  1O7E A;  3E4Q A;  3DW0 A;  1K56 D;  2VK3 A;  3VV4 A;  4EQ1 A;  2UV0 E;  3IWQ A;  4G3W A;  3NUL A;  4WEK A;  1ESI A;  1PFL A;  5HAI A;  1YLJ A;  4WLA A;  2OWJ A;  3PBS A;  1N9L A;  1UWN X;  3VMA A;  4JBF A;  3ZVT A;  1I2W A;  3FPW A;  5DKK A;  1BUL A;  4Y7P A;  1CQA A;  4IBX A;  1N9B A;  2DMW A;  4U0X A;  5GHZ A;  4Y17 A;  5AQA A;  2UWX A;  2L1M A;  4QHC A;  4EEU A;  4C75 A;  4FOF A;  5LBR A;  3A3J A;  5EM0 A;  3WWX A;  2EX9 A;  4OOL A;  2P74 A;  1GA0 A;  2QYB A;  3OC2 A;  4HIA A;  2QZ6 A;  3JVV A;  1H5X A;  1MZU A;  2B5R A;  3MZE A;  2NUP C;  2XSS A;  3ZG8 B;  2HDU A;  4BL3 A;  1SHV A;  4QY5 A;  4BJP A;  1FCO A;  5AQ7 A;  5CEB A;  1V9Y A;  3GSG A;  3D3O A;  3H82 A;  3G35 A;  4CQH A;  1FCM A;  3BRM A;  2WAD A;  3G30 A;  4LPZ A;  2A2L A;  3I7J A;  2V1B A;  1AWI A;  2BTF P;  4E3L A;  5C5K A;  3Q1F A;  5JYO A;  4OPZ A;  3PXP A;  4BLM A;  1YAX A;  4EUZ A;  2I72 A;  3IX4 A;  3RFB A;  3HCY A;  2O9B A;  5EVI B;  4WF0 A;  2FFY A;  2PR5 A;  4R0Q A;  3HLE A;  5I94 A;  3RTY A;  4GHI B;  2XD5 A;  3R7W B;  1TD5 A;  2GZA A;  1VQQ A;  2HJ9 C;  2ZQC A;  4S2N C;  3GTC A;  4UAA A;  1LLB A;  2PHY A;  3RH8 B;  4HI4 A;  5CTM A;  4XT2 A;  3ZQ5 A;  4U3T A;  3OBF A;  3GVB A;  1WE4 A;  3VP3 A;  5MC7 A;  4P6Z M;  1J3W A;  1M6K A;  3IS2 B;  2ZM8 A;  4LV0 A;  4JGP A;  2O9C A;  3LR4 A;  3MKE A;  2WGW A;  1S0W A;  4HH3 A;  1ERO A;  4LLO B;  4FD8 A;  2O0Y A;  2M7U A;  1OME A;  4S2O A;  2KOI A;  3C38 A;  4EU0 A;  1GHM A;  5FA7 A;  4P87 A;  4C6Y A;  3G31 A;  1FSY A;  3O88 A;  3S7P A;  3VSK A;  1PWD A;  2Y59 A;  3FKW A;  4EES A;  4X56 A;  3B3X A;  4G3K A;  4HEF A;  3BFF A;  3RXW A;  3E2L A;  1LL9 A;  5J8X A;  4RA7 A;  3S7O A;  5HL6 A;  4LV2 A;  5FEG A;  2V1A A;  3IX8 A;  3NCK A;  1K4E A;  4PKY G;  3DTI A;  1T19 A;  3F1P A;  4X55 A;  5CHM A;  3Q7V B;  1TS0 A;  5F5Y A;  3BFE A;  1YM1 A;  1K25 A;  2G2U A;  1VEU B;  3QP1 A;  3QP4 A;  4WEJ A;  2JE5 A;  1TS8 A;  3VOL A;  2K31 A;  3NOU C;  1VET A;  4GW9 A;  1CF0 A;  2ZLY A;  5CX7 A;  2XRN A;  2RCX A;  2W1T A;  3OLO A;  2J3T D;  1O07 A;  4H8R A;  4IUH A;  2WK0 A;  3P7N A;  5CHU A;  1IEM A;  1K4F A;  4E3J A;  2WAE A;  4YFM A;  1MWU A;  3QP6 A;  2ZMF A;  3PBO A;  5HAR A;  4NXG A;  4UA6 A;  2PYP A;  4KZ9 A;  4OQI A;  3RJU A;  2NUT C;  3A3E A;  2V2F F;  2G2W A;  3NY4 A;  3A0R A;  5HPF A;  5HD3 A;  4ETZ A;  2PD7 A;  3M6B A;  4PMA A;  2E8J A;  4WZ5 C;  1NLY A;  2Y2H A;  2H5S A;  3Q82 A;  5DJT A;  4R3J A;  1OJ5 A;  2ZQD A;  1NRJ A;  3ZNT A;  5FI2 A;  1STZ A;  4OON A;  3CHW P;  1P9W A;  1ES3 A;  2JC7 A;  4HNB A;  1YLW A;  1YLZ A;  4EEP A;  1XPB A;  3CPT B;  4S2J A;  3F1O B;  5TGF A;  1MPL A;  3NIA A;  3CMZ A;  1D06 A;  1FCN A;  4LRY C;  4XUZ A;  3W2Z A;  2ZL1 A;  5G4Z A;  4EWF A;  5HSQ A;  4KZ4 A;  4WBG A;  5A93 A;  4KQO A;  2P04 A;  4OPQ A;  2XRO A;  3BY9 A;  4GN2 A;  4HES A;  3UY6 A;  4IED A;  5KIZ A;  3VOY A;  1KE4 A;  2XR0 A;  3KYE A;  1DJC A;  4BBT A;  1DP6 A;  2A3U A;  4BQM A;  1S6R A;  3EEA A;  1N9O A;  4ARZ A;  3MSH A;  2G7U A;  3KSH A;  2KDK A;  1QME A;  3EQU A;  3WS2 A;  3N8R A;  3N8L A;  3EGD C;  4QWO A;  3ISG A;  2A24 A;  3FC7 A;  3IF6 C;  1ZKJ A;  2R78 A;  1HLU P;  4KZ3 A;  4EBN A;  3G34 A;  1K38 A;  4EW7 A;  4S2L A;  5EOE A;  2EFX A;  2PD8 A;  4N92 A;  5TBM B;  4I3I A;  3VFF A;  4HHD A;  2Y2N A;  4ZJ2 A;  5FQI A;  5AQB A;  4Y5F A;  1PIO A;  4ZBE A;  3FYZ A;  4BD1 A;  4Z9Q A;  3NHQ A;  2XDM A;  1OTD A;  4GDN A;  1Z6F A;  1ES2 A;  2L0W A;  5E43 A;  4I38 A;  1KGE A;  1L0E A;  4BEN A;  3HJK A;  4OQ0 A;  4OPR A;  4FUW A;  4Y15 A;  3UDF A;  3A3I A;  3VOZ A;  3IF5 A;  4S2N A;  4E3I A;  2B95 A;  1ES4 A;  4Y3I A;  5EEC A;  3Q81 A;  3IXB A;  5E2E A;  3E4O A;  2Y79 A;  4PM8 A;  1T1A A;  1CK3 A;  3EOI A;  5FQJ A;  1E4D A;  4JXG A;  4LV3 A;  4DE0 A;  1L2S A;  2Y2G A;  1F2K A;  3WS5 A;  2QPN A;  2QWS A;  1FIK A;  2L4R A;  1GSW A;  4BMW A;  3C30 A;  4NET A;  5CED A;  5HPI A;  2XFS A;  2ZBB A;  1RP5 A;  4X69 A;  3W4P A;  4WYY A;  1EI5 A;  5F69 A;  1S4R A;  1RGZ A;  1W63 Q;  4HY8 A;  4HP9 A;  1GSV A;  4F3L A;  3VFH A;  1T1C A;  1YLP A;  5F82 A;  1PI4 A;  4I3A A;  4D60 A;  4OKP A;  2AVX A;  3V67 A;  2WZX A;  2WGI A;  4OOY A;  2W3G A;  4JF5 A;  4Q0I A;  4EET B;  5L2F A;  4B93 A;  4MN5 A;  5M1A A;  1BZA A; 
#chains in the Genus database with same CATH homology
 1SHV A;  1MWR A;  4QY5 A;  1K57 C;  4N9K A;  2V1Z A;  5GLC A;  3FZC A;  3HUO A;  2DNS A;  1Q2P A;  4BJP A;  3OPH A;  4FH4 A;  4XUX A;  2OLV A;  4X6T A;  2QMI A;  1JWV A;  1FCO A;  4KZ8 A;  5D3O A;  5FQK A;  3IH9 A;  4X68 A;  5AQ7 A;  2Y2J A;  3NDG A;  5CEB A;  1Q2Q A;  4KZ6 A;  3GSG A;  2EX2 A;  4JF6 A;  3ZGA B;  3G35 A;  2R9W A;  3GV9 A;  1FCM A;  3AGD A;  5JYP A;  3PBT A;  3Q07 A;  4S2I A;  1L0G A;  1K54 C;  3BRM A;  4E3K A;  3PAE A;  2P9V B;  3LCE A;  1DY6 A;  2WAD A;  3G30 A;  3AGF A;  4LEN A;  1DJA A;  3I7J A;  3BYD A;  2HDS A;  3FKV A;  2ZD8 A;  1W7F A;  1ZG6 A;  4N1X A;  5GHX A;  4E3L A;  5U47 A;  4UA9 A;  3V50 A;  3JYI A;  2H0T A;  3UDX A;  3N8S A;  3Q1F A;  1E25 A;  1ERQ A;  3GMW A;  4JXW A;  4O7D A;  5JYO A;  4OPZ A;  1YT4 A;  3C7U A;  4BLM A;  2R9X A;  4EUZ A;  3G2Z A;  2I72 A;  4UA7 A;  2HDR A;  3BFD A;  3Q7V A;  1I5Q A;  1PW1 A;  3O86 A;  1SKF A;  3PTE A;  5EVI B;  1U60 A;  4RYE A;  3ZG0 A;  5FAO A;  2FFY A;  5CER A;  4R3B A;  2XEP A;  4R0Q A;  3HLE A;  1C3B A;  4OVD A;  3ZNY A;  4B4X A;  4PM7 A;  5I94 A;  1IYS A;  4KZB A;  3VP1 A;  3S22 A;  3S4X A;  1WYC A;  3N7W A;  2XD5 A;  2EX8 A;  1W79 A;  5CRF A;  1VQQ A;  2ZQC A;  3FWL A;  1JVJ A;  1K56 A;  2Y91 A;  4S2N C;  3GTC A;  2XGN A;  1LLB A;  4UAA A;  2IWB A;  5HAQ A;  3WRZ A;  3IXD A;  3M2K A;  4OLG A;  3N4I A;  1NXY A;  3UPP A;  5CTM A;  3BFG A;  2Y2O A;  1FR1 A;  3NI9 A;  3C4O A;  1YLT A;  4U3T A;  3BM6 A;  3QHY A;  5EVI C;  3GVB A;  5DF7 A;  4WMC D;  4WZ5 A;  4QU3 A;  1WE4 A;  3UN7 A;  2Q9N A;  3VP3 A;  1GHP A;  2WYX A;  3OCL A;  2WKH A;  1NRF A;  1XKZ A;  4EV4 A;  1LI0 A;  1M6K A;  2WUQ A;  2HDQ A;  3IXH A;  1H8Y A;  5TR7 A;  3LEZ A;  4R4R A;  2ZM8 A;  3DTM A;  4LV0 A;  5CXW A;  2WKI A;  3MKE A;  5FDH A;  2WGW A;  3LY4 A;  2ZMA A;  3NBL A;  2JBF A;  1MKI A;  3V3R A;  4DE2 A;  1PZP A;  2IWD A;  1HTZ A;  1S0W A;  4X53 A;  4OP5 A;  1ERO A;  2ZQ7 A;  3E2K A;  4HBU A;  4E3M A;  2C5W B;  4OQG A;  5F1G A;  2OSU A;  4DDS A;  4FD8 A;  3S1Y A;  1JWZ A;  5DTT A;  5EVI D;  3VP4 A;  3C4P A;  2J7V A;  2WGV A;  3WS1 A;  1OME A;  1PWC A;  4S2O A;  3VP2 A;  4DDY A;  4U0T A;  1W8Y A;  3PBN A;  4PM9 A;  5CTN A;  3ZHH A;  5M19 A;  2ZM0 A;  1CEG A;  1GHM A;  3N6I A;  1CEF A;  4P87 A;  5FA7 A;  2E8I A;  3G31 A;  4C6Y A;  1FSY A;  3O88 A;  4DE1 A;  4GD6 A;  3A3F A;  4DE3 A;  3VSK A;  4N9L A;  1PWD A;  1YMS A;  4FH2 A;  3ZG5 A;  4JLF A;  2Y59 A;  3FKW A;  3PAG A;  3HLB A;  3SH7 A;  5M18 A;  4KZA A;  3A3D A;  4X56 A;  4DXC A;  3B3X A;  5HFO A;  1TEM A;  2HP5 A;  5FAQ A;  4HEF A;  4N1H A;  3BFF A;  4JXS A;  5AQ9 A;  4IVI A;  4Y0O A;  5HW3 A;  4R23 A;  2H10 A;  3RXW A;  4PPR A;  3E2L A;  4QD4 A;  1ES5 A;  1LL9 A;  5J8X A;  4RA7 A;  1HD8 A;  4LV2 A;  4KZ7 A;  1PWG A;  2BLS A;  1YLY A;  4MBF A;  3M6H A;  4E6W A;  3MKF A;  3NCK A;  1K4E A;  4S2K A;  2ZM2 A;  3RXX A;  4X55 A;  3HLW A;  4WZ4 A;  1W5D A;  3Q7V B;  5CHM A;  2XFT A;  2X71 A;  4KEN B;  1ALQ A;  3BFE A;  1KE3 A;  1YM1 A;  2J8Y A;  1K25 A;  2G2U A;  2J9P A;  3UPO A;  2XD1 A;  4QJG A;  3AGE A;  4WEJ A;  2JE5 A;  4OOM A;  3LY3 A;  4K0X A;  1GHI A;  2Y2L A;  3BFC A;  2ZLY A;  1JWP A;  3HLF A;  2Z2L B;  2Y2P A;  5CGX A;  2RCX A;  3EQV A;  5FQ9 A;  2XH9 A;  1IYQ A;  3MXR A;  3ZFZ A;  3FV7 A;  4K0W A;  4OQH A;  1O07 A;  2Y2I A;  2X02 A;  1BT5 A;  3BLM A;  5FQQ A;  4R4S A;  1XXM A;  4H8R A;  4ID4 A;  5HL1 A;  4P85 A;  3HBR A;  3C7V A;  4A5R A;  2WK0 A;  1FR6 A;  5CHU A;  3ITB A;  1IEM A;  1K4F A;  4E3J A;  3MBZ A;  3HLD A;  4EQI A;  2WAE A;  5CEC A;  4GD8 A;  5KSC A;  4YFM A;  4GNU A;  1MWU A;  1K55 A;  2WAF A;  3PBO A;  1TVF A;  3ITA A;  2HPB A;  5HAR A;  2FFF B;  1ERM A;  5IHV A;  3HL9 A;  4ZJ3 A;  1PZO A;  4WMC A;  4UA6 A;  1SDN A;  3LO7 A;  1G68 A;  2WGW B;  4KZ9 A;  4OQI A;  4P0M A;  3UNW A;  3RJU A;  3UE1 A;  4D2O A;  3A3E A;  3P98 A;  2V2F F;  2ZC5 B;  3ZDJ A;  2C6W B;  3HVF A;  2G2W A;  3NY4 A;  4C3Q A;  4F94 A;  5FI6 A;  1BLH A;  3VP0 A;  3BEC A;  3M6B A;  4PMA A;  4R1G A;  1KGG A;  3IXG A;  4WZ5 C;  1RCJ A;  4E6X A;  1XP4 A;  2Y2H A;  4EBL A;  2H5S A;  3Q82 A;  4FCF A;  5A91 A;  2Q9M A;  3IWO A;  4R3J A;  5GLB A;  5FAP A;  2ZQD A;  3IWI A;  1PI5 A;  3ZNT A;  4DKI A;  1AXB A;  1FSW A;  5CGS A;  4YIN A;  4K91 A;  5FI2 A;  4OON A;  1MWT A;  3UPN A;  3IH8 A;  4IBR A;  4ZJ1 A;  1K6R A;  5TFQ A;  3UDI A;  1ES3 A;  4GOG A;  4QY6 A;  2JC7 A;  4L0L A;  1Y54 A;  4ZAM A;  1YLW A;  1YLZ A;  2VGK A;  3BLS A;  3UE0 A;  1GCE A;  1ONH A;  1XPB A;  3W8K A;  1SDE A;  3V3S A;  2Y55 A;  1NJ4 A;  2ZC7 A;  5A90 A;  4S2J A;  5DVA A;  5TGF A;  1MPL A;  5DTS A;  1XGJ A;  1MXO A;  2ZQ9 A;  3IHA A;  3C5A A;  4KQQ A;  1KDW A;  3NIA A;  1E3U D;  3O87 A;  3CMZ A;  4S2M A;  3MXS A;  4GZB A;  4XXR A;  1FCN A;  4JKT A;  5EOO A;  4XUZ A;  2GDN A;  5EVL A;  1BLC A;  3W4Q A;  4EWF A;  4MLL A;  4JF4 A;  3MFD A;  4Y0U A;  5FI7 A;  4KZ4 A;  3UO9 A;  2VGJ A;  4WBG A;  1IKG A;  1ONG A;  4UHU A;  5EE8 A;  3DWZ A;  5A93 A;  4WEL A;  4KQO A;  1MBL A;  2XLN A;  4CJN A;  1BUE A;  1KDS A;  3GQZ A;  4OPQ A;  3SH9 A;  3SS5 A;  1EWZ A;  4MEZ A;  1ZG4 A;  5FAT A;  4GN2 A;  4QB8 A;  4RX3 A;  4HES A;  3UY6 A;  1J9M A;  1G6A A;  3GR2 A;  3IF6 B;  3PBR A;  4WM9 A;  4IED A;  2V20 A;  3G2Y A;  4MBK A;  3VOY A;  1IEL A;  3DWK A;  4B4Z A;  5A92 A;  1KE4 A;  2XR0 A;  4LCM A;  1DJC A;  3HLG A;  2A3U A;  3P09 A;  5EUA A;  4BQM A;  1S6R A;  2OLU A;  3O3V A;  1KE0 A;  1KVL A;  2EX6 A;  3ZG9 B;  2EXA A;  3WS0 A;  1XA1 A;  5HX9 A;  1K6S A;  3SS4 A;  5E2H A;  4RVA A;  1XGI A;  4E3N A;  4M3K A;  1BLS A;  4DF6 A;  4LCL A;  2XK1 A;  3CZD A;  5GLA A;  4GDB A;  5DF9 A;  4RX2 A;  1QME A;  3GRJ A;  3HUN A;  1IYO A;  2ZJ9 A;  1MWS A;  3EQU A;  1LHY A;  1PW8 A;  3IF6 A;  3WS2 A;  3N8R A;  1DJB A;  1GA9 A;  3N8L A;  5GL9 A;  2A49 A;  5DTK A;  1SCW A;  2DRW A;  3ISG A;  1NZU A;  3OPR A;  3IF6 C;  1MY8 A;  3IT9 A;  1YMX A;  1ZKJ A;  4MNR A;  4NK3 A;  3TOI A;  3OZH A;  2HP6 A;  2Y2Q A;  5G18 A;  1K54 A;  3SOI A;  2ZQ8 A;  3CJM A;  1BSG A;  4KZ3 A;  1YQS A;  4EBN A;  3Q7Z A;  5KMW A;  2IWC A;  3G34 A;  4Y0T A;  1K38 A;  3OPL A;  4S2L A;  5EOE A;  4P6B A;  2EFX A;  3NC8 A;  1CI9 A;  4JPM A;  4DRT A;  1CI8 A;  1XA7 A;  4N92 A;  5FQM A;  3VFF A;  5F83 A;  4EBP A;  2Y2N A;  1M40 A;  4ZJ2 A;  5FQI A;  5BOH A;  1QMF A;  2EXB A;  5AQB A;  3HRE A;  4FSF A;  5E2G A;  1PIO A;  4ZTK A;  2ZC3 B;  4ZBE A;  3FYZ A;  4BD1 A;  4Z9Q A;  2PBY A;  2Y4A A;  4GB7 A;  2WKE A;  3MZF A;  1BLP A;  2XDM A;  1JTG A;  1FOF A;  4KQR A;  2J9O A;  4KZ5 A;  2JCH A;  1HVB A;  4Q8I A;  3G4P A;  2Z2M B;  4GDN A;  4KG5 A;  3PBQ A;  1Z6F A;  2PU4 A;  3NDE A;  1K55 C;  2P9V A;  3OCN A;  1ES2 A;  4KG2 A;  3SS3 A;  4B88 A;  1TDL A;  4OP8 A;  3G32 A;  5E43 A;  5EPH A;  3BEB A;  3V5M A;  5CGW A;  1ESU A;  5F1F A;  5KSH A;  1KGE A;  1L0E A;  4BEN A;  4OQ0 A;  5FAS A;  2XF3 A;  3M2J A;  3TG9 A;  3ZVW A;  4OPR A;  3UDF A;  2DCF A;  3A3I A;  3HLC A;  3ZG7 B;  1XX2 A;  4OH0 A;  3SH8 A;  3VOZ A;  3IF5 A;  4PM6 A;  4S2N A;  3OPP A;  2RL3 A;  3W4O A;  4E3I A;  1ZC2 A;  1ES4 A;  2ZQA A;  4JXV A;  3TSG A;  2Y2M A;  1NZO A;  2PU2 A;  5E2F A;  2WZZ A;  1HZO A;  4OLD A;  5EEC A;  4BL2 A;  2X01 A;  1NYY A;  3Q81 A;  3WRT A;  4LV1 A;  1KVM A;  4DXB A;  1LL5 A;  2HP9 A;  5GLD A;  1BTL A;  3D4F A;  3IXB A;  4E3O A;  1L0F A;  5EVI A;  1TDG A;  5E2E A;  1NYM A;  4S2P A;  1O7E A;  2EFU A;  3DW0 A;  1K56 D;  4PM8 A;  1CK3 A;  3MZD A;  5FQJ A;  3IWQ A;  1E4D A;  1IYP A;  4JXG A;  4LV3 A;  4WEK A;  5DF8 A;  1E3U A;  4DE0 A;  1L2S A;  2Y2G A;  1ESI A;  3V39 A;  1N4O A;  4KG6 A;  5HAI A;  1YLJ A;  2ZC4 B;  3QNB A;  3PBS A;  3VMA A;  3WS5 A;  4CPK A;  2QPN A;  4JBF A;  3ZVT A;  3ZCZ A;  2CC1 A;  1I2W A;  3HUM A;  1RGY A;  1FQG A;  1BUL A;  5FSR A;  4Y7P A;  1VM1 A;  4IBX A;  2XQZ A;  1KGF A;  1N9B A;  5GHZ A;  4U0X A;  4NET A;  5CED A;  5CHJ A;  5AQA A;  1PYY A;  1L0D A;  2Y2K A;  2UWX A;  2XFS A;  1RP5 A;  3IHB A;  1JTD A;  4QHC A;  4ZDX A;  4IVK A;  4X69 A;  1W8Q A;  4WYY A;  3W4P A;  4C75 A;  1IKI A;  1EI5 A;  3A3J A;  1RGZ A;  2ZC6 B;  2EX9 A;  1I2S A;  3WWX A;  5HAP A;  3CG5 A;  4OPY A;  2BG1 A;  4MBH A;  4OOL A;  2P74 A;  1GA0 A;  3WS4 A;  3OC2 A;  4GKU A;  3VFH A;  4BL3 A;  1WYB A;  1YLP A;  5F82 A;  4PM5 A;  1LI9 A;  2QZ6 A;  1PI4 A;  1NY0 A;  4OKP A;  1H5X A;  2H0Y A;  2WZX A;  2WGI A;  1H8Z A;  2B5R A;  3IQA A;  3UE3 A;  3MZE A;  4OOY A;  3QNC A;  3ZG8 B;  4JF5 A;  5KZH A;  1K57 A;  4BD0 A;  2HDU A;  4HBT A;  5L2F A;  5GHY A;  3VSL A;  2OV5 A;  5M1A A;  1BZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...