3DW0A

Crystal structure of the class a carbapenemase kpc-2 at 1.6 angstrom resolution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
265
structure length
265
Chain Sequence
AEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Class A carbapenemase KPC-2
publication title Genetic and structural insights into the dissemination potential of the extremely broad-spectrum class A beta-lactamase KPC-2 identified in an Escherichia coli strain and an Enterobacter cloacae strain isolated from the same patient in France.
pubmed doi rcsb
source organism Escherichia coli
total genus 91
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3dw0A00
5KMWA 1ZG6A 1QMEA 1PI4A 4H8RA 2V1ZA 1MWRA 1NRFA 5FAQA 4E3OA 2H0TA 2V2FF 3P09A 5CXWA 3S4XA 4DE3A 1L0DA 4S2MA 2XR0A 2J9PA 1NJ4A 5CEDA 3MZEA 1K54C 3VP4A 1K6SA 3BLSA 4K91A 1JWPA 4BD1A 4EBPA 4WBGA 3HLGA 4QY6A 2PU2A 4PM6A 5FQQA 3UPOA 4OOMA 4R3BA 5CTMA 5F1FA 3EQVA 4LV1A 1W8YA 4E3KA 1HZOA 1XA1A 3NY4A 5FAOA 3OC2A 3HVFA 5DTKA 1IYSA 1KVLA 4IBRA 2Y2OA 5HAIA 3ISGA 2HDRA 5M18A 4U3TA 3MBZA 4Z9QA 2WKIA 1JWZA 1PWDA 4MBKA 5HX9A 1JWVA 2X01A 4QJGA 5FI7A 1HTZA 5TFQA 4GD6A 3S1YA 5FQMA 1Q2PA 3VP0A 1J9MA 5FAPA 3C7VA 3HBRA 5GHZA 2Y59A 4XUXA 3UE3A 2J7VA 1RP5A 4EUZA 2ZLYA 3V5MA 3FWLA 2HDUA 1YLZA 4EBLA 4ZDXA 2G2UA 3LCEA 2X02A 1M40A 1CI8A 3IH9A 4KZ9A 4E6WA 3AGFA 3G2ZA 1IYOA 2WGVA 4DF6A 4DE1A 3HLWA 4KZAA 2CC1A 2RL3A 2R9WA 4BENA 2JE5A 4EQIA 3ZVTA 1DJCA 4U0XA 3MZDA 2EX8A 5E2HA 4GN2A 1YLPA 4JXSA 3ITBA 3AGEA 4KQQA 3TOIA 1E3UA 2ZQ8A 3HL9A 1ERQA 1WYBA 1FCNA 3HUMA 5GLDA 1YT4A 5FQ9A 5CEBA 5TGFA 5HAQA 1H5XA 5GLAA 4OPYA 3N4IA 4O7DA 1IYQA 2ZC6B 3IHAA 1K4EA 4GZBA 4KZ8A 3PBNA 5EVIA 4GD8A 4BL3A 5FQIA 3ZHHA 3VP3A 3IXDA 2V20A 5EPHA 2FFYA 3HREA 4MBFA 2ZC4B 5A91A 3RXXA 5FA7A 3SS5A 1U60A 3MFDA 3UO9A 2Y2LA 3IT9A 4PM7A 5EE8A 1ZKJA 3DWZA 5A90A 3WS4A 1MXOA 1YLTA 1S6RA 5G18A 5EOOA 1CEGA 4K0XA 2Y2HA 4E3NA 1XXMA 2ZM2A 3D4FA 4IVKA 1PWGA 2XFSA 2Y2PA 3CMZA 2J9OA 3IXBA 4PM8A 4QB8A 1O07A 1IEMA 4WEJA 4F94A 1I2SA 4KZBA 3SS3A 3UE1A 1DJAA 1NZUA 3SS4A 1ESIA 5FQJA 4MNRA 5GL9A 3WWXA 3V3RA 3N6IA 3A3JA 3A3IA 3G2YA 4R0QA 4DKIA 4QD4A 1FR6A 5EVIB 3PBTA 4YINA 1K56A 1LLBA 3LY3A 3Q1FA 4ZTKA 3RJUA 4P85A 2HP9A 5IHVA 3ZNTA 1I2WA 2WUQA 3UDFA 3A3FA 3G32A 1ONHA 3N8LA 3A3EA 1PW1A 1XA7A 4UA9A 3Q7VA 5FDHA 2WZZA 4WMCD 2WAEA 1W79A 4JF6A 5GLCA 4EBNA 1ES4A 2Y2QA 4OQIA 3ZCZA 2H5SA 5CGSA 5DTSA 4WELA 4KENB 1JTDA 1EROA 1GA0A 1H8ZA 4BLMA 1NY0A 3WS5A 4NK3A 3NDGA 1FSWA 1KGGA 5E43A 2Z2LB 4UA6A 2QPNA 3MXSA 3W8KA 3Q81A 3IF5A 1GHIA 3N8RA 1GHMA 4GNUA 4B4XA 2PU4A 4OP8A 1OMEA 2H10A 4U0TA 2ZM8A 1L0EA 1MBLA 1E3UD 3VP2A 1YMSA 1VQQA 3C7UA 3ZDJA 1MWSA 3G31A 3IQAA 4M3KA 1Q2QA 3BFFA 3Q7VB 3BFDA 5EVID 3M2KA 1ERMA 5CHMA 1KE0A 1GA9A 3B3XA 3ZGAB 3VP1A 4S2NC 4ZJ2A 2EXAA 1IKGA 3A3DA 2E8IA 1SCWA 5U47A 4GKUA 5M19A 5HW3A 2Y4AA 3ZG0A 3M6HA 4OPRA 4GOGA 1KGEA 1KVMA 4OONA 2RCXA 2HDQA 4QU3A 3UY6A 3VMAA 5JYOA 1TDGA 3IXGA 5EVLA 3W4OA 3LEZA 3UPNA 3HLEA 5AQBA 1GCEA 3HLFA 4WM9A 5HFOA 1PIOA 3IWQA 4KQOA 4ZJ3A 2ZD8A 5KZHA 3NCKA 1PZOA 1HD8A 2WZXA 4JF5A 1SDEA 3P98A 3BM6A 5HARA 4RX3A 2ZC7A 2EFUA 1TVFA 4N1XA 4GDNA 2C6WB 2ZJ9A 3PAEA 1M6KA 2J8YA 1NXYA 1RCJA 4OQGA 4RVAA 4X69A 1CK3A 1FCMA 5AQ9A 5AQAA 1MWUA 3NIAA 1DY6A 1WE4A 2XD1A 1YM1A 2Y2GA 4OVDA 1SDNA 1XX2A 1ES2A 2HP5A 2Y2NA 4IEDA 1ZG4A 4UAAA 1MWTA 2WYXA 1JTGA 2OLVA 4DE0A 1FQGA 5CHJA 3UDXA 4PPRA 1N4OA 3N8SA 4WEKA 5E2GA 2DNSA 3BYDA 4Y0OA 1FR1A 4Y0TA 4DE2A 5E2FA 2DRWA 3TG9A 4JF4A 1K57A 1ALQA 3Q7ZA 4RA7A 5BOHA 2WGWA 2P9VA 1YQSA 2EX9A 2BG1A 4N1HA 1L0FA 1K4FA 5HAPA 2EFXA 3VFFA 4CJNA 4JXWA 3QHYA 4DRTA 1NYMA 3W4PA 4RX2A 2Q9NA 2UWXA 2XGNA 4S2OA 2ZMAA 3MKEA 4OQHA 1K25A 2ZQDA 2ZQ9A 4HEFA 3LO7A 3AGDA 2ZQ7A 4PM9A 1K57C 3PBOA 3OZHA 3PAGA 3ZVWA 1FSYA 1H8YA 1PI5A 2JC7A 2EX2A 5KSCA 3EQUA 3ZNYA 4S2PA 1BTLA 2IWDA 5EUAA 4S2KA 3RXWA 4Q8IA 1KDSA 4HBTA 3PBSA 1K6RA 4OOYA 4Y0UA 1MKIA 1KGFA 2JCHA 3W4QA 2WGWB 2P9VB 3LY4A 3UNWA 2G2WA 4LV2A 2XH9A 2P74A 3ZFZA 3N7WA 3ZG9B 3PBQA 5D3OA 1S0WA 3HLDA 4Y7PA 1NZOA 5A92A 4KZ5A 3OCLA 4N9LA 2WKHA 1BLPA 2Z2MB 1FCOA 4LCMA 3BEBA 4UHUA 1JVJA 1PW8A 3MXRA 5JYPA 4OH0A 4IVIA 4NETA 4RYEA 1CI9A 1YMXA 2I72A 4GDBA 1BLHA 4X53A 3CJMA 1XP4A 4C75A 3HUOA 1QMFA 4E3MA 1BUEA 3OPPA 3IWIA 3ZG7B 3BECA 4QY5A 1KDWA 2XFTA 3G34A 4ZJ1A 4GB7A 4OLGA 1BULA 1W8QA 4LV0A 1ESUA 3GRJA 1SKFA 4OPQA 2BLSA 3O86A 4JXVA 4ZAMA 1MY8A 4S2NA 3Q82A 2XLNA 5CECA 1G68A 1XPBA 2A49A 2XDMA 3OPLA 1KE4A 1IELA 1LHYA 1LI0A 2XEPA 1L0GA 4PMAA 3BRMA 2WGIA 4P0MA 1VM1A 3FKVA 2WADA 4HBUA 1EI5A 4KG2A 2IWBA 3PBRA 3NC8A 4X55A 1BT5A 2ZQAA 4K0WA 4LV3A 3ZG5A 5L2FA 5KSHA 4LCLA 1WYCA 4JKTA 4BD0A 1BZAA 3FZCA 4MBHA 2IWCA 1N9BA 3V50A 4JLFA 4N92A 1CEFA 1TEMA 3G30A 1ZC2A 1Z6FA 4XUZA 5DTTA 3SH7A 1DJBA 2Y55A 3FYZA 5M1AA 3WRZA 4JPMA 1PZPA 3ITAA 2QZ6A 4OP5A 4S2LA 1SHVA 2WKEA 2GDNA 4R1GA 3C4OA 1RGZA 3PTEA 4L0LA 5FQKA 4PM5A 4DDSA 2Q9MA 2EX6A 4B88A 5I94A 4R4SA 4KQRA 5A93A 1K55A 4DXCA 1C3BA 4S2IA 5DVAA 4EWFA 5F1GA 2C5WB 2WK0A 3IHBA 4X6TA 4C6YA 1ES3A 1K38A 1YLYA 5HL1A 1TDLA 2VGKA 1K56D 1IKIA 3GTCA 2Y2IA 2Y91A 3GSGA 3S22A 3OPHA 3O3VA 2HPBA 3BFGA 1HVBA 4X68A 4FH4A 2PBYA 2DCFA 1K55C 3IWOA 5CGXA 3M2JA 5F83A 1O7EA 2Y2KA 3FV7A 3QNCA 4BL2A 1LI9A 5FATA 3HLBA 5CGWA 4DXBA 4OOLA 4WZ4A 5GHYA 4E3IA 4EV4A 5FI6A 4C3QA 4WMCA 3IF6A 3M6BA 4E6XA 3I7JA 2EXBA 3OCNA 4OKPA 3WRTA 5FASA 3BFEA 2ZQCA 3NI9A 3VOYA 3DTMA 2ZM0A 5FI2A 4ZBEA 1PWCA 4KZ6A 1AXBA 1EWZA 2QMIA 4IBXA 3O87A 4R23A 5E2EA 5GLBA 3SOIA 3UN7A 3BLMA 2OSUA 3O88A 1FOFA 2Y2JA 4ID4A 5CRFA 4JXGA 4E3LA 4KZ3A 3VOZA 1IYPA 3SH9A 4P6BA 3SH8A 1KE3A 3NBLA 1NYYA 3IF6C 4D2OA 1BLCA 1XKZA 1Y54A 4OQ0A 1ONGA 2H0YA 3DW0A 4BQMA 2X71A 4OPZA 3WS0A 1PYYA 1W7FA 3GR2A 2WAFA 4DDYA 3Q07A 3QNBA 4X56A 4YFMA 4KZ7A 4WYYA 1YLWA 3IF6B 4JBFA 2OLUA 1XGJA 5AQ7A 2Y2MA 5EECA 2R9XA 3GMWA 5F82A 3V39A 1GHPA 5DF9A 3OPRA 2A3UA 2JBFA 3V3SA 3VFHA 4OLDA 4QHCA 4FD8A 1BSGA 3TSGA 4A5RA 3GV9A 1MPLA 2HP6A 4MLLA 1BLSA 5J8XA 3C4PA 1RGYA 3JYIA 3UDIA 3E2KA 3MZFA 4KG5A 5DF8A 3G35A 4HESA 5EVIC 1I5QA 1YLJA 3ZG8B 4FH2A 3UE0A 2HDSA 3HUNA 4S2JA 2XD5A 5CERA 3UPPA 4UA7A 3IH8A 3G4PA 4FCFA 5CTNA 4R3JA 1E4DA 4E3JA 1LL9A 2B5RA 3HLCA 3NDEA 4FSFA 3GVBA 4WZ5A 5DF7A 5FSRA 2XF3A 2XK1A 4B4ZA 3BFCA 3VSLA 4KG6A 2VGJA 3C5AA 1W5DA 3CG5A 1LL5A 3GQZA 3CZDA 3FKWA 5GHXA 5TR7A 5EOEA 1G6AA 1L2SA 4CPKA 3E2LA 2ZC3B 2OV5A 3IXHA 4R4RA 3VSKA 4P87A 4WZ5C 3DWKA 4KZ4A 3WS2A 1E25A 3MKFA 4XXRA 2ZC5B 4BJPA 3WS1A 1XGIA 4N9KA 5CHUA 1K54A 1ES5A 2XQZA 4MEZA 2FFFB 4LENA
chains in the Genus database with same CATH superfamily
3EEAA 1NRFA 2V8FA 2H0TA 4GHIA 5DJTA 5HZHA 5FL3A 4QY6A 4MN5A 3UPOA 5FEGA 3EQVA 1W8YA 2PYRA 1HZOA 3DTIA 3HVFA 5FDSA 4LRXC 5HWWA 4HNBA 2WKPA 4EEPA 5L10A 4HP9A 2WKIA 1JWZA 3A0SA 4GHIB 4BMWA 5F6AA 2HJ9C 3S1YA 4IHQA 1Q2PA 4EUZA 2ZLYA 2HDUA 3KYZA 1Z09A 1K0KA 4YOFA 4KZ9A 1ACFA 4R6LA 4DE1A 4K08A 1Y28A 2CC1A 5DJUA 1DJCA 4U0XA 2J3TD 3IX3A 3HUMA 1WYBA 1FCNA 5CEBA 4OPYA 3BJNA 1IYQA 3IHAA 4HJ4A 4GZBA 3EGXC 1S4SA 5FQIA 3ZHHA 1S66L 5EPHA 2FFYA 3SS5A 1U60A 3MFDA 3IT9A 4D60A 4MCWA 4GJ4A 4I3AA 5G18A 2L0WA 4JGOA 4K0XA 5GLBA 3CMZA 2Y2PA 4PM8A 1O07A 3IX4A 3UB8A 1ESIA 2XA7M 3RFBA 1STZA 4R0QA 2VGLM 3PBTA 1LLBA 2ZL1A 2I9VA 3ZNTA 1I2WA 2WUQA 2XSSA 1ONHA 1PW1A 1XA7A 2WZZA 3QP6A 1EROA 1ZHHB 3WS5A 4NK3A 3NDGA 2QPNA 2QHKA 1GHMA 4X25A 3MJQA 1OMEA 2ZL1B 3ULFA 3VP2A 3C7UA 3IQAA 5CHMA 1KE0A 3ZGAB 4BBUA 3VP1A 1D1JA 3A3DA 2E8IA 5U47A 3ZG0A 4OPRA 2RCXA 1PRQA 4FUWA 3UY6A 4F3LA 5L8MA 3W4OA 4O0PA 4DJ2A 3HLEA 1PIOA 3FC7A 1PZOA 4RX3A 2O0YA 2O9CA 4EEUA 3DBAA 2ZJ9A 2ZMFA 1NXYA 2P7JA 5AQAA 4ESPA 2GNXA 1SDNA 3VE3A 3DAVA 4DE0A 4F3LB 3UDXA 1OTAA 4JGPA 5E2GA 4Y0OA 2M7VA 4Y0TA 3A0RA 3TG9A 3MSHA 1ALQA 1G28A 2P9VA 1YQSA 3LIBA 5HAPA 1L3LA 2EFXA 3QHYA 2JKTM 4DRTA 5IT5A 2XGNA 2UV0E 4L9FA 2KDKA 3LO7A 2ZQ7A 4HOIA 2KX6A 3PBOA 1PI5A 2JC7A 3LR4A 1KDSA 1K6RA 4OOYA 2P9VB 3JVUA 4Y7PA 3OCLA 3LR3A 5FEFA 2J3WA 1FCOA 3BEBA 3MXRA 2KOIA 1CI9A 3LI9A 3OPPA 1YAXA 3IWIA 1W8QA 3HJKA 1SKFA 3O86A 2XROA 2A49A 2XDMA 1IELA 4I3IA 4FTXA 2L1MA 1LHYA 2XEPA 4P0MA 2WADA 1BT5A 2ZQAA 2A2LA 5G4YA 5L2FA 5HL6A 3H9WA 2AVXA 2VZWA 3W2ZA 3G30A 4XUZA 1ZC2A 5DTTA 1OJ5A 4M4XA 1PZPA 3ITAA 2QZ6A 5DFXA 2J3TC 4P6ZM 1NLYA 1SHVA 4HY8A 2DMWA 2Q9MA 2EX6A 4KQRA 1T1CA 4DXCA 3E98A 2V1AA 5F1GA 2WK0A 2QWSA 5HWVA 1TDLA 2VGKA 5C5KA 1W63Q 1IKIA 3GTCA 2Y2IA 3GSGA 2PHYA 2DCFA 3M2JA 5F83A 4BL2A 4DN0A 4R3AA 1LI9A 3HLBA 4OOLA 3IF6A 2EXBA 3CWFA 1V9ZA 1OTDA 2ZM0A 4X1MA 3NULA 2QMIA 4IBXA 3O5YA 2R78A 3UN7A 3O88A 1WA9A 4DJ3A 4ID4A 5CRFA 1N9OA 1KE3A 3IBRA 1NYYA 2VV6A 1XKZA 3VE4A 4OPZA 3WS0A 3T4TA 4ZRRA 4KZ7A 1YLWA 3IF6B 4CQHA 2OLUA 5EECA 3V39A 5DF9A 3VFHA 1NLZA 3LYXA 3LIEA 1MPLA 1BLSA 3C4PA 2PD7A 5DF8A 1CJFA 4HESA 3F1PA 1N9NA 5EV0A 1LL9A 4FSFA 2HJEA 4LRZE 1DRMA 2XF3A 3BFCA 2VGJA 4EXOA 3GQZA 3CZDA 2ZC3B 3IXHA 5KIZA 3T4QA 1PNEA 1E25A 4XXRA 1DP9A 3F1PB 5CHUA 1K54A 2FFFB 1VEUA 1QMEA 2V1ZA 1MWRA 3C2WA 3S4XA 2W3HA 4S2MA 5CEDA 3BQAA 3BLSA 2K31A 4R70A 3A0VA 5FQQA 4OOMA 2V9AA 5CTMA 4LV1A 3R7WA 2W27A 1VEUB 4IBRA 5M18A 2EWVA 3IBJA 1Y4OA 4Z9QA 1PWDA 2X01A 2CMNA 5FAPA 3UE6A 3C7VA 1PFLA 3HBRA 2Y59A 2J7VA 1RP5A 2J80A 4B93A 3LGOA 3V5MA 2ZMVA 1YLZA 2W3DA 2G2UA 3LCEA 3R7WB 1M40A 2P04A 1CI8A 1IYOA 2WGVA 3HLWA 2RL3A 4EQIA 2JE5A 3H7WA 3AGEA 2ZQ8A 3HL9A 5GLDA 1YT4A 5FQ9A 1H5XA 5GLAA 3LFVA 3D3OA 2FZ0A 3RH8B 2OWHA 2ZC6B 4Y17A 1K4EA 1F9IA 3MS6A 3S7NA 3VP3A 3IXDA 3NOUC 1XFQA 2ZC4B 3EOIA 4NEED 3UO9A 2HZ5A 5EE8A 1JNUA 1TD5A 3WS4A 1MXOA 1YLTA 2GX5A 4NXBA 2ZM2A 3H7WB 1PWGA 2J9OA 1I2SA 3QP8A 3TE8A 3SS4A 3N6IA 3A3JA 1MKMA 2V0WA 3G2YA 4WL9A 4ZTKA 1K56A 5IHVA 3UDFA 2INWA 3CLOA 3BY9A 4ARZA 2B95A 1W79A 1V9YA 3K2NA 2Y2QA 3ZCZA 2H5SA 3KSHA 1JTDA 5E43A 2Z2LB 4UA6A 3MXSA 3Q81A 1GHIA 4B4XA 2ZM8A 1VHMA 3KYEA 1YPRA 1VQQA 3ZDJA 3G31A 4ARZB 3BFDA 3M2KA 5DKLA 2JKRI 1GA9A 5MC7A 4ZJ2A 2EXAA 1TF1A 1A0KA 2LB9A 3E4QA 5HW3A 3M6HA 4GOGA 1KGEA 2HDQA 3MFXA 3MXQA 4QU3A 3KYQA 5JYOA 3VV4A 4HJ6A 3LEZA 1GCEA 3E0YA 2PAVP 4KQOA 2ZD8A 1HD8A 1X0OA 1SDEA 3P98A 2ZC7A 1TVFA 4GDNA 2C6WB 4II7A 1RCJA 4RVAA 1CK3A 5K5BA 2IA2A 5AQ9A 1KOUA 1WE4A 2Y2GA 4OVDA 2Y79A 4IEDA 2HP5A 1OTBA 2Y2NA 5EVEA 3P01A 1MWTA 2E8JA 4FOFA 3NECA 1N4OA 1BYWA 2VKSA 4WUJA 2DRWA 4JF4A 2WGWA 3U4LP 2BG1A 1K4FA 1D7EA 4CJNA 3T4KA 1NYMA 5AVFA 3NOPC 5HWTA 2JKGA 2Q9NA 3E4PA 1MC0A 3MKEA 4OQHA 4HEFA 3V67A 4EESA 1OJGA 3T1XA 3CITA 1FSYA 1H8YA 4Q0JA 5EUAA 4EQ1A 2B18A 4G3VA 4Y0UA 1KGFA 2WGWB 3LY4A 2OAP1 4O8GA 4BBVA 3ZFZA 5L07A 3EEHA 1H0MA 3F1NA 1BLPA 4NXGA 4LCMA 2PYPA 4CLCD 2I72A 4Y13A 1XP4A 4C75A 3HUOA 1QMFA 4E3MA 3KSFA 5F69A 4WLAA 4GB7A 4OPQA 2Z6DA 4ZAMA 3T1RA 3Q82A 2XLNA 1G68A 3OPLA 4HH2A 3F1NB 1VM1A 4HBUA 1EI5A 3KO6A 2IWBA 3PBRA 3ZG5A 1S1YA 5F5YA 2W3FA 3CUEA 4AFIA 5EFWA 1SKOA 2IWCA 4N92A 3FPWA 1Z6FA 1DJBA 5M1AA 3FYZA 2NUTC 4JPMA 2VA0A 4S2LA 2GDNA 4L0LA 2ACGA 4PM5A 4DDSA 3MR0A 5HPFA 1K55A 1C3BA 3CI6A 4PHTA 2PDRA 4C6YA 1ES3A 1K38A 3TRCA 1K56D 2ZOIA 3S22A 2VX8A 5TBMA 4R38A 3BFGA 1SKOB 3LR5A 3LIFA 2PBYA 1LSVA 3IWOA 1O7EA 3DTKA 4EV4A 5CGWA 4DXBA 4UQIM 5FI6A 3F1OA 1P9WA 3M6BA 3WRTA 3NJAA 4HJ3A 3BFEA 2ZQCA 1EW0A 1AXBA 1EWZA 4R23A 3SOIA 3BLMA 1FOFA 4MDZA 3LEQA 4JXGA 1XFNA 4KZ3A 3VOZA 5TBMB 3NBLA 3IF6C 4D2OA 1BLCA 3BQ8A 1ONGA 3LICA 3DW0A 1S67L 3TJZC 3GR2A 2WAFA 2PR6A 4HP4A 3G6OA 3EWKA 3TW8A 3F1OB 3QNBA 3LUQA 4YFMA 3GMWA 5F82A 1GHPA 4A5RA 3B47A 3GV9A 2OAQ1 4NG2A 2QKPA 4PAUA 1TS8A 3MZFA 2JKFA 1F2KA 1I5QA 4LPZA 2PR5A 2HDSA 2XD5A 3LIAA 2V0UA 2BTFP 4E3JA 4WZ5A 3VSLA 4KG6A 3C5AA 1LL5A 5EOEA 3E2LA 1OPXA 4R4RA 3VSKA 5J7EA 4P87A 3DWKA 4KZ4A 3WS2A 2YKHA 4BJPA 1IOUA 3LI8A 1XGIA 1ES5A 2GZAA 3MMHA 2XA7S 5HD3A 2VGLS 2VV7A 3MQQA 5KMWA 1ZG6A 1PI4A 1UWNX 4H8RA 5FAQA 4MN7A 4DE3A 1L0DA 4ETZA 1K54C 4YWZA 4K91A 4LRYC 3CPTA 4EBPA 4WBGA 3HLGA 2PU2A 2XRNA 4R3BA 5DKKA 5F1FA 4E3KA 1XA1A 3NY4A 4GLQA 5DTKA 1IYSA 1ODVA 5HAIA 4B9OA 2HDRA 2L4RA 5HDDA 3MBZA 5HX9A 1JWVA 1HTZA 5TFQA 3S7PA 1GSXA 3IS2A 3CPTB 4XUXA 2MJ6A 3UE3A 2PRFA 4ZDXA 3SW1A 3L9KA 3AGFA 4DF6A 2P08A 3R4KA 4E04A 2R9WA 3ZVTA 4BWIA 3MZDA 2EX8A 5E2HA 1YLPA 3TOIA 2K2NA 3CAXA 4Q0IA 5TGFA 3N4IA 3IS2B 4O7DA 4HI4A 5DFYA 3S7OA 4BL3A 3PBNA 2OOLA 2V20A 4ME4A 3T4OA 3HREA 5A91A 4Q0HA 3RXXA 1N9LA 3DWZA 3FPVA 3K3CA 5EOOA 1CEGA 1XXMA 4IVKA 2XFSA 3D9YA 3IXBA 4QB8A 1IEMA 4WEJA 4F94A 3SS3A 5FQJA 4MNRA 5GL9A 3A3IA 4DKIA 4QD4A 1FR6A 3RJUA 4P85A 2G7UA 3G32A 3A3EA 4UA9A 5FDHA 1TS0A 2WAEA 5GLCA 4EBNA 5DTSA 5CGSA 4BLMA 1H8ZA 1F5MA 1FSWA 2JKRM 1S1ZA 3W8KA 3IF5A 4GNUA 3L7HA 2PU4A 4OP8A 2H10A 1MBLA 1E3UD 2K7SA 1MWSA 1G6OA 1T1BA 5EVID 3B3XA 1SZVA 1IKGA 4LLOB 3B33A 1SCWA 4GKUA 4Y3IA 1UGUA 2Y4AA 3BWLA 4YNRA 4OONA 1XJ2A 3IXGA 5EVLA 5HPIA 4WM9A 5HFOA 4ZJ3A 2WZXA 3BM6A 2EFUA 1NRJA 1DP6A 3PAEA 1M6KA 4CLCA 4X69A 3RTYA 1FCMA 1MWUA 5AVEA 4LGWA 4P6ZS 3LR0A 1XX2A 2V8CA 2WYXA 1JTGA 2OLVA 3T12B 5HDCA 4I39A 1LSXA 4WEKA 2DNSA 3BYDA 4Y2FA 4WF0A 1IFQA 4DE2A 5E2FA 2FH5A 3T50A 2ZOHA 3ZYTA 1K57A 5BOHA 4RA7A 2EX9A 2W0NA 1L0FA 3VFFA 4JXWA 4CLCB 4RX2A 2UWXA 4NXFA 3LIDA 3OOVA 1K25A 2ZQDA 3AGDA 4PM9A 5G4ZA 4ETXA 3OZHA 3PAGA 3ZVWA 2EX2A 5KSCA 5F68A 1ZTUA 2IWDA 3MQ0A 4S2KA 4Q8IA 2D01A 4HBTA 3PBSA 1AWIA 3W4QA 2G2WA 4LV2A 2XH9A 2P74A 3N7WA 3ZG9B 5D3OA 5A92A 4KZ5A 4N9LA 2WKHA 2Z2MB 4UHUA 1JVJA 5JYPA 1DP8A 4NETA 4RYEA 3CHWP 4GDBA 1BLHA 2PD8A 2Q0OA 4QY5A 1KDWA 2XFTA 3G34A 4ZJ1A 4OLGA 4LV0A 1ESUA 3GRJA 2BLSA 4JXVA 1MY8A 5CECA 1XPBA 1KE4A 1LI0A 3KSIA 4O01A 4EERA 4PMAA 2A24A 3FKVA 3PR6A 1VB6A 3NC8A 4K0WA 4LV3A 3FZCA 4MBHA 1N9BA 4JLFA 1CEFA 1TEMA 3C8CA 3SH7A 2Y55A 3WRZA 3QP1A 4OP5A 4EETB 4EU0A 5FQKA 3CUEC 3PTEA 4L9GA 4R4SA 1W63M 4EWFA 3IHBA 2A24B 2GJ3A 1YLYA 3BW6A 2Y91A 3OPHA 3O3VA 2HPBA 4X68A 4FH4A 1K55C 5AJGA 2Y2KA 1OTEA 3FG8A 3FV7A 4WZ4A 5GHYA 4E3IA 3PHYA 4WMCA 3I7JA 3UMDA 5FASA 3NI9A 5EM0A 1UWPX 4KZ6A 1P9RA 3O87A 2O9AA 4MMNA 5E2EA 1IYPA 3SH9A 4P6BA 3SH8A 4GCZA 1XJ6A 4OQ0A 4BQMA 3NHQA 1W7FA 4EW7A 4DDYA 4Y15A 2Y2MA 2R9XA 2A3UA 2JBFA 3V3SA 1NWZA 4OLDA 4FD8A 1BSGA 1OT9A 2HP6A 4PKYG 4MLLA 5J8XA 1RGYA 4I3JA 4RQ9A 3SZTA 3OBFA 4KG5A 3G35A 2M7UA 5EVIC 3ZG8B 1S4RA 4CLCE 4S2JA 3HUNA 5CERA 3UPPA 3IX8A 3IH8A 4QPRA 4FCFA 4R3JA 3HLCA 3NDEA 3GVBA 2XK1A 4B4ZA 1YSPA 3D72A 1W5DA 1T1AA 5TR7A 5GHXA 3MQOA 1G6AA 4CPKA 2OV5A 5HD5A 1GSVA 4WZ5C 3QP2A 2ZC5B 5IS1A 3WS1A 5J4EA 2XQZA 4MEZA 4MBFA 3JPUA 4I38A 1OTIA 4E3OA 2V2FF 3P09A 5CXWA 2HF6A 2XR0A 2J9PA 1NJ4A 3MZEA 3VP4A 1K6SA 1JWPA 4BD1A 3C30A 4PM6A 4Y5FA 5J3WA 4X1LA 5FAOA 3OC2A 1KVLA 2Y2OA 3ISGA 1XJ3A 1LT0A 4U3TA 4MBKA 4QJGA 5FI7A 4GD6A 5FQMA 3VP0A 1J9MA 2O99A 2D02A 5GHZA 1P97A 3FWLA 4L9EA 4EBLA 2X02A 1CQAA 3IH9A 4E6WA 3G2ZA 1P0ZA 4KZAA 4EUVA 1FILA 4BENA 4PKYA 4GN2A 4JXSA 3OLOA 3ITBA 4KQQA 1E3UA 1ERQA 5HAQA 4HIAA 5EVIA 4KZ8A 4GD8A 4QWOA 4GS9A 2NUPC 4G3WA 4MN6A 5FA7A 3T4LA 2Y2LA 4PM7A 1ZKJA 5A90A 3T4JA 1S6RA 4G3KA 4E3NA 2Y2HA 3D4FA 2M1CA 4KUKA 2Y8HA 4KZBA 3UE1A 1DJAA 1NZUA 2PBDP 3WWXA 3V3RA 3NOTC 5EVIB 4YINA 3LY3A 3Q1FA 4GS9B 1TS6A 3DTEA 2HP9A 3A3FA 3N8LA 2WKQA 2W1TA 3U2AA 1LSWA 3Q7VA 4WMCD 4JF6A 1LL8A 1ES4A 4OQIA 4WELA 4KENB 2BASA 1GA0A 1NY0A 1T18A 4NKPA 1KGGA 2VK3A 3ZQ5A 3N8RA 5I5LA 3HCYA 4U0TA 1L0EA 3KSGA 1YMSA 3EGDC 4LFUA 4M3KA 1Q2QA 2W1TB 1FIKA 3BFFA 3Q7VB 1ERMA 4S2NC 3UMEA 5L09A 5M19A 1KVMA 3GDIA 3VMAA 1TDGA 3JVVA 2YKFA 3UPNA 5AQBA 3HLFA 3IWQA 4BBTA 5KZHA 3NCKA 4JF5A 1TS7A 4HH3A 5HARA 2LB5A 4KQDA 4N1XA 5HDSA 2J8YA 2Z6CA 4OQGA 4I5SA 3NIAA 1DY6A 2XD1A 1YM1A 1ES2A 1ZG4A 4UAAA 1FQGA 5CHJA 4PPRA 2W3GA 4CLCC 1MZUA 3N8SA 4IUKA 1FR1A 3UB9A 5HSQA 3H82A 3Q7ZA 4N1HA 2B02A 3UB7A 1CF0A 4JGRA 3W4PA 2EWWA 4S2OA 2ZMAA 2JHEA 2ZQ9A 3KX0X 4UQIS 1K57C 2JKTI 1T19A 3EQUA 3ZNYA 4S2PA 4XT2A 1BTLA 1GSWA 3RXWA 3H82B 1MKIA 3PYPA 2JCHA 3UNWA 4JGQA 2VV8A 3PBQA 1S0WA 2V1BA 3HLDA 1NZOA 4HQAA 1J3WA 2VEAA 1PW8A 4OH0A 4IVIA 2W3EA 1YMXA 4X53A 3CJMA 4GW9A 2HV1A 4XT2B 1YSQA 1BUEA 5CX7A 3ZG7B 2WKRA 3BECA 1BULA 5A8BA 4S2NA 3BY8A 2PT7A 3T4SA 3E4OA 1L0GA 3BRMA 2WGIA 4KG2A 1H8MA 4X55A 3P7NA 5KSHA 4LCLA 2H28A 1YKDA 3K3DA 1WYCA 4JKTA 4BD0A 1BZAA 3V50A 2ZBBA 3C38A 3T1SA 4R1GA 2WKEA 2QYBA 3C4OA 4NXEA 1G5UA 1RGZA 3B42A 4B88A 2HGVA 5I94A 5A93A 5DVAA 4S2IA 2C5WB 4X6TA 5HL1A 2OWJA 2QJ5A 2O9BA 3ICYA 4IUHA 1HVBA 3QP4A 3HJIA 3T1QB 3S7QA 5CGXA 1VETA 2VJWA 4WN5A 3QNCA 5FATA 4C3QA 4IJGA 4E6XA 3OCNA 4OKPA 3UB5P 5EM1A 5TJJA 3VOYA 3DTMA 5FI2A 4ZBEA 1PWCA 3PXPA 2OSUA 1D06A 2Y2JA 4E3LA 4DMZA 1Y54A 2H0YA 2X71A 1VETB 1PYYA 4KUOA 2KLIA 2W1RA 3Q07A 4X56A 1XJ4A 4WYYA 4H6JA 4JBFA 1XGJA 5AQ7A 3OPRA 4HHDA 4QHCA 3TSGA 1HLUP 3JYIA 3VOLA 4UEYA 3UDIA 3E2KA 3UB6A 4Z1WA 1YLJA 4FH2A 3UE0A 5IU1A 3MF0A 4UA7A 3G4PA 1H3QA 1OT6A 5CTNA 1E4DA 2B5RA 5FSRA 5DF7A 2JN7A 4H6JB 2QJ7A 2EA9A 2VLGA 3CG5A 3FKWA 1L2SA 3GECA 5LBRA 1F98A 3MKFA 4N9KA 3QP5A 4LENA
chains in the Genus database with same CATH topology
5KMWA 1ZG6A 1QMEA 1PI4A 4H8RA 2V1ZA 1MWRA 1NRFA 5FAQA 4E3OA 2H0TA 2V2FF 3P09A 5CXWA 3S4XA 4DE3A 1L0DA 4S2MA 2XR0A 2J9PA 1NJ4A 5CEDA 3MZEA 1K54C 3VP4A 1K6SA 3BLSA 4K91A 1JWPA 4BD1A 4EBPA 4WBGA 3HLGA 4QY6A 2PU2A 4PM6A 5FQQA 3UPOA 4OOMA 4R3BA 5CTMA 5F1FA 3EQVA 4LV1A 1W8YA 4E3KA 1HZOA 1XA1A 3NY4A 5FAOA 3OC2A 3HVFA 5DTKA 1IYSA 1KVLA 4IBRA 2Y2OA 5HAIA 3ISGA 2HDRA 5M18A 4U3TA 3MBZA 4Z9QA 2WKIA 1JWZA 1PWDA 4MBKA 5HX9A 1JWVA 2X01A 4QJGA 5FI7A 1HTZA 5TFQA 4GD6A 3S1YA 5FQMA 1Q2PA 3VP0A 1J9MA 5FAPA 3C7VA 3HBRA 5GHZA 2Y59A 4XUXA 3UE3A 2J7VA 1RP5A 4EUZA 2ZLYA 3V5MA 3FWLA 2HDUA 1YLZA 4EBLA 4ZDXA 2G2UA 3LCEA 2X02A 1M40A 1CI8A 3IH9A 4KZ9A 4E6WA 3AGFA 3G2ZA 1IYOA 2WGVA 4DF6A 4DE1A 3HLWA 4KZAA 2CC1A 2RL3A 2R9WA 4BENA 2JE5A 4EQIA 3ZVTA 1DJCA 4U0XA 3MZDA 2EX8A 5E2HA 4GN2A 1YLPA 4JXSA 3ITBA 3AGEA 4KQQA 3TOIA 1E3UA 2ZQ8A 3HL9A 1ERQA 1WYBA 1FCNA 3HUMA 5GLDA 1YT4A 5FQ9A 5CEBA 5TGFA 5HAQA 1H5XA 5GLAA 4OPYA 3N4IA 4O7DA 1IYQA 2ZC6B 3IHAA 1K4EA 4GZBA 4KZ8A 3PBNA 5EVIA 4GD8A 4BL3A 5FQIA 3ZHHA 3VP3A 3IXDA 2V20A 5EPHA 2FFYA 3HREA 4MBFA 2ZC4B 5A91A 3RXXA 5FA7A 3SS5A 1U60A 3MFDA 3UO9A 2Y2LA 3IT9A 4PM7A 5EE8A 1ZKJA 3DWZA 5A90A 3WS4A 1MXOA 1YLTA 1S6RA 5G18A 5EOOA 1CEGA 4K0XA 2Y2HA 4E3NA 1XXMA 2ZM2A 3D4FA 4IVKA 1PWGA 2XFSA 2Y2PA 3CMZA 2J9OA 3IXBA 4PM8A 4QB8A 1O07A 1IEMA 4WEJA 4F94A 1I2SA 4KZBA 3SS3A 3UE1A 1DJAA 1NZUA 3SS4A 1ESIA 5FQJA 4MNRA 5GL9A 3WWXA 3V3RA 3N6IA 3A3JA 3A3IA 3G2YA 4R0QA 4DKIA 4QD4A 1FR6A 5EVIB 3PBTA 4YINA 1K56A 1LLBA 3LY3A 3Q1FA 4ZTKA 3RJUA 4P85A 2HP9A 5IHVA 3ZNTA 1I2WA 2WUQA 3UDFA 3A3FA 3G32A 1ONHA 3N8LA 3A3EA 1PW1A 1XA7A 4UA9A 3Q7VA 5FDHA 2WZZA 4WMCD 2WAEA 1W79A 4JF6A 5GLCA 4EBNA 1ES4A 2Y2QA 4OQIA 3ZCZA 2H5SA 5CGSA 5DTSA 4WELA 4KENB 1JTDA 1EROA 1GA0A 1H8ZA 4BLMA 1NY0A 3WS5A 4NK3A 3NDGA 1FSWA 1KGGA 5E43A 2Z2LB 4UA6A 2QPNA 3MXSA 3W8KA 3Q81A 3IF5A 1GHIA 3N8RA 1GHMA 4GNUA 4B4XA 2PU4A 4OP8A 1OMEA 2H10A 4U0TA 2ZM8A 1L0EA 1MBLA 1E3UD 3VP2A 1YMSA 1VQQA 3C7UA 3ZDJA 1MWSA 3G31A 3IQAA 4M3KA 1Q2QA 3BFFA 3Q7VB 3BFDA 5EVID 3M2KA 1ERMA 5CHMA 1KE0A 1GA9A 3B3XA 3ZGAB 3VP1A 4S2NC 4ZJ2A 2EXAA 1IKGA 3A3DA 2E8IA 1SCWA 5U47A 4GKUA 5M19A 5HW3A 2Y4AA 3ZG0A 3M6HA 4OPRA 4GOGA 1KGEA 1KVMA 4OONA 2RCXA 2HDQA 4QU3A 3UY6A 3VMAA 5JYOA 1TDGA 3IXGA 5EVLA 3W4OA 3LEZA 3UPNA 3HLEA 5AQBA 1GCEA 3HLFA 4WM9A 5HFOA 1PIOA 3IWQA 4KQOA 4ZJ3A 2ZD8A 5KZHA 3NCKA 1PZOA 1HD8A 2WZXA 4JF5A 1SDEA 3P98A 3BM6A 5HARA 4RX3A 2ZC7A 2EFUA 1TVFA 4N1XA 4GDNA 2C6WB 2ZJ9A 3PAEA 1M6KA 2J8YA 1NXYA 1RCJA 4OQGA 4RVAA 4X69A 1CK3A 1FCMA 5AQ9A 5AQAA 1MWUA 3NIAA 1DY6A 1WE4A 2XD1A 1YM1A 2Y2GA 4OVDA 1SDNA 1XX2A 1ES2A 2HP5A 2Y2NA 4IEDA 1ZG4A 4UAAA 1MWTA 2WYXA 1JTGA 2OLVA 4DE0A 1FQGA 5CHJA 3UDXA 4PPRA 1N4OA 3N8SA 4WEKA 5E2GA 2DNSA 3BYDA 4Y0OA 1FR1A 4Y0TA 4DE2A 5E2FA 2DRWA 3TG9A 4JF4A 1K57A 1ALQA 3Q7ZA 4RA7A 5BOHA 2WGWA 2P9VA 1YQSA 2EX9A 2BG1A 4N1HA 1L0FA 1K4FA 5HAPA 2EFXA 3VFFA 4CJNA 4JXWA 3QHYA 4DRTA 1NYMA 3W4PA 4RX2A 2Q9NA 2UWXA 2XGNA 4S2OA 2ZMAA 3MKEA 4OQHA 1K25A 2ZQDA 2ZQ9A 4HEFA 3LO7A 3AGDA 2ZQ7A 4PM9A 1K57C 3PBOA 3OZHA 3PAGA 3ZVWA 1FSYA 1H8YA 1PI5A 2JC7A 2EX2A 5KSCA 3EQUA 3ZNYA 4S2PA 1BTLA 2IWDA 5EUAA 4S2KA 3RXWA 4Q8IA 1KDSA 4HBTA 3PBSA 1K6RA 4OOYA 4Y0UA 1MKIA 1KGFA 2JCHA 3W4QA 2WGWB 2P9VB 3LY4A 3UNWA 2G2WA 4LV2A 2XH9A 2P74A 3ZFZA 3N7WA 3ZG9B 3PBQA 5D3OA 1S0WA 3HLDA 4Y7PA 1NZOA 5A92A 4KZ5A 3OCLA 4N9LA 2WKHA 1BLPA 2Z2MB 1FCOA 4LCMA 3BEBA 4UHUA 1JVJA 1PW8A 3MXRA 5JYPA 4OH0A 4IVIA 4NETA 4RYEA 1CI9A 1YMXA 2I72A 4GDBA 1BLHA 4X53A 3CJMA 1XP4A 4C75A 3HUOA 1QMFA 4E3MA 1BUEA 3OPPA 3IWIA 3ZG7B 3BECA 4QY5A 1KDWA 2XFTA 3G34A 4ZJ1A 4GB7A 4OLGA 1BULA 1W8QA 4LV0A 1ESUA 3GRJA 1SKFA 4OPQA 2BLSA 3O86A 4JXVA 4ZAMA 1MY8A 4S2NA 3Q82A 2XLNA 5CECA 1G68A 1XPBA 2A49A 2XDMA 3OPLA 1KE4A 1IELA 1LHYA 1LI0A 2XEPA 1L0GA 4PMAA 3BRMA 2WGIA 4P0MA 1VM1A 3FKVA 2WADA 4HBUA 1EI5A 4KG2A 2IWBA 3PBRA 3NC8A 4X55A 1BT5A 2ZQAA 4K0WA 4LV3A 3ZG5A 5L2FA 5KSHA 4LCLA 1WYCA 4JKTA 4BD0A 1BZAA 3FZCA 4MBHA 2IWCA 1N9BA 3V50A 4JLFA 4N92A 1CEFA 1TEMA 3G30A 1ZC2A 1Z6FA 4XUZA 5DTTA 3SH7A 1DJBA 2Y55A 3FYZA 5M1AA 3WRZA 4JPMA 1PZPA 3ITAA 2QZ6A 4OP5A 4S2LA 1SHVA 2WKEA 2GDNA 4R1GA 3C4OA 1RGZA 3PTEA 4L0LA 5FQKA 4PM5A 4DDSA 2Q9MA 2EX6A 4B88A 5I94A 4R4SA 4KQRA 5A93A 1K55A 4DXCA 1C3BA 4S2IA 5DVAA 4EWFA 5F1GA 2C5WB 2WK0A 3IHBA 4X6TA 4C6YA 1ES3A 1K38A 1YLYA 5HL1A 1TDLA 2VGKA 1K56D 1IKIA 3GTCA 2Y2IA 2Y91A 3GSGA 3S22A 3OPHA 3O3VA 2HPBA 3BFGA 1HVBA 4X68A 4FH4A 2PBYA 2DCFA 1K55C 3IWOA 5CGXA 3M2JA 5F83A 1O7EA 2Y2KA 3FV7A 3QNCA 4BL2A 1LI9A 5FATA 3HLBA 5CGWA 4DXBA 4OOLA 4WZ4A 5GHYA 4E3IA 4EV4A 5FI6A 4C3QA 4WMCA 3IF6A 3M6BA 4E6XA 3I7JA 2EXBA 3OCNA 4OKPA 3WRTA 5FASA 3BFEA 2ZQCA 3NI9A 3VOYA 3DTMA 2ZM0A 5FI2A 4ZBEA 1PWCA 4KZ6A 1AXBA 1EWZA 2QMIA 4IBXA 3O87A 4R23A 5E2EA 5GLBA 3SOIA 3UN7A 3BLMA 2OSUA 3O88A 1FOFA 2Y2JA 4ID4A 5CRFA 4JXGA 4E3LA 4KZ3A 3VOZA 1IYPA 3SH9A 4P6BA 3SH8A 1KE3A 3NBLA 1NYYA 3IF6C 4D2OA 1BLCA 1XKZA 1Y54A 4OQ0A 1ONGA 2H0YA 3DW0A 4BQMA 2X71A 4OPZA 3WS0A 1PYYA 1W7FA 3GR2A 2WAFA 4DDYA 3Q07A 3QNBA 4X56A 4YFMA 4KZ7A 4WYYA 1YLWA 3IF6B 4JBFA 2OLUA 1XGJA 5AQ7A 2Y2MA 5EECA 2R9XA 3GMWA 5F82A 3V39A 1GHPA 5DF9A 3OPRA 2A3UA 2JBFA 3V3SA 3VFHA 4OLDA 4QHCA 4FD8A 1BSGA 3TSGA 4A5RA 3GV9A 1MPLA 2HP6A 4MLLA 1BLSA 5J8XA 3C4PA 1RGYA 3JYIA 3UDIA 3E2KA 3MZFA 4KG5A 5DF8A 3G35A 4HESA 5EVIC 1I5QA 1YLJA 3ZG8B 4FH2A 3UE0A 2HDSA 3HUNA 4S2JA 2XD5A 5CERA 3UPPA 4UA7A 3IH8A 3G4PA 4FCFA 5CTNA 4R3JA 1E4DA 4E3JA 1LL9A 2B5RA 3HLCA 3NDEA 4FSFA 3GVBA 4WZ5A 5DF7A 5FSRA 2XF3A 2XK1A 4B4ZA 3BFCA 3VSLA 4KG6A 2VGJA 3C5AA 1W5DA 3CG5A 1LL5A 3GQZA 3CZDA 3FKWA 5GHXA 5TR7A 5EOEA 1G6AA 1L2SA 4CPKA 3E2LA 2ZC3B 2OV5A 3IXHA 4R4RA 3VSKA 4P87A 4WZ5C 3DWKA 4KZ4A 3WS2A 1E25A 3MKFA 4XXRA 2ZC5B 4BJPA 3WS1A 1XGIA 4N9KA 5CHUA 1K54A 1ES5A 2XQZA 4MEZA 2FFFB 4LENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KMW A;  1ZG6 A;  1QME A;  1PI4 A;  4H8R A;  2V1Z A;  1MWR A;  1NRF A;  5FAQ A;  4E3O A;  2H0T A;  2V2F F;  3P09 A;  5CXW A;  3S4X A;  4DE3 A;  1L0D A;  4S2M A;  2XR0 A;  2J9P A;  1NJ4 A;  5CED A;  3MZE A;  1K54 C;  3VP4 A;  1K6S A;  3BLS A;  4K91 A;  1JWP A;  4BD1 A;  4EBP A;  4WBG A;  3HLG A;  4QY6 A;  2PU2 A;  4PM6 A;  5FQQ A;  3UPO A;  4OOM A;  4R3B A;  5CTM A;  5F1F A;  3EQV A;  4LV1 A;  1W8Y A;  4E3K A;  1HZO A;  1XA1 A;  3NY4 A;  5FAO A;  3OC2 A;  3HVF A;  5DTK A;  1IYS A;  1KVL A;  4IBR A;  2Y2O A;  5HAI A;  3ISG A;  2HDR A;  5M18 A;  4U3T A;  3MBZ A;  4Z9Q A;  2WKI A;  1JWZ A;  1PWD A;  4MBK A;  5HX9 A;  1JWV A;  2X01 A;  4QJG A;  5FI7 A;  1HTZ A;  5TFQ A;  4GD6 A;  3S1Y A;  5FQM A;  1Q2P A;  3VP0 A;  1J9M A;  5FAP A;  3C7V A;  3HBR A;  5GHZ A;  2Y59 A;  4XUX A;  3UE3 A;  2J7V A;  1RP5 A;  4EUZ A;  2ZLY A;  3V5M A;  3FWL A;  2HDU A;  1YLZ A;  4EBL A;  4ZDX A;  2G2U A;  3LCE A;  2X02 A;  1M40 A;  1CI8 A;  3IH9 A;  4KZ9 A;  4E6W A;  3AGF A;  3G2Z A;  1IYO A;  2WGV A;  4DF6 A;  4DE1 A;  3HLW A;  4KZA A;  2CC1 A;  2RL3 A;  2R9W A;  4BEN A;  2JE5 A;  4EQI A;  3ZVT A;  1DJC A;  4U0X A;  3MZD A;  2EX8 A;  5E2H A;  4GN2 A;  1YLP A;  4JXS A;  3ITB A;  3AGE A;  4KQQ A;  3TOI A;  1E3U A;  2ZQ8 A;  3HL9 A;  1ERQ A;  1WYB A;  1FCN A;  3HUM A;  5GLD A;  1YT4 A;  5FQ9 A;  5CEB A;  5TGF A;  5HAQ A;  1H5X A;  5GLA A;  4OPY A;  3N4I A;  4O7D A;  1IYQ A;  2ZC6 B;  3IHA A;  1K4E A;  4GZB A;  4KZ8 A;  3PBN A;  5EVI A;  4GD8 A;  4BL3 A;  5FQI A;  3ZHH A;  3VP3 A;  3IXD A;  2V20 A;  5EPH A;  2FFY A;  3HRE A;  4MBF A;  2ZC4 B;  5A91 A;  3RXX A;  5FA7 A;  3SS5 A;  1U60 A;  3MFD A;  3UO9 A;  2Y2L A;  3IT9 A;  4PM7 A;  5EE8 A;  1ZKJ A;  3DWZ A;  5A90 A;  3WS4 A;  1MXO A;  1YLT A;  1S6R A;  5G18 A;  5EOO A;  1CEG A;  4K0X A;  2Y2H A;  4E3N A;  1XXM A;  2ZM2 A;  3D4F A;  4IVK A;  1PWG A;  2XFS A;  2Y2P A;  3CMZ A;  2J9O A;  3IXB A;  4PM8 A;  4QB8 A;  1O07 A;  1IEM A;  4WEJ A;  4F94 A;  1I2S A;  4KZB A;  3SS3 A;  3UE1 A;  1DJA A;  1NZU A;  3SS4 A;  1ESI A;  5FQJ A;  4MNR A;  5GL9 A;  3WWX A;  3V3R A;  3N6I A;  3A3J A;  3A3I A;  3G2Y A;  4R0Q A;  4DKI A;  4QD4 A;  1FR6 A;  5EVI B;  3PBT A;  4YIN A;  1K56 A;  1LLB A;  3LY3 A;  3Q1F A;  4ZTK A;  3RJU A;  4P85 A;  2HP9 A;  5IHV A;  3ZNT A;  1I2W A;  2WUQ A;  3UDF A;  3A3F A;  3G32 A;  1ONH A;  3N8L A;  3A3E A;  1PW1 A;  1XA7 A;  4UA9 A;  3Q7V A;  5FDH A;  2WZZ A;  4WMC D;  2WAE A;  1W79 A;  4JF6 A;  5GLC A;  4EBN A;  1ES4 A;  2Y2Q A;  4OQI A;  3ZCZ A;  2H5S A;  5CGS A;  5DTS A;  4WEL A;  4KEN B;  1JTD A;  1ERO A;  1GA0 A;  1H8Z A;  4BLM A;  1NY0 A;  3WS5 A;  4NK3 A;  3NDG A;  1FSW A;  1KGG A;  5E43 A;  2Z2L B;  4UA6 A;  2QPN A;  3MXS A;  3W8K A;  3Q81 A;  3IF5 A;  1GHI A;  3N8R A;  1GHM A;  4GNU A;  4B4X A;  2PU4 A;  4OP8 A;  1OME A;  2H10 A;  4U0T A;  2ZM8 A;  1L0E A;  1MBL A;  1E3U D;  3VP2 A;  1YMS A;  1VQQ A;  3C7U A;  3ZDJ A;  1MWS A;  3G31 A;  3IQA A;  4M3K A;  1Q2Q A;  3BFF A;  3Q7V B;  3BFD A;  5EVI D;  3M2K A;  1ERM A;  5CHM A;  1KE0 A;  1GA9 A;  3B3X A;  3ZGA B;  3VP1 A;  4S2N C;  4ZJ2 A;  2EXA A;  1IKG A;  3A3D A;  2E8I A;  1SCW A;  5U47 A;  4GKU A;  5M19 A;  5HW3 A;  2Y4A A;  3ZG0 A;  3M6H A;  4OPR A;  4GOG A;  1KGE A;  1KVM A;  4OON A;  2RCX A;  2HDQ A;  4QU3 A;  3UY6 A;  3VMA A;  5JYO A;  1TDG A;  3IXG A;  5EVL A;  3W4O A;  3LEZ A;  3UPN A;  3HLE A;  5AQB A;  1GCE A;  3HLF A;  4WM9 A;  5HFO A;  1PIO A;  3IWQ A;  4KQO A;  4ZJ3 A;  2ZD8 A;  5KZH A;  3NCK A;  1PZO A;  1HD8 A;  2WZX A;  4JF5 A;  1SDE A;  3P98 A;  3BM6 A;  5HAR A;  4RX3 A;  2ZC7 A;  2EFU A;  1TVF A;  4N1X A;  4GDN A;  2C6W B;  2ZJ9 A;  3PAE A;  1M6K A;  2J8Y A;  1NXY A;  1RCJ A;  4OQG A;  4RVA A;  4X69 A;  1CK3 A;  1FCM A;  5AQ9 A;  5AQA A;  1MWU A;  3NIA A;  1DY6 A;  1WE4 A;  2XD1 A;  1YM1 A;  2Y2G A;  4OVD A;  1SDN A;  1XX2 A;  1ES2 A;  2HP5 A;  2Y2N A;  4IED A;  1ZG4 A;  4UAA A;  1MWT A;  2WYX A;  1JTG A;  2OLV A;  4DE0 A;  1FQG A;  5CHJ A;  3UDX A;  4PPR A;  1N4O A;  3N8S A;  4WEK A;  5E2G A;  2DNS A;  3BYD A;  4Y0O A;  1FR1 A;  4Y0T A;  4DE2 A;  5E2F A;  2DRW A;  3TG9 A;  4JF4 A;  1K57 A;  1ALQ A;  3Q7Z A;  4RA7 A;  5BOH A;  2WGW A;  2P9V A;  1YQS A;  2EX9 A;  2BG1 A;  4N1H A;  1L0F A;  1K4F A;  5HAP A;  2EFX A;  3VFF A;  4CJN A;  4JXW A;  3QHY A;  4DRT A;  1NYM A;  3W4P A;  4RX2 A;  2Q9N A;  2UWX A;  2XGN A;  4S2O A;  2ZMA A;  3MKE A;  4OQH A;  1K25 A;  2ZQD A;  2ZQ9 A;  4HEF A;  3LO7 A;  3AGD A;  2ZQ7 A;  4PM9 A;  1K57 C;  3PBO A;  3OZH A;  3PAG A;  3ZVW A;  1FSY A;  1H8Y A;  1PI5 A;  2JC7 A;  2EX2 A;  5KSC A;  3EQU A;  3ZNY A;  4S2P A;  1BTL A;  2IWD A;  5EUA A;  4S2K A;  3RXW A;  4Q8I A;  1KDS A;  4HBT A;  3PBS A;  1K6R A;  4OOY A;  4Y0U A;  1MKI A;  1KGF A;  2JCH A;  3W4Q A;  2WGW B;  2P9V B;  3LY4 A;  3UNW A;  2G2W A;  4LV2 A;  2XH9 A;  2P74 A;  3ZFZ A;  3N7W A;  3ZG9 B;  3PBQ A;  5D3O A;  1S0W A;  3HLD A;  4Y7P A;  1NZO A;  5A92 A;  4KZ5 A;  3OCL A;  4N9L A;  2WKH A;  1BLP A;  2Z2M B;  1FCO A;  4LCM A;  3BEB A;  4UHU A;  1JVJ A;  1PW8 A;  3MXR A;  5JYP A;  4OH0 A;  4IVI A;  4NET A;  4RYE A;  1CI9 A;  1YMX A;  2I72 A;  4GDB A;  1BLH A;  4X53 A;  3CJM A;  1XP4 A;  4C75 A;  3HUO A;  1QMF A;  4E3M A;  1BUE A;  3OPP A;  3IWI A;  3ZG7 B;  3BEC A;  4QY5 A;  1KDW A;  2XFT A;  3G34 A;  4ZJ1 A;  4GB7 A;  4OLG A;  1BUL A;  1W8Q A;  4LV0 A;  1ESU A;  3GRJ A;  1SKF A;  4OPQ A;  2BLS A;  3O86 A;  4JXV A;  4ZAM A;  1MY8 A;  4S2N A;  3Q82 A;  2XLN A;  5CEC A;  1G68 A;  1XPB A;  2A49 A;  2XDM A;  3OPL A;  1KE4 A;  1IEL A;  1LHY A;  1LI0 A;  2XEP A;  1L0G A;  4PMA A;  3BRM A;  2WGI A;  4P0M A;  1VM1 A;  3FKV A;  2WAD A;  4HBU A;  1EI5 A;  4KG2 A;  2IWB A;  3PBR A;  3NC8 A;  4X55 A;  1BT5 A;  2ZQA A;  4K0W A;  4LV3 A;  3ZG5 A;  5L2F A;  5KSH A;  4LCL A;  1WYC A;  4JKT A;  4BD0 A;  1BZA A;  3FZC A;  4MBH A;  2IWC A;  1N9B A;  3V50 A;  4JLF A;  4N92 A;  1CEF A;  1TEM A;  3G30 A;  1ZC2 A;  1Z6F A;  4XUZ A;  5DTT A;  3SH7 A;  1DJB A;  2Y55 A;  3FYZ A;  5M1A A;  3WRZ A;  4JPM A;  1PZP A;  3ITA A;  2QZ6 A;  4OP5 A;  4S2L A;  1SHV A;  2WKE A;  2GDN A;  4R1G A;  3C4O A;  1RGZ A;  3PTE A;  4L0L A;  5FQK A;  4PM5 A;  4DDS A;  2Q9M A;  2EX6 A;  4B88 A;  5I94 A;  4R4S A;  4KQR A;  5A93 A;  1K55 A;  4DXC A;  1C3B A;  4S2I A;  5DVA A;  4EWF A;  5F1G A;  2C5W B;  2WK0 A;  3IHB A;  4X6T A;  4C6Y A;  1ES3 A;  1K38 A;  1YLY A;  5HL1 A;  1TDL A;  2VGK A;  1K56 D;  1IKI A;  3GTC A;  2Y2I A;  2Y91 A;  3GSG A;  3S22 A;  3OPH A;  3O3V A;  2HPB A;  3BFG A;  1HVB A;  4X68 A;  4FH4 A;  2PBY A;  2DCF A;  1K55 C;  3IWO A;  5CGX A;  3M2J A;  5F83 A;  1O7E A;  2Y2K A;  3FV7 A;  3QNC A;  4BL2 A;  1LI9 A;  5FAT A;  3HLB A;  5CGW A;  4DXB A;  4OOL A;  4WZ4 A;  5GHY A;  4E3I A;  4EV4 A;  5FI6 A;  4C3Q A;  4WMC A;  3IF6 A;  3M6B A;  4E6X A;  3I7J A;  2EXB A;  3OCN A;  4OKP A;  3WRT A;  5FAS A;  3BFE A;  2ZQC A;  3NI9 A;  3VOY A;  3DTM A;  2ZM0 A;  5FI2 A;  4ZBE A;  1PWC A;  4KZ6 A;  1AXB A;  1EWZ A;  2QMI A;  4IBX A;  3O87 A;  4R23 A;  5E2E A;  5GLB A;  3SOI A;  3UN7 A;  3BLM A;  2OSU A;  3O88 A;  1FOF A;  2Y2J A;  4ID4 A;  5CRF A;  4JXG A;  4E3L A;  4KZ3 A;  3VOZ A;  1IYP A;  3SH9 A;  4P6B A;  3SH8 A;  1KE3 A;  3NBL A;  1NYY A;  3IF6 C;  4D2O A;  1BLC A;  1XKZ A;  1Y54 A;  4OQ0 A;  1ONG A;  2H0Y A;  3DW0 A;  4BQM A;  2X71 A;  4OPZ A;  3WS0 A;  1PYY A;  1W7F A;  3GR2 A;  2WAF A;  4DDY A;  3Q07 A;  3QNB A;  4X56 A;  4YFM A;  4KZ7 A;  4WYY A;  1YLW A;  3IF6 B;  4JBF A;  2OLU A;  1XGJ A;  5AQ7 A;  2Y2M A;  5EEC A;  2R9X A;  3GMW A;  5F82 A;  3V39 A;  1GHP A;  5DF9 A;  3OPR A;  2A3U A;  2JBF A;  3V3S A;  3VFH A;  4OLD A;  4QHC A;  4FD8 A;  1BSG A;  3TSG A;  4A5R A;  3GV9 A;  1MPL A;  2HP6 A;  4MLL A;  1BLS A;  5J8X A;  3C4P A;  1RGY A;  3JYI A;  3UDI A;  3E2K A;  3MZF A;  4KG5 A;  5DF8 A;  3G35 A;  4HES A;  5EVI C;  1I5Q A;  1YLJ A;  3ZG8 B;  4FH2 A;  3UE0 A;  2HDS A;  3HUN A;  4S2J A;  2XD5 A;  5CER A;  3UPP A;  4UA7 A;  3IH8 A;  3G4P A;  4FCF A;  5CTN A;  4R3J A;  1E4D A;  4E3J A;  1LL9 A;  2B5R A;  3HLC A;  3NDE A;  4FSF A;  3GVB A;  4WZ5 A;  5DF7 A;  5FSR A;  2XF3 A;  2XK1 A;  4B4Z A;  3BFC A;  3VSL A;  4KG6 A;  2VGJ A;  3C5A A;  1W5D A;  3CG5 A;  1LL5 A;  3GQZ A;  3CZD A;  3FKW A;  5GHX A;  5TR7 A;  5EOE A;  1G6A A;  1L2S A;  4CPK A;  3E2L A;  2ZC3 B;  2OV5 A;  3IXH A;  4R4R A;  3VSK A;  4P87 A;  4WZ5 C;  3DWK A;  4KZ4 A;  3WS2 A;  1E25 A;  3MKF A;  4XXR A;  2ZC5 B;  4BJP A;  3WS1 A;  1XGI A;  4N9K A;  5CHU A;  1K54 A;  1ES5 A;  2XQZ A;  4MEZ A;  2FFF B;  4LEN A; 
#chains in the Genus database with same CATH topology
 3EEA A;  1NRF A;  2V8F A;  2H0T A;  4GHI A;  5DJT A;  5HZH A;  5FL3 A;  4QY6 A;  4MN5 A;  3UPO A;  5FEG A;  3EQV A;  1W8Y A;  2PYR A;  1HZO A;  3DTI A;  3HVF A;  5FDS A;  4LRX C;  5HWW A;  4HNB A;  2WKP A;  4EEP A;  5L10 A;  4HP9 A;  2WKI A;  1JWZ A;  3A0S A;  4GHI B;  4BMW A;  5F6A A;  2HJ9 C;  3S1Y A;  4IHQ A;  1Q2P A;  4EUZ A;  2ZLY A;  2HDU A;  3KYZ A;  1Z09 A;  1K0K A;  4YOF A;  4KZ9 A;  1ACF A;  4R6L A;  4DE1 A;  4K08 A;  1Y28 A;  2CC1 A;  5DJU A;  1DJC A;  4U0X A;  2J3T D;  3IX3 A;  3HUM A;  1WYB A;  1FCN A;  5CEB A;  4OPY A;  3BJN A;  1IYQ A;  3IHA A;  4HJ4 A;  4GZB A;  3EGX C;  1S4S A;  5FQI A;  3ZHH A;  1S66 L;  5EPH A;  2FFY A;  3SS5 A;  1U60 A;  3MFD A;  3IT9 A;  4D60 A;  4MCW A;  4GJ4 A;  4I3A A;  5G18 A;  2L0W A;  4JGO A;  4K0X A;  5GLB A;  3CMZ A;  2Y2P A;  4PM8 A;  1O07 A;  3IX4 A;  3UB8 A;  1ESI A;  2XA7 M;  3RFB A;  1STZ A;  4R0Q A;  2VGL M;  3PBT A;  1LLB A;  2ZL1 A;  2I9V A;  3ZNT A;  1I2W A;  2WUQ A;  2XSS A;  1ONH A;  1PW1 A;  1XA7 A;  2WZZ A;  3QP6 A;  1ERO A;  1ZHH B;  3WS5 A;  4NK3 A;  3NDG A;  2QPN A;  2QHK A;  1GHM A;  4X25 A;  3MJQ A;  1OME A;  2ZL1 B;  3ULF A;  3VP2 A;  3C7U A;  3IQA A;  5CHM A;  1KE0 A;  3ZGA B;  4BBU A;  3VP1 A;  1D1J A;  3A3D A;  2E8I A;  5U47 A;  3ZG0 A;  4OPR A;  2RCX A;  1PRQ A;  4FUW A;  3UY6 A;  4F3L A;  5L8M A;  3W4O A;  4O0P A;  4DJ2 A;  3HLE A;  1PIO A;  3FC7 A;  1PZO A;  4RX3 A;  2O0Y A;  2O9C A;  4EEU A;  3DBA A;  2ZJ9 A;  2ZMF A;  1NXY A;  2P7J A;  5AQA A;  4ESP A;  2GNX A;  1SDN A;  3VE3 A;  3DAV A;  4DE0 A;  4F3L B;  3UDX A;  1OTA A;  4JGP A;  5E2G A;  4Y0O A;  2M7V A;  4Y0T A;  3A0R A;  3TG9 A;  3MSH A;  1ALQ A;  1G28 A;  2P9V A;  1YQS A;  3LIB A;  5HAP A;  1L3L A;  2EFX A;  3QHY A;  2JKT M;  4DRT A;  5IT5 A;  2XGN A;  2UV0 E;  4L9F A;  2KDK A;  3LO7 A;  2ZQ7 A;  4HOI A;  2KX6 A;  3PBO A;  1PI5 A;  2JC7 A;  3LR4 A;  1KDS A;  1K6R A;  4OOY A;  2P9V B;  3JVU A;  4Y7P A;  3OCL A;  3LR3 A;  5FEF A;  2J3W A;  1FCO A;  3BEB A;  3MXR A;  2KOI A;  1CI9 A;  3LI9 A;  3OPP A;  1YAX A;  3IWI A;  1W8Q A;  3HJK A;  1SKF A;  3O86 A;  2XRO A;  2A49 A;  2XDM A;  1IEL A;  4I3I A;  4FTX A;  2L1M A;  1LHY A;  2XEP A;  4P0M A;  2WAD A;  1BT5 A;  2ZQA A;  2A2L A;  5G4Y A;  5L2F A;  5HL6 A;  3H9W A;  2AVX A;  2VZW A;  3W2Z A;  3G30 A;  4XUZ A;  1ZC2 A;  5DTT A;  1OJ5 A;  4M4X A;  1PZP A;  3ITA A;  2QZ6 A;  5DFX A;  2J3T C;  4P6Z M;  1NLY A;  1SHV A;  4HY8 A;  2DMW A;  2Q9M A;  2EX6 A;  4KQR A;  1T1C A;  4DXC A;  3E98 A;  2V1A A;  5F1G A;  2WK0 A;  2QWS A;  5HWV A;  1TDL A;  2VGK A;  5C5K A;  1W63 Q;  1IKI A;  3GTC A;  2Y2I A;  3GSG A;  2PHY A;  2DCF A;  3M2J A;  5F83 A;  4BL2 A;  4DN0 A;  4R3A A;  1LI9 A;  3HLB A;  4OOL A;  3IF6 A;  2EXB A;  3CWF A;  1V9Z A;  1OTD A;  2ZM0 A;  4X1M A;  3NUL A;  2QMI A;  4IBX A;  3O5Y A;  2R78 A;  3UN7 A;  3O88 A;  1WA9 A;  4DJ3 A;  4ID4 A;  5CRF A;  1N9O A;  1KE3 A;  3IBR A;  1NYY A;  2VV6 A;  1XKZ A;  3VE4 A;  4OPZ A;  3WS0 A;  3T4T A;  4ZRR A;  4KZ7 A;  1YLW A;  3IF6 B;  4CQH A;  2OLU A;  5EEC A;  3V39 A;  5DF9 A;  3VFH A;  1NLZ A;  3LYX A;  3LIE A;  1MPL A;  1BLS A;  3C4P A;  2PD7 A;  5DF8 A;  1CJF A;  4HES A;  3F1P A;  1N9N A;  5EV0 A;  1LL9 A;  4FSF A;  2HJE A;  4LRZ E;  1DRM A;  2XF3 A;  3BFC A;  2VGJ A;  4EXO A;  3GQZ A;  3CZD A;  2ZC3 B;  3IXH A;  5KIZ A;  3T4Q A;  1PNE A;  1E25 A;  4XXR A;  1DP9 A;  3F1P B;  5CHU A;  1K54 A;  2FFF B;  1VEU A;  1QME A;  2V1Z A;  1MWR A;  3C2W A;  3S4X A;  2W3H A;  4S2M A;  5CED A;  3BQA A;  3BLS A;  2K31 A;  4R70 A;  3A0V A;  5FQQ A;  4OOM A;  2V9A A;  5CTM A;  4LV1 A;  3R7W A;  2W27 A;  1VEU B;  4IBR A;  5M18 A;  2EWV A;  3IBJ A;  1Y4O A;  4Z9Q A;  1PWD A;  2X01 A;  2CMN A;  5FAP A;  3UE6 A;  3C7V A;  1PFL A;  3HBR A;  2Y59 A;  2J7V A;  1RP5 A;  2J80 A;  4B93 A;  3LGO A;  3V5M A;  2ZMV A;  1YLZ A;  2W3D A;  2G2U A;  3LCE A;  3R7W B;  1M40 A;  2P04 A;  1CI8 A;  1IYO A;  2WGV A;  3HLW A;  2RL3 A;  4EQI A;  2JE5 A;  3H7W A;  3AGE A;  2ZQ8 A;  3HL9 A;  5GLD A;  1YT4 A;  5FQ9 A;  1H5X A;  5GLA A;  3LFV A;  3D3O A;  2FZ0 A;  3RH8 B;  2OWH A;  2ZC6 B;  4Y17 A;  1K4E A;  1F9I A;  3MS6 A;  3S7N A;  3VP3 A;  3IXD A;  3NOU C;  1XFQ A;  2ZC4 B;  3EOI A;  4NEE D;  3UO9 A;  2HZ5 A;  5EE8 A;  1JNU A;  1TD5 A;  3WS4 A;  1MXO A;  1YLT A;  2GX5 A;  4NXB A;  2ZM2 A;  3H7W B;  1PWG A;  2J9O A;  1I2S A;  3QP8 A;  3TE8 A;  3SS4 A;  3N6I A;  3A3J A;  1MKM A;  2V0W A;  3G2Y A;  4WL9 A;  4ZTK A;  1K56 A;  5IHV A;  3UDF A;  2INW A;  3CLO A;  3BY9 A;  4ARZ A;  2B95 A;  1W79 A;  1V9Y A;  3K2N A;  2Y2Q A;  3ZCZ A;  2H5S A;  3KSH A;  1JTD A;  5E43 A;  2Z2L B;  4UA6 A;  3MXS A;  3Q81 A;  1GHI A;  4B4X A;  2ZM8 A;  1VHM A;  3KYE A;  1YPR A;  1VQQ A;  3ZDJ A;  3G31 A;  4ARZ B;  3BFD A;  3M2K A;  5DKL A;  2JKR I;  1GA9 A;  5MC7 A;  4ZJ2 A;  2EXA A;  1TF1 A;  1A0K A;  2LB9 A;  3E4Q A;  5HW3 A;  3M6H A;  4GOG A;  1KGE A;  2HDQ A;  3MFX A;  3MXQ A;  4QU3 A;  3KYQ A;  5JYO A;  3VV4 A;  4HJ6 A;  3LEZ A;  1GCE A;  3E0Y A;  2PAV P;  4KQO A;  2ZD8 A;  1HD8 A;  1X0O A;  1SDE A;  3P98 A;  2ZC7 A;  1TVF A;  4GDN A;  2C6W B;  4II7 A;  1RCJ A;  4RVA A;  1CK3 A;  5K5B A;  2IA2 A;  5AQ9 A;  1KOU A;  1WE4 A;  2Y2G A;  4OVD A;  2Y79 A;  4IED A;  2HP5 A;  1OTB A;  2Y2N A;  5EVE A;  3P01 A;  1MWT A;  2E8J A;  4FOF A;  3NEC A;  1N4O A;  1BYW A;  2VKS A;  4WUJ A;  2DRW A;  4JF4 A;  2WGW A;  3U4L P;  2BG1 A;  1K4F A;  1D7E A;  4CJN A;  3T4K A;  1NYM A;  5AVF A;  3NOP C;  5HWT A;  2JKG A;  2Q9N A;  3E4P A;  1MC0 A;  3MKE A;  4OQH A;  4HEF A;  3V67 A;  4EES A;  1OJG A;  3T1X A;  3CIT A;  1FSY A;  1H8Y A;  4Q0J A;  5EUA A;  4EQ1 A;  2B18 A;  4G3V A;  4Y0U A;  1KGF A;  2WGW B;  3LY4 A;  2OAP 1;  4O8G A;  4BBV A;  3ZFZ A;  5L07 A;  3EEH A;  1H0M A;  3F1N A;  1BLP A;  4NXG A;  4LCM A;  2PYP A;  4CLC D;  2I72 A;  4Y13 A;  1XP4 A;  4C75 A;  3HUO A;  1QMF A;  4E3M A;  3KSF A;  5F69 A;  4WLA A;  4GB7 A;  4OPQ A;  2Z6D A;  4ZAM A;  3T1R A;  3Q82 A;  2XLN A;  1G68 A;  3OPL A;  4HH2 A;  3F1N B;  1VM1 A;  4HBU A;  1EI5 A;  3KO6 A;  2IWB A;  3PBR A;  3ZG5 A;  1S1Y A;  5F5Y A;  2W3F A;  3CUE A;  4AFI A;  5EFW A;  1SKO A;  2IWC A;  4N92 A;  3FPW A;  1Z6F A;  1DJB A;  5M1A A;  3FYZ A;  2NUT C;  4JPM A;  2VA0 A;  4S2L A;  2GDN A;  4L0L A;  2ACG A;  4PM5 A;  4DDS A;  3MR0 A;  5HPF A;  1K55 A;  1C3B A;  3CI6 A;  4PHT A;  2PDR A;  4C6Y A;  1ES3 A;  1K38 A;  3TRC A;  1K56 D;  2ZOI A;  3S22 A;  2VX8 A;  5TBM A;  4R38 A;  3BFG A;  1SKO B;  3LR5 A;  3LIF A;  2PBY A;  1LSV A;  3IWO A;  1O7E A;  3DTK A;  4EV4 A;  5CGW A;  4DXB A;  4UQI M;  5FI6 A;  3F1O A;  1P9W A;  3M6B A;  3WRT A;  3NJA A;  4HJ3 A;  3BFE A;  2ZQC A;  1EW0 A;  1AXB A;  1EWZ A;  4R23 A;  3SOI A;  3BLM A;  1FOF A;  4MDZ A;  3LEQ A;  4JXG A;  1XFN A;  4KZ3 A;  3VOZ A;  5TBM B;  3NBL A;  3IF6 C;  4D2O A;  1BLC A;  3BQ8 A;  1ONG A;  3LIC A;  3DW0 A;  1S67 L;  3TJZ C;  3GR2 A;  2WAF A;  2PR6 A;  4HP4 A;  3G6O A;  3EWK A;  3TW8 A;  3F1O B;  3QNB A;  3LUQ A;  4YFM A;  3GMW A;  5F82 A;  1GHP A;  4A5R A;  3B47 A;  3GV9 A;  2OAQ 1;  4NG2 A;  2QKP A;  4PAU A;  1TS8 A;  3MZF A;  2JKF A;  1F2K A;  1I5Q A;  4LPZ A;  2PR5 A;  2HDS A;  2XD5 A;  3LIA A;  2V0U A;  2BTF P;  4E3J A;  4WZ5 A;  3VSL A;  4KG6 A;  3C5A A;  1LL5 A;  5EOE A;  3E2L A;  1OPX A;  4R4R A;  3VSK A;  5J7E A;  4P87 A;  3DWK A;  4KZ4 A;  3WS2 A;  2YKH A;  4BJP A;  1IOU A;  3LI8 A;  1XGI A;  1ES5 A;  2GZA A;  3MMH A;  2XA7 S;  5HD3 A;  2VGL S;  2VV7 A;  3MQQ A;  5KMW A;  1ZG6 A;  1PI4 A;  1UWN X;  4H8R A;  5FAQ A;  4MN7 A;  4DE3 A;  1L0D A;  4ETZ A;  1K54 C;  4YWZ A;  4K91 A;  4LRY C;  3CPT A;  4EBP A;  4WBG A;  3HLG A;  2PU2 A;  2XRN A;  4R3B A;  5DKK A;  5F1F A;  4E3K A;  1XA1 A;  3NY4 A;  4GLQ A;  5DTK A;  1IYS A;  1ODV A;  5HAI A;  4B9O A;  2HDR A;  2L4R A;  5HDD A;  3MBZ A;  5HX9 A;  1JWV A;  1HTZ A;  5TFQ A;  3S7P A;  1GSX A;  3IS2 A;  3CPT B;  4XUX A;  2MJ6 A;  3UE3 A;  2PRF A;  4ZDX A;  3SW1 A;  3L9K A;  3AGF A;  4DF6 A;  2P08 A;  3R4K A;  4E04 A;  2R9W A;  3ZVT A;  4BWI A;  3MZD A;  2EX8 A;  5E2H A;  1YLP A;  3TOI A;  2K2N A;  3CAX A;  4Q0I A;  5TGF A;  3N4I A;  3IS2 B;  4O7D A;  4HI4 A;  5DFY A;  3S7O A;  4BL3 A;  3PBN A;  2OOL A;  2V20 A;  4ME4 A;  3T4O A;  3HRE A;  5A91 A;  4Q0H A;  3RXX A;  1N9L A;  3DWZ A;  3FPV A;  3K3C A;  5EOO A;  1CEG A;  1XXM A;  4IVK A;  2XFS A;  3D9Y A;  3IXB A;  4QB8 A;  1IEM A;  4WEJ A;  4F94 A;  3SS3 A;  5FQJ A;  4MNR A;  5GL9 A;  3A3I A;  4DKI A;  4QD4 A;  1FR6 A;  3RJU A;  4P85 A;  2G7U A;  3G32 A;  3A3E A;  4UA9 A;  5FDH A;  1TS0 A;  2WAE A;  5GLC A;  4EBN A;  5DTS A;  5CGS A;  4BLM A;  1H8Z A;  1F5M A;  1FSW A;  2JKR M;  1S1Z A;  3W8K A;  3IF5 A;  4GNU A;  3L7H A;  2PU4 A;  4OP8 A;  2H10 A;  1MBL A;  1E3U D;  2K7S A;  1MWS A;  1G6O A;  1T1B A;  5EVI D;  3B3X A;  1SZV A;  1IKG A;  4LLO B;  3B33 A;  1SCW A;  4GKU A;  4Y3I A;  1UGU A;  2Y4A A;  3BWL A;  4YNR A;  4OON A;  1XJ2 A;  3IXG A;  5EVL A;  5HPI A;  4WM9 A;  5HFO A;  4ZJ3 A;  2WZX A;  3BM6 A;  2EFU A;  1NRJ A;  1DP6 A;  3PAE A;  1M6K A;  4CLC A;  4X69 A;  3RTY A;  1FCM A;  1MWU A;  5AVE A;  4LGW A;  4P6Z S;  3LR0 A;  1XX2 A;  2V8C A;  2WYX A;  1JTG A;  2OLV A;  3T12 B;  5HDC A;  4I39 A;  1LSX A;  4WEK A;  2DNS A;  3BYD A;  4Y2F A;  4WF0 A;  1IFQ A;  4DE2 A;  5E2F A;  2FH5 A;  3T50 A;  2ZOH A;  3ZYT A;  1K57 A;  5BOH A;  4RA7 A;  2EX9 A;  2W0N A;  1L0F A;  3VFF A;  4JXW A;  4CLC B;  4RX2 A;  2UWX A;  4NXF A;  3LID A;  3OOV A;  1K25 A;  2ZQD A;  3AGD A;  4PM9 A;  5G4Z A;  4ETX A;  3OZH A;  3PAG A;  3ZVW A;  2EX2 A;  5KSC A;  5F68 A;  1ZTU A;  2IWD A;  3MQ0 A;  4S2K A;  4Q8I A;  2D01 A;  4HBT A;  3PBS A;  1AWI A;  3W4Q A;  2G2W A;  4LV2 A;  2XH9 A;  2P74 A;  3N7W A;  3ZG9 B;  5D3O A;  5A92 A;  4KZ5 A;  4N9L A;  2WKH A;  2Z2M B;  4UHU A;  1JVJ A;  5JYP A;  1DP8 A;  4NET A;  4RYE A;  3CHW P;  4GDB A;  1BLH A;  2PD8 A;  2Q0O A;  4QY5 A;  1KDW A;  2XFT A;  3G34 A;  4ZJ1 A;  4OLG A;  4LV0 A;  1ESU A;  3GRJ A;  2BLS A;  4JXV A;  1MY8 A;  5CEC A;  1XPB A;  1KE4 A;  1LI0 A;  3KSI A;  4O01 A;  4EER A;  4PMA A;  2A24 A;  3FKV A;  3PR6 A;  1VB6 A;  3NC8 A;  4K0W A;  4LV3 A;  3FZC A;  4MBH A;  1N9B A;  4JLF A;  1CEF A;  1TEM A;  3C8C A;  3SH7 A;  2Y55 A;  3WRZ A;  3QP1 A;  4OP5 A;  4EET B;  4EU0 A;  5FQK A;  3CUE C;  3PTE A;  4L9G A;  4R4S A;  1W63 M;  4EWF A;  3IHB A;  2A24 B;  2GJ3 A;  1YLY A;  3BW6 A;  2Y91 A;  3OPH A;  3O3V A;  2HPB A;  4X68 A;  4FH4 A;  1K55 C;  5AJG A;  2Y2K A;  1OTE A;  3FG8 A;  3FV7 A;  4WZ4 A;  5GHY A;  4E3I A;  3PHY A;  4WMC A;  3I7J A;  3UMD A;  5FAS A;  3NI9 A;  5EM0 A;  1UWP X;  4KZ6 A;  1P9R A;  3O87 A;  2O9A A;  4MMN A;  5E2E A;  1IYP A;  3SH9 A;  4P6B A;  3SH8 A;  4GCZ A;  1XJ6 A;  4OQ0 A;  4BQM A;  3NHQ A;  1W7F A;  4EW7 A;  4DDY A;  4Y15 A;  2Y2M A;  2R9X A;  2A3U A;  2JBF A;  3V3S A;  1NWZ A;  4OLD A;  4FD8 A;  1BSG A;  1OT9 A;  2HP6 A;  4PKY G;  4MLL A;  5J8X A;  1RGY A;  4I3J A;  4RQ9 A;  3SZT A;  3OBF A;  4KG5 A;  3G35 A;  2M7U A;  5EVI C;  3ZG8 B;  1S4R A;  4CLC E;  4S2J A;  3HUN A;  5CER A;  3UPP A;  3IX8 A;  3IH8 A;  4QPR A;  4FCF A;  4R3J A;  3HLC A;  3NDE A;  3GVB A;  2XK1 A;  4B4Z A;  1YSP A;  3D72 A;  1W5D A;  1T1A A;  5TR7 A;  5GHX A;  3MQO A;  1G6A A;  4CPK A;  2OV5 A;  5HD5 A;  1GSV A;  4WZ5 C;  3QP2 A;  2ZC5 B;  5IS1 A;  3WS1 A;  5J4E A;  2XQZ A;  4MEZ A;  4MBF A;  3JPU A;  4I38 A;  1OTI A;  4E3O A;  2V2F F;  3P09 A;  5CXW A;  2HF6 A;  2XR0 A;  2J9P A;  1NJ4 A;  3MZE A;  3VP4 A;  1K6S A;  1JWP A;  4BD1 A;  3C30 A;  4PM6 A;  4Y5F A;  5J3W A;  4X1L A;  5FAO A;  3OC2 A;  1KVL A;  2Y2O A;  3ISG A;  1XJ3 A;  1LT0 A;  4U3T A;  4MBK A;  4QJG A;  5FI7 A;  4GD6 A;  5FQM A;  3VP0 A;  1J9M A;  2O99 A;  2D02 A;  5GHZ A;  1P97 A;  3FWL A;  4L9E A;  4EBL A;  2X02 A;  1CQA A;  3IH9 A;  4E6W A;  3G2Z A;  1P0Z A;  4KZA A;  4EUV A;  1FIL A;  4BEN A;  4PKY A;  4GN2 A;  4JXS A;  3OLO A;  3ITB A;  4KQQ A;  1E3U A;  1ERQ A;  5HAQ A;  4HIA A;  5EVI A;  4KZ8 A;  4GD8 A;  4QWO A;  4GS9 A;  2NUP C;  4G3W A;  4MN6 A;  5FA7 A;  3T4L A;  2Y2L A;  4PM7 A;  1ZKJ A;  5A90 A;  3T4J A;  1S6R A;  4G3K A;  4E3N A;  2Y2H A;  3D4F A;  2M1C A;  4KUK A;  2Y8H A;  4KZB A;  3UE1 A;  1DJA A;  1NZU A;  2PBD P;  3WWX A;  3V3R A;  3NOT C;  5EVI B;  4YIN A;  3LY3 A;  3Q1F A;  4GS9 B;  1TS6 A;  3DTE A;  2HP9 A;  3A3F A;  3N8L A;  2WKQ A;  2W1T A;  3U2A A;  1LSW A;  3Q7V A;  4WMC D;  4JF6 A;  1LL8 A;  1ES4 A;  4OQI A;  4WEL A;  4KEN B;  2BAS A;  1GA0 A;  1NY0 A;  1T18 A;  4NKP A;  1KGG A;  2VK3 A;  3ZQ5 A;  3N8R A;  5I5L A;  3HCY A;  4U0T A;  1L0E A;  3KSG A;  1YMS A;  3EGD C;  4LFU A;  4M3K A;  1Q2Q A;  2W1T B;  1FIK A;  3BFF A;  3Q7V B;  1ERM A;  4S2N C;  3UME A;  5L09 A;  5M19 A;  1KVM A;  3GDI A;  3VMA A;  1TDG A;  3JVV A;  2YKF A;  3UPN A;  5AQB A;  3HLF A;  3IWQ A;  4BBT A;  5KZH A;  3NCK A;  4JF5 A;  1TS7 A;  4HH3 A;  5HAR A;  2LB5 A;  4KQD A;  4N1X A;  5HDS A;  2J8Y A;  2Z6C A;  4OQG A;  4I5S A;  3NIA A;  1DY6 A;  2XD1 A;  1YM1 A;  1ES2 A;  1ZG4 A;  4UAA A;  1FQG A;  5CHJ A;  4PPR A;  2W3G A;  4CLC C;  1MZU A;  3N8S A;  4IUK A;  1FR1 A;  3UB9 A;  5HSQ A;  3H82 A;  3Q7Z A;  4N1H A;  2B02 A;  3UB7 A;  1CF0 A;  4JGR A;  3W4P A;  2EWW A;  4S2O A;  2ZMA A;  2JHE A;  2ZQ9 A;  3KX0 X;  4UQI S;  1K57 C;  2JKT I;  1T19 A;  3EQU A;  3ZNY A;  4S2P A;  4XT2 A;  1BTL A;  1GSW A;  3RXW A;  3H82 B;  1MKI A;  3PYP A;  2JCH A;  3UNW A;  4JGQ A;  2VV8 A;  3PBQ A;  1S0W A;  2V1B A;  3HLD A;  1NZO A;  4HQA A;  1J3W A;  2VEA A;  1PW8 A;  4OH0 A;  4IVI A;  2W3E A;  1YMX A;  4X53 A;  3CJM A;  4GW9 A;  2HV1 A;  4XT2 B;  1YSQ A;  1BUE A;  5CX7 A;  3ZG7 B;  2WKR A;  3BEC A;  1BUL A;  5A8B A;  4S2N A;  3BY8 A;  2PT7 A;  3T4S A;  3E4O A;  1L0G A;  3BRM A;  2WGI A;  4KG2 A;  1H8M A;  4X55 A;  3P7N A;  5KSH A;  4LCL A;  2H28 A;  1YKD A;  3K3D A;  1WYC A;  4JKT A;  4BD0 A;  1BZA A;  3V50 A;  2ZBB A;  3C38 A;  3T1S A;  4R1G A;  2WKE A;  2QYB A;  3C4O A;  4NXE A;  1G5U A;  1RGZ A;  3B42 A;  4B88 A;  2HGV A;  5I94 A;  5A93 A;  5DVA A;  4S2I A;  2C5W B;  4X6T A;  5HL1 A;  2OWJ A;  2QJ5 A;  2O9B A;  3ICY A;  4IUH A;  1HVB A;  3QP4 A;  3HJI A;  3T1Q B;  3S7Q A;  5CGX A;  1VET A;  2VJW A;  4WN5 A;  3QNC A;  5FAT A;  4C3Q A;  4IJG A;  4E6X A;  3OCN A;  4OKP A;  3UB5 P;  5EM1 A;  5TJJ A;  3VOY A;  3DTM A;  5FI2 A;  4ZBE A;  1PWC A;  3PXP A;  2OSU A;  1D06 A;  2Y2J A;  4E3L A;  4DMZ A;  1Y54 A;  2H0Y A;  2X71 A;  1VET B;  1PYY A;  4KUO A;  2KLI A;  2W1R A;  3Q07 A;  4X56 A;  1XJ4 A;  4WYY A;  4H6J A;  4JBF A;  1XGJ A;  5AQ7 A;  3OPR A;  4HHD A;  4QHC A;  3TSG A;  1HLU P;  3JYI A;  3VOL A;  4UEY A;  3UDI A;  3E2K A;  3UB6 A;  4Z1W A;  1YLJ A;  4FH2 A;  3UE0 A;  5IU1 A;  3MF0 A;  4UA7 A;  3G4P A;  1H3Q A;  1OT6 A;  5CTN A;  1E4D A;  2B5R A;  5FSR A;  5DF7 A;  2JN7 A;  4H6J B;  2QJ7 A;  2EA9 A;  2VLG A;  3CG5 A;  3FKW A;  1L2S A;  3GEC A;  5LBR A;  1F98 A;  3MKF A;  4N9K A;  3QP5 A;  4LEN A; 
#chains in the Genus database with same CATH homology
 5KMW A;  1ZG6 A;  1QME A;  1PI4 A;  4H8R A;  2V1Z A;  1MWR A;  1NRF A;  5FAQ A;  4E3O A;  2H0T A;  2V2F F;  3P09 A;  5CXW A;  3S4X A;  4DE3 A;  1L0D A;  4S2M A;  2XR0 A;  2J9P A;  1NJ4 A;  5CED A;  3MZE A;  1K54 C;  3VP4 A;  1K6S A;  3BLS A;  4K91 A;  1JWP A;  4BD1 A;  4EBP A;  4WBG A;  3HLG A;  4QY6 A;  2PU2 A;  4PM6 A;  5FQQ A;  3UPO A;  4OOM A;  4R3B A;  5CTM A;  5F1F A;  3EQV A;  4LV1 A;  1W8Y A;  4E3K A;  1HZO A;  1XA1 A;  3NY4 A;  5FAO A;  3OC2 A;  3HVF A;  5DTK A;  1IYS A;  1KVL A;  4IBR A;  2Y2O A;  5HAI A;  3ISG A;  2HDR A;  5M18 A;  4U3T A;  3MBZ A;  4Z9Q A;  2WKI A;  1JWZ A;  1PWD A;  4MBK A;  5HX9 A;  1JWV A;  2X01 A;  4QJG A;  5FI7 A;  1HTZ A;  5TFQ A;  4GD6 A;  3S1Y A;  5FQM A;  1Q2P A;  3VP0 A;  1J9M A;  5FAP A;  3C7V A;  3HBR A;  5GHZ A;  2Y59 A;  4XUX A;  3UE3 A;  2J7V A;  1RP5 A;  4EUZ A;  2ZLY A;  3V5M A;  3FWL A;  2HDU A;  1YLZ A;  4EBL A;  4ZDX A;  2G2U A;  3LCE A;  2X02 A;  1M40 A;  1CI8 A;  3IH9 A;  4KZ9 A;  4E6W A;  3AGF A;  3G2Z A;  1IYO A;  2WGV A;  4DF6 A;  4DE1 A;  3HLW A;  4KZA A;  2CC1 A;  2RL3 A;  2R9W A;  4BEN A;  2JE5 A;  4EQI A;  3ZVT A;  1DJC A;  4U0X A;  3MZD A;  2EX8 A;  5E2H A;  4GN2 A;  1YLP A;  4JXS A;  3ITB A;  3AGE A;  4KQQ A;  3TOI A;  1E3U A;  2ZQ8 A;  3HL9 A;  1ERQ A;  1WYB A;  1FCN A;  3HUM A;  5GLD A;  1YT4 A;  5FQ9 A;  5CEB A;  5TGF A;  5HAQ A;  1H5X A;  5GLA A;  4OPY A;  3N4I A;  4O7D A;  1IYQ A;  2ZC6 B;  3IHA A;  1K4E A;  4GZB A;  4KZ8 A;  3PBN A;  5EVI A;  4GD8 A;  4BL3 A;  5FQI A;  3ZHH A;  3VP3 A;  3IXD A;  2V20 A;  5EPH A;  2FFY A;  3HRE A;  4MBF A;  2ZC4 B;  5A91 A;  3RXX A;  5FA7 A;  3SS5 A;  1U60 A;  3MFD A;  3UO9 A;  2Y2L A;  3IT9 A;  4PM7 A;  5EE8 A;  1ZKJ A;  3DWZ A;  5A90 A;  3WS4 A;  1MXO A;  1YLT A;  1S6R A;  5G18 A;  5EOO A;  1CEG A;  4K0X A;  2Y2H A;  4E3N A;  1XXM A;  2ZM2 A;  3D4F A;  4IVK A;  1PWG A;  2XFS A;  2Y2P A;  3CMZ A;  2J9O A;  3IXB A;  4PM8 A;  4QB8 A;  1O07 A;  1IEM A;  4WEJ A;  4F94 A;  1I2S A;  4KZB A;  3SS3 A;  3UE1 A;  1DJA A;  1NZU A;  3SS4 A;  1ESI A;  5FQJ A;  4MNR A;  5GL9 A;  3WWX A;  3V3R A;  3N6I A;  3A3J A;  3A3I A;  3G2Y A;  4R0Q A;  4DKI A;  4QD4 A;  1FR6 A;  5EVI B;  3PBT A;  4YIN A;  1K56 A;  1LLB A;  3LY3 A;  3Q1F A;  4ZTK A;  3RJU A;  4P85 A;  2HP9 A;  5IHV A;  3ZNT A;  1I2W A;  2WUQ A;  3UDF A;  3A3F A;  3G32 A;  1ONH A;  3N8L A;  3A3E A;  1PW1 A;  1XA7 A;  4UA9 A;  3Q7V A;  5FDH A;  2WZZ A;  4WMC D;  2WAE A;  1W79 A;  4JF6 A;  5GLC A;  4EBN A;  1ES4 A;  2Y2Q A;  4OQI A;  3ZCZ A;  2H5S A;  5CGS A;  5DTS A;  4WEL A;  4KEN B;  1JTD A;  1ERO A;  1GA0 A;  1H8Z A;  4BLM A;  1NY0 A;  3WS5 A;  4NK3 A;  3NDG A;  1FSW A;  1KGG A;  5E43 A;  2Z2L B;  4UA6 A;  2QPN A;  3MXS A;  3W8K A;  3Q81 A;  3IF5 A;  1GHI A;  3N8R A;  1GHM A;  4GNU A;  4B4X A;  2PU4 A;  4OP8 A;  1OME A;  2H10 A;  4U0T A;  2ZM8 A;  1L0E A;  1MBL A;  1E3U D;  3VP2 A;  1YMS A;  1VQQ A;  3C7U A;  3ZDJ A;  1MWS A;  3G31 A;  3IQA A;  4M3K A;  1Q2Q A;  3BFF A;  3Q7V B;  3BFD A;  5EVI D;  3M2K A;  1ERM A;  5CHM A;  1KE0 A;  1GA9 A;  3B3X A;  3ZGA B;  3VP1 A;  4S2N C;  4ZJ2 A;  2EXA A;  1IKG A;  3A3D A;  2E8I A;  1SCW A;  5U47 A;  4GKU A;  5M19 A;  5HW3 A;  2Y4A A;  3ZG0 A;  3M6H A;  4OPR A;  4GOG A;  1KGE A;  1KVM A;  4OON A;  2RCX A;  2HDQ A;  4QU3 A;  3UY6 A;  3VMA A;  5JYO A;  1TDG A;  3IXG A;  5EVL A;  3W4O A;  3LEZ A;  3UPN A;  3HLE A;  5AQB A;  1GCE A;  3HLF A;  4WM9 A;  5HFO A;  1PIO A;  3IWQ A;  4KQO A;  4ZJ3 A;  2ZD8 A;  5KZH A;  3NCK A;  1PZO A;  1HD8 A;  2WZX A;  4JF5 A;  1SDE A;  3P98 A;  3BM6 A;  5HAR A;  4RX3 A;  2ZC7 A;  2EFU A;  1TVF A;  4N1X A;  4GDN A;  2C6W B;  2ZJ9 A;  3PAE A;  1M6K A;  2J8Y A;  1NXY A;  1RCJ A;  4OQG A;  4RVA A;  4X69 A;  1CK3 A;  1FCM A;  5AQ9 A;  5AQA A;  1MWU A;  3NIA A;  1DY6 A;  1WE4 A;  2XD1 A;  1YM1 A;  2Y2G A;  4OVD A;  1SDN A;  1XX2 A;  1ES2 A;  2HP5 A;  2Y2N A;  4IED A;  1ZG4 A;  4UAA A;  1MWT A;  2WYX A;  1JTG A;  2OLV A;  4DE0 A;  1FQG A;  5CHJ A;  3UDX A;  4PPR A;  1N4O A;  3N8S A;  4WEK A;  5E2G A;  2DNS A;  3BYD A;  4Y0O A;  1FR1 A;  4Y0T A;  4DE2 A;  5E2F A;  2DRW A;  3TG9 A;  4JF4 A;  1K57 A;  1ALQ A;  3Q7Z A;  4RA7 A;  5BOH A;  2WGW A;  2P9V A;  1YQS A;  2EX9 A;  2BG1 A;  4N1H A;  1L0F A;  1K4F A;  5HAP A;  2EFX A;  3VFF A;  4CJN A;  4JXW A;  3QHY A;  4DRT A;  1NYM A;  3W4P A;  4RX2 A;  2Q9N A;  2UWX A;  2XGN A;  4S2O A;  2ZMA A;  3MKE A;  4OQH A;  1K25 A;  2ZQD A;  2ZQ9 A;  4HEF A;  3LO7 A;  3AGD A;  2ZQ7 A;  4PM9 A;  1K57 C;  3PBO A;  3OZH A;  3PAG A;  3ZVW A;  1FSY A;  1H8Y A;  1PI5 A;  2JC7 A;  2EX2 A;  5KSC A;  3EQU A;  3ZNY A;  4S2P A;  1BTL A;  2IWD A;  5EUA A;  4S2K A;  3RXW A;  4Q8I A;  1KDS A;  4HBT A;  3PBS A;  1K6R A;  4OOY A;  4Y0U A;  1MKI A;  1KGF A;  2JCH A;  3W4Q A;  2WGW B;  2P9V B;  3LY4 A;  3UNW A;  2G2W A;  4LV2 A;  2XH9 A;  2P74 A;  3ZFZ A;  3N7W A;  3ZG9 B;  3PBQ A;  5D3O A;  1S0W A;  3HLD A;  4Y7P A;  1NZO A;  5A92 A;  4KZ5 A;  3OCL A;  4N9L A;  2WKH A;  1BLP A;  2Z2M B;  1FCO A;  4LCM A;  3BEB A;  4UHU A;  1JVJ A;  1PW8 A;  3MXR A;  5JYP A;  4OH0 A;  4IVI A;  4NET A;  4RYE A;  1CI9 A;  1YMX A;  2I72 A;  4GDB A;  1BLH A;  4X53 A;  3CJM A;  1XP4 A;  4C75 A;  3HUO A;  1QMF A;  4E3M A;  1BUE A;  3OPP A;  3IWI A;  3ZG7 B;  3BEC A;  4QY5 A;  1KDW A;  2XFT A;  3G34 A;  4ZJ1 A;  4GB7 A;  4OLG A;  1BUL A;  1W8Q A;  4LV0 A;  1ESU A;  3GRJ A;  1SKF A;  4OPQ A;  2BLS A;  3O86 A;  4JXV A;  4ZAM A;  1MY8 A;  4S2N A;  3Q82 A;  2XLN A;  5CEC A;  1G68 A;  1XPB A;  2A49 A;  2XDM A;  3OPL A;  1KE4 A;  1IEL A;  1LHY A;  1LI0 A;  2XEP A;  1L0G A;  4PMA A;  3BRM A;  2WGI A;  4P0M A;  1VM1 A;  3FKV A;  2WAD A;  4HBU A;  1EI5 A;  4KG2 A;  2IWB A;  3PBR A;  3NC8 A;  4X55 A;  1BT5 A;  2ZQA A;  4K0W A;  4LV3 A;  3ZG5 A;  5L2F A;  5KSH A;  4LCL A;  1WYC A;  4JKT A;  4BD0 A;  1BZA A;  3FZC A;  4MBH A;  2IWC A;  1N9B A;  3V50 A;  4JLF A;  4N92 A;  1CEF A;  1TEM A;  3G30 A;  1ZC2 A;  1Z6F A;  4XUZ A;  5DTT A;  3SH7 A;  1DJB A;  2Y55 A;  3FYZ A;  5M1A A;  3WRZ A;  4JPM A;  1PZP A;  3ITA A;  2QZ6 A;  4OP5 A;  4S2L A;  1SHV A;  2WKE A;  2GDN A;  4R1G A;  3C4O A;  1RGZ A;  3PTE A;  4L0L A;  5FQK A;  4PM5 A;  4DDS A;  2Q9M A;  2EX6 A;  4B88 A;  5I94 A;  4R4S A;  4KQR A;  5A93 A;  1K55 A;  4DXC A;  1C3B A;  4S2I A;  5DVA A;  4EWF A;  5F1G A;  2C5W B;  2WK0 A;  3IHB A;  4X6T A;  4C6Y A;  1ES3 A;  1K38 A;  1YLY A;  5HL1 A;  1TDL A;  2VGK A;  1K56 D;  1IKI A;  3GTC A;  2Y2I A;  2Y91 A;  3GSG A;  3S22 A;  3OPH A;  3O3V A;  2HPB A;  3BFG A;  1HVB A;  4X68 A;  4FH4 A;  2PBY A;  2DCF A;  1K55 C;  3IWO A;  5CGX A;  3M2J A;  5F83 A;  1O7E A;  2Y2K A;  3FV7 A;  3QNC A;  4BL2 A;  1LI9 A;  5FAT A;  3HLB A;  5CGW A;  4DXB A;  4OOL A;  4WZ4 A;  5GHY A;  4E3I A;  4EV4 A;  5FI6 A;  4C3Q A;  4WMC A;  3IF6 A;  3M6B A;  4E6X A;  3I7J A;  2EXB A;  3OCN A;  4OKP A;  3WRT A;  5FAS A;  3BFE A;  2ZQC A;  3NI9 A;  3VOY A;  3DTM A;  2ZM0 A;  5FI2 A;  4ZBE A;  1PWC A;  4KZ6 A;  1AXB A;  1EWZ A;  2QMI A;  4IBX A;  3O87 A;  4R23 A;  5E2E A;  5GLB A;  3SOI A;  3UN7 A;  3BLM A;  2OSU A;  3O88 A;  1FOF A;  2Y2J A;  4ID4 A;  5CRF A;  4JXG A;  4E3L A;  4KZ3 A;  3VOZ A;  1IYP A;  3SH9 A;  4P6B A;  3SH8 A;  1KE3 A;  3NBL A;  1NYY A;  3IF6 C;  4D2O A;  1BLC A;  1XKZ A;  1Y54 A;  4OQ0 A;  1ONG A;  2H0Y A;  3DW0 A;  4BQM A;  2X71 A;  4OPZ A;  3WS0 A;  1PYY A;  1W7F A;  3GR2 A;  2WAF A;  4DDY A;  3Q07 A;  3QNB A;  4X56 A;  4YFM A;  4KZ7 A;  4WYY A;  1YLW A;  3IF6 B;  4JBF A;  2OLU A;  1XGJ A;  5AQ7 A;  2Y2M A;  5EEC A;  2R9X A;  3GMW A;  5F82 A;  3V39 A;  1GHP A;  5DF9 A;  3OPR A;  2A3U A;  2JBF A;  3V3S A;  3VFH A;  4OLD A;  4QHC A;  4FD8 A;  1BSG A;  3TSG A;  4A5R A;  3GV9 A;  1MPL A;  2HP6 A;  4MLL A;  1BLS A;  5J8X A;  3C4P A;  1RGY A;  3JYI A;  3UDI A;  3E2K A;  3MZF A;  4KG5 A;  5DF8 A;  3G35 A;  4HES A;  5EVI C;  1I5Q A;  1YLJ A;  3ZG8 B;  4FH2 A;  3UE0 A;  2HDS A;  3HUN A;  4S2J A;  2XD5 A;  5CER A;  3UPP A;  4UA7 A;  3IH8 A;  3G4P A;  4FCF A;  5CTN A;  4R3J A;  1E4D A;  4E3J A;  1LL9 A;  2B5R A;  3HLC A;  3NDE A;  4FSF A;  3GVB A;  4WZ5 A;  5DF7 A;  5FSR A;  2XF3 A;  2XK1 A;  4B4Z A;  3BFC A;  3VSL A;  4KG6 A;  2VGJ A;  3C5A A;  1W5D A;  3CG5 A;  1LL5 A;  3GQZ A;  3CZD A;  3FKW A;  5GHX A;  5TR7 A;  5EOE A;  1G6A A;  1L2S A;  4CPK A;  3E2L A;  2ZC3 B;  2OV5 A;  3IXH A;  4R4R A;  3VSK A;  4P87 A;  4WZ5 C;  3DWK A;  4KZ4 A;  3WS2 A;  1E25 A;  3MKF A;  4XXR A;  2ZC5 B;  4BJP A;  3WS1 A;  1XGI A;  4N9K A;  5CHU A;  1K54 A;  1ES5 A;  2XQZ A;  4MEZ A;  2FFF B;  4LEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...