1YLWA

X-ray structure of ctx-m-16 beta-lactamase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGGYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CTX-M-16 beta-lactamase
publication title Atomic Resolution Structures of CTX-M beta-Lactamases: Extended Spectrum Activities from Increased Mobility and Decreased Stability.
pubmed doi rcsb
source organism Escherichia coli
total genus 95
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ylwA00
3LY4A 4WBGA 3WS1A 4DE0A 4WEJA 1SCWA 3A3IA 3A3EA 4JF4A 3HLEA 1FQGA 2FFYA 2HP9A 5FSRA 4EQIA 1BLPA 2WAFA 4HESA 3IXHA 4JF5A 1VM1A 3UO9A 2R9XA 1K54A 3HUNA 3MBZA 4S2KA 3GQZA 4R4SA 1N9BA 5IHVA 3VFFA 5E2EA 5F83A 4DF6A 4U3TA 4UA6A 4Y7PA 1RCJA 3N8RA 3VMAA 1NRFA 3GVBA 4H8RA 5D3OA 1YLYA 4D2OA 1N4OA 3HVFA 3P98A 3QNBA 2E8IA 2Y2MA 4OPRA 1KE0A 4PM9A 3QHYA 3BFDA 4B4ZA 2HDUA 3UE1A 4WM9A 1ES3A 1I5QA 4MLLA 4P0MA 4CJNA 1MWRA 2WZXA 1GA9A 4GDBA 1PZOA 1YT4A 3S4XA 3ZGAB 3SS3A 2Y55A 5GHYA 4BLMA 3C4OA 1LI0A 1DJCA 1OMEA 2Y2NA 2ZQ9A 4DXBA 5CEBA 1FSYA 1EWZA 3M2JA 1MY8A 5J8XA 1IYQA 2WGVA 2Y2QA 4JPMA 5E43A 3S22A 3ZNYA 3WS5A 1XP4A 1K25A 5FQQA 3G32A 4E3NA 2XR0A 3C5AA 1K57C 1NYMA 1WE4A 1YM1A 3IHBA 4X56A 4OQGA 4R3BA 1L0GA 1IKGA 4LV0A 5FATA 5U47A 4DE2A 5M18A 1AXBA 1S6RA 3VFHA 2Q9MA 4N9KA 1PWDA 3VP2A 1BZAA 2WKEA 5CHJA 3WS0A 1I2WA 3SH7A 4P85A 2ZC3B 3A3FA 2WZZA 1PIOA 3O87A 1K54C 2P9VB 5FDHA 2HDSA 4OLDA 2ZQDA 4JXGA 3N8LA 4MNRA 1JWVA 5KSCA 3UNWA 5BOHA 5EECA 2UWXA 1CK3A 2V1ZA 3BECA 4NETA 3DWZA 3UDXA 4BD0A 3V3SA 4BENA 4UA7A 2A3UA 2ZD8A 2XEPA 4M3KA 2EX6A 1EROA 4L0LA 1ZKJA 4DDSA 4F94A 2WADA 1Y54A 4PM8A 3Q1FA 4QY5A 3OPPA 4R23A 4E3OA 2ZQ7A 1XX2A 1PZPA 2XF3A 3BM6A 3Q7VB 4KG6A 3C7VA 1H8YA 2ZQ8A 3A3JA 3M6HA 3Q7ZA 3ZFZA 2XGNA 4E3MA 5FAQA 3IF5A 3TOIA 1PYYA 3A3DA 3V39A 4HBUA 1BLCA 5GLAA 1KDSA 5FQJA 2XFTA 1W5DA 3G34A 4OVDA 4PMAA 3MZDA 5GL9A 1S0WA 4BJPA 5GHZA 2ZQAA 2Y2JA 4GOGA 5E2GA 4LENA 5FI7A 3VSKA 2JE5A 2OLUA 2ZM2A 1KVLA 3OPRA 1L0EA 5FI6A 4GKUA 2HP5A 1FOFA 3FV7A 4WMCD 4IBRA 2WGWA 4UHUA 3TG9A 1ZC2A 2ZQCA 3G31A 2RL3A 3G30A 3UN7A 3IXDA 4EBPA 5FAPA 1SDNA 2FFFB 3BFEA 1KGFA 3PBNA 4KZAA 1SHVA 1E25A 3NBLA 1PWGA 3ZVWA 3HLBA 3VSLA 1HZOA 3JYIA 4S2PA 4DDYA 3G2ZA 3UE0A 5FA7A 1ES4A 3DWKA 3IWIA 3UDIA 3GR2A 5M1AA 3ZVTA 1PW8A 2DRWA 2VGJA 4X69A 5E2FA 1H5XA 4ZJ3A 1U60A 4JLFA 2QPNA 2G2UA 2P74A 2WAEA 1ALQA 1HTZA 3GRJA 1MPLA 3IQAA 5HFOA 3VP4A 3FKWA 3IH8A 3ZHHA 4JF6A 5AQBA 3BLSA 3PAEA 1BUEA 4KZ8A 3WWXA 1HD8A 4KZ9A 3IF6B 2Y59A 1YLJA 5CERA 3QNCA 4S2MA 3ZG9B 4OLGA 2VGKA 1BT5A 4X68A 4LV2A 1K6RA 1K4FA 2WGIA 5DTKA 4DE3A 5CEDA 5GLBA 5KMWA 5A91A 4MBHA 3SH8A 1JWZA 1NY0A 1W79A 2EFUA 3MFDA 3RXXA 3UPOA 1KE3A 1CI8A 4U0XA 1E3UA 1L2SA 2Y2OA 3G4PA 4MBFA 1EI5A 4BD1A 4PM5A 4OP8A 5EUAA 5EVIB 4FH2A 4RVAA 1BSGA 4E6XA 1VQQA 2ZMAA 3HBRA 4KZ3A 2CC1A 3WS4A 1ONGA 2Q9NA 1TVFA 1W8QA 2J8YA 1QMEA 3SH9A 5A93A 4U0TA 4X55A 4JBFA 5FI2A 5FASA 1LL9A 4BQMA 3C4PA 4S2JA 3BRMA 3V3RA 3M6BA 3N8SA 5E2HA 3S1YA 1H8ZA 3ISGA 3ZCZA 3NI9A 4E6WA 4IEDA 5F1GA 5EPHA 1K4EA 5F82A 3EQVA 5FQKA 3PBTA 2H0TA 4JXVA 1NXYA 1K55C 3NDEA 1W8YA 1YMSA 3HLCA 4S2LA 1GHMA 1JVJA 4BL2A 3PTEA 3IXGA 2IWCA 4S2NA 5F1FA 5KZHA 3BFGA 1K6SA 1Q2PA 2DNSA 4QU3A 4N9LA 2BG1A 4YFMA 4QY6A 3GTCA 1W7FA 3LY3A 4ZJ1A 3V50A 4Y0OA 1J9MA 1PWCA 3AGEA 5CGSA 4GZBA 1G68A 2XDMA 4GDNA 5CTNA 3NCKA 1BLSA 1TEMA 5DTTA 4N1XA 1XA7A 1KVMA 4GN2A 4KENB 2H5SA 3HUMA 4ZBEA 2I72A 4OOMA 1GHIA 4N1HA 3OPLA 5CXWA 1YQSA 2ZM0A 2P9VA 4RX3A 4X53A 4WZ5A 3DTMA 1O07A 2QZ6A 4QHCA 1RGYA 1CEFA 1IYSA 4YINA 3MKEA 1XPBA 2X02A 4N92A 1RGZA 4O7DA 3ZG0A 3Q81A 4EBNA 3AGDA 2OLVA 3ZNTA 3LO7A 3FWLA 3MXRA 1LL5A 1CI9A 4IBXA 3VP3A 3O3VA 2IWDA 2HDRA 3ZG8B 4NK3A 1XGIA 2QMIA 3HLDA 5L2FA 3ITBA 3HUOA 4GD8A 4DRTA 2H10A 1JTGA 3CG5A 5EOEA 5EVIC 5HAQA 4KG2A 4S2IA 4XUZA 1IELA 4KZBA 4QD4A 2HP6A 3I7JA 3Q7VA 3IXBA 4LCMA 4MBKA 4EV4A 2EX9A 1WYCA 1XGJA 3G35A 2V2FF 1QMFA 4S2NC 3N7WA 1ZG4A 1BTLA 4MEZA 3CZDA 2XK1A 5CGXA 3W4OA 1IEMA 4ZJ2A 4DE1A 3ZG7B 1YLTA 3O88A 2Y91A 3ITAA 2OSUA 1CEGA 3WS2A 1SKFA 3HREA 4Q8IA 3MZEA 3MZFA 4QJGA 2ZC6B 5A90A 2WUQA 2ZC5B 1JWPA 4R1GA 3W4PA 2HDQA 2PU4A 4X6TA 1KGEA 5HAPA 1LHYA 3NC8A 4KZ7A 1C3BA 4OQIA 5AQ9A 2PBYA 4IVKA 3SS4A 2A49A 4WZ5C 5M19A 1K55A 4OOLA 1FCMA 1FR6A 2Y2IA 4B4XA 1IYOA 2WYXA 5HAIA 5HL1A 1M6KA 1KE4A 1ESUA 1O7EA 2Y2GA 4WYYA 4EWFA 3RXWA 2XD5A 4LV1A 1YLPA 3HLGA 2RCXA 1E3UD 3N6IA 4RX2A 4KZ4A 3D4FA 1XKZA 3AGFA 4GD6A 5FQMA 1E4DA 4OQHA 3NIAA 1I2SA 2JBFA 4KQOA 2DCFA 5EVLA 4WZ4A 1IKIA 3HLWA 3VP1A 4OP5A 5AQ7A 2Y2KA 2XD1A 2OV5A 4ZDXA 3OPHA 3PBOA 3OCLA 4OOYA 4Y0UA 5CECA 5CGWA 2ZC7A 4OPQA 3EQUA 2ZM8A 3IH9A 1TDLA 4XXRA 4OPZA 5I94A 1PW1A 3Q82A 3IF6A 5DF8A 2ZC4B 5FQ9A 3UPNA 1YMXA 3HL9A 4ZAMA 1FCOA 5CRFA 1SDEA 2WKHA 1JTDA 1MBLA 3ZDJA 1FSWA 1NYYA 2PU2A 2Y2HA 3FZCA 4LCLA 5EVID 3RJUA 4P87A 3TSGA 4WEKA 3B3XA 1PI5A 4ID4A 2G2WA 1KGGA 2Y4AA 4KQRA 1GCEA 1NZOA 3BYDA 5GHXA 1DJBA 4CPKA 1NZUA 1LLBA 5EVIA 4XUXA 1L0FA 4JXWA 4KG5A 5DVAA 1BLHA 1MKIA 2Y2PA 2X71A 4IVIA 4UA9A 3UDFA 1HVBA 4JXSA 2J7VA 3FKVA 2HPBA 3CJMA 1PI4A 4PM6A 5CHUA 3SOIA 4LV3A 3GMWA 3NY4A 4FSFA 2XLNA 4QB8A 3MKFA 1ES5A 1FR1A 3E2KA 1MWUA 2EX2A 5EE8A 1ZG6A 3BLMA 1RP5A 4R4RA 5HARA 3IHAA 1ONHA 4FCFA 3GSGA 3IWQA 4E3KA 4RA7A 3CMZA 4KZ5A 1DJAA 1XA1A 5GLDA 2ZJ9A 3W8KA 3SS5A 3M2KA 3GV9A 2EXBA 1YLWA 4OH0A 2WK0A 2XH9A 5CHMA 5CTMA 5DF9A 3ZG5A 4JKTA 5KSHA 1GHPA 1LI9A 3IF6C 4P6BA 3PBSA 1G6AA 4K0WA 5A92A 5AQAA 1K38A 2EX8A 4BL3A 4DKIA 1WYBA 3MXSA 2C5WB 4PM7A 2Y2LA 3OZHA 2J9PA 1FCNA 1NJ4A 2C6WB 3DW0A 3VOZA 4R3JA 5DTSA 3WRTA 3V5MA 1L0DA 1BULA 1Q2QA 1TDGA 4OQ0A 4C3QA 4UAAA 3OCNA 4FD8A 4EUZA 4Y0TA 1MWSA 4S2OA 4C75A 2WGWB 2X01A 1IYPA 1Z6FA 3PBRA 1ERMA 1ERQA 1MWTA 4GB7A 4OONA 2V20A 3Q07A 1KDWA 4Z9QA 5GLCA 3LEZA 4EBLA 5JYPA 3IWOA 1ES2A 2B5RA 3BEBA 4R0QA 2GDNA 2JC7A 4KQQA 4E3JA 1DY6A 2WKIA 4C6YA 4GNUA 4DXCA 4E3LA 3BFFA 3NDGA 4B88A 2J9OA 3UE3A 4RYEA 4HBTA 5JYOA 1K56D 3G2YA 4K91A 3UY6A 5DF7A 4FH4A 3VOYA 3BFCA 3O86A 1ESIA 3C7UA 3LCEA 2IWBA 1YLZA 3HLFA 3VP0A 2XFSA 4E3IA 5HW3A 3N4IA 1XXMA 1K56A 2JCHA 3UPPA 5TR7A 4WMCA 5EOOA 5TFQA 5TGFA 4KZ6A 1GA0A 3E2LA 5FAOA 3PBQA 5FQIA 5G18A 2H0YA 3PAGA 4PPRA 4WELA 4A5RA 2BLSA 2XQZA 3OC2A 4OPYA 3P09A 3IT9A 2EXAA 1M40A 2Z2MB 4OKPA 2Z2LB 3W4QA 5HX9A 2ZLYA 4HEFA 4ZTKA 2EFXA 3WRZA 2R9WA 4K0XA 1K57A 3FYZA 1MXOA
chains in the Genus database with same CATH superfamily
3LY4A 3WS1A 4WEJA 1SCWA 1ZTUA 4JF4A 2ZMVA 3IS2B 1BLPA 2VJWA 4HESA 4JF5A 1VM1A 3CPTA 3GECA 4LRXC 3T1QB 1VEUB 4I3AA 5IHVA 3VFFA 5F83A 4U3TA 4Y7PA 3N8RA 3G6OA 3GVBA 5D3OA 1CJFA 3HVFA 3UE1A 3IBRA 1I5QA 1OTBA 1NWZA 3ZGAB 2BTFP 1LL8A 3U2AA 4BLMA 3C4OA 1XJ6A 5FQQA 2XR0A 1K57C 1NYMA 3TJZC 4X56A 5M18A 5FATA 4LV0A 3VFHA 2Q9MA 3VP2A 2WKEA 5CHJA 3WS0A 2WZZA 1PIOA 5HDDA 4OLDA 3S7NA 4MNRA 5A8BA 5FEFA 5BOHA 2ZOHA 2UWXA 3NECA 2A2LA 3S7QA 4BD0A 4BENA 5MC7A 2ZD8A 3UB7A 4DDSA 2WADA 5AVEA 4R23A 2ZBBA 1YKDA 5DJUA 1PZPA 4KG6A 2ZQ8A 3ZFZA 5HD5A 4CLCC 3TOIA 4HBUA 5GLAA 5HDSA 3MZDA 2KOIA 4GOGA 5E2GA 2ZM2A 5FI6A 1VETB 1FOFA 2HGVA 4WMCD 4UHUA 1KOUA 2EA9A 5F69A 4HNBA 1IFQA 2FFFB 3BFEA 4KZAA 2ZOIA 1SHVA 3NBLA 1HZOA 4S2PA 3UE0A 1ES4A 2IA2A 3UDIA 3GR2A 3ZVTA 1PW8A 2DRWA 1TS8A 2VGJA 4X69A 1U60A 2QPNA 1F5MA 2P74A 5HWWA 1ALQA 5HFOA 1MPLA 3UB8A 1MZUA 2YKHA 3IH8A 4JF6A 5AQBA 1BUEA 3WWXA 2PDRA 3S7OA 2VGKA 4X68A 5DTKA 4GHIB 1K6RA 5GLBA 2K7SA 4MBHA 3SH8A 3DTKA 1NY0A 3MFDA 1W79A 2HV1A 3RXXA 4U0XA 2Y2OA 3IS2A 4CLCD 5EUAA 5EVIB 2ZMAA 1VEUA 4KZ3A 2CC1A 4E04A 5FASA 4UQIM 3ISGA 2GNXA 4IEDA 3BJNA 5F1GA 5F82A 3K3CA 5EFWA 5FQKA 3CITA 3PBTA 2WKRA 1W8YA 3UB5P 4S2NA 2VGLM 3FG8A 5K5BA 2V1AA 1OPXA 2VV6A 3QP1A 4QY6A 3GTCA 4ZJ1A 5CGSA 2XDMA 5CTNA 2W3EA 4CQHA 5DTTA 1XA7A 4KENB 4HQAA 5DKKA 3HUMA 2ZM0A 3QP4A 4WZ5A 3DTMA 1F98A 2QZ6A 3IBJA 1N9LA 1RGZA 2XA7S 3MXRA 1OTAA 1CI9A 3VP3A 3O3VA 4WLAA 3BW6A 1NLZA 2QJ5A 4BBUA 1XGIA 3MXQA 3HLDA 5L2FA 4GD8A 5HAQA 1Z09A 4XUZA 1IELA 3I7JA 4MBKA 4EV4A 4S2NC 3NOPC 3MQOA 2BASA 3CZDA 4HOIA 5CX7A 5DFXA 4ZJ2A 3ZG7B 2Y91A 4Q8IA 4I3IA 3MZFA 2ZC6B 5A90A 2WUQA 5C5KA 1JWPA 4X6TA 1VETA 4KZ7A 1S67L 3IX3A 4WZ5C 4OOLA 2K2NA 1M6KA 1O7EA 2Y2GA 2VEAA 4WYYA 4F3LB 1YLPA 2RCXA 3N6IA 1K0KA 5J4EA 5FQMA 2PAVP 1E4DA 1I2SA 4WZ4A 3HLWA 3VP1A 4OP5A 2Y2KA 1MKMA 2OV5A 1VHMA 3OPHA 4ZDXA 3E98A 3A0RA 3EQUA 1PW1A 2PRFA 3KSFA 1LSVA 5HPFA 5F68A 4BWIA 5CRFA 1SDEA 2WKHA 5HDCA 4GHIA 1MBLA 3MQQA 2PU2A 4LCLA 3UMEA 3FPVA 2VA0A 3TSGA 3BY8A 4WEKA 3B3XA 4LRZE 2P04A 4ID4A 1OTDA 1LLBA 5EVIA 2QJ7A 4JXWA 4IVIA 2Y2PA 2X71A 3SZTA 4JXSA 2J7VA 1T18A 1PI4A 3GMWA 1S1YA 4DJ3A 4YOFA 3MR0A 1MC0A 4LFUA 3E2KA 2CMNA 1ZG6A 3BLMA 4NXGA 4B9OA 1RP5A 3C8CA 4R4RA 4JGRA 2PR5A 4FCFA 3GSGA 5AVFA 2EWVA 3F1PA 3KYQA 2V8CA 3RH8B 4Y3IA 2EXBA 2XH9A 1GHPA 4K0WA 4BL3A 2C5WB 1G6OA 1NJ4A 3VOZA 4R3JA 3OBFA 2G7UA 2AVXA 1Q2QA 5DKLA 4Y0TA 1UWPX 1MWSA 4S2OA 2WGWB 3PBRA 2NUTC 5GLCA 2O9CA 3BFFA 1OT6A 2J9OA 3UE3A 5J7EA 1Y4OA 3LIAA 4FH4A 3BFCA 3RTYA 1ESIA 4E3IA 3HLFA 1XXMA 2JCHA 5AJGA 3E4QA 5TR7A 5TGFA 3JVUA 5L09A 4A5RA 3PAGA 2BLSA 2XQZA 3OC2A 4OPYA 3IT9A 1M40A 4R6LA 4L9GA 5HX9A 2M7VA 4HEFA 4JGOA 2VKSA 4WBGA 4DE0A 2XA7M 3A3IA 3HLEA 2HP9A 5FSRA 4IJGA 2O99A 3HUNA 1NRJA 4YNRA 1N9BA 4MN6A 4Q0IA 4CLCB 4F3LA 1RCJA 4Q0HA 1G28A 3LUQA 4D2OA 2E8IA 2Y2MA 1KE0A 3LR5A 4PM9A 3QHYA 3BFDA 2HDUA 2W3FA 5HL6A 1GA9A 4GDBA 3S4XA 4MMNA 5GHYA 5HSQA 1DJCA 1IOUA 1FSYA 1EWZA 5F6AA 5J8XA 1IYQA 2Y2QA 4JPMA 3WS5A 3NOTC 1X0OA 4E3NA 1F2KA 3C5AA 3IHBA 2HF6A 1WE4A 4DE2A 5HD3A 3VOLA 1S6RA 1BZAA 4MCWA 3SH7A 2ZC3B 3A3FA 3C30A 2ZQDA 3N8LA 3EWKA 5KSCA 1CK3A 3JVVA 4NETA 3V3SA 1OT9A 4KUOA 2XEPA 1ZKJA 2V0WA 4F94A 3Q1FA 4QY5A 1TD5A 2ZQ7A 1H8MA 3Q7VB 1H8YA 3A3JA 3M6HA 3LR3A 3E4OA 3LIDA 1D1JA 3H82B 5J3WA 2OAP1 3K2NA 2YKFA 2VLGA 4G3VA 3PYPA 5FQJA 1W5DA 4PMAA 1D06A 2H28A 2ZQAA 3IX8A 3VSKA 2JE5A 2OLUA 3OPRA 3ICYA 4IBRA 2WGWA 4HH3A 2ZQCA 2RL3A 3IXDA 4EBPA 5FAPA 3CLOA 5IS1A 1SDNA 1HLUP 3PBNA 1PWGA 3HLBA 4P6ZS 2ZMFA 3G2ZA 3LI8A 2LB5A 5M1AA 4JLFA 3GRJA 3IQAA 3VP4A 3ZHHA 1WA9A 4I39A 3PAEA 2V8FA 4KZ9A 2OWHA 3QNCA 4HHDA 4DE3A 5CEDA 3KSGA 3UPOA 1KE3A 1CI8A 3VE4A 1E3UA 2KX6A 5L10A 1EI5A 1CQAA 4OP8A 3LIEA 1VQQA 1ONGA 4EERA 1W8QA 2J8YA 1QMEA 3SH9A 4CLCA 5A93A 4U0TA 5FI2A 3C4PA 1LSWA 3N8SA 4E6WA 1SKOB 1H8ZA 3S1YA 5EPHA 1K4EA 3EQVA 1PNEA 1OJ5A 1NXYA 1K55C 3FC7A 1YMSA 2OOLA 4S2LA 1JVJA 4BL2A 2JKRI 4PKYG 5F1FA 3EGXC 5KZHA 3MFXA 3AGEA 3T4JA 2J3WA 4OOMA 5CXWA 3B33A 2OAQ1 1CEFA 4YINA 3MKEA 4NXFA 4N92A 2X02A 4O7DA 3T4OA 3AGDA 2OLVA 4Z1WA 4G3KA 3ZNTA 3LO7A 4EXOA 2QHKA 3QP8A 5EVEA 4O01A 2IWDA 3ZG8B 4NK3A 1JTGA 4MN5A 3CG5A 5EOEA 4KG2A 3T4SA 2HP6A 3Q7VA 2EX9A 4WF0A 3H82A 3N7WA 1ZG4A 3T4QA 2UV0E 1S4SA 4DE1A 4NG2A 3B47A 1CF0A 3UB6A 3WS2A 3DBAA 4QJGA 4GW9A 1XJ3A 1GSVA 3HJKA 4R1GA 5TBMB 2PU4A 5HAPA 2J80A 3L7HA 3NC8A 1C3BA 3ZQ5A 2JKFA 2PD8A 3SS4A 5M19A 1FR6A 1IYOA 4K08A 1ESUA 4LV1A 1E3UD 4RX2A 4BBVA 4BMWA 4R70A 4KQOA 4WL9A 4B93A 2O9AA 5AQ7A 3PBOA 3OCLA 3UB9A 1T1CA 5CGWA 1H0MA 5IU1A 4XXRA 4OPZA 5DF8A 2V1BA 3UPNA 1ZHHB 4O8GA 1TF1A 3RJUA 5TJJA 1PI5A 2Y4AA 1GCEA 1DJBA 1NZUA 4BBTA 4P6ZM 3P7NA 4EW7A 1DP8A 2HPBA 3CJMA 4PM6A 5CHUA 5EM0A 3OLOA 4LV3A 4GJ4A 2XLNA 1SKOA 4HI4A 1ES5A 1T19A 1P9RA 4GLQA 4NXBA 1DP6A 1PFLA 4RA7A 4HP9A 4KZ5A 1DJAA 1XA1A 5GLDA 3D3OA 2HZ5A 3GV9A 5KSHA 1LI9A 5AQAA 2EX8A 3C38A 3MXSA 4PM7A 2J9PA 2C6WB 3SW1A 5EM1A 3V5MA 1BULA 1TDGA 4C3QA 4UAAA 3ZYTA 4FD8A 3E4PA 4C75A 2DMWA 3KYZA 2MJ6A 1Z6FA 1MWTA 4GB7A 4OONA 3Q07A 3F1NB 1KDWA 3H7WB 5JYPA 4EBLA 2B5RA 1XJ4A 3PR6A 2GDNA 2JC7A 4KQQA 2VX8A 3TW8A 4E3JA 2WKIA 2O9BA 4E3LA 3KYEA 3NDGA 4B88A 4RYEA 2M7UA 3UY6A 4HIAA 3VOYA 3C7UA 3VP0A 4IUKA 5HW3A 2XFSA 4PKYA 4LGWA 5EOOA 3DTIA 1GA0A 4KZ6A 5FQIA 5G18A 2H0YA 4OKPA 2Z2LB 4Y15A 5LBRA 4ZTKA 2EFXA 4K0XA 5TBMA 4O0PA 3FYZA 4DMZA 1FQGA 2FFYA 4EUVA 2WAFA 3IXHA 2O0YA 2R9XA 1K54A 1S66L 3GQZA 5E2EA 4DF6A 4UA6A 3VMAA 1NRFA 4H8RA 3VE3A 3S7PA 3U4LP 3QNBA 4EEPA 4OPRA 2KDKA 3MQ0A 4B4ZA 2B18A 4WM9A 4MLLA 2WZXA 1YT4A 3SS3A 2Y55A 1LI0A 2Y2NA 5CEBA 3M2JA 1MY8A 3ZNYA 1YM1A 1IKGA 5U47A 1AXBA 4N9KA 1PWDA 4NXEA 2P08A 3O87A 1K54C 2P9VB 3T4LA 2HDSA 2KLIA 1JWVA 2V1ZA 3UDXA 3DWZA 2A3UA 4KUKA 3T4KA 2EX6A 2JKRM 1EROA 4L0LA 3OPPA 1XX2A 5L07A 2XGNA 4E3MA 4Y13A 3IF5A 1PYYA 3A3DA 4GCZA 1BLCA 2JKGA 1KDSA 4OVDA 5GL9A 1S0WA 2P7JA 2Y2JA 3ULFA 5FI7A 4FUWA 1L0EA 2HP5A 3FV7A 3TG9A 3LEQA 5DJTA 3G31A 3F1NA 3H7WA 1NLYA 1FILA 3ZVWA 3TE8A 3VSLA 3JYIA 4DJ2A 5FA7A 3T1SA 1BYWA 2A24B 3DWKA 3IWIA 5E2FA 4HJ4A 2G2UA 2J3TC 2WAEA 1HTZA 3BQ8A 3EGDC 3B42A 4KZ8A 1HD8A 3IF6B 1TS7A 5CERA 4S2MA 4JGPA 1YAXA 4ETZA 4LV2A 5KMWA 2WGIA 1N9NA 1JWZA 2EFUA 3QP5A 1L2SA 3G4PA 4PM5A 4FH2A 4RVAA 1BSGA 4HP4A 2PD7A 4X55A 4JBFA 3CAXA 3T1XA 1LL9A 1XFNA 3LIBA 3BRMA 5E2HA 3ZCZA 1FIKA 2H0TA 4LRYC 3HLCA 3IXGA 2IWCA 5IT5A 3BFGA 1Q2PA 2DNSA 4QU3A 2BG1A 4QPRA 1W7FA 3LY3A 3V50A 2HJEA 4Y0OA 1PWCA 4GDNA 1BLSA 1TEMA 3T12B 2J3TD 1KVMA 4HJ3A 1GHIA 4N1HA 3OPLA 1YPRA 4IHQA 4RX3A 2P9VA 1OJGA 3QP6A 1RGYA 4EETB 1ACFA 1IYSA 3ZG0A 3FWLA 1LL5A 4IBXA 1P97A 2HDRA 1UGUA 3C2WA 3HUOA 2H10A 3F1OB 2QKPA 2VV7A 3LR0A 3LR4A 2XRNA 4S2IA 4KZBA 4QD4A 4LCMA 3EOIA 4L9EA 3RFBA 1WYCA 3UE6A 1ODVA 2FH5A 1BTLA 2W0NA 5CGXA 3W4OA 1H3QA 1IEMA 3LICA 1YLTA 4ZRRA 3FPWA 2OSUA 1CEGA 2W1TB 1PRQA 1SKFA 3MZEA 3BWLA 2ZC5B 1LT0A 2HDQA 1KGEA 1LHYA 1W63Q 4OQIA 4ME4A 5AQ9A 4IVKA 2A49A 3CWFA 1K55A 3VV4A 1FCMA 2Y2IA 5HAIA 3T50A 3HLGA 3GDIA 2Z6DA 2A24A 2JBFA 5EVLA 4FTXA 5F5YA 5FEGA 4OOYA 4MDZA 1P0ZA 2ZC7A 2V9AA 2ZM8A 3IH9A 2B95A 5I94A 1S4RA 3Q82A 4JGQA 3IF6A 1LSXA 4ARZB 2ZC4B 5FQ9A 1YMXA 3HL9A 4ZAMA 1JNUA 1FCOA 3UMDA 1JTDA 3EEAA 3EEHA 2G2WA 4KQRA 1NZOA 5GHXA 3MF0A 3NOUC 3CHWP 4FOFA 1BLHA 4R38A 4UA9A 1HVBA 3BQAA 4AFIA 3FKVA 3R7WB 1OTIA 4FSFA 2K31A 1FR1A 2LB9A 2EX2A 4H6JB 5HARA 3IHAA 1ONHA 2EWWA 3L9KA 4E3KA 3NHQA 3QP2A 2ZJ9A 2Y8HA 2E8JA 3SS5A 3M2KA 4OH0A 1V9YA 2WK0A 3LYXA 5CHMA 4JKTA 3IF6C 2JKTI 1G6AA 1P9WA 1K38A 4DKIA 5HZHA 4EQ1A 3OZHA 3DW0A 1L0DA 4EUZA 2PYPA 4HY8A 1ERMA 1ERQA 2V20A 4Z9QA 2GJ3A 2W3GA 3LEZA 2R78A 3IWOA 5KIZA 1V9ZA 2PHYA 1TS6A 3DAVA 4C6YA 2PR6A 3F1OA 5JYOA 1K56D 3G2YA 1XJ2A 3K3DA 3LCEA 2QYBA 3N4IA 3UPPA 2FZ0A 3PBQA 2OWJA 2EXAA 2W1TA 4WN5A 2W1RA 2ZLYA 2HJ9C 3A3EA 4EQIA 2GX5A 3UO9A 3MBZA 4S2KA 4I38A 4R4SA 3E0YA 3W2ZA 1SZVA 4EU0A 5HWVA 1T1BA 1YLYA 1N4OA 3P98A 3MJQA 1ES3A 4P0MA 4CJNA 1MWRA 1PZOA 4DN0A 3KSHA 2XSSA 4ARZA 1OMEA 2ZQ9A 4DXBA 4I3JA 1EW0A 5E43A 2WGVA 3S22A 1XP4A 1K25A 4NEED 3G32A 3KO6A 4ESPA 4OQGA 4R3BA 1L0GA 2ACGA 4IUHA 3MS6A 3F1PB 4MN7A 1I2WA 4P85A 2NUPC 5FDHA 4JXGA 3LFVA 1YSPA 3R7WA 3UNWA 5EECA 3TRCA 3BECA 5L8MA 3D72A 3NJAA 4HH2A 4UA7A 4H6JA 4M3KA 2M1CA 2PYRA 1Y54A 4PM8A 2Z6CA 4E3OA 2XF3A 3BM6A 3C7VA 3Q7ZA 4LLOB 1Y28A 5FAQA 4D60A 3V39A 2Q0OA 2XFTA 2D02A 3G34A 4BJPA 5GHZA 3CI6A 3NULA 4LENA 3BY9A 1J3WA 1KVLA 4GKUA 3A0VA 1ZC2A 1UWNX 1S1ZA 3G30A 5I5LA 3UN7A 3H9WA 1KGFA 4CLCE 2W3DA 1E25A 1DP9A 5G4ZA 4DDYA 1XFQA 4XT2B 1H5XA 4ZJ3A 2ZL1B 1STZA 3FKWA 3BLSA 1N9OA 2Y59A 1YLJA 3T1RA 4RQ9A 1GSXA 2B02A 3ZG9B 4OLGA 1BT5A 1K4FA 5A91A 1VB6A 4MBFA 4BD1A 2VV8A 4E6XA 3HBRA 3WS4A 2Q9NA 1TVFA 5HWTA 2D01A 4BQMA 4S2JA 3V3RA 3M6BA 2VZWA 3NI9A 2W3HA 3OOVA 4GS9B 3MSHA 4JXVA 3NDEA 3PHYA 1GHMA 1G5UA 4Y5FA 2L1MA 3PTEA 1K6SA 4UEYA 4N9LA 4YFMA 4X1MA 1D7EA 4EEUA 1J9MA 4GZBA 1G68A 3KSIA 3NCKA 4X1LA 4N1XA 4GN2A 1A0KA 2H5SA 4ZBEA 2I72A 4Y2FA 1YQSA 4X53A 5EV0A 3HCYA 1O07A 4QHCA 2XROA 1XPBA 3Q81A 4EBNA 4M4XA 2JHEA 4EESA 2QMIA 2INWA 3ITBA 4DRTA 2JKTM 5DFYA 5EVIC 4WUJA 4I5SA 5FL3A 3LI9A 2PT7A 3IXBA 1XGJA 3G35A 1AWIA 1QMFA 2V2FF 3CUEA 4MEZA 2XK1A 3O88A 3ITAA 3HREA 1OTEA 2L0WA 3W4PA 3DTEA 4QWOA 3A0SA 2PBYA 4B4XA 4YWZA 2WYXA 3CPTB 5HL1A 1KE4A 4EWFA 3RXWA 2XD5A 1T1AA 4KZ4A 3D4FA 3T4TA 1XKZA 3AGFA 4GD6A 2QWSA 4XT2A 4OQHA 3NIAA 3JPUA 2DCFA 1IKIA 2ZL1A 2XD1A 3PXPA 3O5YA 4Y17A 4Y0UA 5CECA 3CUEC 4OPQA 4Q0JA 1TDLA 4KQDA 4NKPA 5HPIA 3ZDJA 1FSWA 1NYYA 2Y2HA 3FZCA 5EVID 4P87A 1L3LA 4L9FA 3IX4A 1KGGA 3BYDA 4CPKA 4XUXA 1L0FA 4KG5A 2W27A 3KX0X 5DVAA 1MKIA 4X25A 3UDFA 1YSQA 4PHTA 2WKPA 2V0UA 3SOIA 3NY4A 3HJIA 4QB8A 3MKFA 1MWUA 5EE8A 3LIFA 4GS9A 3IWQA 3CMZA 4ETXA 3W8KA 1W63M 1DRMA 5G4YA 1YLWA 5CTMA 5DF9A 3ZG5A 1F9IA 2VK3A 3PBSA 4P6BA 2L4RA 5A92A 2GZAA 1WYBA 2WKQA 2Y2LA 1FCNA 2Y79A 5DTSA 3WRTA 4OQ0A 3OCNA 4G3WA 3D9YA 2X01A 1GSWA 1IYPA 2JN7A 3LGOA 4LPZA 1ES2A 3BEBA 4R0QA 3MMHA 1DY6A 4GNUA 4DXCA 3P01A 1TS0A 4HBTA 5FDSA 2PBDP 4K91A 4II7A 5DF7A 4HJ6A 3O86A 4R3AA 4UQIS 2IWBA 1YLZA 1K56A 2I9VA 4PAUA 4WMCA 5TFQA 3E2LA 5FAOA 4WELA 4PPRA 3P09A 2Z2MB 3V67A 3W4QA 3R4KA 3WRZA 2R9WA 1K57A 1MXOA 2VGLS
chains in the Genus database with same CATH topology
3LY4A 4WBGA 3WS1A 4DE0A 4WEJA 1SCWA 3A3IA 3A3EA 4JF4A 3HLEA 1FQGA 2FFYA 2HP9A 5FSRA 4EQIA 1BLPA 2WAFA 4HESA 3IXHA 4JF5A 1VM1A 3UO9A 2R9XA 1K54A 3HUNA 3MBZA 4S2KA 3GQZA 4R4SA 1N9BA 5IHVA 3VFFA 5E2EA 5F83A 4DF6A 4U3TA 4UA6A 4Y7PA 1RCJA 3N8RA 3VMAA 1NRFA 3GVBA 4H8RA 5D3OA 1YLYA 4D2OA 1N4OA 3HVFA 3P98A 3QNBA 2E8IA 2Y2MA 4OPRA 1KE0A 4PM9A 3QHYA 3BFDA 4B4ZA 2HDUA 3UE1A 4WM9A 1ES3A 1I5QA 4MLLA 4P0MA 4CJNA 1MWRA 2WZXA 1GA9A 4GDBA 1PZOA 1YT4A 3S4XA 3ZGAB 3SS3A 2Y55A 5GHYA 4BLMA 3C4OA 1LI0A 1DJCA 1OMEA 2Y2NA 2ZQ9A 4DXBA 5CEBA 1FSYA 1EWZA 3M2JA 1MY8A 5J8XA 1IYQA 2WGVA 2Y2QA 4JPMA 5E43A 3S22A 3ZNYA 3WS5A 1XP4A 1K25A 5FQQA 3G32A 4E3NA 2XR0A 3C5AA 1K57C 1NYMA 1WE4A 1YM1A 3IHBA 4X56A 4OQGA 4R3BA 1L0GA 1IKGA 4LV0A 5FATA 5U47A 4DE2A 5M18A 1AXBA 1S6RA 3VFHA 2Q9MA 4N9KA 1PWDA 3VP2A 1BZAA 2WKEA 5CHJA 3WS0A 1I2WA 3SH7A 4P85A 2ZC3B 3A3FA 2WZZA 1PIOA 3O87A 1K54C 2P9VB 5FDHA 2HDSA 4OLDA 2ZQDA 4JXGA 3N8LA 4MNRA 1JWVA 5KSCA 3UNWA 5BOHA 5EECA 2UWXA 1CK3A 2V1ZA 3BECA 4NETA 3DWZA 3UDXA 4BD0A 3V3SA 4BENA 4UA7A 2A3UA 2ZD8A 2XEPA 4M3KA 2EX6A 1EROA 4L0LA 1ZKJA 4DDSA 4F94A 2WADA 1Y54A 4PM8A 3Q1FA 4QY5A 3OPPA 4R23A 4E3OA 2ZQ7A 1XX2A 1PZPA 2XF3A 3BM6A 3Q7VB 4KG6A 3C7VA 1H8YA 2ZQ8A 3A3JA 3M6HA 3Q7ZA 3ZFZA 2XGNA 4E3MA 5FAQA 3IF5A 3TOIA 1PYYA 3A3DA 3V39A 4HBUA 1BLCA 5GLAA 1KDSA 5FQJA 2XFTA 1W5DA 3G34A 4OVDA 4PMAA 3MZDA 5GL9A 1S0WA 4BJPA 5GHZA 2ZQAA 2Y2JA 4GOGA 5E2GA 4LENA 5FI7A 3VSKA 2JE5A 2OLUA 2ZM2A 1KVLA 3OPRA 1L0EA 5FI6A 4GKUA 2HP5A 1FOFA 3FV7A 4WMCD 4IBRA 2WGWA 4UHUA 3TG9A 1ZC2A 2ZQCA 3G31A 2RL3A 3G30A 3UN7A 3IXDA 4EBPA 5FAPA 1SDNA 2FFFB 3BFEA 1KGFA 3PBNA 4KZAA 1SHVA 1E25A 3NBLA 1PWGA 3ZVWA 3HLBA 3VSLA 1HZOA 3JYIA 4S2PA 4DDYA 3G2ZA 3UE0A 5FA7A 1ES4A 3DWKA 3IWIA 3UDIA 3GR2A 5M1AA 3ZVTA 1PW8A 2DRWA 2VGJA 4X69A 5E2FA 1H5XA 4ZJ3A 1U60A 4JLFA 2QPNA 2G2UA 2P74A 2WAEA 1ALQA 1HTZA 3GRJA 1MPLA 3IQAA 5HFOA 3VP4A 3FKWA 3IH8A 3ZHHA 4JF6A 5AQBA 3BLSA 3PAEA 1BUEA 4KZ8A 3WWXA 1HD8A 4KZ9A 3IF6B 2Y59A 1YLJA 5CERA 3QNCA 4S2MA 3ZG9B 4OLGA 2VGKA 1BT5A 4X68A 4LV2A 1K6RA 1K4FA 2WGIA 5DTKA 4DE3A 5CEDA 5GLBA 5KMWA 5A91A 4MBHA 3SH8A 1JWZA 1NY0A 1W79A 2EFUA 3MFDA 3RXXA 3UPOA 1KE3A 1CI8A 4U0XA 1E3UA 1L2SA 2Y2OA 3G4PA 4MBFA 1EI5A 4BD1A 4PM5A 4OP8A 5EUAA 5EVIB 4FH2A 4RVAA 1BSGA 4E6XA 1VQQA 2ZMAA 3HBRA 4KZ3A 2CC1A 3WS4A 1ONGA 2Q9NA 1TVFA 1W8QA 2J8YA 1QMEA 3SH9A 5A93A 4U0TA 4X55A 4JBFA 5FI2A 5FASA 1LL9A 4BQMA 3C4PA 4S2JA 3BRMA 3V3RA 3M6BA 3N8SA 5E2HA 3S1YA 1H8ZA 3ISGA 3ZCZA 3NI9A 4E6WA 4IEDA 5F1GA 5EPHA 1K4EA 5F82A 3EQVA 5FQKA 3PBTA 2H0TA 4JXVA 1NXYA 1K55C 3NDEA 1W8YA 1YMSA 3HLCA 4S2LA 1GHMA 1JVJA 4BL2A 3PTEA 3IXGA 2IWCA 4S2NA 5F1FA 5KZHA 3BFGA 1K6SA 1Q2PA 2DNSA 4QU3A 4N9LA 2BG1A 4YFMA 4QY6A 3GTCA 1W7FA 3LY3A 4ZJ1A 3V50A 4Y0OA 1J9MA 1PWCA 3AGEA 5CGSA 4GZBA 1G68A 2XDMA 4GDNA 5CTNA 3NCKA 1BLSA 1TEMA 5DTTA 4N1XA 1XA7A 1KVMA 4GN2A 4KENB 2H5SA 3HUMA 4ZBEA 2I72A 4OOMA 1GHIA 4N1HA 3OPLA 5CXWA 1YQSA 2ZM0A 2P9VA 4RX3A 4X53A 4WZ5A 3DTMA 1O07A 2QZ6A 4QHCA 1RGYA 1CEFA 1IYSA 4YINA 3MKEA 1XPBA 2X02A 4N92A 1RGZA 4O7DA 3ZG0A 3Q81A 4EBNA 3AGDA 2OLVA 3ZNTA 3LO7A 3FWLA 3MXRA 1LL5A 1CI9A 4IBXA 3VP3A 3O3VA 2IWDA 2HDRA 3ZG8B 4NK3A 1XGIA 2QMIA 3HLDA 5L2FA 3ITBA 3HUOA 4GD8A 4DRTA 2H10A 1JTGA 3CG5A 5EOEA 5EVIC 5HAQA 4KG2A 4S2IA 4XUZA 1IELA 4KZBA 4QD4A 2HP6A 3I7JA 3Q7VA 3IXBA 4LCMA 4MBKA 4EV4A 2EX9A 1WYCA 1XGJA 3G35A 2V2FF 1QMFA 4S2NC 3N7WA 1ZG4A 1BTLA 4MEZA 3CZDA 2XK1A 5CGXA 3W4OA 1IEMA 4ZJ2A 4DE1A 3ZG7B 1YLTA 3O88A 2Y91A 3ITAA 2OSUA 1CEGA 3WS2A 1SKFA 3HREA 4Q8IA 3MZEA 3MZFA 4QJGA 2ZC6B 5A90A 2WUQA 2ZC5B 1JWPA 4R1GA 3W4PA 2HDQA 2PU4A 4X6TA 1KGEA 5HAPA 1LHYA 3NC8A 4KZ7A 1C3BA 4OQIA 5AQ9A 2PBYA 4IVKA 3SS4A 2A49A 4WZ5C 5M19A 1K55A 4OOLA 1FCMA 1FR6A 2Y2IA 4B4XA 1IYOA 2WYXA 5HAIA 5HL1A 1M6KA 1KE4A 1ESUA 1O7EA 2Y2GA 4WYYA 4EWFA 3RXWA 2XD5A 4LV1A 1YLPA 3HLGA 2RCXA 1E3UD 3N6IA 4RX2A 4KZ4A 3D4FA 1XKZA 3AGFA 4GD6A 5FQMA 1E4DA 4OQHA 3NIAA 1I2SA 2JBFA 4KQOA 2DCFA 5EVLA 4WZ4A 1IKIA 3HLWA 3VP1A 4OP5A 5AQ7A 2Y2KA 2XD1A 2OV5A 4ZDXA 3OPHA 3PBOA 3OCLA 4OOYA 4Y0UA 5CECA 5CGWA 2ZC7A 4OPQA 3EQUA 2ZM8A 3IH9A 1TDLA 4XXRA 4OPZA 5I94A 1PW1A 3Q82A 3IF6A 5DF8A 2ZC4B 5FQ9A 3UPNA 1YMXA 3HL9A 4ZAMA 1FCOA 5CRFA 1SDEA 2WKHA 1JTDA 1MBLA 3ZDJA 1FSWA 1NYYA 2PU2A 2Y2HA 3FZCA 4LCLA 5EVID 3RJUA 4P87A 3TSGA 4WEKA 3B3XA 1PI5A 4ID4A 2G2WA 1KGGA 2Y4AA 4KQRA 1GCEA 1NZOA 3BYDA 5GHXA 1DJBA 4CPKA 1NZUA 1LLBA 5EVIA 4XUXA 1L0FA 4JXWA 4KG5A 5DVAA 1BLHA 1MKIA 2Y2PA 2X71A 4IVIA 4UA9A 3UDFA 1HVBA 4JXSA 2J7VA 3FKVA 2HPBA 3CJMA 1PI4A 4PM6A 5CHUA 3SOIA 4LV3A 3GMWA 3NY4A 4FSFA 2XLNA 4QB8A 3MKFA 1ES5A 1FR1A 3E2KA 1MWUA 2EX2A 5EE8A 1ZG6A 3BLMA 1RP5A 4R4RA 5HARA 3IHAA 1ONHA 4FCFA 3GSGA 3IWQA 4E3KA 4RA7A 3CMZA 4KZ5A 1DJAA 1XA1A 5GLDA 2ZJ9A 3W8KA 3SS5A 3M2KA 3GV9A 2EXBA 1YLWA 4OH0A 2WK0A 2XH9A 5CHMA 5CTMA 5DF9A 3ZG5A 4JKTA 5KSHA 1GHPA 1LI9A 3IF6C 4P6BA 3PBSA 1G6AA 4K0WA 5A92A 5AQAA 1K38A 2EX8A 4BL3A 4DKIA 1WYBA 3MXSA 2C5WB 4PM7A 2Y2LA 3OZHA 2J9PA 1FCNA 1NJ4A 2C6WB 3DW0A 3VOZA 4R3JA 5DTSA 3WRTA 3V5MA 1L0DA 1BULA 1Q2QA 1TDGA 4OQ0A 4C3QA 4UAAA 3OCNA 4FD8A 4EUZA 4Y0TA 1MWSA 4S2OA 4C75A 2WGWB 2X01A 1IYPA 1Z6FA 3PBRA 1ERMA 1ERQA 1MWTA 4GB7A 4OONA 2V20A 3Q07A 1KDWA 4Z9QA 5GLCA 3LEZA 4EBLA 5JYPA 3IWOA 1ES2A 2B5RA 3BEBA 4R0QA 2GDNA 2JC7A 4KQQA 4E3JA 1DY6A 2WKIA 4C6YA 4GNUA 4DXCA 4E3LA 3BFFA 3NDGA 4B88A 2J9OA 3UE3A 4RYEA 4HBTA 5JYOA 1K56D 3G2YA 4K91A 3UY6A 5DF7A 4FH4A 3VOYA 3BFCA 3O86A 1ESIA 3C7UA 3LCEA 2IWBA 1YLZA 3HLFA 3VP0A 2XFSA 4E3IA 5HW3A 3N4IA 1XXMA 1K56A 2JCHA 3UPPA 5TR7A 4WMCA 5EOOA 5TFQA 5TGFA 4KZ6A 1GA0A 3E2LA 5FAOA 3PBQA 5FQIA 5G18A 2H0YA 3PAGA 4PPRA 4WELA 4A5RA 2BLSA 2XQZA 3OC2A 4OPYA 3P09A 3IT9A 2EXAA 1M40A 2Z2MB 4OKPA 2Z2LB 3W4QA 5HX9A 2ZLYA 4HEFA 4ZTKA 2EFXA 3WRZA 2R9WA 4K0XA 1K57A 3FYZA 1MXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LY4 A;  4WBG A;  3WS1 A;  4DE0 A;  4WEJ A;  1SCW A;  3A3I A;  3A3E A;  4JF4 A;  3HLE A;  1FQG A;  2FFY A;  2HP9 A;  5FSR A;  4EQI A;  1BLP A;  2WAF A;  4HES A;  3IXH A;  4JF5 A;  1VM1 A;  3UO9 A;  2R9X A;  1K54 A;  3HUN A;  3MBZ A;  4S2K A;  3GQZ A;  4R4S A;  1N9B A;  5IHV A;  3VFF A;  5E2E A;  5F83 A;  4DF6 A;  4U3T A;  4UA6 A;  4Y7P A;  1RCJ A;  3N8R A;  3VMA A;  1NRF A;  3GVB A;  4H8R A;  5D3O A;  1YLY A;  4D2O A;  1N4O A;  3HVF A;  3P98 A;  3QNB A;  2E8I A;  2Y2M A;  4OPR A;  1KE0 A;  4PM9 A;  3QHY A;  3BFD A;  4B4Z A;  2HDU A;  3UE1 A;  4WM9 A;  1ES3 A;  1I5Q A;  4MLL A;  4P0M A;  4CJN A;  1MWR A;  2WZX A;  1GA9 A;  4GDB A;  1PZO A;  1YT4 A;  3S4X A;  3ZGA B;  3SS3 A;  2Y55 A;  5GHY A;  4BLM A;  3C4O A;  1LI0 A;  1DJC A;  1OME A;  2Y2N A;  2ZQ9 A;  4DXB A;  5CEB A;  1FSY A;  1EWZ A;  3M2J A;  1MY8 A;  5J8X A;  1IYQ A;  2WGV A;  2Y2Q A;  4JPM A;  5E43 A;  3S22 A;  3ZNY A;  3WS5 A;  1XP4 A;  1K25 A;  5FQQ A;  3G32 A;  4E3N A;  2XR0 A;  3C5A A;  1K57 C;  1NYM A;  1WE4 A;  1YM1 A;  3IHB A;  4X56 A;  4OQG A;  4R3B A;  1L0G A;  1IKG A;  4LV0 A;  5FAT A;  5U47 A;  4DE2 A;  5M18 A;  1AXB A;  1S6R A;  3VFH A;  2Q9M A;  4N9K A;  1PWD A;  3VP2 A;  1BZA A;  2WKE A;  5CHJ A;  3WS0 A;  1I2W A;  3SH7 A;  4P85 A;  2ZC3 B;  3A3F A;  2WZZ A;  1PIO A;  3O87 A;  1K54 C;  2P9V B;  5FDH A;  2HDS A;  4OLD A;  2ZQD A;  4JXG A;  3N8L A;  4MNR A;  1JWV A;  5KSC A;  3UNW A;  5BOH A;  5EEC A;  2UWX A;  1CK3 A;  2V1Z A;  3BEC A;  4NET A;  3DWZ A;  3UDX A;  4BD0 A;  3V3S A;  4BEN A;  4UA7 A;  2A3U A;  2ZD8 A;  2XEP A;  4M3K A;  2EX6 A;  1ERO A;  4L0L A;  1ZKJ A;  4DDS A;  4F94 A;  2WAD A;  1Y54 A;  4PM8 A;  3Q1F A;  4QY5 A;  3OPP A;  4R23 A;  4E3O A;  2ZQ7 A;  1XX2 A;  1PZP A;  2XF3 A;  3BM6 A;  3Q7V B;  4KG6 A;  3C7V A;  1H8Y A;  2ZQ8 A;  3A3J A;  3M6H A;  3Q7Z A;  3ZFZ A;  2XGN A;  4E3M A;  5FAQ A;  3IF5 A;  3TOI A;  1PYY A;  3A3D A;  3V39 A;  4HBU A;  1BLC A;  5GLA A;  1KDS A;  5FQJ A;  2XFT A;  1W5D A;  3G34 A;  4OVD A;  4PMA A;  3MZD A;  5GL9 A;  1S0W A;  4BJP A;  5GHZ A;  2ZQA A;  2Y2J A;  4GOG A;  5E2G A;  4LEN A;  5FI7 A;  3VSK A;  2JE5 A;  2OLU A;  2ZM2 A;  1KVL A;  3OPR A;  1L0E A;  5FI6 A;  4GKU A;  2HP5 A;  1FOF A;  3FV7 A;  4WMC D;  4IBR A;  2WGW A;  4UHU A;  3TG9 A;  1ZC2 A;  2ZQC A;  3G31 A;  2RL3 A;  3G30 A;  3UN7 A;  3IXD A;  4EBP A;  5FAP A;  1SDN A;  2FFF B;  3BFE A;  1KGF A;  3PBN A;  4KZA A;  1SHV A;  1E25 A;  3NBL A;  1PWG A;  3ZVW A;  3HLB A;  3VSL A;  1HZO A;  3JYI A;  4S2P A;  4DDY A;  3G2Z A;  3UE0 A;  5FA7 A;  1ES4 A;  3DWK A;  3IWI A;  3UDI A;  3GR2 A;  5M1A A;  3ZVT A;  1PW8 A;  2DRW A;  2VGJ A;  4X69 A;  5E2F A;  1H5X A;  4ZJ3 A;  1U60 A;  4JLF A;  2QPN A;  2G2U A;  2P74 A;  2WAE A;  1ALQ A;  1HTZ A;  3GRJ A;  1MPL A;  3IQA A;  5HFO A;  3VP4 A;  3FKW A;  3IH8 A;  3ZHH A;  4JF6 A;  5AQB A;  3BLS A;  3PAE A;  1BUE A;  4KZ8 A;  3WWX A;  1HD8 A;  4KZ9 A;  3IF6 B;  2Y59 A;  1YLJ A;  5CER A;  3QNC A;  4S2M A;  3ZG9 B;  4OLG A;  2VGK A;  1BT5 A;  4X68 A;  4LV2 A;  1K6R A;  1K4F A;  2WGI A;  5DTK A;  4DE3 A;  5CED A;  5GLB A;  5KMW A;  5A91 A;  4MBH A;  3SH8 A;  1JWZ A;  1NY0 A;  1W79 A;  2EFU A;  3MFD A;  3RXX A;  3UPO A;  1KE3 A;  1CI8 A;  4U0X A;  1E3U A;  1L2S A;  2Y2O A;  3G4P A;  4MBF A;  1EI5 A;  4BD1 A;  4PM5 A;  4OP8 A;  5EUA A;  5EVI B;  4FH2 A;  4RVA A;  1BSG A;  4E6X A;  1VQQ A;  2ZMA A;  3HBR A;  4KZ3 A;  2CC1 A;  3WS4 A;  1ONG A;  2Q9N A;  1TVF A;  1W8Q A;  2J8Y A;  1QME A;  3SH9 A;  5A93 A;  4U0T A;  4X55 A;  4JBF A;  5FI2 A;  5FAS A;  1LL9 A;  4BQM A;  3C4P A;  4S2J A;  3BRM A;  3V3R A;  3M6B A;  3N8S A;  5E2H A;  3S1Y A;  1H8Z A;  3ISG A;  3ZCZ A;  3NI9 A;  4E6W A;  4IED A;  5F1G A;  5EPH A;  1K4E A;  5F82 A;  3EQV A;  5FQK A;  3PBT A;  2H0T A;  4JXV A;  1NXY A;  1K55 C;  3NDE A;  1W8Y A;  1YMS A;  3HLC A;  4S2L A;  1GHM A;  1JVJ A;  4BL2 A;  3PTE A;  3IXG A;  2IWC A;  4S2N A;  5F1F A;  5KZH A;  3BFG A;  1K6S A;  1Q2P A;  2DNS A;  4QU3 A;  4N9L A;  2BG1 A;  4YFM A;  4QY6 A;  3GTC A;  1W7F A;  3LY3 A;  4ZJ1 A;  3V50 A;  4Y0O A;  1J9M A;  1PWC A;  3AGE A;  5CGS A;  4GZB A;  1G68 A;  2XDM A;  4GDN A;  5CTN A;  3NCK A;  1BLS A;  1TEM A;  5DTT A;  4N1X A;  1XA7 A;  1KVM A;  4GN2 A;  4KEN B;  2H5S A;  3HUM A;  4ZBE A;  2I72 A;  4OOM A;  1GHI A;  4N1H A;  3OPL A;  5CXW A;  1YQS A;  2ZM0 A;  2P9V A;  4RX3 A;  4X53 A;  4WZ5 A;  3DTM A;  1O07 A;  2QZ6 A;  4QHC A;  1RGY A;  1CEF A;  1IYS A;  4YIN A;  3MKE A;  1XPB A;  2X02 A;  4N92 A;  1RGZ A;  4O7D A;  3ZG0 A;  3Q81 A;  4EBN A;  3AGD A;  2OLV A;  3ZNT A;  3LO7 A;  3FWL A;  3MXR A;  1LL5 A;  1CI9 A;  4IBX A;  3VP3 A;  3O3V A;  2IWD A;  2HDR A;  3ZG8 B;  4NK3 A;  1XGI A;  2QMI A;  3HLD A;  5L2F A;  3ITB A;  3HUO A;  4GD8 A;  4DRT A;  2H10 A;  1JTG A;  3CG5 A;  5EOE A;  5EVI C;  5HAQ A;  4KG2 A;  4S2I A;  4XUZ A;  1IEL A;  4KZB A;  4QD4 A;  2HP6 A;  3I7J A;  3Q7V A;  3IXB A;  4LCM A;  4MBK A;  4EV4 A;  2EX9 A;  1WYC A;  1XGJ A;  3G35 A;  2V2F F;  1QMF A;  4S2N C;  3N7W A;  1ZG4 A;  1BTL A;  4MEZ A;  3CZD A;  2XK1 A;  5CGX A;  3W4O A;  1IEM A;  4ZJ2 A;  4DE1 A;  3ZG7 B;  1YLT A;  3O88 A;  2Y91 A;  3ITA A;  2OSU A;  1CEG A;  3WS2 A;  1SKF A;  3HRE A;  4Q8I A;  3MZE A;  3MZF A;  4QJG A;  2ZC6 B;  5A90 A;  2WUQ A;  2ZC5 B;  1JWP A;  4R1G A;  3W4P A;  2HDQ A;  2PU4 A;  4X6T A;  1KGE A;  5HAP A;  1LHY A;  3NC8 A;  4KZ7 A;  1C3B A;  4OQI A;  5AQ9 A;  2PBY A;  4IVK A;  3SS4 A;  2A49 A;  4WZ5 C;  5M19 A;  1K55 A;  4OOL A;  1FCM A;  1FR6 A;  2Y2I A;  4B4X A;  1IYO A;  2WYX A;  5HAI A;  5HL1 A;  1M6K A;  1KE4 A;  1ESU A;  1O7E A;  2Y2G A;  4WYY A;  4EWF A;  3RXW A;  2XD5 A;  4LV1 A;  1YLP A;  3HLG A;  2RCX A;  1E3U D;  3N6I A;  4RX2 A;  4KZ4 A;  3D4F A;  1XKZ A;  3AGF A;  4GD6 A;  5FQM A;  1E4D A;  4OQH A;  3NIA A;  1I2S A;  2JBF A;  4KQO A;  2DCF A;  5EVL A;  4WZ4 A;  1IKI A;  3HLW A;  3VP1 A;  4OP5 A;  5AQ7 A;  2Y2K A;  2XD1 A;  2OV5 A;  4ZDX A;  3OPH A;  3PBO A;  3OCL A;  4OOY A;  4Y0U A;  5CEC A;  5CGW A;  2ZC7 A;  4OPQ A;  3EQU A;  2ZM8 A;  3IH9 A;  1TDL A;  4XXR A;  4OPZ A;  5I94 A;  1PW1 A;  3Q82 A;  3IF6 A;  5DF8 A;  2ZC4 B;  5FQ9 A;  3UPN A;  1YMX A;  3HL9 A;  4ZAM A;  1FCO A;  5CRF A;  1SDE A;  2WKH A;  1JTD A;  1MBL A;  3ZDJ A;  1FSW A;  1NYY A;  2PU2 A;  2Y2H A;  3FZC A;  4LCL A;  5EVI D;  3RJU A;  4P87 A;  3TSG A;  4WEK A;  3B3X A;  1PI5 A;  4ID4 A;  2G2W A;  1KGG A;  2Y4A A;  4KQR A;  1GCE A;  1NZO A;  3BYD A;  5GHX A;  1DJB A;  4CPK A;  1NZU A;  1LLB A;  5EVI A;  4XUX A;  1L0F A;  4JXW A;  4KG5 A;  5DVA A;  1BLH A;  1MKI A;  2Y2P A;  2X71 A;  4IVI A;  4UA9 A;  3UDF A;  1HVB A;  4JXS A;  2J7V A;  3FKV A;  2HPB A;  3CJM A;  1PI4 A;  4PM6 A;  5CHU A;  3SOI A;  4LV3 A;  3GMW A;  3NY4 A;  4FSF A;  2XLN A;  4QB8 A;  3MKF A;  1ES5 A;  1FR1 A;  3E2K A;  1MWU A;  2EX2 A;  5EE8 A;  1ZG6 A;  3BLM A;  1RP5 A;  4R4R A;  5HAR A;  3IHA A;  1ONH A;  4FCF A;  3GSG A;  3IWQ A;  4E3K A;  4RA7 A;  3CMZ A;  4KZ5 A;  1DJA A;  1XA1 A;  5GLD A;  2ZJ9 A;  3W8K A;  3SS5 A;  3M2K A;  3GV9 A;  2EXB A;  1YLW A;  4OH0 A;  2WK0 A;  2XH9 A;  5CHM A;  5CTM A;  5DF9 A;  3ZG5 A;  4JKT A;  5KSH A;  1GHP A;  1LI9 A;  3IF6 C;  4P6B A;  3PBS A;  1G6A A;  4K0W A;  5A92 A;  5AQA A;  1K38 A;  2EX8 A;  4BL3 A;  4DKI A;  1WYB A;  3MXS A;  2C5W B;  4PM7 A;  2Y2L A;  3OZH A;  2J9P A;  1FCN A;  1NJ4 A;  2C6W B;  3DW0 A;  3VOZ A;  4R3J A;  5DTS A;  3WRT A;  3V5M A;  1L0D A;  1BUL A;  1Q2Q A;  1TDG A;  4OQ0 A;  4C3Q A;  4UAA A;  3OCN A;  4FD8 A;  4EUZ A;  4Y0T A;  1MWS A;  4S2O A;  4C75 A;  2WGW B;  2X01 A;  1IYP A;  1Z6F A;  3PBR A;  1ERM A;  1ERQ A;  1MWT A;  4GB7 A;  4OON A;  2V20 A;  3Q07 A;  1KDW A;  4Z9Q A;  5GLC A;  3LEZ A;  4EBL A;  5JYP A;  3IWO A;  1ES2 A;  2B5R A;  3BEB A;  4R0Q A;  2GDN A;  2JC7 A;  4KQQ A;  4E3J A;  1DY6 A;  2WKI A;  4C6Y A;  4GNU A;  4DXC A;  4E3L A;  3BFF A;  3NDG A;  4B88 A;  2J9O A;  3UE3 A;  4RYE A;  4HBT A;  5JYO A;  1K56 D;  3G2Y A;  4K91 A;  3UY6 A;  5DF7 A;  4FH4 A;  3VOY A;  3BFC A;  3O86 A;  1ESI A;  3C7U A;  3LCE A;  2IWB A;  1YLZ A;  3HLF A;  3VP0 A;  2XFS A;  4E3I A;  5HW3 A;  3N4I A;  1XXM A;  1K56 A;  2JCH A;  3UPP A;  5TR7 A;  4WMC A;  5EOO A;  5TFQ A;  5TGF A;  4KZ6 A;  1GA0 A;  3E2L A;  5FAO A;  3PBQ A;  5FQI A;  5G18 A;  2H0Y A;  3PAG A;  4PPR A;  4WEL A;  4A5R A;  2BLS A;  2XQZ A;  3OC2 A;  4OPY A;  3P09 A;  3IT9 A;  2EXA A;  1M40 A;  2Z2M B;  4OKP A;  2Z2L B;  3W4Q A;  5HX9 A;  2ZLY A;  4HEF A;  4ZTK A;  2EFX A;  3WRZ A;  2R9W A;  4K0X A;  1K57 A;  3FYZ A;  1MXO A; 
#chains in the Genus database with same CATH topology
 3LY4 A;  3WS1 A;  4WEJ A;  1SCW A;  1ZTU A;  4JF4 A;  2ZMV A;  3IS2 B;  1BLP A;  2VJW A;  4HES A;  4JF5 A;  1VM1 A;  3CPT A;  3GEC A;  4LRX C;  3T1Q B;  1VEU B;  4I3A A;  5IHV A;  3VFF A;  5F83 A;  4U3T A;  4Y7P A;  3N8R A;  3G6O A;  3GVB A;  5D3O A;  1CJF A;  3HVF A;  3UE1 A;  3IBR A;  1I5Q A;  1OTB A;  1NWZ A;  3ZGA B;  2BTF P;  1LL8 A;  3U2A A;  4BLM A;  3C4O A;  1XJ6 A;  5FQQ A;  2XR0 A;  1K57 C;  1NYM A;  3TJZ C;  4X56 A;  5M18 A;  5FAT A;  4LV0 A;  3VFH A;  2Q9M A;  3VP2 A;  2WKE A;  5CHJ A;  3WS0 A;  2WZZ A;  1PIO A;  5HDD A;  4OLD A;  3S7N A;  4MNR A;  5A8B A;  5FEF A;  5BOH A;  2ZOH A;  2UWX A;  3NEC A;  2A2L A;  3S7Q A;  4BD0 A;  4BEN A;  5MC7 A;  2ZD8 A;  3UB7 A;  4DDS A;  2WAD A;  5AVE A;  4R23 A;  2ZBB A;  1YKD A;  5DJU A;  1PZP A;  4KG6 A;  2ZQ8 A;  3ZFZ A;  5HD5 A;  4CLC C;  3TOI A;  4HBU A;  5GLA A;  5HDS A;  3MZD A;  2KOI A;  4GOG A;  5E2G A;  2ZM2 A;  5FI6 A;  1VET B;  1FOF A;  2HGV A;  4WMC D;  4UHU A;  1KOU A;  2EA9 A;  5F69 A;  4HNB A;  1IFQ A;  2FFF B;  3BFE A;  4KZA A;  2ZOI A;  1SHV A;  3NBL A;  1HZO A;  4S2P A;  3UE0 A;  1ES4 A;  2IA2 A;  3UDI A;  3GR2 A;  3ZVT A;  1PW8 A;  2DRW A;  1TS8 A;  2VGJ A;  4X69 A;  1U60 A;  2QPN A;  1F5M A;  2P74 A;  5HWW A;  1ALQ A;  5HFO A;  1MPL A;  3UB8 A;  1MZU A;  2YKH A;  3IH8 A;  4JF6 A;  5AQB A;  1BUE A;  3WWX A;  2PDR A;  3S7O A;  2VGK A;  4X68 A;  5DTK A;  4GHI B;  1K6R A;  5GLB A;  2K7S A;  4MBH A;  3SH8 A;  3DTK A;  1NY0 A;  3MFD A;  1W79 A;  2HV1 A;  3RXX A;  4U0X A;  2Y2O A;  3IS2 A;  4CLC D;  5EUA A;  5EVI B;  2ZMA A;  1VEU A;  4KZ3 A;  2CC1 A;  4E04 A;  5FAS A;  4UQI M;  3ISG A;  2GNX A;  4IED A;  3BJN A;  5F1G A;  5F82 A;  3K3C A;  5EFW A;  5FQK A;  3CIT A;  3PBT A;  2WKR A;  1W8Y A;  3UB5 P;  4S2N A;  2VGL M;  3FG8 A;  5K5B A;  2V1A A;  1OPX A;  2VV6 A;  3QP1 A;  4QY6 A;  3GTC A;  4ZJ1 A;  5CGS A;  2XDM A;  5CTN A;  2W3E A;  4CQH A;  5DTT A;  1XA7 A;  4KEN B;  4HQA A;  5DKK A;  3HUM A;  2ZM0 A;  3QP4 A;  4WZ5 A;  3DTM A;  1F98 A;  2QZ6 A;  3IBJ A;  1N9L A;  1RGZ A;  2XA7 S;  3MXR A;  1OTA A;  1CI9 A;  3VP3 A;  3O3V A;  4WLA A;  3BW6 A;  1NLZ A;  2QJ5 A;  4BBU A;  1XGI A;  3MXQ A;  3HLD A;  5L2F A;  4GD8 A;  5HAQ A;  1Z09 A;  4XUZ A;  1IEL A;  3I7J A;  4MBK A;  4EV4 A;  4S2N C;  3NOP C;  3MQO A;  2BAS A;  3CZD A;  4HOI A;  5CX7 A;  5DFX A;  4ZJ2 A;  3ZG7 B;  2Y91 A;  4Q8I A;  4I3I A;  3MZF A;  2ZC6 B;  5A90 A;  2WUQ A;  5C5K A;  1JWP A;  4X6T A;  1VET A;  4KZ7 A;  1S67 L;  3IX3 A;  4WZ5 C;  4OOL A;  2K2N A;  1M6K A;  1O7E A;  2Y2G A;  2VEA A;  4WYY A;  4F3L B;  1YLP A;  2RCX A;  3N6I A;  1K0K A;  5J4E A;  5FQM A;  2PAV P;  1E4D A;  1I2S A;  4WZ4 A;  3HLW A;  3VP1 A;  4OP5 A;  2Y2K A;  1MKM A;  2OV5 A;  1VHM A;  3OPH A;  4ZDX A;  3E98 A;  3A0R A;  3EQU A;  1PW1 A;  2PRF A;  3KSF A;  1LSV A;  5HPF A;  5F68 A;  4BWI A;  5CRF A;  1SDE A;  2WKH A;  5HDC A;  4GHI A;  1MBL A;  3MQQ A;  2PU2 A;  4LCL A;  3UME A;  3FPV A;  2VA0 A;  3TSG A;  3BY8 A;  4WEK A;  3B3X A;  4LRZ E;  2P04 A;  4ID4 A;  1OTD A;  1LLB A;  5EVI A;  2QJ7 A;  4JXW A;  4IVI A;  2Y2P A;  2X71 A;  3SZT A;  4JXS A;  2J7V A;  1T18 A;  1PI4 A;  3GMW A;  1S1Y A;  4DJ3 A;  4YOF A;  3MR0 A;  1MC0 A;  4LFU A;  3E2K A;  2CMN A;  1ZG6 A;  3BLM A;  4NXG A;  4B9O A;  1RP5 A;  3C8C A;  4R4R A;  4JGR A;  2PR5 A;  4FCF A;  3GSG A;  5AVF A;  2EWV A;  3F1P A;  3KYQ A;  2V8C A;  3RH8 B;  4Y3I A;  2EXB A;  2XH9 A;  1GHP A;  4K0W A;  4BL3 A;  2C5W B;  1G6O A;  1NJ4 A;  3VOZ A;  4R3J A;  3OBF A;  2G7U A;  2AVX A;  1Q2Q A;  5DKL A;  4Y0T A;  1UWP X;  1MWS A;  4S2O A;  2WGW B;  3PBR A;  2NUT C;  5GLC A;  2O9C A;  3BFF A;  1OT6 A;  2J9O A;  3UE3 A;  5J7E A;  1Y4O A;  3LIA A;  4FH4 A;  3BFC A;  3RTY A;  1ESI A;  4E3I A;  3HLF A;  1XXM A;  2JCH A;  5AJG A;  3E4Q A;  5TR7 A;  5TGF A;  3JVU A;  5L09 A;  4A5R A;  3PAG A;  2BLS A;  2XQZ A;  3OC2 A;  4OPY A;  3IT9 A;  1M40 A;  4R6L A;  4L9G A;  5HX9 A;  2M7V A;  4HEF A;  4JGO A;  2VKS A;  4WBG A;  4DE0 A;  2XA7 M;  3A3I A;  3HLE A;  2HP9 A;  5FSR A;  4IJG A;  2O99 A;  3HUN A;  1NRJ A;  4YNR A;  1N9B A;  4MN6 A;  4Q0I A;  4CLC B;  4F3L A;  1RCJ A;  4Q0H A;  1G28 A;  3LUQ A;  4D2O A;  2E8I A;  2Y2M A;  1KE0 A;  3LR5 A;  4PM9 A;  3QHY A;  3BFD A;  2HDU A;  2W3F A;  5HL6 A;  1GA9 A;  4GDB A;  3S4X A;  4MMN A;  5GHY A;  5HSQ A;  1DJC A;  1IOU A;  1FSY A;  1EWZ A;  5F6A A;  5J8X A;  1IYQ A;  2Y2Q A;  4JPM A;  3WS5 A;  3NOT C;  1X0O A;  4E3N A;  1F2K A;  3C5A A;  3IHB A;  2HF6 A;  1WE4 A;  4DE2 A;  5HD3 A;  3VOL A;  1S6R A;  1BZA A;  4MCW A;  3SH7 A;  2ZC3 B;  3A3F A;  3C30 A;  2ZQD A;  3N8L A;  3EWK A;  5KSC A;  1CK3 A;  3JVV A;  4NET A;  3V3S A;  1OT9 A;  4KUO A;  2XEP A;  1ZKJ A;  2V0W A;  4F94 A;  3Q1F A;  4QY5 A;  1TD5 A;  2ZQ7 A;  1H8M A;  3Q7V B;  1H8Y A;  3A3J A;  3M6H A;  3LR3 A;  3E4O A;  3LID A;  1D1J A;  3H82 B;  5J3W A;  2OAP 1;  3K2N A;  2YKF A;  2VLG A;  4G3V A;  3PYP A;  5FQJ A;  1W5D A;  4PMA A;  1D06 A;  2H28 A;  2ZQA A;  3IX8 A;  3VSK A;  2JE5 A;  2OLU A;  3OPR A;  3ICY A;  4IBR A;  2WGW A;  4HH3 A;  2ZQC A;  2RL3 A;  3IXD A;  4EBP A;  5FAP A;  3CLO A;  5IS1 A;  1SDN A;  1HLU P;  3PBN A;  1PWG A;  3HLB A;  4P6Z S;  2ZMF A;  3G2Z A;  3LI8 A;  2LB5 A;  5M1A A;  4JLF A;  3GRJ A;  3IQA A;  3VP4 A;  3ZHH A;  1WA9 A;  4I39 A;  3PAE A;  2V8F A;  4KZ9 A;  2OWH A;  3QNC A;  4HHD A;  4DE3 A;  5CED A;  3KSG A;  3UPO A;  1KE3 A;  1CI8 A;  3VE4 A;  1E3U A;  2KX6 A;  5L10 A;  1EI5 A;  1CQA A;  4OP8 A;  3LIE A;  1VQQ A;  1ONG A;  4EER A;  1W8Q A;  2J8Y A;  1QME A;  3SH9 A;  4CLC A;  5A93 A;  4U0T A;  5FI2 A;  3C4P A;  1LSW A;  3N8S A;  4E6W A;  1SKO B;  1H8Z A;  3S1Y A;  5EPH A;  1K4E A;  3EQV A;  1PNE A;  1OJ5 A;  1NXY A;  1K55 C;  3FC7 A;  1YMS A;  2OOL A;  4S2L A;  1JVJ A;  4BL2 A;  2JKR I;  4PKY G;  5F1F A;  3EGX C;  5KZH A;  3MFX A;  3AGE A;  3T4J A;  2J3W A;  4OOM A;  5CXW A;  3B33 A;  2OAQ 1;  1CEF A;  4YIN A;  3MKE A;  4NXF A;  4N92 A;  2X02 A;  4O7D A;  3T4O A;  3AGD A;  2OLV A;  4Z1W A;  4G3K A;  3ZNT A;  3LO7 A;  4EXO A;  2QHK A;  3QP8 A;  5EVE A;  4O01 A;  2IWD A;  3ZG8 B;  4NK3 A;  1JTG A;  4MN5 A;  3CG5 A;  5EOE A;  4KG2 A;  3T4S A;  2HP6 A;  3Q7V A;  2EX9 A;  4WF0 A;  3H82 A;  3N7W A;  1ZG4 A;  3T4Q A;  2UV0 E;  1S4S A;  4DE1 A;  4NG2 A;  3B47 A;  1CF0 A;  3UB6 A;  3WS2 A;  3DBA A;  4QJG A;  4GW9 A;  1XJ3 A;  1GSV A;  3HJK A;  4R1G A;  5TBM B;  2PU4 A;  5HAP A;  2J80 A;  3L7H A;  3NC8 A;  1C3B A;  3ZQ5 A;  2JKF A;  2PD8 A;  3SS4 A;  5M19 A;  1FR6 A;  1IYO A;  4K08 A;  1ESU A;  4LV1 A;  1E3U D;  4RX2 A;  4BBV A;  4BMW A;  4R70 A;  4KQO A;  4WL9 A;  4B93 A;  2O9A A;  5AQ7 A;  3PBO A;  3OCL A;  3UB9 A;  1T1C A;  5CGW A;  1H0M A;  5IU1 A;  4XXR A;  4OPZ A;  5DF8 A;  2V1B A;  3UPN A;  1ZHH B;  4O8G A;  1TF1 A;  3RJU A;  5TJJ A;  1PI5 A;  2Y4A A;  1GCE A;  1DJB A;  1NZU A;  4BBT A;  4P6Z M;  3P7N A;  4EW7 A;  1DP8 A;  2HPB A;  3CJM A;  4PM6 A;  5CHU A;  5EM0 A;  3OLO A;  4LV3 A;  4GJ4 A;  2XLN A;  1SKO A;  4HI4 A;  1ES5 A;  1T19 A;  1P9R A;  4GLQ A;  4NXB A;  1DP6 A;  1PFL A;  4RA7 A;  4HP9 A;  4KZ5 A;  1DJA A;  1XA1 A;  5GLD A;  3D3O A;  2HZ5 A;  3GV9 A;  5KSH A;  1LI9 A;  5AQA A;  2EX8 A;  3C38 A;  3MXS A;  4PM7 A;  2J9P A;  2C6W B;  3SW1 A;  5EM1 A;  3V5M A;  1BUL A;  1TDG A;  4C3Q A;  4UAA A;  3ZYT A;  4FD8 A;  3E4P A;  4C75 A;  2DMW A;  3KYZ A;  2MJ6 A;  1Z6F A;  1MWT A;  4GB7 A;  4OON A;  3Q07 A;  3F1N B;  1KDW A;  3H7W B;  5JYP A;  4EBL A;  2B5R A;  1XJ4 A;  3PR6 A;  2GDN A;  2JC7 A;  4KQQ A;  2VX8 A;  3TW8 A;  4E3J A;  2WKI A;  2O9B A;  4E3L A;  3KYE A;  3NDG A;  4B88 A;  4RYE A;  2M7U A;  3UY6 A;  4HIA A;  3VOY A;  3C7U A;  3VP0 A;  4IUK A;  5HW3 A;  2XFS A;  4PKY A;  4LGW A;  5EOO A;  3DTI A;  1GA0 A;  4KZ6 A;  5FQI A;  5G18 A;  2H0Y A;  4OKP A;  2Z2L B;  4Y15 A;  5LBR A;  4ZTK A;  2EFX A;  4K0X A;  5TBM A;  4O0P A;  3FYZ A;  4DMZ A;  1FQG A;  2FFY A;  4EUV A;  2WAF A;  3IXH A;  2O0Y A;  2R9X A;  1K54 A;  1S66 L;  3GQZ A;  5E2E A;  4DF6 A;  4UA6 A;  3VMA A;  1NRF A;  4H8R A;  3VE3 A;  3S7P A;  3U4L P;  3QNB A;  4EEP A;  4OPR A;  2KDK A;  3MQ0 A;  4B4Z A;  2B18 A;  4WM9 A;  4MLL A;  2WZX A;  1YT4 A;  3SS3 A;  2Y55 A;  1LI0 A;  2Y2N A;  5CEB A;  3M2J A;  1MY8 A;  3ZNY A;  1YM1 A;  1IKG A;  5U47 A;  1AXB A;  4N9K A;  1PWD A;  4NXE A;  2P08 A;  3O87 A;  1K54 C;  2P9V B;  3T4L A;  2HDS A;  2KLI A;  1JWV A;  2V1Z A;  3UDX A;  3DWZ A;  2A3U A;  4KUK A;  3T4K A;  2EX6 A;  2JKR M;  1ERO A;  4L0L A;  3OPP A;  1XX2 A;  5L07 A;  2XGN A;  4E3M A;  4Y13 A;  3IF5 A;  1PYY A;  3A3D A;  4GCZ A;  1BLC A;  2JKG A;  1KDS A;  4OVD A;  5GL9 A;  1S0W A;  2P7J A;  2Y2J A;  3ULF A;  5FI7 A;  4FUW A;  1L0E A;  2HP5 A;  3FV7 A;  3TG9 A;  3LEQ A;  5DJT A;  3G31 A;  3F1N A;  3H7W A;  1NLY A;  1FIL A;  3ZVW A;  3TE8 A;  3VSL A;  3JYI A;  4DJ2 A;  5FA7 A;  3T1S A;  1BYW A;  2A24 B;  3DWK A;  3IWI A;  5E2F A;  4HJ4 A;  2G2U A;  2J3T C;  2WAE A;  1HTZ A;  3BQ8 A;  3EGD C;  3B42 A;  4KZ8 A;  1HD8 A;  3IF6 B;  1TS7 A;  5CER A;  4S2M A;  4JGP A;  1YAX A;  4ETZ A;  4LV2 A;  5KMW A;  2WGI A;  1N9N A;  1JWZ A;  2EFU A;  3QP5 A;  1L2S A;  3G4P A;  4PM5 A;  4FH2 A;  4RVA A;  1BSG A;  4HP4 A;  2PD7 A;  4X55 A;  4JBF A;  3CAX A;  3T1X A;  1LL9 A;  1XFN A;  3LIB A;  3BRM A;  5E2H A;  3ZCZ A;  1FIK A;  2H0T A;  4LRY C;  3HLC A;  3IXG A;  2IWC A;  5IT5 A;  3BFG A;  1Q2P A;  2DNS A;  4QU3 A;  2BG1 A;  4QPR A;  1W7F A;  3LY3 A;  3V50 A;  2HJE A;  4Y0O A;  1PWC A;  4GDN A;  1BLS A;  1TEM A;  3T12 B;  2J3T D;  1KVM A;  4HJ3 A;  1GHI A;  4N1H A;  3OPL A;  1YPR A;  4IHQ A;  4RX3 A;  2P9V A;  1OJG A;  3QP6 A;  1RGY A;  4EET B;  1ACF A;  1IYS A;  3ZG0 A;  3FWL A;  1LL5 A;  4IBX A;  1P97 A;  2HDR A;  1UGU A;  3C2W A;  3HUO A;  2H10 A;  3F1O B;  2QKP A;  2VV7 A;  3LR0 A;  3LR4 A;  2XRN A;  4S2I A;  4KZB A;  4QD4 A;  4LCM A;  3EOI A;  4L9E A;  3RFB A;  1WYC A;  3UE6 A;  1ODV A;  2FH5 A;  1BTL A;  2W0N A;  5CGX A;  3W4O A;  1H3Q A;  1IEM A;  3LIC A;  1YLT A;  4ZRR A;  3FPW A;  2OSU A;  1CEG A;  2W1T B;  1PRQ A;  1SKF A;  3MZE A;  3BWL A;  2ZC5 B;  1LT0 A;  2HDQ A;  1KGE A;  1LHY A;  1W63 Q;  4OQI A;  4ME4 A;  5AQ9 A;  4IVK A;  2A49 A;  3CWF A;  1K55 A;  3VV4 A;  1FCM A;  2Y2I A;  5HAI A;  3T50 A;  3HLG A;  3GDI A;  2Z6D A;  2A24 A;  2JBF A;  5EVL A;  4FTX A;  5F5Y A;  5FEG A;  4OOY A;  4MDZ A;  1P0Z A;  2ZC7 A;  2V9A A;  2ZM8 A;  3IH9 A;  2B95 A;  5I94 A;  1S4R A;  3Q82 A;  4JGQ A;  3IF6 A;  1LSX A;  4ARZ B;  2ZC4 B;  5FQ9 A;  1YMX A;  3HL9 A;  4ZAM A;  1JNU A;  1FCO A;  3UMD A;  1JTD A;  3EEA A;  3EEH A;  2G2W A;  4KQR A;  1NZO A;  5GHX A;  3MF0 A;  3NOU C;  3CHW P;  4FOF A;  1BLH A;  4R38 A;  4UA9 A;  1HVB A;  3BQA A;  4AFI A;  3FKV A;  3R7W B;  1OTI A;  4FSF A;  2K31 A;  1FR1 A;  2LB9 A;  2EX2 A;  4H6J B;  5HAR A;  3IHA A;  1ONH A;  2EWW A;  3L9K A;  4E3K A;  3NHQ A;  3QP2 A;  2ZJ9 A;  2Y8H A;  2E8J A;  3SS5 A;  3M2K A;  4OH0 A;  1V9Y A;  2WK0 A;  3LYX A;  5CHM A;  4JKT A;  3IF6 C;  2JKT I;  1G6A A;  1P9W A;  1K38 A;  4DKI A;  5HZH A;  4EQ1 A;  3OZH A;  3DW0 A;  1L0D A;  4EUZ A;  2PYP A;  4HY8 A;  1ERM A;  1ERQ A;  2V20 A;  4Z9Q A;  2GJ3 A;  2W3G A;  3LEZ A;  2R78 A;  3IWO A;  5KIZ A;  1V9Z A;  2PHY A;  1TS6 A;  3DAV A;  4C6Y A;  2PR6 A;  3F1O A;  5JYO A;  1K56 D;  3G2Y A;  1XJ2 A;  3K3D A;  3LCE A;  2QYB A;  3N4I A;  3UPP A;  2FZ0 A;  3PBQ A;  2OWJ A;  2EXA A;  2W1T A;  4WN5 A;  2W1R A;  2ZLY A;  2HJ9 C;  3A3E A;  4EQI A;  2GX5 A;  3UO9 A;  3MBZ A;  4S2K A;  4I38 A;  4R4S A;  3E0Y A;  3W2Z A;  1SZV A;  4EU0 A;  5HWV A;  1T1B A;  1YLY A;  1N4O A;  3P98 A;  3MJQ A;  1ES3 A;  4P0M A;  4CJN A;  1MWR A;  1PZO A;  4DN0 A;  3KSH A;  2XSS A;  4ARZ A;  1OME A;  2ZQ9 A;  4DXB A;  4I3J A;  1EW0 A;  5E43 A;  2WGV A;  3S22 A;  1XP4 A;  1K25 A;  4NEE D;  3G32 A;  3KO6 A;  4ESP A;  4OQG A;  4R3B A;  1L0G A;  2ACG A;  4IUH A;  3MS6 A;  3F1P B;  4MN7 A;  1I2W A;  4P85 A;  2NUP C;  5FDH A;  4JXG A;  3LFV A;  1YSP A;  3R7W A;  3UNW A;  5EEC A;  3TRC A;  3BEC A;  5L8M A;  3D72 A;  3NJA A;  4HH2 A;  4UA7 A;  4H6J A;  4M3K A;  2M1C A;  2PYR A;  1Y54 A;  4PM8 A;  2Z6C A;  4E3O A;  2XF3 A;  3BM6 A;  3C7V A;  3Q7Z A;  4LLO B;  1Y28 A;  5FAQ A;  4D60 A;  3V39 A;  2Q0O A;  2XFT A;  2D02 A;  3G34 A;  4BJP A;  5GHZ A;  3CI6 A;  3NUL A;  4LEN A;  3BY9 A;  1J3W A;  1KVL A;  4GKU A;  3A0V A;  1ZC2 A;  1UWN X;  1S1Z A;  3G30 A;  5I5L A;  3UN7 A;  3H9W A;  1KGF A;  4CLC E;  2W3D A;  1E25 A;  1DP9 A;  5G4Z A;  4DDY A;  1XFQ A;  4XT2 B;  1H5X A;  4ZJ3 A;  2ZL1 B;  1STZ A;  3FKW A;  3BLS A;  1N9O A;  2Y59 A;  1YLJ A;  3T1R A;  4RQ9 A;  1GSX A;  2B02 A;  3ZG9 B;  4OLG A;  1BT5 A;  1K4F A;  5A91 A;  1VB6 A;  4MBF A;  4BD1 A;  2VV8 A;  4E6X A;  3HBR A;  3WS4 A;  2Q9N A;  1TVF A;  5HWT A;  2D01 A;  4BQM A;  4S2J A;  3V3R A;  3M6B A;  2VZW A;  3NI9 A;  2W3H A;  3OOV A;  4GS9 B;  3MSH A;  4JXV A;  3NDE A;  3PHY A;  1GHM A;  1G5U A;  4Y5F A;  2L1M A;  3PTE A;  1K6S A;  4UEY A;  4N9L A;  4YFM A;  4X1M A;  1D7E A;  4EEU A;  1J9M A;  4GZB A;  1G68 A;  3KSI A;  3NCK A;  4X1L A;  4N1X A;  4GN2 A;  1A0K A;  2H5S A;  4ZBE A;  2I72 A;  4Y2F A;  1YQS A;  4X53 A;  5EV0 A;  3HCY A;  1O07 A;  4QHC A;  2XRO A;  1XPB A;  3Q81 A;  4EBN A;  4M4X A;  2JHE A;  4EES A;  2QMI A;  2INW A;  3ITB A;  4DRT A;  2JKT M;  5DFY A;  5EVI C;  4WUJ A;  4I5S A;  5FL3 A;  3LI9 A;  2PT7 A;  3IXB A;  1XGJ A;  3G35 A;  1AWI A;  1QMF A;  2V2F F;  3CUE A;  4MEZ A;  2XK1 A;  3O88 A;  3ITA A;  3HRE A;  1OTE A;  2L0W A;  3W4P A;  3DTE A;  4QWO A;  3A0S A;  2PBY A;  4B4X A;  4YWZ A;  2WYX A;  3CPT B;  5HL1 A;  1KE4 A;  4EWF A;  3RXW A;  2XD5 A;  1T1A A;  4KZ4 A;  3D4F A;  3T4T A;  1XKZ A;  3AGF A;  4GD6 A;  2QWS A;  4XT2 A;  4OQH A;  3NIA A;  3JPU A;  2DCF A;  1IKI A;  2ZL1 A;  2XD1 A;  3PXP A;  3O5Y A;  4Y17 A;  4Y0U A;  5CEC A;  3CUE C;  4OPQ A;  4Q0J A;  1TDL A;  4KQD A;  4NKP A;  5HPI A;  3ZDJ A;  1FSW A;  1NYY A;  2Y2H A;  3FZC A;  5EVI D;  4P87 A;  1L3L A;  4L9F A;  3IX4 A;  1KGG A;  3BYD A;  4CPK A;  4XUX A;  1L0F A;  4KG5 A;  2W27 A;  3KX0 X;  5DVA A;  1MKI A;  4X25 A;  3UDF A;  1YSQ A;  4PHT A;  2WKP A;  2V0U A;  3SOI A;  3NY4 A;  3HJI A;  4QB8 A;  3MKF A;  1MWU A;  5EE8 A;  3LIF A;  4GS9 A;  3IWQ A;  3CMZ A;  4ETX A;  3W8K A;  1W63 M;  1DRM A;  5G4Y A;  1YLW A;  5CTM A;  5DF9 A;  3ZG5 A;  1F9I A;  2VK3 A;  3PBS A;  4P6B A;  2L4R A;  5A92 A;  2GZA A;  1WYB A;  2WKQ A;  2Y2L A;  1FCN A;  2Y79 A;  5DTS A;  3WRT A;  4OQ0 A;  3OCN A;  4G3W A;  3D9Y A;  2X01 A;  1GSW A;  1IYP A;  2JN7 A;  3LGO A;  4LPZ A;  1ES2 A;  3BEB A;  4R0Q A;  3MMH A;  1DY6 A;  4GNU A;  4DXC A;  3P01 A;  1TS0 A;  4HBT A;  5FDS A;  2PBD P;  4K91 A;  4II7 A;  5DF7 A;  4HJ6 A;  3O86 A;  4R3A A;  4UQI S;  2IWB A;  1YLZ A;  1K56 A;  2I9V A;  4PAU A;  4WMC A;  5TFQ A;  3E2L A;  5FAO A;  4WEL A;  4PPR A;  3P09 A;  2Z2M B;  3V67 A;  3W4Q A;  3R4K A;  3WRZ A;  2R9W A;  1K57 A;  1MXO A;  2VGL S; 
#chains in the Genus database with same CATH homology
 3LY4 A;  4WBG A;  3WS1 A;  4DE0 A;  4WEJ A;  1SCW A;  3A3I A;  3A3E A;  4JF4 A;  3HLE A;  1FQG A;  2FFY A;  2HP9 A;  5FSR A;  4EQI A;  1BLP A;  2WAF A;  4HES A;  3IXH A;  4JF5 A;  1VM1 A;  3UO9 A;  2R9X A;  1K54 A;  3HUN A;  3MBZ A;  4S2K A;  3GQZ A;  4R4S A;  1N9B A;  5IHV A;  3VFF A;  5E2E A;  5F83 A;  4DF6 A;  4U3T A;  4UA6 A;  4Y7P A;  1RCJ A;  3N8R A;  3VMA A;  1NRF A;  3GVB A;  4H8R A;  5D3O A;  1YLY A;  4D2O A;  1N4O A;  3HVF A;  3P98 A;  3QNB A;  2E8I A;  2Y2M A;  4OPR A;  1KE0 A;  4PM9 A;  3QHY A;  3BFD A;  4B4Z A;  2HDU A;  3UE1 A;  4WM9 A;  1ES3 A;  1I5Q A;  4MLL A;  4P0M A;  4CJN A;  1MWR A;  2WZX A;  1GA9 A;  4GDB A;  1PZO A;  1YT4 A;  3S4X A;  3ZGA B;  3SS3 A;  2Y55 A;  5GHY A;  4BLM A;  3C4O A;  1LI0 A;  1DJC A;  1OME A;  2Y2N A;  2ZQ9 A;  4DXB A;  5CEB A;  1FSY A;  1EWZ A;  3M2J A;  1MY8 A;  5J8X A;  1IYQ A;  2WGV A;  2Y2Q A;  4JPM A;  5E43 A;  3S22 A;  3ZNY A;  3WS5 A;  1XP4 A;  1K25 A;  5FQQ A;  3G32 A;  4E3N A;  2XR0 A;  3C5A A;  1K57 C;  1NYM A;  1WE4 A;  1YM1 A;  3IHB A;  4X56 A;  4OQG A;  4R3B A;  1L0G A;  1IKG A;  4LV0 A;  5FAT A;  5U47 A;  4DE2 A;  5M18 A;  1AXB A;  1S6R A;  3VFH A;  2Q9M A;  4N9K A;  1PWD A;  3VP2 A;  1BZA A;  2WKE A;  5CHJ A;  3WS0 A;  1I2W A;  3SH7 A;  4P85 A;  2ZC3 B;  3A3F A;  2WZZ A;  1PIO A;  3O87 A;  1K54 C;  2P9V B;  5FDH A;  2HDS A;  4OLD A;  2ZQD A;  4JXG A;  3N8L A;  4MNR A;  1JWV A;  5KSC A;  3UNW A;  5BOH A;  5EEC A;  2UWX A;  1CK3 A;  2V1Z A;  3BEC A;  4NET A;  3DWZ A;  3UDX A;  4BD0 A;  3V3S A;  4BEN A;  4UA7 A;  2A3U A;  2ZD8 A;  2XEP A;  4M3K A;  2EX6 A;  1ERO A;  4L0L A;  1ZKJ A;  4DDS A;  4F94 A;  2WAD A;  1Y54 A;  4PM8 A;  3Q1F A;  4QY5 A;  3OPP A;  4R23 A;  4E3O A;  2ZQ7 A;  1XX2 A;  1PZP A;  2XF3 A;  3BM6 A;  3Q7V B;  4KG6 A;  3C7V A;  1H8Y A;  2ZQ8 A;  3A3J A;  3M6H A;  3Q7Z A;  3ZFZ A;  2XGN A;  4E3M A;  5FAQ A;  3IF5 A;  3TOI A;  1PYY A;  3A3D A;  3V39 A;  4HBU A;  1BLC A;  5GLA A;  1KDS A;  5FQJ A;  2XFT A;  1W5D A;  3G34 A;  4OVD A;  4PMA A;  3MZD A;  5GL9 A;  1S0W A;  4BJP A;  5GHZ A;  2ZQA A;  2Y2J A;  4GOG A;  5E2G A;  4LEN A;  5FI7 A;  3VSK A;  2JE5 A;  2OLU A;  2ZM2 A;  1KVL A;  3OPR A;  1L0E A;  5FI6 A;  4GKU A;  2HP5 A;  1FOF A;  3FV7 A;  4WMC D;  4IBR A;  2WGW A;  4UHU A;  3TG9 A;  1ZC2 A;  2ZQC A;  3G31 A;  2RL3 A;  3G30 A;  3UN7 A;  3IXD A;  4EBP A;  5FAP A;  1SDN A;  2FFF B;  3BFE A;  1KGF A;  3PBN A;  4KZA A;  1SHV A;  1E25 A;  3NBL A;  1PWG A;  3ZVW A;  3HLB A;  3VSL A;  1HZO A;  3JYI A;  4S2P A;  4DDY A;  3G2Z A;  3UE0 A;  5FA7 A;  1ES4 A;  3DWK A;  3IWI A;  3UDI A;  3GR2 A;  5M1A A;  3ZVT A;  1PW8 A;  2DRW A;  2VGJ A;  4X69 A;  5E2F A;  1H5X A;  4ZJ3 A;  1U60 A;  4JLF A;  2QPN A;  2G2U A;  2P74 A;  2WAE A;  1ALQ A;  1HTZ A;  3GRJ A;  1MPL A;  3IQA A;  5HFO A;  3VP4 A;  3FKW A;  3IH8 A;  3ZHH A;  4JF6 A;  5AQB A;  3BLS A;  3PAE A;  1BUE A;  4KZ8 A;  3WWX A;  1HD8 A;  4KZ9 A;  3IF6 B;  2Y59 A;  1YLJ A;  5CER A;  3QNC A;  4S2M A;  3ZG9 B;  4OLG A;  2VGK A;  1BT5 A;  4X68 A;  4LV2 A;  1K6R A;  1K4F A;  2WGI A;  5DTK A;  4DE3 A;  5CED A;  5GLB A;  5KMW A;  5A91 A;  4MBH A;  3SH8 A;  1JWZ A;  1NY0 A;  1W79 A;  2EFU A;  3MFD A;  3RXX A;  3UPO A;  1KE3 A;  1CI8 A;  4U0X A;  1E3U A;  1L2S A;  2Y2O A;  3G4P A;  4MBF A;  1EI5 A;  4BD1 A;  4PM5 A;  4OP8 A;  5EUA A;  5EVI B;  4FH2 A;  4RVA A;  1BSG A;  4E6X A;  1VQQ A;  2ZMA A;  3HBR A;  4KZ3 A;  2CC1 A;  3WS4 A;  1ONG A;  2Q9N A;  1TVF A;  1W8Q A;  2J8Y A;  1QME A;  3SH9 A;  5A93 A;  4U0T A;  4X55 A;  4JBF A;  5FI2 A;  5FAS A;  1LL9 A;  4BQM A;  3C4P A;  4S2J A;  3BRM A;  3V3R A;  3M6B A;  3N8S A;  5E2H A;  3S1Y A;  1H8Z A;  3ISG A;  3ZCZ A;  3NI9 A;  4E6W A;  4IED A;  5F1G A;  5EPH A;  1K4E A;  5F82 A;  3EQV A;  5FQK A;  3PBT A;  2H0T A;  4JXV A;  1NXY A;  1K55 C;  3NDE A;  1W8Y A;  1YMS A;  3HLC A;  4S2L A;  1GHM A;  1JVJ A;  4BL2 A;  3PTE A;  3IXG A;  2IWC A;  4S2N A;  5F1F A;  5KZH A;  3BFG A;  1K6S A;  1Q2P A;  2DNS A;  4QU3 A;  4N9L A;  2BG1 A;  4YFM A;  4QY6 A;  3GTC A;  1W7F A;  3LY3 A;  4ZJ1 A;  3V50 A;  4Y0O A;  1J9M A;  1PWC A;  3AGE A;  5CGS A;  4GZB A;  1G68 A;  2XDM A;  4GDN A;  5CTN A;  3NCK A;  1BLS A;  1TEM A;  5DTT A;  4N1X A;  1XA7 A;  1KVM A;  4GN2 A;  4KEN B;  2H5S A;  3HUM A;  4ZBE A;  2I72 A;  4OOM A;  1GHI A;  4N1H A;  3OPL A;  5CXW A;  1YQS A;  2ZM0 A;  2P9V A;  4RX3 A;  4X53 A;  4WZ5 A;  3DTM A;  1O07 A;  2QZ6 A;  4QHC A;  1RGY A;  1CEF A;  1IYS A;  4YIN A;  3MKE A;  1XPB A;  2X02 A;  4N92 A;  1RGZ A;  4O7D A;  3ZG0 A;  3Q81 A;  4EBN A;  3AGD A;  2OLV A;  3ZNT A;  3LO7 A;  3FWL A;  3MXR A;  1LL5 A;  1CI9 A;  4IBX A;  3VP3 A;  3O3V A;  2IWD A;  2HDR A;  3ZG8 B;  4NK3 A;  1XGI A;  2QMI A;  3HLD A;  5L2F A;  3ITB A;  3HUO A;  4GD8 A;  4DRT A;  2H10 A;  1JTG A;  3CG5 A;  5EOE A;  5EVI C;  5HAQ A;  4KG2 A;  4S2I A;  4XUZ A;  1IEL A;  4KZB A;  4QD4 A;  2HP6 A;  3I7J A;  3Q7V A;  3IXB A;  4LCM A;  4MBK A;  4EV4 A;  2EX9 A;  1WYC A;  1XGJ A;  3G35 A;  2V2F F;  1QMF A;  4S2N C;  3N7W A;  1ZG4 A;  1BTL A;  4MEZ A;  3CZD A;  2XK1 A;  5CGX A;  3W4O A;  1IEM A;  4ZJ2 A;  4DE1 A;  3ZG7 B;  1YLT A;  3O88 A;  2Y91 A;  3ITA A;  2OSU A;  1CEG A;  3WS2 A;  1SKF A;  3HRE A;  4Q8I A;  3MZE A;  3MZF A;  4QJG A;  2ZC6 B;  5A90 A;  2WUQ A;  2ZC5 B;  1JWP A;  4R1G A;  3W4P A;  2HDQ A;  2PU4 A;  4X6T A;  1KGE A;  5HAP A;  1LHY A;  3NC8 A;  4KZ7 A;  1C3B A;  4OQI A;  5AQ9 A;  2PBY A;  4IVK A;  3SS4 A;  2A49 A;  4WZ5 C;  5M19 A;  1K55 A;  4OOL A;  1FCM A;  1FR6 A;  2Y2I A;  4B4X A;  1IYO A;  2WYX A;  5HAI A;  5HL1 A;  1M6K A;  1KE4 A;  1ESU A;  1O7E A;  2Y2G A;  4WYY A;  4EWF A;  3RXW A;  2XD5 A;  4LV1 A;  1YLP A;  3HLG A;  2RCX A;  1E3U D;  3N6I A;  4RX2 A;  4KZ4 A;  3D4F A;  1XKZ A;  3AGF A;  4GD6 A;  5FQM A;  1E4D A;  4OQH A;  3NIA A;  1I2S A;  2JBF A;  4KQO A;  2DCF A;  5EVL A;  4WZ4 A;  1IKI A;  3HLW A;  3VP1 A;  4OP5 A;  5AQ7 A;  2Y2K A;  2XD1 A;  2OV5 A;  4ZDX A;  3OPH A;  3PBO A;  3OCL A;  4OOY A;  4Y0U A;  5CEC A;  5CGW A;  2ZC7 A;  4OPQ A;  3EQU A;  2ZM8 A;  3IH9 A;  1TDL A;  4XXR A;  4OPZ A;  5I94 A;  1PW1 A;  3Q82 A;  3IF6 A;  5DF8 A;  2ZC4 B;  5FQ9 A;  3UPN A;  1YMX A;  3HL9 A;  4ZAM A;  1FCO A;  5CRF A;  1SDE A;  2WKH A;  1JTD A;  1MBL A;  3ZDJ A;  1FSW A;  1NYY A;  2PU2 A;  2Y2H A;  3FZC A;  4LCL A;  5EVI D;  3RJU A;  4P87 A;  3TSG A;  4WEK A;  3B3X A;  1PI5 A;  4ID4 A;  2G2W A;  1KGG A;  2Y4A A;  4KQR A;  1GCE A;  1NZO A;  3BYD A;  5GHX A;  1DJB A;  4CPK A;  1NZU A;  1LLB A;  5EVI A;  4XUX A;  1L0F A;  4JXW A;  4KG5 A;  5DVA A;  1BLH A;  1MKI A;  2Y2P A;  2X71 A;  4IVI A;  4UA9 A;  3UDF A;  1HVB A;  4JXS A;  2J7V A;  3FKV A;  2HPB A;  3CJM A;  1PI4 A;  4PM6 A;  5CHU A;  3SOI A;  4LV3 A;  3GMW A;  3NY4 A;  4FSF A;  2XLN A;  4QB8 A;  3MKF A;  1ES5 A;  1FR1 A;  3E2K A;  1MWU A;  2EX2 A;  5EE8 A;  1ZG6 A;  3BLM A;  1RP5 A;  4R4R A;  5HAR A;  3IHA A;  1ONH A;  4FCF A;  3GSG A;  3IWQ A;  4E3K A;  4RA7 A;  3CMZ A;  4KZ5 A;  1DJA A;  1XA1 A;  5GLD A;  2ZJ9 A;  3W8K A;  3SS5 A;  3M2K A;  3GV9 A;  2EXB A;  1YLW A;  4OH0 A;  2WK0 A;  2XH9 A;  5CHM A;  5CTM A;  5DF9 A;  3ZG5 A;  4JKT A;  5KSH A;  1GHP A;  1LI9 A;  3IF6 C;  4P6B A;  3PBS A;  1G6A A;  4K0W A;  5A92 A;  5AQA A;  1K38 A;  2EX8 A;  4BL3 A;  4DKI A;  1WYB A;  3MXS A;  2C5W B;  4PM7 A;  2Y2L A;  3OZH A;  2J9P A;  1FCN A;  1NJ4 A;  2C6W B;  3DW0 A;  3VOZ A;  4R3J A;  5DTS A;  3WRT A;  3V5M A;  1L0D A;  1BUL A;  1Q2Q A;  1TDG A;  4OQ0 A;  4C3Q A;  4UAA A;  3OCN A;  4FD8 A;  4EUZ A;  4Y0T A;  1MWS A;  4S2O A;  4C75 A;  2WGW B;  2X01 A;  1IYP A;  1Z6F A;  3PBR A;  1ERM A;  1ERQ A;  1MWT A;  4GB7 A;  4OON A;  2V20 A;  3Q07 A;  1KDW A;  4Z9Q A;  5GLC A;  3LEZ A;  4EBL A;  5JYP A;  3IWO A;  1ES2 A;  2B5R A;  3BEB A;  4R0Q A;  2GDN A;  2JC7 A;  4KQQ A;  4E3J A;  1DY6 A;  2WKI A;  4C6Y A;  4GNU A;  4DXC A;  4E3L A;  3BFF A;  3NDG A;  4B88 A;  2J9O A;  3UE3 A;  4RYE A;  4HBT A;  5JYO A;  1K56 D;  3G2Y A;  4K91 A;  3UY6 A;  5DF7 A;  4FH4 A;  3VOY A;  3BFC A;  3O86 A;  1ESI A;  3C7U A;  3LCE A;  2IWB A;  1YLZ A;  3HLF A;  3VP0 A;  2XFS A;  4E3I A;  5HW3 A;  3N4I A;  1XXM A;  1K56 A;  2JCH A;  3UPP A;  5TR7 A;  4WMC A;  5EOO A;  5TFQ A;  5TGF A;  4KZ6 A;  1GA0 A;  3E2L A;  5FAO A;  3PBQ A;  5FQI A;  5G18 A;  2H0Y A;  3PAG A;  4PPR A;  4WEL A;  4A5R A;  2BLS A;  2XQZ A;  3OC2 A;  4OPY A;  3P09 A;  3IT9 A;  2EXA A;  1M40 A;  2Z2M B;  4OKP A;  2Z2L B;  3W4Q A;  5HX9 A;  2ZLY A;  4HEF A;  4ZTK A;  2EFX A;  3WRZ A;  2R9W A;  4K0X A;  1K57 A;  3FYZ A;  1MXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...