1KOUA

Crystal structure of the photoactive yellow protein reconstituted with caffeic acid at 1.16 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
122
structure length
119
Chain Sequence
VAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Structure of the photoactive yellow protein reconstituted with caffeic acid at 1.16 A resolution.
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 35
structure length 119
sequence length 122
ec nomenclature
pdb deposition date 2001-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1kouA00
1TS6A 1S1YA 2Z6DA 4GW9A 1DP6A 4GCZA 4HJ3A 2ZOIA 1BYWA 3ICYA 5IU1A 4I5SA 4DJ3A 3LIAA 3E4QA 3SW1A 4BBUA 3C2WA 4LRXC 3LIDA 4EW7A 4HIAA 1D7EA 1KOUA 4WLAA 1OTBA 1OTIA 5HWWA 4KUOA 1LSVA 4HJ6A 3A0RA 4XT2A 3LYXA 4YWZA 1Y28A 2KDKA 3F1OA 4I39A 5TBMA 4WUJA 4EERA 2V1BA 3MQQA 3BY8A 3LIEA 4HY8A 4F3LA 2YKFA 4GHIB 5F68A 1XJ3A 5AVFA 4EESA 4MN6A 4R6LA 5J4EA 1TS7A 1OTDA 2L0WA 4EXOA 3CLOA 4JGRA 1LSWA 3H9WA 5I5LA 2OOLA 1GSWA 3H82B 4HI4A 3MJQA 2PHYA 1F9IA 3P7NA 2BASA 4PKYG 2JN7A 3OLOA 3LIFA 4HNBA 4EEUA 3A0VA 3NOUC 2ZBBA 1JNUA 1LL8A 1XJ4A 2WKRA 2W0NA 1GSXA 2INWA 1N9LA 1T1BA 4WN5A 5HZHA 2WKPA 3GECA 2A24A 2P7JA 4K08A 3MXQA 5J7EA 2VV7A 2B02A 2I9VA 3F1PB 2QHKA 2YKHA 3IS2B 2PR5A 3UB9A 3NJAA 4KQDA 2VEAA 3LIBA 5HDCA 1X0OA 1F98A 5DKKA 1OT9A 1UWNX 1S67L 2WKQA 3K3DA 1D06A 2L1MA 5HSQA 1UGUA 2PD8A 5AVEA 5F5YA 4NXGA 2V0UA 3VE4A 4EEPA 4R38A 1S1ZA 1S4SA 5DKLA 3C8CA 1XFQA 3FC7A 2ZOHA 4I3IA 4NXFA 1N9NA 2V0WA 5G4ZA 3HJKA 1TS8A 4NXEA 3RH8B 2Z6CA 4BBTA 4H6JA 4WL9A 3K3CA 5HWTA 4DJ2A 1WA9A 1OT6A 3NHQA 1P0ZA 1N9OA 2QWSA 3BY9A 3CWFA 4JGPA 4XT2B 4LPZA 4JGOA 5TBMB 1XJ6A 4L9FA 3KX0X 3UB6A 3ZQ5A 2PD7A 3UB7A 4HH2A 4WF0A 1T19A 3LI9A 3NOPC 4PKYA 4HHDA 3BWLA 4LRYC 5DJTA 1P97A 1T1AA 2VV6A 4HP9A 3MR0A 5HD3A 3H82A 4B9OA 4L9GA 1S4RA 4BBVA 3HJIA 4I3AA 2H28A 3H7WA 2KX6A 3F1NA 1UWPX 5F69A 2L4RA 1DRMA 4HJ4A 1ODVA 2GJ3A 2QJ7A 3MFXA 3VOLA 4I3JA 5G4YA 4HOIA 2PYPA 2D02A 3ULFA 3IBRA 2OWJA 3MQOA 2PDRA 3F1PA 3T50A 3IS2A 1LSXA 4LLOB 1EW0A 2A24B 2HV1A 1XFNA 1OTEA 1T1CA 4GS9B 3GDIA 2W27A 2OWHA 2V1AA 3VE3A 2VLGA 4HQAA 1GSVA 3G6OA 2V9AA 4HH3A 4MN5A 1OJGA 1TS0A 4RQ9A 3UMEA 4E04A 5HWVA 4M4XA 4EETB 1DP9A 2CMNA 3UB8A 1MZUA 2J80A 3EWKA 3RTYA 5A8BA 4H6JB 3E4PA 3F1OB 3PYPA 1NWZA 4R3AA 4R70A 1V9YA 4GHIA 3UMDA 1VB6A 1XJ2A 1OJ5A 2EA9A 4EQ1A 3LI8A 2VV8A 4I38A 4F3LB 5KIZA 2PR6A 3B33A 5J3WA 5EFWA 3FG8A 1V9ZA 5F6AA 2M1CA 4JGQA 2QKPA 3UE6A 1LT0A 4HP4A 3EEHA 2R78A 1G28A 4L9EA 3D72A 5HD5A 2QJ5A 1DP8A 1T18A 2JHEA 3A0SA 2PYRA 3H7WB 5IS1A 3E4OA 3LUQA 1S66L 3F1NB 4KUKA 2K7SA 5HDSA 5DJUA 4LRZE 3CAXA 1OTAA 3NOTC 5HDDA 3PHYA 2D01A 4NXBA 3LICA 4GS9A
chains in the Genus database with same CATH superfamily
1I2SA 3R7WB 2Z6DA 1DP6A 1BUEA 3D4FA 5FI6A 4MN7A 4I5SA 3O87A 2J3TD 2WADA 5EECA 4FH2A 3C38A 2H0YA 5GL9A 3LIAA 2XD1A 3Q82A 4GB7A 1LL5A 4BBUA 2RCXA 3QP2A 2XF3A 3VP4A 5EVID 4G3KA 5GHXA 4HIAA 4WZ4A 1KOUA 3IT9A 4XUXA 1OTBA 3IF5A 2Y2QA 3LEZA 4IEDA 2JKGA 2JKTI 4KUOA 2Y2GA 4HJ6A 1YLZA 2X71A 4MEZA 1ZC2A 1YMSA 2KDKA 4I39A 5TBMA 1K6RA 1ONHA 3O3VA 5FA7A 4QB8A 4JXSA 2XH9A 1J9MA 5FSRA 2V1BA 5FQMA 3MQQA 3BY8A 4UHUA 3A3IA 4PM7A 3M2JA 1XJ3A 4PM8A 3IXDA 1TS7A 3SS4A 1YQSA 4EXOA 3LFVA 3UB5P 5EPHA 4JLFA 1K38A 1LSWA 2ZLYA 3L7HA 3P09A 1JTDA 3MJQA 2BASA 3IQAA 4PKYG 2XK1A 4LGWA 1FSWA 4HNBA 3MMHA 4MMNA 3E0YA 4EEUA 1FIKA 3DTMA 3LR0A 2ZBBA 4O0PA 4LENA 2Z2MB 1FILA 2W1TA 3CMZA 1FOFA 3G32A 3RXWA 3T4QA 2W0NA 1GSXA 4WN5A 5HZHA 2G7UA 1L3LA 2UWXA 1PZOA 4C75A 3GECA 4N9KA 4K08A 2ZQ7A 3MXQA 3UNWA 2B02A 2I9VA 2Y79A 3EGDC 3MZDA 2PR5A 4PAUA 3TSGA 4ZJ1A 3HBRA 2ZM2A 1NY0A 3FYZA 3NDGA 4WZ5A 1X0OA 3CITA 5DKKA 1P9RA 4B93A 1UWNX 2L1MA 3ITBA 3CG5A 1K4EA 5HSQA 4ETZA 4WMCA 2ZC3B 5M1AA 4JXVA 1XX2A 3CHWP 5AVEA 1K6SA 2Y2JA 3EQUA 2O9CA 4E3IA 4R4SA 5HFOA 2ZC5B 1L0DA 1PWCA 1BZAA 4CJNA 5DKLA 4RX2A 3O86A 4PMAA 1XFQA 1E25A 4I3IA 2ZQ9A 1N9NA 3V50A 3BYDA 3HJKA 2WGVA 3SH7A 3T4OA 2Z6CA 1NXYA 1P9WA 3MQ0A 3OPHA 3QNBA 4UEYA 1NYMA 3K3CA 1SKOA 4DJ2A 3EEAA 5CGXA 1MKMA 5E2FA 5DTSA 4N1HA 1W63M 2JCHA 3NCKA 3AGEA 4LPZA 4P6ZM 5CGWA 4PM5A 2HF6A 4B4ZA 1XJ6A 4L9FA 3JVUA 1SHVA 4WF0A 3IF6B 5CGSA 2EFXA 3BM6A 3BWLA 1Q2QA 4EU0A 5LBRA 4KZ5A 3FKWA 4P0MA 3T4KA 3WS4A 2VV6A 4JF5A 3MR0A 1KGFA 2OLVA 5AQ9A 4D2OA 3HJIA 2J3WA 2H28A 4ZBEA 4Y7PA 1TVFA 4E3JA 2QPNA 5E2HA 2L4RA 4X69A 1ODVA 3KO6A 2V1ZA 2IWBA 5G4YA 1VETA 3TOIA 2D02A 3IWQA 2WUQA 3ULFA 4WEJA 2W3GA 2OWJA 2MJ6A 3IWIA 3W2ZA 4NETA 3VOZA 4LLOB 4IVIA 4UQIS 1AXBA 3QP8A 3RFBA 2HJ9C 3GDIA 3DAVA 4WBGA 2Y2PA 2W27A 4BD0A 2V1AA 3OCNA 2Y4AA 1K4FA 3T12B 2ZMVA 2GNXA 1ONGA 3C7VA 2ZL1A 3SOIA 1K57A 1PIOA 3ZHHA 4KZ4A 3UO9A 3NULA 3A3JA 3G6OA 2WAEA 2C5WB 1OMEA 3ZDJA 4RQ9A 3LGOA 1FCOA 3UMEA 3CPTB 5HWVA 2Y2OA 3LO7A 4WZ5C 1CEGA 3Q7VA 2XDMA 5HAPA 3EWKA 1GCEA 4Y5FA 3E4PA 3OPRA 3DW0A 4HBUA 4IHQA 2I72A 3HUNA 1VM1A 2EA9A 3GVBA 3MZEA 1O07A 3MBZA 4I38A 3IF6A 5EE8A 4OP8A 5J3WA 4B4XA 3VP3A 4KZ8A 4ZRRA 1CJFA 5EOOA 5HAQA 1JVJA 2P74A 2M1CA 4LV3A 4X68A 4OOMA 5A91A 4U0TA 3LY4A 4LCLA 3CI6A 1IKGA 1TEMA 3M6BA 2HZ5A 3D72A 2QJ5A 3C4PA 4OLDA 1G6AA 4PPRA 1ESIA 4X1LA 3PAEA 3VP2A 3UPPA 3K2NA 2WKIA 3H7WB 3E4OA 3VP0A 1S66L 3F1NB 3HLFA 1HVBA 3WS2A 4C3QA 2E8JA 1BT5A 4K0WA 3E2LA 1OTAA 4OQIA 3IX4A 3NOTC 3ZVTA 4BLMA 1H8MA 5GHZA 2D01A 5A93A 1BLSA 3LICA 1GA9A 4O8GA 1W79A 3OPLA 2O0YA 4MBFA 2EX8A 2FFFB 1BSGA 1TS6A 4IBRA 3QP4A 1FR1A 4EBPA 2BTFP 3MF0A 4ARZB 4FD8A 2DNSA 2XQZA 5AQ7A 5IT5A 2Q0OA 4CLCB 5E2GA 3S7QA 5A92A 2VJWA 4IUHA 1BYWA 5CTMA 4ESPA 3ZFZA 2QMIA 2XFTA 3Q1FA 3D3OA 3U4LP 4DJ3A 4JXWA 1L2SA 3E4QA 3SW1A 3CZDA 4MNRA 3W4PA 4H8RA 1YLPA 1KE4A 3DTKA 3O88A 1D7EA 3UPNA 4WLAA 5DF9A 1OTIA 5HWWA 4BMWA 1LSVA 3V3RA 3EOIA 3A0RA 3NBLA 4XT2A 4YWZA 1K57C 1Y28A 4R1GA 4EERA 5L09A 3WS1A 2WKHA 3HLEA 3FPVA 3G30A 3V3SA 1IKIA 2PBYA 4GOGA 2XA7S 1IYOA 4JBFA 5MC7A 3BQ8A 3HL9A 2YKFA 4GHIB 1H3QA 4R6LA 1EWZA 4GKUA 3HUMA 4DRTA 4X1MA 2OOLA 1F9IA 2B18A 2ZQCA 4Q0JA 1MKIA 4U3TA 2ZM0A 1JNUA 5F83A 1XJ4A 3T4LA 1DY6A 2A3UA 4QWOA 3UE3A 1NRJA 4PM9A 5EVLA 2M7VA 3IF6C 3BFFA 2M7UA 3VV4A 2XFSA 3S1YA 4R3JA 3N6IA 5J7EA 3NIAA 4FH4A 1XGIA 3F1PB 5CERA 2H5SA 3BQAA 3PBOA 1VEUA 1XA1A 2K2NA 4E3MA 3ISGA 2V8CA 4WELA 2QZ6A 4ARZA 2ZC6B 5L8MA 4FCFA 1MXOA 2G2UA 4OPYA 4CLCA 3W4OA 4L0LA 5FQJA 2PD8A 2P9VB 1RGZA 3MKEA 2V0UA 3VE4A 3BLSA 1S1ZA 5CX7A 5U47A 2H10A 2V0WA 4S2OA 5G4ZA 3G34A 2JKRM 4NXEA 1KE3A 3RH8B 1FSYA 4MLLA 1TDLA 5CEDA 5CECA 4DXBA 1K55A 1WA9A 1W63Q 3BRMA 1N9OA 3CWFA 1Z09A 3MZFA 1PW1A 4EQIA 3WS5A 1M6KA 4JGOA 4GZBA 4X6TA 1YT4A 3KX0X 3V5MA 2V2FF 1K56A 2EFUA 5AQBA 4KG5A 5CXWA 4HH2A 1T19A 3LY3A 3LI9A 3FKVA 1XKZA 4ZTKA 2G2WA 4LCMA 4OOLA 3D9YA 3WRZA 1T1AA 3BW6A 5KMWA 3ZG7B 5HD3A 4B9OA 4QU3A 3NDEA 5JYPA 3BJNA 1KDWA 2KX6A 2W3HA 5F69A 3IX8A 1SCWA 2GJ3A 3JYIA 4MDZA 4EUZA 2QJ7A 4Y0UA 2OLUA 3S7OA 2W1RA 3G2ZA 4I3JA 2NUTC 4HOIA 4RX3A 1A0KA 2Y55A 2EXAA 3BFCA 4NK3A 5FL3A 4OLGA 1TDGA 3EGXC 1EI5A 3F1PA 4GJ4A 5FDSA 3T50A 3NC8A 2A24B 1XPBA 1PI5A 1XFNA 1OTEA 5HL1A 5CRFA 1E3UA 4WMCD 1CI8A 2XA7M 3R7WA 2OWHA 4Y17A 3VE3A 4ZJ2A 1W8YA 4DF6A 3HCYA 3L9KA 5HPIA 4HQAA 1FQGA 1GA0A 4BENA 1YLYA 3RJUA 3S4XA 3A3DA 4EBLA 4X53A 5AQAA 3OOVA 1OJGA 1H8ZA 2VGKA 3HREA 1LLBA 4GNUA 3SS5A 4E04A 2XSSA 1I2WA 4MBHA 4Q8IA 1EROA 3KSGA 3IH9A 5C5KA 5DF8A 3IHBA 2V20A 3RTYA 4CLCC 3ZVWA 4H6JB 4IBXA 3B47A 3DWKA 2H0TA 4KZ6A 3UY6A 1NWZA 3T4SA 1XJ2A 4EQ1A 5DFYA 3LI8A 2JKRI 1IOUA 3V67A 2PR6A 3B33A 3DBAA 5DFXA 5EFWA 3FG8A 1V9ZA 1ZG6A 4QJGA 3SH8A 2WGIA 4Z1WA 4Q0HA 2J3TC 1LT0A 5DVAA 1K55C 3IWOA 4YFMA 3EEHA 5HD5A 3PR6A 5FQIA 4R4RA 2FZ0A 1PFLA 1L0GA 5IHVA 3MKFA 1ES2A 3LUQA 2HDSA 2LB9A 3QP6A 5L10A 1SZVA 3DTEA 2PRFA 4LRZE 3BFEA 3CAXA 4GD8A 4R0QA 4DE1A 5M18A 4YNRA 5FQQA 2WYXA 3IBJA 2Y59A 4OKPA 2ZM8A 4WYYA 5EOEA 5CHMA 1YSPA 4E3KA 1MWSA 3CJMA 2HDUA 1MWRA 1S1YA 3G31A 3LR4A 3A3FA 3LEQA 2ZOIA 4OPZA 5E2EA 4GDBA 5FASA 3PBSA 1GHIA 3VSLA 3IXGA 1I5QA 1ZG4A 2DRWA 3W8KA 1O7EA 3PAGA 3T1SA 4LRXC 1ALQA 3OPPA 2HP6A 2VA0A 2FH5A 1DJBA 3KYQA 4FSFA 1IELA 1YAXA 1PRQA 5DF7A 1VQQA 3SS3A 3FPWA 4KZBA 4CPKA 5FAQA 5EV0A 1KVMA 4BJPA 4KQOA 1W5DA 2VKSA 3LIEA 3S7NA 4UA9A 4HY8A 4Y15A 3TG9A 5AVFA 5J4EA 1SDEA 4Y0TA 3IH8A 1YKDA 1SDNA 2L0WA 1G68A 4JGRA 5FDHA 1JWZA 2XEPA 5I5LA 1PWGA 3MXSA 1GSWA 3H82B 3PBTA 2PHYA 2CC1A 1PZPA 2JN7A 1NYYA 2GZAA 3A3EA 3R4KA 3UPOA 1W7FA 2RL3A 1KDSA 3G4PA 4FOFA 3HLCA 1LL8A 2XLNA 4II7A 1YPRA 3AGFA 4E6WA 1T1BA 4D60A 1AWIA 2HJEA 1LI9A 1H5XA 2P7JA 1BLCA 1Y54A 1M40A 2Q9NA 4GN2A 3QP1A 5F1GA 2VV7A 2C6WB 2QHKA 2YKHA 2A49A 1RGYA 3UB9A 4KQDA 1VHMA 1RCJA 4S2MA 3RXXA 2VEAA 3LIBA 2OAP1 4S2NA 1F98A 1OT9A 1IYSA 1S67L 4JXGA 1D06A 1IYPA 2QYBA 2B5RA 4RVAA 3KSIA 5F5YA 4GD6A 4Q0IA 1DJCA 2Y8HA 1SKFA 3CPTA 4ME4A 2A2LA 2OAQ1 1QMFA 5D3OA 4KZAA 2X02A 1ZHHB 3FC7A 2ZOHA 2DCFA 4NXFA 2OSUA 3ZNYA 1E4DA 1BTLA 2B95A 1BLHA 2W3DA 4OQHA 1XXMA 4XXRA 3FZCA 4P6BA 1PNEA 4BBTA 3VFHA 1LI0A 4KG6A 4PM6A 3ZG8B 4WL9A 2PAVP 4Y13A 3NHQA 2OV5A 1Z6FA 1YMXA 3HLDA 5EVIB 5DTKA 2VX8A 4E3LA 3LR3A 5EM1A 3ZCZA 1JWPA 5TBMB 5K5BA 3QHYA 4ID4A 3PBNA 3UB6A 3ZQ5A 2PD7A 4KZ3A 3UB7A 2P04A 4S2KA 3CUEA 2V8FA 3KYEA 4HHDA 4LRYC 1STZA 4E6XA 5FQ9A 1BLPA 4HP9A 3FV7A 5FQKA 1HTZA 4BD1A 3IXHA 3H82A 1CEFA 3W4QA 3M2KA 3H7WA 4Y3IA 3KYZA 3F1NA 4MCWA 2J7VA 1UWPX 4OQGA 3UDIA 2W3FA 1H0MA 4HJ4A 3ZG0A 4QY6A 5TFQA 3GV9A 3M6HA 4KG2A 3MXRA 4A5RA 3MFXA 3HLBA 2K31A 4Z9QA 2W1TB 3VP1A 5G18A 5L07A 3N8SA 4X25A 1MWUA 3MQOA 2ZQ8A 2PDRA 2GDNA 1BULA 1W8QA 1LSXA 4OPRA 3T4JA 2DMWA 4P85A 3C5AA 2XD5A 1T1CA 4GS9B 4IJGA 1Y4OA 1LHYA 1PYYA 3OCLA 4RA7A 3C7UA 2VLGA 5FI7A 4BL2A 1WE4A 4O01A 4G3VA 2NUPC 4Y0OA 3WWXA 3N4IA 3N7WA 1ES3A 1G5UA 3LR5A 4OP5A 2Z2LB 4HH3A 4MN5A 4QPRA 3OC2A 1ES4A 4OPQA 1TS0A 1K25A 4U0XA 3UDFA 2VK3A 2O9BA 1NJ4A 3UN7A 4QY5A 4AFIA 3TJZC 4YINA 5TGFA 2J80A 1MWTA 1LL9A 4S2NC 1YM1A 4JF6A 5DTTA 4RYEA 1K54A 1K56D 2HP5A 5EVIA 5HX9A 1DJAA 3F1OB 1SKOB 3HUOA 3ITAA 3MS6A 4DE0A 4R70A 3Q07A 1V9YA 2J8YA 4GHIA 1OJ5A 1GHMA 3HLWA 4HESA 2VV8A 4F3LB 5KIZA 2EX9A 4GLQA 2EXBA 4QD4A 3TE8A 1WYCA 2BG1A 3G2YA 5F6AA 5HL6A 5KSCA 4JGQA 2QKPA 3UE6A 4EUVA 1G28A 4L9EA 1XA7A 2LB5A 1DP8A 1T18A 3NECA 3A0SA 2PYRA 2HPBA 4UAAA 5IS1A 2VGLS 5J8XA 2XRNA 1IFQA 5HDSA 5DJUA 3V39A 3CUEC 2FFYA 3VFFA 1IYQA 4CLCE 1OPXA 1PWDA 3FWLA 1E3UD 3HLGA 5HDDA 1J3WA 1F5MA 1VETB 2ACGA 3E98A 1ERQA 3C30A 4NXBA 1MY8A 5FI2A 1JTGA 4GS9A 4FTXA 4ZAMA 2EWWA 3U2AA 2WZZA 2Y2IA 1TF1A 4ETXA 2P9VA 3GMWA 2HDQA 4GW9A 4X56A 2WAFA 2HP9A 4PHTA 4GCZA 5EM0A 5EUAA 4HJ3A 2PU2A 4LV2A 4EWFA 3C4OA 3ICYA 5IU1A 2ZL1B 3T1XA 1CK3A 4UA6A 2PT7A 3Q81A 2JC7A 3C2WA 3LIDA 5CHJA 4EW7A 3N8RA 4NKPA 4OH0A 2WKEA 4DMZA 4KENB 3LYXA 3IXBA 3ZNTA 3Q7VB 3F1OA 1ACFA 4WUJA 1ESUA 1HD8A 2XGNA 2Y2NA 2VGJA 1FCNA 2EWVA 5CTNA 3AGDA 4FUWA 4F3LA 2GX5A 5F68A 2JBFA 4MN6A 4EESA 3BFGA 2JKFA 1OTDA 3EQVA 1PI4A 3CLOA 5GLBA 2Y2MA 4LV1A 3T4TA 3H9WA 4JPMA 1K54C 3DTIA 4HI4A 2ZQAA 4O7DA 3P7NA 3T1QB 3OLOA 2AVXA 3LIFA 4GDNA 4LFUA 2ZC7A 5EVIC 3SZTA 3IHAA 3PXPA 1HLUP 2R9XA 1HZOA 3A0VA 1D1JA 3NOUC 1CI9A 1S0WA 1YLWA 4E3OA 3QNCA 2Y2KA 5FAPA 4DXCA 3PTEA 1QMEA 2WKRA 3VMAA 1U60A 4S2JA 2INWA 4E3NA 1N9LA 2Q9MA 2WKPA 1L0EA 2XR0A 2A24A 3BEBA 4OONA 3PBQA 5GLDA 4Y2FA 4BQMA 3IS2B 3G35A 1N4OA 3GTCA 1KGEA 1KGGA 3NJAA 3OZHA 5A90A 2XROA 4K91A 5HDCA 4S2LA 4ZDXA 3WS0A 1C3BA 3SH9A 2E8IA 2WKQA 3K3DA 5BOHA 4KQRA 1UGUA 4EV4A 4NG2A 4NXGA 1Q2PA 4IVKA 4EEPA 4R38A 2ZC4B 2ZD8A 1S4SA 4XUZA 2HGVA 2ZQDA 4MBKA 5F82A 4X55A 3C8CA 1MC0A 3QP5A 5GHYA 4JF4A 1YLJA 2VGLM 1TS8A 4NEED 2Y2HA 5F1FA 4KZ9A 4H6JA 2O99A 1ZKJA 4HBTA 4M3KA 5HWTA 1FCMA 1MPLA 1FR6A 1OT6A 1P0ZA 4BWIA 1NLYA 2QWSA 3BY9A 5M19A 2O9AA 4JGPA 4XT2B 3GSGA 4R3BA 3DWZA 1YSQA 2KOIA 5TR7A 4YOFA 3ZG5A 4N92A 3ZYTA 5HW3A 4PKYA 3NOPC 5GLCA 2UV0E 2Y91A 1NZUA 3KSFA 5DJTA 3MFDA 1P97A 4ZJ3A 1RP5A 3S7PA 4KQQA 4DE2A 3VOYA 2WK0A 4L9GA 1S4RA 3UE0A 1L0FA 1NRFA 4BBVA 1GHPA 4I3AA 3JPUA 4BL3A 3NI9A 3BECA 3P01A 4LV0A 1DRMA 2J9OA 5I94A 1KVLA 4WM9A 3VOLA 2WZXA 2PYPA 3B3XA 5KZHA 5CHUA 3GQZA 4N1XA 3IBRA 3PBRA 1PW8A 1G6OA 2Y2LA 3IS2A 1EW0A 4S2IA 3JVVA 2HV1A 5FATA 3B42A 2WGWB 5HARA 1VEUB 2PBDP 1NZOA 1ES5A 3Q7ZA 3GRJA 4DE3A 2JKTM 4DDSA 1GSVA 1ZTUA 4OQ0A 1XP4A 2V9AA 1JWVA 1F2KA 3TW8A 5L2FA 3N8LA 4G3WA 2PU4A 3GR2A 3S22A 4M4XA 3TRCA 1CQAA 2W3EA 1DP9A 4EETB 5HPFA 2ZMAA 2CMNA 4IUKA 5AJGA 2X01A 4K0XA 4EBNA 1YLTA 1S6RA 3LCEA 3UB8A 1MZUA 4CQHA 1N9BA 3UE1A 4C6YA 1WYBA 4DKIA 5EVEA 5A8BA 2VZWA 3I7JA 4N9LA 2BLSA 5TJJA 3O5YA 3BLMA 4UA7A 5FEFA 2IA2A 2EX6A 3BFDA 3PYPA 4R3AA 1K0KA 4B88A 3UDXA 3UMDA 1VB6A 2HDRA 3WRTA 4UQIM 4KZ7A 3IX3A 4QHCA 3T1RA 5KSHA 2IWCA 3HVFA 4JKTA 4S2PA 2IWDA 3KSHA 2ZMFA 1IEMA 4F94A 2EX2A 5E43A 4OVDA 4DDYA 4P87A 1CF0A 5JYOA 3NY4A 3OBFA 3VSKA 1MBLA 4DN0A 3ZGAB 4HP4A 2R78A 1TD5A 2R9WA 2ZJ9A 2P08A 2JE5A 2KLIA 4R23A 2JHEA 1KE0A 3ZG9B 1ERMA 4KUKA 1H8YA 2K7SA 3P98A 1NLZA 5CEBA 2J9PA 5FAOA 4WEKA 3PHYA 4CLCD 4HEFA 4P6ZS 3MSHA 5FEGA 5GLAA 5HAIA 4OOYA 3E2KA 1XGJA 2WGWA
chains in the Genus database with same CATH topology
1TS6A 3U2AA 3MF0A 4ARZB 1TF1A 1S1YA 4ETXA 3R7WB 2Z6DA 5IT5A 3LR4A 1DP6A 4GW9A 4PHTA 4GCZA 4CLCB 3S7QA 4HJ3A 2VJWA 2ZOIA 4IUHA 1BYWA 3ICYA 3PBSA 4MN7A 5IU1A 3D3OA 4I5SA 2J3TD 4DJ3A 2PT7A 3C38A 3LIAA 3E4QA 3SW1A 4BBUA 3C2WA 4LRXC 3LIDA 4EW7A 4NKPA 4G3KA 4HIAA 1D7EA 1KOUA 2VA0A 2FH5A 4WLAA 1OTBA 3KYQA 5DF9A 1OTIA 4FSFA 5HWWA 4DMZA 1YAXA 2JKTI 4BMWA 4KUOA 1LSVA 3EOIA 4HJ6A 3A0RA 4XT2A 3LYXA 4YWZA 3FPWA 1Y28A 2KDKA 3F1OA 4I39A 5TBMA 4WUJA 4EERA 4BJPA 4KQOA 3FPVA 2EWVA 2V1BA 3MQQA 3BY8A 2XA7S 2VKSA 3LIEA 3S7NA 5MC7A 4HY8A 4F3LA 3BQ8A 2GX5A 2YKFA 4GHIB 5F68A 1XJ3A 5AVFA 4EESA 4MN6A 1H3QA 4R6LA 5J4EA 1TS7A 1YKDA 3EQVA 1OTDA 2L0WA 4EXOA 3LFVA 3CLOA 4JGRA 1LSWA 3T4TA 3H9WA 5I5LA 2OOLA 3H82B 1GSWA 4HI4A 3MJQA 2PHYA 1F9IA 3PBTA 3P7NA 2BASA 2B18A 4PKYG 2JN7A 3OLOA 3LIFA 4Q0JA 4HNBA 3MMHA 4MMNA 2GZAA 3PXPA 3E0YA 3R4KA 4EEUA 3A0VA 3LR0A 3NOUC 2ZBBA 1JNUA 4FOFA 4O0PA 1LL8A 1XJ4A 3T4LA 2W1TA 4II7A 3UE3A 1NRJA 2WKRA 2M7VA 3T4QA 2W0NA 1GSXA 2INWA 1N9LA 1T1BA 4WN5A 5HZHA 2G7UA 2WKPA 2HJEA 2M7UA 3VV4A 3GECA 2A24A 2P7JA 4K08A 3MXQA 5J7EA 2VV7A 2B02A 2I9VA 2Y79A 3F1PB 3EGDC 2QHKA 2YKHA 3PBQA 3IS2B 4Y2FA 2PR5A 3UB9A 4PAUA 3PBOA 3BQAA 3NJAA 2XROA 4KQDA 1VHMA 2K2NA 2VEAA 3LIBA 5HDCA 4WELA 1X0OA 4ARZA 2OAP1 3CITA 5L8MA 1F98A 5DKKA 1P9RA 4B93A 1OT9A 1UWNX 1S67L 2WKQA 3K3DA 1D06A 2L1MA 2QYBA 4CLCA 5HSQA 4ETZA 4L0LA 1UGUA 2PD8A 3KSIA 5AVEA 5F5YA 4NXGA 3EQUA 4Q0IA 2V0UA 2O9CA 2Y8HA 3VE4A 4EEPA 4ME4A 2A2LA 2OAQ1 4R38A 1S1ZA 1S4SA 5CX7A 2HGVA 5DKLA 3C8CA 1ZHHB 1XFQA 3FC7A 2ZOHA 4I3IA 4NXFA 1MC0A 1N9NA 2V0WA 5G4ZA 2W3DA 3HJKA 4NEED 2VGLM 1TS8A 2JKRM 4NXEA 3T4OA 3RH8B 2Z6CA 1P9WA 3MQ0A 4BBTA 4H6JA 2O99A 4UEYA 4WL9A 3K3CA 5HWTA 4DJ2A 1WA9A 3EEAA 1W63Q 1MKMA 1OT6A 3NHQA 1P0ZA 4BWIA 1NLYA 1N9OA 3CWFA 2QWSA 3BY9A 2VX8A 2O9AA 4JGPA 1W63M 4XT2B 4LPZA 3LR3A 1YSQA 2KOIA 4P6ZM 4JGOA 4YOFA 2HF6A 5TBMB 1XJ6A 5K5BA 4L9FA 3KX0X 3JVUA 3UB6A 3PBNA 3ZQ5A 2PD7A 3UB7A 3ZYTA 2P04A 4HH2A 4WF0A 1T19A 3CUEA 3LI9A 3NOPC 4PKYA 4HHDA 3BWLA 3KSFA 4LRYC 5DJTA 4EU0A 5LBRA 4OOLA 1P97A 1STZA 3T4KA 1T1AA 2VV6A 3S7PA 4HP9A 3MR0A 3BW6A 5HD3A 3H82A 4B9OA 4L9GA 1S4RA 4BBVA 3HJIA 2J3WA 3BJNA 4I3AA 2H28A 3H7WA 4Y3IA 2KX6A 3KYZA 2W3HA 3F1NA 4MCWA 1UWPX 5F69A 3P01A 2W3FA 2L4RA 1DRMA 4HJ4A 1ODVA 2GJ3A 4MDZA 2QJ7A 3KO6A 3S7OA 3MFXA 2W1RA 3VOLA 4I3JA 2NUTC 5G4YA 2K31A 4HOIA 2PYPA 2D02A 2W1TB 5FL3A 3ULFA 4WEJA 2W3GA 3IBRA 3PBRA 2OWJA 2MJ6A 3EGXC 3MQOA 3W2ZA 2PDRA 3F1PA 4GJ4A 1G6OA 3IS2A 3T50A 1LSXA 4LLOB 4UQIS 1EW0A 2A24B 3JVVA 2HV1A 1XFNA 3T4JA 1OTEA 2DMWA 3RFBA 1T1CA 3B42A 2HJ9C 4GS9B 4IJGA 3GDIA 2XA7M 2W27A 3R7WA 3OCLA 2OWHA 2V1AA 3OCNA 3VE3A 2ZMVA 2VLGA 2GNXA 3HCYA 4O01A 5HPIA 4G3VA 2NUPC 4HQAA 2JKTM 1GSVA 1ZTUA 3G6OA 2V9AA 3LR5A 4HH3A 4MN5A 3OOVA 1OJGA 4QPRA 3TW8A 3OC2A 1TS0A 4RQ9A 4G3WA 3UMEA 4E04A 5HWVA 2XSSA 4M4XA 3TRCA 2W3EA 1DP9A 4EETB 5HPFA 2CMNA 4IUKA 5AJGA 2O9BA 3KSGA 4AFIA 3TJZC 3UB8A 1MZUA 2J80A 4CQHA 5C5KA 3EWKA 3RTYA 4CLCC 5A8BA 4Y5FA 2VZWA 4H6JB 3E4PA 5TJJA 3B47A 3O5YA 3F1OB 2IA2A 3PYPA 1NWZA 4R3AA 3T4SA 4R70A 4IHQA 1V9YA 4GHIA 3UMDA 1VB6A 1XJ2A 1OJ5A 4UQIM 2EA9A 4EQ1A 5DFYA 3LI8A 2JKRI 2VV8A 1IOUA 5KSHA 4I38A 3V67A 4F3LB 5KIZA 2PR6A 3B33A 5J3WA 3DBAA 5DFXA 5EFWA 4GLQA 3KSHA 2ZMFA 4ZRRA 3TE8A 3FG8A 1V9ZA 5F6AA 5HL6A 2M1CA 4JGQA 2QKPA 4OOMA 4Z1WA 3UE6A 3OBFA 4Q0HA 2J3TC 1LT0A 3CI6A 4DN0A 4EUVA 4HP4A 3EEHA 2R78A 1G28A 4L9EA 1TD5A 2LB5A 3D72A 5HD5A 2QJ5A 3PR6A 2FZ0A 1DP8A 1T18A 2P08A 2KLIA 3K2NA 2JHEA 3A0SA 2PYRA 3H7WB 5IS1A 2VGLS 3E4OA 3LUQA 1S66L 2XRNA 3F1NB 4KUKA 2LB9A 1IFQA 2K7SA 5HDSA 5DJUA 1NLZA 3CUEC 4LRZE 3CAXA 1OTAA 4CLCE 1OPXA 4YNRA 3NOTC 5HDDA 1F5MA 4WEKA 3E98A 1H8MA 3IBJA 3C30A 3PHYA 2D01A 4NXBA 4CLCD 4P6ZS 3LICA 4O8GA 4GS9A 2O0YA 2EWWA 1YSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TS6 A;  1S1Y A;  2Z6D A;  4GW9 A;  1DP6 A;  4GCZ A;  4HJ3 A;  2ZOI A;  1BYW A;  3ICY A;  5IU1 A;  4I5S A;  4DJ3 A;  3LIA A;  3E4Q A;  3SW1 A;  4BBU A;  3C2W A;  4LRX C;  3LID A;  4EW7 A;  4HIA A;  1D7E A;  1KOU A;  4WLA A;  1OTB A;  1OTI A;  5HWW A;  4KUO A;  1LSV A;  4HJ6 A;  3A0R A;  4XT2 A;  3LYX A;  4YWZ A;  1Y28 A;  2KDK A;  3F1O A;  4I39 A;  5TBM A;  4WUJ A;  4EER A;  2V1B A;  3MQQ A;  3BY8 A;  3LIE A;  4HY8 A;  4F3L A;  2YKF A;  4GHI B;  5F68 A;  1XJ3 A;  5AVF A;  4EES A;  4MN6 A;  4R6L A;  5J4E A;  1TS7 A;  1OTD A;  2L0W A;  4EXO A;  3CLO A;  4JGR A;  1LSW A;  3H9W A;  5I5L A;  2OOL A;  1GSW A;  3H82 B;  4HI4 A;  3MJQ A;  2PHY A;  1F9I A;  3P7N A;  2BAS A;  4PKY G;  2JN7 A;  3OLO A;  3LIF A;  4HNB A;  4EEU A;  3A0V A;  3NOU C;  2ZBB A;  1JNU A;  1LL8 A;  1XJ4 A;  2WKR A;  2W0N A;  1GSX A;  2INW A;  1N9L A;  1T1B A;  4WN5 A;  5HZH A;  2WKP A;  3GEC A;  2A24 A;  2P7J A;  4K08 A;  3MXQ A;  5J7E A;  2VV7 A;  2B02 A;  2I9V A;  3F1P B;  2QHK A;  2YKH A;  3IS2 B;  2PR5 A;  3UB9 A;  3NJA A;  4KQD A;  2VEA A;  3LIB A;  5HDC A;  1X0O A;  1F98 A;  5DKK A;  1OT9 A;  1UWN X;  1S67 L;  2WKQ A;  3K3D A;  1D06 A;  2L1M A;  5HSQ A;  1UGU A;  2PD8 A;  5AVE A;  5F5Y A;  4NXG A;  2V0U A;  3VE4 A;  4EEP A;  4R38 A;  1S1Z A;  1S4S A;  5DKL A;  3C8C A;  1XFQ A;  3FC7 A;  2ZOH A;  4I3I A;  4NXF A;  1N9N A;  2V0W A;  5G4Z A;  3HJK A;  1TS8 A;  4NXE A;  3RH8 B;  2Z6C A;  4BBT A;  4H6J A;  4WL9 A;  3K3C A;  5HWT A;  4DJ2 A;  1WA9 A;  1OT6 A;  3NHQ A;  1P0Z A;  1N9O A;  2QWS A;  3BY9 A;  3CWF A;  4JGP A;  4XT2 B;  4LPZ A;  4JGO A;  5TBM B;  1XJ6 A;  4L9F A;  3KX0 X;  3UB6 A;  3ZQ5 A;  2PD7 A;  3UB7 A;  4HH2 A;  4WF0 A;  1T19 A;  3LI9 A;  3NOP C;  4PKY A;  4HHD A;  3BWL A;  4LRY C;  5DJT A;  1P97 A;  1T1A A;  2VV6 A;  4HP9 A;  3MR0 A;  5HD3 A;  3H82 A;  4B9O A;  4L9G A;  1S4R A;  4BBV A;  3HJI A;  4I3A A;  2H28 A;  3H7W A;  2KX6 A;  3F1N A;  1UWP X;  5F69 A;  2L4R A;  1DRM A;  4HJ4 A;  1ODV A;  2GJ3 A;  2QJ7 A;  3MFX A;  3VOL A;  4I3J A;  5G4Y A;  4HOI A;  2PYP A;  2D02 A;  3ULF A;  3IBR A;  2OWJ A;  3MQO A;  2PDR A;  3F1P A;  3T50 A;  3IS2 A;  1LSX A;  4LLO B;  1EW0 A;  2A24 B;  2HV1 A;  1XFN A;  1OTE A;  1T1C A;  4GS9 B;  3GDI A;  2W27 A;  2OWH A;  2V1A A;  3VE3 A;  2VLG A;  4HQA A;  1GSV A;  3G6O A;  2V9A A;  4HH3 A;  4MN5 A;  1OJG A;  1TS0 A;  4RQ9 A;  3UME A;  4E04 A;  5HWV A;  4M4X A;  4EET B;  1DP9 A;  2CMN A;  3UB8 A;  1MZU A;  2J80 A;  3EWK A;  3RTY A;  5A8B A;  4H6J B;  3E4P A;  3F1O B;  3PYP A;  1NWZ A;  4R3A A;  4R70 A;  1V9Y A;  4GHI A;  3UMD A;  1VB6 A;  1XJ2 A;  1OJ5 A;  2EA9 A;  4EQ1 A;  3LI8 A;  2VV8 A;  4I38 A;  4F3L B;  5KIZ A;  2PR6 A;  3B33 A;  5J3W A;  5EFW A;  3FG8 A;  1V9Z A;  5F6A A;  2M1C A;  4JGQ A;  2QKP A;  3UE6 A;  1LT0 A;  4HP4 A;  3EEH A;  2R78 A;  1G28 A;  4L9E A;  3D72 A;  5HD5 A;  2QJ5 A;  1DP8 A;  1T18 A;  2JHE A;  3A0S A;  2PYR A;  3H7W B;  5IS1 A;  3E4O A;  3LUQ A;  1S66 L;  3F1N B;  4KUK A;  2K7S A;  5HDS A;  5DJU A;  4LRZ E;  3CAX A;  1OTA A;  3NOT C;  5HDD A;  3PHY A;  2D01 A;  4NXB A;  3LIC A;  4GS9 A; 
#chains in the Genus database with same CATH topology
 1I2S A;  3R7W B;  2Z6D A;  1DP6 A;  1BUE A;  3D4F A;  5FI6 A;  4MN7 A;  4I5S A;  3O87 A;  2J3T D;  2WAD A;  5EEC A;  4FH2 A;  3C38 A;  2H0Y A;  5GL9 A;  3LIA A;  2XD1 A;  3Q82 A;  4GB7 A;  1LL5 A;  4BBU A;  2RCX A;  3QP2 A;  2XF3 A;  3VP4 A;  5EVI D;  4G3K A;  5GHX A;  4HIA A;  4WZ4 A;  1KOU A;  3IT9 A;  4XUX A;  1OTB A;  3IF5 A;  2Y2Q A;  3LEZ A;  4IED A;  2JKG A;  2JKT I;  4KUO A;  2Y2G A;  4HJ6 A;  1YLZ A;  2X71 A;  4MEZ A;  1ZC2 A;  1YMS A;  2KDK A;  4I39 A;  5TBM A;  1K6R A;  1ONH A;  3O3V A;  5FA7 A;  4QB8 A;  4JXS A;  2XH9 A;  1J9M A;  5FSR A;  2V1B A;  5FQM A;  3MQQ A;  3BY8 A;  4UHU A;  3A3I A;  4PM7 A;  3M2J A;  1XJ3 A;  4PM8 A;  3IXD A;  1TS7 A;  3SS4 A;  1YQS A;  4EXO A;  3LFV A;  3UB5 P;  5EPH A;  4JLF A;  1K38 A;  1LSW A;  2ZLY A;  3L7H A;  3P09 A;  1JTD A;  3MJQ A;  2BAS A;  3IQA A;  4PKY G;  2XK1 A;  4LGW A;  1FSW A;  4HNB A;  3MMH A;  4MMN A;  3E0Y A;  4EEU A;  1FIK A;  3DTM A;  3LR0 A;  2ZBB A;  4O0P A;  4LEN A;  2Z2M B;  1FIL A;  2W1T A;  3CMZ A;  1FOF A;  3G32 A;  3RXW A;  3T4Q A;  2W0N A;  1GSX A;  4WN5 A;  5HZH A;  2G7U A;  1L3L A;  2UWX A;  1PZO A;  4C75 A;  3GEC A;  4N9K A;  4K08 A;  2ZQ7 A;  3MXQ A;  3UNW A;  2B02 A;  2I9V A;  2Y79 A;  3EGD C;  3MZD A;  2PR5 A;  4PAU A;  3TSG A;  4ZJ1 A;  3HBR A;  2ZM2 A;  1NY0 A;  3FYZ A;  3NDG A;  4WZ5 A;  1X0O A;  3CIT A;  5DKK A;  1P9R A;  4B93 A;  1UWN X;  2L1M A;  3ITB A;  3CG5 A;  1K4E A;  5HSQ A;  4ETZ A;  4WMC A;  2ZC3 B;  5M1A A;  4JXV A;  1XX2 A;  3CHW P;  5AVE A;  1K6S A;  2Y2J A;  3EQU A;  2O9C A;  4E3I A;  4R4S A;  5HFO A;  2ZC5 B;  1L0D A;  1PWC A;  1BZA A;  4CJN A;  5DKL A;  4RX2 A;  3O86 A;  4PMA A;  1XFQ A;  1E25 A;  4I3I A;  2ZQ9 A;  1N9N A;  3V50 A;  3BYD A;  3HJK A;  2WGV A;  3SH7 A;  3T4O A;  2Z6C A;  1NXY A;  1P9W A;  3MQ0 A;  3OPH A;  3QNB A;  4UEY A;  1NYM A;  3K3C A;  1SKO A;  4DJ2 A;  3EEA A;  5CGX A;  1MKM A;  5E2F A;  5DTS A;  4N1H A;  1W63 M;  2JCH A;  3NCK A;  3AGE A;  4LPZ A;  4P6Z M;  5CGW A;  4PM5 A;  2HF6 A;  4B4Z A;  1XJ6 A;  4L9F A;  3JVU A;  1SHV A;  4WF0 A;  3IF6 B;  5CGS A;  2EFX A;  3BM6 A;  3BWL A;  1Q2Q A;  4EU0 A;  5LBR A;  4KZ5 A;  3FKW A;  4P0M A;  3T4K A;  3WS4 A;  2VV6 A;  4JF5 A;  3MR0 A;  1KGF A;  2OLV A;  5AQ9 A;  4D2O A;  3HJI A;  2J3W A;  2H28 A;  4ZBE A;  4Y7P A;  1TVF A;  4E3J A;  2QPN A;  5E2H A;  2L4R A;  4X69 A;  1ODV A;  3KO6 A;  2V1Z A;  2IWB A;  5G4Y A;  1VET A;  3TOI A;  2D02 A;  3IWQ A;  2WUQ A;  3ULF A;  4WEJ A;  2W3G A;  2OWJ A;  2MJ6 A;  3IWI A;  3W2Z A;  4NET A;  3VOZ A;  4LLO B;  4IVI A;  4UQI S;  1AXB A;  3QP8 A;  3RFB A;  2HJ9 C;  3GDI A;  3DAV A;  4WBG A;  2Y2P A;  2W27 A;  4BD0 A;  2V1A A;  3OCN A;  2Y4A A;  1K4F A;  3T12 B;  2ZMV A;  2GNX A;  1ONG A;  3C7V A;  2ZL1 A;  3SOI A;  1K57 A;  1PIO A;  3ZHH A;  4KZ4 A;  3UO9 A;  3NUL A;  3A3J A;  3G6O A;  2WAE A;  2C5W B;  1OME A;  3ZDJ A;  4RQ9 A;  3LGO A;  1FCO A;  3UME A;  3CPT B;  5HWV A;  2Y2O A;  3LO7 A;  4WZ5 C;  1CEG A;  3Q7V A;  2XDM A;  5HAP A;  3EWK A;  1GCE A;  4Y5F A;  3E4P A;  3OPR A;  3DW0 A;  4HBU A;  4IHQ A;  2I72 A;  3HUN A;  1VM1 A;  2EA9 A;  3GVB A;  3MZE A;  1O07 A;  3MBZ A;  4I38 A;  3IF6 A;  5EE8 A;  4OP8 A;  5J3W A;  4B4X A;  3VP3 A;  4KZ8 A;  4ZRR A;  1CJF A;  5EOO A;  5HAQ A;  1JVJ A;  2P74 A;  2M1C A;  4LV3 A;  4X68 A;  4OOM A;  5A91 A;  4U0T A;  3LY4 A;  4LCL A;  3CI6 A;  1IKG A;  1TEM A;  3M6B A;  2HZ5 A;  3D72 A;  2QJ5 A;  3C4P A;  4OLD A;  1G6A A;  4PPR A;  1ESI A;  4X1L A;  3PAE A;  3VP2 A;  3UPP A;  3K2N A;  2WKI A;  3H7W B;  3E4O A;  3VP0 A;  1S66 L;  3F1N B;  3HLF A;  1HVB A;  3WS2 A;  4C3Q A;  2E8J A;  1BT5 A;  4K0W A;  3E2L A;  1OTA A;  4OQI A;  3IX4 A;  3NOT C;  3ZVT A;  4BLM A;  1H8M A;  5GHZ A;  2D01 A;  5A93 A;  1BLS A;  3LIC A;  1GA9 A;  4O8G A;  1W79 A;  3OPL A;  2O0Y A;  4MBF A;  2EX8 A;  2FFF B;  1BSG A;  1TS6 A;  4IBR A;  3QP4 A;  1FR1 A;  4EBP A;  2BTF P;  3MF0 A;  4ARZ B;  4FD8 A;  2DNS A;  2XQZ A;  5AQ7 A;  5IT5 A;  2Q0O A;  4CLC B;  5E2G A;  3S7Q A;  5A92 A;  2VJW A;  4IUH A;  1BYW A;  5CTM A;  4ESP A;  3ZFZ A;  2QMI A;  2XFT A;  3Q1F A;  3D3O A;  3U4L P;  4DJ3 A;  4JXW A;  1L2S A;  3E4Q A;  3SW1 A;  3CZD A;  4MNR A;  3W4P A;  4H8R A;  1YLP A;  1KE4 A;  3DTK A;  3O88 A;  1D7E A;  3UPN A;  4WLA A;  5DF9 A;  1OTI A;  5HWW A;  4BMW A;  1LSV A;  3V3R A;  3EOI A;  3A0R A;  3NBL A;  4XT2 A;  4YWZ A;  1K57 C;  1Y28 A;  4R1G A;  4EER A;  5L09 A;  3WS1 A;  2WKH A;  3HLE A;  3FPV A;  3G30 A;  3V3S A;  1IKI A;  2PBY A;  4GOG A;  2XA7 S;  1IYO A;  4JBF A;  5MC7 A;  3BQ8 A;  3HL9 A;  2YKF A;  4GHI B;  1H3Q A;  4R6L A;  1EWZ A;  4GKU A;  3HUM A;  4DRT A;  4X1M A;  2OOL A;  1F9I A;  2B18 A;  2ZQC A;  4Q0J A;  1MKI A;  4U3T A;  2ZM0 A;  1JNU A;  5F83 A;  1XJ4 A;  3T4L A;  1DY6 A;  2A3U A;  4QWO A;  3UE3 A;  1NRJ A;  4PM9 A;  5EVL A;  2M7V A;  3IF6 C;  3BFF A;  2M7U A;  3VV4 A;  2XFS A;  3S1Y A;  4R3J A;  3N6I A;  5J7E A;  3NIA A;  4FH4 A;  1XGI A;  3F1P B;  5CER A;  2H5S A;  3BQA A;  3PBO A;  1VEU A;  1XA1 A;  2K2N A;  4E3M A;  3ISG A;  2V8C A;  4WEL A;  2QZ6 A;  4ARZ A;  2ZC6 B;  5L8M A;  4FCF A;  1MXO A;  2G2U A;  4OPY A;  4CLC A;  3W4O A;  4L0L A;  5FQJ A;  2PD8 A;  2P9V B;  1RGZ A;  3MKE A;  2V0U A;  3VE4 A;  3BLS A;  1S1Z A;  5CX7 A;  5U47 A;  2H10 A;  2V0W A;  4S2O A;  5G4Z A;  3G34 A;  2JKR M;  4NXE A;  1KE3 A;  3RH8 B;  1FSY A;  4MLL A;  1TDL A;  5CED A;  5CEC A;  4DXB A;  1K55 A;  1WA9 A;  1W63 Q;  3BRM A;  1N9O A;  3CWF A;  1Z09 A;  3MZF A;  1PW1 A;  4EQI A;  3WS5 A;  1M6K A;  4JGO A;  4GZB A;  4X6T A;  1YT4 A;  3KX0 X;  3V5M A;  2V2F F;  1K56 A;  2EFU A;  5AQB A;  4KG5 A;  5CXW A;  4HH2 A;  1T19 A;  3LY3 A;  3LI9 A;  3FKV A;  1XKZ A;  4ZTK A;  2G2W A;  4LCM A;  4OOL A;  3D9Y A;  3WRZ A;  1T1A A;  3BW6 A;  5KMW A;  3ZG7 B;  5HD3 A;  4B9O A;  4QU3 A;  3NDE A;  5JYP A;  3BJN A;  1KDW A;  2KX6 A;  2W3H A;  5F69 A;  3IX8 A;  1SCW A;  2GJ3 A;  3JYI A;  4MDZ A;  4EUZ A;  2QJ7 A;  4Y0U A;  2OLU A;  3S7O A;  2W1R A;  3G2Z A;  4I3J A;  2NUT C;  4HOI A;  4RX3 A;  1A0K A;  2Y55 A;  2EXA A;  3BFC A;  4NK3 A;  5FL3 A;  4OLG A;  1TDG A;  3EGX C;  1EI5 A;  3F1P A;  4GJ4 A;  5FDS A;  3T50 A;  3NC8 A;  2A24 B;  1XPB A;  1PI5 A;  1XFN A;  1OTE A;  5HL1 A;  5CRF A;  1E3U A;  4WMC D;  1CI8 A;  2XA7 M;  3R7W A;  2OWH A;  4Y17 A;  3VE3 A;  4ZJ2 A;  1W8Y A;  4DF6 A;  3HCY A;  3L9K A;  5HPI A;  4HQA A;  1FQG A;  1GA0 A;  4BEN A;  1YLY A;  3RJU A;  3S4X A;  3A3D A;  4EBL A;  4X53 A;  5AQA A;  3OOV A;  1OJG A;  1H8Z A;  2VGK A;  3HRE A;  1LLB A;  4GNU A;  3SS5 A;  4E04 A;  2XSS A;  1I2W A;  4MBH A;  4Q8I A;  1ERO A;  3KSG A;  3IH9 A;  5C5K A;  5DF8 A;  3IHB A;  2V20 A;  3RTY A;  4CLC C;  3ZVW A;  4H6J B;  4IBX A;  3B47 A;  3DWK A;  2H0T A;  4KZ6 A;  3UY6 A;  1NWZ A;  3T4S A;  1XJ2 A;  4EQ1 A;  5DFY A;  3LI8 A;  2JKR I;  1IOU A;  3V67 A;  2PR6 A;  3B33 A;  3DBA A;  5DFX A;  5EFW A;  3FG8 A;  1V9Z A;  1ZG6 A;  4QJG A;  3SH8 A;  2WGI A;  4Z1W A;  4Q0H A;  2J3T C;  1LT0 A;  5DVA A;  1K55 C;  3IWO A;  4YFM A;  3EEH A;  5HD5 A;  3PR6 A;  5FQI A;  4R4R A;  2FZ0 A;  1PFL A;  1L0G A;  5IHV A;  3MKF A;  1ES2 A;  3LUQ A;  2HDS A;  2LB9 A;  3QP6 A;  5L10 A;  1SZV A;  3DTE A;  2PRF A;  4LRZ E;  3BFE A;  3CAX A;  4GD8 A;  4R0Q A;  4DE1 A;  5M18 A;  4YNR A;  5FQQ A;  2WYX A;  3IBJ A;  2Y59 A;  4OKP A;  2ZM8 A;  4WYY A;  5EOE A;  5CHM A;  1YSP A;  4E3K A;  1MWS A;  3CJM A;  2HDU A;  1MWR A;  1S1Y A;  3G31 A;  3LR4 A;  3A3F A;  3LEQ A;  2ZOI A;  4OPZ A;  5E2E A;  4GDB A;  5FAS A;  3PBS A;  1GHI A;  3VSL A;  3IXG A;  1I5Q A;  1ZG4 A;  2DRW A;  3W8K A;  1O7E A;  3PAG A;  3T1S A;  4LRX C;  1ALQ A;  3OPP A;  2HP6 A;  2VA0 A;  2FH5 A;  1DJB A;  3KYQ A;  4FSF A;  1IEL A;  1YAX A;  1PRQ A;  5DF7 A;  1VQQ A;  3SS3 A;  3FPW A;  4KZB A;  4CPK A;  5FAQ A;  5EV0 A;  1KVM A;  4BJP A;  4KQO A;  1W5D A;  2VKS A;  3LIE A;  3S7N A;  4UA9 A;  4HY8 A;  4Y15 A;  3TG9 A;  5AVF A;  5J4E A;  1SDE A;  4Y0T A;  3IH8 A;  1YKD A;  1SDN A;  2L0W A;  1G68 A;  4JGR A;  5FDH A;  1JWZ A;  2XEP A;  5I5L A;  1PWG A;  3MXS A;  1GSW A;  3H82 B;  3PBT A;  2PHY A;  2CC1 A;  1PZP A;  2JN7 A;  1NYY A;  2GZA A;  3A3E A;  3R4K A;  3UPO A;  1W7F A;  2RL3 A;  1KDS A;  3G4P A;  4FOF A;  3HLC A;  1LL8 A;  2XLN A;  4II7 A;  1YPR A;  3AGF A;  4E6W A;  1T1B A;  4D60 A;  1AWI A;  2HJE A;  1LI9 A;  1H5X A;  2P7J A;  1BLC A;  1Y54 A;  1M40 A;  2Q9N A;  4GN2 A;  3QP1 A;  5F1G A;  2VV7 A;  2C6W B;  2QHK A;  2YKH A;  2A49 A;  1RGY A;  3UB9 A;  4KQD A;  1VHM A;  1RCJ A;  4S2M A;  3RXX A;  2VEA A;  3LIB A;  2OAP 1;  4S2N A;  1F98 A;  1OT9 A;  1IYS A;  1S67 L;  4JXG A;  1D06 A;  1IYP A;  2QYB A;  2B5R A;  4RVA A;  3KSI A;  5F5Y A;  4GD6 A;  4Q0I A;  1DJC A;  2Y8H A;  1SKF A;  3CPT A;  4ME4 A;  2A2L A;  2OAQ 1;  1QMF A;  5D3O A;  4KZA A;  2X02 A;  1ZHH B;  3FC7 A;  2ZOH A;  2DCF A;  4NXF A;  2OSU A;  3ZNY A;  1E4D A;  1BTL A;  2B95 A;  1BLH A;  2W3D A;  4OQH A;  1XXM A;  4XXR A;  3FZC A;  4P6B A;  1PNE A;  4BBT A;  3VFH A;  1LI0 A;  4KG6 A;  4PM6 A;  3ZG8 B;  4WL9 A;  2PAV P;  4Y13 A;  3NHQ A;  2OV5 A;  1Z6F A;  1YMX A;  3HLD A;  5EVI B;  5DTK A;  2VX8 A;  4E3L A;  3LR3 A;  5EM1 A;  3ZCZ A;  1JWP A;  5TBM B;  5K5B A;  3QHY A;  4ID4 A;  3PBN A;  3UB6 A;  3ZQ5 A;  2PD7 A;  4KZ3 A;  3UB7 A;  2P04 A;  4S2K A;  3CUE A;  2V8F A;  3KYE A;  4HHD A;  4LRY C;  1STZ A;  4E6X A;  5FQ9 A;  1BLP A;  4HP9 A;  3FV7 A;  5FQK A;  1HTZ A;  4BD1 A;  3IXH A;  3H82 A;  1CEF A;  3W4Q A;  3M2K A;  3H7W A;  4Y3I A;  3KYZ A;  3F1N A;  4MCW A;  2J7V A;  1UWP X;  4OQG A;  3UDI A;  2W3F A;  1H0M A;  4HJ4 A;  3ZG0 A;  4QY6 A;  5TFQ A;  3GV9 A;  3M6H A;  4KG2 A;  3MXR A;  4A5R A;  3MFX A;  3HLB A;  2K31 A;  4Z9Q A;  2W1T B;  3VP1 A;  5G18 A;  5L07 A;  3N8S A;  4X25 A;  1MWU A;  3MQO A;  2ZQ8 A;  2PDR A;  2GDN A;  1BUL A;  1W8Q A;  1LSX A;  4OPR A;  3T4J A;  2DMW A;  4P85 A;  3C5A A;  2XD5 A;  1T1C A;  4GS9 B;  4IJG A;  1Y4O A;  1LHY A;  1PYY A;  3OCL A;  4RA7 A;  3C7U A;  2VLG A;  5FI7 A;  4BL2 A;  1WE4 A;  4O01 A;  4G3V A;  2NUP C;  4Y0O A;  3WWX A;  3N4I A;  3N7W A;  1ES3 A;  1G5U A;  3LR5 A;  4OP5 A;  2Z2L B;  4HH3 A;  4MN5 A;  4QPR A;  3OC2 A;  1ES4 A;  4OPQ A;  1TS0 A;  1K25 A;  4U0X A;  3UDF A;  2VK3 A;  2O9B A;  1NJ4 A;  3UN7 A;  4QY5 A;  4AFI A;  3TJZ C;  4YIN A;  5TGF A;  2J80 A;  1MWT A;  1LL9 A;  4S2N C;  1YM1 A;  4JF6 A;  5DTT A;  4RYE A;  1K54 A;  1K56 D;  2HP5 A;  5EVI A;  5HX9 A;  1DJA A;  3F1O B;  1SKO B;  3HUO A;  3ITA A;  3MS6 A;  4DE0 A;  4R70 A;  3Q07 A;  1V9Y A;  2J8Y A;  4GHI A;  1OJ5 A;  1GHM A;  3HLW A;  4HES A;  2VV8 A;  4F3L B;  5KIZ A;  2EX9 A;  4GLQ A;  2EXB A;  4QD4 A;  3TE8 A;  1WYC A;  2BG1 A;  3G2Y A;  5F6A A;  5HL6 A;  5KSC A;  4JGQ A;  2QKP A;  3UE6 A;  4EUV A;  1G28 A;  4L9E A;  1XA7 A;  2LB5 A;  1DP8 A;  1T18 A;  3NEC A;  3A0S A;  2PYR A;  2HPB A;  4UAA A;  5IS1 A;  2VGL S;  5J8X A;  2XRN A;  1IFQ A;  5HDS A;  5DJU A;  3V39 A;  3CUE C;  2FFY A;  3VFF A;  1IYQ A;  4CLC E;  1OPX A;  1PWD A;  3FWL A;  1E3U D;  3HLG A;  5HDD A;  1J3W A;  1F5M A;  1VET B;  2ACG A;  3E98 A;  1ERQ A;  3C30 A;  4NXB A;  1MY8 A;  5FI2 A;  1JTG A;  4GS9 A;  4FTX A;  4ZAM A;  2EWW A;  3U2A A;  2WZZ A;  2Y2I A;  1TF1 A;  4ETX A;  2P9V A;  3GMW A;  2HDQ A;  4GW9 A;  4X56 A;  2WAF A;  2HP9 A;  4PHT A;  4GCZ A;  5EM0 A;  5EUA A;  4HJ3 A;  2PU2 A;  4LV2 A;  4EWF A;  3C4O A;  3ICY A;  5IU1 A;  2ZL1 B;  3T1X A;  1CK3 A;  4UA6 A;  2PT7 A;  3Q81 A;  2JC7 A;  3C2W A;  3LID A;  5CHJ A;  4EW7 A;  3N8R A;  4NKP A;  4OH0 A;  2WKE A;  4DMZ A;  4KEN B;  3LYX A;  3IXB A;  3ZNT A;  3Q7V B;  3F1O A;  1ACF A;  4WUJ A;  1ESU A;  1HD8 A;  2XGN A;  2Y2N A;  2VGJ A;  1FCN A;  2EWV A;  5CTN A;  3AGD A;  4FUW A;  4F3L A;  2GX5 A;  5F68 A;  2JBF A;  4MN6 A;  4EES A;  3BFG A;  2JKF A;  1OTD A;  3EQV A;  1PI4 A;  3CLO A;  5GLB A;  2Y2M A;  4LV1 A;  3T4T A;  3H9W A;  4JPM A;  1K54 C;  3DTI A;  4HI4 A;  2ZQA A;  4O7D A;  3P7N A;  3T1Q B;  3OLO A;  2AVX A;  3LIF A;  4GDN A;  4LFU A;  2ZC7 A;  5EVI C;  3SZT A;  3IHA A;  3PXP A;  1HLU P;  2R9X A;  1HZO A;  3A0V A;  1D1J A;  3NOU C;  1CI9 A;  1S0W A;  1YLW A;  4E3O A;  3QNC A;  2Y2K A;  5FAP A;  4DXC A;  3PTE A;  1QME A;  2WKR A;  3VMA A;  1U60 A;  4S2J A;  2INW A;  4E3N A;  1N9L A;  2Q9M A;  2WKP A;  1L0E A;  2XR0 A;  2A24 A;  3BEB A;  4OON A;  3PBQ A;  5GLD A;  4Y2F A;  4BQM A;  3IS2 B;  3G35 A;  1N4O A;  3GTC A;  1KGE A;  1KGG A;  3NJA A;  3OZH A;  5A90 A;  2XRO A;  4K91 A;  5HDC A;  4S2L A;  4ZDX A;  3WS0 A;  1C3B A;  3SH9 A;  2E8I A;  2WKQ A;  3K3D A;  5BOH A;  4KQR A;  1UGU A;  4EV4 A;  4NG2 A;  4NXG A;  1Q2P A;  4IVK A;  4EEP A;  4R38 A;  2ZC4 B;  2ZD8 A;  1S4S A;  4XUZ A;  2HGV A;  2ZQD A;  4MBK A;  5F82 A;  4X55 A;  3C8C A;  1MC0 A;  3QP5 A;  5GHY A;  4JF4 A;  1YLJ A;  2VGL M;  1TS8 A;  4NEE D;  2Y2H A;  5F1F A;  4KZ9 A;  4H6J A;  2O99 A;  1ZKJ A;  4HBT A;  4M3K A;  5HWT A;  1FCM A;  1MPL A;  1FR6 A;  1OT6 A;  1P0Z A;  4BWI A;  1NLY A;  2QWS A;  3BY9 A;  5M19 A;  2O9A A;  4JGP A;  4XT2 B;  3GSG A;  4R3B A;  3DWZ A;  1YSQ A;  2KOI A;  5TR7 A;  4YOF A;  3ZG5 A;  4N92 A;  3ZYT A;  5HW3 A;  4PKY A;  3NOP C;  5GLC A;  2UV0 E;  2Y91 A;  1NZU A;  3KSF A;  5DJT A;  3MFD A;  1P97 A;  4ZJ3 A;  1RP5 A;  3S7P A;  4KQQ A;  4DE2 A;  3VOY A;  2WK0 A;  4L9G A;  1S4R A;  3UE0 A;  1L0F A;  1NRF A;  4BBV A;  1GHP A;  4I3A A;  3JPU A;  4BL3 A;  3NI9 A;  3BEC A;  3P01 A;  4LV0 A;  1DRM A;  2J9O A;  5I94 A;  1KVL A;  4WM9 A;  3VOL A;  2WZX A;  2PYP A;  3B3X A;  5KZH A;  5CHU A;  3GQZ A;  4N1X A;  3IBR A;  3PBR A;  1PW8 A;  1G6O A;  2Y2L A;  3IS2 A;  1EW0 A;  4S2I A;  3JVV A;  2HV1 A;  5FAT A;  3B42 A;  2WGW B;  5HAR A;  1VEU B;  2PBD P;  1NZO A;  1ES5 A;  3Q7Z A;  3GRJ A;  4DE3 A;  2JKT M;  4DDS A;  1GSV A;  1ZTU A;  4OQ0 A;  1XP4 A;  2V9A A;  1JWV A;  1F2K A;  3TW8 A;  5L2F A;  3N8L A;  4G3W A;  2PU4 A;  3GR2 A;  3S22 A;  4M4X A;  3TRC A;  1CQA A;  2W3E A;  1DP9 A;  4EET B;  5HPF A;  2ZMA A;  2CMN A;  4IUK A;  5AJG A;  2X01 A;  4K0X A;  4EBN A;  1YLT A;  1S6R A;  3LCE A;  3UB8 A;  1MZU A;  4CQH A;  1N9B A;  3UE1 A;  4C6Y A;  1WYB A;  4DKI A;  5EVE A;  5A8B A;  2VZW A;  3I7J A;  4N9L A;  2BLS A;  5TJJ A;  3O5Y A;  3BLM A;  4UA7 A;  5FEF A;  2IA2 A;  2EX6 A;  3BFD A;  3PYP A;  4R3A A;  1K0K A;  4B88 A;  3UDX A;  3UMD A;  1VB6 A;  2HDR A;  3WRT A;  4UQI M;  4KZ7 A;  3IX3 A;  4QHC A;  3T1R A;  5KSH A;  2IWC A;  3HVF A;  4JKT A;  4S2P A;  2IWD A;  3KSH A;  2ZMF A;  1IEM A;  4F94 A;  2EX2 A;  5E43 A;  4OVD A;  4DDY A;  4P87 A;  1CF0 A;  5JYO A;  3NY4 A;  3OBF A;  3VSK A;  1MBL A;  4DN0 A;  3ZGA B;  4HP4 A;  2R78 A;  1TD5 A;  2R9W A;  2ZJ9 A;  2P08 A;  2JE5 A;  2KLI A;  4R23 A;  2JHE A;  1KE0 A;  3ZG9 B;  1ERM A;  4KUK A;  1H8Y A;  2K7S A;  3P98 A;  1NLZ A;  5CEB A;  2J9P A;  5FAO A;  4WEK A;  3PHY A;  4CLC D;  4HEF A;  4P6Z S;  3MSH A;  5FEG A;  5GLA A;  5HAI A;  4OOY A;  3E2K A;  1XGJ A;  2WGW A; 
#chains in the Genus database with same CATH homology
 1TS6 A;  3U2A A;  3MF0 A;  4ARZ B;  1TF1 A;  1S1Y A;  4ETX A;  3R7W B;  2Z6D A;  5IT5 A;  3LR4 A;  1DP6 A;  4GW9 A;  4PHT A;  4GCZ A;  4CLC B;  3S7Q A;  4HJ3 A;  2VJW A;  2ZOI A;  4IUH A;  1BYW A;  3ICY A;  3PBS A;  4MN7 A;  5IU1 A;  3D3O A;  4I5S A;  2J3T D;  4DJ3 A;  2PT7 A;  3C38 A;  3LIA A;  3E4Q A;  3SW1 A;  4BBU A;  3C2W A;  4LRX C;  3LID A;  4EW7 A;  4NKP A;  4G3K A;  4HIA A;  1D7E A;  1KOU A;  2VA0 A;  2FH5 A;  4WLA A;  1OTB A;  3KYQ A;  5DF9 A;  1OTI A;  4FSF A;  5HWW A;  4DMZ A;  1YAX A;  2JKT I;  4BMW A;  4KUO A;  1LSV A;  3EOI A;  4HJ6 A;  3A0R A;  4XT2 A;  3LYX A;  4YWZ A;  3FPW A;  1Y28 A;  2KDK A;  3F1O A;  4I39 A;  5TBM A;  4WUJ A;  4EER A;  4BJP A;  4KQO A;  3FPV A;  2EWV A;  2V1B A;  3MQQ A;  3BY8 A;  2XA7 S;  2VKS A;  3LIE A;  3S7N A;  5MC7 A;  4HY8 A;  4F3L A;  3BQ8 A;  2GX5 A;  2YKF A;  4GHI B;  5F68 A;  1XJ3 A;  5AVF A;  4EES A;  4MN6 A;  1H3Q A;  4R6L A;  5J4E A;  1TS7 A;  1YKD A;  3EQV A;  1OTD A;  2L0W A;  4EXO A;  3LFV A;  3CLO A;  4JGR A;  1LSW A;  3T4T A;  3H9W A;  5I5L A;  2OOL A;  3H82 B;  1GSW A;  4HI4 A;  3MJQ A;  2PHY A;  1F9I A;  3PBT A;  3P7N A;  2BAS A;  2B18 A;  4PKY G;  2JN7 A;  3OLO A;  3LIF A;  4Q0J A;  4HNB A;  3MMH A;  4MMN A;  2GZA A;  3PXP A;  3E0Y A;  3R4K A;  4EEU A;  3A0V A;  3LR0 A;  3NOU C;  2ZBB A;  1JNU A;  4FOF A;  4O0P A;  1LL8 A;  1XJ4 A;  3T4L A;  2W1T A;  4II7 A;  3UE3 A;  1NRJ A;  2WKR A;  2M7V A;  3T4Q A;  2W0N A;  1GSX A;  2INW A;  1N9L A;  1T1B A;  4WN5 A;  5HZH A;  2G7U A;  2WKP A;  2HJE A;  2M7U A;  3VV4 A;  3GEC A;  2A24 A;  2P7J A;  4K08 A;  3MXQ A;  5J7E A;  2VV7 A;  2B02 A;  2I9V A;  2Y79 A;  3F1P B;  3EGD C;  2QHK A;  2YKH A;  3PBQ A;  3IS2 B;  4Y2F A;  2PR5 A;  3UB9 A;  4PAU A;  3PBO A;  3BQA A;  3NJA A;  2XRO A;  4KQD A;  1VHM A;  2K2N A;  2VEA A;  3LIB A;  5HDC A;  4WEL A;  1X0O A;  4ARZ A;  2OAP 1;  3CIT A;  5L8M A;  1F98 A;  5DKK A;  1P9R A;  4B93 A;  1OT9 A;  1UWN X;  1S67 L;  2WKQ A;  3K3D A;  1D06 A;  2L1M A;  2QYB A;  4CLC A;  5HSQ A;  4ETZ A;  4L0L A;  1UGU A;  2PD8 A;  3KSI A;  5AVE A;  5F5Y A;  4NXG A;  3EQU A;  4Q0I A;  2V0U A;  2O9C A;  2Y8H A;  3VE4 A;  4EEP A;  4ME4 A;  2A2L A;  2OAQ 1;  4R38 A;  1S1Z A;  1S4S A;  5CX7 A;  2HGV A;  5DKL A;  3C8C A;  1ZHH B;  1XFQ A;  3FC7 A;  2ZOH A;  4I3I A;  4NXF A;  1MC0 A;  1N9N A;  2V0W A;  5G4Z A;  2W3D A;  3HJK A;  4NEE D;  2VGL M;  1TS8 A;  2JKR M;  4NXE A;  3T4O A;  3RH8 B;  2Z6C A;  1P9W A;  3MQ0 A;  4BBT A;  4H6J A;  2O99 A;  4UEY A;  4WL9 A;  3K3C A;  5HWT A;  4DJ2 A;  1WA9 A;  3EEA A;  1W63 Q;  1MKM A;  1OT6 A;  3NHQ A;  1P0Z A;  4BWI A;  1NLY A;  1N9O A;  3CWF A;  2QWS A;  3BY9 A;  2VX8 A;  2O9A A;  4JGP A;  1W63 M;  4XT2 B;  4LPZ A;  3LR3 A;  1YSQ A;  2KOI A;  4P6Z M;  4JGO A;  4YOF A;  2HF6 A;  5TBM B;  1XJ6 A;  5K5B A;  4L9F A;  3KX0 X;  3JVU A;  3UB6 A;  3PBN A;  3ZQ5 A;  2PD7 A;  3UB7 A;  3ZYT A;  2P04 A;  4HH2 A;  4WF0 A;  1T19 A;  3CUE A;  3LI9 A;  3NOP C;  4PKY A;  4HHD A;  3BWL A;  3KSF A;  4LRY C;  5DJT A;  4EU0 A;  5LBR A;  4OOL A;  1P97 A;  1STZ A;  3T4K A;  1T1A A;  2VV6 A;  3S7P A;  4HP9 A;  3MR0 A;  3BW6 A;  5HD3 A;  3H82 A;  4B9O A;  4L9G A;  1S4R A;  4BBV A;  3HJI A;  2J3W A;  3BJN A;  4I3A A;  2H28 A;  3H7W A;  4Y3I A;  2KX6 A;  3KYZ A;  2W3H A;  3F1N A;  4MCW A;  1UWP X;  5F69 A;  3P01 A;  2W3F A;  2L4R A;  1DRM A;  4HJ4 A;  1ODV A;  2GJ3 A;  4MDZ A;  2QJ7 A;  3KO6 A;  3S7O A;  3MFX A;  2W1R A;  3VOL A;  4I3J A;  2NUT C;  5G4Y A;  2K31 A;  4HOI A;  2PYP A;  2D02 A;  2W1T B;  5FL3 A;  3ULF A;  4WEJ A;  2W3G A;  3IBR A;  3PBR A;  2OWJ A;  2MJ6 A;  3EGX C;  3MQO A;  3W2Z A;  2PDR A;  3F1P A;  4GJ4 A;  1G6O A;  3IS2 A;  3T50 A;  1LSX A;  4LLO B;  4UQI S;  1EW0 A;  2A24 B;  3JVV A;  2HV1 A;  1XFN A;  3T4J A;  1OTE A;  2DMW A;  3RFB A;  1T1C A;  3B42 A;  2HJ9 C;  4GS9 B;  4IJG A;  3GDI A;  2XA7 M;  2W27 A;  3R7W A;  3OCL A;  2OWH A;  2V1A A;  3OCN A;  3VE3 A;  2ZMV A;  2VLG A;  2GNX A;  3HCY A;  4O01 A;  5HPI A;  4G3V A;  2NUP C;  4HQA A;  2JKT M;  1GSV A;  1ZTU A;  3G6O A;  2V9A A;  3LR5 A;  4HH3 A;  4MN5 A;  3OOV A;  1OJG A;  4QPR A;  3TW8 A;  3OC2 A;  1TS0 A;  4RQ9 A;  4G3W A;  3UME A;  4E04 A;  5HWV A;  2XSS A;  4M4X A;  3TRC A;  2W3E A;  1DP9 A;  4EET B;  5HPF A;  2CMN A;  4IUK A;  5AJG A;  2O9B A;  3KSG A;  4AFI A;  3TJZ C;  3UB8 A;  1MZU A;  2J80 A;  4CQH A;  5C5K A;  3EWK A;  3RTY A;  4CLC C;  5A8B A;  4Y5F A;  2VZW A;  4H6J B;  3E4P A;  5TJJ A;  3B47 A;  3O5Y A;  3F1O B;  2IA2 A;  3PYP A;  1NWZ A;  4R3A A;  3T4S A;  4R70 A;  4IHQ A;  1V9Y A;  4GHI A;  3UMD A;  1VB6 A;  1XJ2 A;  1OJ5 A;  4UQI M;  2EA9 A;  4EQ1 A;  5DFY A;  3LI8 A;  2JKR I;  2VV8 A;  1IOU A;  5KSH A;  4I38 A;  3V67 A;  4F3L B;  5KIZ A;  2PR6 A;  3B33 A;  5J3W A;  3DBA A;  5DFX A;  5EFW A;  4GLQ A;  3KSH A;  2ZMF A;  4ZRR A;  3TE8 A;  3FG8 A;  1V9Z A;  5F6A A;  5HL6 A;  2M1C A;  4JGQ A;  2QKP A;  4OOM A;  4Z1W A;  3UE6 A;  3OBF A;  4Q0H A;  2J3T C;  1LT0 A;  3CI6 A;  4DN0 A;  4EUV A;  4HP4 A;  3EEH A;  2R78 A;  1G28 A;  4L9E A;  1TD5 A;  2LB5 A;  3D72 A;  5HD5 A;  2QJ5 A;  3PR6 A;  2FZ0 A;  1DP8 A;  1T18 A;  2P08 A;  2KLI A;  3K2N A;  2JHE A;  3A0S A;  2PYR A;  3H7W B;  5IS1 A;  2VGL S;  3E4O A;  3LUQ A;  1S66 L;  2XRN A;  3F1N B;  4KUK A;  2LB9 A;  1IFQ A;  2K7S A;  5HDS A;  5DJU A;  1NLZ A;  3CUE C;  4LRZ E;  3CAX A;  1OTA A;  4CLC E;  1OPX A;  4YNR A;  3NOT C;  5HDD A;  1F5M A;  4WEK A;  3E98 A;  1H8M A;  3IBJ A;  3C30 A;  3PHY A;  2D01 A;  4NXB A;  4CLC D;  4P6Z S;  3LIC A;  4O8G A;  4GS9 A;  2O0Y A;  2EWW A;  1YSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...