3DW0A

Crystal structure of the class a carbapenemase kpc-2 at 1.6 angstrom resolution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
265
structure length
265
Chain Sequence
b'AEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class A carbapenemase KPC-2
molecule tags Hydrolase
source organism Escherichia coli
publication title Genetic and structural insights into the dissemination potential of the extremely broad-spectrum class A beta-lactamase KPC-2 identified in an Escherichia coli strain and an Enterobacter cloacae strain isolated from the same patient in France.
pubmed doi rcsb
total genus 91
structure length 265
sequence length 265
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3dw0A00
2HDSA 5CRFA 1G6AA 4L0LA 1MXOA 1W79A 3ZG7B 3WRTA 4E3JA 1KE4A 5GL9A 3M2JA 4ZJ1A 1FCMA 5FQQA 3OPRA 2HP9A 4HBTA 1SCWA 3VFFA 2Y2QA 3WS5A 4EUZA 3EQUA 3IH8A 4K0XA 2V20A 3MXRA 4KQOA 5L2FA 5HAIA 4JXWA 3V50A 4X69A 2XF3A 2Y59A 5FDHA 1NYMA 3ZNTA 1K38A 1ERMA 2DRWA 5F1FA 1JWZA 1MBLA 5HAQA 3JYIA 2ZQ7A 4WMCD 2I72A 1ZG4A 1MPLA 5AQBA 4R3JA 3M6HA 3IT9A 3V39A 1ES5A 2ZM0A 2VGJA 3N6IA 3ZVWA 3UDFA 4E6WA 2V1ZA 2WZXA 4P6BA 3P98A 5E2FA 2EFXA 3SS4A 1QMFA 1KE0A 3DTMA 4PM5A 5M18A 2ZM2A 5A90A 4JF4A 4JPMA 3EQVA 2J8YA 2HDQA 3W4PA 4X56A 5CERA 1MKIA 1LI9A 1IKIA 1U60A 4JXVA 2Q9MA 3TSGA 1ES3A 3W4QA 5EOOA 3MXSA 2Y2NA 4LV3A 4OPRA 5A91A 1SDEA 2PU4A 4ID4A 5CEBA 1ZC2A 1BLHA 2Y2PA 4GNUA 4Y0UA 4ZBEA 3S1YA 2G2UA 3BFGA 3IXDA 4WZ4A 3BFEA 3QHYA 1OMEA 1I2WA 3ZCZA 4JXSA 1I5QA 4MNRA 3HUMA 2ZMAA 1XXMA 3FKVA 4PPRA 1K56D 2Z2LB 3G2YA 4MBFA 4MLLA 1JWPA 4OQ0A 2EX8A 3GR2A 5HARA 4QJGA 5BOHA 5FI2A 2XLNA 2V2FF 1S0WA 2G2WA 3C4OA 4EBNA 5HFOA 2ZC4B 4JF5A 4RVAA 3GQZA 4GD6A 4YFMA 4R3BA 3PAGA 2Y2OA 3Q7VA 4YINA 5EVID 4H8RA 2H5SA 1AXBA 3HREA 1RGZA 4X53A 4QB8A 3SH8A 1K6RA 4R1GA 3DWZA 5E43A 4CJNA 2HPBA 1W5DA 3HVFA 2Y2JA 2PBYA 4U0TA 2QZ6A 3Q7ZA 2ZM8A 3CJMA 3PBNA 1VQQA 2OLUA 4LV2A 1HD8A 1Z6FA 4R4RA 1M40A 1XP4A 3V3SA 3ITBA 1SDNA 4GZBA 4QHCA 2Z2MB 2ZQAA 2HDRA 3G35A 3AGEA 1VM1A 2Y2GA 3Q07A 3VP1A 2H10A 4S2OA 2GDNA 1K56A 1YM1A 4GDNA 1PWGA 4WBGA 3UN7A 4DDYA 1YLWA 1Q2PA 4EV4A 2WKIA 3DWKA 3ZG8B 1N4OA 5F83A 5U47A 1YT4A 4WELA 5GLAA 1BTLA 2WAFA 3MZFA 1K54C 5FA7A 1PW8A 1IKGA 4ZDXA 5I94A 4OOYA 4KZ5A 3NDGA 4D2OA 1BUEA 4KENB 1K54A 4KZBA 3A3JA 4K0WA 1IYQA 3HLBA 2EXBA 4WMCA 5EECA 3BFFA 2HP6A 2OLVA 3FV7A 1ZKJA 4UA9A 4S2LA 4C3QA 2OSUA 2WGWA 1KGEA 3PBRA 3V5MA 1CEGA 4IVIA 5CGWA 4P85A 3HBRA 3S4XA 1DJBA 5GHYA 4PM9A 3UE0A 5E2GA 1XKZA 4Y7PA 1FQGA 2IWDA 2WAEA 1K25A 2Y2HA 2Y2LA 1YMXA 3Q82A 2VGKA 5D3OA 3SS3A 1PZOA 3CZDA 4OONA 3GV9A 5FAOA 1YQSA 3VOZA 2RCXA 4GOGA 2QPNA 1Q2QA 4FH4A 4N9KA 2Y2KA 5E2EA 1NZUA 3RXXA 5KZHA 3WRZA 3C7UA 3A3EA 1KVLA 3WWXA 3HLCA 3O87A 4Z9QA 3OZHA 4KG2A 2EX9A 1JTDA 1E4DA 5AQ9A 3VFHA 3SOIA 3OPPA 5E2HA 5EVIC 5CXWA 3PBOA 1TVFA 5CHJA 4B4XA 1BLSA 3ZFZA 3D4FA 3VP4A 5HAPA 3MKEA 1IYSA 2E8IA 4ZAMA 3TOIA 1H5XA 1SKFA 1XPBA 2CC1A 3G2ZA 4P0MA 1ONHA 1XA1A 4E3KA 2ZJ9A 1JTGA 3DW0A 4QY6A 4MEZA 2ZC6B 3B3XA 2ZQDA 4BD0A 1YLJA 3NC8A 3AGFA 3V3RA 4RX3A 1S6RA 2XR0A 4OQHA 2FFYA 5AQAA 2XD5A 3BLSA 3N8SA 5KSHA 5J8XA 5FQJA 4UAAA 4OQGA 3IXGA 1JWVA 3IF6C 4DF6A 3LCEA 2WUQA 5DVAA 3G34A 3HLFA 4GKUA 4LV1A 3GRJA 4DXCA 4E6XA 3OPLA 1KDSA 2ZLYA 3OCLA 2ZC5B 3MBZA 3ZNYA 5CEDA 1HTZA 4N9LA 1K4FA 1NXYA 4OLGA 5CTMA 5DF8A 5F1GA 4EQIA 3SH9A 2H0YA 3M2KA 4OPQA 2XEPA 3HUNA 4FH2A 1L2SA 2XK1A 5KMWA 1NZOA 1PYYA 3IWOA 3BYDA 4O7DA 5GHXA 1L0EA 4N1HA 3G32A 3GTCA 4PM6A 5FI6A 1W8YA 1CEFA 1H8YA 1K55C 3N8LA 2Y55A 5FQIA 5GLBA 2XH9A 2EX6A 5G18A 3IH9A 4ZJ2A 1BT5A 1ESUA 3C5AA 4E3MA 1E25A 1K6SA 1ONGA 3G4PA 4B4ZA 4DE2A 4KZ4A 4Y0OA 2IWBA 1GHMA 4JXGA 4OKPA 5EUAA 4QY5A 3FYZA 3Q7VB 1SHVA 3UPOA 3HLDA 1IYOA 3CMZA 1O07A 2ZC7A 1GHIA 1NRFA 1YLPA 1LL5A 2HDUA 3A3FA 2XD1A 4XUXA 5FQMA 4C6YA 4E3LA 5EVLA 5HL1A 3GMWA 3FKWA 3RXWA 3UDXA 4IBXA 1LHYA 1LL9A 2DCFA 4OP8A 2Y4AA 2C6WB 2WYXA 4HBUA 3ZVTA 4P87A 3IHBA 3Q1FA 4GDBA 5TFQA 2C5WB 3Q81A 3O88A 5EVIA 3IWQA 3MKFA 1BLPA 1IEMA 4WEJA 1NY0A 4KZ7A 5A93A 2R9XA 1PI4A 3BECA 3ZDJA 1K55A 1MY8A 5DF9A 3G31A 3PBTA 1CI9A 1GA0A 2WZZA 4S2JA 4BLMA 4EWFA 5JYOA 4DDSA 2XFTA 1KE3A 3NBLA 2JCHA 1E3UD 1G68A 3LY4A 1EWZA 1FR6A 4FCFA 4S2MA 4KZAA 3IQAA 2J9OA 5EVIB 1HVBA 3N8RA 5JYPA 4Q8IA 1PW1A 2BG1A 2ZC3B 4KZ3A 4KG5A 5CECA 2WADA 4GN2A 3I7JA 1WE4A 1GCEA 3VMAA 5EE8A 2OV5A 4OOLA 4X68A 4BENA 4WZ5C 4U3TA 4S2IA 4E3NA 1XGJA 1W7FA 4OH0A 2HP5A 5DTSA 4EBPA 4OQIA 5CTNA 5FI7A 3UE3A 4E3OA 1M6KA 1WYCA 2FFFB 1KGGA 5GHZA 1ES4A 2IWCA 2QMIA 5TR7A 2BLSA 3GVBA 4PMAA 1RGYA 1J9MA 3C7VA 3HLGA 4S2NC 5GLCA 1FCNA 5DF7A 1EROA 3PAEA 2JE5A 3WS1A 1NJ4A 3VP3A 1KDWA 2P74A 1DY6A 3CG5A 4DKIA 3FZCA 3LEZA 4LCMA 4PM7A 4N92A 3LY3A 1IELA 2B5RA 4S2KA 3OCNA 3O3VA 3S22A 3HLWA 2Y2IA 3M6BA 2WK0A 3MZDA 1RCJA 1K4EA 2XGNA 4BD1A 2EX2A 3ISGA 4OPYA 1XA7A 2PU2A 3QNBA 3HL9A 5TGFA 1GHPA 1K57C 1YLYA 3FWLA 1LLBA 5EOEA 5IHVA 1L0DA 1PZPA 1MWTA 1HZOA 2A3UA 3IHAA 5DTKA 4Y0TA 4OP5A 3VSKA 4EBLA 4BJPA 1NYYA 5F82A 1W8QA 4GD8A 3G30A 1BULA 1DJAA 1C3BA 4OLDA 1MWSA 1JVJA 2WKHA 4UA7A 2H0TA 1I2SA 4UHUA 3PBSA 5FASA 2A49A 3SS5A 1BSGA 4X6TA 2Y91A 3WS4A 4R4SA 1CI8A 3WS2A 3BEBA 1TDLA 5CGXA 5DTTA 4KZ9A 1FCOA 1LI0A 3BFDA 4FD8A 2WGVA 3OC2A 1KVMA 3W8KA 1IYPA 3ZG9B 1XGIA 4IEDA 3BLMA 1L0FA 4KG6A 3IF6B 4B88A 3A3IA 2P9VA 3MZEA 4BL2A 1ALQA 5HW3A 4FSFA 1YLZA 2P9VB 4XXRA 5CHUA 3W4OA 3BRMA 4S2NA 4RX2A 3NDEA 3VP2A 3NY4A 3AGDA 4WZ5A 5FQ9A 3UDIA 3N7WA 4IVKA 4WYYA 1ERQA 4KQRA 3NCKA 3PTEA 2JC7A 5CHMA 3IF5A 1BZAA 3PBQA 5FAQA 4LENA 3ZGAB 2J9PA 4MBKA 4GB7A 1FR1A 3ZHHA 3O86A 2X02A 1TDGA 1FSYA 4DRTA 4X55A 2R9WA 3N4IA 3P09A 4OOMA 4A5RA 5CGSA 1O7EA 1DJCA 1ZG6A 4LV0A 1Y54A 4N1XA 3SH7A 2WGWB 4IBRA 3ZG0A 4NK3A 4ZJ3A 4F94A 2XFSA 3A3DA 1YMSA 3UO9A 1FOFA 3UY6A 2Y2MA 4LCLA 3IWIA 1ESIA 4K91A 1H8ZA 4S2PA 1ES2A 2ZQ9A 4RYEA 5FAPA 1KGFA 4JF6A 5HX9A 3UE1A 3VP0A 1K57A 4BQMA 4ZTKA 4JKTA 1FSWA 1YLTA 3E2KA 3IXBA 4WM9A 4DE0A 4JLFA 3C4PA 3IF6A 4E3IA 1GA9A 3OPHA 2RL3A 4HESA 2XQZA 1E3UA 4DE1A 4U0XA 3BM6A 5FSRA 4PM8A 1PWDA 3UPPA 4KZ6A 1PI5A 3TG9A 5KSCA 5FATA 3QNCA 2EXAA 1CK3A 3ITAA 1L0GA 4BL3A 2ZQCA 3LO7A 4QU3A 2ZD8A 1QMEA 2DNSA 4C75A 1EI5A 4CPKA 4OVDA 4XUZA 4MBHA 4M3KA 5EPHA 1MWRA 1N9BA 2X71A 4WEKA 1PIOA 3NIAA 1MWUA 5M19A 2WGIA 4JBFA 3HLEA 4KZ8A 2X01A 5A92A 2ZQ8A 4KQQA 3UNWA 5AQ7A 2Q9NA 1RP5A 4NETA 3MFDA 4OPZA 4QD4A 5M1AA 3VOYA 4DXBA 3UPNA 1XX2A 2XDMA 2J7VA 1BLCA 3NI9A 4RA7A 1TEMA 2EFUA 4R23A 3GSGA 3VSLA 5GLDA 4HEFA 4DE3A 3E2LA 5FQKA 3HUOA 3WS0A 3RJUA 4R0QA 3ZG5A 2WKEA 2UWXA 4UA6A 3IXHA 1WYBA 3BFCA 2JBFA 1PWCA
chains in the Genus database with same CATH superfamily
2W3DA 4L0LA 3WRTA 4ZJ1A 3M2JA 5FQQA 3T1XA 3QP8A 2HP9A 5AVEA 4Y17A 3IH8A 2V20A 5L2FA 3V50A 1OJGA 4G3KA 2M7VA 2ZQ7A 4F3LB 2VZWA 1MPLA 3JVVA 3V39A 2ZM0A 2VGJA 3KYZA 3N6IA 3UDFA 2JKRI 3TE8A 2Y79A 2EFXA 1QMFA 1KE0A 5M18A 4JF4A 4DJ2A 2J8YA 2L4RA 3FC7A 1MKIA 4ZRRA 1IKIA 4MMNA 5EOOA 4LV3A 3LR5A 1BLHA 4JXSA 1TF1A 2ZMAA 2Z2LB 1GSXA 2P7JA 4MBFA 4MLLA 2EX8A 2V2FF 5HFOA 4JF5A 4RVAA 4XT2A 3GQZA 4YFMA 2JKGA 4H8RA 4HJ6A 5FL3A 4R1GA 3DWZA 5E43A 1W5DA 2EWWA 2Y2JA 4U0TA 3CJMA 1UGUA 3PBNA 4BMWA 2J80A 3T4KA 2WKRA 2Z2MB 5EM1A 4CLCC 3AGEA 1G28A 4II7A 3VP1A 2GDNA 4ME4A 1Y28A 1YLWA 2ZMFA 3ZG8B 5U47A 2QJ7A 3D72A 5GLAA 3MZFA 1NWZA 1IKGA 1T1CA 1CF0A 4D2OA 3BQ8A 2OLVA 4C3QA 1XFQA 2OSUA 3PBRA 5EM0A 5CGWA 4IVIA 1A0KA 3LGOA 1D7EA 3HBRA 3S4XA 3GECA 3UB6A 4Y7PA 2IWDA 1K25A 1YMXA 2VGKA 4Q0HA 1PZOA 2ZMVA 3CZDA 3VOZA 2RCXA 4GOGA 2BTFP 3WRZA 1KVLA 5IS1A 5HPFA 2EX9A 5AQ9A 1TS0A 3OPPA 1WYBA 5EVIC 2KLIA 2Q0OA 5CXWA 5HAPA 1H5XA 2R78A 4YNRA 3CWFA 3B3XA 3KYEA 4BD0A 4K08A 3N8SA 4AFIA 4OQGA 4CQHA 1JWVA 4DF6A 2WUQA 2PHYA 3MQQA 1N9OA 4E6XA 2KOIA 3OCLA 4OLGA 5CTMA 5DF8A 1OTDA 5F1GA 4LGWA 2JN7A 2XEPA 4FH2A 5KMWA 3MQ0A 1OTBA 1PYYA 3IWOA 3BYDA 4O7DA 1L0EA 4PM6A 1CEFA 1H8YA 3N8LA 3F1PA 2OWJA 2XH9A 3C2WA 3G4PA 4B4ZA 3LIFA 3FYZA 3UPOA 3E0YA 1GHIA 2HDUA 3A3FA 2XD1A 4I39A 2HGVA 4NXFA 3GMWA 3UDXA 4PKYA 4IBXA 4Z1WA 5J4EA 2C6WB 2W0NA 1STZA 2C5WB 2W3FA 3V67A 5EVIA 2I9VA 2V8CA 3MF0A 1PI4A 4I3JA 3CLOA 3PBTA 1GA0A 2WZZA 5JYOA 1LSWA 1YPRA 1F98A 4E04A 3LY4A 1FR6A 4GS9A 5TBMA 3T1SA 3N8RA 2BG1A 5CECA 2CMNA 4KG5A 4GN2A 2KDKA 3I7JA 4OOLA 4BENA 2ZOIA 3OOVA 3D3OA 5DTSA 2INWA 5CTNA 2JKFA 4BBUA 2QMIA 4PMAA 3HLGA 4S2NC 4Y2FA 1EROA 2KX6A 3PAEA 4H6JB 4JGOA 1DY6A 4DKIA 4PM7A 3LY3A 1TD5A 3O3VA 3MMHA 3HLWA 3B42A 2K2NA 4PHTA 3P7NA 3HL9A 3QP5A 3CI6A 4GS9B 5TBMB 3FWLA 1LLBA 3A0RA 5EOEA 1L0DA 1HZOA 5DTKA 4OP5A 4EBLA 4OLDA 4HHDA 4ESPA 1BSGA 1F2KA 1TDLA 5CGXA 4KZ9A 1FCOA 1LI0A 3PR6A 4NXGA 1IYPA 1XGIA 4KG6A 3IF6B 1UWNX 4KQDA 1F9IA 1ALQA 2P9VB 1OJ5A 3F1PB 3UB9A 5CHUA 3BRMA 4S2NA 3NDEA 2JHEA 3LYXA 3NY4A 4WZ5A 4WYYA 3PBQA 2X02A 1TDGA 1FSYA 1OT9A 4DRTA 3P09A 4OOMA 4HP4A 1DJCA 3LR3A 3A3DA 1YMSA 1FOFA 3UY6A 2Y2MA 1ESIA 3QP2A 3DTIA 1H8ZA 4S2PA 5FAPA 3VP0A 4JF6A 1K57A 4NG2A 3C4PA 5HD3A 4HESA 1P97A 4Q0IA 4IUHA 5L07A 4KZ6A 4R70A 1MZUA 3MS6A 3UB5P 3DTEA 1CK3A 3ITAA 1L0GA 2ZD8A 4C75A 4KUOA 1EI5A 3QP1A 4R38A 3T4QA 1N9BA 3E4PA 1MWUA 4KZ8A 1MC0A 3LIDA 4OPZA 4QD4A 5GLDA 2O9CA 3E2LA 3NOUC 2Z6CA 3ZG5A 5AJGA 2HDSA 5CRFA 1G6AA 3ZG7B 3OPRA 4QPRA 4HBTA 1ODVA 3EQUA 3LIEA 4ARZB 4K0XA 3MXRA 5HAIA 5C5KA 4X69A 2XF3A 1NYMA 2DRWA 4Y5FA 1JWZA 2WKPA 2ZL1B 2I72A 1ZG4A 3G6OA 5F68A 4R3JA 3TJZC 3MR0A 4E6WA 5K5BA 5E2FA 3DTMA 5A90A 1IOUA 4WLAA 3EQVA 3LIBA 2HDQA 1LI9A 1U60A 2Q9MA 3MXSA 3K2NA 4I3IA 4ID4A 5CEBA 4GLQA 4DMZA 1ZC2A 2Y2PA 2PAVP 4WZ4A 3BFEA 3QHYA 3ZCZA 3HUMA 1OT6A 2XA7S 4OQ0A 2VK3A 5FI2A 1S0WA 4EBNA 3C4OA 3H82A 4R3BA 3PAGA 2Y2OA 4YINA 5EVID 2H5SA 2V1AA 4QB8A 3SH8A 3K3DA 4MN5A 4EETB 2HPBA 2PBYA 3Q7ZA 3V3SA 1SDNA 4QHCA 3CUEA 2HDRA 2VGLS 1VM1A 2Y2GA 3Q07A 2H10A 5HDCA 1K56A 1PWGA 1HLUP 3UN7A 4DDYA 1ZTUA 2A2LA 4BBTA 2A24B 3D9YA 3MQOA 1K54C 5FA7A 1PW8A 3RH8B 3T1RA 5I94A 1G6OA 1K54A 3HLBA 2EXBA 5EECA 5IU1A 3UMEA 2PDRA 4S2LA 1PNEA 3VE3A 2WGWA 4O01A 3V5MA 2PD7A 1CEGA 5HD5A 5LBRA 1F5MA 4WN5A 5GHYA 4PM9A 3UE0A 1XKZA 1L3LA 2Y2HA 2LB5A 3SS3A 5FAOA 3GV9A 3VOLA 4FH4A 3IX8A 4Y15A 1GSWA 5E2EA 3RXXA 2HJ9C 3HLCA 3O87A 4Z9QA 4KG2A 3MFXA 2V9AA 3SOIA 2MJ6A 5CHJA 3D4FA 4ZAMA 3TOIA 2VLGA 3G2ZA 4P0MA 1ONHA 3FPVA 4E3KA 3DW0A 4QY6A 1JNUA 2ZQDA 3V3RA 4CLCD 4Q0JA 3LFVA 1H0MA 2HJEA 3IXGA 3IF6C 4LV1A 3T4OA 1K0KA 5F69A 4EQIA 3A0SA 3M2KA 4EERA 4OPQA 1NZOA 3IS2B 5GHXA 1Y4OA 3GTCA 4HH2A 4UEYA 5FQIA 5GLBA 2EX6A 4ZJ2A 2O99A 3KYQA 3C5AA 3PYPA 4Y0OA 2IWBA 4JXGA 5EUAA 3Q7VB 3T4TA 1IYOA 1PRQA 4XUXA 2Y8HA 3UO9A 1YLPA 1LL5A 1N9LA 5FQMA 5EVLA 5HL1A 2NUTC 3E98A 4MDZA 4OP8A 2Y4AA 2WYXA 3ZVTA 3IHBA 3NOTC 3Q81A 3TW8A 2H28A 3IWQA 3MKFA 1IEMA 4KZ7A 3G31A 4S2JA 2JKRM 4EWFA 5I5LA 4DDSA 2XA7M 1KE3A 3NBLA 3IBJA 1G68A 4S2MA 4KZAA 3IQAA 2ZC3B 4KZ3A 1GCEA 3VMAA 3EWKA 5EE8A 2OV5A 3NJAA 4WZ5C 1XGJA 4OH0A 4EBPA 5FI7A 3UE3A 3SW1A 1WYCA 3CHWP 4JGRA 3EGDC 4UQIS 2BLSA 3C7VA 1FCNA 4R3AA 5DF7A 4HY8A 5EVEA 3VP3A 2P74A 3T1QB 3FZCA 1IELA 3NOPC 3K3CA 3BW6A 1TS7A 1K4EA 4EXOA 3ISGA 2K7SA 1H8MA 3F1NB 4BJPA 3OLOA 3BY8A 4GHIA 1DJAA 1XJ2A 2H0TA 1I2SA 4HQAA 4B9OA 5FASA 2A49A 3SS5A 3DAVA 4DN0A 1CI8A 2P08A 3BEBA 4ETZA 4FD8A 2WGVA 4P6ZS 4IEDA 1L0FA 2QYBA 3C30A 3MZEA 4BL2A 4FSFA 4EESA 2HZ5A 3R4KA 2EA9A 3VP2A 3LIAA 3AGDA 3N7WA 4IVKA 2M7UA 1ERQA 4KQRA 3NCKA 1DP6A 1PFLA 2JC7A 3VE4A 2YKFA 4LENA 2PYPA 4MBKA 4FOFA 4PKYG 3N4IA 1S4SA 4A5RA 5CGSA 4HIAA 3SH7A 4N1XA 1Y54A 4LRXC 2WGWB 1P9WA 4ZJ3A 3IX4A 3IWIA 1J3WA 1CQAA 1ES2A 3UE1A 1SKOA 3IXBA 1YLTA 3E2KA 4WM9A 4E3IA 1GA9A 5FSRA 1PWDA 1PI5A 2EXAA 2IA2A 3LUQA 4QU3A 5EPHA 1MWRA 2X71A 4WUJA 3NIAA 5M19A 2WGIA 4JBFA 5A92A 2Q9NA 3L9KA 3MFDA 3BJNA 5M1AA 3VOYA 3KO6A 3QP4A 3UPNA 3U2AA 1XX2A 4NXEA 4RA7A 3VSLA 2EWVA 4HEFA 4DE3A 5FQKA 3WS0A 4CLCB 4D60A 4R0QA 2WKEA 4RQ9A 3BFCA 2JBFA 5L09A 1W79A 2D01A 3NECA 4EUVA 3WS5A 1SCWA 3VFFA 2Y2QA 1D1JA 4FUWA 4EUZA 4YOFA 5L10A 4KQOA 3JPUA 5FDHA 3ZNTA 3F1NA 1MBLA 5HAQA 3JYIA 3ZYTA 2ZOHA 3M6HA 5DKLA 3IT9A 4MCWA 5HWTA 2V1ZA 2WZXA 4P6BA 4PM5A 1T18A 3NHQA 3T50A 4HOIA 5CERA 4JXVA 5F6AA 2WKQA 5A91A 1SDEA 2PU4A 5EV0A 3IBRA 4R6LA 5F5YA 4GNUA 4ZBEA 2J3TC 3S1YA 2G2UA 2D02A 3BFGA 3IXDA 2BASA 4ETXA 1I5QA 4MNRA 2OAP1 1XXMA 1LL8A 1V9ZA 3O5YA 4PPRA 1K56D 3G2YA 3LR0A 1JWPA 4CLCE 5BOHA 2ZC4B 5L8MA 4GD6A 2L1MA 2PD8A 4LRZE 3UMDA 2VV6A 2AVXA 1AXBA 1VEUB 1RGZA 4X53A 1K6RA 4CJNA 2W3EA 4MN7A 4JGPA 1AWIA 1M40A 4DJ3A 3ITBA 4CLCA 3F1OA 3G35A 1WA9A 4S2OA 1YSQA 4GDNA 1XJ3A 3ULFA 2O0YA 3DWKA 5F83A 4L9GA 4WELA 2WAFA 4LRYC 4OOYA 4KZ5A 1BUEA 4KENB 4KZBA 3A3JA 3UE6A 4K0WA 5DJUA 2HP6A 1ZKJA 2VV7A 1KGEA 4KUKA 3LICA 1DJBA 3LI8A 4H6JA 2W3HA 2WAEA 3S7PA 2QJ5A 2XRNA 4OONA 1Z09A 2A24A 4I3AA 1Q2QA 4WF0A 3MXQA 4BWIA 2GX5A 3C7UA 4M4XA 1YKDA 3WWXA 2ACGA 3OZHA 4GCZA 2JKTI 5E2HA 1TVFA 1BLSA 3ZFZA 1IYSA 2E8IA 2QHKA 2VKSA 1SKFA 1XPBA 2CC1A 2ZJ9A 1JTGA 3RTYA 1EW0A 4OQHA 2FFYA 5AQAA 1VETA 5KSHA 3JVUA 4UAAA 1XJ6A 5DVAA 1S66L 4GKUA 4DXCA 2ZLYA 5G4ZA 3MBZA 1W63Q 5HSQA 3CAXA 3UB8A 1NXYA 3H9WA 3SH9A 1IFQA 2B18A 5HZHA 3KSIA 2PYRA 1SZVA 3DBAA 3G32A 4N1HA 5FI6A 1YAXA 1K55C 2Y55A 4HJ3A 1BT5A 1ESUA 4E3MA 4YWZA 4KZ4A 1S1YA 2NUPC 4QY5A 1SHVA 3CMZA 4L9EA 3GDIA 4C6YA 4X1LA 3RXWA 1LHYA 2DCFA 2VJWA 4MN6A 4HBUA 1X0OA 4HH3A 2GJ3A 4GDBA 4G3WA 4NEED 3TRCA 1DP9A 4B93A 5A93A 3ZDJA 3HJKA 2OAQ1 1CI9A 4BLMA 2XFTA 1E3UD 5HL6A 2OOLA 5EVIB 4Q8IA 5FEFA 2V0UA 1FILA 1WE4A 3T4JA 4HNBA 3VV4A 1P0ZA 4E3OA 1M6KA 2YKHA 2FFFB 2V1BA 1ES4A 2IWCA 5TR7A 1RGYA 1J9MA 2JE5A 3WS1A 1NJ4A 3CG5A 4N92A 4S2KA 3OCNA 3S22A 2Y2IA 4EU0A 2WK0A 3MZDA 2XGNA 2EX2A 4OPYA 1XA7A 3EOIA 2PU2A 3QNBA 1GHPA 1K57C 1S1ZA 4NKPA 5IHVA 2A3UA 1MWTA 4JGQA 3H82B 1W8QA 1W63M 2GZAA 1C3BA 1MWSA 2WKHA 4UA7A 2V8FA 1N9NA 4X6TA 5EFWA 2Y91A 3F1OB 3WS2A 3MJQA 5DTTA 2PR6A 3BFDA 4IUKA 2HF6A 3OC2A 1KVMA 3W8KA 1H3QA 3ZG9B 3ICYA 3BLMA 4NXBA 4B88A 2P9VA 3LEQA 3IX3A 1LSXA 3W4OA 4RX2A 3S7OA 2FZ0A 3UDIA 5J3WA 3PTEA 5CHMA 3A0VA 5FAQA 3ZHHA 2XSSA 2R9WA 5DJTA 5FDSA 3ZG0A 4NK3A 4F94A 5IT5A 4LCLA 1VETB 5HX9A 3FG8A 4EW7A 4BQMA 4ZTKA 2XQZA 1KOUA 4U0XA 3EGXC 5A8BA 5KSCA 3BY9A 3HJIA 2J3TD 5FEGA 3R7WB 1QMEA 4CPKA 5DKKA 4MBHA 2QKPA 4M3KA 3S7QA 4LLOB 5HWWA 1PIOA 3HLEA 2X01A 1DRMA 2ZQ8A 4KQQA 2VV8A 3UNWA 1RP5A 2FH5A 4IJGA 2PRFA 4DXBA 3UB7A 3R7WA 3RFBA 2EFUA 4R23A 5TJJA 3GSGA 3HUOA 4GJ4A 2PT7A 2UWXA 4UA6A 5DFXA 2H0YA 1NZUA 1PWCA 3KX0X 1MXOA 4E3JA 1KE4A 5GL9A 1FCMA 2ZL1A 2B02A 4JXWA 3U4LP 2Y59A 3HCYA 1K38A 5MC7A 1ERMA 3CUEC 1CJFA 5F1FA 4WMCD 1OTAA 4X25A 5AQBA 4PAUA 1ES5A 3ZVWA 4UQIM 3SS4A 3P98A 3LI9A 2ZM2A 4JPMA 3W2ZA 3W4PA 4X56A 3OBFA 3KSHA 2VA0A 3TSGA 1ES3A 3W4QA 2Y2NA 4OPRA 4Y13A 1XFNA 2E8JA 1P9RA 1NLYA 4L9FA 4O0PA 4Y0UA 1OMEA 1I2WA 1OPXA 4QWOA 3FKVA 5HARA 4QJGA 3GR2A 2XLNA 1YSPA 2G2WA 4G3VA 1BYWA 3Q7VA 3HREA 2PR5A 1T1BA 3PHYA 2VGLM 3HVFA 3T12B 2QZ6A 2ZM8A 1VQQA 2OLUA 3CPTA 4LV2A 1HD8A 2W1RA 1Z6FA 4R4RA 1XP4A 4I5SA 4GZBA 2ZQAA 5J7EA 4F3LA 1T1AA 5HWVA 1LSVA 4WBGA 1Q2PA 4IHQA 4EV4A 2WKIA 1N4OA 1DP8A 1YT4A 1BTLA 3SZTA 3EEAA 4ZDXA 3NDGA 1D06A 1IYQA 4WMCA 3BFFA 3FV7A 3EEHA 4I38A 4UA9A 2QWSA 2W3GA 2PBDP 4P85A 4Y3IA 5E2GA 1FQGA 3ZQ5A 2Y2LA 3Q82A 5D3OA 1XJ4A 1YQSA 2QPNA 4ARZA 4N9KA 3NULA 1MKMA 2JKTM 2Y2KA 5KZHA 2XROA 3A3EA 3DTKA 1TS8A 2VX8A 1JTDA 1E4DA 3VFHA 3PBOA 4B4XA 3VP4A 3MKEA 1XA1A 4MEZA 2ZC6B 1YLJA 3NC8A 3AGFA 4RX3A 1S6RA 2XR0A 3E4OA 2XD5A 3BLSA 3T4LA 5J8XA 5FQJA 5KIZA 4HI4A 4X1MA 3LCEA 3BQAA 2M1CA 3G34A 3HLFA 2K31A 3GRJA 3OPLA 1KDSA 3PXPA 2ZC5B 3ZNYA 5CEDA 1HTZA 4N9LA 1K4FA 5HDDA 3HUNA 1L2SA 2XK1A 2V0WA 1W8YA 3S7NA 1FIKA 5G18A 3IH9A 3E4QA 1E25A 1K6SA 1ONGA 4DE2A 1LT0A 1GHMA 4OKPA 3IS2A 1T19A 1ACFA 3HLDA 2O9BA 1S67L 1O07A 2ZC7A 1NRFA 4E3LA 2GNXA 3FKWA 5HPIA 1LL9A 5G4YA 4P87A 3Q1FA 5TFQA 1ZHHB 3H7WB 3O88A 1BLPA 4WEJA 1NY0A 2R9XA 3BECA 1K55A 1MY8A 5DF9A 4FTXA 2JCHA 1SKOB 1EWZA 4FCFA 2J9OA 2ZBBA 3L7HA 4EQ1A 3C38A 1HVBA 4XT2B 5JYPA 4O8GA 2G7UA 1PW1A 2WADA 1G5UA 4X68A 3P01A 4U3TA 4S2IA 4E3NA 1W7FA 2HP5A 2J3WA 4OQIA 2UV0E 1KGGA 4WL9A 5GHZA 3GVBA 2HV1A 2DMWA 5GLCA 3T4SA 1KDWA 2VEAA 3LEZA 4LCMA 2B5RA 2O9AA 4EEPA 4GW9A 3M6BA 1RCJA 4BD1A 3FPWA 5TGFA 1NLZA 2LB9A 1YLYA 1PZPA 3QP6A 3IHAA 4Y0TA 3VSKA 4GHIB 1NYYA 5F82A 4GD8A 3C8CA 3G30A 3H7WA 1BULA 1JVJA 4UHUA 3PBSA 5CX7A 3WS4A 4R4SA 4HP9A 1V9YA 3CPTB 3LR4A 3A3IA 1S4RA 2W1TA 1UWPX 2B95A 3MSHA 5HW3A 1YLZA 4XXRA 1OTEA 3B47A 5FQ9A 3B33A 3IF5A 1BZAA 3ZGAB 2J9PA 4GB7A 1FR1A 3O86A 5HDSA 5DFYA 2W27A 4X55A 2OWHA 1O7EA 1ZG6A 4LV0A 5AVFA 3CITA 4IBRA 2XFSA 4HJ4A 2Z6DA 1GSVA 4K91A 2ZQ9A 4RYEA 1KGFA 1VEUA 1VHMA 1FSWA 4JKTA 4DE0A 4JLFA 3IF6A 3OPHA 2RL3A 1E3UA 4DE1A 3BM6A 4PM8A 3UPPA 3TG9A 3KSFA 5FATA 1NRJA 3QNCA 4BL3A 2ZQCA 3LO7A 2DNSA 4OVDA 4XUZA 4LPZA 3KSGA 4WEKA 1OTIA 4EEUA 4LFUA 5AQ7A 4NETA 1VB6A 4P6ZM 2XDMA 2W1TB 2J7VA 1BLCA 3NI9A 1TEMA 1TS6A 2L0WA 3RJUA 4BBVA 3BWLA 3IXHA 1YM1A 2P04A
chains in the Genus database with same CATH topology
2HDSA 5CRFA 1G6AA 4L0LA 1MXOA 1W79A 3ZG7B 3WRTA 4E3JA 1KE4A 5GL9A 3M2JA 4ZJ1A 1FCMA 5FQQA 3OPRA 2HP9A 4HBTA 1SCWA 3VFFA 2Y2QA 3WS5A 4EUZA 3EQUA 3IH8A 4K0XA 2V20A 3MXRA 4KQOA 5L2FA 5HAIA 4JXWA 3V50A 4X69A 2XF3A 2Y59A 5FDHA 1NYMA 3ZNTA 1K38A 1ERMA 2DRWA 5F1FA 1JWZA 1MBLA 5HAQA 3JYIA 2ZQ7A 4WMCD 2I72A 1ZG4A 1MPLA 5AQBA 4R3JA 3M6HA 3IT9A 3V39A 1ES5A 2ZM0A 2VGJA 3N6IA 3ZVWA 3UDFA 4E6WA 2V1ZA 2WZXA 4P6BA 3P98A 5E2FA 2EFXA 3SS4A 1QMFA 1KE0A 3DTMA 4PM5A 5M18A 2ZM2A 5A90A 4JF4A 4JPMA 3EQVA 2J8YA 2HDQA 3W4PA 4X56A 5CERA 1MKIA 1LI9A 1IKIA 1U60A 4JXVA 2Q9MA 3TSGA 1ES3A 3W4QA 5EOOA 3MXSA 2Y2NA 4LV3A 4OPRA 5A91A 1SDEA 2PU4A 4ID4A 5CEBA 1ZC2A 1BLHA 2Y2PA 4GNUA 4Y0UA 4ZBEA 3S1YA 2G2UA 3BFGA 3IXDA 4WZ4A 3BFEA 3QHYA 1OMEA 1I2WA 3ZCZA 4JXSA 1I5QA 4MNRA 3HUMA 2ZMAA 1XXMA 3FKVA 4PPRA 1K56D 2Z2LB 3G2YA 4MBFA 4MLLA 1JWPA 4OQ0A 2EX8A 3GR2A 5HARA 4QJGA 5BOHA 5FI2A 2XLNA 2V2FF 1S0WA 2G2WA 3C4OA 4EBNA 5HFOA 2ZC4B 4JF5A 4RVAA 3GQZA 4GD6A 4YFMA 4R3BA 3PAGA 2Y2OA 3Q7VA 4YINA 5EVID 4H8RA 2H5SA 1AXBA 3HREA 1RGZA 4X53A 4QB8A 3SH8A 1K6RA 4R1GA 3DWZA 5E43A 4CJNA 2HPBA 1W5DA 3HVFA 2Y2JA 2PBYA 4U0TA 2QZ6A 3Q7ZA 2ZM8A 3CJMA 3PBNA 1VQQA 2OLUA 4LV2A 1HD8A 1Z6FA 4R4RA 1M40A 1XP4A 3V3SA 3ITBA 1SDNA 4GZBA 4QHCA 2Z2MB 2ZQAA 2HDRA 3G35A 3AGEA 1VM1A 2Y2GA 3Q07A 3VP1A 2H10A 4S2OA 2GDNA 1K56A 1YM1A 4GDNA 1PWGA 4WBGA 3UN7A 4DDYA 1YLWA 1Q2PA 4EV4A 2WKIA 3DWKA 3ZG8B 1N4OA 5F83A 5U47A 1YT4A 4WELA 5GLAA 1BTLA 2WAFA 3MZFA 1K54C 5FA7A 1PW8A 1IKGA 4ZDXA 5I94A 4OOYA 4KZ5A 3NDGA 4D2OA 1BUEA 4KENB 1K54A 4KZBA 3A3JA 4K0WA 1IYQA 3HLBA 2EXBA 4WMCA 5EECA 3BFFA 2HP6A 2OLVA 3FV7A 1ZKJA 4UA9A 4S2LA 4C3QA 2OSUA 2WGWA 1KGEA 3PBRA 3V5MA 1CEGA 4IVIA 5CGWA 4P85A 3HBRA 3S4XA 1DJBA 5GHYA 4PM9A 3UE0A 5E2GA 1XKZA 4Y7PA 1FQGA 2IWDA 2WAEA 1K25A 2Y2HA 2Y2LA 1YMXA 3Q82A 2VGKA 5D3OA 3SS3A 1PZOA 3CZDA 4OONA 3GV9A 5FAOA 1YQSA 3VOZA 2RCXA 4GOGA 2QPNA 1Q2QA 4FH4A 4N9KA 2Y2KA 5E2EA 1NZUA 3RXXA 5KZHA 3WRZA 3C7UA 3A3EA 1KVLA 3WWXA 3HLCA 3O87A 4Z9QA 3OZHA 4KG2A 2EX9A 1JTDA 1E4DA 5AQ9A 3VFHA 3SOIA 3OPPA 5E2HA 5EVIC 5CXWA 3PBOA 1TVFA 5CHJA 4B4XA 1BLSA 3ZFZA 3D4FA 3VP4A 5HAPA 3MKEA 1IYSA 2E8IA 4ZAMA 3TOIA 1H5XA 1SKFA 1XPBA 2CC1A 3G2ZA 4P0MA 1ONHA 1XA1A 4E3KA 2ZJ9A 1JTGA 3DW0A 4QY6A 4MEZA 2ZC6B 3B3XA 2ZQDA 4BD0A 1YLJA 3NC8A 3AGFA 3V3RA 4RX3A 1S6RA 2XR0A 4OQHA 2FFYA 5AQAA 2XD5A 3BLSA 3N8SA 5KSHA 5J8XA 5FQJA 4UAAA 4OQGA 3IXGA 1JWVA 3IF6C 4DF6A 3LCEA 2WUQA 5DVAA 3G34A 3HLFA 4GKUA 4LV1A 3GRJA 4DXCA 4E6XA 3OPLA 1KDSA 2ZLYA 3OCLA 2ZC5B 3MBZA 3ZNYA 5CEDA 1HTZA 4N9LA 1K4FA 1NXYA 4OLGA 5CTMA 5DF8A 5F1GA 4EQIA 3SH9A 2H0YA 3M2KA 4OPQA 2XEPA 3HUNA 4FH2A 1L2SA 2XK1A 5KMWA 1NZOA 1PYYA 3IWOA 3BYDA 4O7DA 5GHXA 1L0EA 4N1HA 3G32A 3GTCA 4PM6A 5FI6A 1W8YA 1CEFA 1H8YA 1K55C 3N8LA 2Y55A 5FQIA 5GLBA 2XH9A 2EX6A 5G18A 3IH9A 4ZJ2A 1BT5A 1ESUA 3C5AA 4E3MA 1E25A 1K6SA 1ONGA 3G4PA 4B4ZA 4DE2A 4KZ4A 4Y0OA 2IWBA 1GHMA 4JXGA 4OKPA 5EUAA 4QY5A 3FYZA 3Q7VB 1SHVA 3UPOA 3HLDA 1IYOA 3CMZA 1O07A 2ZC7A 1GHIA 1NRFA 1YLPA 1LL5A 2HDUA 3A3FA 2XD1A 4XUXA 5FQMA 4C6YA 4E3LA 5EVLA 5HL1A 3GMWA 3FKWA 3RXWA 3UDXA 4IBXA 1LHYA 1LL9A 2DCFA 4OP8A 2Y4AA 2C6WB 2WYXA 4HBUA 3ZVTA 4P87A 3IHBA 3Q1FA 4GDBA 5TFQA 2C5WB 3Q81A 3O88A 5EVIA 3IWQA 3MKFA 1BLPA 1IEMA 4WEJA 1NY0A 4KZ7A 5A93A 2R9XA 1PI4A 3BECA 3ZDJA 1K55A 1MY8A 5DF9A 3G31A 3PBTA 1CI9A 1GA0A 2WZZA 4S2JA 4BLMA 4EWFA 5JYOA 4DDSA 2XFTA 1KE3A 3NBLA 2JCHA 1E3UD 1G68A 3LY4A 1EWZA 1FR6A 4FCFA 4S2MA 4KZAA 3IQAA 2J9OA 5EVIB 1HVBA 3N8RA 5JYPA 4Q8IA 1PW1A 2BG1A 2ZC3B 4KZ3A 4KG5A 5CECA 2WADA 4GN2A 3I7JA 1WE4A 1GCEA 3VMAA 5EE8A 2OV5A 4OOLA 4X68A 4BENA 4WZ5C 4U3TA 4S2IA 4E3NA 1XGJA 1W7FA 4OH0A 2HP5A 5DTSA 4EBPA 4OQIA 5CTNA 5FI7A 3UE3A 4E3OA 1M6KA 1WYCA 2FFFB 1KGGA 5GHZA 1ES4A 2IWCA 2QMIA 5TR7A 2BLSA 3GVBA 4PMAA 1RGYA 1J9MA 3C7VA 3HLGA 4S2NC 5GLCA 1FCNA 5DF7A 1EROA 3PAEA 2JE5A 3WS1A 1NJ4A 3VP3A 1KDWA 2P74A 1DY6A 3CG5A 4DKIA 3FZCA 3LEZA 4LCMA 4PM7A 4N92A 3LY3A 1IELA 2B5RA 4S2KA 3OCNA 3O3VA 3S22A 3HLWA 2Y2IA 3M6BA 2WK0A 3MZDA 1RCJA 1K4EA 2XGNA 4BD1A 2EX2A 3ISGA 4OPYA 1XA7A 2PU2A 3QNBA 3HL9A 5TGFA 1GHPA 1K57C 1YLYA 3FWLA 1LLBA 5EOEA 5IHVA 1L0DA 1PZPA 1MWTA 1HZOA 2A3UA 3IHAA 5DTKA 4Y0TA 4OP5A 3VSKA 4EBLA 4BJPA 1NYYA 5F82A 1W8QA 4GD8A 3G30A 1BULA 1DJAA 1C3BA 4OLDA 1MWSA 1JVJA 2WKHA 4UA7A 2H0TA 1I2SA 4UHUA 3PBSA 5FASA 2A49A 3SS5A 1BSGA 4X6TA 2Y91A 3WS4A 4R4SA 1CI8A 3WS2A 3BEBA 1TDLA 5CGXA 5DTTA 4KZ9A 1FCOA 1LI0A 3BFDA 4FD8A 2WGVA 3OC2A 1KVMA 3W8KA 1IYPA 3ZG9B 1XGIA 4IEDA 3BLMA 1L0FA 4KG6A 3IF6B 4B88A 3A3IA 2P9VA 3MZEA 4BL2A 1ALQA 5HW3A 4FSFA 1YLZA 2P9VB 4XXRA 5CHUA 3W4OA 3BRMA 4S2NA 4RX2A 3NDEA 3VP2A 3NY4A 3AGDA 4WZ5A 5FQ9A 3UDIA 3N7WA 4IVKA 4WYYA 1ERQA 4KQRA 3NCKA 3PTEA 2JC7A 5CHMA 3IF5A 1BZAA 3PBQA 5FAQA 4LENA 3ZGAB 2J9PA 4MBKA 4GB7A 1FR1A 3ZHHA 3O86A 2X02A 1TDGA 1FSYA 4DRTA 4X55A 2R9WA 3N4IA 3P09A 4OOMA 4A5RA 5CGSA 1O7EA 1DJCA 1ZG6A 4LV0A 1Y54A 4N1XA 3SH7A 2WGWB 4IBRA 3ZG0A 4NK3A 4ZJ3A 4F94A 2XFSA 3A3DA 1YMSA 3UO9A 1FOFA 3UY6A 2Y2MA 4LCLA 3IWIA 1ESIA 4K91A 1H8ZA 4S2PA 1ES2A 2ZQ9A 4RYEA 5FAPA 1KGFA 4JF6A 5HX9A 3UE1A 3VP0A 1K57A 4BQMA 4ZTKA 4JKTA 1FSWA 1YLTA 3E2KA 3IXBA 4WM9A 4DE0A 4JLFA 3C4PA 3IF6A 4E3IA 1GA9A 3OPHA 2RL3A 4HESA 2XQZA 1E3UA 4DE1A 4U0XA 3BM6A 5FSRA 4PM8A 1PWDA 3UPPA 4KZ6A 1PI5A 3TG9A 5KSCA 5FATA 3QNCA 2EXAA 1CK3A 3ITAA 1L0GA 4BL3A 2ZQCA 3LO7A 4QU3A 2ZD8A 1QMEA 2DNSA 4C75A 1EI5A 4CPKA 4OVDA 4XUZA 4MBHA 4M3KA 5EPHA 1MWRA 1N9BA 2X71A 4WEKA 1PIOA 3NIAA 1MWUA 5M19A 2WGIA 4JBFA 3HLEA 4KZ8A 2X01A 5A92A 2ZQ8A 4KQQA 3UNWA 5AQ7A 2Q9NA 1RP5A 4NETA 3MFDA 4OPZA 4QD4A 5M1AA 3VOYA 4DXBA 3UPNA 1XX2A 2XDMA 2J7VA 1BLCA 3NI9A 4RA7A 1TEMA 2EFUA 4R23A 3GSGA 3VSLA 5GLDA 4HEFA 4DE3A 3E2LA 5FQKA 3HUOA 3WS0A 3RJUA 4R0QA 3ZG5A 2WKEA 2UWXA 4UA6A 3IXHA 1WYBA 3BFCA 2JBFA 1PWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDS A;  5CRF A;  1G6A A;  4L0L A;  1MXO A;  1W79 A;  3ZG7 B;  3WRT A;  4E3J A;  1KE4 A;  5GL9 A;  3M2J A;  4ZJ1 A;  1FCM A;  5FQQ A;  3OPR A;  2HP9 A;  4HBT A;  1SCW A;  3VFF A;  2Y2Q A;  3WS5 A;  4EUZ A;  3EQU A;  3IH8 A;  4K0X A;  2V20 A;  3MXR A;  4KQO A;  5L2F A;  5HAI A;  4JXW A;  3V50 A;  4X69 A;  2XF3 A;  2Y59 A;  5FDH A;  1NYM A;  3ZNT A;  1K38 A;  1ERM A;  2DRW A;  5F1F A;  1JWZ A;  1MBL A;  5HAQ A;  3JYI A;  2ZQ7 A;  4WMC D;  2I72 A;  1ZG4 A;  1MPL A;  5AQB A;  4R3J A;  3M6H A;  3IT9 A;  3V39 A;  1ES5 A;  2ZM0 A;  2VGJ A;  3N6I A;  3ZVW A;  3UDF A;  4E6W A;  2V1Z A;  2WZX A;  4P6B A;  3P98 A;  5E2F A;  2EFX A;  3SS4 A;  1QMF A;  1KE0 A;  3DTM A;  4PM5 A;  5M18 A;  2ZM2 A;  5A90 A;  4JF4 A;  4JPM A;  3EQV A;  2J8Y A;  2HDQ A;  3W4P A;  4X56 A;  5CER A;  1MKI A;  1LI9 A;  1IKI A;  1U60 A;  4JXV A;  2Q9M A;  3TSG A;  1ES3 A;  3W4Q A;  5EOO A;  3MXS A;  2Y2N A;  4LV3 A;  4OPR A;  5A91 A;  1SDE A;  2PU4 A;  4ID4 A;  5CEB A;  1ZC2 A;  1BLH A;  2Y2P A;  4GNU A;  4Y0U A;  4ZBE A;  3S1Y A;  2G2U A;  3BFG A;  3IXD A;  4WZ4 A;  3BFE A;  3QHY A;  1OME A;  1I2W A;  3ZCZ A;  4JXS A;  1I5Q A;  4MNR A;  3HUM A;  2ZMA A;  1XXM A;  3FKV A;  4PPR A;  1K56 D;  2Z2L B;  3G2Y A;  4MBF A;  4MLL A;  1JWP A;  4OQ0 A;  2EX8 A;  3GR2 A;  5HAR A;  4QJG A;  5BOH A;  5FI2 A;  2XLN A;  2V2F F;  1S0W A;  2G2W A;  3C4O A;  4EBN A;  5HFO A;  2ZC4 B;  4JF5 A;  4RVA A;  3GQZ A;  4GD6 A;  4YFM A;  4R3B A;  3PAG A;  2Y2O A;  3Q7V A;  4YIN A;  5EVI D;  4H8R A;  2H5S A;  1AXB A;  3HRE A;  1RGZ A;  4X53 A;  4QB8 A;  3SH8 A;  1K6R A;  4R1G A;  3DWZ A;  5E43 A;  4CJN A;  2HPB A;  1W5D A;  3HVF A;  2Y2J A;  2PBY A;  4U0T A;  2QZ6 A;  3Q7Z A;  2ZM8 A;  3CJM A;  3PBN A;  1VQQ A;  2OLU A;  4LV2 A;  1HD8 A;  1Z6F A;  4R4R A;  1M40 A;  1XP4 A;  3V3S A;  3ITB A;  1SDN A;  4GZB A;  4QHC A;  2Z2M B;  2ZQA A;  2HDR A;  3G35 A;  3AGE A;  1VM1 A;  2Y2G A;  3Q07 A;  3VP1 A;  2H10 A;  4S2O A;  2GDN A;  1K56 A;  1YM1 A;  4GDN A;  1PWG A;  4WBG A;  3UN7 A;  4DDY A;  1YLW A;  1Q2P A;  4EV4 A;  2WKI A;  3DWK A;  3ZG8 B;  1N4O A;  5F83 A;  5U47 A;  1YT4 A;  4WEL A;  5GLA A;  1BTL A;  2WAF A;  3MZF A;  1K54 C;  5FA7 A;  1PW8 A;  1IKG A;  4ZDX A;  5I94 A;  4OOY A;  4KZ5 A;  3NDG A;  4D2O A;  1BUE A;  4KEN B;  1K54 A;  4KZB A;  3A3J A;  4K0W A;  1IYQ A;  3HLB A;  2EXB A;  4WMC A;  5EEC A;  3BFF A;  2HP6 A;  2OLV A;  3FV7 A;  1ZKJ A;  4UA9 A;  4S2L A;  4C3Q A;  2OSU A;  2WGW A;  1KGE A;  3PBR A;  3V5M A;  1CEG A;  4IVI A;  5CGW A;  4P85 A;  3HBR A;  3S4X A;  1DJB A;  5GHY A;  4PM9 A;  3UE0 A;  5E2G A;  1XKZ A;  4Y7P A;  1FQG A;  2IWD A;  2WAE A;  1K25 A;  2Y2H A;  2Y2L A;  1YMX A;  3Q82 A;  2VGK A;  5D3O A;  3SS3 A;  1PZO A;  3CZD A;  4OON A;  3GV9 A;  5FAO A;  1YQS A;  3VOZ A;  2RCX A;  4GOG A;  2QPN A;  1Q2Q A;  4FH4 A;  4N9K A;  2Y2K A;  5E2E A;  1NZU A;  3RXX A;  5KZH A;  3WRZ A;  3C7U A;  3A3E A;  1KVL A;  3WWX A;  3HLC A;  3O87 A;  4Z9Q A;  3OZH A;  4KG2 A;  2EX9 A;  1JTD A;  1E4D A;  5AQ9 A;  3VFH A;  3SOI A;  3OPP A;  5E2H A;  5EVI C;  5CXW A;  3PBO A;  1TVF A;  5CHJ A;  4B4X A;  1BLS A;  3ZFZ A;  3D4F A;  3VP4 A;  5HAP A;  3MKE A;  1IYS A;  2E8I A;  4ZAM A;  3TOI A;  1H5X A;  1SKF A;  1XPB A;  2CC1 A;  3G2Z A;  4P0M A;  1ONH A;  1XA1 A;  4E3K A;  2ZJ9 A;  1JTG A;  3DW0 A;  4QY6 A;  4MEZ A;  2ZC6 B;  3B3X A;  2ZQD A;  4BD0 A;  1YLJ A;  3NC8 A;  3AGF A;  3V3R A;  4RX3 A;  1S6R A;  2XR0 A;  4OQH A;  2FFY A;  5AQA A;  2XD5 A;  3BLS A;  3N8S A;  5KSH A;  5J8X A;  5FQJ A;  4UAA A;  4OQG A;  3IXG A;  1JWV A;  3IF6 C;  4DF6 A;  3LCE A;  2WUQ A;  5DVA A;  3G34 A;  3HLF A;  4GKU A;  4LV1 A;  3GRJ A;  4DXC A;  4E6X A;  3OPL A;  1KDS A;  2ZLY A;  3OCL A;  2ZC5 B;  3MBZ A;  3ZNY A;  5CED A;  1HTZ A;  4N9L A;  1K4F A;  1NXY A;  4OLG A;  5CTM A;  5DF8 A;  5F1G A;  4EQI A;  3SH9 A;  2H0Y A;  3M2K A;  4OPQ A;  2XEP A;  3HUN A;  4FH2 A;  1L2S A;  2XK1 A;  5KMW A;  1NZO A;  1PYY A;  3IWO A;  3BYD A;  4O7D A;  5GHX A;  1L0E A;  4N1H A;  3G32 A;  3GTC A;  4PM6 A;  5FI6 A;  1W8Y A;  1CEF A;  1H8Y A;  1K55 C;  3N8L A;  2Y55 A;  5FQI A;  5GLB A;  2XH9 A;  2EX6 A;  5G18 A;  3IH9 A;  4ZJ2 A;  1BT5 A;  1ESU A;  3C5A A;  4E3M A;  1E25 A;  1K6S A;  1ONG A;  3G4P A;  4B4Z A;  4DE2 A;  4KZ4 A;  4Y0O A;  2IWB A;  1GHM A;  4JXG A;  4OKP A;  5EUA A;  4QY5 A;  3FYZ A;  3Q7V B;  1SHV A;  3UPO A;  3HLD A;  1IYO A;  3CMZ A;  1O07 A;  2ZC7 A;  1GHI A;  1NRF A;  1YLP A;  1LL5 A;  2HDU A;  3A3F A;  2XD1 A;  4XUX A;  5FQM A;  4C6Y A;  4E3L A;  5EVL A;  5HL1 A;  3GMW A;  3FKW A;  3RXW A;  3UDX A;  4IBX A;  1LHY A;  1LL9 A;  2DCF A;  4OP8 A;  2Y4A A;  2C6W B;  2WYX A;  4HBU A;  3ZVT A;  4P87 A;  3IHB A;  3Q1F A;  4GDB A;  5TFQ A;  2C5W B;  3Q81 A;  3O88 A;  5EVI A;  3IWQ A;  3MKF A;  1BLP A;  1IEM A;  4WEJ A;  1NY0 A;  4KZ7 A;  5A93 A;  2R9X A;  1PI4 A;  3BEC A;  3ZDJ A;  1K55 A;  1MY8 A;  5DF9 A;  3G31 A;  3PBT A;  1CI9 A;  1GA0 A;  2WZZ A;  4S2J A;  4BLM A;  4EWF A;  5JYO A;  4DDS A;  2XFT A;  1KE3 A;  3NBL A;  2JCH A;  1E3U D;  1G68 A;  3LY4 A;  1EWZ A;  1FR6 A;  4FCF A;  4S2M A;  4KZA A;  3IQA A;  2J9O A;  5EVI B;  1HVB A;  3N8R A;  5JYP A;  4Q8I A;  1PW1 A;  2BG1 A;  2ZC3 B;  4KZ3 A;  4KG5 A;  5CEC A;  2WAD A;  4GN2 A;  3I7J A;  1WE4 A;  1GCE A;  3VMA A;  5EE8 A;  2OV5 A;  4OOL A;  4X68 A;  4BEN A;  4WZ5 C;  4U3T A;  4S2I A;  4E3N A;  1XGJ A;  1W7F A;  4OH0 A;  2HP5 A;  5DTS A;  4EBP A;  4OQI A;  5CTN A;  5FI7 A;  3UE3 A;  4E3O A;  1M6K A;  1WYC A;  2FFF B;  1KGG A;  5GHZ A;  1ES4 A;  2IWC A;  2QMI A;  5TR7 A;  2BLS A;  3GVB A;  4PMA A;  1RGY A;  1J9M A;  3C7V A;  3HLG A;  4S2N C;  5GLC A;  1FCN A;  5DF7 A;  1ERO A;  3PAE A;  2JE5 A;  3WS1 A;  1NJ4 A;  3VP3 A;  1KDW A;  2P74 A;  1DY6 A;  3CG5 A;  4DKI A;  3FZC A;  3LEZ A;  4LCM A;  4PM7 A;  4N92 A;  3LY3 A;  1IEL A;  2B5R A;  4S2K A;  3OCN A;  3O3V A;  3S22 A;  3HLW A;  2Y2I A;  3M6B A;  2WK0 A;  3MZD A;  1RCJ A;  1K4E A;  2XGN A;  4BD1 A;  2EX2 A;  3ISG A;  4OPY A;  1XA7 A;  2PU2 A;  3QNB A;  3HL9 A;  5TGF A;  1GHP A;  1K57 C;  1YLY A;  3FWL A;  1LLB A;  5EOE A;  5IHV A;  1L0D A;  1PZP A;  1MWT A;  1HZO A;  2A3U A;  3IHA A;  5DTK A;  4Y0T A;  4OP5 A;  3VSK A;  4EBL A;  4BJP A;  1NYY A;  5F82 A;  1W8Q A;  4GD8 A;  3G30 A;  1BUL A;  1DJA A;  1C3B A;  4OLD A;  1MWS A;  1JVJ A;  2WKH A;  4UA7 A;  2H0T A;  1I2S A;  4UHU A;  3PBS A;  5FAS A;  2A49 A;  3SS5 A;  1BSG A;  4X6T A;  2Y91 A;  3WS4 A;  4R4S A;  1CI8 A;  3WS2 A;  3BEB A;  1TDL A;  5CGX A;  5DTT A;  4KZ9 A;  1FCO A;  1LI0 A;  3BFD A;  4FD8 A;  2WGV A;  3OC2 A;  1KVM A;  3W8K A;  1IYP A;  3ZG9 B;  1XGI A;  4IED A;  3BLM A;  1L0F A;  4KG6 A;  3IF6 B;  4B88 A;  3A3I A;  2P9V A;  3MZE A;  4BL2 A;  1ALQ A;  5HW3 A;  4FSF A;  1YLZ A;  2P9V B;  4XXR A;  5CHU A;  3W4O A;  3BRM A;  4S2N A;  4RX2 A;  3NDE A;  3VP2 A;  3NY4 A;  3AGD A;  4WZ5 A;  5FQ9 A;  3UDI A;  3N7W A;  4IVK A;  4WYY A;  1ERQ A;  4KQR A;  3NCK A;  3PTE A;  2JC7 A;  5CHM A;  3IF5 A;  1BZA A;  3PBQ A;  5FAQ A;  4LEN A;  3ZGA B;  2J9P A;  4MBK A;  4GB7 A;  1FR1 A;  3ZHH A;  3O86 A;  2X02 A;  1TDG A;  1FSY A;  4DRT A;  4X55 A;  2R9W A;  3N4I A;  3P09 A;  4OOM A;  4A5R A;  5CGS A;  1O7E A;  1DJC A;  1ZG6 A;  4LV0 A;  1Y54 A;  4N1X A;  3SH7 A;  2WGW B;  4IBR A;  3ZG0 A;  4NK3 A;  4ZJ3 A;  4F94 A;  2XFS A;  3A3D A;  1YMS A;  3UO9 A;  1FOF A;  3UY6 A;  2Y2M A;  4LCL A;  3IWI A;  1ESI A;  4K91 A;  1H8Z A;  4S2P A;  1ES2 A;  2ZQ9 A;  4RYE A;  5FAP A;  1KGF A;  4JF6 A;  5HX9 A;  3UE1 A;  3VP0 A;  1K57 A;  4BQM A;  4ZTK A;  4JKT A;  1FSW A;  1YLT A;  3E2K A;  3IXB A;  4WM9 A;  4DE0 A;  4JLF A;  3C4P A;  3IF6 A;  4E3I A;  1GA9 A;  3OPH A;  2RL3 A;  4HES A;  2XQZ A;  1E3U A;  4DE1 A;  4U0X A;  3BM6 A;  5FSR A;  4PM8 A;  1PWD A;  3UPP A;  4KZ6 A;  1PI5 A;  3TG9 A;  5KSC A;  5FAT A;  3QNC A;  2EXA A;  1CK3 A;  3ITA A;  1L0G A;  4BL3 A;  2ZQC A;  3LO7 A;  4QU3 A;  2ZD8 A;  1QME A;  2DNS A;  4C75 A;  1EI5 A;  4CPK A;  4OVD A;  4XUZ A;  4MBH A;  4M3K A;  5EPH A;  1MWR A;  1N9B A;  2X71 A;  4WEK A;  1PIO A;  3NIA A;  1MWU A;  5M19 A;  2WGI A;  4JBF A;  3HLE A;  4KZ8 A;  2X01 A;  5A92 A;  2ZQ8 A;  4KQQ A;  3UNW A;  5AQ7 A;  2Q9N A;  1RP5 A;  4NET A;  3MFD A;  4OPZ A;  4QD4 A;  5M1A A;  3VOY A;  4DXB A;  3UPN A;  1XX2 A;  2XDM A;  2J7V A;  1BLC A;  3NI9 A;  4RA7 A;  1TEM A;  2EFU A;  4R23 A;  3GSG A;  3VSL A;  5GLD A;  4HEF A;  4DE3 A;  3E2L A;  5FQK A;  3HUO A;  3WS0 A;  3RJU A;  4R0Q A;  3ZG5 A;  2WKE A;  2UWX A;  4UA6 A;  3IXH A;  1WYB A;  3BFC A;  2JBF A;  1PWC A; 
#chains in the Genus database with same CATH topology
 2W3D A;  4L0L A;  3WRT A;  4ZJ1 A;  3M2J A;  5FQQ A;  3T1X A;  3QP8 A;  2HP9 A;  5AVE A;  4Y17 A;  3IH8 A;  2V20 A;  5L2F A;  3V50 A;  1OJG A;  4G3K A;  2M7V A;  2ZQ7 A;  4F3L B;  2VZW A;  1MPL A;  3JVV A;  3V39 A;  2ZM0 A;  2VGJ A;  3KYZ A;  3N6I A;  3UDF A;  2JKR I;  3TE8 A;  2Y79 A;  2EFX A;  1QMF A;  1KE0 A;  5M18 A;  4JF4 A;  4DJ2 A;  2J8Y A;  2L4R A;  3FC7 A;  1MKI A;  4ZRR A;  1IKI A;  4MMN A;  5EOO A;  4LV3 A;  3LR5 A;  1BLH A;  4JXS A;  1TF1 A;  2ZMA A;  2Z2L B;  1GSX A;  2P7J A;  4MBF A;  4MLL A;  2EX8 A;  2V2F F;  5HFO A;  4JF5 A;  4RVA A;  4XT2 A;  3GQZ A;  4YFM A;  2JKG A;  4H8R A;  4HJ6 A;  5FL3 A;  4R1G A;  3DWZ A;  5E43 A;  1W5D A;  2EWW A;  2Y2J A;  4U0T A;  3CJM A;  1UGU A;  3PBN A;  4BMW A;  2J80 A;  3T4K A;  2WKR A;  2Z2M B;  5EM1 A;  4CLC C;  3AGE A;  1G28 A;  4II7 A;  3VP1 A;  2GDN A;  4ME4 A;  1Y28 A;  1YLW A;  2ZMF A;  3ZG8 B;  5U47 A;  2QJ7 A;  3D72 A;  5GLA A;  3MZF A;  1NWZ A;  1IKG A;  1T1C A;  1CF0 A;  4D2O A;  3BQ8 A;  2OLV A;  4C3Q A;  1XFQ A;  2OSU A;  3PBR A;  5EM0 A;  5CGW A;  4IVI A;  1A0K A;  3LGO A;  1D7E A;  3HBR A;  3S4X A;  3GEC A;  3UB6 A;  4Y7P A;  2IWD A;  1K25 A;  1YMX A;  2VGK A;  4Q0H A;  1PZO A;  2ZMV A;  3CZD A;  3VOZ A;  2RCX A;  4GOG A;  2BTF P;  3WRZ A;  1KVL A;  5IS1 A;  5HPF A;  2EX9 A;  5AQ9 A;  1TS0 A;  3OPP A;  1WYB A;  5EVI C;  2KLI A;  2Q0O A;  5CXW A;  5HAP A;  1H5X A;  2R78 A;  4YNR A;  3CWF A;  3B3X A;  3KYE A;  4BD0 A;  4K08 A;  3N8S A;  4AFI A;  4OQG A;  4CQH A;  1JWV A;  4DF6 A;  2WUQ A;  2PHY A;  3MQQ A;  1N9O A;  4E6X A;  2KOI A;  3OCL A;  4OLG A;  5CTM A;  5DF8 A;  1OTD A;  5F1G A;  4LGW A;  2JN7 A;  2XEP A;  4FH2 A;  5KMW A;  3MQ0 A;  1OTB A;  1PYY A;  3IWO A;  3BYD A;  4O7D A;  1L0E A;  4PM6 A;  1CEF A;  1H8Y A;  3N8L A;  3F1P A;  2OWJ A;  2XH9 A;  3C2W A;  3G4P A;  4B4Z A;  3LIF A;  3FYZ A;  3UPO A;  3E0Y A;  1GHI A;  2HDU A;  3A3F A;  2XD1 A;  4I39 A;  2HGV A;  4NXF A;  3GMW A;  3UDX A;  4PKY A;  4IBX A;  4Z1W A;  5J4E A;  2C6W B;  2W0N A;  1STZ A;  2C5W B;  2W3F A;  3V67 A;  5EVI A;  2I9V A;  2V8C A;  3MF0 A;  1PI4 A;  4I3J A;  3CLO A;  3PBT A;  1GA0 A;  2WZZ A;  5JYO A;  1LSW A;  1YPR A;  1F98 A;  4E04 A;  3LY4 A;  1FR6 A;  4GS9 A;  5TBM A;  3T1S A;  3N8R A;  2BG1 A;  5CEC A;  2CMN A;  4KG5 A;  4GN2 A;  2KDK A;  3I7J A;  4OOL A;  4BEN A;  2ZOI A;  3OOV A;  3D3O A;  5DTS A;  2INW A;  5CTN A;  2JKF A;  4BBU A;  2QMI A;  4PMA A;  3HLG A;  4S2N C;  4Y2F A;  1ERO A;  2KX6 A;  3PAE A;  4H6J B;  4JGO A;  1DY6 A;  4DKI A;  4PM7 A;  3LY3 A;  1TD5 A;  3O3V A;  3MMH A;  3HLW A;  3B42 A;  2K2N A;  4PHT A;  3P7N A;  3HL9 A;  3QP5 A;  3CI6 A;  4GS9 B;  5TBM B;  3FWL A;  1LLB A;  3A0R A;  5EOE A;  1L0D A;  1HZO A;  5DTK A;  4OP5 A;  4EBL A;  4OLD A;  4HHD A;  4ESP A;  1BSG A;  1F2K A;  1TDL A;  5CGX A;  4KZ9 A;  1FCO A;  1LI0 A;  3PR6 A;  4NXG A;  1IYP A;  1XGI A;  4KG6 A;  3IF6 B;  1UWN X;  4KQD A;  1F9I A;  1ALQ A;  2P9V B;  1OJ5 A;  3F1P B;  3UB9 A;  5CHU A;  3BRM A;  4S2N A;  3NDE A;  2JHE A;  3LYX A;  3NY4 A;  4WZ5 A;  4WYY A;  3PBQ A;  2X02 A;  1TDG A;  1FSY A;  1OT9 A;  4DRT A;  3P09 A;  4OOM A;  4HP4 A;  1DJC A;  3LR3 A;  3A3D A;  1YMS A;  1FOF A;  3UY6 A;  2Y2M A;  1ESI A;  3QP2 A;  3DTI A;  1H8Z A;  4S2P A;  5FAP A;  3VP0 A;  4JF6 A;  1K57 A;  4NG2 A;  3C4P A;  5HD3 A;  4HES A;  1P97 A;  4Q0I A;  4IUH A;  5L07 A;  4KZ6 A;  4R70 A;  1MZU A;  3MS6 A;  3UB5 P;  3DTE A;  1CK3 A;  3ITA A;  1L0G A;  2ZD8 A;  4C75 A;  4KUO A;  1EI5 A;  3QP1 A;  4R38 A;  3T4Q A;  1N9B A;  3E4P A;  1MWU A;  4KZ8 A;  1MC0 A;  3LID A;  4OPZ A;  4QD4 A;  5GLD A;  2O9C A;  3E2L A;  3NOU C;  2Z6C A;  3ZG5 A;  5AJG A;  2HDS A;  5CRF A;  1G6A A;  3ZG7 B;  3OPR A;  4QPR A;  4HBT A;  1ODV A;  3EQU A;  3LIE A;  4ARZ B;  4K0X A;  3MXR A;  5HAI A;  5C5K A;  4X69 A;  2XF3 A;  1NYM A;  2DRW A;  4Y5F A;  1JWZ A;  2WKP A;  2ZL1 B;  2I72 A;  1ZG4 A;  3G6O A;  5F68 A;  4R3J A;  3TJZ C;  3MR0 A;  4E6W A;  5K5B A;  5E2F A;  3DTM A;  5A90 A;  1IOU A;  4WLA A;  3EQV A;  3LIB A;  2HDQ A;  1LI9 A;  1U60 A;  2Q9M A;  3MXS A;  3K2N A;  4I3I A;  4ID4 A;  5CEB A;  4GLQ A;  4DMZ A;  1ZC2 A;  2Y2P A;  2PAV P;  4WZ4 A;  3BFE A;  3QHY A;  3ZCZ A;  3HUM A;  1OT6 A;  2XA7 S;  4OQ0 A;  2VK3 A;  5FI2 A;  1S0W A;  4EBN A;  3C4O A;  3H82 A;  4R3B A;  3PAG A;  2Y2O A;  4YIN A;  5EVI D;  2H5S A;  2V1A A;  4QB8 A;  3SH8 A;  3K3D A;  4MN5 A;  4EET B;  2HPB A;  2PBY A;  3Q7Z A;  3V3S A;  1SDN A;  4QHC A;  3CUE A;  2HDR A;  2VGL S;  1VM1 A;  2Y2G A;  3Q07 A;  2H10 A;  5HDC A;  1K56 A;  1PWG A;  1HLU P;  3UN7 A;  4DDY A;  1ZTU A;  2A2L A;  4BBT A;  2A24 B;  3D9Y A;  3MQO A;  1K54 C;  5FA7 A;  1PW8 A;  3RH8 B;  3T1R A;  5I94 A;  1G6O A;  1K54 A;  3HLB A;  2EXB A;  5EEC A;  5IU1 A;  3UME A;  2PDR A;  4S2L A;  1PNE A;  3VE3 A;  2WGW A;  4O01 A;  3V5M A;  2PD7 A;  1CEG A;  5HD5 A;  5LBR A;  1F5M A;  4WN5 A;  5GHY A;  4PM9 A;  3UE0 A;  1XKZ A;  1L3L A;  2Y2H A;  2LB5 A;  3SS3 A;  5FAO A;  3GV9 A;  3VOL A;  4FH4 A;  3IX8 A;  4Y15 A;  1GSW A;  5E2E A;  3RXX A;  2HJ9 C;  3HLC A;  3O87 A;  4Z9Q A;  4KG2 A;  3MFX A;  2V9A A;  3SOI A;  2MJ6 A;  5CHJ A;  3D4F A;  4ZAM A;  3TOI A;  2VLG A;  3G2Z A;  4P0M A;  1ONH A;  3FPV A;  4E3K A;  3DW0 A;  4QY6 A;  1JNU A;  2ZQD A;  3V3R A;  4CLC D;  4Q0J A;  3LFV A;  1H0M A;  2HJE A;  3IXG A;  3IF6 C;  4LV1 A;  3T4O A;  1K0K A;  5F69 A;  4EQI A;  3A0S A;  3M2K A;  4EER A;  4OPQ A;  1NZO A;  3IS2 B;  5GHX A;  1Y4O A;  3GTC A;  4HH2 A;  4UEY A;  5FQI A;  5GLB A;  2EX6 A;  4ZJ2 A;  2O99 A;  3KYQ A;  3C5A A;  3PYP A;  4Y0O A;  2IWB A;  4JXG A;  5EUA A;  3Q7V B;  3T4T A;  1IYO A;  1PRQ A;  4XUX A;  2Y8H A;  3UO9 A;  1YLP A;  1LL5 A;  1N9L A;  5FQM A;  5EVL A;  5HL1 A;  2NUT C;  3E98 A;  4MDZ A;  4OP8 A;  2Y4A A;  2WYX A;  3ZVT A;  3IHB A;  3NOT C;  3Q81 A;  3TW8 A;  2H28 A;  3IWQ A;  3MKF A;  1IEM A;  4KZ7 A;  3G31 A;  4S2J A;  2JKR M;  4EWF A;  5I5L A;  4DDS A;  2XA7 M;  1KE3 A;  3NBL A;  3IBJ A;  1G68 A;  4S2M A;  4KZA A;  3IQA A;  2ZC3 B;  4KZ3 A;  1GCE A;  3VMA A;  3EWK A;  5EE8 A;  2OV5 A;  3NJA A;  4WZ5 C;  1XGJ A;  4OH0 A;  4EBP A;  5FI7 A;  3UE3 A;  3SW1 A;  1WYC A;  3CHW P;  4JGR A;  3EGD C;  4UQI S;  2BLS A;  3C7V A;  1FCN A;  4R3A A;  5DF7 A;  4HY8 A;  5EVE A;  3VP3 A;  2P74 A;  3T1Q B;  3FZC A;  1IEL A;  3NOP C;  3K3C A;  3BW6 A;  1TS7 A;  1K4E A;  4EXO A;  3ISG A;  2K7S A;  1H8M A;  3F1N B;  4BJP A;  3OLO A;  3BY8 A;  4GHI A;  1DJA A;  1XJ2 A;  2H0T A;  1I2S A;  4HQA A;  4B9O A;  5FAS A;  2A49 A;  3SS5 A;  3DAV A;  4DN0 A;  1CI8 A;  2P08 A;  3BEB A;  4ETZ A;  4FD8 A;  2WGV A;  4P6Z S;  4IED A;  1L0F A;  2QYB A;  3C30 A;  3MZE A;  4BL2 A;  4FSF A;  4EES A;  2HZ5 A;  3R4K A;  2EA9 A;  3VP2 A;  3LIA A;  3AGD A;  3N7W A;  4IVK A;  2M7U A;  1ERQ A;  4KQR A;  3NCK A;  1DP6 A;  1PFL A;  2JC7 A;  3VE4 A;  2YKF A;  4LEN A;  2PYP A;  4MBK A;  4FOF A;  4PKY G;  3N4I A;  1S4S A;  4A5R A;  5CGS A;  4HIA A;  3SH7 A;  4N1X A;  1Y54 A;  4LRX C;  2WGW B;  1P9W A;  4ZJ3 A;  3IX4 A;  3IWI A;  1J3W A;  1CQA A;  1ES2 A;  3UE1 A;  1SKO A;  3IXB A;  1YLT A;  3E2K A;  4WM9 A;  4E3I A;  1GA9 A;  5FSR A;  1PWD A;  1PI5 A;  2EXA A;  2IA2 A;  3LUQ A;  4QU3 A;  5EPH A;  1MWR A;  2X71 A;  4WUJ A;  3NIA A;  5M19 A;  2WGI A;  4JBF A;  5A92 A;  2Q9N A;  3L9K A;  3MFD A;  3BJN A;  5M1A A;  3VOY A;  3KO6 A;  3QP4 A;  3UPN A;  3U2A A;  1XX2 A;  4NXE A;  4RA7 A;  3VSL A;  2EWV A;  4HEF A;  4DE3 A;  5FQK A;  3WS0 A;  4CLC B;  4D60 A;  4R0Q A;  2WKE A;  4RQ9 A;  3BFC A;  2JBF A;  5L09 A;  1W79 A;  2D01 A;  3NEC A;  4EUV A;  3WS5 A;  1SCW A;  3VFF A;  2Y2Q A;  1D1J A;  4FUW A;  4EUZ A;  4YOF A;  5L10 A;  4KQO A;  3JPU A;  5FDH A;  3ZNT A;  3F1N A;  1MBL A;  5HAQ A;  3JYI A;  3ZYT A;  2ZOH A;  3M6H A;  5DKL A;  3IT9 A;  4MCW A;  5HWT A;  2V1Z A;  2WZX A;  4P6B A;  4PM5 A;  1T18 A;  3NHQ A;  3T50 A;  4HOI A;  5CER A;  4JXV A;  5F6A A;  2WKQ A;  5A91 A;  1SDE A;  2PU4 A;  5EV0 A;  3IBR A;  4R6L A;  5F5Y A;  4GNU A;  4ZBE A;  2J3T C;  3S1Y A;  2G2U A;  2D02 A;  3BFG A;  3IXD A;  2BAS A;  4ETX A;  1I5Q A;  4MNR A;  2OAP 1;  1XXM A;  1LL8 A;  1V9Z A;  3O5Y A;  4PPR A;  1K56 D;  3G2Y A;  3LR0 A;  1JWP A;  4CLC E;  5BOH A;  2ZC4 B;  5L8M A;  4GD6 A;  2L1M A;  2PD8 A;  4LRZ E;  3UMD A;  2VV6 A;  2AVX A;  1AXB A;  1VEU B;  1RGZ A;  4X53 A;  1K6R A;  4CJN A;  2W3E A;  4MN7 A;  4JGP A;  1AWI A;  1M40 A;  4DJ3 A;  3ITB A;  4CLC A;  3F1O A;  3G35 A;  1WA9 A;  4S2O A;  1YSQ A;  4GDN A;  1XJ3 A;  3ULF A;  2O0Y A;  3DWK A;  5F83 A;  4L9G A;  4WEL A;  2WAF A;  4LRY C;  4OOY A;  4KZ5 A;  1BUE A;  4KEN B;  4KZB A;  3A3J A;  3UE6 A;  4K0W A;  5DJU A;  2HP6 A;  1ZKJ A;  2VV7 A;  1KGE A;  4KUK A;  3LIC A;  1DJB A;  3LI8 A;  4H6J A;  2W3H A;  2WAE A;  3S7P A;  2QJ5 A;  2XRN A;  4OON A;  1Z09 A;  2A24 A;  4I3A A;  1Q2Q A;  4WF0 A;  3MXQ A;  4BWI A;  2GX5 A;  3C7U A;  4M4X A;  1YKD A;  3WWX A;  2ACG A;  3OZH A;  4GCZ A;  2JKT I;  5E2H A;  1TVF A;  1BLS A;  3ZFZ A;  1IYS A;  2E8I A;  2QHK A;  2VKS A;  1SKF A;  1XPB A;  2CC1 A;  2ZJ9 A;  1JTG A;  3RTY A;  1EW0 A;  4OQH A;  2FFY A;  5AQA A;  1VET A;  5KSH A;  3JVU A;  4UAA A;  1XJ6 A;  5DVA A;  1S66 L;  4GKU A;  4DXC A;  2ZLY A;  5G4Z A;  3MBZ A;  1W63 Q;  5HSQ A;  3CAX A;  3UB8 A;  1NXY A;  3H9W A;  3SH9 A;  1IFQ A;  2B18 A;  5HZH A;  3KSI A;  2PYR A;  1SZV A;  3DBA A;  3G32 A;  4N1H A;  5FI6 A;  1YAX A;  1K55 C;  2Y55 A;  4HJ3 A;  1BT5 A;  1ESU A;  4E3M A;  4YWZ A;  4KZ4 A;  1S1Y A;  2NUP C;  4QY5 A;  1SHV A;  3CMZ A;  4L9E A;  3GDI A;  4C6Y A;  4X1L A;  3RXW A;  1LHY A;  2DCF A;  2VJW A;  4MN6 A;  4HBU A;  1X0O A;  4HH3 A;  2GJ3 A;  4GDB A;  4G3W A;  4NEE D;  3TRC A;  1DP9 A;  4B93 A;  5A93 A;  3ZDJ A;  3HJK A;  2OAQ 1;  1CI9 A;  4BLM A;  2XFT A;  1E3U D;  5HL6 A;  2OOL A;  5EVI B;  4Q8I A;  5FEF A;  2V0U A;  1FIL A;  1WE4 A;  3T4J A;  4HNB A;  3VV4 A;  1P0Z A;  4E3O A;  1M6K A;  2YKH A;  2FFF B;  2V1B A;  1ES4 A;  2IWC A;  5TR7 A;  1RGY A;  1J9M A;  2JE5 A;  3WS1 A;  1NJ4 A;  3CG5 A;  4N92 A;  4S2K A;  3OCN A;  3S22 A;  2Y2I A;  4EU0 A;  2WK0 A;  3MZD A;  2XGN A;  2EX2 A;  4OPY A;  1XA7 A;  3EOI A;  2PU2 A;  3QNB A;  1GHP A;  1K57 C;  1S1Z A;  4NKP A;  5IHV A;  2A3U A;  1MWT A;  4JGQ A;  3H82 B;  1W8Q A;  1W63 M;  2GZA A;  1C3B A;  1MWS A;  2WKH A;  4UA7 A;  2V8F A;  1N9N A;  4X6T A;  5EFW A;  2Y91 A;  3F1O B;  3WS2 A;  3MJQ A;  5DTT A;  2PR6 A;  3BFD A;  4IUK A;  2HF6 A;  3OC2 A;  1KVM A;  3W8K A;  1H3Q A;  3ZG9 B;  3ICY A;  3BLM A;  4NXB A;  4B88 A;  2P9V A;  3LEQ A;  3IX3 A;  1LSX A;  3W4O A;  4RX2 A;  3S7O A;  2FZ0 A;  3UDI A;  5J3W A;  3PTE A;  5CHM A;  3A0V A;  5FAQ A;  3ZHH A;  2XSS A;  2R9W A;  5DJT A;  5FDS A;  3ZG0 A;  4NK3 A;  4F94 A;  5IT5 A;  4LCL A;  1VET B;  5HX9 A;  3FG8 A;  4EW7 A;  4BQM A;  4ZTK A;  2XQZ A;  1KOU A;  4U0X A;  3EGX C;  5A8B A;  5KSC A;  3BY9 A;  3HJI A;  2J3T D;  5FEG A;  3R7W B;  1QME A;  4CPK A;  5DKK A;  4MBH A;  2QKP A;  4M3K A;  3S7Q A;  4LLO B;  5HWW A;  1PIO A;  3HLE A;  2X01 A;  1DRM A;  2ZQ8 A;  4KQQ A;  2VV8 A;  3UNW A;  1RP5 A;  2FH5 A;  4IJG A;  2PRF A;  4DXB A;  3UB7 A;  3R7W A;  3RFB A;  2EFU A;  4R23 A;  5TJJ A;  3GSG A;  3HUO A;  4GJ4 A;  2PT7 A;  2UWX A;  4UA6 A;  5DFX A;  2H0Y A;  1NZU A;  1PWC A;  3KX0 X;  1MXO A;  4E3J A;  1KE4 A;  5GL9 A;  1FCM A;  2ZL1 A;  2B02 A;  4JXW A;  3U4L P;  2Y59 A;  3HCY A;  1K38 A;  5MC7 A;  1ERM A;  3CUE C;  1CJF A;  5F1F A;  4WMC D;  1OTA A;  4X25 A;  5AQB A;  4PAU A;  1ES5 A;  3ZVW A;  4UQI M;  3SS4 A;  3P98 A;  3LI9 A;  2ZM2 A;  4JPM A;  3W2Z A;  3W4P A;  4X56 A;  3OBF A;  3KSH A;  2VA0 A;  3TSG A;  1ES3 A;  3W4Q A;  2Y2N A;  4OPR A;  4Y13 A;  1XFN A;  2E8J A;  1P9R A;  1NLY A;  4L9F A;  4O0P A;  4Y0U A;  1OME A;  1I2W A;  1OPX A;  4QWO A;  3FKV A;  5HAR A;  4QJG A;  3GR2 A;  2XLN A;  1YSP A;  2G2W A;  4G3V A;  1BYW A;  3Q7V A;  3HRE A;  2PR5 A;  1T1B A;  3PHY A;  2VGL M;  3HVF A;  3T12 B;  2QZ6 A;  2ZM8 A;  1VQQ A;  2OLU A;  3CPT A;  4LV2 A;  1HD8 A;  2W1R A;  1Z6F A;  4R4R A;  1XP4 A;  4I5S A;  4GZB A;  2ZQA A;  5J7E A;  4F3L A;  1T1A A;  5HWV A;  1LSV A;  4WBG A;  1Q2P A;  4IHQ A;  4EV4 A;  2WKI A;  1N4O A;  1DP8 A;  1YT4 A;  1BTL A;  3SZT A;  3EEA A;  4ZDX A;  3NDG A;  1D06 A;  1IYQ A;  4WMC A;  3BFF A;  3FV7 A;  3EEH A;  4I38 A;  4UA9 A;  2QWS A;  2W3G A;  2PBD P;  4P85 A;  4Y3I A;  5E2G A;  1FQG A;  3ZQ5 A;  2Y2L A;  3Q82 A;  5D3O A;  1XJ4 A;  1YQS A;  2QPN A;  4ARZ A;  4N9K A;  3NUL A;  1MKM A;  2JKT M;  2Y2K A;  5KZH A;  2XRO A;  3A3E A;  3DTK A;  1TS8 A;  2VX8 A;  1JTD A;  1E4D A;  3VFH A;  3PBO A;  4B4X A;  3VP4 A;  3MKE A;  1XA1 A;  4MEZ A;  2ZC6 B;  1YLJ A;  3NC8 A;  3AGF A;  4RX3 A;  1S6R A;  2XR0 A;  3E4O A;  2XD5 A;  3BLS A;  3T4L A;  5J8X A;  5FQJ A;  5KIZ A;  4HI4 A;  4X1M A;  3LCE A;  3BQA A;  2M1C A;  3G34 A;  3HLF A;  2K31 A;  3GRJ A;  3OPL A;  1KDS A;  3PXP A;  2ZC5 B;  3ZNY A;  5CED A;  1HTZ A;  4N9L A;  1K4F A;  5HDD A;  3HUN A;  1L2S A;  2XK1 A;  2V0W A;  1W8Y A;  3S7N A;  1FIK A;  5G18 A;  3IH9 A;  3E4Q A;  1E25 A;  1K6S A;  1ONG A;  4DE2 A;  1LT0 A;  1GHM A;  4OKP A;  3IS2 A;  1T19 A;  1ACF A;  3HLD A;  2O9B A;  1S67 L;  1O07 A;  2ZC7 A;  1NRF A;  4E3L A;  2GNX A;  3FKW A;  5HPI A;  1LL9 A;  5G4Y A;  4P87 A;  3Q1F A;  5TFQ A;  1ZHH B;  3H7W B;  3O88 A;  1BLP A;  4WEJ A;  1NY0 A;  2R9X A;  3BEC A;  1K55 A;  1MY8 A;  5DF9 A;  4FTX A;  2JCH A;  1SKO B;  1EWZ A;  4FCF A;  2J9O A;  2ZBB A;  3L7H A;  4EQ1 A;  3C38 A;  1HVB A;  4XT2 B;  5JYP A;  4O8G A;  2G7U A;  1PW1 A;  2WAD A;  1G5U A;  4X68 A;  3P01 A;  4U3T A;  4S2I A;  4E3N A;  1W7F A;  2HP5 A;  2J3W A;  4OQI A;  2UV0 E;  1KGG A;  4WL9 A;  5GHZ A;  3GVB A;  2HV1 A;  2DMW A;  5GLC A;  3T4S A;  1KDW A;  2VEA A;  3LEZ A;  4LCM A;  2B5R A;  2O9A A;  4EEP A;  4GW9 A;  3M6B A;  1RCJ A;  4BD1 A;  3FPW A;  5TGF A;  1NLZ A;  2LB9 A;  1YLY A;  1PZP A;  3QP6 A;  3IHA A;  4Y0T A;  3VSK A;  4GHI B;  1NYY A;  5F82 A;  4GD8 A;  3C8C A;  3G30 A;  3H7W A;  1BUL A;  1JVJ A;  4UHU A;  3PBS A;  5CX7 A;  3WS4 A;  4R4S A;  4HP9 A;  1V9Y A;  3CPT B;  3LR4 A;  3A3I A;  1S4R A;  2W1T A;  1UWP X;  2B95 A;  3MSH A;  5HW3 A;  1YLZ A;  4XXR A;  1OTE A;  3B47 A;  5FQ9 A;  3B33 A;  3IF5 A;  1BZA A;  3ZGA B;  2J9P A;  4GB7 A;  1FR1 A;  3O86 A;  5HDS A;  5DFY A;  2W27 A;  4X55 A;  2OWH A;  1O7E A;  1ZG6 A;  4LV0 A;  5AVF A;  3CIT A;  4IBR A;  2XFS A;  4HJ4 A;  2Z6D A;  1GSV A;  4K91 A;  2ZQ9 A;  4RYE A;  1KGF A;  1VEU A;  1VHM A;  1FSW A;  4JKT A;  4DE0 A;  4JLF A;  3IF6 A;  3OPH A;  2RL3 A;  1E3U A;  4DE1 A;  3BM6 A;  4PM8 A;  3UPP A;  3TG9 A;  3KSF A;  5FAT A;  1NRJ A;  3QNC A;  4BL3 A;  2ZQC A;  3LO7 A;  2DNS A;  4OVD A;  4XUZ A;  4LPZ A;  3KSG A;  4WEK A;  1OTI A;  4EEU A;  4LFU A;  5AQ7 A;  4NET A;  1VB6 A;  4P6Z M;  2XDM A;  2W1T B;  2J7V A;  1BLC A;  3NI9 A;  1TEM A;  1TS6 A;  2L0W A;  3RJU A;  4BBV A;  3BWL A;  3IXH A;  1YM1 A;  2P04 A; 
#chains in the Genus database with same CATH homology
 2HDS A;  5CRF A;  1G6A A;  4L0L A;  1MXO A;  1W79 A;  3ZG7 B;  3WRT A;  4E3J A;  1KE4 A;  5GL9 A;  3M2J A;  4ZJ1 A;  1FCM A;  5FQQ A;  3OPR A;  2HP9 A;  4HBT A;  1SCW A;  3VFF A;  2Y2Q A;  3WS5 A;  4EUZ A;  3EQU A;  3IH8 A;  4K0X A;  2V20 A;  3MXR A;  4KQO A;  5L2F A;  5HAI A;  4JXW A;  3V50 A;  4X69 A;  2XF3 A;  2Y59 A;  5FDH A;  1NYM A;  3ZNT A;  1K38 A;  1ERM A;  2DRW A;  5F1F A;  1JWZ A;  1MBL A;  5HAQ A;  3JYI A;  2ZQ7 A;  4WMC D;  2I72 A;  1ZG4 A;  1MPL A;  5AQB A;  4R3J A;  3M6H A;  3IT9 A;  3V39 A;  1ES5 A;  2ZM0 A;  2VGJ A;  3N6I A;  3ZVW A;  3UDF A;  4E6W A;  2V1Z A;  2WZX A;  4P6B A;  3P98 A;  5E2F A;  2EFX A;  3SS4 A;  1QMF A;  1KE0 A;  3DTM A;  4PM5 A;  5M18 A;  2ZM2 A;  5A90 A;  4JF4 A;  4JPM A;  3EQV A;  2J8Y A;  2HDQ A;  3W4P A;  4X56 A;  5CER A;  1MKI A;  1LI9 A;  1IKI A;  1U60 A;  4JXV A;  2Q9M A;  3TSG A;  1ES3 A;  3W4Q A;  5EOO A;  3MXS A;  2Y2N A;  4LV3 A;  4OPR A;  5A91 A;  1SDE A;  2PU4 A;  4ID4 A;  5CEB A;  1ZC2 A;  1BLH A;  2Y2P A;  4GNU A;  4Y0U A;  4ZBE A;  3S1Y A;  2G2U A;  3BFG A;  3IXD A;  4WZ4 A;  3BFE A;  3QHY A;  1OME A;  1I2W A;  3ZCZ A;  4JXS A;  1I5Q A;  4MNR A;  3HUM A;  2ZMA A;  1XXM A;  3FKV A;  4PPR A;  1K56 D;  2Z2L B;  3G2Y A;  4MBF A;  4MLL A;  1JWP A;  4OQ0 A;  2EX8 A;  3GR2 A;  5HAR A;  4QJG A;  5BOH A;  5FI2 A;  2XLN A;  2V2F F;  1S0W A;  2G2W A;  3C4O A;  4EBN A;  5HFO A;  2ZC4 B;  4JF5 A;  4RVA A;  3GQZ A;  4GD6 A;  4YFM A;  4R3B A;  3PAG A;  2Y2O A;  3Q7V A;  4YIN A;  5EVI D;  4H8R A;  2H5S A;  1AXB A;  3HRE A;  1RGZ A;  4X53 A;  4QB8 A;  3SH8 A;  1K6R A;  4R1G A;  3DWZ A;  5E43 A;  4CJN A;  2HPB A;  1W5D A;  3HVF A;  2Y2J A;  2PBY A;  4U0T A;  2QZ6 A;  3Q7Z A;  2ZM8 A;  3CJM A;  3PBN A;  1VQQ A;  2OLU A;  4LV2 A;  1HD8 A;  1Z6F A;  4R4R A;  1M40 A;  1XP4 A;  3V3S A;  3ITB A;  1SDN A;  4GZB A;  4QHC A;  2Z2M B;  2ZQA A;  2HDR A;  3G35 A;  3AGE A;  1VM1 A;  2Y2G A;  3Q07 A;  3VP1 A;  2H10 A;  4S2O A;  2GDN A;  1K56 A;  1YM1 A;  4GDN A;  1PWG A;  4WBG A;  3UN7 A;  4DDY A;  1YLW A;  1Q2P A;  4EV4 A;  2WKI A;  3DWK A;  3ZG8 B;  1N4O A;  5F83 A;  5U47 A;  1YT4 A;  4WEL A;  5GLA A;  1BTL A;  2WAF A;  3MZF A;  1K54 C;  5FA7 A;  1PW8 A;  1IKG A;  4ZDX A;  5I94 A;  4OOY A;  4KZ5 A;  3NDG A;  4D2O A;  1BUE A;  4KEN B;  1K54 A;  4KZB A;  3A3J A;  4K0W A;  1IYQ A;  3HLB A;  2EXB A;  4WMC A;  5EEC A;  3BFF A;  2HP6 A;  2OLV A;  3FV7 A;  1ZKJ A;  4UA9 A;  4S2L A;  4C3Q A;  2OSU A;  2WGW A;  1KGE A;  3PBR A;  3V5M A;  1CEG A;  4IVI A;  5CGW A;  4P85 A;  3HBR A;  3S4X A;  1DJB A;  5GHY A;  4PM9 A;  3UE0 A;  5E2G A;  1XKZ A;  4Y7P A;  1FQG A;  2IWD A;  2WAE A;  1K25 A;  2Y2H A;  2Y2L A;  1YMX A;  3Q82 A;  2VGK A;  5D3O A;  3SS3 A;  1PZO A;  3CZD A;  4OON A;  3GV9 A;  5FAO A;  1YQS A;  3VOZ A;  2RCX A;  4GOG A;  2QPN A;  1Q2Q A;  4FH4 A;  4N9K A;  2Y2K A;  5E2E A;  1NZU A;  3RXX A;  5KZH A;  3WRZ A;  3C7U A;  3A3E A;  1KVL A;  3WWX A;  3HLC A;  3O87 A;  4Z9Q A;  3OZH A;  4KG2 A;  2EX9 A;  1JTD A;  1E4D A;  5AQ9 A;  3VFH A;  3SOI A;  3OPP A;  5E2H A;  5EVI C;  5CXW A;  3PBO A;  1TVF A;  5CHJ A;  4B4X A;  1BLS A;  3ZFZ A;  3D4F A;  3VP4 A;  5HAP A;  3MKE A;  1IYS A;  2E8I A;  4ZAM A;  3TOI A;  1H5X A;  1SKF A;  1XPB A;  2CC1 A;  3G2Z A;  4P0M A;  1ONH A;  1XA1 A;  4E3K A;  2ZJ9 A;  1JTG A;  3DW0 A;  4QY6 A;  4MEZ A;  2ZC6 B;  3B3X A;  2ZQD A;  4BD0 A;  1YLJ A;  3NC8 A;  3AGF A;  3V3R A;  4RX3 A;  1S6R A;  2XR0 A;  4OQH A;  2FFY A;  5AQA A;  2XD5 A;  3BLS A;  3N8S A;  5KSH A;  5J8X A;  5FQJ A;  4UAA A;  4OQG A;  3IXG A;  1JWV A;  3IF6 C;  4DF6 A;  3LCE A;  2WUQ A;  5DVA A;  3G34 A;  3HLF A;  4GKU A;  4LV1 A;  3GRJ A;  4DXC A;  4E6X A;  3OPL A;  1KDS A;  2ZLY A;  3OCL A;  2ZC5 B;  3MBZ A;  3ZNY A;  5CED A;  1HTZ A;  4N9L A;  1K4F A;  1NXY A;  4OLG A;  5CTM A;  5DF8 A;  5F1G A;  4EQI A;  3SH9 A;  2H0Y A;  3M2K A;  4OPQ A;  2XEP A;  3HUN A;  4FH2 A;  1L2S A;  2XK1 A;  5KMW A;  1NZO A;  1PYY A;  3IWO A;  3BYD A;  4O7D A;  5GHX A;  1L0E A;  4N1H A;  3G32 A;  3GTC A;  4PM6 A;  5FI6 A;  1W8Y A;  1CEF A;  1H8Y A;  1K55 C;  3N8L A;  2Y55 A;  5FQI A;  5GLB A;  2XH9 A;  2EX6 A;  5G18 A;  3IH9 A;  4ZJ2 A;  1BT5 A;  1ESU A;  3C5A A;  4E3M A;  1E25 A;  1K6S A;  1ONG A;  3G4P A;  4B4Z A;  4DE2 A;  4KZ4 A;  4Y0O A;  2IWB A;  1GHM A;  4JXG A;  4OKP A;  5EUA A;  4QY5 A;  3FYZ A;  3Q7V B;  1SHV A;  3UPO A;  3HLD A;  1IYO A;  3CMZ A;  1O07 A;  2ZC7 A;  1GHI A;  1NRF A;  1YLP A;  1LL5 A;  2HDU A;  3A3F A;  2XD1 A;  4XUX A;  5FQM A;  4C6Y A;  4E3L A;  5EVL A;  5HL1 A;  3GMW A;  3FKW A;  3RXW A;  3UDX A;  4IBX A;  1LHY A;  1LL9 A;  2DCF A;  4OP8 A;  2Y4A A;  2C6W B;  2WYX A;  4HBU A;  3ZVT A;  4P87 A;  3IHB A;  3Q1F A;  4GDB A;  5TFQ A;  2C5W B;  3Q81 A;  3O88 A;  5EVI A;  3IWQ A;  3MKF A;  1BLP A;  1IEM A;  4WEJ A;  1NY0 A;  4KZ7 A;  5A93 A;  2R9X A;  1PI4 A;  3BEC A;  3ZDJ A;  1K55 A;  1MY8 A;  5DF9 A;  3G31 A;  3PBT A;  1CI9 A;  1GA0 A;  2WZZ A;  4S2J A;  4BLM A;  4EWF A;  5JYO A;  4DDS A;  2XFT A;  1KE3 A;  3NBL A;  2JCH A;  1E3U D;  1G68 A;  3LY4 A;  1EWZ A;  1FR6 A;  4FCF A;  4S2M A;  4KZA A;  3IQA A;  2J9O A;  5EVI B;  1HVB A;  3N8R A;  5JYP A;  4Q8I A;  1PW1 A;  2BG1 A;  2ZC3 B;  4KZ3 A;  4KG5 A;  5CEC A;  2WAD A;  4GN2 A;  3I7J A;  1WE4 A;  1GCE A;  3VMA A;  5EE8 A;  2OV5 A;  4OOL A;  4X68 A;  4BEN A;  4WZ5 C;  4U3T A;  4S2I A;  4E3N A;  1XGJ A;  1W7F A;  4OH0 A;  2HP5 A;  5DTS A;  4EBP A;  4OQI A;  5CTN A;  5FI7 A;  3UE3 A;  4E3O A;  1M6K A;  1WYC A;  2FFF B;  1KGG A;  5GHZ A;  1ES4 A;  2IWC A;  2QMI A;  5TR7 A;  2BLS A;  3GVB A;  4PMA A;  1RGY A;  1J9M A;  3C7V A;  3HLG A;  4S2N C;  5GLC A;  1FCN A;  5DF7 A;  1ERO A;  3PAE A;  2JE5 A;  3WS1 A;  1NJ4 A;  3VP3 A;  1KDW A;  2P74 A;  1DY6 A;  3CG5 A;  4DKI A;  3FZC A;  3LEZ A;  4LCM A;  4PM7 A;  4N92 A;  3LY3 A;  1IEL A;  2B5R A;  4S2K A;  3OCN A;  3O3V A;  3S22 A;  3HLW A;  2Y2I A;  3M6B A;  2WK0 A;  3MZD A;  1RCJ A;  1K4E A;  2XGN A;  4BD1 A;  2EX2 A;  3ISG A;  4OPY A;  1XA7 A;  2PU2 A;  3QNB A;  3HL9 A;  5TGF A;  1GHP A;  1K57 C;  1YLY A;  3FWL A;  1LLB A;  5EOE A;  5IHV A;  1L0D A;  1PZP A;  1MWT A;  1HZO A;  2A3U A;  3IHA A;  5DTK A;  4Y0T A;  4OP5 A;  3VSK A;  4EBL A;  4BJP A;  1NYY A;  5F82 A;  1W8Q A;  4GD8 A;  3G30 A;  1BUL A;  1DJA A;  1C3B A;  4OLD A;  1MWS A;  1JVJ A;  2WKH A;  4UA7 A;  2H0T A;  1I2S A;  4UHU A;  3PBS A;  5FAS A;  2A49 A;  3SS5 A;  1BSG A;  4X6T A;  2Y91 A;  3WS4 A;  4R4S A;  1CI8 A;  3WS2 A;  3BEB A;  1TDL A;  5CGX A;  5DTT A;  4KZ9 A;  1FCO A;  1LI0 A;  3BFD A;  4FD8 A;  2WGV A;  3OC2 A;  1KVM A;  3W8K A;  1IYP A;  3ZG9 B;  1XGI A;  4IED A;  3BLM A;  1L0F A;  4KG6 A;  3IF6 B;  4B88 A;  3A3I A;  2P9V A;  3MZE A;  4BL2 A;  1ALQ A;  5HW3 A;  4FSF A;  1YLZ A;  2P9V B;  4XXR A;  5CHU A;  3W4O A;  3BRM A;  4S2N A;  4RX2 A;  3NDE A;  3VP2 A;  3NY4 A;  3AGD A;  4WZ5 A;  5FQ9 A;  3UDI A;  3N7W A;  4IVK A;  4WYY A;  1ERQ A;  4KQR A;  3NCK A;  3PTE A;  2JC7 A;  5CHM A;  3IF5 A;  1BZA A;  3PBQ A;  5FAQ A;  4LEN A;  3ZGA B;  2J9P A;  4MBK A;  4GB7 A;  1FR1 A;  3ZHH A;  3O86 A;  2X02 A;  1TDG A;  1FSY A;  4DRT A;  4X55 A;  2R9W A;  3N4I A;  3P09 A;  4OOM A;  4A5R A;  5CGS A;  1O7E A;  1DJC A;  1ZG6 A;  4LV0 A;  1Y54 A;  4N1X A;  3SH7 A;  2WGW B;  4IBR A;  3ZG0 A;  4NK3 A;  4ZJ3 A;  4F94 A;  2XFS A;  3A3D A;  1YMS A;  3UO9 A;  1FOF A;  3UY6 A;  2Y2M A;  4LCL A;  3IWI A;  1ESI A;  4K91 A;  1H8Z A;  4S2P A;  1ES2 A;  2ZQ9 A;  4RYE A;  5FAP A;  1KGF A;  4JF6 A;  5HX9 A;  3UE1 A;  3VP0 A;  1K57 A;  4BQM A;  4ZTK A;  4JKT A;  1FSW A;  1YLT A;  3E2K A;  3IXB A;  4WM9 A;  4DE0 A;  4JLF A;  3C4P A;  3IF6 A;  4E3I A;  1GA9 A;  3OPH A;  2RL3 A;  4HES A;  2XQZ A;  1E3U A;  4DE1 A;  4U0X A;  3BM6 A;  5FSR A;  4PM8 A;  1PWD A;  3UPP A;  4KZ6 A;  1PI5 A;  3TG9 A;  5KSC A;  5FAT A;  3QNC A;  2EXA A;  1CK3 A;  3ITA A;  1L0G A;  4BL3 A;  2ZQC A;  3LO7 A;  4QU3 A;  2ZD8 A;  1QME A;  2DNS A;  4C75 A;  1EI5 A;  4CPK A;  4OVD A;  4XUZ A;  4MBH A;  4M3K A;  5EPH A;  1MWR A;  1N9B A;  2X71 A;  4WEK A;  1PIO A;  3NIA A;  1MWU A;  5M19 A;  2WGI A;  4JBF A;  3HLE A;  4KZ8 A;  2X01 A;  5A92 A;  2ZQ8 A;  4KQQ A;  3UNW A;  5AQ7 A;  2Q9N A;  1RP5 A;  4NET A;  3MFD A;  4OPZ A;  4QD4 A;  5M1A A;  3VOY A;  4DXB A;  3UPN A;  1XX2 A;  2XDM A;  2J7V A;  1BLC A;  3NI9 A;  4RA7 A;  1TEM A;  2EFU A;  4R23 A;  3GSG A;  3VSL A;  5GLD A;  4HEF A;  4DE3 A;  3E2L A;  5FQK A;  3HUO A;  3WS0 A;  3RJU A;  4R0Q A;  3ZG5 A;  2WKE A;  2UWX A;  4UA6 A;  3IXH A;  1WYB A;  3BFC A;  2JBF A;  1PWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...