1YLWA

X-ray structure of ctx-m-16 beta-lactamase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGGYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CTX-M-16 beta-lactamase
publication title Atomic Resolution Structures of CTX-M beta-Lactamases: Extended Spectrum Activities from Increased Mobility and Decreased Stability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 95
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ylwA00
3RXWA 1CI8A 4UHUA 5KZHA 3IT9A 5M1AA 4N9KA 1L2SA 2FFYA 5TR7A 4ZDXA 1SKFA 3Q1FA 2WGWA 4HEFA 4OP5A 3Q7VB 3VP2A 4C6YA 3OPRA 1YM1A 2OSUA 4S2KA 2XFSA 1ES2A 4OOLA 4UAAA 3ITAA 3Q7ZA 2PBYA 4MLLA 2WADA 3Q82A 1L0EA 3VP1A 2ZC3B 3IH8A 3PBNA 4OPZA 1N4OA 4JXSA 2Y2MA 1VQQA 4KG5A 5FQIA 5FQKA 4IBRA 1LL5A 3A3JA 4KENB 4S2LA 1WYCA 2R9XA 5CEBA 5HX9A 1RCJA 3UDIA 3IH9A 5IHVA 1E25A 2V1ZA 3ZG0A 3M2JA 4BLMA 1K38A 5F1FA 2J9PA 4U0TA 1H8YA 4HBTA 3BFEA 3WRZA 1K57A 1PW1A 3BYDA 2OV5A 3ZCZA 2XDMA 2RL3A 3WS4A 3DTMA 3FKWA 4PM6A 2WYXA 1FCOA 2H0YA 5E2GA 3W4QA 1K4EA 2JE5A 4GZBA 1HD8A 3FWLA 5FQJA 3NY4A 3HLWA 1CI9A 1JTDA 5E2EA 5EVID 1LL9A 2OLUA 4BD0A 1O7EA 4GKUA 3SS5A 2EX8A 2WUQA 3VP3A 1U60A 1KGFA 3BFDA 3ITBA 1KE4A 3IXGA 3OZHA 1JWZA 2X71A 1ZKJA 3IXDA 2BG1A 2XGNA 1MXOA 3UNWA 3DWKA 3Q07A 5KMWA 3OC2A 4QHCA 3N8LA 1BTLA 5AQ7A 5FDHA 5M19A 3E2KA 4MBKA 1LI0A 4WZ5A 5A92A 4K0XA 1K54A 5BOHA 1TVFA 2ZQ9A 4ID4A 3NDEA 4R1GA 4UA6A 2E8IA 2ZQAA 4P6BA 1M6KA 1EWZA 2Y4AA 4XXRA 2XQZA 2EXAA 4KQOA 3BLMA 2XR0A 4X55A 1GA9A 4F94A 3UO9A 4UA7A 2C5WB 1MWSA 1BUEA 4WYYA 4N1HA 3SS3A 3O86A 2ZC5B 3QHYA 4DRTA 1C3BA 3LO7A 4OH0A 5DF8A 1YMSA 1ZG6A 5EECA 3IQAA 4FH2A 4KZ7A 4RA7A 3BEBA 4YFMA 4DDSA 4WEKA 4U3TA 3TOIA 4OOYA 4EUZA 5CHJA 2A49A 4E3OA 4OKPA 1G6AA 3MFDA 4S2OA 3GV9A 3NIAA 1KVMA 3WS1A 1NYYA 2XD1A 2ZM2A 3MXSA 1SDNA 2XFTA 1E4DA 1KGGA 4S2IA 1K25A 4LV0A 3GRJA 1WE4A 1KE0A 4QY5A 5U47A 5FI6A 4MBFA 1NYMA 2CC1A 3O88A 1HTZA 1QMEA 3IHBA 4MEZA 5J8XA 5A91A 3HL9A 4Z9QA 3UY6A 2ZC7A 3HBRA 2WAEA 4X69A 4WMCA 3ZVWA 2J7VA 2XK1A 3OPLA 3O87A 5EVIC 4A5RA 4LCMA 1PZOA 4WZ5C 1K55A 3PBSA 4WZ4A 4X56A 4E3JA 1XXMA 1BLCA 2ZJ9A 2WZXA 1BULA 3IF5A 3AGEA 1SCWA 3RXXA 2J9OA 4C3QA 4OLDA 4HBUA 3VSKA 3ZG9B 2VGJA 4KZBA 4QJGA 3BFCA 1HZOA 1JWPA 4GD6A 3ZG8B 1GHMA 1XA7A 1SHVA 4JF6A 4GDNA 4PM9A 1L0DA 3W4OA 4BL2A 1PWDA 3ZHHA 1K56D 2HP5A 1IEMA 3DWZA 1W5DA 1CEGA 4X53A 4GDBA 5E2FA 2Y59A 4H8RA 4E3KA 1ESIA 3BECA 4QB8A 2P9VA 1TDLA 2C6WB 3C5AA 4E6WA 1OMEA 4OP8A 4R4RA 4O7DA 3UDXA 3MXRA 2WGIA 1KDWA 3MKFA 3LEZA 4JF5A 3G35A 4DE0A 4WELA 2H0TA 1GHIA 1K56A 3C7UA 5EOEA 3PAGA 4KZ4A 2DCFA 1TDGA 1E3UA 4LV2A 3CMZA 2Z2MB 5TFQA 5JYPA 4EQIA 3BFGA 5DTSA 3WRTA 2XLNA 4IEDA 4MBHA 3GSGA 4LV1A 4E3LA 3HREA 4OPRA 2HP6A 3VMAA 1FCNA 5EVLA 1SDEA 1O07A 4KZ9A 4OQHA 4GOGA 5GLDA 3UPOA 1DJBA 4Q8IA 2Y55A 3ZFZA 2OLVA 3BM6A 4GB7A 4IVIA 4OVDA 4E3NA 5TGFA 3HUOA 2IWCA 4MNRA 1WYBA 5DTKA 1IYOA 1K55C 3A3EA 4R23A 5M18A 3BRMA 4BENA 4KG6A 1XKZA 3EQUA 1I5QA 3OCLA 5HFOA 1KVLA 2WGVA 2A3UA 4DE1A 3HVFA 3CJMA 3LY4A 2ZQ8A 4KZ5A 1DJCA 2HDUA 1BLHA 1ESUA 1ERQA 3HUNA 5KSHA 2JC7A 2Y91A 5FQQA 4OONA 3PAEA 4E3MA 4KZ6A 4N9LA 3V39A 3HLDA 3S1YA 5F83A 4PM7A 2XD5A 4C75A 1FOFA 5D3OA 3SH9A 4JXGA 1HVBA 4FD8A 2RCXA 3IWQA 3IXHA 1I2SA 1QMFA 4N1XA 2ZC6B 2J8YA 2WKEA 5F82A 5FAPA 3OPPA 3PTEA 4FCFA 1XGIA 2X02A 3BFFA 2WGWB 1VM1A 3PBTA 4WM9A 4XUXA 5EVIA 4D2OA 4EBPA 1GCEA 4K91A 1YMXA 4QY6A 1EI5A 1J9MA 1DJAA 1M40A 1PWCA 1Q2QA 2IWDA 2VGKA 3GVBA 3IF6A 2PU4A 5FAQA 5HAIA 3NDGA 2Y2KA 1I2WA 1PI5A 3HLFA 4WEJA 3UDFA 3IWOA 5E2HA 4ZAMA 4HESA 2ZM8A 2Y2OA 1KDSA 4Y0OA 1XPBA 3VSLA 1YQSA 1CEFA 5FI7A 1IYSA 1RP5A 3N6IA 1MWRA 1PW8A 1Z6FA 1ZG4A 2G2UA 3ZG5A 4EBNA 3AGFA 3VOYA 3UE1A 5CEDA 4B4XA 2P74A 2Q9MA 3FZCA 5EE8A 5GHYA 1ES5A 3GR2A 3GTCA 3D4FA 4P85A 5EOOA 4EBLA 1NZOA 2Y2GA 1ES3A 4ZJ3A 4S2MA 1FSWA 1IYQA 4L0LA 3SOIA 3PBOA 1BLSA 3WS0A 4PPRA 1W8QA 1NJ4A 5FASA 4B88A 3LY3A 2Y2IA 3G32A 1BT5A 5CRFA 1IKGA 1TEMA 3CZDA 4FH4A 5CGXA 1YLJA 2EXBA 2HDQA 3IWIA 5FQ9A 4E3IA 4U0XA 3FYZA 4OPQA 4EV4A 4RYEA 1YLZA 1W7FA 5EVIB 5CHMA 4ZTKA 2ZC4B 4BL3A 3E2LA 4JLFA 4DKIA 2PU2A 4DE2A 3V5MA 3C4OA 1DY6A 3S4XA 2ZQCA 3HLGA 3P98A 4YINA 1MPLA 3IF6C 5E43A 5GLBA 5CERA 3UPNA 1PI4A 3N4IA 5GHXA 2Y2NA 1PZPA 3NI9A 4LCLA 1XGJA 3HLCA 4KZ3A 4OLGA 5AQ9A 2Y2QA 3VP4A 4R3BA 2I72A 4RX2A 4JPMA 2IWBA 1BSGA 2QPNA 4KG2A 1FR6A 3Q81A 3VOZA 2ZM0A 3OCNA 2ZD8A 3RJUA 1RGYA 3WS5A 5HARA 4EWFA 3N8SA 1JWVA 5AQAA 1CK3A 1ES4A 5HAPA 4KZ8A 3MZFA 3NC8A 3IXBA 5CXWA 4ZJ2A 4NK3A 1W8YA 5A93A 1K6SA 4R4SA 3TSGA 5CTNA 4CJNA 3PBQA 5CGWA 2H5SA 4DE3A 4CPKA 2GDNA 1YLPA 1S0WA 4JKTA 3LCEA 1FQGA 4QD4A 2ZMAA 4S2JA 2EX6A 5I94A 4OQ0A 3G2ZA 5FSRA 4KQRA 4OQGA 4X6TA 1ERMA 5CECA 1S6RA 4JXVA 4LV3A 2EX9A 2DNSA 1XP4A 3SH8A 2Y2HA 3G31A 4BQMA 2EFUA 2ZQDA 3C4PA 3ZVTA 5HAQA 2Q9NA 4IBXA 4GNUA 4KZAA 2WKIA 3UE0A 3UPPA 4GN2A 1EROA 2HPBA 3G30A 1ONHA 2XEPA 3M6HA 4PMAA 1IELA 1JTGA 1BLPA 2DRWA 4R3JA 3BLSA 5FI2A 3WWXA 3ZGAB 1IKIA 5EUAA 2QZ6A 3ZG7B 2Z2LB 3ZNYA 1MWTA 3S22A 2UWXA 1MKIA 3G34A 3GQZA 3FKVA 4S2NC 5GHZA 3QNBA 2HDSA 4OOMA 5CTMA 1RGZA 2B5RA 3CG5A 5FATA 5GLCA 3M2KA 4OQIA 2Y2LA 2JBFA 3QNCA 4OPYA 1Y54A 1PWGA 3B3XA 3G4PA 3UN7A 4PM8A 2P9VB 2X01A 4RVAA 1L0FA 5FAOA 4JXWA 3TG9A 3M6BA 1XA1A 3GMWA 5EPHA 4QU3A 1W79A 3A3IA 3ISGA 3NCKA 3VFFA 3JYIA 4Y0UA 4P0MA 4DF6A 4E6XA 1AXBA 4P87A 1BZAA 4S2PA 5JYOA 3N8RA 5HW3A 1PIOA 2FFFB 1N9BA 1GHPA 2V2FF 1IYPA 3VP0A 2Y2JA 3V50A 1KGEA 4DXBA 3UE3A 2HDRA 3DW0A 1NY0A 2JCHA 4B4ZA 1FR1A 3N7WA 4PM5A 1H5XA 5DF9A 2EFXA 3V3RA 5GLAA 4RX3A 5GL9A 3FV7A 1KE3A 1YT4A 2QMIA 1PYYA 3SS4A 3ZDJA 2ZQ7A 1LI9A 1GA0A 4R0QA 1L0GA 1K6RA 5A90A 3VFHA 1LHYA 1MY8A 1YLWA 1NRFA 2V20A 5FQMA 3A3FA 4M3KA 4N92A 1ALQA 5CGSA 2XF3A 3V3SA 3Q7VA 4FSFA 5DTTA 5L2FA 1K57C 2H10A 1NZUA 3O3VA 3I7JA 2WK0A 3G2YA 3IHAA 2Y2PA 1LLBA 3AGDA 3MZDA 3NBLA 3WS2A 3MZEA 1FSYA 1Q2PA 3P09A 5FA7A 3W4PA 5G18A 1MWUA 4WMCD 4JF4A 4LENA 5KSCA 3A3DA 2XH9A 3SH7A 5DF7A 4ZJ1A 3PBRA 4K0WA 3HUMA 3HLEA 2ZLYA 3IF6B 1ONGA 1FCMA 4DXCA 4IVKA 3OPHA 1XX2A 3EQVA 3MBZA 1ZC2A 5DVAA 5HL1A 4S2NA 2WAFA 1YLYA 4NETA 2WZZA 5F1GA 1YLTA 3MKEA 2EX2A 2WKHA 1K54C 2HP9A 4Y7PA 4JBFA 4UA9A 2BLSA 1K4FA 1JVJA 2G2WA 4BJPA 4XUZA 5AQBA 1MBLA 4WBGA 1NXYA 1G68A 3W8KA 3C7VA 4GD8A 3HLBA 4ZBEA 2R9WA 5CHUA 4DDYA 4Y0TA 3ZNTA 1H8ZA 4BD1A 4X68A 4KQQA 1E3UD
chains in the Genus database with same CATH superfamily
3RXWA 1X0OA 5M1AA 4N9KA 5TR7A 1SKFA 1TS6A 3KSFA 3VP2A 4UQIM 4NKPA 4HH2A 4OOLA 3KSGA 4UAAA 3ITAA 4MLLA 5HWVA 3IH8A 4OPZA 4JXSA 2Y2MA 2D02A 5DJUA 4CLCE 4EQ1A 3A3JA 4KENB 2VGLS 3UB9A 3IBJA 1RCJA 2OAQ1 1E25A 4BLMA 5F1FA 4MDZA 3WRZA 2KOIA 1UGUA 2OV5A 3S7PA 3WS4A 2H0YA 3PXPA 2OLUA 1T18A 5C5KA 2VKSA 1O7EA 3MQOA 3QP1A 4HJ4A 1U60A 3ITBA 3OZHA 2BG1A 1MXOA 3DWKA 3Q07A 1BTLA 1F5MA 3E2KA 3A0RA 1LI0A 4MBKA 1TVFA 4ID4A 4R1GA 5EPHA 4L9FA 1LT0A 4XT2A 4KQOA 2KX6A 1YPRA 1N9NA 4X55A 4F94A 4UA7A 4HJ3A 1XJ2A 2W1TB 4WYYA 3SS3A 3QHYA 3UB8A 4DRTA 1YMSA 4WF0A 5EECA 5FEFA 4CLCA 1Y4OA 2PT7A 4G3KA 1NYYA 2HJ9C 3DAVA 1E4DA 1KGGA 3GRJA 3BQAA 3EEHA 4MBFA 1S66L 1NYMA 5I5LA 3O88A 2VZWA 5A91A 4Z9QA 4X69A 3FPVA 2J7VA 4A5RA 1T19A 4LCMA 4E3JA 4X56A 1XXMA 3IF5A 2L1MA 3CPTA 4C3QA 5DFXA 5L10A 3ZG8B 3T4SA 4F3LA 1TS0A 3ZHHA 1W5DA 1CEGA 1W63Q 2VLGA 2Y59A 1SKOA 2GZAA 3BECA 4QB8A 2C6WB 3C5AA 1OMEA 4OP8A 4R4RA 1KDWA 3G35A 1OT9A 1GHIA 4P6ZM 5EOEA 3PAGA 4KZ4A 4K08A 1E3UA 4LV2A 3CMZA 2Z2MB 3BFGA 2XLNA 4GS9B 4LV1A 3HREA 1O07A 4OQHA 4Q8IA 2Y55A 4OVDA 4GB7A 3CWFA 5TGFA 1WYBA 5DTKA 5M18A 5FL3A 5HFOA 2WGVA 2A3UA 2ZQ8A 1H8MA 4E3MA 4KZ6A 3V39A 3HLDA 4PM7A 1FOFA 2NUPC 4L9GA 4UQIS 2RCXA 3MFXA 3KSHA 5FAPA 3BFFA 2WGWB 4XUXA 2K7SA 4K91A 3H9WA 1YMXA 1FIKA 1M40A 1DJAA 2QJ5A 2IWDA 2VGKA 2PU4A 3OBFA 1I2WA 5AVFA 4AFIA 1IYSA 1RP5A 3DTKA 4HI4A 1F2KA 5EOOA 2Y2GA 2IA2A 1IYQA 4L0LA 4EEPA 5HWWA 3S7QA 3LY3A 5MC7A 3H82A 1IKGA 4EV4A 4RYEA 1YLZA 5CHMA 3V5MA 3C4OA 1DY6A 2PHYA 3HLGA 4YINA 1MPLA 1XJ3A 3U4LP 3PHYA 2Y2NA 3HLCA 4R6LA 3VE4A 3VP4A 4JPMA 1BSGA 3NHQA 3OCNA 2ZD8A 3E98A 1CK3A 2PR5A 3F1PB 4KZ8A 3MZFA 1K6SA 4R4SA 3TSGA 1A0KA 4MCWA 1YKDA 5CGWA 2H5SA 2MJ6A 1FQGA 3G2ZA 4I3IA 2VV8A 3A0VA 4D60A 3C4PA 4KZAA 2W3DA 3MQ0A 2V8FA 4GN2A 1EROA 2HPBA 4Y17A 4PMAA 1IELA 1JTGA 5G4ZA 4R3JA 5FI2A 1W63M 1IKIA 5EUAA 2QZ6A 3ZG7B 3IBRA 3KSIA 3ZNYA 2G7UA 3FKVA 5FATA 1PWGA 4P6ZS 3G4PA 3UN7A 1S1YA 1LSWA 5EV0A 1TS7A 4QPRA 4JXWA 4PHTA 2JKRM 1P97A 2J3TD 3ISGA 3JYIA 3JVUA 2YKFA 4S2PA 2QWSA 3GECA 1GHPA 3VP0A 2Y2JA 5G4YA 2HDRA 2XA7M 3V3RA 4RX3A 5GL9A 5HD3A 3KYEA 2OAP1 1LI9A 1IOUA 1OPXA 3D9YA 2FZ0A 4CLCD 1LHYA 1NRFA 4M3KA 2BTFP 2XF3A 4FSFA 4HOIA 3O3VA 3I7JA 3CHWP 1FILA 3P09A 3W4PA 2PDRA 3E4QA 2XH9A 3SH7A 4EU0A 1UWPX 4K0WA 3HUMA 3HLEA 1ONGA 4DXCA 1EW0A 2L4RA 5HL1A 3IX3A 2J3TC 3MKEA 2EX2A 3MJQA 1G5UA 4MN5A 4Y7PA 4UA9A 1XJ6A 1STZA 2R9WA 2ZL1A 5CHUA 4ZBEA 4KQQA 1E3UD 4E04A 1CI8A 4UHUA 5KZHA 4LGWA 4LRXC 3QP2A 3Q7VB 1VETA 2OSUA 2XFSA 4CLCC 3ICYA 4O01A 3Q7ZA 5TJJA 4YOFA 3Q82A 3UB5P 4KG5A 1LL5A 3BW6A 1WYCA 2R9XA 2PRFA 3DBAA 4HP4A 3IH9A 2V1ZA 4ZRRA 2J9PA 3BFEA 1PW1A 3BYDA 3T4TA 3VV4A 4M4XA 2RL3A 3NECA 3K3DA 5E2GA 4GZBA 3FWLA 3NY4A 2WKQA 1CI9A 5E2EA 1LL9A 4BD0A 4H6JB 4Y13A 4YWZA 2Q0OA 3IXGA 1JWZA 5KMWA 2PD7A 4O0PA 4QHCA 5AQ7A 1SZVA 5FDHA 5M19A 4WZ5A 5J3WA 2ZQAA 1M6KA 3RTYA 3S7NA 5IT5A 2XR0A 3TJZC 2O99A 3UO9A 2C5WB 1MWSA 1P9RA 1DP6A 4BBVA 3LO7A 1ZG6A 3IX8A 3BEBA 3RH8B 4DDSA 3TOIA 3ZYTA 4E3OA 5TBMA 3KYQA 3GV9A 3NIAA 3WS1A 3MXSA 2J80A 4S2IA 4LV0A 3EGDC 5AVEA 5U47A 1HTZA 2XA7S 3UY6A 3ZVWA 3O87A 1K55A 4WZ4A 3MXQA 2H28A 4JGQA 4OLDA 3VSKA 2A2LA 1JWPA 3B47A 4XT2B 1XA7A 1SHVA 4PM9A 3NULA 5DKLA 1K56D 1IEMA 4X25A 4X53A 4GDBA 4H8RA 2W0NA 2W1RA 3C38A 3MXRA 3MKFA 2WKPA 4WELA 3C7UA 4CLCB 1TDGA 4UEYA 2K2NA 5TFQA 1D7EA 3GSGA 4FOFA 3VMAA 1SDEA 4JGRA 4GOGA 3UPOA 1DJBA 3BM6A 4R23A 3A3EA 1D1JA 3L9KA 4KG6A 1G28A 1OTIA 3C30A 3CJMA 3LY4A 4KZ5A 1BLHA 3HUNA 5FQQA 2ZOHA 4NXFA 1LSVA 1P9WA 2CMNA 2Y79A 2XD5A 4F3LB 3SH9A 1HVBA 1MKMA 4GCZA 5F82A 1XGIA 2W3HA 4X1MA 4WM9A 1DP8A 4B9OA 1YSPA 4HNBA 3EGXC 4HBTA 1J9MA 1Q2QA 3K3CA 5HL6A 3UB6A 2Y2KA 1ODVA 4WEJA 4HESA 3LEQA 3TRCA 5HDCA 3N6IA 1S1ZA 1PW8A 2G2UA 4D2OA 2P74A 2Q9MA 4L9EA 3K2NA 5EE8A 3GR2A 3GTCA 4KUOA 4P85A 4EBLA 1NZOA 1ES3A 2PD8A 1FSWA 3PBOA 4PPRA 1NJ4A 4IUKA 2Y2IA 5CRFA 5CX7A 1TEMA 4FH4A 2HDQA 3FYZA 1CQAA 2HF6A 3E2LA 4JLFA 1VHMA 3S4XA 3W2ZA 3IF6C 5GLBA 1PZPA 3HCYA 4RX2A 2JKRI 3T1QB 5LBRA 2W3EA 2PR6A 2ZM0A 3LR5A 3WS5A 3VE3A 1JNUA 5HDDA 3NC8A 3IXBA 5CXWA 4ZJ2A 3UE6A 4CJNA 2EA9A 1YLPA 1ZTUA 4JKTA 2ZMAA 2EX6A 4OQGA 4X6TA 4I5SA 4Y15A 1S6RA 1K0KA 3CI6A 3JVVA 4LLOB 4LV3A 3UB7A 1AWIA 1XP4A 4BQMA 1ACFA 5HSQA 3UE0A 3G30A 2XEPA 2DRWA 1S4RA 5J4EA 2Z2LB 3EOIA 4Q0JA 3QNBA 1RGZA 3CG5A 4OQIA 2OWHA 2Y2LA 1GSVA 1F98A 3QP5A 3QNCA 5HPFA 4ESPA 4GJ4A 4O8GA 4PM8A 2P9VB 4RVAA 1VEUB 1L0FA 4R3AA 2XRNA 1XA1A 3GMWA 2JHEA 4FTXA 2Y8HA 4PAUA 4DF6A 4E6XA 1PIOA 1IYPA 3E0YA 3F1OB 4DXBA 3UE3A 3DW0A 1NY0A 2JCHA 1Z09A 3N7WA 5DF9A 2KDKA 5GLAA 2GJ3A 3V67A 3SS4A 2ZQ7A 5A90A 5FQMA 5HZHA 1WA9A 5CGSA 3V3SA 5DTTA 4I38A 2H10A 4DJ3A 1LLBA 1FSYA 3MF0A 4IUHA 4B93A 5DF7A 3UMDA 4ZJ1A 3PBRA 2ZLYA 3IF6B 1FCMA 4IVKA 1XX2A 2JN7A 3EQVA 2V9AA 2WAFA 2V0WA 2WZZA 5F1GA 3MQQA 2WKHA 2PYRA 5EM0A 3OOVA 3T50A 1JVJA 4HIAA 2G2WA 4BJPA 4XUZA 1MBLA 4GD8A 3LI8A 1TS8A 4IHQA 1OJGA 4DDYA 1H8ZA 4MMNA 2GX5A 2Z6DA 3KO6A 4HEFA 2WGWA 4OP5A 3T4QA 3R7WB 3LIDA 4S2KA 1MC0A 4HJ6A 2PBYA 2WADA 3VP1A 3TW8A 3PBNA 3CUEA 1VQQA 3QP6A 5CEBA 3UDIA 5IHVA 3ZG0A 3M2JA 2HJEA 1K38A 2VX8A 4U0TA 5FDSA 2ZMFA 2XDMA 4PKYG 1T1BA 3FKWA 2WYXA 1FCOA 2V1BA 1K4EA 1HD8A 5FQJA 3HLWA 1JTDA 3P01A 3P7NA 5DJTA 4GKUA 2ZL1B 2EX8A 5EVEA 4X1LA 3BFDA 2X71A 2EWVA 2XGNA 2VK3A 3UNWA 3T1RA 2O9BA 3FPWA 5KIZA 1VETB 4K0XA 1K54A 5BOHA 2E8IA 4WUJA 1EWZA 2XQZA 3BLMA 1V9YA 3E4OA 5A8BA 3O86A 2ZC5B 1C3BA 4OH0A 3L7HA 1UWNX 5DF8A 3F1PA 4GW9A 3IQAA 4RA7A 4YFMA 4U3TA 2AVXA 2VV6A 2ZBBA 3DTIA 4EUZA 2JKFA 2A49A 1G6AA 3MFDA 4KUKA 1Y28A 3IX4A 1SDNA 3OLOA 2V1AA 1WE4A 1KE0A 5FI6A 2CC1A 1QMEA 2ZC7A 3HBRA 5J7EA 4WMCA 1T1CA 2XK1A 1PZOA 2V8CA 3PBSA 4G3WA 3LIFA 2ZJ9A 2WZXA 1BULA 4HBUA 4KZBA 4QJGA 3BFCA 1HZOA 4NXBA 4GHIB 3SW1A 3LFVA 4JF6A 4BL2A 1L0DA 2HZ5A 1PWDA 3DWZA 3T4KA 2BASA 2QHKA 4Y2FA 1TDLA 3UMEA 4O7DA 4G3VA 4JF5A 3LEZA 1G6OA 2H0TA 5TBMB 2DCFA 1NLZA 5JYPA 4EW7A 2B02A 5DTSA 3WRTA 1NLYA 4MBHA 4OPRA 2O9AA 3NOPC 1S4SA 4BWIA 3HJKA 4LFUA 2OLVA 2KLIA 4MNRA 2IWCA 1IYOA 2VV7A 4BENA 1MZUA 1XKZA 1I5QA 4NXEA 3HVFA 1DJCA 5KSHA 1ERQA 2Y91A 4OONA 1T1AA 3PAEA 2A24B 2OOLA 4JXGA 4WLAA 1I2SA 1QMFA 2V0UA 2VEAA 2X02A 3G6OA 3PBTA 4EERA 1VM1A 5EVIA 4EBPA 4QY6A 1D06A 5F69A 1IFQA 3GVBA 5FAQA 3NDGA 3HLFA 3UDFA 3IWOA 5E2HA 3CITA 4ZAMA 1N9OA 1KDSA 4Y0OA 1XPBA 3VSLA 1YQSA 1MWRA 1ZG4A 3AGFA 3VOYA 3UE1A 4B4XA 2HGVA 1ES5A 2JKTM 3SOIA 3T4JA 1CF0A 1W8QA 4B88A 3HJIA 4HY8A 3G32A 1OTEA 3MS6A 4EESA 3CZDA 5CGXA 1YLJA 2EXBA 3IWIA 5FQ9A 4U0XA 2PAVP 1W7FA 3F1NA 4ZTKA 3KX0X 2ZC4B 4DKIA 4DE2A 2ZQCA 5E43A 3TE8A 1PI4A 3N4IA 2ACGA 2J3WA 3A0SA 3NI9A 1XGJA 1N9LA 4R38A 2QPNA 2P08A 5HARA 3N8SA 4ARZA 1ES4A 5HAPA 2VJWA 1W8YA 4NK3A 5A93A 2XSSA 3KYZA 5F6AA 3C8CA 1L3LA 4H6JA 3SZTA 3LCEA 4KQRA 2B95A 3BQ8A 3S7OA 2EX9A 2DNSA 2Y2HA 2EFUA 2ZQDA 5HAQA 2Q9NA 3ZQ5A 4GNUA 2WKIA 5IU1A 1P0ZA 1ONHA 3M6HA 1BLPA 3CPTB 1MWTA 1VB6A 3G34A 5GHZA 4ETXA 2DMWA 2HDSA 4OOMA 3H7WA 2B5RA 5CTMA 2B18A 3PR6A 4OPYA 1DP9A 3B3XA 1SKOB 1ZHHB 4I3AA 1KOUA 3IS2A 4I3JA 3M6BA 2Z6CA 3NCKA 5L07A 4P0MA 1OTBA 3T1SA 4P87A 5JYOA 2W3GA 3LICA 3N8RA 1N9BA 1KGEA 4B4ZA 1FR1A 5DKKA 1H5XA 2EFXA 1F9IA 3R4KA 1LSXA 3FV7A 3CUEC 2ZOIA 4FUWA 3ULFA 1GA0A 3MSHA 4R0QA 1K6RA 5EFWA 3VFHA 1YLWA 2K31A 2V20A 2LB5A 4LRZE 3LIBA 4Q0HA 4CQHA 4HP9A 1XJ4A 2L0WA 4EEUA 2Y2PA 3MZDA 3MZEA 1Q2PA 5FA7A 3LR4A 5G18A 4WMCD 5IS1A 4LENA 5KSCA 3U2AA 4JGOA 4Q0IA 4LPZA 3MBZA 5DVAA 4S2NA 4BBUA 1YLYA 1YLTA 1K54C 2BLSA 4Y3IA 1S67L 4WBGA 1G68A 3W8KA 3HLBA 1LL8A 3JPUA 2EWWA 3ZNTA 3IT9A 1L2SA 2FFYA 4ZDXA 3Q1FA 3H82B 3NJAA 4C6YA 3OPRA 1YM1A 1ES2A 1GSXA 1L0EA 2ZC3B 3LR3A 1N4OA 3O5YA 5FQIA 5FQKA 4IBRA 2W1TA 4S2LA 5HX9A 3LIAA 3T4LA 1H8YA 3QP4A 1K57A 3ZCZA 3B33A 3DTMA 4PM6A 2W27A 3W4QA 1PRQA 2JE5A 2JKGA 5EVID 2I9VA 2UV0E 3SS5A 3E4PA 2WUQA 3VP3A 1KGFA 1KE4A 1ZKJA 3IXDA 3OC2A 3N8LA 5A92A 2ZQ9A 3NDEA 4UA6A 2P04A 4P6BA 2Y4AA 4XXRA 5AJGA 2EXAA 1GA9A 1BUEA 4N1HA 1CJFA 4FH2A 1XFQA 4KZ7A 4DN0A 1J3WA 4WEKA 2P7JA 4OOYA 5CHJA 4OKPA 1HLUP 4S2OA 2D01A 1KVMA 5F5YA 2XD1A 2ZM2A 2XFTA 1K25A 4GS9A 5HDSA 2HV1A 4QY5A 4MEZA 3IHBA 3PYPA 4MN6A 5J8XA 3HL9A 2O0YA 2WAEA 3OPLA 5EVIC 5HPIA 4WZ5C 4LRYC 1BLCA 3LIEA 3AGEA 1SCWA 3BY8A 2J9OA 3RXXA 1BYWA 2NUTC 3ZG9B 2VGJA 3RFBA 4GD6A 1GHMA 2ZMVA 3W4OA 4GDNA 2HP5A 4I39A 3GDIA 5HWTA 5E2FA 4E3KA 1ESIA 2P9VA 4E6WA 1VEUA 5K5BA 3CLOA 3UDXA 2WGIA 4DE0A 1K56A 3EWKA 4NG2A 2QYBA 4EQIA 4IEDA 3F1OA 4E3LA 2HP6A 1FCNA 5EVLA 4BBTA 4BMWA 4KZ9A 2JKTI 5GLDA 3ZFZA 4IVIA 4E3NA 5DFYA 3HUOA 1K55C 3BRMA 4WN5A 3EQUA 3OCLA 1KVLA 4DE1A 2W3FA 3MR0A 4YNRA 3QP8A 2HDUA 1ESUA 2JC7A 3LI9A 3BWLA 1OTAA 4N9LA 1DRMA 3S1YA 5F83A 4C75A 2FH5A 5D3OA 2XROA 4FD8A 1YSQA 3IWQA 3IXHA 4N1XA 2ZC6B 2J8YA 2WKEA 3OPPA 3PTEA 4FCFA 3EEAA 2M7UA 2WKRA 1GCEA 4ETZA 1OJ5A 3BJNA 1EI5A 1PWCA 3B42A 3IF6A 5HAIA 1PI5A 4ME4A 2ZM8A 2Y2OA 3T12B 1OTDA 1CEFA 2OWJA 5FI7A 3ZG5A 1Z6FA 4EBNA 5CEDA 3FZCA 5GHYA 4EXOA 3D4FA 4DMZA 4ZJ3A 4S2MA 1BLSA 3WS0A 5F68A 5FASA 1NWZA 3CAXA 4HH3A 1PFLA 4HHDA 1BT5A 4GLQA 3R7WA 4IJGA 3NOUC 4E3IA 4EETB 4OPQA 4Z1WA 5EVIB 4BL3A 4R70A 2PU2A 3BY9A 5CERA 3P98A 3UPNA 3FC7A 5GHXA 4LCLA 2E8JA 4KZ3A 4OLGA 5AQ9A 4R3BA 2I72A 2IWBA 4KG2A 3VOZA 1FR6A 3Q81A 2VGLM 1OT6A 3RJUA 1RGYA 4EWFA 1JWVA 5AQAA 4NXGA 4WL9A 4Y5FA 5CTNA 3PBQA 4DE3A 4CPKA 2GDNA 1S0WA 4RQ9A 4QD4A 4S2JA 5I94A 4OQ0A 4QWOA 5FSRA 5CECA 1ERMA 2R78A 4JXVA 2QKPA 1TF1A 3SH8A 3G31A 4JGPA 2LB9A 3ZVTA 4IBXA 3UPPA 3FG8A 3F1NB 1H0MA 3T4OA 3BLSA 3ZGAB 3WWXA 5FEGA 3D3OA 3S22A 2UWXA 1MKIA 2PYPA 4S2NC 3GQZA 3LUQA 5GLCA 5L8MA 3M2KA 2JBFA 1NRJA 1Y54A 1PNEA 4ARZB 2VA0A 2X01A 5FAOA 3T1XA 1V9ZA 3TG9A 4QU3A 1W79A 3A3IA 3VFFA 4Y0UA 1AXBA 1GSWA 2YKHA 1BZAA 5HW3A 2FFFB 3VOLA 2V2FF 3V50A 3D72A 2M7VA 3LYXA 4PM5A 4NEED 2O9CA 2QJ7A 3DTEA 4GHIA 1KE3A 1YT4A 4HQAA 2QMIA 1PYYA 4II7A 3ZDJA 1L0GA 1MY8A 3A3FA 4N92A 1ALQA 4PKYA 4EUVA 3NOTC 3Q7VA 5L2FA 2GNXA 3H7WB 1K57C 3MMHA 1NZUA 4KQDA 2WK0A 3G2YA 3IHAA 3NBLA 3AGDA 3WS2A 3LR0A 3IS2B 1XFNA 1MWUA 4JF4A 3A3DA 5HD5A 1YAXA 5EM1A 3OPHA 5L09A 1ZC2A 3C2WA 4MN7A 4NETA 4DJ2A 1H3QA 1TD5A 2HP9A 2INWA 4JBFA 1K4FA 3LGOA 5AQBA 1NXYA 3C7VA 2A24A 2M1CA 4Y0TA 2PBDP 4BD1A 4X68A 2Y2QA
chains in the Genus database with same CATH topology
3RXWA 1CI8A 4UHUA 5KZHA 3IT9A 5M1AA 4N9KA 1L2SA 2FFYA 5TR7A 4ZDXA 1SKFA 3Q1FA 2WGWA 4HEFA 4OP5A 3Q7VB 3VP2A 4C6YA 3OPRA 1YM1A 2OSUA 4S2KA 2XFSA 1ES2A 4OOLA 4UAAA 3ITAA 3Q7ZA 2PBYA 4MLLA 2WADA 3Q82A 1L0EA 3VP1A 2ZC3B 3IH8A 3PBNA 4OPZA 1N4OA 4JXSA 2Y2MA 1VQQA 4KG5A 5FQIA 5FQKA 4IBRA 1LL5A 3A3JA 4KENB 4S2LA 1WYCA 2R9XA 5CEBA 5HX9A 1RCJA 3UDIA 3IH9A 5IHVA 1E25A 2V1ZA 3ZG0A 3M2JA 4BLMA 1K38A 5F1FA 2J9PA 4U0TA 1H8YA 4HBTA 3BFEA 3WRZA 1K57A 1PW1A 3BYDA 2OV5A 3ZCZA 2XDMA 2RL3A 3WS4A 3DTMA 3FKWA 4PM6A 2WYXA 1FCOA 2H0YA 5E2GA 3W4QA 1K4EA 2JE5A 4GZBA 1HD8A 3FWLA 5FQJA 3NY4A 3HLWA 1CI9A 1JTDA 5E2EA 5EVID 1LL9A 2OLUA 4BD0A 1O7EA 4GKUA 3SS5A 2EX8A 2WUQA 3VP3A 1U60A 1KGFA 3BFDA 3ITBA 1KE4A 3IXGA 3OZHA 1JWZA 2X71A 1ZKJA 3IXDA 2BG1A 2XGNA 1MXOA 3UNWA 3DWKA 3Q07A 5KMWA 3OC2A 4QHCA 3N8LA 1BTLA 5AQ7A 5FDHA 5M19A 3E2KA 4MBKA 1LI0A 4WZ5A 5A92A 4K0XA 1K54A 5BOHA 1TVFA 2ZQ9A 4ID4A 3NDEA 4R1GA 4UA6A 2E8IA 2ZQAA 4P6BA 1M6KA 1EWZA 2Y4AA 4XXRA 2XQZA 2EXAA 4KQOA 3BLMA 2XR0A 4X55A 1GA9A 4F94A 3UO9A 4UA7A 2C5WB 1MWSA 1BUEA 4WYYA 4N1HA 3SS3A 3O86A 2ZC5B 3QHYA 4DRTA 1C3BA 3LO7A 4OH0A 5DF8A 1YMSA 1ZG6A 5EECA 3IQAA 4FH2A 4KZ7A 4RA7A 3BEBA 4YFMA 4DDSA 4WEKA 4U3TA 3TOIA 4OOYA 4EUZA 5CHJA 2A49A 4E3OA 4OKPA 1G6AA 3MFDA 4S2OA 3GV9A 3NIAA 1KVMA 3WS1A 1NYYA 2XD1A 2ZM2A 3MXSA 1SDNA 2XFTA 1E4DA 1KGGA 4S2IA 1K25A 4LV0A 3GRJA 1WE4A 1KE0A 4QY5A 5U47A 5FI6A 4MBFA 1NYMA 2CC1A 3O88A 1HTZA 1QMEA 3IHBA 4MEZA 5J8XA 5A91A 3HL9A 4Z9QA 3UY6A 2ZC7A 3HBRA 2WAEA 4X69A 4WMCA 3ZVWA 2J7VA 2XK1A 3OPLA 3O87A 5EVIC 4A5RA 4LCMA 1PZOA 4WZ5C 1K55A 3PBSA 4WZ4A 4X56A 4E3JA 1XXMA 1BLCA 2ZJ9A 2WZXA 1BULA 3IF5A 3AGEA 1SCWA 3RXXA 2J9OA 4C3QA 4OLDA 4HBUA 3VSKA 3ZG9B 2VGJA 4KZBA 4QJGA 3BFCA 1HZOA 1JWPA 4GD6A 3ZG8B 1GHMA 1XA7A 1SHVA 4JF6A 4GDNA 4PM9A 1L0DA 3W4OA 4BL2A 1PWDA 3ZHHA 1K56D 2HP5A 1IEMA 3DWZA 1W5DA 1CEGA 4X53A 4GDBA 5E2FA 2Y59A 4H8RA 4E3KA 1ESIA 3BECA 4QB8A 2P9VA 1TDLA 2C6WB 3C5AA 4E6WA 1OMEA 4OP8A 4R4RA 4O7DA 3UDXA 3MXRA 2WGIA 1KDWA 3MKFA 3LEZA 4JF5A 3G35A 4DE0A 4WELA 2H0TA 1GHIA 1K56A 3C7UA 5EOEA 3PAGA 4KZ4A 2DCFA 1TDGA 1E3UA 4LV2A 3CMZA 2Z2MB 5TFQA 5JYPA 4EQIA 3BFGA 5DTSA 3WRTA 2XLNA 4IEDA 4MBHA 3GSGA 4LV1A 4E3LA 3HREA 4OPRA 2HP6A 3VMAA 1FCNA 5EVLA 1SDEA 1O07A 4KZ9A 4OQHA 4GOGA 5GLDA 3UPOA 1DJBA 4Q8IA 2Y55A 3ZFZA 2OLVA 3BM6A 4GB7A 4IVIA 4OVDA 4E3NA 5TGFA 3HUOA 2IWCA 4MNRA 1WYBA 5DTKA 1IYOA 1K55C 3A3EA 4R23A 5M18A 3BRMA 4BENA 4KG6A 1XKZA 3EQUA 1I5QA 3OCLA 5HFOA 1KVLA 2WGVA 2A3UA 4DE1A 3HVFA 3CJMA 3LY4A 2ZQ8A 4KZ5A 1DJCA 2HDUA 1BLHA 1ESUA 1ERQA 3HUNA 5KSHA 2JC7A 2Y91A 5FQQA 4OONA 3PAEA 4E3MA 4KZ6A 4N9LA 3V39A 3HLDA 3S1YA 5F83A 4PM7A 2XD5A 4C75A 1FOFA 5D3OA 3SH9A 4JXGA 1HVBA 4FD8A 2RCXA 3IWQA 3IXHA 1I2SA 1QMFA 4N1XA 2ZC6B 2J8YA 2WKEA 5F82A 5FAPA 3OPPA 3PTEA 4FCFA 1XGIA 2X02A 3BFFA 2WGWB 1VM1A 3PBTA 4WM9A 4XUXA 5EVIA 4D2OA 4EBPA 1GCEA 4K91A 1YMXA 4QY6A 1EI5A 1J9MA 1DJAA 1M40A 1PWCA 1Q2QA 2IWDA 2VGKA 3GVBA 3IF6A 2PU4A 5FAQA 5HAIA 3NDGA 2Y2KA 1I2WA 1PI5A 3HLFA 4WEJA 3UDFA 3IWOA 5E2HA 4ZAMA 4HESA 2ZM8A 2Y2OA 1KDSA 4Y0OA 1XPBA 3VSLA 1YQSA 1CEFA 5FI7A 1IYSA 1RP5A 3N6IA 1MWRA 1PW8A 1Z6FA 1ZG4A 2G2UA 3ZG5A 4EBNA 3AGFA 3VOYA 3UE1A 5CEDA 4B4XA 2P74A 2Q9MA 3FZCA 5EE8A 5GHYA 1ES5A 3GR2A 3GTCA 3D4FA 4P85A 5EOOA 4EBLA 1NZOA 2Y2GA 1ES3A 4ZJ3A 4S2MA 1FSWA 1IYQA 4L0LA 3SOIA 3PBOA 1BLSA 3WS0A 4PPRA 1W8QA 1NJ4A 5FASA 4B88A 3LY3A 2Y2IA 3G32A 1BT5A 5CRFA 1IKGA 1TEMA 3CZDA 4FH4A 5CGXA 1YLJA 2EXBA 2HDQA 3IWIA 5FQ9A 4E3IA 4U0XA 3FYZA 4OPQA 4EV4A 4RYEA 1YLZA 1W7FA 5EVIB 5CHMA 4ZTKA 2ZC4B 4BL3A 3E2LA 4JLFA 4DKIA 2PU2A 4DE2A 3V5MA 3C4OA 1DY6A 3S4XA 2ZQCA 3HLGA 3P98A 4YINA 1MPLA 3IF6C 5E43A 5GLBA 5CERA 3UPNA 1PI4A 3N4IA 5GHXA 2Y2NA 1PZPA 3NI9A 4LCLA 1XGJA 3HLCA 4KZ3A 4OLGA 5AQ9A 2Y2QA 3VP4A 4R3BA 2I72A 4RX2A 4JPMA 2IWBA 1BSGA 2QPNA 4KG2A 1FR6A 3Q81A 3VOZA 2ZM0A 3OCNA 2ZD8A 3RJUA 1RGYA 3WS5A 5HARA 4EWFA 3N8SA 1JWVA 5AQAA 1CK3A 1ES4A 5HAPA 4KZ8A 3MZFA 3NC8A 3IXBA 5CXWA 4ZJ2A 4NK3A 1W8YA 5A93A 1K6SA 4R4SA 3TSGA 5CTNA 4CJNA 3PBQA 5CGWA 2H5SA 4DE3A 4CPKA 2GDNA 1YLPA 1S0WA 4JKTA 3LCEA 1FQGA 4QD4A 2ZMAA 4S2JA 2EX6A 5I94A 4OQ0A 3G2ZA 5FSRA 4KQRA 4OQGA 4X6TA 1ERMA 5CECA 1S6RA 4JXVA 4LV3A 2EX9A 2DNSA 1XP4A 3SH8A 2Y2HA 3G31A 4BQMA 2EFUA 2ZQDA 3C4PA 3ZVTA 5HAQA 2Q9NA 4IBXA 4GNUA 4KZAA 2WKIA 3UE0A 3UPPA 4GN2A 1EROA 2HPBA 3G30A 1ONHA 2XEPA 3M6HA 4PMAA 1IELA 1JTGA 1BLPA 2DRWA 4R3JA 3BLSA 5FI2A 3WWXA 3ZGAB 1IKIA 5EUAA 2QZ6A 3ZG7B 2Z2LB 3ZNYA 1MWTA 3S22A 2UWXA 1MKIA 3G34A 3GQZA 3FKVA 4S2NC 5GHZA 3QNBA 2HDSA 4OOMA 5CTMA 1RGZA 2B5RA 3CG5A 5FATA 5GLCA 3M2KA 4OQIA 2Y2LA 2JBFA 3QNCA 4OPYA 1Y54A 1PWGA 3B3XA 3G4PA 3UN7A 4PM8A 2P9VB 2X01A 4RVAA 1L0FA 5FAOA 4JXWA 3TG9A 3M6BA 1XA1A 3GMWA 5EPHA 4QU3A 1W79A 3A3IA 3ISGA 3NCKA 3VFFA 3JYIA 4Y0UA 4P0MA 4DF6A 4E6XA 1AXBA 4P87A 1BZAA 4S2PA 5JYOA 3N8RA 5HW3A 1PIOA 2FFFB 1N9BA 1GHPA 2V2FF 1IYPA 3VP0A 2Y2JA 3V50A 1KGEA 4DXBA 3UE3A 2HDRA 3DW0A 1NY0A 2JCHA 4B4ZA 1FR1A 3N7WA 4PM5A 1H5XA 5DF9A 2EFXA 3V3RA 5GLAA 4RX3A 5GL9A 3FV7A 1KE3A 1YT4A 2QMIA 1PYYA 3SS4A 3ZDJA 2ZQ7A 1LI9A 1GA0A 4R0QA 1L0GA 1K6RA 5A90A 3VFHA 1LHYA 1MY8A 1YLWA 1NRFA 2V20A 5FQMA 3A3FA 4M3KA 4N92A 1ALQA 5CGSA 2XF3A 3V3SA 3Q7VA 4FSFA 5DTTA 5L2FA 1K57C 2H10A 1NZUA 3O3VA 3I7JA 2WK0A 3G2YA 3IHAA 2Y2PA 1LLBA 3AGDA 3MZDA 3NBLA 3WS2A 3MZEA 1FSYA 1Q2PA 3P09A 5FA7A 3W4PA 5G18A 1MWUA 4WMCD 4JF4A 4LENA 5KSCA 3A3DA 2XH9A 3SH7A 5DF7A 4ZJ1A 3PBRA 4K0WA 3HUMA 3HLEA 2ZLYA 3IF6B 1ONGA 1FCMA 4DXCA 4IVKA 3OPHA 1XX2A 3EQVA 3MBZA 1ZC2A 5DVAA 5HL1A 4S2NA 2WAFA 1YLYA 4NETA 2WZZA 5F1GA 1YLTA 3MKEA 2EX2A 2WKHA 1K54C 2HP9A 4Y7PA 4JBFA 4UA9A 2BLSA 1K4FA 1JVJA 2G2WA 4BJPA 4XUZA 5AQBA 1MBLA 4WBGA 1NXYA 1G68A 3W8KA 3C7VA 4GD8A 3HLBA 4ZBEA 2R9WA 5CHUA 4DDYA 4Y0TA 3ZNTA 1H8ZA 4BD1A 4X68A 4KQQA 1E3UD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RXW A;  1CI8 A;  4UHU A;  5KZH A;  3IT9 A;  5M1A A;  4N9K A;  1L2S A;  2FFY A;  5TR7 A;  4ZDX A;  1SKF A;  3Q1F A;  2WGW A;  4HEF A;  4OP5 A;  3Q7V B;  3VP2 A;  4C6Y A;  3OPR A;  1YM1 A;  2OSU A;  4S2K A;  2XFS A;  1ES2 A;  4OOL A;  4UAA A;  3ITA A;  3Q7Z A;  2PBY A;  4MLL A;  2WAD A;  3Q82 A;  1L0E A;  3VP1 A;  2ZC3 B;  3IH8 A;  3PBN A;  4OPZ A;  1N4O A;  4JXS A;  2Y2M A;  1VQQ A;  4KG5 A;  5FQI A;  5FQK A;  4IBR A;  1LL5 A;  3A3J A;  4KEN B;  4S2L A;  1WYC A;  2R9X A;  5CEB A;  5HX9 A;  1RCJ A;  3UDI A;  3IH9 A;  5IHV A;  1E25 A;  2V1Z A;  3ZG0 A;  3M2J A;  4BLM A;  1K38 A;  5F1F A;  2J9P A;  4U0T A;  1H8Y A;  4HBT A;  3BFE A;  3WRZ A;  1K57 A;  1PW1 A;  3BYD A;  2OV5 A;  3ZCZ A;  2XDM A;  2RL3 A;  3WS4 A;  3DTM A;  3FKW A;  4PM6 A;  2WYX A;  1FCO A;  2H0Y A;  5E2G A;  3W4Q A;  1K4E A;  2JE5 A;  4GZB A;  1HD8 A;  3FWL A;  5FQJ A;  3NY4 A;  3HLW A;  1CI9 A;  1JTD A;  5E2E A;  5EVI D;  1LL9 A;  2OLU A;  4BD0 A;  1O7E A;  4GKU A;  3SS5 A;  2EX8 A;  2WUQ A;  3VP3 A;  1U60 A;  1KGF A;  3BFD A;  3ITB A;  1KE4 A;  3IXG A;  3OZH A;  1JWZ A;  2X71 A;  1ZKJ A;  3IXD A;  2BG1 A;  2XGN A;  1MXO A;  3UNW A;  3DWK A;  3Q07 A;  5KMW A;  3OC2 A;  4QHC A;  3N8L A;  1BTL A;  5AQ7 A;  5FDH A;  5M19 A;  3E2K A;  4MBK A;  1LI0 A;  4WZ5 A;  5A92 A;  4K0X A;  1K54 A;  5BOH A;  1TVF A;  2ZQ9 A;  4ID4 A;  3NDE A;  4R1G A;  4UA6 A;  2E8I A;  2ZQA A;  4P6B A;  1M6K A;  1EWZ A;  2Y4A A;  4XXR A;  2XQZ A;  2EXA A;  4KQO A;  3BLM A;  2XR0 A;  4X55 A;  1GA9 A;  4F94 A;  3UO9 A;  4UA7 A;  2C5W B;  1MWS A;  1BUE A;  4WYY A;  4N1H A;  3SS3 A;  3O86 A;  2ZC5 B;  3QHY A;  4DRT A;  1C3B A;  3LO7 A;  4OH0 A;  5DF8 A;  1YMS A;  1ZG6 A;  5EEC A;  3IQA A;  4FH2 A;  4KZ7 A;  4RA7 A;  3BEB A;  4YFM A;  4DDS A;  4WEK A;  4U3T A;  3TOI A;  4OOY A;  4EUZ A;  5CHJ A;  2A49 A;  4E3O A;  4OKP A;  1G6A A;  3MFD A;  4S2O A;  3GV9 A;  3NIA A;  1KVM A;  3WS1 A;  1NYY A;  2XD1 A;  2ZM2 A;  3MXS A;  1SDN A;  2XFT A;  1E4D A;  1KGG A;  4S2I A;  1K25 A;  4LV0 A;  3GRJ A;  1WE4 A;  1KE0 A;  4QY5 A;  5U47 A;  5FI6 A;  4MBF A;  1NYM A;  2CC1 A;  3O88 A;  1HTZ A;  1QME A;  3IHB A;  4MEZ A;  5J8X A;  5A91 A;  3HL9 A;  4Z9Q A;  3UY6 A;  2ZC7 A;  3HBR A;  2WAE A;  4X69 A;  4WMC A;  3ZVW A;  2J7V A;  2XK1 A;  3OPL A;  3O87 A;  5EVI C;  4A5R A;  4LCM A;  1PZO A;  4WZ5 C;  1K55 A;  3PBS A;  4WZ4 A;  4X56 A;  4E3J A;  1XXM A;  1BLC A;  2ZJ9 A;  2WZX A;  1BUL A;  3IF5 A;  3AGE A;  1SCW A;  3RXX A;  2J9O A;  4C3Q A;  4OLD A;  4HBU A;  3VSK A;  3ZG9 B;  2VGJ A;  4KZB A;  4QJG A;  3BFC A;  1HZO A;  1JWP A;  4GD6 A;  3ZG8 B;  1GHM A;  1XA7 A;  1SHV A;  4JF6 A;  4GDN A;  4PM9 A;  1L0D A;  3W4O A;  4BL2 A;  1PWD A;  3ZHH A;  1K56 D;  2HP5 A;  1IEM A;  3DWZ A;  1W5D A;  1CEG A;  4X53 A;  4GDB A;  5E2F A;  2Y59 A;  4H8R A;  4E3K A;  1ESI A;  3BEC A;  4QB8 A;  2P9V A;  1TDL A;  2C6W B;  3C5A A;  4E6W A;  1OME A;  4OP8 A;  4R4R A;  4O7D A;  3UDX A;  3MXR A;  2WGI A;  1KDW A;  3MKF A;  3LEZ A;  4JF5 A;  3G35 A;  4DE0 A;  4WEL A;  2H0T A;  1GHI A;  1K56 A;  3C7U A;  5EOE A;  3PAG A;  4KZ4 A;  2DCF A;  1TDG A;  1E3U A;  4LV2 A;  3CMZ A;  2Z2M B;  5TFQ A;  5JYP A;  4EQI A;  3BFG A;  5DTS A;  3WRT A;  2XLN A;  4IED A;  4MBH A;  3GSG A;  4LV1 A;  4E3L A;  3HRE A;  4OPR A;  2HP6 A;  3VMA A;  1FCN A;  5EVL A;  1SDE A;  1O07 A;  4KZ9 A;  4OQH A;  4GOG A;  5GLD A;  3UPO A;  1DJB A;  4Q8I A;  2Y55 A;  3ZFZ A;  2OLV A;  3BM6 A;  4GB7 A;  4IVI A;  4OVD A;  4E3N A;  5TGF A;  3HUO A;  2IWC A;  4MNR A;  1WYB A;  5DTK A;  1IYO A;  1K55 C;  3A3E A;  4R23 A;  5M18 A;  3BRM A;  4BEN A;  4KG6 A;  1XKZ A;  3EQU A;  1I5Q A;  3OCL A;  5HFO A;  1KVL A;  2WGV A;  2A3U A;  4DE1 A;  3HVF A;  3CJM A;  3LY4 A;  2ZQ8 A;  4KZ5 A;  1DJC A;  2HDU A;  1BLH A;  1ESU A;  1ERQ A;  3HUN A;  5KSH A;  2JC7 A;  2Y91 A;  5FQQ A;  4OON A;  3PAE A;  4E3M A;  4KZ6 A;  4N9L A;  3V39 A;  3HLD A;  3S1Y A;  5F83 A;  4PM7 A;  2XD5 A;  4C75 A;  1FOF A;  5D3O A;  3SH9 A;  4JXG A;  1HVB A;  4FD8 A;  2RCX A;  3IWQ A;  3IXH A;  1I2S A;  1QMF A;  4N1X A;  2ZC6 B;  2J8Y A;  2WKE A;  5F82 A;  5FAP A;  3OPP A;  3PTE A;  4FCF A;  1XGI A;  2X02 A;  3BFF A;  2WGW B;  1VM1 A;  3PBT A;  4WM9 A;  4XUX A;  5EVI A;  4D2O A;  4EBP A;  1GCE A;  4K91 A;  1YMX A;  4QY6 A;  1EI5 A;  1J9M A;  1DJA A;  1M40 A;  1PWC A;  1Q2Q A;  2IWD A;  2VGK A;  3GVB A;  3IF6 A;  2PU4 A;  5FAQ A;  5HAI A;  3NDG A;  2Y2K A;  1I2W A;  1PI5 A;  3HLF A;  4WEJ A;  3UDF A;  3IWO A;  5E2H A;  4ZAM A;  4HES A;  2ZM8 A;  2Y2O A;  1KDS A;  4Y0O A;  1XPB A;  3VSL A;  1YQS A;  1CEF A;  5FI7 A;  1IYS A;  1RP5 A;  3N6I A;  1MWR A;  1PW8 A;  1Z6F A;  1ZG4 A;  2G2U A;  3ZG5 A;  4EBN A;  3AGF A;  3VOY A;  3UE1 A;  5CED A;  4B4X A;  2P74 A;  2Q9M A;  3FZC A;  5EE8 A;  5GHY A;  1ES5 A;  3GR2 A;  3GTC A;  3D4F A;  4P85 A;  5EOO A;  4EBL A;  1NZO A;  2Y2G A;  1ES3 A;  4ZJ3 A;  4S2M A;  1FSW A;  1IYQ A;  4L0L A;  3SOI A;  3PBO A;  1BLS A;  3WS0 A;  4PPR A;  1W8Q A;  1NJ4 A;  5FAS A;  4B88 A;  3LY3 A;  2Y2I A;  3G32 A;  1BT5 A;  5CRF A;  1IKG A;  1TEM A;  3CZD A;  4FH4 A;  5CGX A;  1YLJ A;  2EXB A;  2HDQ A;  3IWI A;  5FQ9 A;  4E3I A;  4U0X A;  3FYZ A;  4OPQ A;  4EV4 A;  4RYE A;  1YLZ A;  1W7F A;  5EVI B;  5CHM A;  4ZTK A;  2ZC4 B;  4BL3 A;  3E2L A;  4JLF A;  4DKI A;  2PU2 A;  4DE2 A;  3V5M A;  3C4O A;  1DY6 A;  3S4X A;  2ZQC A;  3HLG A;  3P98 A;  4YIN A;  1MPL A;  3IF6 C;  5E43 A;  5GLB A;  5CER A;  3UPN A;  1PI4 A;  3N4I A;  5GHX A;  2Y2N A;  1PZP A;  3NI9 A;  4LCL A;  1XGJ A;  3HLC A;  4KZ3 A;  4OLG A;  5AQ9 A;  2Y2Q A;  3VP4 A;  4R3B A;  2I72 A;  4RX2 A;  4JPM A;  2IWB A;  1BSG A;  2QPN A;  4KG2 A;  1FR6 A;  3Q81 A;  3VOZ A;  2ZM0 A;  3OCN A;  2ZD8 A;  3RJU A;  1RGY A;  3WS5 A;  5HAR A;  4EWF A;  3N8S A;  1JWV A;  5AQA A;  1CK3 A;  1ES4 A;  5HAP A;  4KZ8 A;  3MZF A;  3NC8 A;  3IXB A;  5CXW A;  4ZJ2 A;  4NK3 A;  1W8Y A;  5A93 A;  1K6S A;  4R4S A;  3TSG A;  5CTN A;  4CJN A;  3PBQ A;  5CGW A;  2H5S A;  4DE3 A;  4CPK A;  2GDN A;  1YLP A;  1S0W A;  4JKT A;  3LCE A;  1FQG A;  4QD4 A;  2ZMA A;  4S2J A;  2EX6 A;  5I94 A;  4OQ0 A;  3G2Z A;  5FSR A;  4KQR A;  4OQG A;  4X6T A;  1ERM A;  5CEC A;  1S6R A;  4JXV A;  4LV3 A;  2EX9 A;  2DNS A;  1XP4 A;  3SH8 A;  2Y2H A;  3G31 A;  4BQM A;  2EFU A;  2ZQD A;  3C4P A;  3ZVT A;  5HAQ A;  2Q9N A;  4IBX A;  4GNU A;  4KZA A;  2WKI A;  3UE0 A;  3UPP A;  4GN2 A;  1ERO A;  2HPB A;  3G30 A;  1ONH A;  2XEP A;  3M6H A;  4PMA A;  1IEL A;  1JTG A;  1BLP A;  2DRW A;  4R3J A;  3BLS A;  5FI2 A;  3WWX A;  3ZGA B;  1IKI A;  5EUA A;  2QZ6 A;  3ZG7 B;  2Z2L B;  3ZNY A;  1MWT A;  3S22 A;  2UWX A;  1MKI A;  3G34 A;  3GQZ A;  3FKV A;  4S2N C;  5GHZ A;  3QNB A;  2HDS A;  4OOM A;  5CTM A;  1RGZ A;  2B5R A;  3CG5 A;  5FAT A;  5GLC A;  3M2K A;  4OQI A;  2Y2L A;  2JBF A;  3QNC A;  4OPY A;  1Y54 A;  1PWG A;  3B3X A;  3G4P A;  3UN7 A;  4PM8 A;  2P9V B;  2X01 A;  4RVA A;  1L0F A;  5FAO A;  4JXW A;  3TG9 A;  3M6B A;  1XA1 A;  3GMW A;  5EPH A;  4QU3 A;  1W79 A;  3A3I A;  3ISG A;  3NCK A;  3VFF A;  3JYI A;  4Y0U A;  4P0M A;  4DF6 A;  4E6X A;  1AXB A;  4P87 A;  1BZA A;  4S2P A;  5JYO A;  3N8R A;  5HW3 A;  1PIO A;  2FFF B;  1N9B A;  1GHP A;  2V2F F;  1IYP A;  3VP0 A;  2Y2J A;  3V50 A;  1KGE A;  4DXB A;  3UE3 A;  2HDR A;  3DW0 A;  1NY0 A;  2JCH A;  4B4Z A;  1FR1 A;  3N7W A;  4PM5 A;  1H5X A;  5DF9 A;  2EFX A;  3V3R A;  5GLA A;  4RX3 A;  5GL9 A;  3FV7 A;  1KE3 A;  1YT4 A;  2QMI A;  1PYY A;  3SS4 A;  3ZDJ A;  2ZQ7 A;  1LI9 A;  1GA0 A;  4R0Q A;  1L0G A;  1K6R A;  5A90 A;  3VFH A;  1LHY A;  1MY8 A;  1YLW A;  1NRF A;  2V20 A;  5FQM A;  3A3F A;  4M3K A;  4N92 A;  1ALQ A;  5CGS A;  2XF3 A;  3V3S A;  3Q7V A;  4FSF A;  5DTT A;  5L2F A;  1K57 C;  2H10 A;  1NZU A;  3O3V A;  3I7J A;  2WK0 A;  3G2Y A;  3IHA A;  2Y2P A;  1LLB A;  3AGD A;  3MZD A;  3NBL A;  3WS2 A;  3MZE A;  1FSY A;  1Q2P A;  3P09 A;  5FA7 A;  3W4P A;  5G18 A;  1MWU A;  4WMC D;  4JF4 A;  4LEN A;  5KSC A;  3A3D A;  2XH9 A;  3SH7 A;  5DF7 A;  4ZJ1 A;  3PBR A;  4K0W A;  3HUM A;  3HLE A;  2ZLY A;  3IF6 B;  1ONG A;  1FCM A;  4DXC A;  4IVK A;  3OPH A;  1XX2 A;  3EQV A;  3MBZ A;  1ZC2 A;  5DVA A;  5HL1 A;  4S2N A;  2WAF A;  1YLY A;  4NET A;  2WZZ A;  5F1G A;  1YLT A;  3MKE A;  2EX2 A;  2WKH A;  1K54 C;  2HP9 A;  4Y7P A;  4JBF A;  4UA9 A;  2BLS A;  1K4F A;  1JVJ A;  2G2W A;  4BJP A;  4XUZ A;  5AQB A;  1MBL A;  4WBG A;  1NXY A;  1G68 A;  3W8K A;  3C7V A;  4GD8 A;  3HLB A;  4ZBE A;  2R9W A;  5CHU A;  4DDY A;  4Y0T A;  3ZNT A;  1H8Z A;  4BD1 A;  4X68 A;  4KQQ A;  1E3U D; 
#chains in the Genus database with same CATH topology
 3RXW A;  1X0O A;  5M1A A;  4N9K A;  5TR7 A;  1SKF A;  1TS6 A;  3KSF A;  3VP2 A;  4UQI M;  4NKP A;  4HH2 A;  4OOL A;  3KSG A;  4UAA A;  3ITA A;  4MLL A;  5HWV A;  3IH8 A;  4OPZ A;  4JXS A;  2Y2M A;  2D02 A;  5DJU A;  4CLC E;  4EQ1 A;  3A3J A;  4KEN B;  2VGL S;  3UB9 A;  3IBJ A;  1RCJ A;  2OAQ 1;  1E25 A;  4BLM A;  5F1F A;  4MDZ A;  3WRZ A;  2KOI A;  1UGU A;  2OV5 A;  3S7P A;  3WS4 A;  2H0Y A;  3PXP A;  2OLU A;  1T18 A;  5C5K A;  2VKS A;  1O7E A;  3MQO A;  3QP1 A;  4HJ4 A;  1U60 A;  3ITB A;  3OZH A;  2BG1 A;  1MXO A;  3DWK A;  3Q07 A;  1BTL A;  1F5M A;  3E2K A;  3A0R A;  1LI0 A;  4MBK A;  1TVF A;  4ID4 A;  4R1G A;  5EPH A;  4L9F A;  1LT0 A;  4XT2 A;  4KQO A;  2KX6 A;  1YPR A;  1N9N A;  4X55 A;  4F94 A;  4UA7 A;  4HJ3 A;  1XJ2 A;  2W1T B;  4WYY A;  3SS3 A;  3QHY A;  3UB8 A;  4DRT A;  1YMS A;  4WF0 A;  5EEC A;  5FEF A;  4CLC A;  1Y4O A;  2PT7 A;  4G3K A;  1NYY A;  2HJ9 C;  3DAV A;  1E4D A;  1KGG A;  3GRJ A;  3BQA A;  3EEH A;  4MBF A;  1S66 L;  1NYM A;  5I5L A;  3O88 A;  2VZW A;  5A91 A;  4Z9Q A;  4X69 A;  3FPV A;  2J7V A;  4A5R A;  1T19 A;  4LCM A;  4E3J A;  4X56 A;  1XXM A;  3IF5 A;  2L1M A;  3CPT A;  4C3Q A;  5DFX A;  5L10 A;  3ZG8 B;  3T4S A;  4F3L A;  1TS0 A;  3ZHH A;  1W5D A;  1CEG A;  1W63 Q;  2VLG A;  2Y59 A;  1SKO A;  2GZA A;  3BEC A;  4QB8 A;  2C6W B;  3C5A A;  1OME A;  4OP8 A;  4R4R A;  1KDW A;  3G35 A;  1OT9 A;  1GHI A;  4P6Z M;  5EOE A;  3PAG A;  4KZ4 A;  4K08 A;  1E3U A;  4LV2 A;  3CMZ A;  2Z2M B;  3BFG A;  2XLN A;  4GS9 B;  4LV1 A;  3HRE A;  1O07 A;  4OQH A;  4Q8I A;  2Y55 A;  4OVD A;  4GB7 A;  3CWF A;  5TGF A;  1WYB A;  5DTK A;  5M18 A;  5FL3 A;  5HFO A;  2WGV A;  2A3U A;  2ZQ8 A;  1H8M A;  4E3M A;  4KZ6 A;  3V39 A;  3HLD A;  4PM7 A;  1FOF A;  2NUP C;  4L9G A;  4UQI S;  2RCX A;  3MFX A;  3KSH A;  5FAP A;  3BFF A;  2WGW B;  4XUX A;  2K7S A;  4K91 A;  3H9W A;  1YMX A;  1FIK A;  1M40 A;  1DJA A;  2QJ5 A;  2IWD A;  2VGK A;  2PU4 A;  3OBF A;  1I2W A;  5AVF A;  4AFI A;  1IYS A;  1RP5 A;  3DTK A;  4HI4 A;  1F2K A;  5EOO A;  2Y2G A;  2IA2 A;  1IYQ A;  4L0L A;  4EEP A;  5HWW A;  3S7Q A;  3LY3 A;  5MC7 A;  3H82 A;  1IKG A;  4EV4 A;  4RYE A;  1YLZ A;  5CHM A;  3V5M A;  3C4O A;  1DY6 A;  2PHY A;  3HLG A;  4YIN A;  1MPL A;  1XJ3 A;  3U4L P;  3PHY A;  2Y2N A;  3HLC A;  4R6L A;  3VE4 A;  3VP4 A;  4JPM A;  1BSG A;  3NHQ A;  3OCN A;  2ZD8 A;  3E98 A;  1CK3 A;  2PR5 A;  3F1P B;  4KZ8 A;  3MZF A;  1K6S A;  4R4S A;  3TSG A;  1A0K A;  4MCW A;  1YKD A;  5CGW A;  2H5S A;  2MJ6 A;  1FQG A;  3G2Z A;  4I3I A;  2VV8 A;  3A0V A;  4D60 A;  3C4P A;  4KZA A;  2W3D A;  3MQ0 A;  2V8F A;  4GN2 A;  1ERO A;  2HPB A;  4Y17 A;  4PMA A;  1IEL A;  1JTG A;  5G4Z A;  4R3J A;  5FI2 A;  1W63 M;  1IKI A;  5EUA A;  2QZ6 A;  3ZG7 B;  3IBR A;  3KSI A;  3ZNY A;  2G7U A;  3FKV A;  5FAT A;  1PWG A;  4P6Z S;  3G4P A;  3UN7 A;  1S1Y A;  1LSW A;  5EV0 A;  1TS7 A;  4QPR A;  4JXW A;  4PHT A;  2JKR M;  1P97 A;  2J3T D;  3ISG A;  3JYI A;  3JVU A;  2YKF A;  4S2P A;  2QWS A;  3GEC A;  1GHP A;  3VP0 A;  2Y2J A;  5G4Y A;  2HDR A;  2XA7 M;  3V3R A;  4RX3 A;  5GL9 A;  5HD3 A;  3KYE A;  2OAP 1;  1LI9 A;  1IOU A;  1OPX A;  3D9Y A;  2FZ0 A;  4CLC D;  1LHY A;  1NRF A;  4M3K A;  2BTF P;  2XF3 A;  4FSF A;  4HOI A;  3O3V A;  3I7J A;  3CHW P;  1FIL A;  3P09 A;  3W4P A;  2PDR A;  3E4Q A;  2XH9 A;  3SH7 A;  4EU0 A;  1UWP X;  4K0W A;  3HUM A;  3HLE A;  1ONG A;  4DXC A;  1EW0 A;  2L4R A;  5HL1 A;  3IX3 A;  2J3T C;  3MKE A;  2EX2 A;  3MJQ A;  1G5U A;  4MN5 A;  4Y7P A;  4UA9 A;  1XJ6 A;  1STZ A;  2R9W A;  2ZL1 A;  5CHU A;  4ZBE A;  4KQQ A;  1E3U D;  4E04 A;  1CI8 A;  4UHU A;  5KZH A;  4LGW A;  4LRX C;  3QP2 A;  3Q7V B;  1VET A;  2OSU A;  2XFS A;  4CLC C;  3ICY A;  4O01 A;  3Q7Z A;  5TJJ A;  4YOF A;  3Q82 A;  3UB5 P;  4KG5 A;  1LL5 A;  3BW6 A;  1WYC A;  2R9X A;  2PRF A;  3DBA A;  4HP4 A;  3IH9 A;  2V1Z A;  4ZRR A;  2J9P A;  3BFE A;  1PW1 A;  3BYD A;  3T4T A;  3VV4 A;  4M4X A;  2RL3 A;  3NEC A;  3K3D A;  5E2G A;  4GZB A;  3FWL A;  3NY4 A;  2WKQ A;  1CI9 A;  5E2E A;  1LL9 A;  4BD0 A;  4H6J B;  4Y13 A;  4YWZ A;  2Q0O A;  3IXG A;  1JWZ A;  5KMW A;  2PD7 A;  4O0P A;  4QHC A;  5AQ7 A;  1SZV A;  5FDH A;  5M19 A;  4WZ5 A;  5J3W A;  2ZQA A;  1M6K A;  3RTY A;  3S7N A;  5IT5 A;  2XR0 A;  3TJZ C;  2O99 A;  3UO9 A;  2C5W B;  1MWS A;  1P9R A;  1DP6 A;  4BBV A;  3LO7 A;  1ZG6 A;  3IX8 A;  3BEB A;  3RH8 B;  4DDS A;  3TOI A;  3ZYT A;  4E3O A;  5TBM A;  3KYQ A;  3GV9 A;  3NIA A;  3WS1 A;  3MXS A;  2J80 A;  4S2I A;  4LV0 A;  3EGD C;  5AVE A;  5U47 A;  1HTZ A;  2XA7 S;  3UY6 A;  3ZVW A;  3O87 A;  1K55 A;  4WZ4 A;  3MXQ A;  2H28 A;  4JGQ A;  4OLD A;  3VSK A;  2A2L A;  1JWP A;  3B47 A;  4XT2 B;  1XA7 A;  1SHV A;  4PM9 A;  3NUL A;  5DKL A;  1K56 D;  1IEM A;  4X25 A;  4X53 A;  4GDB A;  4H8R A;  2W0N A;  2W1R A;  3C38 A;  3MXR A;  3MKF A;  2WKP A;  4WEL A;  3C7U A;  4CLC B;  1TDG A;  4UEY A;  2K2N A;  5TFQ A;  1D7E A;  3GSG A;  4FOF A;  3VMA A;  1SDE A;  4JGR A;  4GOG A;  3UPO A;  1DJB A;  3BM6 A;  4R23 A;  3A3E A;  1D1J A;  3L9K A;  4KG6 A;  1G28 A;  1OTI A;  3C30 A;  3CJM A;  3LY4 A;  4KZ5 A;  1BLH A;  3HUN A;  5FQQ A;  2ZOH A;  4NXF A;  1LSV A;  1P9W A;  2CMN A;  2Y79 A;  2XD5 A;  4F3L B;  3SH9 A;  1HVB A;  1MKM A;  4GCZ A;  5F82 A;  1XGI A;  2W3H A;  4X1M A;  4WM9 A;  1DP8 A;  4B9O A;  1YSP A;  4HNB A;  3EGX C;  4HBT A;  1J9M A;  1Q2Q A;  3K3C A;  5HL6 A;  3UB6 A;  2Y2K A;  1ODV A;  4WEJ A;  4HES A;  3LEQ A;  3TRC A;  5HDC A;  3N6I A;  1S1Z A;  1PW8 A;  2G2U A;  4D2O A;  2P74 A;  2Q9M A;  4L9E A;  3K2N A;  5EE8 A;  3GR2 A;  3GTC A;  4KUO A;  4P85 A;  4EBL A;  1NZO A;  1ES3 A;  2PD8 A;  1FSW A;  3PBO A;  4PPR A;  1NJ4 A;  4IUK A;  2Y2I A;  5CRF A;  5CX7 A;  1TEM A;  4FH4 A;  2HDQ A;  3FYZ A;  1CQA A;  2HF6 A;  3E2L A;  4JLF A;  1VHM A;  3S4X A;  3W2Z A;  3IF6 C;  5GLB A;  1PZP A;  3HCY A;  4RX2 A;  2JKR I;  3T1Q B;  5LBR A;  2W3E A;  2PR6 A;  2ZM0 A;  3LR5 A;  3WS5 A;  3VE3 A;  1JNU A;  5HDD A;  3NC8 A;  3IXB A;  5CXW A;  4ZJ2 A;  3UE6 A;  4CJN A;  2EA9 A;  1YLP A;  1ZTU A;  4JKT A;  2ZMA A;  2EX6 A;  4OQG A;  4X6T A;  4I5S A;  4Y15 A;  1S6R A;  1K0K A;  3CI6 A;  3JVV A;  4LLO B;  4LV3 A;  3UB7 A;  1AWI A;  1XP4 A;  4BQM A;  1ACF A;  5HSQ A;  3UE0 A;  3G30 A;  2XEP A;  2DRW A;  1S4R A;  5J4E A;  2Z2L B;  3EOI A;  4Q0J A;  3QNB A;  1RGZ A;  3CG5 A;  4OQI A;  2OWH A;  2Y2L A;  1GSV A;  1F98 A;  3QP5 A;  3QNC A;  5HPF A;  4ESP A;  4GJ4 A;  4O8G A;  4PM8 A;  2P9V B;  4RVA A;  1VEU B;  1L0F A;  4R3A A;  2XRN A;  1XA1 A;  3GMW A;  2JHE A;  4FTX A;  2Y8H A;  4PAU A;  4DF6 A;  4E6X A;  1PIO A;  1IYP A;  3E0Y A;  3F1O B;  4DXB A;  3UE3 A;  3DW0 A;  1NY0 A;  2JCH A;  1Z09 A;  3N7W A;  5DF9 A;  2KDK A;  5GLA A;  2GJ3 A;  3V67 A;  3SS4 A;  2ZQ7 A;  5A90 A;  5FQM A;  5HZH A;  1WA9 A;  5CGS A;  3V3S A;  5DTT A;  4I38 A;  2H10 A;  4DJ3 A;  1LLB A;  1FSY A;  3MF0 A;  4IUH A;  4B93 A;  5DF7 A;  3UMD A;  4ZJ1 A;  3PBR A;  2ZLY A;  3IF6 B;  1FCM A;  4IVK A;  1XX2 A;  2JN7 A;  3EQV A;  2V9A A;  2WAF A;  2V0W A;  2WZZ A;  5F1G A;  3MQQ A;  2WKH A;  2PYR A;  5EM0 A;  3OOV A;  3T50 A;  1JVJ A;  4HIA A;  2G2W A;  4BJP A;  4XUZ A;  1MBL A;  4GD8 A;  3LI8 A;  1TS8 A;  4IHQ A;  1OJG A;  4DDY A;  1H8Z A;  4MMN A;  2GX5 A;  2Z6D A;  3KO6 A;  4HEF A;  2WGW A;  4OP5 A;  3T4Q A;  3R7W B;  3LID A;  4S2K A;  1MC0 A;  4HJ6 A;  2PBY A;  2WAD A;  3VP1 A;  3TW8 A;  3PBN A;  3CUE A;  1VQQ A;  3QP6 A;  5CEB A;  3UDI A;  5IHV A;  3ZG0 A;  3M2J A;  2HJE A;  1K38 A;  2VX8 A;  4U0T A;  5FDS A;  2ZMF A;  2XDM A;  4PKY G;  1T1B A;  3FKW A;  2WYX A;  1FCO A;  2V1B A;  1K4E A;  1HD8 A;  5FQJ A;  3HLW A;  1JTD A;  3P01 A;  3P7N A;  5DJT A;  4GKU A;  2ZL1 B;  2EX8 A;  5EVE A;  4X1L A;  3BFD A;  2X71 A;  2EWV A;  2XGN A;  2VK3 A;  3UNW A;  3T1R A;  2O9B A;  3FPW A;  5KIZ A;  1VET B;  4K0X A;  1K54 A;  5BOH A;  2E8I A;  4WUJ A;  1EWZ A;  2XQZ A;  3BLM A;  1V9Y A;  3E4O A;  5A8B A;  3O86 A;  2ZC5 B;  1C3B A;  4OH0 A;  3L7H A;  1UWN X;  5DF8 A;  3F1P A;  4GW9 A;  3IQA A;  4RA7 A;  4YFM A;  4U3T A;  2AVX A;  2VV6 A;  2ZBB A;  3DTI A;  4EUZ A;  2JKF A;  2A49 A;  1G6A A;  3MFD A;  4KUK A;  1Y28 A;  3IX4 A;  1SDN A;  3OLO A;  2V1A A;  1WE4 A;  1KE0 A;  5FI6 A;  2CC1 A;  1QME A;  2ZC7 A;  3HBR A;  5J7E A;  4WMC A;  1T1C A;  2XK1 A;  1PZO A;  2V8C A;  3PBS A;  4G3W A;  3LIF A;  2ZJ9 A;  2WZX A;  1BUL A;  4HBU A;  4KZB A;  4QJG A;  3BFC A;  1HZO A;  4NXB A;  4GHI B;  3SW1 A;  3LFV A;  4JF6 A;  4BL2 A;  1L0D A;  2HZ5 A;  1PWD A;  3DWZ A;  3T4K A;  2BAS A;  2QHK A;  4Y2F A;  1TDL A;  3UME A;  4O7D A;  4G3V A;  4JF5 A;  3LEZ A;  1G6O A;  2H0T A;  5TBM B;  2DCF A;  1NLZ A;  5JYP A;  4EW7 A;  2B02 A;  5DTS A;  3WRT A;  1NLY A;  4MBH A;  4OPR A;  2O9A A;  3NOP C;  1S4S A;  4BWI A;  3HJK A;  4LFU A;  2OLV A;  2KLI A;  4MNR A;  2IWC A;  1IYO A;  2VV7 A;  4BEN A;  1MZU A;  1XKZ A;  1I5Q A;  4NXE A;  3HVF A;  1DJC A;  5KSH A;  1ERQ A;  2Y91 A;  4OON A;  1T1A A;  3PAE A;  2A24 B;  2OOL A;  4JXG A;  4WLA A;  1I2S A;  1QMF A;  2V0U A;  2VEA A;  2X02 A;  3G6O A;  3PBT A;  4EER A;  1VM1 A;  5EVI A;  4EBP A;  4QY6 A;  1D06 A;  5F69 A;  1IFQ A;  3GVB A;  5FAQ A;  3NDG A;  3HLF A;  3UDF A;  3IWO A;  5E2H A;  3CIT A;  4ZAM A;  1N9O A;  1KDS A;  4Y0O A;  1XPB A;  3VSL A;  1YQS A;  1MWR A;  1ZG4 A;  3AGF A;  3VOY A;  3UE1 A;  4B4X A;  2HGV A;  1ES5 A;  2JKT M;  3SOI A;  3T4J A;  1CF0 A;  1W8Q A;  4B88 A;  3HJI A;  4HY8 A;  3G32 A;  1OTE A;  3MS6 A;  4EES A;  3CZD A;  5CGX A;  1YLJ A;  2EXB A;  3IWI A;  5FQ9 A;  4U0X A;  2PAV P;  1W7F A;  3F1N A;  4ZTK A;  3KX0 X;  2ZC4 B;  4DKI A;  4DE2 A;  2ZQC A;  5E43 A;  3TE8 A;  1PI4 A;  3N4I A;  2ACG A;  2J3W A;  3A0S A;  3NI9 A;  1XGJ A;  1N9L A;  4R38 A;  2QPN A;  2P08 A;  5HAR A;  3N8S A;  4ARZ A;  1ES4 A;  5HAP A;  2VJW A;  1W8Y A;  4NK3 A;  5A93 A;  2XSS A;  3KYZ A;  5F6A A;  3C8C A;  1L3L A;  4H6J A;  3SZT A;  3LCE A;  4KQR A;  2B95 A;  3BQ8 A;  3S7O A;  2EX9 A;  2DNS A;  2Y2H A;  2EFU A;  2ZQD A;  5HAQ A;  2Q9N A;  3ZQ5 A;  4GNU A;  2WKI A;  5IU1 A;  1P0Z A;  1ONH A;  3M6H A;  1BLP A;  3CPT B;  1MWT A;  1VB6 A;  3G34 A;  5GHZ A;  4ETX A;  2DMW A;  2HDS A;  4OOM A;  3H7W A;  2B5R A;  5CTM A;  2B18 A;  3PR6 A;  4OPY A;  1DP9 A;  3B3X A;  1SKO B;  1ZHH B;  4I3A A;  1KOU A;  3IS2 A;  4I3J A;  3M6B A;  2Z6C A;  3NCK A;  5L07 A;  4P0M A;  1OTB A;  3T1S A;  4P87 A;  5JYO A;  2W3G A;  3LIC A;  3N8R A;  1N9B A;  1KGE A;  4B4Z A;  1FR1 A;  5DKK A;  1H5X A;  2EFX A;  1F9I A;  3R4K A;  1LSX A;  3FV7 A;  3CUE C;  2ZOI A;  4FUW A;  3ULF A;  1GA0 A;  3MSH A;  4R0Q A;  1K6R A;  5EFW A;  3VFH A;  1YLW A;  2K31 A;  2V20 A;  2LB5 A;  4LRZ E;  3LIB A;  4Q0H A;  4CQH A;  4HP9 A;  1XJ4 A;  2L0W A;  4EEU A;  2Y2P A;  3MZD A;  3MZE A;  1Q2P A;  5FA7 A;  3LR4 A;  5G18 A;  4WMC D;  5IS1 A;  4LEN A;  5KSC A;  3U2A A;  4JGO A;  4Q0I A;  4LPZ A;  3MBZ A;  5DVA A;  4S2N A;  4BBU A;  1YLY A;  1YLT A;  1K54 C;  2BLS A;  4Y3I A;  1S67 L;  4WBG A;  1G68 A;  3W8K A;  3HLB A;  1LL8 A;  3JPU A;  2EWW A;  3ZNT A;  3IT9 A;  1L2S A;  2FFY A;  4ZDX A;  3Q1F A;  3H82 B;  3NJA A;  4C6Y A;  3OPR A;  1YM1 A;  1ES2 A;  1GSX A;  1L0E A;  2ZC3 B;  3LR3 A;  1N4O A;  3O5Y A;  5FQI A;  5FQK A;  4IBR A;  2W1T A;  4S2L A;  5HX9 A;  3LIA A;  3T4L A;  1H8Y A;  3QP4 A;  1K57 A;  3ZCZ A;  3B33 A;  3DTM A;  4PM6 A;  2W27 A;  3W4Q A;  1PRQ A;  2JE5 A;  2JKG A;  5EVI D;  2I9V A;  2UV0 E;  3SS5 A;  3E4P A;  2WUQ A;  3VP3 A;  1KGF A;  1KE4 A;  1ZKJ A;  3IXD A;  3OC2 A;  3N8L A;  5A92 A;  2ZQ9 A;  3NDE A;  4UA6 A;  2P04 A;  4P6B A;  2Y4A A;  4XXR A;  5AJG A;  2EXA A;  1GA9 A;  1BUE A;  4N1H A;  1CJF A;  4FH2 A;  1XFQ A;  4KZ7 A;  4DN0 A;  1J3W A;  4WEK A;  2P7J A;  4OOY A;  5CHJ A;  4OKP A;  1HLU P;  4S2O A;  2D01 A;  1KVM A;  5F5Y A;  2XD1 A;  2ZM2 A;  2XFT A;  1K25 A;  4GS9 A;  5HDS A;  2HV1 A;  4QY5 A;  4MEZ A;  3IHB A;  3PYP A;  4MN6 A;  5J8X A;  3HL9 A;  2O0Y A;  2WAE A;  3OPL A;  5EVI C;  5HPI A;  4WZ5 C;  4LRY C;  1BLC A;  3LIE A;  3AGE A;  1SCW A;  3BY8 A;  2J9O A;  3RXX A;  1BYW A;  2NUT C;  3ZG9 B;  2VGJ A;  3RFB A;  4GD6 A;  1GHM A;  2ZMV A;  3W4O A;  4GDN A;  2HP5 A;  4I39 A;  3GDI A;  5HWT A;  5E2F A;  4E3K A;  1ESI A;  2P9V A;  4E6W A;  1VEU A;  5K5B A;  3CLO A;  3UDX A;  2WGI A;  4DE0 A;  1K56 A;  3EWK A;  4NG2 A;  2QYB A;  4EQI A;  4IED A;  3F1O A;  4E3L A;  2HP6 A;  1FCN A;  5EVL A;  4BBT A;  4BMW A;  4KZ9 A;  2JKT I;  5GLD A;  3ZFZ A;  4IVI A;  4E3N A;  5DFY A;  3HUO A;  1K55 C;  3BRM A;  4WN5 A;  3EQU A;  3OCL A;  1KVL A;  4DE1 A;  2W3F A;  3MR0 A;  4YNR A;  3QP8 A;  2HDU A;  1ESU A;  2JC7 A;  3LI9 A;  3BWL A;  1OTA A;  4N9L A;  1DRM A;  3S1Y A;  5F83 A;  4C75 A;  2FH5 A;  5D3O A;  2XRO A;  4FD8 A;  1YSQ A;  3IWQ A;  3IXH A;  4N1X A;  2ZC6 B;  2J8Y A;  2WKE A;  3OPP A;  3PTE A;  4FCF A;  3EEA A;  2M7U A;  2WKR A;  1GCE A;  4ETZ A;  1OJ5 A;  3BJN A;  1EI5 A;  1PWC A;  3B42 A;  3IF6 A;  5HAI A;  1PI5 A;  4ME4 A;  2ZM8 A;  2Y2O A;  3T12 B;  1OTD A;  1CEF A;  2OWJ A;  5FI7 A;  3ZG5 A;  1Z6F A;  4EBN A;  5CED A;  3FZC A;  5GHY A;  4EXO A;  3D4F A;  4DMZ A;  4ZJ3 A;  4S2M A;  1BLS A;  3WS0 A;  5F68 A;  5FAS A;  1NWZ A;  3CAX A;  4HH3 A;  1PFL A;  4HHD A;  1BT5 A;  4GLQ A;  3R7W A;  4IJG A;  3NOU C;  4E3I A;  4EET B;  4OPQ A;  4Z1W A;  5EVI B;  4BL3 A;  4R70 A;  2PU2 A;  3BY9 A;  5CER A;  3P98 A;  3UPN A;  3FC7 A;  5GHX A;  4LCL A;  2E8J A;  4KZ3 A;  4OLG A;  5AQ9 A;  4R3B A;  2I72 A;  2IWB A;  4KG2 A;  3VOZ A;  1FR6 A;  3Q81 A;  2VGL M;  1OT6 A;  3RJU A;  1RGY A;  4EWF A;  1JWV A;  5AQA A;  4NXG A;  4WL9 A;  4Y5F A;  5CTN A;  3PBQ A;  4DE3 A;  4CPK A;  2GDN A;  1S0W A;  4RQ9 A;  4QD4 A;  4S2J A;  5I94 A;  4OQ0 A;  4QWO A;  5FSR A;  5CEC A;  1ERM A;  2R78 A;  4JXV A;  2QKP A;  1TF1 A;  3SH8 A;  3G31 A;  4JGP A;  2LB9 A;  3ZVT A;  4IBX A;  3UPP A;  3FG8 A;  3F1N B;  1H0M A;  3T4O A;  3BLS A;  3ZGA B;  3WWX A;  5FEG A;  3D3O A;  3S22 A;  2UWX A;  1MKI A;  2PYP A;  4S2N C;  3GQZ A;  3LUQ A;  5GLC A;  5L8M A;  3M2K A;  2JBF A;  1NRJ A;  1Y54 A;  1PNE A;  4ARZ B;  2VA0 A;  2X01 A;  5FAO A;  3T1X A;  1V9Z A;  3TG9 A;  4QU3 A;  1W79 A;  3A3I A;  3VFF A;  4Y0U A;  1AXB A;  1GSW A;  2YKH A;  1BZA A;  5HW3 A;  2FFF B;  3VOL A;  2V2F F;  3V50 A;  3D72 A;  2M7V A;  3LYX A;  4PM5 A;  4NEE D;  2O9C A;  2QJ7 A;  3DTE A;  4GHI A;  1KE3 A;  1YT4 A;  4HQA A;  2QMI A;  1PYY A;  4II7 A;  3ZDJ A;  1L0G A;  1MY8 A;  3A3F A;  4N92 A;  1ALQ A;  4PKY A;  4EUV A;  3NOT C;  3Q7V A;  5L2F A;  2GNX A;  3H7W B;  1K57 C;  3MMH A;  1NZU A;  4KQD A;  2WK0 A;  3G2Y A;  3IHA A;  3NBL A;  3AGD A;  3WS2 A;  3LR0 A;  3IS2 B;  1XFN A;  1MWU A;  4JF4 A;  3A3D A;  5HD5 A;  1YAX A;  5EM1 A;  3OPH A;  5L09 A;  1ZC2 A;  3C2W A;  4MN7 A;  4NET A;  4DJ2 A;  1H3Q A;  1TD5 A;  2HP9 A;  2INW A;  4JBF A;  1K4F A;  3LGO A;  5AQB A;  1NXY A;  3C7V A;  2A24 A;  2M1C A;  4Y0T A;  2PBD P;  4BD1 A;  4X68 A;  2Y2Q A; 
#chains in the Genus database with same CATH homology
 3RXW A;  1CI8 A;  4UHU A;  5KZH A;  3IT9 A;  5M1A A;  4N9K A;  1L2S A;  2FFY A;  5TR7 A;  4ZDX A;  1SKF A;  3Q1F A;  2WGW A;  4HEF A;  4OP5 A;  3Q7V B;  3VP2 A;  4C6Y A;  3OPR A;  1YM1 A;  2OSU A;  4S2K A;  2XFS A;  1ES2 A;  4OOL A;  4UAA A;  3ITA A;  3Q7Z A;  2PBY A;  4MLL A;  2WAD A;  3Q82 A;  1L0E A;  3VP1 A;  2ZC3 B;  3IH8 A;  3PBN A;  4OPZ A;  1N4O A;  4JXS A;  2Y2M A;  1VQQ A;  4KG5 A;  5FQI A;  5FQK A;  4IBR A;  1LL5 A;  3A3J A;  4KEN B;  4S2L A;  1WYC A;  2R9X A;  5CEB A;  5HX9 A;  1RCJ A;  3UDI A;  3IH9 A;  5IHV A;  1E25 A;  2V1Z A;  3ZG0 A;  3M2J A;  4BLM A;  1K38 A;  5F1F A;  2J9P A;  4U0T A;  1H8Y A;  4HBT A;  3BFE A;  3WRZ A;  1K57 A;  1PW1 A;  3BYD A;  2OV5 A;  3ZCZ A;  2XDM A;  2RL3 A;  3WS4 A;  3DTM A;  3FKW A;  4PM6 A;  2WYX A;  1FCO A;  2H0Y A;  5E2G A;  3W4Q A;  1K4E A;  2JE5 A;  4GZB A;  1HD8 A;  3FWL A;  5FQJ A;  3NY4 A;  3HLW A;  1CI9 A;  1JTD A;  5E2E A;  5EVI D;  1LL9 A;  2OLU A;  4BD0 A;  1O7E A;  4GKU A;  3SS5 A;  2EX8 A;  2WUQ A;  3VP3 A;  1U60 A;  1KGF A;  3BFD A;  3ITB A;  1KE4 A;  3IXG A;  3OZH A;  1JWZ A;  2X71 A;  1ZKJ A;  3IXD A;  2BG1 A;  2XGN A;  1MXO A;  3UNW A;  3DWK A;  3Q07 A;  5KMW A;  3OC2 A;  4QHC A;  3N8L A;  1BTL A;  5AQ7 A;  5FDH A;  5M19 A;  3E2K A;  4MBK A;  1LI0 A;  4WZ5 A;  5A92 A;  4K0X A;  1K54 A;  5BOH A;  1TVF A;  2ZQ9 A;  4ID4 A;  3NDE A;  4R1G A;  4UA6 A;  2E8I A;  2ZQA A;  4P6B A;  1M6K A;  1EWZ A;  2Y4A A;  4XXR A;  2XQZ A;  2EXA A;  4KQO A;  3BLM A;  2XR0 A;  4X55 A;  1GA9 A;  4F94 A;  3UO9 A;  4UA7 A;  2C5W B;  1MWS A;  1BUE A;  4WYY A;  4N1H A;  3SS3 A;  3O86 A;  2ZC5 B;  3QHY A;  4DRT A;  1C3B A;  3LO7 A;  4OH0 A;  5DF8 A;  1YMS A;  1ZG6 A;  5EEC A;  3IQA A;  4FH2 A;  4KZ7 A;  4RA7 A;  3BEB A;  4YFM A;  4DDS A;  4WEK A;  4U3T A;  3TOI A;  4OOY A;  4EUZ A;  5CHJ A;  2A49 A;  4E3O A;  4OKP A;  1G6A A;  3MFD A;  4S2O A;  3GV9 A;  3NIA A;  1KVM A;  3WS1 A;  1NYY A;  2XD1 A;  2ZM2 A;  3MXS A;  1SDN A;  2XFT A;  1E4D A;  1KGG A;  4S2I A;  1K25 A;  4LV0 A;  3GRJ A;  1WE4 A;  1KE0 A;  4QY5 A;  5U47 A;  5FI6 A;  4MBF A;  1NYM A;  2CC1 A;  3O88 A;  1HTZ A;  1QME A;  3IHB A;  4MEZ A;  5J8X A;  5A91 A;  3HL9 A;  4Z9Q A;  3UY6 A;  2ZC7 A;  3HBR A;  2WAE A;  4X69 A;  4WMC A;  3ZVW A;  2J7V A;  2XK1 A;  3OPL A;  3O87 A;  5EVI C;  4A5R A;  4LCM A;  1PZO A;  4WZ5 C;  1K55 A;  3PBS A;  4WZ4 A;  4X56 A;  4E3J A;  1XXM A;  1BLC A;  2ZJ9 A;  2WZX A;  1BUL A;  3IF5 A;  3AGE A;  1SCW A;  3RXX A;  2J9O A;  4C3Q A;  4OLD A;  4HBU A;  3VSK A;  3ZG9 B;  2VGJ A;  4KZB A;  4QJG A;  3BFC A;  1HZO A;  1JWP A;  4GD6 A;  3ZG8 B;  1GHM A;  1XA7 A;  1SHV A;  4JF6 A;  4GDN A;  4PM9 A;  1L0D A;  3W4O A;  4BL2 A;  1PWD A;  3ZHH A;  1K56 D;  2HP5 A;  1IEM A;  3DWZ A;  1W5D A;  1CEG A;  4X53 A;  4GDB A;  5E2F A;  2Y59 A;  4H8R A;  4E3K A;  1ESI A;  3BEC A;  4QB8 A;  2P9V A;  1TDL A;  2C6W B;  3C5A A;  4E6W A;  1OME A;  4OP8 A;  4R4R A;  4O7D A;  3UDX A;  3MXR A;  2WGI A;  1KDW A;  3MKF A;  3LEZ A;  4JF5 A;  3G35 A;  4DE0 A;  4WEL A;  2H0T A;  1GHI A;  1K56 A;  3C7U A;  5EOE A;  3PAG A;  4KZ4 A;  2DCF A;  1TDG A;  1E3U A;  4LV2 A;  3CMZ A;  2Z2M B;  5TFQ A;  5JYP A;  4EQI A;  3BFG A;  5DTS A;  3WRT A;  2XLN A;  4IED A;  4MBH A;  3GSG A;  4LV1 A;  4E3L A;  3HRE A;  4OPR A;  2HP6 A;  3VMA A;  1FCN A;  5EVL A;  1SDE A;  1O07 A;  4KZ9 A;  4OQH A;  4GOG A;  5GLD A;  3UPO A;  1DJB A;  4Q8I A;  2Y55 A;  3ZFZ A;  2OLV A;  3BM6 A;  4GB7 A;  4IVI A;  4OVD A;  4E3N A;  5TGF A;  3HUO A;  2IWC A;  4MNR A;  1WYB A;  5DTK A;  1IYO A;  1K55 C;  3A3E A;  4R23 A;  5M18 A;  3BRM A;  4BEN A;  4KG6 A;  1XKZ A;  3EQU A;  1I5Q A;  3OCL A;  5HFO A;  1KVL A;  2WGV A;  2A3U A;  4DE1 A;  3HVF A;  3CJM A;  3LY4 A;  2ZQ8 A;  4KZ5 A;  1DJC A;  2HDU A;  1BLH A;  1ESU A;  1ERQ A;  3HUN A;  5KSH A;  2JC7 A;  2Y91 A;  5FQQ A;  4OON A;  3PAE A;  4E3M A;  4KZ6 A;  4N9L A;  3V39 A;  3HLD A;  3S1Y A;  5F83 A;  4PM7 A;  2XD5 A;  4C75 A;  1FOF A;  5D3O A;  3SH9 A;  4JXG A;  1HVB A;  4FD8 A;  2RCX A;  3IWQ A;  3IXH A;  1I2S A;  1QMF A;  4N1X A;  2ZC6 B;  2J8Y A;  2WKE A;  5F82 A;  5FAP A;  3OPP A;  3PTE A;  4FCF A;  1XGI A;  2X02 A;  3BFF A;  2WGW B;  1VM1 A;  3PBT A;  4WM9 A;  4XUX A;  5EVI A;  4D2O A;  4EBP A;  1GCE A;  4K91 A;  1YMX A;  4QY6 A;  1EI5 A;  1J9M A;  1DJA A;  1M40 A;  1PWC A;  1Q2Q A;  2IWD A;  2VGK A;  3GVB A;  3IF6 A;  2PU4 A;  5FAQ A;  5HAI A;  3NDG A;  2Y2K A;  1I2W A;  1PI5 A;  3HLF A;  4WEJ A;  3UDF A;  3IWO A;  5E2H A;  4ZAM A;  4HES A;  2ZM8 A;  2Y2O A;  1KDS A;  4Y0O A;  1XPB A;  3VSL A;  1YQS A;  1CEF A;  5FI7 A;  1IYS A;  1RP5 A;  3N6I A;  1MWR A;  1PW8 A;  1Z6F A;  1ZG4 A;  2G2U A;  3ZG5 A;  4EBN A;  3AGF A;  3VOY A;  3UE1 A;  5CED A;  4B4X A;  2P74 A;  2Q9M A;  3FZC A;  5EE8 A;  5GHY A;  1ES5 A;  3GR2 A;  3GTC A;  3D4F A;  4P85 A;  5EOO A;  4EBL A;  1NZO A;  2Y2G A;  1ES3 A;  4ZJ3 A;  4S2M A;  1FSW A;  1IYQ A;  4L0L A;  3SOI A;  3PBO A;  1BLS A;  3WS0 A;  4PPR A;  1W8Q A;  1NJ4 A;  5FAS A;  4B88 A;  3LY3 A;  2Y2I A;  3G32 A;  1BT5 A;  5CRF A;  1IKG A;  1TEM A;  3CZD A;  4FH4 A;  5CGX A;  1YLJ A;  2EXB A;  2HDQ A;  3IWI A;  5FQ9 A;  4E3I A;  4U0X A;  3FYZ A;  4OPQ A;  4EV4 A;  4RYE A;  1YLZ A;  1W7F A;  5EVI B;  5CHM A;  4ZTK A;  2ZC4 B;  4BL3 A;  3E2L A;  4JLF A;  4DKI A;  2PU2 A;  4DE2 A;  3V5M A;  3C4O A;  1DY6 A;  3S4X A;  2ZQC A;  3HLG A;  3P98 A;  4YIN A;  1MPL A;  3IF6 C;  5E43 A;  5GLB A;  5CER A;  3UPN A;  1PI4 A;  3N4I A;  5GHX A;  2Y2N A;  1PZP A;  3NI9 A;  4LCL A;  1XGJ A;  3HLC A;  4KZ3 A;  4OLG A;  5AQ9 A;  2Y2Q A;  3VP4 A;  4R3B A;  2I72 A;  4RX2 A;  4JPM A;  2IWB A;  1BSG A;  2QPN A;  4KG2 A;  1FR6 A;  3Q81 A;  3VOZ A;  2ZM0 A;  3OCN A;  2ZD8 A;  3RJU A;  1RGY A;  3WS5 A;  5HAR A;  4EWF A;  3N8S A;  1JWV A;  5AQA A;  1CK3 A;  1ES4 A;  5HAP A;  4KZ8 A;  3MZF A;  3NC8 A;  3IXB A;  5CXW A;  4ZJ2 A;  4NK3 A;  1W8Y A;  5A93 A;  1K6S A;  4R4S A;  3TSG A;  5CTN A;  4CJN A;  3PBQ A;  5CGW A;  2H5S A;  4DE3 A;  4CPK A;  2GDN A;  1YLP A;  1S0W A;  4JKT A;  3LCE A;  1FQG A;  4QD4 A;  2ZMA A;  4S2J A;  2EX6 A;  5I94 A;  4OQ0 A;  3G2Z A;  5FSR A;  4KQR A;  4OQG A;  4X6T A;  1ERM A;  5CEC A;  1S6R A;  4JXV A;  4LV3 A;  2EX9 A;  2DNS A;  1XP4 A;  3SH8 A;  2Y2H A;  3G31 A;  4BQM A;  2EFU A;  2ZQD A;  3C4P A;  3ZVT A;  5HAQ A;  2Q9N A;  4IBX A;  4GNU A;  4KZA A;  2WKI A;  3UE0 A;  3UPP A;  4GN2 A;  1ERO A;  2HPB A;  3G30 A;  1ONH A;  2XEP A;  3M6H A;  4PMA A;  1IEL A;  1JTG A;  1BLP A;  2DRW A;  4R3J A;  3BLS A;  5FI2 A;  3WWX A;  3ZGA B;  1IKI A;  5EUA A;  2QZ6 A;  3ZG7 B;  2Z2L B;  3ZNY A;  1MWT A;  3S22 A;  2UWX A;  1MKI A;  3G34 A;  3GQZ A;  3FKV A;  4S2N C;  5GHZ A;  3QNB A;  2HDS A;  4OOM A;  5CTM A;  1RGZ A;  2B5R A;  3CG5 A;  5FAT A;  5GLC A;  3M2K A;  4OQI A;  2Y2L A;  2JBF A;  3QNC A;  4OPY A;  1Y54 A;  1PWG A;  3B3X A;  3G4P A;  3UN7 A;  4PM8 A;  2P9V B;  2X01 A;  4RVA A;  1L0F A;  5FAO A;  4JXW A;  3TG9 A;  3M6B A;  1XA1 A;  3GMW A;  5EPH A;  4QU3 A;  1W79 A;  3A3I A;  3ISG A;  3NCK A;  3VFF A;  3JYI A;  4Y0U A;  4P0M A;  4DF6 A;  4E6X A;  1AXB A;  4P87 A;  1BZA A;  4S2P A;  5JYO A;  3N8R A;  5HW3 A;  1PIO A;  2FFF B;  1N9B A;  1GHP A;  2V2F F;  1IYP A;  3VP0 A;  2Y2J A;  3V50 A;  1KGE A;  4DXB A;  3UE3 A;  2HDR A;  3DW0 A;  1NY0 A;  2JCH A;  4B4Z A;  1FR1 A;  3N7W A;  4PM5 A;  1H5X A;  5DF9 A;  2EFX A;  3V3R A;  5GLA A;  4RX3 A;  5GL9 A;  3FV7 A;  1KE3 A;  1YT4 A;  2QMI A;  1PYY A;  3SS4 A;  3ZDJ A;  2ZQ7 A;  1LI9 A;  1GA0 A;  4R0Q A;  1L0G A;  1K6R A;  5A90 A;  3VFH A;  1LHY A;  1MY8 A;  1YLW A;  1NRF A;  2V20 A;  5FQM A;  3A3F A;  4M3K A;  4N92 A;  1ALQ A;  5CGS A;  2XF3 A;  3V3S A;  3Q7V A;  4FSF A;  5DTT A;  5L2F A;  1K57 C;  2H10 A;  1NZU A;  3O3V A;  3I7J A;  2WK0 A;  3G2Y A;  3IHA A;  2Y2P A;  1LLB A;  3AGD A;  3MZD A;  3NBL A;  3WS2 A;  3MZE A;  1FSY A;  1Q2P A;  3P09 A;  5FA7 A;  3W4P A;  5G18 A;  1MWU A;  4WMC D;  4JF4 A;  4LEN A;  5KSC A;  3A3D A;  2XH9 A;  3SH7 A;  5DF7 A;  4ZJ1 A;  3PBR A;  4K0W A;  3HUM A;  3HLE A;  2ZLY A;  3IF6 B;  1ONG A;  1FCM A;  4DXC A;  4IVK A;  3OPH A;  1XX2 A;  3EQV A;  3MBZ A;  1ZC2 A;  5DVA A;  5HL1 A;  4S2N A;  2WAF A;  1YLY A;  4NET A;  2WZZ A;  5F1G A;  1YLT A;  3MKE A;  2EX2 A;  2WKH A;  1K54 C;  2HP9 A;  4Y7P A;  4JBF A;  4UA9 A;  2BLS A;  1K4F A;  1JVJ A;  2G2W A;  4BJP A;  4XUZ A;  5AQB A;  1MBL A;  4WBG A;  1NXY A;  1G68 A;  3W8K A;  3C7V A;  4GD8 A;  3HLB A;  4ZBE A;  2R9W A;  5CHU A;  4DDY A;  4Y0T A;  3ZNT A;  1H8Z A;  4BD1 A;  4X68 A;  4KQQ A;  1E3U D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...