1KOUA

Crystal structure of the photoactive yellow protein reconstituted with caffeic acid at 1.16 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
122
structure length
119
Chain Sequence
VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Structure of the photoactive yellow protein reconstituted with caffeic acid at 1.16 A resolution.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photosynthesis
total genus 35
structure length 119
sequence length 122
ec nomenclature
pdb deposition date 2001-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1kouA00
2VLGA 1XFNA 1LT0A 1OJ5A 1TS0A 4MN6A 5IU1A 5HDSA 2OWHA 4L9GA 2WKQA 4HP9A 4BBTA 2A24A 4JGRA 5J3WA 4HQAA 3E4PA 1LL8A 1S1YA 2QJ5A 2BASA 4PKYG 3LIFA 3FG8A 4EESA 2QJ7A 2V1BA 3D72A 4EQ1A 5A8BA 1WA9A 4B9OA 1VB6A 1OTAA 3HJIA 4GCZA 1DRMA 1P0ZA 4NXEA 2PHYA 1N9LA 3EEHA 2V1AA 3LI8A 1GSXA 2VEAA 1V9YA 5HWVA 1XJ2A 2OOLA 4HJ4A 4XT2B 4R6LA 2PD7A 4M4XA 1S4RA 3H82B 5HD3A 1D7EA 4I39A 3E4QA 5HSQA 3IBRA 5DKKA 4WF0A 2L4RA 3NOPC 3A0SA 2Z6CA 3LYXA 1UWPX 4H6JA 5DKLA 1BYWA 1TS7A 2QHKA 3UB9A 3H9WA 4NXBA 3MJQA 2ZBBA 2PDRA 4NXFA 3LIBA 3UMEA 2A24B 1XJ3A 4HOIA 2PR6A 5HWWA 1XJ6A 3BY9A 4DJ3A 4KUOA 3UB8A 3VE3A 2Z6DA 2PR5A 4KQDA 4I5SA 3F1OA 3K3DA 4GW9A 3OLOA 5G4ZA 4RQ9A 3NHQA 3GECA 5DJUA 2W27A 1KOUA 1T1BA 3IS2A 5F69A 4LRZE 4I38A 3MR0A 2ZOIA 4MN5A 3C2WA 4HHDA 1LSWA 5HWTA 2L0WA 5HZHA 4H6JB 4LLOB 1EW0A 4WLAA 3F1NA 5G4YA 5TBMA 3CLOA 3RH8B 2HV1A 3ICYA 3LIEA 2VV8A 1P97A 2PYPA 2QWSA 1F98A 5J4EA 2M1CA 4GHIA 3MQQA 2D02A 2EA9A 1N9NA 4HNBA 2PD8A 1XJ4A 3E4OA 3F1OB 1F9IA 2QKPA 3UB7A 3MFXA 1OTIA 1OTBA 4WL9A 4EEPA 2WKRA 2KX6A 3IS2B 1T18A 4HIAA 2YKHA 4JGPA 4YWZA 1S66L 1OJGA 5J7EA 1JNUA 4LPZA 2I9VA 2P7JA 3F1NB 1UWNX 3GDIA 5TBMB 2V0WA 3LUQA 3NJAA 4WN5A 4HI4A 5IS1A 1S1ZA 4HP4A 1OTEA 2WKPA 1T1AA 3LIAA 1OTDA 4HH2A 4GHIB 5EFWA 2R78A 3F1PA 3H7WA 3NOUC 1OT9A 1MZUA 4I3AA 1DP9A 2CMNA 4BBVA 3ULFA 4DJ2A 3BWLA 5DJTA 3MQOA 4HJ6A 4JGOA 4R70A 3KX0X 1T1CA 2VV6A 5HDCA 5HD5A 4HH3A 1LSVA 4F3LA 1G28A 3CWFA 5AVFA 4WUJA 4R3AA 1X0OA 1DP8A 3FC7A 3EWKA 2ZOHA 4EEUA 4GS9A 2J80A 3B33A 1LSXA 3VOLA 1XFQA 3MXQA 1S4SA 4HY8A 3G6OA 2L1MA 4LRXC 1TS8A 3BY8A 3VE4A 4LRYC 1GSVA 5F6AA 5F68A 1OT6A 3A0VA 3HJKA 3C8CA 3ZQ5A 3SW1A 4R38A 5F5YA 3PYPA 3A0RA 3F1PB 3H7WB 3UE6A 2V0UA 2JN7A 1D06A 1NWZA 2V9AA 3UB6A 3LIDA 2D01A 3LI9A 1TS6A 2VV7A 1ODVA 1Y28A 3T50A 5I5LA 5AVEA 2H28A 3P7NA 4HJ3A 4L9EA 4EERA 2KDKA 4F3LB 3PHYA 1S67L 2OWJA 4K08A 2GJ3A 5KIZA 4GS9B 1DP6A 4PKYA 2W0NA 4KUKA 3RTYA 4JGQA 3NOTC 4EW7A 3K3CA 1T19A 4NXGA 2K7SA 2PYRA 2INWA 4XT2A 4I3JA 2B02A 4EXOA 3CAXA 4I3IA 3UMDA 4E04A 1GSWA 5HDDA 3H82A 2JHEA 4L9FA 4BBUA 4EETB 2YKFA 3LICA 1UGUA 1V9ZA 1N9OA
chains in the Genus database with same CATH superfamily
3O87A 2FFFB 2HDQA 4ZAMA 3VP2A 1OMEA 1XFNA 1LT0A 2E8IA 3FKWA 1FQGA 3S7OA 5HDSA 1J9MA 2OWHA 1KVLA 3UY6A 2A24A 3SH9A 1PI5A 3NY4A 3CI6A 2X01A 1LL8A 1S1YA 1ACFA 2GZAA 3V50A 2QJ7A 3E0YA 2B18A 4OPZA 3D72A 5GHXA 3DTIA 1IKGA 1PNEA 1RGZA 4KG2A 1ES4A 2WKHA 1JVJA 5DVAA 3EOIA 4YINA 3WWXA 3C38A 3BQAA 5HWVA 1XJ2A 3MSHA 5EE8A 1D7EA 1G5UA 2EX9A 5HSQA 2H10A 5DKKA 5HX9A 2L4RA 3NOPC 4MDZA 1UWPX 4ZJ2A 4H6JA 3WS5A 5FATA 1ESIA 4U0XA 3UB9A 3H9WA 5A93A 2XGNA 2ZBBA 4X56A 4OOMA 4CPKA 1IYOA 1IYSA 1YKDA 2M7VA 1XJ3A 3MZEA 2J9OA 3HVFA 1L0DA 1TF1A 4HOIA 5DFXA 3MFDA 2PR6A 2Y2NA 3BY9A 3KSFA 4KUOA 2ZC3B 1YT4A 4ARZA 3WS0A 5EM1A 2HP9A 3N8SA 2WUQA 2ZQ9A 2HJ9C 2K31A 4OPYA 4DDYA 3F1OA 2IWCA 4GW9A 1ZG6A 5KSCA 3A3FA 1S6RA 5G4ZA 4RQ9A 2W3EA 4RX2A 5M18A 3NDEA 5L09A 1T1BA 3MQ0A 2Y2LA 2ZC6B 1W8YA 2V8CA 4PM5A 5HWTA 1LSWA 3BLMA 5FAQA 4JXWA 4N9KA 4LV2A 4LLOB 5FI6A 1YLWA 5EUAA 4JXVA 3TG9A 4DN0A 5TBMA 4DKIA 5KMWA 3IH9A 4JF5A 1N4OA 4KZ3A 2HV1A 3ICYA 1L0GA 4GJ4A 3LIEA 4OVDA 1KGGA 3IX8A 4KZ8A 3C30A 3G34A 4UA7A 2D02A 4EBLA 1TEMA 3FPWA 3S22A 3M6HA 2ZQ8A 4N1HA 2EA9A 1N9NA 2W3HA 3QP5A 4UAAA 4HNBA 2QMIA 3E4OA 3T4OA 1E25A 3UB7A 3MFXA 2ZL1B 5DF8A 4NK3A 3Q7VB 1PFLA 3ZG9B 1OTBA 5KZHA 1YLTA 1GCEA 3ZCZA 1KVMA 3CZDA 4ETZA 2J3TC 4EEPA 1ES5A 1YLZA 4WELA 3IS2B 3OPRA 1PIOA 4HIAA 3ZG7B 2YKHA 1IKIA 1K4FA 5F82A 5FAOA 1QMEA 2I9VA 1K57C 4PM7A 3T4KA 5GHYA 3LUQA 4GDBA 4UHUA 5FASA 5IS1A 2DMWA 1OTEA 5GL9A 3LIAA 3N8LA 4ZTKA 1OTDA 1D1JA 3SH8A 4GHIB 4PM8A 4Q0IA 4R3BA 3FKVA 1PW1A 2R78A 3H7WA 4OKPA 3R7WB 5J8XA 3ZFZA 2HZ5A 4KENB 5F1GA 4DJ2A 3KX0X 1PWGA 2Y2MA 2VV6A 5HD5A 4HH3A 5HAPA 5CXWA 2VJWA 2B95A 1MY8A 4MBHA 2EX2A 1M40A 1ZHHB 3ZVTA 4WMCD 4R3AA 1MXOA 3FC7A 3EWKA 2ZOHA 4PPRA 3B33A 1GHMA 2XR0A 3GR2A 4OLGA 2JKTM 4Q8IA 4WMCA 1JTDA 3MXQA 3M6BA 4HY8A 3G6OA 2XQZA 2L1MA 5E2GA 3JPUA 1TS8A 3CHWP 3QNCA 4S2OA 2VX8A 4E6XA 4QU3A 3LEQA 4LFUA 1K6RA 1VM1A 1N9BA 2P9VA 2NUTC 3IF6B 3ZQ5A 4IEDA 3PYPA 1EWZA 3F1PB 3LCEA 3UE6A 4BL3A 2XROA 1F2KA 2GX5A 4BENA 3GQZA 1DJAA 2V9AA 3C7UA 4YFMA 2OV5A 3LI9A 3SS4A 2VV7A 3NECA 3HCYA 1Y28A 2H28A 2WAFA 2EFXA 4FCFA 4R23A 1BLPA 4DXBA 1MC0A 4ID4A 3T1XA 5HL1A 2J9PA 3NIAA 1S67L 2XD1A 5BOHA 4K08A 4KG5A 5F1FA 2ZLYA 5F83A 4QB8A 4GS9B 5E43A 3MZDA 4PKYA 4S2LA 5FQQA 2WGWB 2W0NA 4X69A 3RTYA 3HLFA 4QPRA 4NXGA 1MWSA 2Y55A 3Q81A 5AJGA 4S2PA 5EPHA 4XT2A 3B42A 4WBGA 5CHJA 4GKUA 3CPTB 5HDDA 3H82A 4FH4A 4L9FA 3A3JA 3TW8A 4BBUA 3DTKA 4EETB 1XX2A 3GMWA 4P87A 1TDLA 5EVEA 3LICA 1V9ZA 1N9OA 3NULA 2C6WB 4IUHA 1LI0A 4P85A 1TS0A 4KG6A 1RP5A 5IU1A 3IX4A 1BUEA 2HPBA 5I94A 2W3DA 3FV7A 1AWIA 5M19A 2GDNA 2BASA 1CJFA 3LIFA 1NLZA 2V1BA 3A3DA 1IELA 1PYYA 2RL3A 3DTMA 5DF7A 4KZ7A 3V5MA 5A8BA 4RVAA 1WA9A 2WGIA 1ONGA 2PU4A 1VB6A 1K6SA 1OTAA 3HJIA 4GCZA 1DRMA 1XA1A 1P0ZA 3ZYTA 4NXEA 2PBDP 4BD1A 3EEHA 2V1ZA 2XH9A 3VP4A 3QP8A 1GSXA 2A3UA 4DXCA 3WS1A 4MMNA 1ALQA 4ZDXA 5EOOA 4HJ4A 1CQAA 3M2KA 2OLVA 3Q07A 4PMAA 4WM9A 4OQHA 2J7VA 4X53A 3W8KA 4Y7PA 3IBRA 1W79A 4WF0A 4C75A 1PZOA 3N8RA 1YQSA 2Z6CA 5CGXA 2XRNA 3HREA 2Y8HA 3UO9A 1TS7A 2QHKA 4BJPA 3C7VA 3PAGA 2XFSA 3VMAA 4BWIA 3MJQA 4CLCB 3PBRA 4NXFA 3ZVWA 1L0EA 1SZVA 3LIBA 2P74A 4OPQA 2ZQ7A 1JWZA 4UEYA 2A24B 3P09A 1VQQA 4GD6A 1XJ6A 1XPBA 3G31A 3UB8A 3VE3A 1PWDA 3E2KA 4X1MA 1E4DA 4WZ5A 4I5SA 5A91A 3S7QA 5DTSA 1WYBA 3VP0A 3HLWA 1KDSA 2Y2KA 5E2EA 4CQHA 3GECA 2WADA 5EECA 4G3VA 5GLCA 4CLCC 1IYQA 4XXRA 5MC7A 1WYCA 5EV0A 3RFBA 2B5RA 4HHDA 3NBLA 1A0KA 2CC1A 4H6JB 2X71A 5CHUA 1EW0A 5DTTA 5TJJA 3JYIA 4U0TA 5G4YA 3ZG0A 3W4OA 2O9AA 3KYEA 5CEDA 3CLOA 3S7PA 1NY0A 2JBFA 3M2JA 2ZJ9A 4JF4A 1SKFA 3UE3A 3ZGAB 2PYPA 4D60A 2Q0OA 4B4ZA 1CEFA 1PWCA 2IA2A 5E2HA 1BLSA 3D9YA 4PHTA 2M1CA 2Y2IA 3SS5A 3ZNTA 4ARZB 2OAQ1 3MKFA 3C4PA 1MBLA 1XJ4A 3F1OB 2IWDA 1F9IA 2O99A 1Y4OA 5IHVA 3Q82A 3T1SA 4IVKA 3IXBA 2XK1A 1EROA 1CEGA 3OPHA 3AGEA 4JGPA 3UPOA 4YWZA 4Y0OA 3TRCA 4B93A 1FSWA 1HVBA 1Z6FA 5J7EA 1U60A 5TBMB 4E3NA 3LR5A 5CERA 4WN5A 4IJGA 4Z9QA 2W3FA 5AQ7A 1DY6A 1S1ZA 4ZRRA 4QJGA 3Q7ZA 1KGEA 4IBRA 5FEFA 4QWOA 3NOUC 5GLDA 3BQ8A 1OT9A 1MZUA 1ERQA 1TD5A 4KZ5A 3GVBA 4X25A 1DP9A 2P08A 4LV3A 3G30A 4BBVA 3ULFA 3BWLA 5DJTA 2VGJA 3IHAA 2A2LA 3W2ZA 1T1CA 5HDCA 3OCLA 1MWRA 3PXPA 3CWFA 5AVFA 4S2MA 5HAIA 3TOIA 1AXBA 1VETA 4ESPA 1MPLA 4O01A 4WUJA 5AQAA 1F5MA 1X0OA 3QP2A 4HBUA 4EEUA 1ONHA 2J80A 3S7NA 3VSKA 4E3IA 1G6OA 3VOLA 1HLUP 1NXYA 2WKIA 3UE1A 2XEPA 3MS6A 1HZOA 2Y2QA 3IH8A 4ZJ1A 3PTEA 4LRXC 2ZM0A 2P04A 2VZWA 3VE4A 4X6TA 1FOFA 4LRYC 3LY4A 3CUEC 1FILA 4IHQA 2W3GA 4KZ9A 1OT6A 3A0VA 3HJKA 5F5YA 5LBRA 3H7WB 4HBTA 1J3WA 2V0UA 5D3OA 4CJNA 1D06A 3UB6A 3QP6A 4FSFA 4R4RA 5I5LA 2J3TD 5CECA 1SKOA 5L07A 4D2OA 4GLQA 3HUOA 4L9EA 4DMZA 2PAVP 2KDKA 1CK3A 5FSRA 4N1XA 3KSIA 4Y2FA 3PHYA 4EBPA 4OP5A 1PZPA 3AGDA 4QY6A 1NZUA 1DP6A 1XKZA 2LB5A 4JXGA 2EXBA 2H0TA 1P9RA 4FH2A 3LO7A 4A5RA 1W7FA 3FZCA 5G18A 3B47A 2HP6A 2K7SA 1K57A 2INWA 1H8ZA 2WYXA 3T4QA 5TR7A 2B02A 4EXOA 3CAXA 1MWUA 1W63M 4AFIA 3DTEA 4OQIA 3LGOA 2YKFA 1HD8A 3G2ZA 2P9VB 5HW3A 4QHCA 3WRTA 1G6AA 2JKTI 2VA0A 5CGSA 2EWVA 1LL9A 3ZG8B 1L2SA 5GLAA 2JCHA 2Y4AA 1PI4A 5E2FA 2ZM2A 2VLGA 4KQQA 1OJ5A 4MN6A 2UWXA 2Z2LB 4L9GA 2WKQA 4HP9A 4BBTA 2V20A 3E2LA 4JGRA 1K4EA 4RYEA 4N92A 4YNRA 4HQAA 3ZNYA 2QJ5A 4PKYG 3HBRA 5L10A 1K54A 3BFDA 4KQRA 1K55C 1PRQA 1QMFA 4NETA 4B9OA 5EM0A 1GA9A 5TFQA 2PHYA 1N9LA 2XLNA 4BMWA 2V1AA 3FPVA 2DNSA 3HLBA 4R3JA 2VEAA 3IT9A 1V9YA 2QYBA 3IF5A 3QHYA 3OPPA 5GHZA 3OBFA 3UDXA 3ITAA 4XT2B 2HGVA 5L2FA 3NC8A 5A92A 1W63Q 1S4RA 3H82B 1CF0A 5HD3A 4I39A 3E4QA 5AQBA 2M7UA 4X68A 3LYXA 1BYWA 2KLIA 2O9CA 5EVID 1L3LA 1FCOA 3V3SA 5FI2A 2JKRM 2FZ0A 4P6ZM 2JKFA 1SHVA 2PDRA 4R4SA 5EVIA 5HFOA 4ETXA 3ZHHA 4C6YA 2EWWA 3IF6C 3OOVA 1BULA 1IEMA 4N9LA 1KE0A 3QP4A 4DJ3A 2HDRA 2W1TA 3UDIA 2Z6DA 4X1LA 3LR0A 2JE5A 4Q0HA 1PW8A 3K3DA 2Y2HA 3PBSA 3HLCA 1K0KA 2EFUA 1E3UD 2H0YA 5DJUA 2Y2PA 3SOIA 3VP1A 1KOUA 1FCMA 3VOZA 3NI9A 3ZG5A 3CMZA 4KZ6A 3KYQA 1E3UA 3MR0A 4UQIM 3MKEA 2ZOIA 3C2WA 4O7DA 3Q1FA 4P6ZS 4DF6A 5HARA 4S2IA 5HZHA 1C3BA 4S2NC 1RGYA 3BYDA 3F1NA 3T4JA 3VP3A 2Z2MB 3RH8B 4Y0TA 2ZC5B 4HEFA 5HPFA 2LB9A 1IFQA 4S2KA 2VV8A 4L0LA 1P97A 1ZTUA 3E98A 2QWSA 3BECA 2X02A 1KDWA 4B88A 1YM1A 5TGFA 1CI9A 3MQQA 3G4PA 4QY5A 1LHYA 4GD8A 1Z09A 5U47A 5FI7A 2RCXA 5CRFA 3T4LA 2QKPA 4LGWA 2MJ6A 3D4FA 4Y17A 3KO6A 3GSGA 4JPMA 1OTIA 4UQIS 3LEZA 5IT5A 4X55A 2WKRA 2K2NA 1BSGA 1FR6A 4MBKA 1T18A 1YLJA 1I2SA 1NYYA 4Y3IA 2Y79A 2ZC7A 3R4KA 3OZHA 5JYOA 4PAUA 2FH5A 1JWPA 1OJGA 1FCNA 2HDUA 1JNUA 4Z1WA 2WAEA 2EXAA 3GDIA 1XA7A 2V0WA 1H3QA 3WRZA 1NLYA 4E3OA 1Y54A 2V2FF 4WZ5C 1MKIA 4HI4A 4WEKA 3LFVA 3HLGA 4IBXA 3UE0A 3UPPA 2Y2OA 4HP4A 2WKPA 1T1AA 2WZXA 4JKTA 4LV0A 5EFWA 4Y5FA 2XD5A 4ME4A 4HESA 4OP8A 1Q2PA 2CMNA 4BLMA 3DWZA 2BLSA 3MQOA 3N7WA 4HJ6A 3FWLA 3VSLA 4DE1A 1SCWA 1BLCA 4KZAA 4JLFA 1I5QA 2HF6A 1LSVA 4F3LA 1VEUA 3EGXC 3MF0A 4CLCA 1BTLA 2XSSA 4EUVA 2O9BA 3IXGA 3NCKA 1YAXA 3N4IA 4GNUA 2H5SA 3BRMA 1LSXA 3PBOA 1S4SA 3A3IA 4II7A 3IQAA 1NRJA 1JWVA 4E3MA 2Q9NA 1GSVA 2ZMFA 4G3WA 1K38A 5F68A 4QD4A 2HDSA 2PU2A 1NZOA 2JC7A 2ZQDA 4NEED 3EGDC 3SW1A 1TVFA 4MEZA 4ZJ3A 3A0RA 2UV0E 3K2NA 2G2WA 3DW0A 4IUKA 3QNBA 1YLYA 2JN7A 2OSUA 2G2UA 1NWZA 4MCWA 3TJZC 2D01A 1KE4A 5K5BA 3T50A 4DRTA 3P7NA 1P9WA 1W5DA 2ZQAA 1Q2QA 3RXWA 3OPLA 3NDGA 4GN2A 4EU0A 2R9WA 3FYZA 2GJ3A 1VETB 5C5KA 5HL6A 2C5WB 4BL2A 3BM6A 4O0PA 1SDNA 1ES3A 3G2YA 4XUXA 1DJBA 1O07A 4E3JA 1XXMA 4JGQA 3JVVA 3K3CA 3O3VA 2Y91A 2OLUA 2PYRA 4BD0A 5FQKA 3KSGA 1LI9A 4I3IA 3UMDA 4E04A 1MKMA 1GSWA 3G35A 2BG1A 3IX3A 3MZFA 3IBJA 2ZD8A 1OPXA 5DFYA 3SZTA 1UGUA 4OLDA 3JVUA 1KE3A 4E6WA 4EBNA 4OQGA 2NUPC 5JYPA 2PBYA 4U3TA 5CX7A 3T4SA 3PBNA 3LY3A 2PRFA 3T1QB 5J3WA 2Y59A 3E4PA 1SKOB 4E3KA 5FA7A 3UN7A 3FG8A 4EESA 1YSPA 4PM9A 3V3RA 4EQ1A 3VV4A 3PBQA 1ES2A 3UB5P 3TE8A 3I7JA 3C5AA 1GA0A 2ZMVA 3IXDA 2EX6A 3DAVA 5FQJA 2V8FA 3BFCA 3LI8A 4K0XA 3AGFA 3W4QA 4R1GA 5DF9A 1GHIA 3PBTA 4S2JA 1TDGA 1YSQA 2OOLA 4R6LA 2PD7A 1ZC2A 4M4XA 3UNWA 1M6KA 2OAP1 1NRFA 4JXSA 5KSHA 1BLHA 3CG5A 3T1RA 3A0SA 3BLSA 3CUEA 4K0WA 5CHMA 5DKLA 4FUWA 4MNRA 4NXBA 3BFGA 2ZQCA 4WZ4A 4E3LA 3UMEA 2A49A 5CEBA 1LL5A 3G32A 2XF3A 2Y2GA 2DRWA 4ZBEA 5FL3A 2BTFP 1MWTA 1L0FA 5HWWA 2IWBA 2Q9MA 5CTMA 1GHPA 3HL9A 2E8JA 4GB7A 5L8MA 2PR5A 4DE2A 3ZDJA 4KQDA 5CGWA 2AVXA 2VGKA 3OLOA 1DJCA 3CJMA 2ZL1A 3OCNA 4RX3A 3Q7VA 3MXSA 3NHQA 3U2AA 4BQMA 4FOFA 1H8YA 1NJ4A 2W27A 3SS3A 4OQ0A 3IS2A 5F69A 2EX8A 4EWFA 5HAQA 4LRZE 3IWIA 4DDSA 4I38A 3N6IA 3DBAA 3SH7A 5FDHA 4MN5A 4Q0JA 2O0YA 3S1YA 2L0WA 4OH0A 4EQIA 3HUNA 1SDEA 3IXHA 1K54C 5HPIA 4WLAA 5FAPA 2JKGA 3BFEA 3HLDA 3LR4A 3V67A 2QPNA 3BJNA 5EVIB 3A3EA 5CTNA 5DTKA 3GV9A 4DE0A 4YOFA 4KQOA 1I2WA 2DCFA 4Y13A 1BT5A 1XGIA 4GDNA 5FQ9A 3VFFA 1F98A 5J4EA 4GHIA 4IVIA 4UA9A 3S4XA 2W1TB 2JKRI 1K55A 3O88A 3PR6A 4P0MA 3R7WA 1VHMA 2KOIA 4R0QA 2PD8A 2J8YA 3CITA 2R9XA 2ZC4B 2ACGA 1ESUA 4OOLA 3WS4A 3QP1A 1G68A 3W4PA 3U4LP 1K25A 1FSYA 4Y0UA 1ZG4A 1RCJA 3BEBA 3UDFA 4WL9A 3O86A 2WK0A 4EUZA 5EVIC 2KX6A 3L9KA 3T12B 4DE3A 4NG2A 4H8RA 2ZMAA 1YPRA 1BZAA 1S66L 3KSHA 4F94A 4G3KA 5M1AA 3D3OA 4LPZA 4WEJA 2P7JA 3F1NB 1UWNX 2VKSA 2HJEA 3NJAA 2GNXA 2XA7M 3DWKA 1FR1A 1CI8A 1O7EA 3L7HA 2J3WA 4XUZA 1K56D 3IF6A 3GTCA 1H5XA 4HH2A 5FQMA 1XGJA 3ITBA 4FD8A 1YMXA 3F1PA 3EQVA 4OONA 2XDMA 5GLBA 4LV1A 4I3AA 1K56A 1S0WA 2XFTA 2W1RA 3T4TA 3EQUA 4JGOA 4R70A 1YLPA 3PAEA 3WS2A 3MMHA 3ISGA 3P98A 3VFHA 3OC2A 4CLCE 1KGFA 4UA6A 1G28A 2G7UA 3BW6A 3V39A 4C3QA 4LENA 5FEGA 4KZBA 1DP8A 4GS9A 3IWOA 2WGVA 2VGLM 2XA7S 4RA7A 2WGWA 4LCMA 1XFQA 4NKPA 5FDSA 1H8MA 1IYPA 1ZKJA 2I72A 4S2NA 1ERMA 1IOUA 5AQ9A 1H0MA 4Y15A 3BY8A 4GZBA 3CPTA 1WE4A 4MLLA 5F6AA 4LCLA 3B3XA 3MBZA 3TSGA 3C8CA 3KYZA 4R38A 3C4OA 2WKEA 4WYYA 2QZ6A 3VOYA 4K91A 3IHBA 3HUMA 2PT7A 4JBFA 3RXXA 2HP5A 5FQIA 4KZ4A 4OPRA 4MN7A 3LIDA 4O8GA 1TS6A 3RJUA 2Y2JA 1ODVA 3HLEA 5AVEA 3LR3A 4HJ3A 1W8QA 4EERA 3EEAA 4F3LB 1VEUB 4FTXA 1LLBA 2OWJA 2VGLS 1XP4A 1YMSA 5KIZA 1EI5A 5EOEA 2FFYA 4P6BA 3P01A 4PM6A 4M3KA 3MXRA 1HTZA 3O5YA 1NYMA 4KUKA 3NOTC 4EW7A 2VK3A 4GOGA 1T19A 4OOYA 1JTGA 4MBFA 2WZZA 4JF6A 4I3JA 1STZA 5A90A 3IWQA 3BFFA 3UPNA 2JHEA 3GRJA 5EVLA 2ZM8A 4EV4A 4CLCD 4B4XA 1FIKA
chains in the Genus database with same CATH topology
2NUPC 4IUHA 2VLGA 1XFNA 1LT0A 1OJ5A 5CX7A 1TS0A 3S7OA 4MN6A 3T4SA 3PBNA 5IU1A 5HDSA 2OWHA 4L9GA 2WKQA 4HP9A 4BBTA 2A24A 4JGRA 2W3DA 4YNRA 5J3WA 4HQAA 3CI6A 3E4PA 1LL8A 1S1YA 2QJ5A 2BASA 4PKYG 2GZAA 3LIFA 3FG8A 4EESA 1NLZA 2QJ7A 1YSPA 3E0YA 2V1BA 2B18A 3D72A 4EQ1A 5A8BA 1WA9A 3VV4A 3PBQA 4B9OA 1VB6A 1OTAA 3TE8A 3HJIA 4GCZA 1DRMA 1P0ZA 2ZMVA 4NXEA 3ZYTA 2PHYA 1N9LA 3EEHA 4BMWA 2V1AA 3LI8A 1GSXA 3FPVA 3EOIA 2VEAA 5DF9A 3C38A 3PBTA 1V9YA 2QYBA 3BQAA 5HWVA 1XJ2A 4MMNA 1YSQA 3OBFA 2OOLA 4HJ4A 4XT2B 2HGVA 4R6LA 2PD7A 1W63Q 4M4XA 1S4RA 3H82B 2OAP1 5HD3A 1D7EA 4I39A 5KSHA 3E4QA 5HSQA 3IBRA 2M7UA 5DKKA 4WF0A 2L4RA 3NOPC 3A0SA 2Z6CA 3LYXA 4MDZA 2XRNA 3CUEA 1UWPX 4H6JA 5DKLA 1BYWA 2KLIA 2O9CA 2Y8HA 1TS7A 2QHKA 4BJPA 3UB9A 3H9WA 4NXBA 2JKRM 2FZ0A 4BWIA 4P6ZM 3MJQA 2ZBBA 4CLCB 2PDRA 3PBRA 4NXFA 4OOMA 3LIBA 1YKDA 4UEYA 3UMEA 2M7VA 4ETXA 2A24B 1XJ3A 2EWWA 1TF1A 5FL3A 4HOIA 5DFXA 3OOVA 2PR6A 5HWWA 1XJ6A 3BY9A 3KSFA 4DJ3A 4KUOA 3UB8A 3VE3A 2W1TA 4ARZA 5L8MA 2Z6DA 2PR5A 2HJ9C 4KQDA 3LR0A 2K31A 4I5SA 3S7QA 3F1OA 4Q0HA 3K3DA 4GW9A 3OLOA 3PBSA 5G4ZA 4RQ9A 3OCNA 3NHQA 2W3EA 3U2AA 4CQHA 3GECA 4FOFA 5DJUA 4G3VA 4CLCC 2W27A 1KOUA 1T1BA 5MC7A 3IS2A 5F69A 4LRZE 4I38A 3KYQA 3MQ0A 3MR0A 3DBAA 4UQIM 3RFBA 2ZOIA 4MN5A 3C2WA 4HHDA 1LSWA 4Q0JA 5HWTA 2O0YA 2L0WA 4P6ZS 5HZHA 4H6JB 4LLOB 1EW0A 5HPIA 4WLAA 5TJJA 3F1NA 4DN0A 5G4YA 5TBMA 3T4JA 2O9AA 3CLOA 3RH8B 3S7PA 3LR4A 3V67A 2HV1A 3BJNA 3ICYA 5HPFA 4GJ4A 2LB9A 1IFQA 3LIEA 2VV8A 3UE3A 4L0LA 4YOFA 1P97A 2PYPA 1ZTUA 3E98A 2QWSA 4KQOA 2IA2A 1F98A 5J4EA 4PHTA 2M1CA 4GHIA 3C30A 3MQQA 2D02A 2W1TB 2JKRI 3FPWA 4ARZB 2OAQ1 3PR6A 3R7WA 1VHMA 2EA9A 2KOIA 1N9NA 2W3HA 4HNBA 2PD8A 3CITA 1XJ4A 3E4OA 3F1OB 3T4LA 3T4OA 1F9IA 4OOLA 2QKPA 2MJ6A 3UB7A 3MFXA 3KO6A 2O99A 1OTIA 1OTBA 4UQIS 5IT5A 4WL9A 4ETZA 2J3TC 4EEPA 4WELA 2WKRA 2K2NA 2KX6A 3IS2B 1T18A 4HIAA 2YKHA 4JGPA 4YWZA 4Y3IA 2Y79A 3TRCA 3R4KA 4B93A 1S66L 3KSHA 4PAUA 2FH5A 4G3KA 1OJGA 5J7EA 3D3OA 1JNUA 4LPZA 4WEJA 2I9VA 2P7JA 3F1NB 3T4KA 1UWNX 2VKSA 4Z1WA 3GDIA 5TBMB 3LR5A 2V0WA 1H3QA 3LUQA 2HJEA 3NJAA 1NLYA 4WN5A 4IJGA 2GNXA 2XA7M 2W3FA 4HI4A 4WEKA 5IS1A 3LFVA 1S1ZA 2DMWA 2J3WA 4ZRRA 4HP4A 1OTEA 2WKPA 1T1AA 3LIAA 1OTDA 4HH2A 4GHIB 4Q0IA 5EFWA 2R78A 3F1PA 3H7WA 3NOUC 4Y5FA 3EQVA 3BQ8A 1OT9A 4ME4A 3R7WB 1MZUA 1TD5A 4I3AA 1DP9A 2P08A 2CMNA 4BBVA 3ULFA 2W1RA 4DJ2A 3BWLA 5DJTA 3MQOA 3T4TA 3EQUA 4HJ6A 4JGOA 4R70A 3KX0X 2A2LA 3W2ZA 1T1CA 3MMHA 2VV6A 5HDCA 3OCLA 5HD5A 4HH3A 3PXPA 3OC2A 4CLCE 2HF6A 1LSVA 4F3LA 2VJWA 1G28A 3EGXC 2G7UA 3CWFA 3MF0A 3BW6A 5AVFA 4CLCA 2XSSA 1ZHHB 4EUVA 2O9BA 4O01A 4WUJA 4R3AA 1F5MA 1X0OA 1DP8A 1YAXA 3FC7A 3EWKA 2ZOHA 4EEUA 4GS9A 2J80A 3S7NA 2VGLM 3B33A 2XA7S 1LSXA 1G6OA 2JKTM 4NKPA 1XFQA 3MXQA 3VOLA 1H8MA 3PBOA 1S4SA 4HY8A 3G6OA 4II7A 1IOUA 2L1MA 4LRXC 1TS8A 1NRJA 3BY8A 2P04A 2VZWA 3VE4A 2VX8A 4LRYC 1GSVA 5F6AA 2ZMFA 4G3WA 5F68A 3CUEC 4IHQA 2W3GA 2NUTC 1OT6A 3A0VA 4NEED 3EGDC 3HJKA 3C8CA 3ZQ5A 3SW1A 3KYZA 4R38A 5F5YA 3PYPA 3A0RA 5LBRA 3F1PB 3K2NA 3H7WB 3UE6A 4IUKA 2XROA 2V0UA 2GX5A 2JN7A 1D06A 1NWZA 2PT7A 2V9AA 4MCWA 3TJZC 3UB6A 4MN7A 3LIDA 4FSFA 2D01A 4O8GA 3LI9A 1TS6A 5K5BA 2VV7A 1ODVA 1Y28A 3HCYA 5I5LA 3T50A 5AVEA 2H28A 2J3TD 3P7NA 1P9WA 1MC0A 3LR3A 4HJ3A 4GLQA 4L9EA 4DMZA 4EERA 2KDKA 3EEAA 4F3LB 3KSIA 4Y2FA 3PHYA 1S67L 2OWJA 4EU0A 4K08A 2VGLS 2GJ3A 5C5KA 5KIZA 5HL6A 3P01A 4O0PA 4GS9B 1DP6A 3O5YA 4PKYA 2LB5A 1P9RA 2W0NA 4KUKA 3RTYA 4JGQA 3NOTC 3JVVA 4EW7A 3K3CA 1T19A 4QPRA 4NXGA 3B47A 2K7SA 2PYRA 2INWA 5AJGA 3KSGA 4XT2A 3B42A 4I3JA 3T4QA 2B02A 4EXOA 3CAXA 4I3IA 1STZA 3UMDA 4E04A 1MKMA 1GSWA 5HDDA 3H82A 1W63M 4AFIA 2JHEA 4L9FA 3TW8A 4BBUA 4EETB 3IBJA 2YKFA 1OPXA 4CLCD 5DFYA 2JKTI 2VA0A 3LICA 1UGUA 3JVUA 1V9ZA 1N9OA 2EWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLG A;  1XFN A;  1LT0 A;  1OJ5 A;  1TS0 A;  4MN6 A;  5IU1 A;  5HDS A;  2OWH A;  4L9G A;  2WKQ A;  4HP9 A;  4BBT A;  2A24 A;  4JGR A;  5J3W A;  4HQA A;  3E4P A;  1LL8 A;  1S1Y A;  2QJ5 A;  2BAS A;  4PKY G;  3LIF A;  3FG8 A;  4EES A;  2QJ7 A;  2V1B A;  3D72 A;  4EQ1 A;  5A8B A;  1WA9 A;  4B9O A;  1VB6 A;  1OTA A;  3HJI A;  4GCZ A;  1DRM A;  1P0Z A;  4NXE A;  2PHY A;  1N9L A;  3EEH A;  2V1A A;  3LI8 A;  1GSX A;  2VEA A;  1V9Y A;  5HWV A;  1XJ2 A;  2OOL A;  4HJ4 A;  4XT2 B;  4R6L A;  2PD7 A;  4M4X A;  1S4R A;  3H82 B;  5HD3 A;  1D7E A;  4I39 A;  3E4Q A;  5HSQ A;  3IBR A;  5DKK A;  4WF0 A;  2L4R A;  3NOP C;  3A0S A;  2Z6C A;  3LYX A;  1UWP X;  4H6J A;  5DKL A;  1BYW A;  1TS7 A;  2QHK A;  3UB9 A;  3H9W A;  4NXB A;  3MJQ A;  2ZBB A;  2PDR A;  4NXF A;  3LIB A;  3UME A;  2A24 B;  1XJ3 A;  4HOI A;  2PR6 A;  5HWW A;  1XJ6 A;  3BY9 A;  4DJ3 A;  4KUO A;  3UB8 A;  3VE3 A;  2Z6D A;  2PR5 A;  4KQD A;  4I5S A;  3F1O A;  3K3D A;  4GW9 A;  3OLO A;  5G4Z A;  4RQ9 A;  3NHQ A;  3GEC A;  5DJU A;  2W27 A;  1KOU A;  1T1B A;  3IS2 A;  5F69 A;  4LRZ E;  4I38 A;  3MR0 A;  2ZOI A;  4MN5 A;  3C2W A;  4HHD A;  1LSW A;  5HWT A;  2L0W A;  5HZH A;  4H6J B;  4LLO B;  1EW0 A;  4WLA A;  3F1N A;  5G4Y A;  5TBM A;  3CLO A;  3RH8 B;  2HV1 A;  3ICY A;  3LIE A;  2VV8 A;  1P97 A;  2PYP A;  2QWS A;  1F98 A;  5J4E A;  2M1C A;  4GHI A;  3MQQ A;  2D02 A;  2EA9 A;  1N9N A;  4HNB A;  2PD8 A;  1XJ4 A;  3E4O A;  3F1O B;  1F9I A;  2QKP A;  3UB7 A;  3MFX A;  1OTI A;  1OTB A;  4WL9 A;  4EEP A;  2WKR A;  2KX6 A;  3IS2 B;  1T18 A;  4HIA A;  2YKH A;  4JGP A;  4YWZ A;  1S66 L;  1OJG A;  5J7E A;  1JNU A;  4LPZ A;  2I9V A;  2P7J A;  3F1N B;  1UWN X;  3GDI A;  5TBM B;  2V0W A;  3LUQ A;  3NJA A;  4WN5 A;  4HI4 A;  5IS1 A;  1S1Z A;  4HP4 A;  1OTE A;  2WKP A;  1T1A A;  3LIA A;  1OTD A;  4HH2 A;  4GHI B;  5EFW A;  2R78 A;  3F1P A;  3H7W A;  3NOU C;  1OT9 A;  1MZU A;  4I3A A;  1DP9 A;  2CMN A;  4BBV A;  3ULF A;  4DJ2 A;  3BWL A;  5DJT A;  3MQO A;  4HJ6 A;  4JGO A;  4R70 A;  3KX0 X;  1T1C A;  2VV6 A;  5HDC A;  5HD5 A;  4HH3 A;  1LSV A;  4F3L A;  1G28 A;  3CWF A;  5AVF A;  4WUJ A;  4R3A A;  1X0O A;  1DP8 A;  3FC7 A;  3EWK A;  2ZOH A;  4EEU A;  4GS9 A;  2J80 A;  3B33 A;  1LSX A;  3VOL A;  1XFQ A;  3MXQ A;  1S4S A;  4HY8 A;  3G6O A;  2L1M A;  4LRX C;  1TS8 A;  3BY8 A;  3VE4 A;  4LRY C;  1GSV A;  5F6A A;  5F68 A;  1OT6 A;  3A0V A;  3HJK A;  3C8C A;  3ZQ5 A;  3SW1 A;  4R38 A;  5F5Y A;  3PYP A;  3A0R A;  3F1P B;  3H7W B;  3UE6 A;  2V0U A;  2JN7 A;  1D06 A;  1NWZ A;  2V9A A;  3UB6 A;  3LID A;  2D01 A;  3LI9 A;  1TS6 A;  2VV7 A;  1ODV A;  1Y28 A;  3T50 A;  5I5L A;  5AVE A;  2H28 A;  3P7N A;  4HJ3 A;  4L9E A;  4EER A;  2KDK A;  4F3L B;  3PHY A;  1S67 L;  2OWJ A;  4K08 A;  2GJ3 A;  5KIZ A;  4GS9 B;  1DP6 A;  4PKY A;  2W0N A;  4KUK A;  3RTY A;  4JGQ A;  3NOT C;  4EW7 A;  3K3C A;  1T19 A;  4NXG A;  2K7S A;  2PYR A;  2INW A;  4XT2 A;  4I3J A;  2B02 A;  4EXO A;  3CAX A;  4I3I A;  3UMD A;  4E04 A;  1GSW A;  5HDD A;  3H82 A;  2JHE A;  4L9F A;  4BBU A;  4EET B;  2YKF A;  3LIC A;  1UGU A;  1V9Z A;  1N9O A; 
#chains in the Genus database with same CATH topology
 3O87 A;  2FFF B;  2HDQ A;  4ZAM A;  3VP2 A;  1OME A;  1XFN A;  1LT0 A;  2E8I A;  3FKW A;  1FQG A;  3S7O A;  5HDS A;  1J9M A;  2OWH A;  1KVL A;  3UY6 A;  2A24 A;  3SH9 A;  1PI5 A;  3NY4 A;  3CI6 A;  2X01 A;  1LL8 A;  1S1Y A;  1ACF A;  2GZA A;  3V50 A;  2QJ7 A;  3E0Y A;  2B18 A;  4OPZ A;  3D72 A;  5GHX A;  3DTI A;  1IKG A;  1PNE A;  1RGZ A;  4KG2 A;  1ES4 A;  2WKH A;  1JVJ A;  5DVA A;  3EOI A;  4YIN A;  3WWX A;  3C38 A;  3BQA A;  5HWV A;  1XJ2 A;  3MSH A;  5EE8 A;  1D7E A;  1G5U A;  2EX9 A;  5HSQ A;  2H10 A;  5DKK A;  5HX9 A;  2L4R A;  3NOP C;  4MDZ A;  1UWP X;  4ZJ2 A;  4H6J A;  3WS5 A;  5FAT A;  1ESI A;  4U0X A;  3UB9 A;  3H9W A;  5A93 A;  2XGN A;  2ZBB A;  4X56 A;  4OOM A;  4CPK A;  1IYO A;  1IYS A;  1YKD A;  2M7V A;  1XJ3 A;  3MZE A;  2J9O A;  3HVF A;  1L0D A;  1TF1 A;  4HOI A;  5DFX A;  3MFD A;  2PR6 A;  2Y2N A;  3BY9 A;  3KSF A;  4KUO A;  2ZC3 B;  1YT4 A;  4ARZ A;  3WS0 A;  5EM1 A;  2HP9 A;  3N8S A;  2WUQ A;  2ZQ9 A;  2HJ9 C;  2K31 A;  4OPY A;  4DDY A;  3F1O A;  2IWC A;  4GW9 A;  1ZG6 A;  5KSC A;  3A3F A;  1S6R A;  5G4Z A;  4RQ9 A;  2W3E A;  4RX2 A;  5M18 A;  3NDE A;  5L09 A;  1T1B A;  3MQ0 A;  2Y2L A;  2ZC6 B;  1W8Y A;  2V8C A;  4PM5 A;  5HWT A;  1LSW A;  3BLM A;  5FAQ A;  4JXW A;  4N9K A;  4LV2 A;  4LLO B;  5FI6 A;  1YLW A;  5EUA A;  4JXV A;  3TG9 A;  4DN0 A;  5TBM A;  4DKI A;  5KMW A;  3IH9 A;  4JF5 A;  1N4O A;  4KZ3 A;  2HV1 A;  3ICY A;  1L0G A;  4GJ4 A;  3LIE A;  4OVD A;  1KGG A;  3IX8 A;  4KZ8 A;  3C30 A;  3G34 A;  4UA7 A;  2D02 A;  4EBL A;  1TEM A;  3FPW A;  3S22 A;  3M6H A;  2ZQ8 A;  4N1H A;  2EA9 A;  1N9N A;  2W3H A;  3QP5 A;  4UAA A;  4HNB A;  2QMI A;  3E4O A;  3T4O A;  1E25 A;  3UB7 A;  3MFX A;  2ZL1 B;  5DF8 A;  4NK3 A;  3Q7V B;  1PFL A;  3ZG9 B;  1OTB A;  5KZH A;  1YLT A;  1GCE A;  3ZCZ A;  1KVM A;  3CZD A;  4ETZ A;  2J3T C;  4EEP A;  1ES5 A;  1YLZ A;  4WEL A;  3IS2 B;  3OPR A;  1PIO A;  4HIA A;  3ZG7 B;  2YKH A;  1IKI A;  1K4F A;  5F82 A;  5FAO A;  1QME A;  2I9V A;  1K57 C;  4PM7 A;  3T4K A;  5GHY A;  3LUQ A;  4GDB A;  4UHU A;  5FAS A;  5IS1 A;  2DMW A;  1OTE A;  5GL9 A;  3LIA A;  3N8L A;  4ZTK A;  1OTD A;  1D1J A;  3SH8 A;  4GHI B;  4PM8 A;  4Q0I A;  4R3B A;  3FKV A;  1PW1 A;  2R78 A;  3H7W A;  4OKP A;  3R7W B;  5J8X A;  3ZFZ A;  2HZ5 A;  4KEN B;  5F1G A;  4DJ2 A;  3KX0 X;  1PWG A;  2Y2M A;  2VV6 A;  5HD5 A;  4HH3 A;  5HAP A;  5CXW A;  2VJW A;  2B95 A;  1MY8 A;  4MBH A;  2EX2 A;  1M40 A;  1ZHH B;  3ZVT A;  4WMC D;  4R3A A;  1MXO A;  3FC7 A;  3EWK A;  2ZOH A;  4PPR A;  3B33 A;  1GHM A;  2XR0 A;  3GR2 A;  4OLG A;  2JKT M;  4Q8I A;  4WMC A;  1JTD A;  3MXQ A;  3M6B A;  4HY8 A;  3G6O A;  2XQZ A;  2L1M A;  5E2G A;  3JPU A;  1TS8 A;  3CHW P;  3QNC A;  4S2O A;  2VX8 A;  4E6X A;  4QU3 A;  3LEQ A;  4LFU A;  1K6R A;  1VM1 A;  1N9B A;  2P9V A;  2NUT C;  3IF6 B;  3ZQ5 A;  4IED A;  3PYP A;  1EWZ A;  3F1P B;  3LCE A;  3UE6 A;  4BL3 A;  2XRO A;  1F2K A;  2GX5 A;  4BEN A;  3GQZ A;  1DJA A;  2V9A A;  3C7U A;  4YFM A;  2OV5 A;  3LI9 A;  3SS4 A;  2VV7 A;  3NEC A;  3HCY A;  1Y28 A;  2H28 A;  2WAF A;  2EFX A;  4FCF A;  4R23 A;  1BLP A;  4DXB A;  1MC0 A;  4ID4 A;  3T1X A;  5HL1 A;  2J9P A;  3NIA A;  1S67 L;  2XD1 A;  5BOH A;  4K08 A;  4KG5 A;  5F1F A;  2ZLY A;  5F83 A;  4QB8 A;  4GS9 B;  5E43 A;  3MZD A;  4PKY A;  4S2L A;  5FQQ A;  2WGW B;  2W0N A;  4X69 A;  3RTY A;  3HLF A;  4QPR A;  4NXG A;  1MWS A;  2Y55 A;  3Q81 A;  5AJG A;  4S2P A;  5EPH A;  4XT2 A;  3B42 A;  4WBG A;  5CHJ A;  4GKU A;  3CPT B;  5HDD A;  3H82 A;  4FH4 A;  4L9F A;  3A3J A;  3TW8 A;  4BBU A;  3DTK A;  4EET B;  1XX2 A;  3GMW A;  4P87 A;  1TDL A;  5EVE A;  3LIC A;  1V9Z A;  1N9O A;  3NUL A;  2C6W B;  4IUH A;  1LI0 A;  4P85 A;  1TS0 A;  4KG6 A;  1RP5 A;  5IU1 A;  3IX4 A;  1BUE A;  2HPB A;  5I94 A;  2W3D A;  3FV7 A;  1AWI A;  5M19 A;  2GDN A;  2BAS A;  1CJF A;  3LIF A;  1NLZ A;  2V1B A;  3A3D A;  1IEL A;  1PYY A;  2RL3 A;  3DTM A;  5DF7 A;  4KZ7 A;  3V5M A;  5A8B A;  4RVA A;  1WA9 A;  2WGI A;  1ONG A;  2PU4 A;  1VB6 A;  1K6S A;  1OTA A;  3HJI A;  4GCZ A;  1DRM A;  1XA1 A;  1P0Z A;  3ZYT A;  4NXE A;  2PBD P;  4BD1 A;  3EEH A;  2V1Z A;  2XH9 A;  3VP4 A;  3QP8 A;  1GSX A;  2A3U A;  4DXC A;  3WS1 A;  4MMN A;  1ALQ A;  4ZDX A;  5EOO A;  4HJ4 A;  1CQA A;  3M2K A;  2OLV A;  3Q07 A;  4PMA A;  4WM9 A;  4OQH A;  2J7V A;  4X53 A;  3W8K A;  4Y7P A;  3IBR A;  1W79 A;  4WF0 A;  4C75 A;  1PZO A;  3N8R A;  1YQS A;  2Z6C A;  5CGX A;  2XRN A;  3HRE A;  2Y8H A;  3UO9 A;  1TS7 A;  2QHK A;  4BJP A;  3C7V A;  3PAG A;  2XFS A;  3VMA A;  4BWI A;  3MJQ A;  4CLC B;  3PBR A;  4NXF A;  3ZVW A;  1L0E A;  1SZV A;  3LIB A;  2P74 A;  4OPQ A;  2ZQ7 A;  1JWZ A;  4UEY A;  2A24 B;  3P09 A;  1VQQ A;  4GD6 A;  1XJ6 A;  1XPB A;  3G31 A;  3UB8 A;  3VE3 A;  1PWD A;  3E2K A;  4X1M A;  1E4D A;  4WZ5 A;  4I5S A;  5A91 A;  3S7Q A;  5DTS A;  1WYB A;  3VP0 A;  3HLW A;  1KDS A;  2Y2K A;  5E2E A;  4CQH A;  3GEC A;  2WAD A;  5EEC A;  4G3V A;  5GLC A;  4CLC C;  1IYQ A;  4XXR A;  5MC7 A;  1WYC A;  5EV0 A;  3RFB A;  2B5R A;  4HHD A;  3NBL A;  1A0K A;  2CC1 A;  4H6J B;  2X71 A;  5CHU A;  1EW0 A;  5DTT A;  5TJJ A;  3JYI A;  4U0T A;  5G4Y A;  3ZG0 A;  3W4O A;  2O9A A;  3KYE A;  5CED A;  3CLO A;  3S7P A;  1NY0 A;  2JBF A;  3M2J A;  2ZJ9 A;  4JF4 A;  1SKF A;  3UE3 A;  3ZGA B;  2PYP A;  4D60 A;  2Q0O A;  4B4Z A;  1CEF A;  1PWC A;  2IA2 A;  5E2H A;  1BLS A;  3D9Y A;  4PHT A;  2M1C A;  2Y2I A;  3SS5 A;  3ZNT A;  4ARZ B;  2OAQ 1;  3MKF A;  3C4P A;  1MBL A;  1XJ4 A;  3F1O B;  2IWD A;  1F9I A;  2O99 A;  1Y4O A;  5IHV A;  3Q82 A;  3T1S A;  4IVK A;  3IXB A;  2XK1 A;  1ERO A;  1CEG A;  3OPH A;  3AGE A;  4JGP A;  3UPO A;  4YWZ A;  4Y0O A;  3TRC A;  4B93 A;  1FSW A;  1HVB A;  1Z6F A;  5J7E A;  1U60 A;  5TBM B;  4E3N A;  3LR5 A;  5CER A;  4WN5 A;  4IJG A;  4Z9Q A;  2W3F A;  5AQ7 A;  1DY6 A;  1S1Z A;  4ZRR A;  4QJG A;  3Q7Z A;  1KGE A;  4IBR A;  5FEF A;  4QWO A;  3NOU C;  5GLD A;  3BQ8 A;  1OT9 A;  1MZU A;  1ERQ A;  1TD5 A;  4KZ5 A;  3GVB A;  4X25 A;  1DP9 A;  2P08 A;  4LV3 A;  3G30 A;  4BBV A;  3ULF A;  3BWL A;  5DJT A;  2VGJ A;  3IHA A;  2A2L A;  3W2Z A;  1T1C A;  5HDC A;  3OCL A;  1MWR A;  3PXP A;  3CWF A;  5AVF A;  4S2M A;  5HAI A;  3TOI A;  1AXB A;  1VET A;  4ESP A;  1MPL A;  4O01 A;  4WUJ A;  5AQA A;  1F5M A;  1X0O A;  3QP2 A;  4HBU A;  4EEU A;  1ONH A;  2J80 A;  3S7N A;  3VSK A;  4E3I A;  1G6O A;  3VOL A;  1HLU P;  1NXY A;  2WKI A;  3UE1 A;  2XEP A;  3MS6 A;  1HZO A;  2Y2Q A;  3IH8 A;  4ZJ1 A;  3PTE A;  4LRX C;  2ZM0 A;  2P04 A;  2VZW A;  3VE4 A;  4X6T A;  1FOF A;  4LRY C;  3LY4 A;  3CUE C;  1FIL A;  4IHQ A;  2W3G A;  4KZ9 A;  1OT6 A;  3A0V A;  3HJK A;  5F5Y A;  5LBR A;  3H7W B;  4HBT A;  1J3W A;  2V0U A;  5D3O A;  4CJN A;  1D06 A;  3UB6 A;  3QP6 A;  4FSF A;  4R4R A;  5I5L A;  2J3T D;  5CEC A;  1SKO A;  5L07 A;  4D2O A;  4GLQ A;  3HUO A;  4L9E A;  4DMZ A;  2PAV P;  2KDK A;  1CK3 A;  5FSR A;  4N1X A;  3KSI A;  4Y2F A;  3PHY A;  4EBP A;  4OP5 A;  1PZP A;  3AGD A;  4QY6 A;  1NZU A;  1DP6 A;  1XKZ A;  2LB5 A;  4JXG A;  2EXB A;  2H0T A;  1P9R A;  4FH2 A;  3LO7 A;  4A5R A;  1W7F A;  3FZC A;  5G18 A;  3B47 A;  2HP6 A;  2K7S A;  1K57 A;  2INW A;  1H8Z A;  2WYX A;  3T4Q A;  5TR7 A;  2B02 A;  4EXO A;  3CAX A;  1MWU A;  1W63 M;  4AFI A;  3DTE A;  4OQI A;  3LGO A;  2YKF A;  1HD8 A;  3G2Z A;  2P9V B;  5HW3 A;  4QHC A;  3WRT A;  1G6A A;  2JKT I;  2VA0 A;  5CGS A;  2EWV A;  1LL9 A;  3ZG8 B;  1L2S A;  5GLA A;  2JCH A;  2Y4A A;  1PI4 A;  5E2F A;  2ZM2 A;  2VLG A;  4KQQ A;  1OJ5 A;  4MN6 A;  2UWX A;  2Z2L B;  4L9G A;  2WKQ A;  4HP9 A;  4BBT A;  2V20 A;  3E2L A;  4JGR A;  1K4E A;  4RYE A;  4N92 A;  4YNR A;  4HQA A;  3ZNY A;  2QJ5 A;  4PKY G;  3HBR A;  5L10 A;  1K54 A;  3BFD A;  4KQR A;  1K55 C;  1PRQ A;  1QMF A;  4NET A;  4B9O A;  5EM0 A;  1GA9 A;  5TFQ A;  2PHY A;  1N9L A;  2XLN A;  4BMW A;  2V1A A;  3FPV A;  2DNS A;  3HLB A;  4R3J A;  2VEA A;  3IT9 A;  1V9Y A;  2QYB A;  3IF5 A;  3QHY A;  3OPP A;  5GHZ A;  3OBF A;  3UDX A;  3ITA A;  4XT2 B;  2HGV A;  5L2F A;  3NC8 A;  5A92 A;  1W63 Q;  1S4R A;  3H82 B;  1CF0 A;  5HD3 A;  4I39 A;  3E4Q A;  5AQB A;  2M7U A;  4X68 A;  3LYX A;  1BYW A;  2KLI A;  2O9C A;  5EVI D;  1L3L A;  1FCO A;  3V3S A;  5FI2 A;  2JKR M;  2FZ0 A;  4P6Z M;  2JKF A;  1SHV A;  2PDR A;  4R4S A;  5EVI A;  5HFO A;  4ETX A;  3ZHH A;  4C6Y A;  2EWW A;  3IF6 C;  3OOV A;  1BUL A;  1IEM A;  4N9L A;  1KE0 A;  3QP4 A;  4DJ3 A;  2HDR A;  2W1T A;  3UDI A;  2Z6D A;  4X1L A;  3LR0 A;  2JE5 A;  4Q0H A;  1PW8 A;  3K3D A;  2Y2H A;  3PBS A;  3HLC A;  1K0K A;  2EFU A;  1E3U D;  2H0Y A;  5DJU A;  2Y2P A;  3SOI A;  3VP1 A;  1KOU A;  1FCM A;  3VOZ A;  3NI9 A;  3ZG5 A;  3CMZ A;  4KZ6 A;  3KYQ A;  1E3U A;  3MR0 A;  4UQI M;  3MKE A;  2ZOI A;  3C2W A;  4O7D A;  3Q1F A;  4P6Z S;  4DF6 A;  5HAR A;  4S2I A;  5HZH A;  1C3B A;  4S2N C;  1RGY A;  3BYD A;  3F1N A;  3T4J A;  3VP3 A;  2Z2M B;  3RH8 B;  4Y0T A;  2ZC5 B;  4HEF A;  5HPF A;  2LB9 A;  1IFQ A;  4S2K A;  2VV8 A;  4L0L A;  1P97 A;  1ZTU A;  3E98 A;  2QWS A;  3BEC A;  2X02 A;  1KDW A;  4B88 A;  1YM1 A;  5TGF A;  1CI9 A;  3MQQ A;  3G4P A;  4QY5 A;  1LHY A;  4GD8 A;  1Z09 A;  5U47 A;  5FI7 A;  2RCX A;  5CRF A;  3T4L A;  2QKP A;  4LGW A;  2MJ6 A;  3D4F A;  4Y17 A;  3KO6 A;  3GSG A;  4JPM A;  1OTI A;  4UQI S;  3LEZ A;  5IT5 A;  4X55 A;  2WKR A;  2K2N A;  1BSG A;  1FR6 A;  4MBK A;  1T18 A;  1YLJ A;  1I2S A;  1NYY A;  4Y3I A;  2Y79 A;  2ZC7 A;  3R4K A;  3OZH A;  5JYO A;  4PAU A;  2FH5 A;  1JWP A;  1OJG A;  1FCN A;  2HDU A;  1JNU A;  4Z1W A;  2WAE A;  2EXA A;  3GDI A;  1XA7 A;  2V0W A;  1H3Q A;  3WRZ A;  1NLY A;  4E3O A;  1Y54 A;  2V2F F;  4WZ5 C;  1MKI A;  4HI4 A;  4WEK A;  3LFV A;  3HLG A;  4IBX A;  3UE0 A;  3UPP A;  2Y2O A;  4HP4 A;  2WKP A;  1T1A A;  2WZX A;  4JKT A;  4LV0 A;  5EFW A;  4Y5F A;  2XD5 A;  4ME4 A;  4HES A;  4OP8 A;  1Q2P A;  2CMN A;  4BLM A;  3DWZ A;  2BLS A;  3MQO A;  3N7W A;  4HJ6 A;  3FWL A;  3VSL A;  4DE1 A;  1SCW A;  1BLC A;  4KZA A;  4JLF A;  1I5Q A;  2HF6 A;  1LSV A;  4F3L A;  1VEU A;  3EGX C;  3MF0 A;  4CLC A;  1BTL A;  2XSS A;  4EUV A;  2O9B A;  3IXG A;  3NCK A;  1YAX A;  3N4I A;  4GNU A;  2H5S A;  3BRM A;  1LSX A;  3PBO A;  1S4S A;  3A3I A;  4II7 A;  3IQA A;  1NRJ A;  1JWV A;  4E3M A;  2Q9N A;  1GSV A;  2ZMF A;  4G3W A;  1K38 A;  5F68 A;  4QD4 A;  2HDS A;  2PU2 A;  1NZO A;  2JC7 A;  2ZQD A;  4NEE D;  3EGD C;  3SW1 A;  1TVF A;  4MEZ A;  4ZJ3 A;  3A0R A;  2UV0 E;  3K2N A;  2G2W A;  3DW0 A;  4IUK A;  3QNB A;  1YLY A;  2JN7 A;  2OSU A;  2G2U A;  1NWZ A;  4MCW A;  3TJZ C;  2D01 A;  1KE4 A;  5K5B A;  3T50 A;  4DRT A;  3P7N A;  1P9W A;  1W5D A;  2ZQA A;  1Q2Q A;  3RXW A;  3OPL A;  3NDG A;  4GN2 A;  4EU0 A;  2R9W A;  3FYZ A;  2GJ3 A;  1VET B;  5C5K A;  5HL6 A;  2C5W B;  4BL2 A;  3BM6 A;  4O0P A;  1SDN A;  1ES3 A;  3G2Y A;  4XUX A;  1DJB A;  1O07 A;  4E3J A;  1XXM A;  4JGQ A;  3JVV A;  3K3C A;  3O3V A;  2Y91 A;  2OLU A;  2PYR A;  4BD0 A;  5FQK A;  3KSG A;  1LI9 A;  4I3I A;  3UMD A;  4E04 A;  1MKM A;  1GSW A;  3G35 A;  2BG1 A;  3IX3 A;  3MZF A;  3IBJ A;  2ZD8 A;  1OPX A;  5DFY A;  3SZT A;  1UGU A;  4OLD A;  3JVU A;  1KE3 A;  4E6W A;  4EBN A;  4OQG A;  2NUP C;  5JYP A;  2PBY A;  4U3T A;  5CX7 A;  3T4S A;  3PBN A;  3LY3 A;  2PRF A;  3T1Q B;  5J3W A;  2Y59 A;  3E4P A;  1SKO B;  4E3K A;  5FA7 A;  3UN7 A;  3FG8 A;  4EES A;  1YSP A;  4PM9 A;  3V3R A;  4EQ1 A;  3VV4 A;  3PBQ A;  1ES2 A;  3UB5 P;  3TE8 A;  3I7J A;  3C5A A;  1GA0 A;  2ZMV A;  3IXD A;  2EX6 A;  3DAV A;  5FQJ A;  2V8F A;  3BFC A;  3LI8 A;  4K0X A;  3AGF A;  3W4Q A;  4R1G A;  5DF9 A;  1GHI A;  3PBT A;  4S2J A;  1TDG A;  1YSQ A;  2OOL A;  4R6L A;  2PD7 A;  1ZC2 A;  4M4X A;  3UNW A;  1M6K A;  2OAP 1;  1NRF A;  4JXS A;  5KSH A;  1BLH A;  3CG5 A;  3T1R A;  3A0S A;  3BLS A;  3CUE A;  4K0W A;  5CHM A;  5DKL A;  4FUW A;  4MNR A;  4NXB A;  3BFG A;  2ZQC A;  4WZ4 A;  4E3L A;  3UME A;  2A49 A;  5CEB A;  1LL5 A;  3G32 A;  2XF3 A;  2Y2G A;  2DRW A;  4ZBE A;  5FL3 A;  2BTF P;  1MWT A;  1L0F A;  5HWW A;  2IWB A;  2Q9M A;  5CTM A;  1GHP A;  3HL9 A;  2E8J A;  4GB7 A;  5L8M A;  2PR5 A;  4DE2 A;  3ZDJ A;  4KQD A;  5CGW A;  2AVX A;  2VGK A;  3OLO A;  1DJC A;  3CJM A;  2ZL1 A;  3OCN A;  4RX3 A;  3Q7V A;  3MXS A;  3NHQ A;  3U2A A;  4BQM A;  4FOF A;  1H8Y A;  1NJ4 A;  2W27 A;  3SS3 A;  4OQ0 A;  3IS2 A;  5F69 A;  2EX8 A;  4EWF A;  5HAQ A;  4LRZ E;  3IWI A;  4DDS A;  4I38 A;  3N6I A;  3DBA A;  3SH7 A;  5FDH A;  4MN5 A;  4Q0J A;  2O0Y A;  3S1Y A;  2L0W A;  4OH0 A;  4EQI A;  3HUN A;  1SDE A;  3IXH A;  1K54 C;  5HPI A;  4WLA A;  5FAP A;  2JKG A;  3BFE A;  3HLD A;  3LR4 A;  3V67 A;  2QPN A;  3BJN A;  5EVI B;  3A3E A;  5CTN A;  5DTK A;  3GV9 A;  4DE0 A;  4YOF A;  4KQO A;  1I2W A;  2DCF A;  4Y13 A;  1BT5 A;  1XGI A;  4GDN A;  5FQ9 A;  3VFF A;  1F98 A;  5J4E A;  4GHI A;  4IVI A;  4UA9 A;  3S4X A;  2W1T B;  2JKR I;  1K55 A;  3O88 A;  3PR6 A;  4P0M A;  3R7W A;  1VHM A;  2KOI A;  4R0Q A;  2PD8 A;  2J8Y A;  3CIT A;  2R9X A;  2ZC4 B;  2ACG A;  1ESU A;  4OOL A;  3WS4 A;  3QP1 A;  1G68 A;  3W4P A;  3U4L P;  1K25 A;  1FSY A;  4Y0U A;  1ZG4 A;  1RCJ A;  3BEB A;  3UDF A;  4WL9 A;  3O86 A;  2WK0 A;  4EUZ A;  5EVI C;  2KX6 A;  3L9K A;  3T12 B;  4DE3 A;  4NG2 A;  4H8R A;  2ZMA A;  1YPR A;  1BZA A;  1S66 L;  3KSH A;  4F94 A;  4G3K A;  5M1A A;  3D3O A;  4LPZ A;  4WEJ A;  2P7J A;  3F1N B;  1UWN X;  2VKS A;  2HJE A;  3NJA A;  2GNX A;  2XA7 M;  3DWK A;  1FR1 A;  1CI8 A;  1O7E A;  3L7H A;  2J3W A;  4XUZ A;  1K56 D;  3IF6 A;  3GTC A;  1H5X A;  4HH2 A;  5FQM A;  1XGJ A;  3ITB A;  4FD8 A;  1YMX A;  3F1P A;  3EQV A;  4OON A;  2XDM A;  5GLB A;  4LV1 A;  4I3A A;  1K56 A;  1S0W A;  2XFT A;  2W1R A;  3T4T A;  3EQU A;  4JGO A;  4R70 A;  1YLP A;  3PAE A;  3WS2 A;  3MMH A;  3ISG A;  3P98 A;  3VFH A;  3OC2 A;  4CLC E;  1KGF A;  4UA6 A;  1G28 A;  2G7U A;  3BW6 A;  3V39 A;  4C3Q A;  4LEN A;  5FEG A;  4KZB A;  1DP8 A;  4GS9 A;  3IWO A;  2WGV A;  2VGL M;  2XA7 S;  4RA7 A;  2WGW A;  4LCM A;  1XFQ A;  4NKP A;  5FDS A;  1H8M A;  1IYP A;  1ZKJ A;  2I72 A;  4S2N A;  1ERM A;  1IOU A;  5AQ9 A;  1H0M A;  4Y15 A;  3BY8 A;  4GZB A;  3CPT A;  1WE4 A;  4MLL A;  5F6A A;  4LCL A;  3B3X A;  3MBZ A;  3TSG A;  3C8C A;  3KYZ A;  4R38 A;  3C4O A;  2WKE A;  4WYY A;  2QZ6 A;  3VOY A;  4K91 A;  3IHB A;  3HUM A;  2PT7 A;  4JBF A;  3RXX A;  2HP5 A;  5FQI A;  4KZ4 A;  4OPR A;  4MN7 A;  3LID A;  4O8G A;  1TS6 A;  3RJU A;  2Y2J A;  1ODV A;  3HLE A;  5AVE A;  3LR3 A;  4HJ3 A;  1W8Q A;  4EER A;  3EEA A;  4F3L B;  1VEU B;  4FTX A;  1LLB A;  2OWJ A;  2VGL S;  1XP4 A;  1YMS A;  5KIZ A;  1EI5 A;  5EOE A;  2FFY A;  4P6B A;  3P01 A;  4PM6 A;  4M3K A;  3MXR A;  1HTZ A;  3O5Y A;  1NYM A;  4KUK A;  3NOT C;  4EW7 A;  2VK3 A;  4GOG A;  1T19 A;  4OOY A;  1JTG A;  4MBF A;  2WZZ A;  4JF6 A;  4I3J A;  1STZ A;  5A90 A;  3IWQ A;  3BFF A;  3UPN A;  2JHE A;  3GRJ A;  5EVL A;  2ZM8 A;  4EV4 A;  4CLC D;  4B4X A;  1FIK A; 
#chains in the Genus database with same CATH homology
 2NUP C;  4IUH A;  2VLG A;  1XFN A;  1LT0 A;  1OJ5 A;  5CX7 A;  1TS0 A;  3S7O A;  4MN6 A;  3T4S A;  3PBN A;  5IU1 A;  5HDS A;  2OWH A;  4L9G A;  2WKQ A;  4HP9 A;  4BBT A;  2A24 A;  4JGR A;  2W3D A;  4YNR A;  5J3W A;  4HQA A;  3CI6 A;  3E4P A;  1LL8 A;  1S1Y A;  2QJ5 A;  2BAS A;  4PKY G;  2GZA A;  3LIF A;  3FG8 A;  4EES A;  1NLZ A;  2QJ7 A;  1YSP A;  3E0Y A;  2V1B A;  2B18 A;  3D72 A;  4EQ1 A;  5A8B A;  1WA9 A;  3VV4 A;  3PBQ A;  4B9O A;  1VB6 A;  1OTA A;  3TE8 A;  3HJI A;  4GCZ A;  1DRM A;  1P0Z A;  2ZMV A;  4NXE A;  3ZYT A;  2PHY A;  1N9L A;  3EEH A;  4BMW A;  2V1A A;  3LI8 A;  1GSX A;  3FPV A;  3EOI A;  2VEA A;  5DF9 A;  3C38 A;  3PBT A;  1V9Y A;  2QYB A;  3BQA A;  5HWV A;  1XJ2 A;  4MMN A;  1YSQ A;  3OBF A;  2OOL A;  4HJ4 A;  4XT2 B;  2HGV A;  4R6L A;  2PD7 A;  1W63 Q;  4M4X A;  1S4R A;  3H82 B;  2OAP 1;  5HD3 A;  1D7E A;  4I39 A;  5KSH A;  3E4Q A;  5HSQ A;  3IBR A;  2M7U A;  5DKK A;  4WF0 A;  2L4R A;  3NOP C;  3A0S A;  2Z6C A;  3LYX A;  4MDZ A;  2XRN A;  3CUE A;  1UWP X;  4H6J A;  5DKL A;  1BYW A;  2KLI A;  2O9C A;  2Y8H A;  1TS7 A;  2QHK A;  4BJP A;  3UB9 A;  3H9W A;  4NXB A;  2JKR M;  2FZ0 A;  4BWI A;  4P6Z M;  3MJQ A;  2ZBB A;  4CLC B;  2PDR A;  3PBR A;  4NXF A;  4OOM A;  3LIB A;  1YKD A;  4UEY A;  3UME A;  2M7V A;  4ETX A;  2A24 B;  1XJ3 A;  2EWW A;  1TF1 A;  5FL3 A;  4HOI A;  5DFX A;  3OOV A;  2PR6 A;  5HWW A;  1XJ6 A;  3BY9 A;  3KSF A;  4DJ3 A;  4KUO A;  3UB8 A;  3VE3 A;  2W1T A;  4ARZ A;  5L8M A;  2Z6D A;  2PR5 A;  2HJ9 C;  4KQD A;  3LR0 A;  2K31 A;  4I5S A;  3S7Q A;  3F1O A;  4Q0H A;  3K3D A;  4GW9 A;  3OLO A;  3PBS A;  5G4Z A;  4RQ9 A;  3OCN A;  3NHQ A;  2W3E A;  3U2A A;  4CQH A;  3GEC A;  4FOF A;  5DJU A;  4G3V A;  4CLC C;  2W27 A;  1KOU A;  1T1B A;  5MC7 A;  3IS2 A;  5F69 A;  4LRZ E;  4I38 A;  3KYQ A;  3MQ0 A;  3MR0 A;  3DBA A;  4UQI M;  3RFB A;  2ZOI A;  4MN5 A;  3C2W A;  4HHD A;  1LSW A;  4Q0J A;  5HWT A;  2O0Y A;  2L0W A;  4P6Z S;  5HZH A;  4H6J B;  4LLO B;  1EW0 A;  5HPI A;  4WLA A;  5TJJ A;  3F1N A;  4DN0 A;  5G4Y A;  5TBM A;  3T4J A;  2O9A A;  3CLO A;  3RH8 B;  3S7P A;  3LR4 A;  3V67 A;  2HV1 A;  3BJN A;  3ICY A;  5HPF A;  4GJ4 A;  2LB9 A;  1IFQ A;  3LIE A;  2VV8 A;  3UE3 A;  4L0L A;  4YOF A;  1P97 A;  2PYP A;  1ZTU A;  3E98 A;  2QWS A;  4KQO A;  2IA2 A;  1F98 A;  5J4E A;  4PHT A;  2M1C A;  4GHI A;  3C30 A;  3MQQ A;  2D02 A;  2W1T B;  2JKR I;  3FPW A;  4ARZ B;  2OAQ 1;  3PR6 A;  3R7W A;  1VHM A;  2EA9 A;  2KOI A;  1N9N A;  2W3H A;  4HNB A;  2PD8 A;  3CIT A;  1XJ4 A;  3E4O A;  3F1O B;  3T4L A;  3T4O A;  1F9I A;  4OOL A;  2QKP A;  2MJ6 A;  3UB7 A;  3MFX A;  3KO6 A;  2O99 A;  1OTI A;  1OTB A;  4UQI S;  5IT5 A;  4WL9 A;  4ETZ A;  2J3T C;  4EEP A;  4WEL A;  2WKR A;  2K2N A;  2KX6 A;  3IS2 B;  1T18 A;  4HIA A;  2YKH A;  4JGP A;  4YWZ A;  4Y3I A;  2Y79 A;  3TRC A;  3R4K A;  4B93 A;  1S66 L;  3KSH A;  4PAU A;  2FH5 A;  4G3K A;  1OJG A;  5J7E A;  3D3O A;  1JNU A;  4LPZ A;  4WEJ A;  2I9V A;  2P7J A;  3F1N B;  3T4K A;  1UWN X;  2VKS A;  4Z1W A;  3GDI A;  5TBM B;  3LR5 A;  2V0W A;  1H3Q A;  3LUQ A;  2HJE A;  3NJA A;  1NLY A;  4WN5 A;  4IJG A;  2GNX A;  2XA7 M;  2W3F A;  4HI4 A;  4WEK A;  5IS1 A;  3LFV A;  1S1Z A;  2DMW A;  2J3W A;  4ZRR A;  4HP4 A;  1OTE A;  2WKP A;  1T1A A;  3LIA A;  1OTD A;  4HH2 A;  4GHI B;  4Q0I A;  5EFW A;  2R78 A;  3F1P A;  3H7W A;  3NOU C;  4Y5F A;  3EQV A;  3BQ8 A;  1OT9 A;  4ME4 A;  3R7W B;  1MZU A;  1TD5 A;  4I3A A;  1DP9 A;  2P08 A;  2CMN A;  4BBV A;  3ULF A;  2W1R A;  4DJ2 A;  3BWL A;  5DJT A;  3MQO A;  3T4T A;  3EQU A;  4HJ6 A;  4JGO A;  4R70 A;  3KX0 X;  2A2L A;  3W2Z A;  1T1C A;  3MMH A;  2VV6 A;  5HDC A;  3OCL A;  5HD5 A;  4HH3 A;  3PXP A;  3OC2 A;  4CLC E;  2HF6 A;  1LSV A;  4F3L A;  2VJW A;  1G28 A;  3EGX C;  2G7U A;  3CWF A;  3MF0 A;  3BW6 A;  5AVF A;  4CLC A;  2XSS A;  1ZHH B;  4EUV A;  2O9B A;  4O01 A;  4WUJ A;  4R3A A;  1F5M A;  1X0O A;  1DP8 A;  1YAX A;  3FC7 A;  3EWK A;  2ZOH A;  4EEU A;  4GS9 A;  2J80 A;  3S7N A;  2VGL M;  3B33 A;  2XA7 S;  1LSX A;  1G6O A;  2JKT M;  4NKP A;  1XFQ A;  3MXQ A;  3VOL A;  1H8M A;  3PBO A;  1S4S A;  4HY8 A;  3G6O A;  4II7 A;  1IOU A;  2L1M A;  4LRX C;  1TS8 A;  1NRJ A;  3BY8 A;  2P04 A;  2VZW A;  3VE4 A;  2VX8 A;  4LRY C;  1GSV A;  5F6A A;  2ZMF A;  4G3W A;  5F68 A;  3CUE C;  4IHQ A;  2W3G A;  2NUT C;  1OT6 A;  3A0V A;  4NEE D;  3EGD C;  3HJK A;  3C8C A;  3ZQ5 A;  3SW1 A;  3KYZ A;  4R38 A;  5F5Y A;  3PYP A;  3A0R A;  5LBR A;  3F1P B;  3K2N A;  3H7W B;  3UE6 A;  4IUK A;  2XRO A;  2V0U A;  2GX5 A;  2JN7 A;  1D06 A;  1NWZ A;  2PT7 A;  2V9A A;  4MCW A;  3TJZ C;  3UB6 A;  4MN7 A;  3LID A;  4FSF A;  2D01 A;  4O8G A;  3LI9 A;  1TS6 A;  5K5B A;  2VV7 A;  1ODV A;  1Y28 A;  3HCY A;  5I5L A;  3T50 A;  5AVE A;  2H28 A;  2J3T D;  3P7N A;  1P9W A;  1MC0 A;  3LR3 A;  4HJ3 A;  4GLQ A;  4L9E A;  4DMZ A;  4EER A;  2KDK A;  3EEA A;  4F3L B;  3KSI A;  4Y2F A;  3PHY A;  1S67 L;  2OWJ A;  4EU0 A;  4K08 A;  2VGL S;  2GJ3 A;  5C5K A;  5KIZ A;  5HL6 A;  3P01 A;  4O0P A;  4GS9 B;  1DP6 A;  3O5Y A;  4PKY A;  2LB5 A;  1P9R A;  2W0N A;  4KUK A;  3RTY A;  4JGQ A;  3NOT C;  3JVV A;  4EW7 A;  3K3C A;  1T19 A;  4QPR A;  4NXG A;  3B47 A;  2K7S A;  2PYR A;  2INW A;  5AJG A;  3KSG A;  4XT2 A;  3B42 A;  4I3J A;  3T4Q A;  2B02 A;  4EXO A;  3CAX A;  4I3I A;  1STZ A;  3UMD A;  4E04 A;  1MKM A;  1GSW A;  5HDD A;  3H82 A;  1W63 M;  4AFI A;  2JHE A;  4L9F A;  3TW8 A;  4BBU A;  4EET B;  3IBJ A;  2YKF A;  1OPX A;  4CLC D;  5DFY A;  2JKT I;  2VA0 A;  3LIC A;  1UGU A;  3JVU A;  1V9Z A;  1N9O A;  2EWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...