1YLWA

X-ray structure of ctx-m-16 beta-lactamase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGGYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Resolution Structures of CTX-M beta-Lactamases: Extended Spectrum Activities from Increased Mobility and Decreased Stability.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords CTX-M-16 beta-lactamase
total genus 95
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ylwA00
3UDXA 5AQAA 2JC7A 4X55A 4E6WA 5GLBA 2HP5A 1KE3A 3OPPA 4OKPA 5KSCA 4IBRA 3C5AA 2G2WA 2Y2GA 2WADA 3ZG5A 3HUMA 3S4XA 1FSWA 1TEMA 4WMCD 2EFXA 3OPRA 3OPLA 4BJPA 1S6RA 1TVFA 2XH9A 4ID4A 1PWDA 2Y55A 3G2YA 3IWQA 1XXMA 4K0XA 4NK3A 3DW0A 3G2ZA 3NCKA 4U0TA 5CGWA 2XD1A 3IF6B 5HAQA 1AXBA 3NDGA 4O7DA 1W79A 3BLSA 5CERA 4DDYA 4JLFA 1YLPA 3NIAA 5FASA 5F1GA 5EOEA 4LV0A 3NDEA 3ZVWA 4KG2A 2G2UA 5M1AA 1XKZA 1ERQA 1IYPA 2XFTA 5GHXA 4E3MA 3A3FA 2XFSA 5M19A 1ONGA 4P87A 3I7JA 5KZHA 4LV1A 4KZ3A 1NXYA 4KZ7A 3PBRA 4MBKA 5CHJA 3WS2A 3SH9A 2Y91A 4D2OA 3P98A 3IHBA 3MXSA 1IYQA 3HVFA 3GSGA 1DJAA 4C75A 3PAEA 4UA9A 3ZFZA 5HAIA 2BLSA 2ZC6B 1E3UA 1CEFA 2J8YA 5FAOA 4E3IA 1H8ZA 5FQ9A 4N92A 2VGJA 4GD6A 1VM1A 1ZG4A 2RCXA 4KG5A 3QHYA 4LCLA 1ES3A 1JWZA 1PWCA 1YLWA 4XXRA 3HLGA 4EWFA 3BEBA 3SH7A 4GDNA 4JXSA 5DF7A 3HLEA 3HREA 5J8XA 1H8YA 1G68A 1JTDA 1K38A 3OCLA 3BFGA 5FQQA 2X71A 4OP8A 2EX8A 3ZNYA 2ZM8A 4E3JA 5L2FA 3WS5A 1PZOA 1SKFA 3IXHA 1W8YA 1E3UD 3M2KA 3ZVTA 2XK1A 2ZD8A 4OPRA 1ESIA 2H5SA 4S2LA 1TDGA 5CTMA 1K6SA 5CXWA 2HDSA 2PU2A 4JF6A 5FQJA 5FQMA 2ZC4B 4OQGA 5AQ9A 2WZXA 4DE1A 1SDEA 5FSRA 1HD8A 3LY4A 4JXVA 3VMAA 1K4FA 4KZ9A 3SS4A 3G31A 4OLDA 3HL9A 3IT9A 1I2SA 4JF5A 3HLDA 4CJNA 1FCMA 4KZBA 1XA1A 1M6KA 1E25A 2ZC5B 3DWKA 3JYIA 5DTKA 4Y0OA 1L0FA 1PIOA 3BFDA 4ZJ2A 3M6BA 2ZM0A 3BECA 3W4PA 5A91A 5G18A 1IELA 3FKVA 4EBPA 5A90A 1CI9A 1DY6A 5GL9A 1L0GA 2H0TA 4JXWA 2DCFA 3UDIA 3B3XA 1L2SA 4QU3A 1BLSA 3Q7ZA 3ZCZA 1BZAA 2HDRA 3UPNA 1PWGA 4BL3A 1KGFA 3SH8A 4R1GA 3N6IA 2WGWA 1K55C 1ONHA 3MZFA 4QHCA 5DF9A 4CPKA 3C7UA 2XEPA 5DTSA 4R3BA 5FAPA 4KG6A 4OOLA 5A93A 3AGFA 2EXAA 4X6TA 1ES4A 3PTEA 1GHPA 3IF6A 3S22A 1BT5A 4KZ5A 2Y4AA 1M40A 1O07A 3G30A 3SS5A 3G35A 1LHYA 4ZBEA 4XUXA 4GKUA 3WS0A 5AQ7A 3BFCA 4DE0A 2QPNA 3MZDA 3NI9A 4X56A 1K56D 4NETA 3PBQA 2IWDA 3CG5A 5GLDA 4MNRA 4KZ6A 5E2GA 1C3BA 3VSKA 5DTTA 5A92A 3IXGA 1K55A 4WZ5A 1KE0A 2HDQA 2HDUA 2WGWB 4RX3A 5GHYA 2C5WB 3GR2A 5FQKA 5CGXA 3TSGA 4DXBA 1JTGA 2V2FF 4U0XA 3EQUA 1MKIA 1NJ4A 4JF4A 1MWTA 1K56A 1IYSA 3N4IA 5E43A 1MBLA 4LV2A 5DVAA 4ZAMA 3QNCA 1ALQA 4OQIA 1CI8A 5F82A 2C6WB 2R9WA 4PM5A 2EX6A 3LY3A 4HBUA 1I5QA 4UAAA 3OCNA 5HFOA 1ES2A 1JWPA 3LCEA 4RYEA 4S2KA 4FCFA 4P6BA 4E3OA 5FI7A 1PYYA 1BUEA 2X01A 4ZJ3A 3PBNA 2QMIA 4K91A 4XUZA 1SCWA 3PAGA 4OH0A 2Y2QA 4OP5A 4S2PA 5EECA 5E2EA 1WYBA 1XPBA 1FR6A 4LENA 1ZC2A 4ZJ1A 1I2WA 2XDMA 4UA6A 5CEBA 4PM9A 3ZG0A 5EVIC 4KZ8A 5BOHA 2WAEA 3A3EA 1KE4A 1KVMA 3CMZA 3BLMA 2J9OA 4HEFA 1BLPA 3W8KA 3Q82A 4QY5A 2UWXA 2Q9NA 3UDFA 2Y2IA 3AGDA 3NY4A 4YFMA 3G4PA 5TGFA 4P0MA 3ZDJA 5U47A 4ZTKA 1IKIA 1YMSA 2A49A 4QJGA 1LL9A 1JVJA 3AGEA 3FZCA 3ZGAB 3V3SA 2VGKA 5CHMA 4WZ5C 2B5RA 3HLFA 2EFUA 2ZJ9A 3IH8A 3SOIA 3Q81A 3VOZA 1N9BA 2Y2MA 2ZC7A 4QB8A 1VQQA 3IXBA 2WAFA 4F94A 4M3KA 2X02A 1MXOA 1W5DA 1ZKJA 4U3TA 4A5RA 2Y2HA 4BD0A 1YMXA 2P9VB 2Z2LB 1MWRA 4JXGA 1EI5A 5CECA 4X53A 1DJCA 4JPMA 5KMWA 3TG9A 1S0WA 5EVLA 4ZDXA 5EPHA 3WRTA 4BD1A 1BTLA 3CJMA 4B4ZA 2V20A 5EUAA 4EBLA 2IWCA 3GV9A 3G34A 3HLCA 3ZG8B 1YT4A 1XGJA 4OONA 3PBOA 4BENA 3A3DA 2I72A 2Y2JA 1BLCA 4PM8A 2WUQA 4GNUA 4MBHA 1K6RA 4YINA 4E3KA 4IVIA 1GHMA 2ZQDA 2IWBA 5JYOA 1XGIA 2XR0A 3UN7A 2OSUA 4PMAA 4GDBA 1KVLA 3DWZA 1MPLA 4FH4A 4PPRA 1PW8A 2J7VA 4WEKA 1IKGA 3GVBA 3Q7VA 3Q7VB 1YQSA 4WZ4A 3UE3A 3NC8A 4UHUA 3WS1A 2JBFA 1NZOA 2XLNA 2J9PA 5F83A 5CEDA 3OZHA 3LEZA 1WYCA 2Z2MB 1KDWA 2PU4A 3FYZA 1G6AA 3G32A 1CEGA 1GCEA 4OPZA 2V1ZA 3QNBA 4MEZA 4BL2A 1ES5A 1GA0A 1L0DA 3GTCA 1LI9A 4R4RA 4HBTA 4K0WA 1FCNA 4GOGA 1O7EA 1BLHA 2HP9A 2R9XA 3IQAA 3OPHA 4R23A 4Q8IA 1DJBA 2RL3A 4GZBA 4DXCA 4DDSA 4GB7A 5FA7A 3ISGA 1BULA 5GLCA 2ZM2A 3RXWA 3VP1A 3FV7A 1K4EA 3C4PA 4WBGA 1NZUA 3Q07A 3UY6A 4E3LA 3V50A 4S2MA 4QD4A 1QMFA 4DE3A 4E3NA 5EOOA 4BQMA 4RX2A 1CK3A 1XA7A 1Z6FA 2HP6A 5EVIA 5FDHA 2EX9A 5FATA 3D4FA 4OQHA 5E2HA 1KGGA 4EV4A 1LLBA 2JCHA 3HUNA 4KZAA 4RA7A 2P74A 5EE8A 4OOYA 4IEDA 3ZG9B 1N4OA 3MBZA 1MWUA 1YLTA 2FFYA 2WGIA 4DRTA 4EBNA 5GLAA 4IVKA 4LV3A 1HZOA 1YLZA 1WE4A 1MY8A 2DRWA 3N8LA 1EROA 2WZZA 4WM9A 1GA9A 3HUOA 2DNSA 4LCMA 1TDLA 3WRZA 3GRJA 3ITAA 1XP4A 2ZQ9A 3ZHHA 4L0LA 5M18A 1NYYA 4Y7PA 3UPOA 5DF8A 2EX2A 4JBFA 1FQGA 2WKHA 4WEJA 2EXBA 4PM6A 1W7FA 2Y2KA 1FOFA 3DTMA 1MWSA 4S2OA 5FQIA 5D3OA 1SDNA 3C7VA 3VP3A 4OPYA 1LL5A 4Y0UA 1K57C 2FFFB 4JKTA 4E6XA 4KQOA 3GMWA 4B88A 1ESUA 1H5XA 1RGZA 4MLLA 3VP2A 2Y2OA 4KENB 4N1HA 3MZEA 4WMCA 3RXXA 3VFHA 4WELA 5E2FA 1IEMA 3NBLA 3BM6A 3RJUA 5HL1A 2H0YA 4B4XA 2GDNA 3P09A 3E2KA 3M2JA 4S2JA 2OLVA 3IH9A 1LI0A 4X68A 3VOYA 4R3JA 3V39A 1J9MA 3BFEA 4S2NC 2ZQAA 1OMEA 1YM1A 2P9VA 4OOMA 3BYDA 1RGYA 2XGNA 3UPPA 1JWVA 3UE0A 3BRMA 3IWOA 4R0QA 3A3JA 5HW3A 3CZDA 1NRFA 3PBTA 1RCJA 5EVIB 4BLMA 3SS3A 2ZQ8A 1PZPA 1K54C 1K25A 2QZ6A 3HLBA 3M6HA 4EUZA 4Z9QA 3N8RA 5HARA 3W4QA 3GQZA 4P85A 2JE5A 3FWLA 4S2IA 4C3QA 4OVDA 4UA7A 1HVBA 2WYXA 5FI6A 3IWIA 1KGEA 2ZC3B 3C4OA 3Q1FA 4EQIA 4Y0TA 1HTZA 3ZNTA 5CRFA 5TR7A 2XQZA 4FSFA 1PI4A 1Q2PA 2HPBA 4N9LA 4S2NA 1BSGA 2OLUA 4RVAA 3S1YA 3MKEA 3FKWA 3ITBA 3W4OA 5F1FA 3IF5A 3VP0A 4KZ4A 1Q2QA 1IYOA 2WKIA 2BG1A 2Y59A 2ZLYA 3EQVA 3PBSA 3BFFA 1QMEA 3IF6C 4PM7A 3IHAA 3O86A 4WYYA 3HBRA 5JYPA 5KSHA 1U60A 3MFDA 3LO7A 1ERMA 1EWZA 4QY6A 3E2LA 5CGSA 2ZQCA 2XD5A 4GN2A 4DKIA 1KDSA 1PW1A 3A3IA 4MBFA 5I94A 2ZMAA 4N1XA 5FAQA 3N8SA 3V5MA 3N7WA 2WK0A 3O87A 3MXRA 3V3RA 1FCOA 3VP4A 1RP5A 1E4DA 4FD8A 4N9KA 4FH2A 1NY0A 1YLYA 3UNWA 4DE2A 4OLGA 5HAPA 5TFQA 2Y2PA 3O3VA 3TOIA 3ZG7B 1FSYA 1K57A 4OPQA 1GHIA 2Y2NA 1NYMA 4IBXA 1K54A 1L0EA 2A3UA 2WGVA 5CHUA 4X69A 5AQBA 3UO9A 3VSLA 3IXDA 3O88A 4OQ0A 5CTNA 3MKFA 1YLJA 4C6YA 3OC2A 3WWXA 1W8QA 1XX2A 4KQRA 4KQQA 4HESA 1SHVA 5HX9A 5IHVA 2H10A 5GHZA 3VFFA 4H8RA 2Q9MA 2CC1A 1ZG6A 2XF3A 4DF6A 1Y54A 1FR1A 4R4SA 3UE1A 3HLWA 2OV5A 1PI5A 4GD8A 2ZQ7A 2E8IA 3WS4A 2WKEA 5FI2A 2PBYA 5EVID 2Y2LA
chains in the Genus database with same CATH superfamily
3NOPC 3B47A 4IBRA 2OAQ1 3HUMA 3S4XA 3CAXA 3OPRA 2ZBBA 2Y55A 5MC7A 4U0TA 5HAQA 4O7DA 1YLPA 5EOEA 4LV0A 1IYPA 2Y79A 5M19A 4P87A 1T1BA 4X1MA 4KZ7A 5AJGA 2Y91A 3P98A 3IHBA 3MXSA 3PR6A 1DJAA 4Z1WA 2V8CA 1CEFA 4N92A 1ZG4A 2W3HA 1ES3A 1JWZA 1PWCA 1YLWA 3RH8B 1YSPA 3BEBA 4JXSA 5DF7A 3HLEA 1G68A 2M7UA 2EX8A 3ZNYA 2ZM8A 5L2FA 3WS5A 4EU0A 4XT2B 1GSWA 2GX5A 5CTMA 4BBTA 3ZQ5A 4R38A 4DE1A 3LR3A 3LY4A 1K4FA 3SS4A 3PYPA 1FCMA 1XA1A 1XJ4A 1M6KA 2PR5A 3BFDA 3H7WA 2ZM0A 5GL9A 3UDIA 1PWGA 4BL3A 3SH8A 2JKGA 3IX8A 4PKYA 4KG6A 4OOLA 3NECA 2EXAA 4X6TA 3IF6A 1O07A 2W0NA 3G30A 3G35A 4LPZA 3T1RA 4HP4A 2QPNA 4X56A 2V0WA 4ETZA 2ACGA 4NETA 2XROA 4L9GA 3CG5A 4BMWA 3CPTB 4KZ6A 4WZ5A 3KYZA 3TRCA 5CGXA 4NEED 1NJ4A 4LGWA 1MWTA 1K56A 1MBLA 3OLOA 1MC0A 5EFWA 2R9WA 2EX6A 2XRNA 2G7UA 2QYBA 1JWPA 1S1YA 3T1QB 3RFBA 4KQDA 1PYYA 3VOLA 4HOIA 4EESA 2QMIA 4S2PA 5EECA 1D06A 4GJ4A 2VA0A 1EW0A 1NRJA 4ZJ1A 1I2WA 1XJ3A 4PM9A 4KZ8A 5BOHA 3A3EA 1KVMA 1BLPA 3W8KA 2Q9NA 3QP8A 3G4PA 3ZDJA 5U47A 1IKIA 2A49A 4ESPA 2NUPC 3V3SA 2VGKA 1N9BA 4F94A 3IXBA 5IU1A 4M3KA 2X02A 1ZKJA 4B93A 1YMXA 2Z2LB 3G6OA 1OT9A 4JPMA 1JNUA 4DN0A 3TG9A 4ZDXA 5EPHA 2WKPA 1TS8A 4EBLA 3D72A 4QWOA 1YT4A 1XGJA 3A3DA 1OTIA 2W1RA 2VEAA 2Y2JA 1BLCA 1S4RA 3LICA 2WUQA 4MBHA 5HWTA 4YINA 4E3KA 2J3TC 5L09A 2IWBA 1XGIA 4CLCB 2B18A 1G6OA 2OSUA 1KVLA 2XA7S 3DWZA 1IKGA 3Q7VA 3NC8A 2J3TD 2Z2MB 4L9FA 3FYZA 4B9OA 2V1AA 3RTYA 2PBDP 4R4RA 4HBTA 4CQHA 2HP9A 1TS7A 3OPHA 3FC7A 2RL3A 4DXCA 3C38A 1BULA 2LB5A 3FV7A 3C4PA 4E3LA 1NZUA 3Q07A 4DE3A 4E3NA 2KLIA 4RX2A 4BQMA 2VGLM 5EVIA 2EX9A 4OQHA 4EV4A 3LR5A 1STZA 3MBZA 4EW7A 1YLTA 2ZOIA 5FEFA 3LIBA 4LV3A 2HV1A 1F98A 2JKTI 3N8LA 4WM9A 3LIAA 4MDZA 1TDLA 3GRJA 1P0ZA 4FOFA 3A0RA 3FPVA 4Y3IA 4JBFA 5J7EA 2OWHA 1CJFA 4S2OA 5FQIA 1SDNA 3VP3A 2FFFB 4D60A 5HDSA 1ESUA 3BY9A 3VP2A 1S4SA 4N1HA 3RXXA 3IS2B 4I38A 4S2JA 4R3JA 3V39A 4S2NC 2XGNA 3UPPA 1JWVA 4R0QA 3A3JA 5HW3A 1NRFA 1RCJA 3DAVA 2YKFA 3SS3A 1PZPA 2QZ6A 3HLBA 2W1TB 4Z9QA 3W4QA 4P85A 3CWFA 2IA2A 1OJ5A 4C3QA 3JVVA 1XFNA 3IWIA 1KGEA 4Y0TA 4BBUA 3FKWA 3VP0A 4KZ4A 3PBSA 2I9VA 2WKIA 4HJ4A 1QMEA 2XSSA 3HBRA 3LO7A 3FG8A 1FIKA 2XD5A 5I94A 1KDSA 2ZMAA 3S7OA 5FAQA 1F2KA 1FCOA 3VP4A 4K08A 1E4DA 4FD8A 5C5KA 4N9KA 1CF0A 1NY0A 2Y2PA 3ZG7B 1FSYA 3EEHA 1GHIA 3EWKA 2A3UA 2WGVA 5CHUA 4X69A 2A2LA 3WWXA 3FPWA 4I39A 4KQRA 5L07A 2H10A 5GHZA 4HH2A 4JGQA 1ZG6A 3QP5A 3U2AA 1L3LA 4I5SA 3VV4A 5L10A 2WKEA 2PBYA 5EVID 2WKRA 3UDXA 4PHTA 1A0KA 5GLBA 1VB6A 3OPPA 4OKPA 3C5AA 2WADA 5F69A 3EGDC 5AVEA 3OPLA 1TVFA 4H6JB 3G2YA 5CGWA 1LSWA 3IF6B 4LRZE 5CERA 4DDYA 3NIAA 5FASA 5F1GA 1S66L 3ZVWA 4KG2A 5GHXA 4EUVA 2XFTA 1DRMA 2V1BA 1LSXA 5KIZA 3R7WB 3TW8A 3WS2A 3SH9A 4CLCA 1T19A 4D2OA 1IYQA 3HVFA 2W3EA 3OOVA 3PAEA 1TD5A 5HAIA 2BLSA 1E3UA 1F9IA 4E3IA 3ZYTA 1H8ZA 4MMNA 5FQ9A 1VM1A 4LFUA 3QHYA 5HDDA 4EWFA 3SH7A 1H8YA 2VKSA 3BFGA 4E3JA 3IXHA 4AFIA 4S2LA 1K6SA 5CXWA 5HPFA 4OQGA 5AQ9A 1SDEA 5FSRA 4Y5FA 3U4LP 2JKRI 1DP6A 4OLDA 3IT9A 1I2SA 4JF5A 4KZBA 2ZC5B 4X25A 3JYIA 4CLCC 4R3AA 2D02A 4NXBA 4Y15A 5A90A 1ACFA 3PHYA 3OBFA 5HWVA 4QU3A 4I3JA 1Z09A 5F68A 3UPNA 2FZ0A 4R1GA 3MZFA 4QHCA 4G3WA 1V9YA 5DF9A 4R6LA 1P9RA 2PD8A 3C7UA 2K31A 5A93A 5HPIA 2Y4AA 3SS5A 4YWZA 1LHYA 4GKUA 3WS0A 3BFCA 4DE0A 3MZDA 1UWPX 3PBQA 3HCYA 2V8FA 5E2GA 1ZTUA 3IXGA 1K55A 3DBAA 3UB6A 1KE0A 5GHYA 2C5WB 3GR2A 4Q0HA 1JTGA 1PNEA 4U0XA 3EQUA 2O9BA 4A5RA 3N4IA 1IYSA 3QNCA 4OQIA 4MN7A 4PM5A 2QJ5A 4P6BA 4E3OA 2X01A 3CLOA 2VV7A 4NXGA 3PXPA 4XUZA 1G28A 3BQAA 2WAEA 2Y8HA 1OTBA 4HEFA 4EEPA 3Q82A 2Y2IA 3AGDA 3NY4A 1OTEA 1YMSA 3F1PA 1JVJA 3LR0A 3SOIA 2B5RA 3HLFA 2EFUA 3Q81A 1VQQA 2VZWA 1MXOA 2Y2HA 1MWRA 4JXGA 5CECA 5KMWA 1GSXA 1S0WA 5EVLA 3JVUA 3VE4A 3WRTA 4BD1A 1BTLA 1SZVA 5EUAA 2DMWA 3LYXA 2QHKA 1D7EA 4NG2A 2I72A 4GNUA 2M1CA 5DKKA 4IVIA 5JYOA 2HJ9C 4ARZB 4YOFA 2V0UA 4PMAA 2PDRA 1Y28A 2J7VA 4IUKA 3UE3A 4BBVA 4UHUA 1HLUP 3OZHA 2EWVA 1LL8A 1G6AA 4KUOA 1CEGA 1GCEA 4OPZA 3QNBA 2PR6A 3LI9A 4K0WA 1BLHA 4R23A 3LR4A 4DDSA 2PHYA 5GLCA 3BWLA 1K4EA 3UY6A 1VETA 3V50A 4S2MA 1XA7A 3S7PA 3D4FA 5E2HA 1LLBA 3HUNA 3ZG9B 3W2ZA 2HGVA 4IEDA 4OOYA 5HZHA 3NOUC 3T4LA 2FFYA 4EBNA 4YNRA 4HP9A 3B33A 3TE8A 2W3GA 1WE4A 2DRWA 1EROA 3LFVA 1GA9A 2O99A 2DNSA 4HHDA 3ITAA 5G4YA 2O0YA 3HJIA 2BTFP 3KX0X 2K2NA 2PRFA 1OJGA 1XFQA 1MWSA 2ZL1A 3KO6A 3E98A 4Y13A 4WL9A 3C7VA 3MSHA 4JKTA 2VV6A 4E6XA 3GMWA 3T4SA 3UMDA 4MLLA 4KENB 1TS6A 4WELA 5E2FA 2W3FA 3NBLA 3BM6A 4IHQA 4B4XA 3E2KA 3M2JA 3DTEA 2OLVA 3IH9A 1LI0A 4X68A 3VOYA 1MZUA 1J3WA 1OMEA 4OOMA 4LRYC 3IX3A 3A0SA 2OAP1 3HJKA 3IWOA 4CLCD 4RQ9A 3PBTA 4I3AA 5K5BA 1K54C 1K25A 3M6HA 3C8CA 3N8RA 5HARA 4S2IA 2EWWA 4PKYG 2ZC3B 1HTZA 5EVEA 4FSFA 1PI4A 1K0KA 2HPBA 2OLUA 4RVAA 3S1YA 3MKEA 3ITBA 3W4OA 5F1FA 1IYOA 2Y59A 2D01A 2ZOHA 1X0OA 3IBRA 1NLZA 2O9CA 3F1NA 3O86A 4WYYA 5KSHA 1U60A 3MFDA 4GN2A 1F5MA 3T1XA 4MBFA 3DTIA 2OWJA 1OTAA 3V3RA 3T1SA 3P7NA 1YPRA 3MMHA 3QP4A 4Q0IA 3TOIA 4OPQA 4O0PA 4R70A 1NYMA 3UO9A 4CLCE 3O88A 3F1OA 1W8QA 1XX2A 2NUTC 3S7NA 2Q9MA 1H3QA 5J4EA 4R4SA 3HLWA 1PI5A 2ZQ7A 2E8IA 3WS4A 2Y2LA 5HAPA 5AQAA 4P6ZM 1UWNX 3CI6A 2JKTM 2G2WA 5EM0A 1P9WA 1FSWA 1TEMA 5DFYA 4LRXC 3IWQA 2ZMFA 2XD1A 2W1TA 1AXBA 3NDGA 4IJGA 1W79A 3BLSA 4JLFA 3NDEA 2G2UA 5M1AA 1XKZA 3E4QA 2XFSA 1T1CA 3I7JA 3GDIA 4LV1A 4KZ3A 2Q0OA 1NXYA 3LIDA 2VX8A 5CHJA 1PFLA 2E8JA 3GSGA 4C75A 2J8YA 5FAOA 3JPUA 5HD3A 5HWWA 4GD6A 2RCXA 4G3VA 4XXRA 3HLGA 1V9ZA 5J8XA 3LIEA 5FQQA 5HDCA 4E04A 4G3KA 1SKFA 1W8YA 3M2KA 3ZVTA 2XK1A 4OPRA 2P08A 2PU2A 3MR0A 5FQMA 3VMAA 3HL9A 4GS9A 1OT6A 3HLDA 4CJNA 1E25A 3S7QA 3MJQA 1L0FA 4Y0OA 4ZJ2A 5IS1A 3W4PA 5G18A 1IELA 3FKVA 4EBPA 4HI4A 1OPXA 3BY8A 2OOLA 3T50A 3B3XA 3T4JA 4MCWA 1BLSA 3IBJA 3Q7ZA 3L9KA 3V67A 1BZAA 1K55C 1ONHA 2HJEA 2XEPA 5DTSA 3BW6A 1H0MA 2V9AA 3ULFA 3AGFA 1ES4A 3S22A 1BT5A 4KUKA 5IT5A 4H6JA 4ZBEA 1XJ6A 2INWA 3NI9A 1K56D 1N9OA 4MNRA 5A92A 1BYWA 4RX3A 2BASA 3LI8A 5FQKA 2V2FF 1ODVA 4JF4A 5E43A 4P6ZS 2C6WB 1S1ZA 3NHQA 1I5QA 3GECA 4UAAA 5HFOA 3QP2A 5LBRA 3LCEA 4RYEA 5CX7A 3UB7A 3F1PB 5EV0A 1BUEA 4ZRRA 1SKOA 3CUEC 3PAGA 4OH0A 3IX4A 5E2EA 5F5YA 1WYBA 1FR6A 4UA6A 5EVIC 3C2WA 1KE4A 5HL6A 3BLMA 2J9OA 2UV0E 4EXOA 4WUJA 4YFMA 4P0MA 4EEUA 2W3DA 2JHEA 4QJGA 1LL9A 3AGEA 3FZCA 3ZGAB 5CHMA 2ZJ9A 3IH8A 3VOZA 2ZMVA 4DJ3A 1W5DA 4U3TA 4BD0A 2VJWA 3QP1A 3F1NB 4X53A 1DJCA 1G5UA 2EA9A 3CJMA 2HZ5A 4Y2FA 2QKPA 2IWCA 3HLCA 3ZG8B 4OONA 3PBOA 4PM8A 2KDKA 1GHMA 3UN7A 4PPRA 5DFXA 3Q7VB 1YQSA 4L9EA 2JBFA 2XLNA 5F83A 5CEDA 1WYCA 1KDWA 2PU4A 3B42A 1LSVA 2V1ZA 4MEZA 1ES5A 1L0DA 1YKDA 1FCNA 4GOGA 3IQAA 2R9XA 4Q8IA 1DJBA 2P7JA 3H9WA 1YAXA 5FA7A 1T1AA 2MJ6A 4WBGA 3LIFA 3MS6A 4QD4A 5A8BA 3EGXC 1CK3A 1VETB 1Z6FA 2HP6A 5FDHA 3T12B 1KGGA 3TJZC 5EE8A 1MWUA 4HJ3A 3H7WB 2A24A 3D9YA 1YLZA 3CUEA 1MY8A 2WZZA 4WF0A 4LCMA 1XP4A 2ZQ9A 3E0YA 2KOIA 4L0LA 5M18A 1NYYA 4Y7PA 4BWIA 1N9LA 5DF8A 2EX2A 2WKHA 4PM6A 4NKPA 1W7FA 2Z6DA 2ZL1B 3KSIA 3QP6A 4OPYA 1K57C 4UQIM 1RGZA 1OTDA 3MXQA 3MZEA 4WMCA 3O5YA 1IEMA 3DTKA 3MQQA 3RJUA 2GDNA 3P09A 4GS9B 1J9MA 3BFEA 2P9VA 3BYDA 1RGYA 3BRMA 4MN6A 3KSGA 3CZDA 3F1OB 5F6AA 4BLMA 2K7SA 4EQ1A 4ARZA 5DJUA 2CMNA 4UA7A 3LUQA 4HY8A 3C4OA 3Q1FA 4EQIA 3IS2A 3ZNTA 5CRFA 3UMEA 5TR7A 2XQZA 2H28A 1BSGA 2M7VA 1LT0A 3IF5A 1Q2QA 3EQVA 4PM7A 5JYPA 1FILA 1ERMA 1EWZA 5CGSA 2ZQCA 4DKIA 1PW1A 4N1XA 3EEAA 5HSQA 3KSHA 4XT2A 3O87A 5DJTA 2PYPA 4FH2A 1YLYA 4DE2A 4OLGA 3O3VA 5HD5A 1L0EA 4OQ0A 5CTNA 1YLJA 4C6YA 5FEGA 4KQQA 5HX9A 1SHVA 3VFFA 1Y54A 3T4TA 4GD8A 3E4PA 5FI2A 2JC7A 2JN7A 4X55A 4E6WA 2QWSA 2HP5A 1KE3A 4FTXA 3P01A 5KSCA 2Y2GA 3ZG5A 4WMCD 2EFXA 3H82B 4BJPA 5DKLA 1S6RA 1XJ2A 2XH9A 4ID4A 1PWDA 4K0XA 1XXMA 4NK3A 3DW0A 3G2ZA 3NCKA 3UB5P 3NJAA 4E3MA 1ERQA 3A3FA 1ONGA 2LB9A 2W27A 5KZHA 4QPRA 3PBRA 4MBKA 4UEYA 4HNBA 4UA9A 1Y4OA 3ZFZA 2FH5A 1UGUA 2ZC6B 3LGOA 2VGJA 4KG5A 4LCLA 5L8MA 3BQ8A 2J80A 4GDNA 2YKHA 3HREA 1JTDA 1K38A 3KSFA 3OCLA 2X71A 4OP8A 2L4RA 1S67L 1PZOA 1E3UD 2ZD8A 1ESIA 2H5SA 1TDGA 2JKRM 3UB8A 2HDSA 4JF6A 5FQJA 2ZC4B 2WZXA 1H8MA 4JGPA 1HD8A 4JXVA 4KZ9A 3G31A 4GLQA 3DWKA 5DTKA 4FUWA 1PIOA 3M6BA 2PD7A 1CQAA 3BECA 5A91A 3R7WA 1CI9A 3E4OA 1DY6A 1L0GA 2H0TA 4JXWA 2DCFA 1L2SA 3CHWP 4EERA 1IOUA 3ZCZA 2HDRA 2VK3A 4HJ6A 3N6IA 2WGWA 1P97A 3H82A 4CPKA 3T4OA 4R3BA 5FAPA 2QJ7A 3PTEA 4LLOB 1GHPA 4KZ5A 1M40A 3T4QA 4XUXA 5AQ7A 4GHIA 4O01A 1KOUA 2IWDA 5GLDA 2VGLS 1C3BA 3VSKA 3L7HA 5DTTA 2HDQA 2HDUA 2WGWB 3MFXA 4ME4A 3TSGA 4DXBA 1VEUA 1MKIA 3UB9A 3LEQA 4LV2A 5DVAA 4ZAMA 1ALQA 1CI8A 4HIAA 5F82A 3LY3A 4HBUA 3OCNA 1ES2A 4S2KA 4FCFA 3SW1A 1GSVA 3R4KA 5FI7A 4ZJ3A 3PBNA 5TBMA 4K91A 1SCWA 4OP5A 2Y2QA 5TJJA 1XPBA 4LENA 4DJ2A 1ZC2A 2XDMA 3K3CA 3MF0A 5CEBA 4JGRA 3ZG0A 2VLGA 3CMZA 2B02A 4QY5A 3C30A 2UWXA 3UDFA 4Q0JA 5TGFA 1AWIA 4ZTKA 3K3DA 2WKQA 1WA9A 4X1LA 2L1MA 5FL3A 4WZ5C 1W63Q 2Y2MA 2ZC7A 4QB8A 2WAFA 1DP9A 2P9VB 2PT7A 4M4XA 1EI5A 1T18A 2KX6A 2PAVP 1ZHHB 4B4ZA 2V20A 3GV9A 3G34A 3UE6A 4BENA 4ETXA 4O8GA 2AVXA 1K6RA 2ZQDA 5EM1A 2A24B 2XR0A 4GDBA 1MPLA 4FH4A 4NXFA 1PW8A 4WEKA 2HF6A 3GVBA 4WZ4A 3WS1A 4JGOA 1NZOA 2J9PA 3LEZA 1TS0A 3G32A 4BL2A 5TBMB 4GHIB 1GA0A 3GTCA 1LI9A 2P04A 1O7EA 4GZBA 1TF1A 4GB7A 4WN5A 3ISGA 3RXWA 3VP1A 2ZM2A 3MQOA 1VEUB 2GZAA 1QMFA 5EOOA 5FATA 4Y17A 5G4ZA 2JCHA 2JKFA 4KZAA 4RA7A 2P74A 1N4OA 1N9NA 2WGIA 4DRTA 5GLAA 4IVKA 3BJNA 1HZOA 5J3WA 3HUOA 1IFQA 3WRZA 3D3OA 3ZHHA 3UPOA 1FQGA 4WEJA 2EXBA 2Y2KA 1FOFA 3DTMA 3A0VA 2PYRA 1NLYA 4PAUA 5D3OA 3CITA 2L0WA 1LL5A 4II7A 4Y0UA 3MQ0A 5AVFA 4I3IA 4KQOA 4B88A 1H5XA 3NULA 2Y2OA 2VV8A 3VFHA 4GCZA 5HL1A 2H0YA 5FDSA 4HQAA 3SZTA 1D1JA 2ZQAA 1YM1A 2O9AA 1VHMA 3T4KA 1MKMA 3UE0A 5EVIB 2ZQ8A 4WLAA 4EUZA 5I5LA 2Z6CA 1SKOB 3GQZA 3K2NA 2JE5A 3FWLA 4F3LA 4OVDA 4NXEA 4IUHA 1HVBA 4HH3A 2WYXA 5FI6A 2R78A 4MN5A 1Q2PA 4N9LA 4S2NA 2J3WA 4UQIS 2BG1A 2ZLYA 3BFFA 3IF6C 3IHAA 3NOTC 4QY6A 3E2LA 3EOIA 4EETB 3A3IA 2GJ3A 3KYEA 3N8SA 3V5MA 3N7WA 2WK0A 3CPTA 3MXRA 1RP5A 3VE3A 3ICYA 3UNWA 1YSQA 2B95A 5TFQA 4DMZA 1W63M 1NWZA 1K57A 3KYQA 2Y2NA 1PRQA 4IBXA 4GW9A 1K54A 5AQBA 3VSLA 2XA7M 3IXDA 3MKFA 3OC2A 4HESA 5IHVA 4F3LB 1DP8A 4H8RA 2CC1A 2XF3A 2GNXA 1FR1A 3UE1A 2OV5A 4DF6A 1KGFA
chains in the Genus database with same CATH topology
3UDXA 5AQAA 2JC7A 4X55A 4E6WA 5GLBA 2HP5A 1KE3A 3OPPA 4OKPA 5KSCA 4IBRA 3C5AA 2G2WA 2Y2GA 2WADA 3ZG5A 3HUMA 3S4XA 1FSWA 1TEMA 4WMCD 2EFXA 3OPRA 3OPLA 4BJPA 1S6RA 1TVFA 2XH9A 4ID4A 1PWDA 2Y55A 3G2YA 3IWQA 1XXMA 4K0XA 4NK3A 3DW0A 3G2ZA 3NCKA 4U0TA 5CGWA 2XD1A 3IF6B 5HAQA 1AXBA 3NDGA 4O7DA 1W79A 3BLSA 5CERA 4DDYA 4JLFA 1YLPA 3NIAA 5FASA 5F1GA 5EOEA 4LV0A 3NDEA 3ZVWA 4KG2A 2G2UA 5M1AA 1XKZA 1ERQA 1IYPA 2XFTA 5GHXA 4E3MA 3A3FA 2XFSA 5M19A 1ONGA 4P87A 3I7JA 5KZHA 4LV1A 4KZ3A 1NXYA 4KZ7A 3PBRA 4MBKA 5CHJA 3WS2A 3SH9A 2Y91A 4D2OA 3P98A 3IHBA 3MXSA 1IYQA 3HVFA 3GSGA 1DJAA 4C75A 3PAEA 4UA9A 3ZFZA 5HAIA 2BLSA 2ZC6B 1E3UA 1CEFA 2J8YA 5FAOA 4E3IA 1H8ZA 5FQ9A 4N92A 2VGJA 4GD6A 1VM1A 1ZG4A 2RCXA 4KG5A 3QHYA 4LCLA 1ES3A 1JWZA 1PWCA 1YLWA 4XXRA 3HLGA 4EWFA 3BEBA 3SH7A 4GDNA 4JXSA 5DF7A 3HLEA 3HREA 5J8XA 1H8YA 1G68A 1JTDA 1K38A 3OCLA 3BFGA 5FQQA 2X71A 4OP8A 2EX8A 3ZNYA 2ZM8A 4E3JA 5L2FA 3WS5A 1PZOA 1SKFA 3IXHA 1W8YA 1E3UD 3M2KA 3ZVTA 2XK1A 2ZD8A 4OPRA 1ESIA 2H5SA 4S2LA 1TDGA 5CTMA 1K6SA 5CXWA 2HDSA 2PU2A 4JF6A 5FQJA 5FQMA 2ZC4B 4OQGA 5AQ9A 2WZXA 4DE1A 1SDEA 5FSRA 1HD8A 3LY4A 4JXVA 3VMAA 1K4FA 4KZ9A 3SS4A 3G31A 4OLDA 3HL9A 3IT9A 1I2SA 4JF5A 3HLDA 4CJNA 1FCMA 4KZBA 1XA1A 1M6KA 1E25A 2ZC5B 3DWKA 3JYIA 5DTKA 4Y0OA 1L0FA 1PIOA 3BFDA 4ZJ2A 3M6BA 2ZM0A 3BECA 3W4PA 5A91A 5G18A 1IELA 3FKVA 4EBPA 5A90A 1CI9A 1DY6A 5GL9A 1L0GA 2H0TA 4JXWA 2DCFA 3UDIA 3B3XA 1L2SA 4QU3A 1BLSA 3Q7ZA 3ZCZA 1BZAA 2HDRA 3UPNA 1PWGA 4BL3A 1KGFA 3SH8A 4R1GA 3N6IA 2WGWA 1K55C 1ONHA 3MZFA 4QHCA 5DF9A 4CPKA 3C7UA 2XEPA 5DTSA 4R3BA 5FAPA 4KG6A 4OOLA 5A93A 3AGFA 2EXAA 4X6TA 1ES4A 3PTEA 1GHPA 3IF6A 3S22A 1BT5A 4KZ5A 2Y4AA 1M40A 1O07A 3G30A 3SS5A 3G35A 1LHYA 4ZBEA 4XUXA 4GKUA 3WS0A 5AQ7A 3BFCA 4DE0A 2QPNA 3MZDA 3NI9A 4X56A 1K56D 4NETA 3PBQA 2IWDA 3CG5A 5GLDA 4MNRA 4KZ6A 5E2GA 1C3BA 3VSKA 5DTTA 5A92A 3IXGA 1K55A 4WZ5A 1KE0A 2HDQA 2HDUA 2WGWB 4RX3A 5GHYA 2C5WB 3GR2A 5FQKA 5CGXA 3TSGA 4DXBA 1JTGA 2V2FF 4U0XA 3EQUA 1MKIA 1NJ4A 4JF4A 1MWTA 1K56A 1IYSA 3N4IA 5E43A 1MBLA 4LV2A 5DVAA 4ZAMA 3QNCA 1ALQA 4OQIA 1CI8A 5F82A 2C6WB 2R9WA 4PM5A 2EX6A 3LY3A 4HBUA 1I5QA 4UAAA 3OCNA 5HFOA 1ES2A 1JWPA 3LCEA 4RYEA 4S2KA 4FCFA 4P6BA 4E3OA 5FI7A 1PYYA 1BUEA 2X01A 4ZJ3A 3PBNA 2QMIA 4K91A 4XUZA 1SCWA 3PAGA 4OH0A 2Y2QA 4OP5A 4S2PA 5EECA 5E2EA 1WYBA 1XPBA 1FR6A 4LENA 1ZC2A 4ZJ1A 1I2WA 2XDMA 4UA6A 5CEBA 4PM9A 3ZG0A 5EVIC 4KZ8A 5BOHA 2WAEA 3A3EA 1KE4A 1KVMA 3CMZA 3BLMA 2J9OA 4HEFA 1BLPA 3W8KA 3Q82A 4QY5A 2UWXA 2Q9NA 3UDFA 2Y2IA 3AGDA 3NY4A 4YFMA 3G4PA 5TGFA 4P0MA 3ZDJA 5U47A 4ZTKA 1IKIA 1YMSA 2A49A 4QJGA 1LL9A 1JVJA 3AGEA 3FZCA 3ZGAB 3V3SA 2VGKA 5CHMA 4WZ5C 2B5RA 3HLFA 2EFUA 2ZJ9A 3IH8A 3SOIA 3Q81A 3VOZA 1N9BA 2Y2MA 2ZC7A 4QB8A 1VQQA 3IXBA 2WAFA 4F94A 4M3KA 2X02A 1MXOA 1W5DA 1ZKJA 4U3TA 4A5RA 2Y2HA 4BD0A 1YMXA 2P9VB 2Z2LB 1MWRA 4JXGA 1EI5A 5CECA 4X53A 1DJCA 4JPMA 5KMWA 3TG9A 1S0WA 5EVLA 4ZDXA 5EPHA 3WRTA 4BD1A 1BTLA 3CJMA 4B4ZA 2V20A 5EUAA 4EBLA 2IWCA 3GV9A 3G34A 3HLCA 3ZG8B 1YT4A 1XGJA 4OONA 3PBOA 4BENA 3A3DA 2I72A 2Y2JA 1BLCA 4PM8A 2WUQA 4GNUA 4MBHA 1K6RA 4YINA 4E3KA 4IVIA 1GHMA 2ZQDA 2IWBA 5JYOA 1XGIA 2XR0A 3UN7A 2OSUA 4PMAA 4GDBA 1KVLA 3DWZA 1MPLA 4FH4A 4PPRA 1PW8A 2J7VA 4WEKA 1IKGA 3GVBA 3Q7VA 3Q7VB 1YQSA 4WZ4A 3UE3A 3NC8A 4UHUA 3WS1A 2JBFA 1NZOA 2XLNA 2J9PA 5F83A 5CEDA 3OZHA 3LEZA 1WYCA 2Z2MB 1KDWA 2PU4A 3FYZA 1G6AA 3G32A 1CEGA 1GCEA 4OPZA 2V1ZA 3QNBA 4MEZA 4BL2A 1ES5A 1GA0A 1L0DA 3GTCA 1LI9A 4R4RA 4HBTA 4K0WA 1FCNA 4GOGA 1O7EA 1BLHA 2HP9A 2R9XA 3IQAA 3OPHA 4R23A 4Q8IA 1DJBA 2RL3A 4GZBA 4DXCA 4DDSA 4GB7A 5FA7A 3ISGA 1BULA 5GLCA 2ZM2A 3RXWA 3VP1A 3FV7A 1K4EA 3C4PA 4WBGA 1NZUA 3Q07A 3UY6A 4E3LA 3V50A 4S2MA 4QD4A 1QMFA 4DE3A 4E3NA 5EOOA 4BQMA 4RX2A 1CK3A 1XA7A 1Z6FA 2HP6A 5EVIA 5FDHA 2EX9A 5FATA 3D4FA 4OQHA 5E2HA 1KGGA 4EV4A 1LLBA 2JCHA 3HUNA 4KZAA 4RA7A 2P74A 5EE8A 4OOYA 4IEDA 3ZG9B 1N4OA 3MBZA 1MWUA 1YLTA 2FFYA 2WGIA 4DRTA 4EBNA 5GLAA 4IVKA 4LV3A 1HZOA 1YLZA 1WE4A 1MY8A 2DRWA 3N8LA 1EROA 2WZZA 4WM9A 1GA9A 3HUOA 2DNSA 4LCMA 1TDLA 3WRZA 3GRJA 3ITAA 1XP4A 2ZQ9A 3ZHHA 4L0LA 5M18A 1NYYA 4Y7PA 3UPOA 5DF8A 2EX2A 4JBFA 1FQGA 2WKHA 4WEJA 2EXBA 4PM6A 1W7FA 2Y2KA 1FOFA 3DTMA 1MWSA 4S2OA 5FQIA 5D3OA 1SDNA 3C7VA 3VP3A 4OPYA 1LL5A 4Y0UA 1K57C 2FFFB 4JKTA 4E6XA 4KQOA 3GMWA 4B88A 1ESUA 1H5XA 1RGZA 4MLLA 3VP2A 2Y2OA 4KENB 4N1HA 3MZEA 4WMCA 3RXXA 3VFHA 4WELA 5E2FA 1IEMA 3NBLA 3BM6A 3RJUA 5HL1A 2H0YA 4B4XA 2GDNA 3P09A 3E2KA 3M2JA 4S2JA 2OLVA 3IH9A 1LI0A 4X68A 3VOYA 4R3JA 3V39A 1J9MA 3BFEA 4S2NC 2ZQAA 1OMEA 1YM1A 2P9VA 4OOMA 3BYDA 1RGYA 2XGNA 3UPPA 1JWVA 3UE0A 3BRMA 3IWOA 4R0QA 3A3JA 5HW3A 3CZDA 1NRFA 3PBTA 1RCJA 5EVIB 4BLMA 3SS3A 2ZQ8A 1PZPA 1K54C 1K25A 2QZ6A 3HLBA 3M6HA 4EUZA 4Z9QA 3N8RA 5HARA 3W4QA 3GQZA 4P85A 2JE5A 3FWLA 4S2IA 4C3QA 4OVDA 4UA7A 1HVBA 2WYXA 5FI6A 3IWIA 1KGEA 2ZC3B 3C4OA 3Q1FA 4EQIA 4Y0TA 1HTZA 3ZNTA 5CRFA 5TR7A 2XQZA 4FSFA 1PI4A 1Q2PA 2HPBA 4N9LA 4S2NA 1BSGA 2OLUA 4RVAA 3S1YA 3MKEA 3FKWA 3ITBA 3W4OA 5F1FA 3IF5A 3VP0A 4KZ4A 1Q2QA 1IYOA 2WKIA 2BG1A 2Y59A 2ZLYA 3EQVA 3PBSA 3BFFA 1QMEA 3IF6C 4PM7A 3IHAA 3O86A 4WYYA 3HBRA 5JYPA 5KSHA 1U60A 3MFDA 3LO7A 1ERMA 1EWZA 4QY6A 3E2LA 5CGSA 2ZQCA 2XD5A 4GN2A 4DKIA 1KDSA 1PW1A 3A3IA 4MBFA 5I94A 2ZMAA 4N1XA 5FAQA 3N8SA 3V5MA 3N7WA 2WK0A 3O87A 3MXRA 3V3RA 1FCOA 3VP4A 1RP5A 1E4DA 4FD8A 4N9KA 4FH2A 1NY0A 1YLYA 3UNWA 4DE2A 4OLGA 5HAPA 5TFQA 2Y2PA 3O3VA 3TOIA 3ZG7B 1FSYA 1K57A 4OPQA 1GHIA 2Y2NA 1NYMA 4IBXA 1K54A 1L0EA 2A3UA 2WGVA 5CHUA 4X69A 5AQBA 3UO9A 3VSLA 3IXDA 3O88A 4OQ0A 5CTNA 3MKFA 1YLJA 4C6YA 3OC2A 3WWXA 1W8QA 1XX2A 4KQRA 4KQQA 4HESA 1SHVA 5HX9A 5IHVA 2H10A 5GHZA 3VFFA 4H8RA 2Q9MA 2CC1A 1ZG6A 2XF3A 4DF6A 1Y54A 1FR1A 4R4SA 3UE1A 3HLWA 2OV5A 1PI5A 4GD8A 2ZQ7A 2E8IA 3WS4A 2WKEA 5FI2A 2PBYA 5EVID 2Y2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UDX A;  5AQA A;  2JC7 A;  4X55 A;  4E6W A;  5GLB A;  2HP5 A;  1KE3 A;  3OPP A;  4OKP A;  5KSC A;  4IBR A;  3C5A A;  2G2W A;  2Y2G A;  2WAD A;  3ZG5 A;  3HUM A;  3S4X A;  1FSW A;  1TEM A;  4WMC D;  2EFX A;  3OPR A;  3OPL A;  4BJP A;  1S6R A;  1TVF A;  2XH9 A;  4ID4 A;  1PWD A;  2Y55 A;  3G2Y A;  3IWQ A;  1XXM A;  4K0X A;  4NK3 A;  3DW0 A;  3G2Z A;  3NCK A;  4U0T A;  5CGW A;  2XD1 A;  3IF6 B;  5HAQ A;  1AXB A;  3NDG A;  4O7D A;  1W79 A;  3BLS A;  5CER A;  4DDY A;  4JLF A;  1YLP A;  3NIA A;  5FAS A;  5F1G A;  5EOE A;  4LV0 A;  3NDE A;  3ZVW A;  4KG2 A;  2G2U A;  5M1A A;  1XKZ A;  1ERQ A;  1IYP A;  2XFT A;  5GHX A;  4E3M A;  3A3F A;  2XFS A;  5M19 A;  1ONG A;  4P87 A;  3I7J A;  5KZH A;  4LV1 A;  4KZ3 A;  1NXY A;  4KZ7 A;  3PBR A;  4MBK A;  5CHJ A;  3WS2 A;  3SH9 A;  2Y91 A;  4D2O A;  3P98 A;  3IHB A;  3MXS A;  1IYQ A;  3HVF A;  3GSG A;  1DJA A;  4C75 A;  3PAE A;  4UA9 A;  3ZFZ A;  5HAI A;  2BLS A;  2ZC6 B;  1E3U A;  1CEF A;  2J8Y A;  5FAO A;  4E3I A;  1H8Z A;  5FQ9 A;  4N92 A;  2VGJ A;  4GD6 A;  1VM1 A;  1ZG4 A;  2RCX A;  4KG5 A;  3QHY A;  4LCL A;  1ES3 A;  1JWZ A;  1PWC A;  1YLW A;  4XXR A;  3HLG A;  4EWF A;  3BEB A;  3SH7 A;  4GDN A;  4JXS A;  5DF7 A;  3HLE A;  3HRE A;  5J8X A;  1H8Y A;  1G68 A;  1JTD A;  1K38 A;  3OCL A;  3BFG A;  5FQQ A;  2X71 A;  4OP8 A;  2EX8 A;  3ZNY A;  2ZM8 A;  4E3J A;  5L2F A;  3WS5 A;  1PZO A;  1SKF A;  3IXH A;  1W8Y A;  1E3U D;  3M2K A;  3ZVT A;  2XK1 A;  2ZD8 A;  4OPR A;  1ESI A;  2H5S A;  4S2L A;  1TDG A;  5CTM A;  1K6S A;  5CXW A;  2HDS A;  2PU2 A;  4JF6 A;  5FQJ A;  5FQM A;  2ZC4 B;  4OQG A;  5AQ9 A;  2WZX A;  4DE1 A;  1SDE A;  5FSR A;  1HD8 A;  3LY4 A;  4JXV A;  3VMA A;  1K4F A;  4KZ9 A;  3SS4 A;  3G31 A;  4OLD A;  3HL9 A;  3IT9 A;  1I2S A;  4JF5 A;  3HLD A;  4CJN A;  1FCM A;  4KZB A;  1XA1 A;  1M6K A;  1E25 A;  2ZC5 B;  3DWK A;  3JYI A;  5DTK A;  4Y0O A;  1L0F A;  1PIO A;  3BFD A;  4ZJ2 A;  3M6B A;  2ZM0 A;  3BEC A;  3W4P A;  5A91 A;  5G18 A;  1IEL A;  3FKV A;  4EBP A;  5A90 A;  1CI9 A;  1DY6 A;  5GL9 A;  1L0G A;  2H0T A;  4JXW A;  2DCF A;  3UDI A;  3B3X A;  1L2S A;  4QU3 A;  1BLS A;  3Q7Z A;  3ZCZ A;  1BZA A;  2HDR A;  3UPN A;  1PWG A;  4BL3 A;  1KGF A;  3SH8 A;  4R1G A;  3N6I A;  2WGW A;  1K55 C;  1ONH A;  3MZF A;  4QHC A;  5DF9 A;  4CPK A;  3C7U A;  2XEP A;  5DTS A;  4R3B A;  5FAP A;  4KG6 A;  4OOL A;  5A93 A;  3AGF A;  2EXA A;  4X6T A;  1ES4 A;  3PTE A;  1GHP A;  3IF6 A;  3S22 A;  1BT5 A;  4KZ5 A;  2Y4A A;  1M40 A;  1O07 A;  3G30 A;  3SS5 A;  3G35 A;  1LHY A;  4ZBE A;  4XUX A;  4GKU A;  3WS0 A;  5AQ7 A;  3BFC A;  4DE0 A;  2QPN A;  3MZD A;  3NI9 A;  4X56 A;  1K56 D;  4NET A;  3PBQ A;  2IWD A;  3CG5 A;  5GLD A;  4MNR A;  4KZ6 A;  5E2G A;  1C3B A;  3VSK A;  5DTT A;  5A92 A;  3IXG A;  1K55 A;  4WZ5 A;  1KE0 A;  2HDQ A;  2HDU A;  2WGW B;  4RX3 A;  5GHY A;  2C5W B;  3GR2 A;  5FQK A;  5CGX A;  3TSG A;  4DXB A;  1JTG A;  2V2F F;  4U0X A;  3EQU A;  1MKI A;  1NJ4 A;  4JF4 A;  1MWT A;  1K56 A;  1IYS A;  3N4I A;  5E43 A;  1MBL A;  4LV2 A;  5DVA A;  4ZAM A;  3QNC A;  1ALQ A;  4OQI A;  1CI8 A;  5F82 A;  2C6W B;  2R9W A;  4PM5 A;  2EX6 A;  3LY3 A;  4HBU A;  1I5Q A;  4UAA A;  3OCN A;  5HFO A;  1ES2 A;  1JWP A;  3LCE A;  4RYE A;  4S2K A;  4FCF A;  4P6B A;  4E3O A;  5FI7 A;  1PYY A;  1BUE A;  2X01 A;  4ZJ3 A;  3PBN A;  2QMI A;  4K91 A;  4XUZ A;  1SCW A;  3PAG A;  4OH0 A;  2Y2Q A;  4OP5 A;  4S2P A;  5EEC A;  5E2E A;  1WYB A;  1XPB A;  1FR6 A;  4LEN A;  1ZC2 A;  4ZJ1 A;  1I2W A;  2XDM A;  4UA6 A;  5CEB A;  4PM9 A;  3ZG0 A;  5EVI C;  4KZ8 A;  5BOH A;  2WAE A;  3A3E A;  1KE4 A;  1KVM A;  3CMZ A;  3BLM A;  2J9O A;  4HEF A;  1BLP A;  3W8K A;  3Q82 A;  4QY5 A;  2UWX A;  2Q9N A;  3UDF A;  2Y2I A;  3AGD A;  3NY4 A;  4YFM A;  3G4P A;  5TGF A;  4P0M A;  3ZDJ A;  5U47 A;  4ZTK A;  1IKI A;  1YMS A;  2A49 A;  4QJG A;  1LL9 A;  1JVJ A;  3AGE A;  3FZC A;  3ZGA B;  3V3S A;  2VGK A;  5CHM A;  4WZ5 C;  2B5R A;  3HLF A;  2EFU A;  2ZJ9 A;  3IH8 A;  3SOI A;  3Q81 A;  3VOZ A;  1N9B A;  2Y2M A;  2ZC7 A;  4QB8 A;  1VQQ A;  3IXB A;  2WAF A;  4F94 A;  4M3K A;  2X02 A;  1MXO A;  1W5D A;  1ZKJ A;  4U3T A;  4A5R A;  2Y2H A;  4BD0 A;  1YMX A;  2P9V B;  2Z2L B;  1MWR A;  4JXG A;  1EI5 A;  5CEC A;  4X53 A;  1DJC A;  4JPM A;  5KMW A;  3TG9 A;  1S0W A;  5EVL A;  4ZDX A;  5EPH A;  3WRT A;  4BD1 A;  1BTL A;  3CJM A;  4B4Z A;  2V20 A;  5EUA A;  4EBL A;  2IWC A;  3GV9 A;  3G34 A;  3HLC A;  3ZG8 B;  1YT4 A;  1XGJ A;  4OON A;  3PBO A;  4BEN A;  3A3D A;  2I72 A;  2Y2J A;  1BLC A;  4PM8 A;  2WUQ A;  4GNU A;  4MBH A;  1K6R A;  4YIN A;  4E3K A;  4IVI A;  1GHM A;  2ZQD A;  2IWB A;  5JYO A;  1XGI A;  2XR0 A;  3UN7 A;  2OSU A;  4PMA A;  4GDB A;  1KVL A;  3DWZ A;  1MPL A;  4FH4 A;  4PPR A;  1PW8 A;  2J7V A;  4WEK A;  1IKG A;  3GVB A;  3Q7V A;  3Q7V B;  1YQS A;  4WZ4 A;  3UE3 A;  3NC8 A;  4UHU A;  3WS1 A;  2JBF A;  1NZO A;  2XLN A;  2J9P A;  5F83 A;  5CED A;  3OZH A;  3LEZ A;  1WYC A;  2Z2M B;  1KDW A;  2PU4 A;  3FYZ A;  1G6A A;  3G32 A;  1CEG A;  1GCE A;  4OPZ A;  2V1Z A;  3QNB A;  4MEZ A;  4BL2 A;  1ES5 A;  1GA0 A;  1L0D A;  3GTC A;  1LI9 A;  4R4R A;  4HBT A;  4K0W A;  1FCN A;  4GOG A;  1O7E A;  1BLH A;  2HP9 A;  2R9X A;  3IQA A;  3OPH A;  4R23 A;  4Q8I A;  1DJB A;  2RL3 A;  4GZB A;  4DXC A;  4DDS A;  4GB7 A;  5FA7 A;  3ISG A;  1BUL A;  5GLC A;  2ZM2 A;  3RXW A;  3VP1 A;  3FV7 A;  1K4E A;  3C4P A;  4WBG A;  1NZU A;  3Q07 A;  3UY6 A;  4E3L A;  3V50 A;  4S2M A;  4QD4 A;  1QMF A;  4DE3 A;  4E3N A;  5EOO A;  4BQM A;  4RX2 A;  1CK3 A;  1XA7 A;  1Z6F A;  2HP6 A;  5EVI A;  5FDH A;  2EX9 A;  5FAT A;  3D4F A;  4OQH A;  5E2H A;  1KGG A;  4EV4 A;  1LLB A;  2JCH A;  3HUN A;  4KZA A;  4RA7 A;  2P74 A;  5EE8 A;  4OOY A;  4IED A;  3ZG9 B;  1N4O A;  3MBZ A;  1MWU A;  1YLT A;  2FFY A;  2WGI A;  4DRT A;  4EBN A;  5GLA A;  4IVK A;  4LV3 A;  1HZO A;  1YLZ A;  1WE4 A;  1MY8 A;  2DRW A;  3N8L A;  1ERO A;  2WZZ A;  4WM9 A;  1GA9 A;  3HUO A;  2DNS A;  4LCM A;  1TDL A;  3WRZ A;  3GRJ A;  3ITA A;  1XP4 A;  2ZQ9 A;  3ZHH A;  4L0L A;  5M18 A;  1NYY A;  4Y7P A;  3UPO A;  5DF8 A;  2EX2 A;  4JBF A;  1FQG A;  2WKH A;  4WEJ A;  2EXB A;  4PM6 A;  1W7F A;  2Y2K A;  1FOF A;  3DTM A;  1MWS A;  4S2O A;  5FQI A;  5D3O A;  1SDN A;  3C7V A;  3VP3 A;  4OPY A;  1LL5 A;  4Y0U A;  1K57 C;  2FFF B;  4JKT A;  4E6X A;  4KQO A;  3GMW A;  4B88 A;  1ESU A;  1H5X A;  1RGZ A;  4MLL A;  3VP2 A;  2Y2O A;  4KEN B;  4N1H A;  3MZE A;  4WMC A;  3RXX A;  3VFH A;  4WEL A;  5E2F A;  1IEM A;  3NBL A;  3BM6 A;  3RJU A;  5HL1 A;  2H0Y A;  4B4X A;  2GDN A;  3P09 A;  3E2K A;  3M2J A;  4S2J A;  2OLV A;  3IH9 A;  1LI0 A;  4X68 A;  3VOY A;  4R3J A;  3V39 A;  1J9M A;  3BFE A;  4S2N C;  2ZQA A;  1OME A;  1YM1 A;  2P9V A;  4OOM A;  3BYD A;  1RGY A;  2XGN A;  3UPP A;  1JWV A;  3UE0 A;  3BRM A;  3IWO A;  4R0Q A;  3A3J A;  5HW3 A;  3CZD A;  1NRF A;  3PBT A;  1RCJ A;  5EVI B;  4BLM A;  3SS3 A;  2ZQ8 A;  1PZP A;  1K54 C;  1K25 A;  2QZ6 A;  3HLB A;  3M6H A;  4EUZ A;  4Z9Q A;  3N8R A;  5HAR A;  3W4Q A;  3GQZ A;  4P85 A;  2JE5 A;  3FWL A;  4S2I A;  4C3Q A;  4OVD A;  4UA7 A;  1HVB A;  2WYX A;  5FI6 A;  3IWI A;  1KGE A;  2ZC3 B;  3C4O A;  3Q1F A;  4EQI A;  4Y0T A;  1HTZ A;  3ZNT A;  5CRF A;  5TR7 A;  2XQZ A;  4FSF A;  1PI4 A;  1Q2P A;  2HPB A;  4N9L A;  4S2N A;  1BSG A;  2OLU A;  4RVA A;  3S1Y A;  3MKE A;  3FKW A;  3ITB A;  3W4O A;  5F1F A;  3IF5 A;  3VP0 A;  4KZ4 A;  1Q2Q A;  1IYO A;  2WKI A;  2BG1 A;  2Y59 A;  2ZLY A;  3EQV A;  3PBS A;  3BFF A;  1QME A;  3IF6 C;  4PM7 A;  3IHA A;  3O86 A;  4WYY A;  3HBR A;  5JYP A;  5KSH A;  1U60 A;  3MFD A;  3LO7 A;  1ERM A;  1EWZ A;  4QY6 A;  3E2L A;  5CGS A;  2ZQC A;  2XD5 A;  4GN2 A;  4DKI A;  1KDS A;  1PW1 A;  3A3I A;  4MBF A;  5I94 A;  2ZMA A;  4N1X A;  5FAQ A;  3N8S A;  3V5M A;  3N7W A;  2WK0 A;  3O87 A;  3MXR A;  3V3R A;  1FCO A;  3VP4 A;  1RP5 A;  1E4D A;  4FD8 A;  4N9K A;  4FH2 A;  1NY0 A;  1YLY A;  3UNW A;  4DE2 A;  4OLG A;  5HAP A;  5TFQ A;  2Y2P A;  3O3V A;  3TOI A;  3ZG7 B;  1FSY A;  1K57 A;  4OPQ A;  1GHI A;  2Y2N A;  1NYM A;  4IBX A;  1K54 A;  1L0E A;  2A3U A;  2WGV A;  5CHU A;  4X69 A;  5AQB A;  3UO9 A;  3VSL A;  3IXD A;  3O88 A;  4OQ0 A;  5CTN A;  3MKF A;  1YLJ A;  4C6Y A;  3OC2 A;  3WWX A;  1W8Q A;  1XX2 A;  4KQR A;  4KQQ A;  4HES A;  1SHV A;  5HX9 A;  5IHV A;  2H10 A;  5GHZ A;  3VFF A;  4H8R A;  2Q9M A;  2CC1 A;  1ZG6 A;  2XF3 A;  4DF6 A;  1Y54 A;  1FR1 A;  4R4S A;  3UE1 A;  3HLW A;  2OV5 A;  1PI5 A;  4GD8 A;  2ZQ7 A;  2E8I A;  3WS4 A;  2WKE A;  5FI2 A;  2PBY A;  5EVI D;  2Y2L A; 
#chains in the Genus database with same CATH topology
 3NOP C;  3B47 A;  4IBR A;  2OAQ 1;  3HUM A;  3S4X A;  3CAX A;  3OPR A;  2ZBB A;  2Y55 A;  5MC7 A;  4U0T A;  5HAQ A;  4O7D A;  1YLP A;  5EOE A;  4LV0 A;  1IYP A;  2Y79 A;  5M19 A;  4P87 A;  1T1B A;  4X1M A;  4KZ7 A;  5AJG A;  2Y91 A;  3P98 A;  3IHB A;  3MXS A;  3PR6 A;  1DJA A;  4Z1W A;  2V8C A;  1CEF A;  4N92 A;  1ZG4 A;  2W3H A;  1ES3 A;  1JWZ A;  1PWC A;  1YLW A;  3RH8 B;  1YSP A;  3BEB A;  4JXS A;  5DF7 A;  3HLE A;  1G68 A;  2M7U A;  2EX8 A;  3ZNY A;  2ZM8 A;  5L2F A;  3WS5 A;  4EU0 A;  4XT2 B;  1GSW A;  2GX5 A;  5CTM A;  4BBT A;  3ZQ5 A;  4R38 A;  4DE1 A;  3LR3 A;  3LY4 A;  1K4F A;  3SS4 A;  3PYP A;  1FCM A;  1XA1 A;  1XJ4 A;  1M6K A;  2PR5 A;  3BFD A;  3H7W A;  2ZM0 A;  5GL9 A;  3UDI A;  1PWG A;  4BL3 A;  3SH8 A;  2JKG A;  3IX8 A;  4PKY A;  4KG6 A;  4OOL A;  3NEC A;  2EXA A;  4X6T A;  3IF6 A;  1O07 A;  2W0N A;  3G30 A;  3G35 A;  4LPZ A;  3T1R A;  4HP4 A;  2QPN A;  4X56 A;  2V0W A;  4ETZ A;  2ACG A;  4NET A;  2XRO A;  4L9G A;  3CG5 A;  4BMW A;  3CPT B;  4KZ6 A;  4WZ5 A;  3KYZ A;  3TRC A;  5CGX A;  4NEE D;  1NJ4 A;  4LGW A;  1MWT A;  1K56 A;  1MBL A;  3OLO A;  1MC0 A;  5EFW A;  2R9W A;  2EX6 A;  2XRN A;  2G7U A;  2QYB A;  1JWP A;  1S1Y A;  3T1Q B;  3RFB A;  4KQD A;  1PYY A;  3VOL A;  4HOI A;  4EES A;  2QMI A;  4S2P A;  5EEC A;  1D06 A;  4GJ4 A;  2VA0 A;  1EW0 A;  1NRJ A;  4ZJ1 A;  1I2W A;  1XJ3 A;  4PM9 A;  4KZ8 A;  5BOH A;  3A3E A;  1KVM A;  1BLP A;  3W8K A;  2Q9N A;  3QP8 A;  3G4P A;  3ZDJ A;  5U47 A;  1IKI A;  2A49 A;  4ESP A;  2NUP C;  3V3S A;  2VGK A;  1N9B A;  4F94 A;  3IXB A;  5IU1 A;  4M3K A;  2X02 A;  1ZKJ A;  4B93 A;  1YMX A;  2Z2L B;  3G6O A;  1OT9 A;  4JPM A;  1JNU A;  4DN0 A;  3TG9 A;  4ZDX A;  5EPH A;  2WKP A;  1TS8 A;  4EBL A;  3D72 A;  4QWO A;  1YT4 A;  1XGJ A;  3A3D A;  1OTI A;  2W1R A;  2VEA A;  2Y2J A;  1BLC A;  1S4R A;  3LIC A;  2WUQ A;  4MBH A;  5HWT A;  4YIN A;  4E3K A;  2J3T C;  5L09 A;  2IWB A;  1XGI A;  4CLC B;  2B18 A;  1G6O A;  2OSU A;  1KVL A;  2XA7 S;  3DWZ A;  1IKG A;  3Q7V A;  3NC8 A;  2J3T D;  2Z2M B;  4L9F A;  3FYZ A;  4B9O A;  2V1A A;  3RTY A;  2PBD P;  4R4R A;  4HBT A;  4CQH A;  2HP9 A;  1TS7 A;  3OPH A;  3FC7 A;  2RL3 A;  4DXC A;  3C38 A;  1BUL A;  2LB5 A;  3FV7 A;  3C4P A;  4E3L A;  1NZU A;  3Q07 A;  4DE3 A;  4E3N A;  2KLI A;  4RX2 A;  4BQM A;  2VGL M;  5EVI A;  2EX9 A;  4OQH A;  4EV4 A;  3LR5 A;  1STZ A;  3MBZ A;  4EW7 A;  1YLT A;  2ZOI A;  5FEF A;  3LIB A;  4LV3 A;  2HV1 A;  1F98 A;  2JKT I;  3N8L A;  4WM9 A;  3LIA A;  4MDZ A;  1TDL A;  3GRJ A;  1P0Z A;  4FOF A;  3A0R A;  3FPV A;  4Y3I A;  4JBF A;  5J7E A;  2OWH A;  1CJF A;  4S2O A;  5FQI A;  1SDN A;  3VP3 A;  2FFF B;  4D60 A;  5HDS A;  1ESU A;  3BY9 A;  3VP2 A;  1S4S A;  4N1H A;  3RXX A;  3IS2 B;  4I38 A;  4S2J A;  4R3J A;  3V39 A;  4S2N C;  2XGN A;  3UPP A;  1JWV A;  4R0Q A;  3A3J A;  5HW3 A;  1NRF A;  1RCJ A;  3DAV A;  2YKF A;  3SS3 A;  1PZP A;  2QZ6 A;  3HLB A;  2W1T B;  4Z9Q A;  3W4Q A;  4P85 A;  3CWF A;  2IA2 A;  1OJ5 A;  4C3Q A;  3JVV A;  1XFN A;  3IWI A;  1KGE A;  4Y0T A;  4BBU A;  3FKW A;  3VP0 A;  4KZ4 A;  3PBS A;  2I9V A;  2WKI A;  4HJ4 A;  1QME A;  2XSS A;  3HBR A;  3LO7 A;  3FG8 A;  1FIK A;  2XD5 A;  5I94 A;  1KDS A;  2ZMA A;  3S7O A;  5FAQ A;  1F2K A;  1FCO A;  3VP4 A;  4K08 A;  1E4D A;  4FD8 A;  5C5K A;  4N9K A;  1CF0 A;  1NY0 A;  2Y2P A;  3ZG7 B;  1FSY A;  3EEH A;  1GHI A;  3EWK A;  2A3U A;  2WGV A;  5CHU A;  4X69 A;  2A2L A;  3WWX A;  3FPW A;  4I39 A;  4KQR A;  5L07 A;  2H10 A;  5GHZ A;  4HH2 A;  4JGQ A;  1ZG6 A;  3QP5 A;  3U2A A;  1L3L A;  4I5S A;  3VV4 A;  5L10 A;  2WKE A;  2PBY A;  5EVI D;  2WKR A;  3UDX A;  4PHT A;  1A0K A;  5GLB A;  1VB6 A;  3OPP A;  4OKP A;  3C5A A;  2WAD A;  5F69 A;  3EGD C;  5AVE A;  3OPL A;  1TVF A;  4H6J B;  3G2Y A;  5CGW A;  1LSW A;  3IF6 B;  4LRZ E;  5CER A;  4DDY A;  3NIA A;  5FAS A;  5F1G A;  1S66 L;  3ZVW A;  4KG2 A;  5GHX A;  4EUV A;  2XFT A;  1DRM A;  2V1B A;  1LSX A;  5KIZ A;  3R7W B;  3TW8 A;  3WS2 A;  3SH9 A;  4CLC A;  1T19 A;  4D2O A;  1IYQ A;  3HVF A;  2W3E A;  3OOV A;  3PAE A;  1TD5 A;  5HAI A;  2BLS A;  1E3U A;  1F9I A;  4E3I A;  3ZYT A;  1H8Z A;  4MMN A;  5FQ9 A;  1VM1 A;  4LFU A;  3QHY A;  5HDD A;  4EWF A;  3SH7 A;  1H8Y A;  2VKS A;  3BFG A;  4E3J A;  3IXH A;  4AFI A;  4S2L A;  1K6S A;  5CXW A;  5HPF A;  4OQG A;  5AQ9 A;  1SDE A;  5FSR A;  4Y5F A;  3U4L P;  2JKR I;  1DP6 A;  4OLD A;  3IT9 A;  1I2S A;  4JF5 A;  4KZB A;  2ZC5 B;  4X25 A;  3JYI A;  4CLC C;  4R3A A;  2D02 A;  4NXB A;  4Y15 A;  5A90 A;  1ACF A;  3PHY A;  3OBF A;  5HWV A;  4QU3 A;  4I3J A;  1Z09 A;  5F68 A;  3UPN A;  2FZ0 A;  4R1G A;  3MZF A;  4QHC A;  4G3W A;  1V9Y A;  5DF9 A;  4R6L A;  1P9R A;  2PD8 A;  3C7U A;  2K31 A;  5A93 A;  5HPI A;  2Y4A A;  3SS5 A;  4YWZ A;  1LHY A;  4GKU A;  3WS0 A;  3BFC A;  4DE0 A;  3MZD A;  1UWP X;  3PBQ A;  3HCY A;  2V8F A;  5E2G A;  1ZTU A;  3IXG A;  1K55 A;  3DBA A;  3UB6 A;  1KE0 A;  5GHY A;  2C5W B;  3GR2 A;  4Q0H A;  1JTG A;  1PNE A;  4U0X A;  3EQU A;  2O9B A;  4A5R A;  3N4I A;  1IYS A;  3QNC A;  4OQI A;  4MN7 A;  4PM5 A;  2QJ5 A;  4P6B A;  4E3O A;  2X01 A;  3CLO A;  2VV7 A;  4NXG A;  3PXP A;  4XUZ A;  1G28 A;  3BQA A;  2WAE A;  2Y8H A;  1OTB A;  4HEF A;  4EEP A;  3Q82 A;  2Y2I A;  3AGD A;  3NY4 A;  1OTE A;  1YMS A;  3F1P A;  1JVJ A;  3LR0 A;  3SOI A;  2B5R A;  3HLF A;  2EFU A;  3Q81 A;  1VQQ A;  2VZW A;  1MXO A;  2Y2H A;  1MWR A;  4JXG A;  5CEC A;  5KMW A;  1GSX A;  1S0W A;  5EVL A;  3JVU A;  3VE4 A;  3WRT A;  4BD1 A;  1BTL A;  1SZV A;  5EUA A;  2DMW A;  3LYX A;  2QHK A;  1D7E A;  4NG2 A;  2I72 A;  4GNU A;  2M1C A;  5DKK A;  4IVI A;  5JYO A;  2HJ9 C;  4ARZ B;  4YOF A;  2V0U A;  4PMA A;  2PDR A;  1Y28 A;  2J7V A;  4IUK A;  3UE3 A;  4BBV A;  4UHU A;  1HLU P;  3OZH A;  2EWV A;  1LL8 A;  1G6A A;  4KUO A;  1CEG A;  1GCE A;  4OPZ A;  3QNB A;  2PR6 A;  3LI9 A;  4K0W A;  1BLH A;  4R23 A;  3LR4 A;  4DDS A;  2PHY A;  5GLC A;  3BWL A;  1K4E A;  3UY6 A;  1VET A;  3V50 A;  4S2M A;  1XA7 A;  3S7P A;  3D4F A;  5E2H A;  1LLB A;  3HUN A;  3ZG9 B;  3W2Z A;  2HGV A;  4IED A;  4OOY A;  5HZH A;  3NOU C;  3T4L A;  2FFY A;  4EBN A;  4YNR A;  4HP9 A;  3B33 A;  3TE8 A;  2W3G A;  1WE4 A;  2DRW A;  1ERO A;  3LFV A;  1GA9 A;  2O99 A;  2DNS A;  4HHD A;  3ITA A;  5G4Y A;  2O0Y A;  3HJI A;  2BTF P;  3KX0 X;  2K2N A;  2PRF A;  1OJG A;  1XFQ A;  1MWS A;  2ZL1 A;  3KO6 A;  3E98 A;  4Y13 A;  4WL9 A;  3C7V A;  3MSH A;  4JKT A;  2VV6 A;  4E6X A;  3GMW A;  3T4S A;  3UMD A;  4MLL A;  4KEN B;  1TS6 A;  4WEL A;  5E2F A;  2W3F A;  3NBL A;  3BM6 A;  4IHQ A;  4B4X A;  3E2K A;  3M2J A;  3DTE A;  2OLV A;  3IH9 A;  1LI0 A;  4X68 A;  3VOY A;  1MZU A;  1J3W A;  1OME A;  4OOM A;  4LRY C;  3IX3 A;  3A0S A;  2OAP 1;  3HJK A;  3IWO A;  4CLC D;  4RQ9 A;  3PBT A;  4I3A A;  5K5B A;  1K54 C;  1K25 A;  3M6H A;  3C8C A;  3N8R A;  5HAR A;  4S2I A;  2EWW A;  4PKY G;  2ZC3 B;  1HTZ A;  5EVE A;  4FSF A;  1PI4 A;  1K0K A;  2HPB A;  2OLU A;  4RVA A;  3S1Y A;  3MKE A;  3ITB A;  3W4O A;  5F1F A;  1IYO A;  2Y59 A;  2D01 A;  2ZOH A;  1X0O A;  3IBR A;  1NLZ A;  2O9C A;  3F1N A;  3O86 A;  4WYY A;  5KSH A;  1U60 A;  3MFD A;  4GN2 A;  1F5M A;  3T1X A;  4MBF A;  3DTI A;  2OWJ A;  1OTA A;  3V3R A;  3T1S A;  3P7N A;  1YPR A;  3MMH A;  3QP4 A;  4Q0I A;  3TOI A;  4OPQ A;  4O0P A;  4R70 A;  1NYM A;  3UO9 A;  4CLC E;  3O88 A;  3F1O A;  1W8Q A;  1XX2 A;  2NUT C;  3S7N A;  2Q9M A;  1H3Q A;  5J4E A;  4R4S A;  3HLW A;  1PI5 A;  2ZQ7 A;  2E8I A;  3WS4 A;  2Y2L A;  5HAP A;  5AQA A;  4P6Z M;  1UWN X;  3CI6 A;  2JKT M;  2G2W A;  5EM0 A;  1P9W A;  1FSW A;  1TEM A;  5DFY A;  4LRX C;  3IWQ A;  2ZMF A;  2XD1 A;  2W1T A;  1AXB A;  3NDG A;  4IJG A;  1W79 A;  3BLS A;  4JLF A;  3NDE A;  2G2U A;  5M1A A;  1XKZ A;  3E4Q A;  2XFS A;  1T1C A;  3I7J A;  3GDI A;  4LV1 A;  4KZ3 A;  2Q0O A;  1NXY A;  3LID A;  2VX8 A;  5CHJ A;  1PFL A;  2E8J A;  3GSG A;  4C75 A;  2J8Y A;  5FAO A;  3JPU A;  5HD3 A;  5HWW A;  4GD6 A;  2RCX A;  4G3V A;  4XXR A;  3HLG A;  1V9Z A;  5J8X A;  3LIE A;  5FQQ A;  5HDC A;  4E04 A;  4G3K A;  1SKF A;  1W8Y A;  3M2K A;  3ZVT A;  2XK1 A;  4OPR A;  2P08 A;  2PU2 A;  3MR0 A;  5FQM A;  3VMA A;  3HL9 A;  4GS9 A;  1OT6 A;  3HLD A;  4CJN A;  1E25 A;  3S7Q A;  3MJQ A;  1L0F A;  4Y0O A;  4ZJ2 A;  5IS1 A;  3W4P A;  5G18 A;  1IEL A;  3FKV A;  4EBP A;  4HI4 A;  1OPX A;  3BY8 A;  2OOL A;  3T50 A;  3B3X A;  3T4J A;  4MCW A;  1BLS A;  3IBJ A;  3Q7Z A;  3L9K A;  3V67 A;  1BZA A;  1K55 C;  1ONH A;  2HJE A;  2XEP A;  5DTS A;  3BW6 A;  1H0M A;  2V9A A;  3ULF A;  3AGF A;  1ES4 A;  3S22 A;  1BT5 A;  4KUK A;  5IT5 A;  4H6J A;  4ZBE A;  1XJ6 A;  2INW A;  3NI9 A;  1K56 D;  1N9O A;  4MNR A;  5A92 A;  1BYW A;  4RX3 A;  2BAS A;  3LI8 A;  5FQK A;  2V2F F;  1ODV A;  4JF4 A;  5E43 A;  4P6Z S;  2C6W B;  1S1Z A;  3NHQ A;  1I5Q A;  3GEC A;  4UAA A;  5HFO A;  3QP2 A;  5LBR A;  3LCE A;  4RYE A;  5CX7 A;  3UB7 A;  3F1P B;  5EV0 A;  1BUE A;  4ZRR A;  1SKO A;  3CUE C;  3PAG A;  4OH0 A;  3IX4 A;  5E2E A;  5F5Y A;  1WYB A;  1FR6 A;  4UA6 A;  5EVI C;  3C2W A;  1KE4 A;  5HL6 A;  3BLM A;  2J9O A;  2UV0 E;  4EXO A;  4WUJ A;  4YFM A;  4P0M A;  4EEU A;  2W3D A;  2JHE A;  4QJG A;  1LL9 A;  3AGE A;  3FZC A;  3ZGA B;  5CHM A;  2ZJ9 A;  3IH8 A;  3VOZ A;  2ZMV A;  4DJ3 A;  1W5D A;  4U3T A;  4BD0 A;  2VJW A;  3QP1 A;  3F1N B;  4X53 A;  1DJC A;  1G5U A;  2EA9 A;  3CJM A;  2HZ5 A;  4Y2F A;  2QKP A;  2IWC A;  3HLC A;  3ZG8 B;  4OON A;  3PBO A;  4PM8 A;  2KDK A;  1GHM A;  3UN7 A;  4PPR A;  5DFX A;  3Q7V B;  1YQS A;  4L9E A;  2JBF A;  2XLN A;  5F83 A;  5CED A;  1WYC A;  1KDW A;  2PU4 A;  3B42 A;  1LSV A;  2V1Z A;  4MEZ A;  1ES5 A;  1L0D A;  1YKD A;  1FCN A;  4GOG A;  3IQA A;  2R9X A;  4Q8I A;  1DJB A;  2P7J A;  3H9W A;  1YAX A;  5FA7 A;  1T1A A;  2MJ6 A;  4WBG A;  3LIF A;  3MS6 A;  4QD4 A;  5A8B A;  3EGX C;  1CK3 A;  1VET B;  1Z6F A;  2HP6 A;  5FDH A;  3T12 B;  1KGG A;  3TJZ C;  5EE8 A;  1MWU A;  4HJ3 A;  3H7W B;  2A24 A;  3D9Y A;  1YLZ A;  3CUE A;  1MY8 A;  2WZZ A;  4WF0 A;  4LCM A;  1XP4 A;  2ZQ9 A;  3E0Y A;  2KOI A;  4L0L A;  5M18 A;  1NYY A;  4Y7P A;  4BWI A;  1N9L A;  5DF8 A;  2EX2 A;  2WKH A;  4PM6 A;  4NKP A;  1W7F A;  2Z6D A;  2ZL1 B;  3KSI A;  3QP6 A;  4OPY A;  1K57 C;  4UQI M;  1RGZ A;  1OTD A;  3MXQ A;  3MZE A;  4WMC A;  3O5Y A;  1IEM A;  3DTK A;  3MQQ A;  3RJU A;  2GDN A;  3P09 A;  4GS9 B;  1J9M A;  3BFE A;  2P9V A;  3BYD A;  1RGY A;  3BRM A;  4MN6 A;  3KSG A;  3CZD A;  3F1O B;  5F6A A;  4BLM A;  2K7S A;  4EQ1 A;  4ARZ A;  5DJU A;  2CMN A;  4UA7 A;  3LUQ A;  4HY8 A;  3C4O A;  3Q1F A;  4EQI A;  3IS2 A;  3ZNT A;  5CRF A;  3UME A;  5TR7 A;  2XQZ A;  2H28 A;  1BSG A;  2M7V A;  1LT0 A;  3IF5 A;  1Q2Q A;  3EQV A;  4PM7 A;  5JYP A;  1FIL A;  1ERM A;  1EWZ A;  5CGS A;  2ZQC A;  4DKI A;  1PW1 A;  4N1X A;  3EEA A;  5HSQ A;  3KSH A;  4XT2 A;  3O87 A;  5DJT A;  2PYP A;  4FH2 A;  1YLY A;  4DE2 A;  4OLG A;  3O3V A;  5HD5 A;  1L0E A;  4OQ0 A;  5CTN A;  1YLJ A;  4C6Y A;  5FEG A;  4KQQ A;  5HX9 A;  1SHV A;  3VFF A;  1Y54 A;  3T4T A;  4GD8 A;  3E4P A;  5FI2 A;  2JC7 A;  2JN7 A;  4X55 A;  4E6W A;  2QWS A;  2HP5 A;  1KE3 A;  4FTX A;  3P01 A;  5KSC A;  2Y2G A;  3ZG5 A;  4WMC D;  2EFX A;  3H82 B;  4BJP A;  5DKL A;  1S6R A;  1XJ2 A;  2XH9 A;  4ID4 A;  1PWD A;  4K0X A;  1XXM A;  4NK3 A;  3DW0 A;  3G2Z A;  3NCK A;  3UB5 P;  3NJA A;  4E3M A;  1ERQ A;  3A3F A;  1ONG A;  2LB9 A;  2W27 A;  5KZH A;  4QPR A;  3PBR A;  4MBK A;  4UEY A;  4HNB A;  4UA9 A;  1Y4O A;  3ZFZ A;  2FH5 A;  1UGU A;  2ZC6 B;  3LGO A;  2VGJ A;  4KG5 A;  4LCL A;  5L8M A;  3BQ8 A;  2J80 A;  4GDN A;  2YKH A;  3HRE A;  1JTD A;  1K38 A;  3KSF A;  3OCL A;  2X71 A;  4OP8 A;  2L4R A;  1S67 L;  1PZO A;  1E3U D;  2ZD8 A;  1ESI A;  2H5S A;  1TDG A;  2JKR M;  3UB8 A;  2HDS A;  4JF6 A;  5FQJ A;  2ZC4 B;  2WZX A;  1H8M A;  4JGP A;  1HD8 A;  4JXV A;  4KZ9 A;  3G31 A;  4GLQ A;  3DWK A;  5DTK A;  4FUW A;  1PIO A;  3M6B A;  2PD7 A;  1CQA A;  3BEC A;  5A91 A;  3R7W A;  1CI9 A;  3E4O A;  1DY6 A;  1L0G A;  2H0T A;  4JXW A;  2DCF A;  1L2S A;  3CHW P;  4EER A;  1IOU A;  3ZCZ A;  2HDR A;  2VK3 A;  4HJ6 A;  3N6I A;  2WGW A;  1P97 A;  3H82 A;  4CPK A;  3T4O A;  4R3B A;  5FAP A;  2QJ7 A;  3PTE A;  4LLO B;  1GHP A;  4KZ5 A;  1M40 A;  3T4Q A;  4XUX A;  5AQ7 A;  4GHI A;  4O01 A;  1KOU A;  2IWD A;  5GLD A;  2VGL S;  1C3B A;  3VSK A;  3L7H A;  5DTT A;  2HDQ A;  2HDU A;  2WGW B;  3MFX A;  4ME4 A;  3TSG A;  4DXB A;  1VEU A;  1MKI A;  3UB9 A;  3LEQ A;  4LV2 A;  5DVA A;  4ZAM A;  1ALQ A;  1CI8 A;  4HIA A;  5F82 A;  3LY3 A;  4HBU A;  3OCN A;  1ES2 A;  4S2K A;  4FCF A;  3SW1 A;  1GSV A;  3R4K A;  5FI7 A;  4ZJ3 A;  3PBN A;  5TBM A;  4K91 A;  1SCW A;  4OP5 A;  2Y2Q A;  5TJJ A;  1XPB A;  4LEN A;  4DJ2 A;  1ZC2 A;  2XDM A;  3K3C A;  3MF0 A;  5CEB A;  4JGR A;  3ZG0 A;  2VLG A;  3CMZ A;  2B02 A;  4QY5 A;  3C30 A;  2UWX A;  3UDF A;  4Q0J A;  5TGF A;  1AWI A;  4ZTK A;  3K3D A;  2WKQ A;  1WA9 A;  4X1L A;  2L1M A;  5FL3 A;  4WZ5 C;  1W63 Q;  2Y2M A;  2ZC7 A;  4QB8 A;  2WAF A;  1DP9 A;  2P9V B;  2PT7 A;  4M4X A;  1EI5 A;  1T18 A;  2KX6 A;  2PAV P;  1ZHH B;  4B4Z A;  2V20 A;  3GV9 A;  3G34 A;  3UE6 A;  4BEN A;  4ETX A;  4O8G A;  2AVX A;  1K6R A;  2ZQD A;  5EM1 A;  2A24 B;  2XR0 A;  4GDB A;  1MPL A;  4FH4 A;  4NXF A;  1PW8 A;  4WEK A;  2HF6 A;  3GVB A;  4WZ4 A;  3WS1 A;  4JGO A;  1NZO A;  2J9P A;  3LEZ A;  1TS0 A;  3G32 A;  4BL2 A;  5TBM B;  4GHI B;  1GA0 A;  3GTC A;  1LI9 A;  2P04 A;  1O7E A;  4GZB A;  1TF1 A;  4GB7 A;  4WN5 A;  3ISG A;  3RXW A;  3VP1 A;  2ZM2 A;  3MQO A;  1VEU B;  2GZA A;  1QMF A;  5EOO A;  5FAT A;  4Y17 A;  5G4Z A;  2JCH A;  2JKF A;  4KZA A;  4RA7 A;  2P74 A;  1N4O A;  1N9N A;  2WGI A;  4DRT A;  5GLA A;  4IVK A;  3BJN A;  1HZO A;  5J3W A;  3HUO A;  1IFQ A;  3WRZ A;  3D3O A;  3ZHH A;  3UPO A;  1FQG A;  4WEJ A;  2EXB A;  2Y2K A;  1FOF A;  3DTM A;  3A0V A;  2PYR A;  1NLY A;  4PAU A;  5D3O A;  3CIT A;  2L0W A;  1LL5 A;  4II7 A;  4Y0U A;  3MQ0 A;  5AVF A;  4I3I A;  4KQO A;  4B88 A;  1H5X A;  3NUL A;  2Y2O A;  2VV8 A;  3VFH A;  4GCZ A;  5HL1 A;  2H0Y A;  5FDS A;  4HQA A;  3SZT A;  1D1J A;  2ZQA A;  1YM1 A;  2O9A A;  1VHM A;  3T4K A;  1MKM A;  3UE0 A;  5EVI B;  2ZQ8 A;  4WLA A;  4EUZ A;  5I5L A;  2Z6C A;  1SKO B;  3GQZ A;  3K2N A;  2JE5 A;  3FWL A;  4F3L A;  4OVD A;  4NXE A;  4IUH A;  1HVB A;  4HH3 A;  2WYX A;  5FI6 A;  2R78 A;  4MN5 A;  1Q2P A;  4N9L A;  4S2N A;  2J3W A;  4UQI S;  2BG1 A;  2ZLY A;  3BFF A;  3IF6 C;  3IHA A;  3NOT C;  4QY6 A;  3E2L A;  3EOI A;  4EET B;  3A3I A;  2GJ3 A;  3KYE A;  3N8S A;  3V5M A;  3N7W A;  2WK0 A;  3CPT A;  3MXR A;  1RP5 A;  3VE3 A;  3ICY A;  3UNW A;  1YSQ A;  2B95 A;  5TFQ A;  4DMZ A;  1W63 M;  1NWZ A;  1K57 A;  3KYQ A;  2Y2N A;  1PRQ A;  4IBX A;  4GW9 A;  1K54 A;  5AQB A;  3VSL A;  2XA7 M;  3IXD A;  3MKF A;  3OC2 A;  4HES A;  5IHV A;  4F3L B;  1DP8 A;  4H8R A;  2CC1 A;  2XF3 A;  2GNX A;  1FR1 A;  3UE1 A;  2OV5 A;  4DF6 A;  1KGF A; 
#chains in the Genus database with same CATH homology
 3UDX A;  5AQA A;  2JC7 A;  4X55 A;  4E6W A;  5GLB A;  2HP5 A;  1KE3 A;  3OPP A;  4OKP A;  5KSC A;  4IBR A;  3C5A A;  2G2W A;  2Y2G A;  2WAD A;  3ZG5 A;  3HUM A;  3S4X A;  1FSW A;  1TEM A;  4WMC D;  2EFX A;  3OPR A;  3OPL A;  4BJP A;  1S6R A;  1TVF A;  2XH9 A;  4ID4 A;  1PWD A;  2Y55 A;  3G2Y A;  3IWQ A;  1XXM A;  4K0X A;  4NK3 A;  3DW0 A;  3G2Z A;  3NCK A;  4U0T A;  5CGW A;  2XD1 A;  3IF6 B;  5HAQ A;  1AXB A;  3NDG A;  4O7D A;  1W79 A;  3BLS A;  5CER A;  4DDY A;  4JLF A;  1YLP A;  3NIA A;  5FAS A;  5F1G A;  5EOE A;  4LV0 A;  3NDE A;  3ZVW A;  4KG2 A;  2G2U A;  5M1A A;  1XKZ A;  1ERQ A;  1IYP A;  2XFT A;  5GHX A;  4E3M A;  3A3F A;  2XFS A;  5M19 A;  1ONG A;  4P87 A;  3I7J A;  5KZH A;  4LV1 A;  4KZ3 A;  1NXY A;  4KZ7 A;  3PBR A;  4MBK A;  5CHJ A;  3WS2 A;  3SH9 A;  2Y91 A;  4D2O A;  3P98 A;  3IHB A;  3MXS A;  1IYQ A;  3HVF A;  3GSG A;  1DJA A;  4C75 A;  3PAE A;  4UA9 A;  3ZFZ A;  5HAI A;  2BLS A;  2ZC6 B;  1E3U A;  1CEF A;  2J8Y A;  5FAO A;  4E3I A;  1H8Z A;  5FQ9 A;  4N92 A;  2VGJ A;  4GD6 A;  1VM1 A;  1ZG4 A;  2RCX A;  4KG5 A;  3QHY A;  4LCL A;  1ES3 A;  1JWZ A;  1PWC A;  1YLW A;  4XXR A;  3HLG A;  4EWF A;  3BEB A;  3SH7 A;  4GDN A;  4JXS A;  5DF7 A;  3HLE A;  3HRE A;  5J8X A;  1H8Y A;  1G68 A;  1JTD A;  1K38 A;  3OCL A;  3BFG A;  5FQQ A;  2X71 A;  4OP8 A;  2EX8 A;  3ZNY A;  2ZM8 A;  4E3J A;  5L2F A;  3WS5 A;  1PZO A;  1SKF A;  3IXH A;  1W8Y A;  1E3U D;  3M2K A;  3ZVT A;  2XK1 A;  2ZD8 A;  4OPR A;  1ESI A;  2H5S A;  4S2L A;  1TDG A;  5CTM A;  1K6S A;  5CXW A;  2HDS A;  2PU2 A;  4JF6 A;  5FQJ A;  5FQM A;  2ZC4 B;  4OQG A;  5AQ9 A;  2WZX A;  4DE1 A;  1SDE A;  5FSR A;  1HD8 A;  3LY4 A;  4JXV A;  3VMA A;  1K4F A;  4KZ9 A;  3SS4 A;  3G31 A;  4OLD A;  3HL9 A;  3IT9 A;  1I2S A;  4JF5 A;  3HLD A;  4CJN A;  1FCM A;  4KZB A;  1XA1 A;  1M6K A;  1E25 A;  2ZC5 B;  3DWK A;  3JYI A;  5DTK A;  4Y0O A;  1L0F A;  1PIO A;  3BFD A;  4ZJ2 A;  3M6B A;  2ZM0 A;  3BEC A;  3W4P A;  5A91 A;  5G18 A;  1IEL A;  3FKV A;  4EBP A;  5A90 A;  1CI9 A;  1DY6 A;  5GL9 A;  1L0G A;  2H0T A;  4JXW A;  2DCF A;  3UDI A;  3B3X A;  1L2S A;  4QU3 A;  1BLS A;  3Q7Z A;  3ZCZ A;  1BZA A;  2HDR A;  3UPN A;  1PWG A;  4BL3 A;  1KGF A;  3SH8 A;  4R1G A;  3N6I A;  2WGW A;  1K55 C;  1ONH A;  3MZF A;  4QHC A;  5DF9 A;  4CPK A;  3C7U A;  2XEP A;  5DTS A;  4R3B A;  5FAP A;  4KG6 A;  4OOL A;  5A93 A;  3AGF A;  2EXA A;  4X6T A;  1ES4 A;  3PTE A;  1GHP A;  3IF6 A;  3S22 A;  1BT5 A;  4KZ5 A;  2Y4A A;  1M40 A;  1O07 A;  3G30 A;  3SS5 A;  3G35 A;  1LHY A;  4ZBE A;  4XUX A;  4GKU A;  3WS0 A;  5AQ7 A;  3BFC A;  4DE0 A;  2QPN A;  3MZD A;  3NI9 A;  4X56 A;  1K56 D;  4NET A;  3PBQ A;  2IWD A;  3CG5 A;  5GLD A;  4MNR A;  4KZ6 A;  5E2G A;  1C3B A;  3VSK A;  5DTT A;  5A92 A;  3IXG A;  1K55 A;  4WZ5 A;  1KE0 A;  2HDQ A;  2HDU A;  2WGW B;  4RX3 A;  5GHY A;  2C5W B;  3GR2 A;  5FQK A;  5CGX A;  3TSG A;  4DXB A;  1JTG A;  2V2F F;  4U0X A;  3EQU A;  1MKI A;  1NJ4 A;  4JF4 A;  1MWT A;  1K56 A;  1IYS A;  3N4I A;  5E43 A;  1MBL A;  4LV2 A;  5DVA A;  4ZAM A;  3QNC A;  1ALQ A;  4OQI A;  1CI8 A;  5F82 A;  2C6W B;  2R9W A;  4PM5 A;  2EX6 A;  3LY3 A;  4HBU A;  1I5Q A;  4UAA A;  3OCN A;  5HFO A;  1ES2 A;  1JWP A;  3LCE A;  4RYE A;  4S2K A;  4FCF A;  4P6B A;  4E3O A;  5FI7 A;  1PYY A;  1BUE A;  2X01 A;  4ZJ3 A;  3PBN A;  2QMI A;  4K91 A;  4XUZ A;  1SCW A;  3PAG A;  4OH0 A;  2Y2Q A;  4OP5 A;  4S2P A;  5EEC A;  5E2E A;  1WYB A;  1XPB A;  1FR6 A;  4LEN A;  1ZC2 A;  4ZJ1 A;  1I2W A;  2XDM A;  4UA6 A;  5CEB A;  4PM9 A;  3ZG0 A;  5EVI C;  4KZ8 A;  5BOH A;  2WAE A;  3A3E A;  1KE4 A;  1KVM A;  3CMZ A;  3BLM A;  2J9O A;  4HEF A;  1BLP A;  3W8K A;  3Q82 A;  4QY5 A;  2UWX A;  2Q9N A;  3UDF A;  2Y2I A;  3AGD A;  3NY4 A;  4YFM A;  3G4P A;  5TGF A;  4P0M A;  3ZDJ A;  5U47 A;  4ZTK A;  1IKI A;  1YMS A;  2A49 A;  4QJG A;  1LL9 A;  1JVJ A;  3AGE A;  3FZC A;  3ZGA B;  3V3S A;  2VGK A;  5CHM A;  4WZ5 C;  2B5R A;  3HLF A;  2EFU A;  2ZJ9 A;  3IH8 A;  3SOI A;  3Q81 A;  3VOZ A;  1N9B A;  2Y2M A;  2ZC7 A;  4QB8 A;  1VQQ A;  3IXB A;  2WAF A;  4F94 A;  4M3K A;  2X02 A;  1MXO A;  1W5D A;  1ZKJ A;  4U3T A;  4A5R A;  2Y2H A;  4BD0 A;  1YMX A;  2P9V B;  2Z2L B;  1MWR A;  4JXG A;  1EI5 A;  5CEC A;  4X53 A;  1DJC A;  4JPM A;  5KMW A;  3TG9 A;  1S0W A;  5EVL A;  4ZDX A;  5EPH A;  3WRT A;  4BD1 A;  1BTL A;  3CJM A;  4B4Z A;  2V20 A;  5EUA A;  4EBL A;  2IWC A;  3GV9 A;  3G34 A;  3HLC A;  3ZG8 B;  1YT4 A;  1XGJ A;  4OON A;  3PBO A;  4BEN A;  3A3D A;  2I72 A;  2Y2J A;  1BLC A;  4PM8 A;  2WUQ A;  4GNU A;  4MBH A;  1K6R A;  4YIN A;  4E3K A;  4IVI A;  1GHM A;  2ZQD A;  2IWB A;  5JYO A;  1XGI A;  2XR0 A;  3UN7 A;  2OSU A;  4PMA A;  4GDB A;  1KVL A;  3DWZ A;  1MPL A;  4FH4 A;  4PPR A;  1PW8 A;  2J7V A;  4WEK A;  1IKG A;  3GVB A;  3Q7V A;  3Q7V B;  1YQS A;  4WZ4 A;  3UE3 A;  3NC8 A;  4UHU A;  3WS1 A;  2JBF A;  1NZO A;  2XLN A;  2J9P A;  5F83 A;  5CED A;  3OZH A;  3LEZ A;  1WYC A;  2Z2M B;  1KDW A;  2PU4 A;  3FYZ A;  1G6A A;  3G32 A;  1CEG A;  1GCE A;  4OPZ A;  2V1Z A;  3QNB A;  4MEZ A;  4BL2 A;  1ES5 A;  1GA0 A;  1L0D A;  3GTC A;  1LI9 A;  4R4R A;  4HBT A;  4K0W A;  1FCN A;  4GOG A;  1O7E A;  1BLH A;  2HP9 A;  2R9X A;  3IQA A;  3OPH A;  4R23 A;  4Q8I A;  1DJB A;  2RL3 A;  4GZB A;  4DXC A;  4DDS A;  4GB7 A;  5FA7 A;  3ISG A;  1BUL A;  5GLC A;  2ZM2 A;  3RXW A;  3VP1 A;  3FV7 A;  1K4E A;  3C4P A;  4WBG A;  1NZU A;  3Q07 A;  3UY6 A;  4E3L A;  3V50 A;  4S2M A;  4QD4 A;  1QMF A;  4DE3 A;  4E3N A;  5EOO A;  4BQM A;  4RX2 A;  1CK3 A;  1XA7 A;  1Z6F A;  2HP6 A;  5EVI A;  5FDH A;  2EX9 A;  5FAT A;  3D4F A;  4OQH A;  5E2H A;  1KGG A;  4EV4 A;  1LLB A;  2JCH A;  3HUN A;  4KZA A;  4RA7 A;  2P74 A;  5EE8 A;  4OOY A;  4IED A;  3ZG9 B;  1N4O A;  3MBZ A;  1MWU A;  1YLT A;  2FFY A;  2WGI A;  4DRT A;  4EBN A;  5GLA A;  4IVK A;  4LV3 A;  1HZO A;  1YLZ A;  1WE4 A;  1MY8 A;  2DRW A;  3N8L A;  1ERO A;  2WZZ A;  4WM9 A;  1GA9 A;  3HUO A;  2DNS A;  4LCM A;  1TDL A;  3WRZ A;  3GRJ A;  3ITA A;  1XP4 A;  2ZQ9 A;  3ZHH A;  4L0L A;  5M18 A;  1NYY A;  4Y7P A;  3UPO A;  5DF8 A;  2EX2 A;  4JBF A;  1FQG A;  2WKH A;  4WEJ A;  2EXB A;  4PM6 A;  1W7F A;  2Y2K A;  1FOF A;  3DTM A;  1MWS A;  4S2O A;  5FQI A;  5D3O A;  1SDN A;  3C7V A;  3VP3 A;  4OPY A;  1LL5 A;  4Y0U A;  1K57 C;  2FFF B;  4JKT A;  4E6X A;  4KQO A;  3GMW A;  4B88 A;  1ESU A;  1H5X A;  1RGZ A;  4MLL A;  3VP2 A;  2Y2O A;  4KEN B;  4N1H A;  3MZE A;  4WMC A;  3RXX A;  3VFH A;  4WEL A;  5E2F A;  1IEM A;  3NBL A;  3BM6 A;  3RJU A;  5HL1 A;  2H0Y A;  4B4X A;  2GDN A;  3P09 A;  3E2K A;  3M2J A;  4S2J A;  2OLV A;  3IH9 A;  1LI0 A;  4X68 A;  3VOY A;  4R3J A;  3V39 A;  1J9M A;  3BFE A;  4S2N C;  2ZQA A;  1OME A;  1YM1 A;  2P9V A;  4OOM A;  3BYD A;  1RGY A;  2XGN A;  3UPP A;  1JWV A;  3UE0 A;  3BRM A;  3IWO A;  4R0Q A;  3A3J A;  5HW3 A;  3CZD A;  1NRF A;  3PBT A;  1RCJ A;  5EVI B;  4BLM A;  3SS3 A;  2ZQ8 A;  1PZP A;  1K54 C;  1K25 A;  2QZ6 A;  3HLB A;  3M6H A;  4EUZ A;  4Z9Q A;  3N8R A;  5HAR A;  3W4Q A;  3GQZ A;  4P85 A;  2JE5 A;  3FWL A;  4S2I A;  4C3Q A;  4OVD A;  4UA7 A;  1HVB A;  2WYX A;  5FI6 A;  3IWI A;  1KGE A;  2ZC3 B;  3C4O A;  3Q1F A;  4EQI A;  4Y0T A;  1HTZ A;  3ZNT A;  5CRF A;  5TR7 A;  2XQZ A;  4FSF A;  1PI4 A;  1Q2P A;  2HPB A;  4N9L A;  4S2N A;  1BSG A;  2OLU A;  4RVA A;  3S1Y A;  3MKE A;  3FKW A;  3ITB A;  3W4O A;  5F1F A;  3IF5 A;  3VP0 A;  4KZ4 A;  1Q2Q A;  1IYO A;  2WKI A;  2BG1 A;  2Y59 A;  2ZLY A;  3EQV A;  3PBS A;  3BFF A;  1QME A;  3IF6 C;  4PM7 A;  3IHA A;  3O86 A;  4WYY A;  3HBR A;  5JYP A;  5KSH A;  1U60 A;  3MFD A;  3LO7 A;  1ERM A;  1EWZ A;  4QY6 A;  3E2L A;  5CGS A;  2ZQC A;  2XD5 A;  4GN2 A;  4DKI A;  1KDS A;  1PW1 A;  3A3I A;  4MBF A;  5I94 A;  2ZMA A;  4N1X A;  5FAQ A;  3N8S A;  3V5M A;  3N7W A;  2WK0 A;  3O87 A;  3MXR A;  3V3R A;  1FCO A;  3VP4 A;  1RP5 A;  1E4D A;  4FD8 A;  4N9K A;  4FH2 A;  1NY0 A;  1YLY A;  3UNW A;  4DE2 A;  4OLG A;  5HAP A;  5TFQ A;  2Y2P A;  3O3V A;  3TOI A;  3ZG7 B;  1FSY A;  1K57 A;  4OPQ A;  1GHI A;  2Y2N A;  1NYM A;  4IBX A;  1K54 A;  1L0E A;  2A3U A;  2WGV A;  5CHU A;  4X69 A;  5AQB A;  3UO9 A;  3VSL A;  3IXD A;  3O88 A;  4OQ0 A;  5CTN A;  3MKF A;  1YLJ A;  4C6Y A;  3OC2 A;  3WWX A;  1W8Q A;  1XX2 A;  4KQR A;  4KQQ A;  4HES A;  1SHV A;  5HX9 A;  5IHV A;  2H10 A;  5GHZ A;  3VFF A;  4H8R A;  2Q9M A;  2CC1 A;  1ZG6 A;  2XF3 A;  4DF6 A;  1Y54 A;  1FR1 A;  4R4S A;  3UE1 A;  3HLW A;  2OV5 A;  1PI5 A;  4GD8 A;  2ZQ7 A;  2E8I A;  3WS4 A;  2WKE A;  5FI2 A;  2PBY A;  5EVI D;  2Y2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...