5F1GA

Crystal structure of a class c beta lactamase
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
361
structure length
351
Chain Sequence
b'HHPQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPATKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPPEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVRSNMNPRDINDKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIINAAHPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVAAAWQILNALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Crystal structure of a class C beta lactamase
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 114
structure length 351
sequence length 361
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5f1gA00
4ZJ3A 5TFQA 4DXBA 4C6YA 1PYYA 1YT4A 1ES3A 3LO7A 5A91A 5CGSA 4R1GA 1WYBA 1GHIA 3O88A 4BENA 3PBRA 5GLBA 3PAGA 4ID4A 3UO9A 5BOHA 4KZ4A 4DDYA 1QMFA 5FQQA 2QPNA 4YINA 2P9VA 4RYEA 5CTNA 5FATA 2ZQCA 1BUEA 2VGKA 3MKFA 5F1FA 1LI9A 3DWZA 3A3EA 3IXHA 5EVIB 2HDQA 1ERQA 4Y0TA 5FQMA 1YLJA 4OVDA 4QB8A 1I5QA 3IF6C 1K4EA 1K54C 3MZDA 1JVJA 4HBUA 1FCOA 1G68A 4RVAA 4MEZA 4X56A 1PZPA 3UE3A 3UPNA 3P09A 3G32A 4BJPA 5AQAA 4OPYA 1XKZA 2V2FF 2A49A 5CERA 2ZQAA 3S22A 4EBPA 3P98A 2EXBA 3V39A 4MBFA 3UE1A 3RXWA 4P6BA 4MBHA 1IKIA 1U60A 3N6IA 3Q82A 5CXWA 3ZG8B 4S2NA 4WBGA 1GHPA 4KZ5A 2WKEA 5DF9A 1ZKJA 3IHBA 1BSGA 1XA7A 4OQGA 3SH7A 5F82A 3IXBA 3G2YA 3WS2A 5D3OA 1XA1A 4O7DA 5GHXA 3VSKA 4OQIA 1PIOA 1K56D 1YLYA 1YMSA 5KSCA 2DRWA 4N92A 3BRMA 3O86A 3GMWA 4XUXA 3ZG9B 3WS5A 1SDEA 5CHUA 2Y91A 5F83A 5JYPA 3DTMA 3Q7VB 4KZ3A 3Q7VA 1YLTA 2FFYA 3UY6A 1SCWA 4OOMA 1ZG4A 4JXGA 1JTGA 3BLMA 5CRFA 4JF6A 1J9MA 3OCLA 2EXAA 2RCXA 3I7JA 3HBRA 3V3RA 4D2OA 1ESUA 4QY5A 4OLGA 3NC8A 3LY3A 5U47A 4EWFA 1NJ4A 4GD8A 4UA6A 3UNWA 2Y2OA 1L0GA 3TG9A 4JLFA 3G35A 1G6AA 1Q2QA 1KVMA 4GKUA 4PPRA 3ZG7B 1PZOA 2OLUA 3AGDA 4JF5A 1Y54A 2BG1A 3GTCA 4KZBA 4EUZA 1E3UA 2ZQ9A 2XFTA 5E2GA 4R3BA 3S1YA 3NBLA 4JXWA 3VP0A 2P74A 4E3LA 5M19A 2H10A 1IKGA 2Y2GA 3BFFA 5A90A 2Y55A 1EWZA 4R4RA 2ZC5B 4N9LA 4PM6A 1LL9A 3A3IA 2ZQDA 2Z2LB 3NI9A 4KG6A 3IWOA 5I94A 1GHMA 1H5XA 1KDWA 2VGJA 2WKHA 3S4XA 5HARA 4OONA 5CGWA 4EBNA 4ZJ1A 3M2KA 5HX9A 1HD8A 3OZHA 4P87A 3NDEA 5FI2A 4KG2A 4X68A 3QNBA 4XXRA 4RX2A 4DXCA 3ZFZA 2QZ6A 5E2HA 5FI7A 1TDGA 1LI0A 3IHAA 2JE5A 2XLNA 1L0FA 3GR2A 4WYYA 3UDFA 3BFDA 1GCEA 2XR0A 3UDIA 4BL2A 4OKPA 1TDLA 2ZM0A 4EBLA 5AQ7A 2WK0A 3HREA 3NDGA 3OC2A 1NYMA 2HP9A 3PBQA 4OOLA 4X55A 1Q2PA 4E3MA 4E3JA 3G34A 1MKIA 4DRTA 2FFFB 3BFEA 1MBLA 1PWGA 2HPBA 4NK3A 3GV9A 1RCJA 5HFOA 2Z2MB 4JXSA 2WZXA 1LL5A 4K91A 2WAFA 1KDSA 3ITAA 3W4PA 3UE0A 4BQMA 2IWBA 4UHUA 1VM1A 4S2LA 2Y2MA 3HLGA 1BLSA 2ZD8A 3MXRA 4BD1A 2P9VB 4U0XA 4OQ0A 1ZG6A 4QY6A 2XQZA 1K38A 2XEPA 1CK3A 3A3FA 2WKIA 1K25A 4DE3A 3OPLA 4GNUA 5AQ9A 4FH4A 5CHMA 5EECA 3EQVA 2WADA 4DF6A 4KG5A 4QD4A 1KGEA 4ZTKA 3G31A 1XGJA 5EVIC 3BYDA 4Y0OA 1W7FA 5A92A 2EFXA 1Z6FA 5HAIA 4FSFA 3C4OA 2WAEA 5GLDA 1IYOA 1BT5A 1DY6A 1N9BA 4WZ5C 5FQIA 3SOIA 3TSGA 1I2WA 1ES4A 1YLZA 3W4OA 3GSGA 4JKTA 2UWXA 3HLFA 4RX3A 3FYZA 1XP4A 5EPHA 3VFFA 4OP8A 1BULA 4U3TA 3ZG0A 4CPKA 3Q07A 4LCLA 2X01A 2HDUA 2Y2HA 1CEGA 5FAOA 1K56A 1KE0A 3HLEA 3QHYA 2ZJ9A 1PWDA 2XD5A 1YQSA 5TR7A 3LEZA 3OPPA 3PBNA 1HTZA 1MWRA 1H8YA 1W5DA 3IF6B 5L2FA 4IBRA 4MNRA 3IF6A 3VP3A 3FWLA 1XGIA 4P0MA 4YFMA 3HUNA 1K54A 1H8ZA 1KE3A 3FKVA 3Q81A 3SS3A 4ZJ2A 4CJNA 2RL3A 5JYOA 5CEBA 3SS5A 4S2IA 4WM9A 1FCMA 3ZVWA 1ALQA 4E3OA 4PM5A 4WZ4A 1KGFA 3ITBA 1E4DA 1RP5A 4QU3A 1FR6A 2J7VA 2XD1A 1BLPA 1K57C 1NYYA 4N1HA 2X71A 3Q1FA 3CZDA 1FR1A 1K6SA 1PI4A 3Q7ZA 2X02A 3DWKA 1EROA 3O3VA 3WRZA 4FD8A 5M18A 1NY0A 1LLBA 3G30A 4B88A 1MWSA 3E2KA 2R9XA 2IWDA 3B3XA 1NZUA 4KENB 3ZCZA 4GDNA 2E8IA 5EOOA 3BFGA 5CECA 4OLDA 5E2EA 1MY8A 4E6XA 3V50A 3HLBA 3HUOA 4OP5A 3N7WA 1FSWA 4P85A 2G2WA 5FA7A 4UAAA 3ZVTA 2EX8A 5DTKA 3C4PA 1ERMA 4BD0A 4R0QA 1FQGA 3MZFA 4U0TA 1WYCA 1W8YA 3M6BA 4PM8A 4R23A 1IYSA 4ZAMA 1LHYA 3HLWA 2EX6A 4KZ6A 1IELA 3ISGA 4LV2A 2OV5A 4KQOA 1NZOA 4Q8IA 3PTEA 2ZQ8A 3BLSA 1SKFA 4QHCA 5CGXA 3IWIA 5HW3A 4UA7A 4C75A 2WZZA 1E25A 1YLWA 1S0WA 2Q9NA 3G2ZA 4WMCD 3BM6A 5EUAA 5FSRA 5DVAA 4BLMA 1SHVA 2V1ZA 2XF3A 4WELA 5KZHA 3PBSA 2H5SA 4MBKA 3ZGAB 4OOYA 1KVLA 3O87A 3NIAA 2A3UA 3QNCA 4QJGA 4X69A 4KQRA 5CEDA 4LCMA 5TGFA 1HZOA 2ZC7A 3RJUA 5FASA 1CEFA 4OPRA 4OQHA 4PM9A 5G18A 4EV4A 1K55C 3A3DA 3CJMA 4OH0A 1HVBA 1XX2A 4JPMA 1I2SA 3CMZA 3VP1A 3LCEA 5KMWA 3OPRA 1RGYA 1PI5A 5IHVA 4L0LA 1IYPA 3BFCA 3VFHA 2JC7A 2GDNA 2J8YA 2H0TA 4KZ9A 4Y7PA 4K0XA 3MZEA 4C3QA 4OPZA 2Y2PA 1WE4A 1VQQA 3HLCA 4N1XA 3UDXA 3C7VA 3PAEA 5CHJA 3UPOA 2EX9A 2Y4AA 1NRFA 4A5RA 3LY4A 5EE8A 3NCKA 3SH8A 1XPBA 3ZG5A 1FOFA 2ZM8A 2ZC3B 4GB7A 5DF8A 1M6KA 3A3JA 3N8SA 3WWXA 2IWCA 3FV7A 3WS4A 4Y0UA 5HAPA 1M40A 3C7UA 4GZBA 2R9WA 4IVKA 3RXXA 4KZ7A 3FKWA 1YMXA 3N8LA 1BZAA 2DNSA 5J8XA 2Y2JA 4E6WA 5M1AA 4HBTA 5DTTA 2OLVA 5EVIA 4DE1A 2ZQ7A 4LV3A 2OSUA 2XFSA 4GDBA 1BLHA 3PBTA 4IEDA 4WEJA 2C6WB 1DJBA 1GA9A 4K0WA 1KE4A 3WS1A 3JYIA 4JBFA 2ZM2A 1O7EA 2HDSA 2HDRA 4ZDXA 5A93A 4WZ5A 3VMAA 5F1GA 4S2NC 2J9OA 4E3NA 4DE0A 1XXMA 2ZMAA 4N9KA 1IYQA 2J9PA 2WUQA 4S2PA 3GVBA 4ZBEA 1MPLA 1ES5A 1MWTA 5GLCA 5DTSA 3SH9A 3MXSA 5GLAA 4F94A 5EVLA 1O07A 1DJCA 4H8RA 2Y2QA 2ZC4B 4BL3A 2XDMA 5EVID 4KZ8A 4IBXA 4HESA 4X6TA 1N4OA 4IVIA 1FCNA 4S2JA 5FQ9A 3W8KA 1QMEA 2PBYA 3IT9A 4R3JA 4R4SA 4OPQA 5E2FA 3TOIA 1C3BA 2EFUA 1L2SA 1YLPA 5AQBA 5GL9A 2XH9A 4E3KA 3UN7A 3VOYA 1BLCA 4GD6A 5HAQA 2JBFA 3PBOA 4E3IA 1K57A 3M2JA 2WGIA 1IEMA 1ONHA 3VP4A 4LV0A 3IQAA 4RA7A 3E2LA 4GN2A 2Y2LA 3VSLA 1MXOA 3IH9A 2B5RA 2Q9MA 1PWCA 3CG5A 4S2MA 3D4FA 4X53A 1ZC2A 2Y2NA 2C5WB 1L0EA 4GOGA 4WMCA 4S2OA 2EX2A 4JF4A 2XGNA 3HVFA 4JXVA 1JWZA 3V3SA 2WYXA 1KGGA 4EQIA 4HEFA 4B4ZA 3DW0A 3ZHHA 1NXYA 2CC1A 1JWPA 3ZNTA 5FAPA 5FQKA 1GA0A 4MLLA 1PW8A 3EQUA 2G2UA 5FDHA 4FCFA 2H0YA 5FAQA 2WGWB 4UA9A 4KQQA 4Z9QA 1JWVA 2ZLYA 1TVFA 2WGWA 1BTLA 3N4IA 2BLSA 2ZC6B 4DKIA 2DCFA 5DF7A 5FQJA 5KSHA 2XK1A 1W8QA 1MWUA 4FH2A 3N8RA 4LV1A 2PU2A 3GRJA 3SS4A 3FZCA 3ZDJA 3OCNA 4DE2A 1YM1A 1W79A 5HL1A 1EI5A 2V20A 4XUZA 3IWQA 3UPPA 3VOZA 4DDSA 3ZNYA 2Y2KA 1CI8A 4PMAA 3MKEA 3HLDA 1L0DA 3WRTA 5GHYA 4PM7A 3BEBA 3HL9A 3NY4A 1K6RA 1TEMA 3GQZA 3WS0A 1SDNA 1E3UD 1S6RA 3AGEA 3BECA 3IXGA 4LENA 1CI9A 4WEKA 3VP2A 1FSYA 1JTDA 3IF5A 3M6HA 1K4FA 3AGFA 3C5AA 3MBZA 3V5MA 5EOEA 4KZAA 4NETA 5E43A 3W4QA 2JCHA 1AXBA 2HP5A 3G4PA 1ESIA 3HUMA 2I72A 3MFDA 1OMEA 2WGVA 2HP6A 2QMIA 1RGZA 4B4XA 1DJAA 3IXDA 1ES2A 1ONGA 2PU4A 2Y2IA 3OPHA 4M3KA 4S2KA 5CTMA 5FI6A 1PW1A 2Y59A 5GHZA 3IH8A 1K55A
chains in the Genus database with same CATH superfamily
4ZJ3A 1F98A 1YT4A 1ES3A 3LO7A 5A91A 4BBVA 2XROA 4R1GA 1WYBA 4NXGA 2M7VA 2ACGA 2ZQCA 1BUEA 1OTDA 3IXHA 1YLJA 4WL9A 3IF6C 3DTEA 3BW6A 3MZDA 1S4SA 1OTEA 1FCOA 4MEZA 1F5MA 3O5YA 3BJNA 2VGLM 2V2FF 3QP6A 4HIAA 2ZQAA 2K2NA 3S22A 4EBPA 1P0ZA 2EXBA 1VEUB 1VEUA 2OWHA 2VJWA 3U4LP 5CXWA 3ZG8B 4S2NA 4WBGA 1GHPA 5DF9A 4OQGA 2PD8A 3G2YA 5D3OA 5GHXA 3VSKA 2ZL1B 1PIOA 5F69A 2ZL1A 1YMSA 1H0MA 4XUXA 5CHUA 5F83A 5LBRA 5JYPA 1SCWA 3D3OA 4HHDA 4JGPA 5CRFA 4ETZA 3I7JA 3E4OA 1NJ4A 2QHKA 2Z6CA 3G35A 4NEED 2VV8A 1DRMA 4GKUA 3ZG7B 5HDDA 4JF5A 1Y54A 4KZBA 5E2GA 3S1YA 2P74A 3D9YA 1EWZA 4PM6A 4N9LA 1LL9A 3NI9A 3S4XA 1H5XA 1KDWA 5HARA 4ZJ1A 5HX9A 1OTIA 3OZHA 4O0PA 2VZWA 3NDEA 2EWVA 4LRZE 2L4RA 3QNBA 2W3GA 3UDIA 1CJFA 4WYYA 2A24B 1GCEA 4BL2A 5A8BA 2J3TC 2A24A 4EBLA 3NDGA 4OOLA 2W3DA 4HI4A 5DJTA 4DRTA 2FFFB 3MJQA 4MDZA 2Q0OA 3GV9A 2QKPA 3HJIA 4ARZA 4JXSA 4I3AA 1V9ZA 3ITAA 3UE0A 2IWBA 4EETB 4ZRRA 4BD1A 4LRYC 1ZG6A 4OQ0A 1CK3A 4GNUA 5CHMA 5EECA 3EEAA 4ZTKA 3G31A 3KYQA 2WKQA 5A92A 1K0KA 1XFNA 1IYOA 1BT5A 1N9BA 3LUQA 1YLZA 3W4OA 3VFFA 1BULA 5EV0A 4LCLA 2HDUA 1CEGA 1K56A 4MMNA 2JKTI 1YQSA 4HJ3A 3PBNA 1UGUA 1MWRA 4MNRA 3FWLA 4YFMA 3FKVA 2RL3A 5JYOA 3SS5A 4S2IA 4QPRA 5DKKA 2O99A 4E3OA 4WZ4A 1OJGA 5F68A 1H3QA 2P08A 3Q7ZA 2PDRA 3O3VA 3NULA 2W3FA 5HSQA 1MWSA 2R9XA 5FEFA 5CECA 4E6XA 3N7WA 3ZYTA 5FA7A 2EX8A 3C4PA 3MR0A 4BD0A 4II7A 3KSHA 3MZFA 3UB8A 2PT7A 1LHYA 3SW1A 3HLWA 2EX6A 2OV5A 3T4TA 3NOPC 5DFYA 4C75A 1E25A 1YLWA 5FSRA 5DVAA 1SHVA 4CLCD 4BWIA 3QNCA 4QJGA 4X69A 3LEQA 2D01A 5G18A 2VK3A 3CJMA 4OH0A 1XX2A 4JPMA 5KMWA 1RGYA 3T1XA 2JC7A 4EEPA 2GDNA 4Y7PA 3C38A 3B42A 2Y2PA 3PAEA 5HWWA 3UB7A 4A5RA 1G6OA 3T4QA 5EE8A 2PYPA 1ZTUA 1T19A 1YKDA 5IU1A 1CQAA 2R9WA 4IVKA 1XFQA 4HH2A 1LSVA 3JVVA 1YMXA 3N8LA 5J8XA 3CHWP 2OLVA 5EVIA 4EW7A 4DE1A 2ZQ7A 4UQIS 1W63Q 4WEJA 1A0KA 2C6WB 3CPTB 2ZM2A 4ZDXA 5A93A 1X0OA 3VMAA 4DE0A 1XXMA 2HV1A 4GHIB 4Z1WA 3FPWA 4N9KA 4GHIA 2WUQA 4ZBEA 1MPLA 2OAQ1 5DTSA 5FDSA 4O8GA 2HZ5A 3IBJA 4FOFA 1FCNA 4B9OA 3W8KA 2PBYA 2K31A 4IJGA 2V0WA 2V0UA 4GJ4A 1L2SA 1Z09A 2XH9A 5HAQA 1K57A 3M2JA 1ONHA 3G6OA 4RA7A 3VSLA 3IH9A 3CG5A 4X53A 4UQIM 4S2OA 2XGNA 1JWZA 4EQIA 4LLOB 4LRXC 1TS8A 3LIDA 1NXYA 2FH5A 5FAPA 5FQKA 1PW8A 3EQUA 2G2UA 1W63M 4KQQA 2ZLYA 1BTLA 2ZC6B 3OBFA 2PRFA 1H8MA 4FH2A 1TS6A 2PU2A 4DE2A 4ME4A 1ACFA 3KYZA 1EI5A 3IX4A 3UPPA 3KX0X 3ZNYA 2Y2KA 1CI8A 4PMAA 2ZOHA 3WRTA 1Y4OA 2YKHA 1T1AA 4IUHA 1TEMA 3GQZA 1SDNA 3IXGA 4LENA 3AGEA 1CI9A 1JTDA 3M6HA 3C5AA 4KZAA 2G7UA 5IS1A 3QP5A 1AXBA 2HP5A 1ESIA 3T50A 3CAXA 1OMEA 2WGVA 4B4XA 1RGZA 1ES2A 3OPHA 5GHZA 2Y59A 2OWJA 4C6YA 2O0YA 2UV0E 1GHIA 3PBRA 4ID4A 2CMNA 3HCYA 4XT2B 3A0VA 1XJ4A 4KZ4A 1MKMA 4JGRA 2QPNA 4RYEA 3S7OA 2VGKA 3MKFA 3DTKA 3F1PA 2W1TB 1S1ZA 3DWZA 4PKYA 3V67A 2W1TA 1ERQA 3VE4A 1OJ5A 2INWA 3T12B 4HBUA 1G68A 4R6LA 2D02A 3UPNA 4BJPA 4OPYA 5HL6A 4R3AA 1XKZA 2A49A 5CERA 2GNXA 3P01A 1XJ2A 3RXWA 4P6BA 1IKIA 3Q82A 3U2AA 1ZKJA 3SH7A 4YNRA 3WS2A 5KIZA 4OQIA 5HD5A 3EEHA 1K56D 4NKPA 3O86A 3WS5A 4KZ3A 1YLTA 2FFYA 2JKRM 3VV4A 2WKPA 1J9MA 2RCXA 3V3RA 3HBRA 4D2OA 4OLGA 3NC8A 3LY3A 4GD8A 4UA6A 3UNWA 1L0GA 3TG9A 3FG8A 4JLFA 1Q2QA 4JGQA 3T1SA 4EUZA 2ZQ9A 2XFTA 4JXWA 2MJ6A 2H10A 2ZC5B 1LT0A 3A3IA 1P9WA 2VGJA 4OONA 4EBNA 2VX8A 3MQQA 4X68A 2QJ5A 4XXRA 4RX2A 1SKOA 1TDGA 3IHAA 1L0FA 3UDFA 4AFIA 4OKPA 2ZM0A 5AQ7A 3OC2A 4X55A 1Q2PA 4E3MA 4E3JA 3G34A 1MBLA 1PWGA 2HPBA 4NK3A 1RCJA 2JN7A 4K91A 1VM1A 2ZMVA 1BLSA 2I9VA 1K38A 2XQZA 2OAP1 3CWFA 2WADA 2W0NA 4QD4A 4DF6A 1VB6A 4RQ9A 3NJAA 2IA2A 4FSFA 3C4OA 3BWLA 1P97A 2O9CA 4WZ5C 5FQIA 4HH3A 3SOIA 1I2WA 4RX3A 2WKRA 5EM1A 3FYZA 5EPHA 2J80A 5C5KA 4H6JB 4G3KA 4H6JA 4X25A 4YWZA 5TBMB 5TBMA 1W5DA 5L2FA 1K54A 1H8ZA 3C8CA 4ZJ2A 3ICYA 1IFQA 2O9BA 1FCMA 4PM5A 3E98A 1KGFA 2JKGA 3ITBA 1RP5A 2XD1A 1BLPA 2X71A 3Q1FA 1PI4A 4FD8A 5M18A 1LLBA 3DBAA 3G30A 2M7UA 4CLCC 5AJGA 2W27A 3E2KA 2IWDA 3L9KA 4P6ZS 4F3LA 5EFWA 3HLBA 4P85A 3H82B 1GSVA 3H82A 3NOUC 3LR0A 4KUKA 4R0QA 1FQGA 1JNUA 1S4RA 4U0TA 1D1JA 3C2WA 4PM8A 2VV6A 1IYSA 1LSXA 4KZ6A 1IELA 4KQOA 2VV7A 1N9NA 2ZQ8A 5HW3A 4JGOA 2WZZA 2Q9NA 4M4XA 2QWSA 4WELA 4BMWA 5HDCA 1LSWA 1KVLA 3O87A 3T1RA 2A3UA 3R7WB 4KQRA 3KYEA 3R7WA 4ARZB 1CEFA 1K55C 4P6ZM 1I2SA 3BY8A 3LCEA 1PI5A 5IHVA 3FC7A 3BFCA 3VFHA 5MC7A 2J8YA 1T18A 4L9GA 1WE4A 4N1XA 1ZHHB 3UDXA 5J7EA 3LY4A 2O9AA 2NUPC 4GB7A 1M6KA 3A3JA 5J4EA 2IWCA 3IS2B 3IS2A 4DJ3A 2Y2JA 5DTTA 2AVXA 3LIAA 4LV3A 2OSUA 2XFSA 1DJBA 3WS1A 3JYIA 2HDRA 4EEUA 3VOLA 4S2NC 2J9OA 4LFUA 2J9PA 2XA7S 5GLAA 3S7PA 2Y2QA 1GSWA 5K5BA 3UMDA 5FQ9A 4ESPA 4BBTA 4R3JA 4R4SA 4OPQA 2QJ7A 1C3BA 3MQ0A 2EFUA 1OPXA 4E3KA 3UN7A 3VOYA 3H9WA 3TRCA 3IQAA 2B5RA 1F2KA 4S2MA 1FIKA 2Y2NA 4WMCA 4Q0IA 4HOIA 3E4QA 2W3HA 2VKSA 3DW0A 2CC1A 3ZQ5A 2H0YA 2WGWB 4UA9A 1TVFA 2WGWA 4DKIA 5KSHA 2V1AA 2XK1A 3CITA 2V9AA 4LV1A 3GRJA 3FZCA 2KLIA 3ZDJA 2GJ3A 1YM1A 3LI8A 4HNBA 4XUZA 3T4JA 3MKEA 3BEBA 1K6RA 3WS0A 1NRJA 3B33A 1S6RA 4WEKA 1FSYA 3AGFA 4KQDA 3MBZA 3V5MA 5E43A 4EUVA 2R78A 3MFDA 2JCHA 4ETXA 3EOIA 2B02A 4NXEA 2QMIA 1DJAA 1OT9A 2Y2IA 3MXQA 3O88A 2LB9A 4BENA 4R38A 3PAGA 3UO9A 5BOHA 1S66L 4DDYA 5FQQA 4YINA 2P9VA 5FATA 2DMWA 3FPVA 5F1FA 1LI9A 3PR6A 2YKFA 3A3EA 5EVIB 4FUWA 1TS7A 5FQMA 4OVDA 2B18A 4QB8A 3IX3A 1I5QA 5FEGA 1FILA 4CLCE 1JVJA 4X56A 1PZPA 3P09A 1YSQA 3G32A 1OT6A 5AQAA 2HJ9C 3MFXA 1TF1A 3V39A 4MBFA 3P7NA 5HPIA 1U60A 4KZ5A 3IHBA 5F82A 1DP6A 2EWWA 1XA1A 1YLYA 4HJ6A 3BRMA 5HZHA 3DTMA 3Q7VB 4I38A 1J3WA 3Q7VA 3UY6A 2KOIA 4OOMA 1ZG4A 1JTGA 2EXAA 1VETB 4QY5A 4I3IA 5U47A 1VETA 2BASA 4PPRA 1PZOA 3AGDA 1HLUP 3CLOA 4GS9B 2BG1A 2OOLA 2E8JA 3GTCA 4GS9A 1E3UA 4R3BA 4E3LA 3NBLA 1IKGA 2Y2GA 2GX5A 2ZQDA 4KG6A 3IWOA 4GW9A 4K08A 2WKHA 5CGWA 3M2KA 3LR3A 4P87A 2XRNA 4KG2A 3EGXC 4DXCA 3ZFZA 4I5SA 2L1MA 1LI0A 4HP9A 1G5UA 3BFDA 2XR0A 1AWIA 3K3DA 2WK0A 2PR6A 3QP1A 3PBQA 4LPZA 3BFEA 3LICA 5HFOA 2WZXA 1LL5A 4EQ1A 4X1MA 2M1CA 2B95A 4S2LA 2Y2MA 2ZD8A 3MXRA 3LIEA 3MQOA 4FTXA 3S7NA 1D7EA 4DE3A 3F1PB 3OPLA 5AQ9A 4QWOA 4KG5A 1KGEA 4EXOA 5HWTA 5EVIC 3BYDA 2EFXA 1PNEA 1Z6FA 1S1YA 5GLDA 3GSGA 2UWXA 2Y8HA 1XP4A 2VLGA 4MN5A 3KSGA 4U3TA 3ZG0A 1DP8A 3Q07A 4DN0A 3QHYA 1PWDA 2XD5A 3LEZA 1T1BA 3K3CA 1HTZA 3IF6B 1H8YA 4IBRA 3VP3A 3IF6A 3GECA 3HUNA 3SS3A 3NECA 1N9LA 4PHTA 4DJ2A 3ZVWA 1ALQA 2V1BA 4QU3A 2J7VA 2Z6DA 1K57C 1FR1A 3KSIA 1K6SA 3T1QB 1NLYA 1EROA 3WRZA 4G3VA 1YPRA 1OTBA 1NY0A 4E04A 4B88A 1NZUA 4KENB 4GDNA 2E8IA 4HP4A 5EOOA 5HWVA 5E2EA 1MY8A 2Y79A 4GLQA 3HUOA 2PAVP 1FSWA 4UAAA 3KO6A 3D72A 5DTKA 1ERMA 1IOUA 3DTIA 3E0YA 1W8YA 3M6BA 2EA9A 4ZAMA 5EM0A 5L09A 4LV2A 3PTEA 3NOTC 4G3WA 1SKFA 5CGXA 3F1OA 1XJ3A 1SKOB 3G2ZA 4WMCD 3BM6A 5EUAA 2K7SA 3LIBA 5DJUA 4GCZA 2V1ZA 2HF6A 1V9YA 4MBKA 4OOYA 3NIAA 3UB9A 1DP9A 2W3EA 4LCMA 3RJUA 4OPRA 4OQHA 4PM9A 4EV4A 3A3DA 2PBDP 3CMZA 3ULFA 3UMEA 4L0LA 1IYPA 4NXBA 4K0XA 4Q0JA 4C3QA 2V8FA 1VQQA 3HLCA 3BQ8A 2JHEA 3C7VA 4L9FA 2EX9A 2Y4AA 1NRFA 3MS6A 1S67L 3NCKA 1XPBA 1FOFA 1T1CA 3UB5P 3N8SA 3WWXA 3WS4A 5HAPA 3C7UA 4GZBA 5J3WA 3RXXA 4Q0HA 1CF0A 3FKWA 1PFLA 1BZAA 4IEDA 4GDBA 1BLHA 3LFVA 4K0WA 1KE4A 4JBFA 2HDSA 5F1GA 4E3NA 2JKTM 4S2PA 2JKFA 3T4OA 5GLCA 1ES5A 3SH9A 4F94A 5EVLA 1DJCA 2ZC4B 3A0RA 2HGVA 5EVID 4KZ8A 4BBUA 4X6TA 1L3LA 4IVIA 4S2JA 3TE8A 1QMEA 3IT9A 2BTFP 4EERA 4L9EA 1YSPA 5E2FA 3TOIA 3T4KA 1P9RA 2JKRI 1OTAA 4F3LB 2JBFA 3T4LA 3B47A 4E3IA 2WGIA 1IEMA 3VP4A 4LV0A 4WF0A 4HY8A 1MXOA 2Q9MA 3CUEA 5DKLA 1ZC2A 4JXVA 3OLOA 2GZAA 5L10A 3V3SA 2WYXA 4B4ZA 3DAVA 4WN5A 1JWPA 3GDIA 4MLLA 5FDHA 4FCFA 5FAQA 4Z9QA 1JWVA 2BLSA 4MCWA 5DF7A 5FQJA 1TD5A 1W8QA 3IWQA 4DDSA 4R70A 1ODVA 3HL9A 1E3UD 3IF5A 1XJ6A 1K4FA 1D06A 4NETA 3LR4A 3W4QA 3G4PA 4Y15A 3HUMA 3HJKA 4MN7A 2HP6A 2PD7A 3IXDA 5EVEA 4S2KA 1ONGA 2PR5A 2PU4A 4M3KA 5FI6A 5CTMA 1PW1A 3QP8A 5TFQA 4DXBA 1PYYA 5F6AA 5CGSA 2QYBA 2J3WA 5GLBA 1N9OA 4DMZA 2ZMFA 1QMFA 5CTNA 3LGOA 2HDQA 4Y0TA 1STZA 5HDSA 1K4EA 1K54C 4RVAA 3UE3A 1G28A 4Y3IA 3E4PA 3P98A 5CX7A 3UE1A 2VA0A 4MBHA 2VEAA 4IHQA 4PKYG 3N6IA 3UB6A 2WKEA 4WLAA 5L8MA 1BSGA 1XA7A 3IXBA 2KX6A 3NHQA 4O7DA 5KSCA 2DRWA 4N92A 3GMWA 3JVUA 3ZG9B 1SDEA 2Y91A 4JXGA 3CUEC 5G4ZA 5L07A 3BLMA 4EESA 4JF6A 3OCLA 1ESUA 4EWFA 4Y5FA 2Y2OA 4X1LA 1G6AA 3K2NA 1KVMA 2XA7M 2OLUA 3KSFA 3VP0A 5M19A 3BFFA 5A90A 2Y55A 4R4RA 2Z2LB 5I94A 3LIFA 1GHMA 5HD3A 4O01A 1HD8A 5FI2A 5F5YA 3QP4A 3IBRA 2QZ6A 5E2HA 3R4KA 5FI7A 4KUOA 4LGWA 2JE5A 2XLNA 3GR2A 2L0WA 1TDLA 3EGDC 3HREA 5G4YA 1NYMA 2HP9A 5AVFA 1MKIA 3UE6A 3H7WB 2Z2MB 3H7WA 2WAFA 1KDSA 3W4PA 3LR5A 4UHUA 3HLGA 4HQAA 2HJEA 2P9VB 4U0XA 4QY6A 2XEPA 3A3FA 2WKIA 1K25A 4FH4A 3EQVA 1YAXA 1XGJA 3CI6A 4Y0OA 1W7FA 3T4SA 2LB5A 5HAIA 2WAEA 1DY6A 3TSGA 2NUTC 1ES4A 4JKTA 3HLFA 3TJZC 2J3TD 4OP8A 4CPKA 2X01A 3W2ZA 2Y2HA 5FAOA 1KE0A 3HLEA 2ZJ9A 5TR7A 3OPPA 1XGIA 4P0MA 1KE3A 3CPTA 3Q81A 4CJNA 5CEBA 4WM9A 1BYWA 1F9IA 1SZVA 1E4DA 2ZOIA 1FR6A 1MZUA 1NYYA 4N1HA 4WUJA 3CZDA 5DFXA 2X02A 4Y2FA 3DWKA 2ZBBA 3B3XA 2P7JA 3ZCZA 2P04A 3BFGA 4OLDA 2V8CA 3V50A 2A2LA 4OP5A 2G2WA 3ZVTA 4D60A 3RFBA 4MN6A 5FL3A 3PHYA 1WYCA 3PXPA 4R23A 3JPUA 3ISGA 4Y17A 1NZOA 4Q8IA 3IX8A 3BLSA 4QHCA 3IWIA 4UA7A 1WA9A 1S0WA 3MSHA 4BLMA 5KZHA 2XF3A 3PBSA 2H5SA 3ZGAB 1K55A 3RTYA 5CEDA 5TGFA 1HZOA 2ZC7A 5FASA 4CQHA 3VE3A 1HVBA 3VP1A 1GSXA 3OPRA 4IUKA 2H0TA 3C30A 4KZ9A 3MZEA 4OPZA 1EW0A 5HPFA 2W1RA 1MC0A 1Y28A 1VHMA 5CHJA 3UPOA 4HJ4A 3SZTA 3SH8A 3ZG5A 2ZM8A 4I39A 2ZC3B 1UWPX 5DF8A 3TW8A 3FV7A 4XT2A 4Y0UA 1M40A 4KZ7A 4EU0A 2DNSA 4E6WA 5M1AA 4HBTA 3LYXA 3PBTA 1GA9A 4YOFA 1O7EA 3QP2A 1LL8A 4WZ5A 5AVEA 2ZMAA 1IYQA 3GVBA 1MWTA 5TJJA 3MXSA 1O07A 3BQAA 4H8RA 4I3JA 4BL3A 2XDMA 4IBXA 4HESA 1N4OA 3EWKA 1YLPA 5AQBA 5GL9A 3L7HA 2FZ0A 3LI9A 1BLCA 4GD6A 5IT5A 4NXFA 3PBOA 4Y13A 3E2LA 4GN2A 2Y2LA 1PWCA 3D4FA 4GOGA 2C5WB 1L0EA 4CLCB 3OOVA 2EX2A 4JF4A 3HVFA 4CLCA 1KGGA 3PYPA 4HEFA 3A0SA 3ZHHA 3ZNTA 1GA0A 4B93A 1KOUA 3BY9A 3F1OB 3N4IA 2DCFA 1NLZA 4NG2A 1MWUA 3N8RA 2XSSA 3SS4A 3OCNA 1W79A 5HL1A 2PHYA 2V20A 3MF0A 3VOZA 5I5LA 4PAUA 3HLDA 1L0DA 3RH8B 5GHYA 4PM7A 2PYRA 1NWZA 3NY4A 3BECA 3VP2A 2VGLS 3MMHA 2H28A 1UWNX 3S7QA 1PRQA 4UEYA 5EOEA 2KDKA 2I72A 1TS0A 4BQMA 3F1NB 3IH8A 3F1NA
chains in the Genus database with same CATH topology
4ZJ3A 5TFQA 4DXBA 4C6YA 1PYYA 1YT4A 1ES3A 3LO7A 5A91A 5CGSA 4R1GA 1WYBA 1GHIA 3O88A 4BENA 3PBRA 5GLBA 3PAGA 4ID4A 3UO9A 5BOHA 4KZ4A 4DDYA 1QMFA 5FQQA 2QPNA 4YINA 2P9VA 4RYEA 5CTNA 5FATA 2ZQCA 1BUEA 2VGKA 3MKFA 5F1FA 1LI9A 3DWZA 3A3EA 3IXHA 5EVIB 2HDQA 1ERQA 4Y0TA 5FQMA 1YLJA 4OVDA 4QB8A 1I5QA 3IF6C 1K4EA 1K54C 3MZDA 1JVJA 4HBUA 1FCOA 1G68A 4RVAA 4MEZA 4X56A 1PZPA 3UE3A 3UPNA 3P09A 3G32A 4BJPA 5AQAA 4OPYA 1XKZA 2V2FF 2A49A 5CERA 2ZQAA 3S22A 4EBPA 3P98A 2EXBA 3V39A 4MBFA 3UE1A 3RXWA 4P6BA 4MBHA 1IKIA 1U60A 3N6IA 3Q82A 5CXWA 3ZG8B 4S2NA 4WBGA 1GHPA 4KZ5A 2WKEA 5DF9A 1ZKJA 3IHBA 1BSGA 1XA7A 4OQGA 3SH7A 5F82A 3IXBA 3G2YA 3WS2A 5D3OA 1XA1A 4O7DA 5GHXA 3VSKA 4OQIA 1PIOA 1K56D 1YLYA 1YMSA 5KSCA 2DRWA 4N92A 3BRMA 3O86A 3GMWA 4XUXA 3ZG9B 3WS5A 1SDEA 5CHUA 2Y91A 5F83A 5JYPA 3DTMA 3Q7VB 4KZ3A 3Q7VA 1YLTA 2FFYA 3UY6A 1SCWA 4OOMA 1ZG4A 4JXGA 1JTGA 3BLMA 5CRFA 4JF6A 1J9MA 3OCLA 2EXAA 2RCXA 3I7JA 3HBRA 3V3RA 4D2OA 1ESUA 4QY5A 4OLGA 3NC8A 3LY3A 5U47A 4EWFA 1NJ4A 4GD8A 4UA6A 3UNWA 2Y2OA 1L0GA 3TG9A 4JLFA 3G35A 1G6AA 1Q2QA 1KVMA 4GKUA 4PPRA 3ZG7B 1PZOA 2OLUA 3AGDA 4JF5A 1Y54A 2BG1A 3GTCA 4KZBA 4EUZA 1E3UA 2ZQ9A 2XFTA 5E2GA 4R3BA 3S1YA 3NBLA 4JXWA 3VP0A 2P74A 4E3LA 5M19A 2H10A 1IKGA 2Y2GA 3BFFA 5A90A 2Y55A 1EWZA 4R4RA 2ZC5B 4N9LA 4PM6A 1LL9A 3A3IA 2ZQDA 2Z2LB 3NI9A 4KG6A 3IWOA 5I94A 1GHMA 1H5XA 1KDWA 2VGJA 2WKHA 3S4XA 5HARA 4OONA 5CGWA 4EBNA 4ZJ1A 3M2KA 5HX9A 1HD8A 3OZHA 4P87A 3NDEA 5FI2A 4KG2A 4X68A 3QNBA 4XXRA 4RX2A 4DXCA 3ZFZA 2QZ6A 5E2HA 5FI7A 1TDGA 1LI0A 3IHAA 2JE5A 2XLNA 1L0FA 3GR2A 4WYYA 3UDFA 3BFDA 1GCEA 2XR0A 3UDIA 4BL2A 4OKPA 1TDLA 2ZM0A 4EBLA 5AQ7A 2WK0A 3HREA 3NDGA 3OC2A 1NYMA 2HP9A 3PBQA 4OOLA 4X55A 1Q2PA 4E3MA 4E3JA 3G34A 1MKIA 4DRTA 2FFFB 3BFEA 1MBLA 1PWGA 2HPBA 4NK3A 3GV9A 1RCJA 5HFOA 2Z2MB 4JXSA 2WZXA 1LL5A 4K91A 2WAFA 1KDSA 3ITAA 3W4PA 3UE0A 4BQMA 2IWBA 4UHUA 1VM1A 4S2LA 2Y2MA 3HLGA 1BLSA 2ZD8A 3MXRA 4BD1A 2P9VB 4U0XA 4OQ0A 1ZG6A 4QY6A 2XQZA 1K38A 2XEPA 1CK3A 3A3FA 2WKIA 1K25A 4DE3A 3OPLA 4GNUA 5AQ9A 4FH4A 5CHMA 5EECA 3EQVA 2WADA 4DF6A 4KG5A 4QD4A 1KGEA 4ZTKA 3G31A 1XGJA 5EVIC 3BYDA 4Y0OA 1W7FA 5A92A 2EFXA 1Z6FA 5HAIA 4FSFA 3C4OA 2WAEA 5GLDA 1IYOA 1BT5A 1DY6A 1N9BA 4WZ5C 5FQIA 3SOIA 3TSGA 1I2WA 1ES4A 1YLZA 3W4OA 3GSGA 4JKTA 2UWXA 3HLFA 4RX3A 3FYZA 1XP4A 5EPHA 3VFFA 4OP8A 1BULA 4U3TA 3ZG0A 4CPKA 3Q07A 4LCLA 2X01A 2HDUA 2Y2HA 1CEGA 5FAOA 1K56A 1KE0A 3HLEA 3QHYA 2ZJ9A 1PWDA 2XD5A 1YQSA 5TR7A 3LEZA 3OPPA 3PBNA 1HTZA 1MWRA 1H8YA 1W5DA 3IF6B 5L2FA 4IBRA 4MNRA 3IF6A 3VP3A 3FWLA 1XGIA 4P0MA 4YFMA 3HUNA 1K54A 1H8ZA 1KE3A 3FKVA 3Q81A 3SS3A 4ZJ2A 4CJNA 2RL3A 5JYOA 5CEBA 3SS5A 4S2IA 4WM9A 1FCMA 3ZVWA 1ALQA 4E3OA 4PM5A 4WZ4A 1KGFA 3ITBA 1E4DA 1RP5A 4QU3A 1FR6A 2J7VA 2XD1A 1BLPA 1K57C 1NYYA 4N1HA 2X71A 3Q1FA 3CZDA 1FR1A 1K6SA 1PI4A 3Q7ZA 2X02A 3DWKA 1EROA 3O3VA 3WRZA 4FD8A 5M18A 1NY0A 1LLBA 3G30A 4B88A 1MWSA 3E2KA 2R9XA 2IWDA 3B3XA 1NZUA 4KENB 3ZCZA 4GDNA 2E8IA 5EOOA 3BFGA 5CECA 4OLDA 5E2EA 1MY8A 4E6XA 3V50A 3HLBA 3HUOA 4OP5A 3N7WA 1FSWA 4P85A 2G2WA 5FA7A 4UAAA 3ZVTA 2EX8A 5DTKA 3C4PA 1ERMA 4BD0A 4R0QA 1FQGA 3MZFA 4U0TA 1WYCA 1W8YA 3M6BA 4PM8A 4R23A 1IYSA 4ZAMA 1LHYA 3HLWA 2EX6A 4KZ6A 1IELA 3ISGA 4LV2A 2OV5A 4KQOA 1NZOA 4Q8IA 3PTEA 2ZQ8A 3BLSA 1SKFA 4QHCA 5CGXA 3IWIA 5HW3A 4UA7A 4C75A 2WZZA 1E25A 1YLWA 1S0WA 2Q9NA 3G2ZA 4WMCD 3BM6A 5EUAA 5FSRA 5DVAA 4BLMA 1SHVA 2V1ZA 2XF3A 4WELA 5KZHA 3PBSA 2H5SA 4MBKA 3ZGAB 4OOYA 1KVLA 3O87A 3NIAA 2A3UA 3QNCA 4QJGA 4X69A 4KQRA 5CEDA 4LCMA 5TGFA 1HZOA 2ZC7A 3RJUA 5FASA 1CEFA 4OPRA 4OQHA 4PM9A 5G18A 4EV4A 1K55C 3A3DA 3CJMA 4OH0A 1HVBA 1XX2A 4JPMA 1I2SA 3CMZA 3VP1A 3LCEA 5KMWA 3OPRA 1RGYA 1PI5A 5IHVA 4L0LA 1IYPA 3BFCA 3VFHA 2JC7A 2GDNA 2J8YA 2H0TA 4KZ9A 4Y7PA 4K0XA 3MZEA 4C3QA 4OPZA 2Y2PA 1WE4A 1VQQA 3HLCA 4N1XA 3UDXA 3C7VA 3PAEA 5CHJA 3UPOA 2EX9A 2Y4AA 1NRFA 4A5RA 3LY4A 5EE8A 3NCKA 3SH8A 1XPBA 3ZG5A 1FOFA 2ZM8A 2ZC3B 4GB7A 5DF8A 1M6KA 3A3JA 3N8SA 3WWXA 2IWCA 3FV7A 3WS4A 4Y0UA 5HAPA 1M40A 3C7UA 4GZBA 2R9WA 4IVKA 3RXXA 4KZ7A 3FKWA 1YMXA 3N8LA 1BZAA 2DNSA 5J8XA 2Y2JA 4E6WA 5M1AA 4HBTA 5DTTA 2OLVA 5EVIA 4DE1A 2ZQ7A 4LV3A 2OSUA 2XFSA 4GDBA 1BLHA 3PBTA 4IEDA 4WEJA 2C6WB 1DJBA 1GA9A 4K0WA 1KE4A 3WS1A 3JYIA 4JBFA 2ZM2A 1O7EA 2HDSA 2HDRA 4ZDXA 5A93A 4WZ5A 3VMAA 5F1GA 4S2NC 2J9OA 4E3NA 4DE0A 1XXMA 2ZMAA 4N9KA 1IYQA 2J9PA 2WUQA 4S2PA 3GVBA 4ZBEA 1MPLA 1ES5A 1MWTA 5GLCA 5DTSA 3SH9A 3MXSA 5GLAA 4F94A 5EVLA 1O07A 1DJCA 4H8RA 2Y2QA 2ZC4B 4BL3A 2XDMA 5EVID 4KZ8A 4IBXA 4HESA 4X6TA 1N4OA 4IVIA 1FCNA 4S2JA 5FQ9A 3W8KA 1QMEA 2PBYA 3IT9A 4R3JA 4R4SA 4OPQA 5E2FA 3TOIA 1C3BA 2EFUA 1L2SA 1YLPA 5AQBA 5GL9A 2XH9A 4E3KA 3UN7A 3VOYA 1BLCA 4GD6A 5HAQA 2JBFA 3PBOA 4E3IA 1K57A 3M2JA 2WGIA 1IEMA 1ONHA 3VP4A 4LV0A 3IQAA 4RA7A 3E2LA 4GN2A 2Y2LA 3VSLA 1MXOA 3IH9A 2B5RA 2Q9MA 1PWCA 3CG5A 4S2MA 3D4FA 4X53A 1ZC2A 2Y2NA 2C5WB 1L0EA 4GOGA 4WMCA 4S2OA 2EX2A 4JF4A 2XGNA 3HVFA 4JXVA 1JWZA 3V3SA 2WYXA 1KGGA 4EQIA 4HEFA 4B4ZA 3DW0A 3ZHHA 1NXYA 2CC1A 1JWPA 3ZNTA 5FAPA 5FQKA 1GA0A 4MLLA 1PW8A 3EQUA 2G2UA 5FDHA 4FCFA 2H0YA 5FAQA 2WGWB 4UA9A 4KQQA 4Z9QA 1JWVA 2ZLYA 1TVFA 2WGWA 1BTLA 3N4IA 2BLSA 2ZC6B 4DKIA 2DCFA 5DF7A 5FQJA 5KSHA 2XK1A 1W8QA 1MWUA 4FH2A 3N8RA 4LV1A 2PU2A 3GRJA 3SS4A 3FZCA 3ZDJA 3OCNA 4DE2A 1YM1A 1W79A 5HL1A 1EI5A 2V20A 4XUZA 3IWQA 3UPPA 3VOZA 4DDSA 3ZNYA 2Y2KA 1CI8A 4PMAA 3MKEA 3HLDA 1L0DA 3WRTA 5GHYA 4PM7A 3BEBA 3HL9A 3NY4A 1K6RA 1TEMA 3GQZA 3WS0A 1SDNA 1E3UD 1S6RA 3AGEA 3BECA 3IXGA 4LENA 1CI9A 4WEKA 3VP2A 1FSYA 1JTDA 3IF5A 3M6HA 1K4FA 3AGFA 3C5AA 3MBZA 3V5MA 5EOEA 4KZAA 4NETA 5E43A 3W4QA 2JCHA 1AXBA 2HP5A 3G4PA 1ESIA 3HUMA 2I72A 3MFDA 1OMEA 2WGVA 2HP6A 2QMIA 1RGZA 4B4XA 1DJAA 3IXDA 1ES2A 1ONGA 2PU4A 2Y2IA 3OPHA 4M3KA 4S2KA 5CTMA 5FI6A 1PW1A 2Y59A 5GHZA 3IH8A 1K55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZJ3 A;  5TFQ A;  4DXB A;  4C6Y A;  1PYY A;  1YT4 A;  1ES3 A;  3LO7 A;  5A91 A;  5CGS A;  4R1G A;  1WYB A;  1GHI A;  3O88 A;  4BEN A;  3PBR A;  5GLB A;  3PAG A;  4ID4 A;  3UO9 A;  5BOH A;  4KZ4 A;  4DDY A;  1QMF A;  5FQQ A;  2QPN A;  4YIN A;  2P9V A;  4RYE A;  5CTN A;  5FAT A;  2ZQC A;  1BUE A;  2VGK A;  3MKF A;  5F1F A;  1LI9 A;  3DWZ A;  3A3E A;  3IXH A;  5EVI B;  2HDQ A;  1ERQ A;  4Y0T A;  5FQM A;  1YLJ A;  4OVD A;  4QB8 A;  1I5Q A;  3IF6 C;  1K4E A;  1K54 C;  3MZD A;  1JVJ A;  4HBU A;  1FCO A;  1G68 A;  4RVA A;  4MEZ A;  4X56 A;  1PZP A;  3UE3 A;  3UPN A;  3P09 A;  3G32 A;  4BJP A;  5AQA A;  4OPY A;  1XKZ A;  2V2F F;  2A49 A;  5CER A;  2ZQA A;  3S22 A;  4EBP A;  3P98 A;  2EXB A;  3V39 A;  4MBF A;  3UE1 A;  3RXW A;  4P6B A;  4MBH A;  1IKI A;  1U60 A;  3N6I A;  3Q82 A;  5CXW A;  3ZG8 B;  4S2N A;  4WBG A;  1GHP A;  4KZ5 A;  2WKE A;  5DF9 A;  1ZKJ A;  3IHB A;  1BSG A;  1XA7 A;  4OQG A;  3SH7 A;  5F82 A;  3IXB A;  3G2Y A;  3WS2 A;  5D3O A;  1XA1 A;  4O7D A;  5GHX A;  3VSK A;  4OQI A;  1PIO A;  1K56 D;  1YLY A;  1YMS A;  5KSC A;  2DRW A;  4N92 A;  3BRM A;  3O86 A;  3GMW A;  4XUX A;  3ZG9 B;  3WS5 A;  1SDE A;  5CHU A;  2Y91 A;  5F83 A;  5JYP A;  3DTM A;  3Q7V B;  4KZ3 A;  3Q7V A;  1YLT A;  2FFY A;  3UY6 A;  1SCW A;  4OOM A;  1ZG4 A;  4JXG A;  1JTG A;  3BLM A;  5CRF A;  4JF6 A;  1J9M A;  3OCL A;  2EXA A;  2RCX A;  3I7J A;  3HBR A;  3V3R A;  4D2O A;  1ESU A;  4QY5 A;  4OLG A;  3NC8 A;  3LY3 A;  5U47 A;  4EWF A;  1NJ4 A;  4GD8 A;  4UA6 A;  3UNW A;  2Y2O A;  1L0G A;  3TG9 A;  4JLF A;  3G35 A;  1G6A A;  1Q2Q A;  1KVM A;  4GKU A;  4PPR A;  3ZG7 B;  1PZO A;  2OLU A;  3AGD A;  4JF5 A;  1Y54 A;  2BG1 A;  3GTC A;  4KZB A;  4EUZ A;  1E3U A;  2ZQ9 A;  2XFT A;  5E2G A;  4R3B A;  3S1Y A;  3NBL A;  4JXW A;  3VP0 A;  2P74 A;  4E3L A;  5M19 A;  2H10 A;  1IKG A;  2Y2G A;  3BFF A;  5A90 A;  2Y55 A;  1EWZ A;  4R4R A;  2ZC5 B;  4N9L A;  4PM6 A;  1LL9 A;  3A3I A;  2ZQD A;  2Z2L B;  3NI9 A;  4KG6 A;  3IWO A;  5I94 A;  1GHM A;  1H5X A;  1KDW A;  2VGJ A;  2WKH A;  3S4X A;  5HAR A;  4OON A;  5CGW A;  4EBN A;  4ZJ1 A;  3M2K A;  5HX9 A;  1HD8 A;  3OZH A;  4P87 A;  3NDE A;  5FI2 A;  4KG2 A;  4X68 A;  3QNB A;  4XXR A;  4RX2 A;  4DXC A;  3ZFZ A;  2QZ6 A;  5E2H A;  5FI7 A;  1TDG A;  1LI0 A;  3IHA A;  2JE5 A;  2XLN A;  1L0F A;  3GR2 A;  4WYY A;  3UDF A;  3BFD A;  1GCE A;  2XR0 A;  3UDI A;  4BL2 A;  4OKP A;  1TDL A;  2ZM0 A;  4EBL A;  5AQ7 A;  2WK0 A;  3HRE A;  3NDG A;  3OC2 A;  1NYM A;  2HP9 A;  3PBQ A;  4OOL A;  4X55 A;  1Q2P A;  4E3M A;  4E3J A;  3G34 A;  1MKI A;  4DRT A;  2FFF B;  3BFE A;  1MBL A;  1PWG A;  2HPB A;  4NK3 A;  3GV9 A;  1RCJ A;  5HFO A;  2Z2M B;  4JXS A;  2WZX A;  1LL5 A;  4K91 A;  2WAF A;  1KDS A;  3ITA A;  3W4P A;  3UE0 A;  4BQM A;  2IWB A;  4UHU A;  1VM1 A;  4S2L A;  2Y2M A;  3HLG A;  1BLS A;  2ZD8 A;  3MXR A;  4BD1 A;  2P9V B;  4U0X A;  4OQ0 A;  1ZG6 A;  4QY6 A;  2XQZ A;  1K38 A;  2XEP A;  1CK3 A;  3A3F A;  2WKI A;  1K25 A;  4DE3 A;  3OPL A;  4GNU A;  5AQ9 A;  4FH4 A;  5CHM A;  5EEC A;  3EQV A;  2WAD A;  4DF6 A;  4KG5 A;  4QD4 A;  1KGE A;  4ZTK A;  3G31 A;  1XGJ A;  5EVI C;  3BYD A;  4Y0O A;  1W7F A;  5A92 A;  2EFX A;  1Z6F A;  5HAI A;  4FSF A;  3C4O A;  2WAE A;  5GLD A;  1IYO A;  1BT5 A;  1DY6 A;  1N9B A;  4WZ5 C;  5FQI A;  3SOI A;  3TSG A;  1I2W A;  1ES4 A;  1YLZ A;  3W4O A;  3GSG A;  4JKT A;  2UWX A;  3HLF A;  4RX3 A;  3FYZ A;  1XP4 A;  5EPH A;  3VFF A;  4OP8 A;  1BUL A;  4U3T A;  3ZG0 A;  4CPK A;  3Q07 A;  4LCL A;  2X01 A;  2HDU A;  2Y2H A;  1CEG A;  5FAO A;  1K56 A;  1KE0 A;  3HLE A;  3QHY A;  2ZJ9 A;  1PWD A;  2XD5 A;  1YQS A;  5TR7 A;  3LEZ A;  3OPP A;  3PBN A;  1HTZ A;  1MWR A;  1H8Y A;  1W5D A;  3IF6 B;  5L2F A;  4IBR A;  4MNR A;  3IF6 A;  3VP3 A;  3FWL A;  1XGI A;  4P0M A;  4YFM A;  3HUN A;  1K54 A;  1H8Z A;  1KE3 A;  3FKV A;  3Q81 A;  3SS3 A;  4ZJ2 A;  4CJN A;  2RL3 A;  5JYO A;  5CEB A;  3SS5 A;  4S2I A;  4WM9 A;  1FCM A;  3ZVW A;  1ALQ A;  4E3O A;  4PM5 A;  4WZ4 A;  1KGF A;  3ITB A;  1E4D A;  1RP5 A;  4QU3 A;  1FR6 A;  2J7V A;  2XD1 A;  1BLP A;  1K57 C;  1NYY A;  4N1H A;  2X71 A;  3Q1F A;  3CZD A;  1FR1 A;  1K6S A;  1PI4 A;  3Q7Z A;  2X02 A;  3DWK A;  1ERO A;  3O3V A;  3WRZ A;  4FD8 A;  5M18 A;  1NY0 A;  1LLB A;  3G30 A;  4B88 A;  1MWS A;  3E2K A;  2R9X A;  2IWD A;  3B3X A;  1NZU A;  4KEN B;  3ZCZ A;  4GDN A;  2E8I A;  5EOO A;  3BFG A;  5CEC A;  4OLD A;  5E2E A;  1MY8 A;  4E6X A;  3V50 A;  3HLB A;  3HUO A;  4OP5 A;  3N7W A;  1FSW A;  4P85 A;  2G2W A;  5FA7 A;  4UAA A;  3ZVT A;  2EX8 A;  5DTK A;  3C4P A;  1ERM A;  4BD0 A;  4R0Q A;  1FQG A;  3MZF A;  4U0T A;  1WYC A;  1W8Y A;  3M6B A;  4PM8 A;  4R23 A;  1IYS A;  4ZAM A;  1LHY A;  3HLW A;  2EX6 A;  4KZ6 A;  1IEL A;  3ISG A;  4LV2 A;  2OV5 A;  4KQO A;  1NZO A;  4Q8I A;  3PTE A;  2ZQ8 A;  3BLS A;  1SKF A;  4QHC A;  5CGX A;  3IWI A;  5HW3 A;  4UA7 A;  4C75 A;  2WZZ A;  1E25 A;  1YLW A;  1S0W A;  2Q9N A;  3G2Z A;  4WMC D;  3BM6 A;  5EUA A;  5FSR A;  5DVA A;  4BLM A;  1SHV A;  2V1Z A;  2XF3 A;  4WEL A;  5KZH A;  3PBS A;  2H5S A;  4MBK A;  3ZGA B;  4OOY A;  1KVL A;  3O87 A;  3NIA A;  2A3U A;  3QNC A;  4QJG A;  4X69 A;  4KQR A;  5CED A;  4LCM A;  5TGF A;  1HZO A;  2ZC7 A;  3RJU A;  5FAS A;  1CEF A;  4OPR A;  4OQH A;  4PM9 A;  5G18 A;  4EV4 A;  1K55 C;  3A3D A;  3CJM A;  4OH0 A;  1HVB A;  1XX2 A;  4JPM A;  1I2S A;  3CMZ A;  3VP1 A;  3LCE A;  5KMW A;  3OPR A;  1RGY A;  1PI5 A;  5IHV A;  4L0L A;  1IYP A;  3BFC A;  3VFH A;  2JC7 A;  2GDN A;  2J8Y A;  2H0T A;  4KZ9 A;  4Y7P A;  4K0X A;  3MZE A;  4C3Q A;  4OPZ A;  2Y2P A;  1WE4 A;  1VQQ A;  3HLC A;  4N1X A;  3UDX A;  3C7V A;  3PAE A;  5CHJ A;  3UPO A;  2EX9 A;  2Y4A A;  1NRF A;  4A5R A;  3LY4 A;  5EE8 A;  3NCK A;  3SH8 A;  1XPB A;  3ZG5 A;  1FOF A;  2ZM8 A;  2ZC3 B;  4GB7 A;  5DF8 A;  1M6K A;  3A3J A;  3N8S A;  3WWX A;  2IWC A;  3FV7 A;  3WS4 A;  4Y0U A;  5HAP A;  1M40 A;  3C7U A;  4GZB A;  2R9W A;  4IVK A;  3RXX A;  4KZ7 A;  3FKW A;  1YMX A;  3N8L A;  1BZA A;  2DNS A;  5J8X A;  2Y2J A;  4E6W A;  5M1A A;  4HBT A;  5DTT A;  2OLV A;  5EVI A;  4DE1 A;  2ZQ7 A;  4LV3 A;  2OSU A;  2XFS A;  4GDB A;  1BLH A;  3PBT A;  4IED A;  4WEJ A;  2C6W B;  1DJB A;  1GA9 A;  4K0W A;  1KE4 A;  3WS1 A;  3JYI A;  4JBF A;  2ZM2 A;  1O7E A;  2HDS A;  2HDR A;  4ZDX A;  5A93 A;  4WZ5 A;  3VMA A;  5F1G A;  4S2N C;  2J9O A;  4E3N A;  4DE0 A;  1XXM A;  2ZMA A;  4N9K A;  1IYQ A;  2J9P A;  2WUQ A;  4S2P A;  3GVB A;  4ZBE A;  1MPL A;  1ES5 A;  1MWT A;  5GLC A;  5DTS A;  3SH9 A;  3MXS A;  5GLA A;  4F94 A;  5EVL A;  1O07 A;  1DJC A;  4H8R A;  2Y2Q A;  2ZC4 B;  4BL3 A;  2XDM A;  5EVI D;  4KZ8 A;  4IBX A;  4HES A;  4X6T A;  1N4O A;  4IVI A;  1FCN A;  4S2J A;  5FQ9 A;  3W8K A;  1QME A;  2PBY A;  3IT9 A;  4R3J A;  4R4S A;  4OPQ A;  5E2F A;  3TOI A;  1C3B A;  2EFU A;  1L2S A;  1YLP A;  5AQB A;  5GL9 A;  2XH9 A;  4E3K A;  3UN7 A;  3VOY A;  1BLC A;  4GD6 A;  5HAQ A;  2JBF A;  3PBO A;  4E3I A;  1K57 A;  3M2J A;  2WGI A;  1IEM A;  1ONH A;  3VP4 A;  4LV0 A;  3IQA A;  4RA7 A;  3E2L A;  4GN2 A;  2Y2L A;  3VSL A;  1MXO A;  3IH9 A;  2B5R A;  2Q9M A;  1PWC A;  3CG5 A;  4S2M A;  3D4F A;  4X53 A;  1ZC2 A;  2Y2N A;  2C5W B;  1L0E A;  4GOG A;  4WMC A;  4S2O A;  2EX2 A;  4JF4 A;  2XGN A;  3HVF A;  4JXV A;  1JWZ A;  3V3S A;  2WYX A;  1KGG A;  4EQI A;  4HEF A;  4B4Z A;  3DW0 A;  3ZHH A;  1NXY A;  2CC1 A;  1JWP A;  3ZNT A;  5FAP A;  5FQK A;  1GA0 A;  4MLL A;  1PW8 A;  3EQU A;  2G2U A;  5FDH A;  4FCF A;  2H0Y A;  5FAQ A;  2WGW B;  4UA9 A;  4KQQ A;  4Z9Q A;  1JWV A;  2ZLY A;  1TVF A;  2WGW A;  1BTL A;  3N4I A;  2BLS A;  2ZC6 B;  4DKI A;  2DCF A;  5DF7 A;  5FQJ A;  5KSH A;  2XK1 A;  1W8Q A;  1MWU A;  4FH2 A;  3N8R A;  4LV1 A;  2PU2 A;  3GRJ A;  3SS4 A;  3FZC A;  3ZDJ A;  3OCN A;  4DE2 A;  1YM1 A;  1W79 A;  5HL1 A;  1EI5 A;  2V20 A;  4XUZ A;  3IWQ A;  3UPP A;  3VOZ A;  4DDS A;  3ZNY A;  2Y2K A;  1CI8 A;  4PMA A;  3MKE A;  3HLD A;  1L0D A;  3WRT A;  5GHY A;  4PM7 A;  3BEB A;  3HL9 A;  3NY4 A;  1K6R A;  1TEM A;  3GQZ A;  3WS0 A;  1SDN A;  1E3U D;  1S6R A;  3AGE A;  3BEC A;  3IXG A;  4LEN A;  1CI9 A;  4WEK A;  3VP2 A;  1FSY A;  1JTD A;  3IF5 A;  3M6H A;  1K4F A;  3AGF A;  3C5A A;  3MBZ A;  3V5M A;  5EOE A;  4KZA A;  4NET A;  5E43 A;  3W4Q A;  2JCH A;  1AXB A;  2HP5 A;  3G4P A;  1ESI A;  3HUM A;  2I72 A;  3MFD A;  1OME A;  2WGV A;  2HP6 A;  2QMI A;  1RGZ A;  4B4X A;  1DJA A;  3IXD A;  1ES2 A;  1ONG A;  2PU4 A;  2Y2I A;  3OPH A;  4M3K A;  4S2K A;  5CTM A;  5FI6 A;  1PW1 A;  2Y59 A;  5GHZ A;  3IH8 A;  1K55 A; 
#chains in the Genus database with same CATH topology
 4ZJ3 A;  1F98 A;  1YT4 A;  1ES3 A;  3LO7 A;  5A91 A;  4BBV A;  2XRO A;  4R1G A;  1WYB A;  4NXG A;  2M7V A;  2ACG A;  2ZQC A;  1BUE A;  1OTD A;  3IXH A;  1YLJ A;  4WL9 A;  3IF6 C;  3DTE A;  3BW6 A;  3MZD A;  1S4S A;  1OTE A;  1FCO A;  4MEZ A;  1F5M A;  3O5Y A;  3BJN A;  2VGL M;  2V2F F;  3QP6 A;  4HIA A;  2ZQA A;  2K2N A;  3S22 A;  4EBP A;  1P0Z A;  2EXB A;  1VEU B;  1VEU A;  2OWH A;  2VJW A;  3U4L P;  5CXW A;  3ZG8 B;  4S2N A;  4WBG A;  1GHP A;  5DF9 A;  4OQG A;  2PD8 A;  3G2Y A;  5D3O A;  5GHX A;  3VSK A;  2ZL1 B;  1PIO A;  5F69 A;  2ZL1 A;  1YMS A;  1H0M A;  4XUX A;  5CHU A;  5F83 A;  5LBR A;  5JYP A;  1SCW A;  3D3O A;  4HHD A;  4JGP A;  5CRF A;  4ETZ A;  3I7J A;  3E4O A;  1NJ4 A;  2QHK A;  2Z6C A;  3G35 A;  4NEE D;  2VV8 A;  1DRM A;  4GKU A;  3ZG7 B;  5HDD A;  4JF5 A;  1Y54 A;  4KZB A;  5E2G A;  3S1Y A;  2P74 A;  3D9Y A;  1EWZ A;  4PM6 A;  4N9L A;  1LL9 A;  3NI9 A;  3S4X A;  1H5X A;  1KDW A;  5HAR A;  4ZJ1 A;  5HX9 A;  1OTI A;  3OZH A;  4O0P A;  2VZW A;  3NDE A;  2EWV A;  4LRZ E;  2L4R A;  3QNB A;  2W3G A;  3UDI A;  1CJF A;  4WYY A;  2A24 B;  1GCE A;  4BL2 A;  5A8B A;  2J3T C;  2A24 A;  4EBL A;  3NDG A;  4OOL A;  2W3D A;  4HI4 A;  5DJT A;  4DRT A;  2FFF B;  3MJQ A;  4MDZ A;  2Q0O A;  3GV9 A;  2QKP A;  3HJI A;  4ARZ A;  4JXS A;  4I3A A;  1V9Z A;  3ITA A;  3UE0 A;  2IWB A;  4EET B;  4ZRR A;  4BD1 A;  4LRY C;  1ZG6 A;  4OQ0 A;  1CK3 A;  4GNU A;  5CHM A;  5EEC A;  3EEA A;  4ZTK A;  3G31 A;  3KYQ A;  2WKQ A;  5A92 A;  1K0K A;  1XFN A;  1IYO A;  1BT5 A;  1N9B A;  3LUQ A;  1YLZ A;  3W4O A;  3VFF A;  1BUL A;  5EV0 A;  4LCL A;  2HDU A;  1CEG A;  1K56 A;  4MMN A;  2JKT I;  1YQS A;  4HJ3 A;  3PBN A;  1UGU A;  1MWR A;  4MNR A;  3FWL A;  4YFM A;  3FKV A;  2RL3 A;  5JYO A;  3SS5 A;  4S2I A;  4QPR A;  5DKK A;  2O99 A;  4E3O A;  4WZ4 A;  1OJG A;  5F68 A;  1H3Q A;  2P08 A;  3Q7Z A;  2PDR A;  3O3V A;  3NUL A;  2W3F A;  5HSQ A;  1MWS A;  2R9X A;  5FEF A;  5CEC A;  4E6X A;  3N7W A;  3ZYT A;  5FA7 A;  2EX8 A;  3C4P A;  3MR0 A;  4BD0 A;  4II7 A;  3KSH A;  3MZF A;  3UB8 A;  2PT7 A;  1LHY A;  3SW1 A;  3HLW A;  2EX6 A;  2OV5 A;  3T4T A;  3NOP C;  5DFY A;  4C75 A;  1E25 A;  1YLW A;  5FSR A;  5DVA A;  1SHV A;  4CLC D;  4BWI A;  3QNC A;  4QJG A;  4X69 A;  3LEQ A;  2D01 A;  5G18 A;  2VK3 A;  3CJM A;  4OH0 A;  1XX2 A;  4JPM A;  5KMW A;  1RGY A;  3T1X A;  2JC7 A;  4EEP A;  2GDN A;  4Y7P A;  3C38 A;  3B42 A;  2Y2P A;  3PAE A;  5HWW A;  3UB7 A;  4A5R A;  1G6O A;  3T4Q A;  5EE8 A;  2PYP A;  1ZTU A;  1T19 A;  1YKD A;  5IU1 A;  1CQA A;  2R9W A;  4IVK A;  1XFQ A;  4HH2 A;  1LSV A;  3JVV A;  1YMX A;  3N8L A;  5J8X A;  3CHW P;  2OLV A;  5EVI A;  4EW7 A;  4DE1 A;  2ZQ7 A;  4UQI S;  1W63 Q;  4WEJ A;  1A0K A;  2C6W B;  3CPT B;  2ZM2 A;  4ZDX A;  5A93 A;  1X0O A;  3VMA A;  4DE0 A;  1XXM A;  2HV1 A;  4GHI B;  4Z1W A;  3FPW A;  4N9K A;  4GHI A;  2WUQ A;  4ZBE A;  1MPL A;  2OAQ 1;  5DTS A;  5FDS A;  4O8G A;  2HZ5 A;  3IBJ A;  4FOF A;  1FCN A;  4B9O A;  3W8K A;  2PBY A;  2K31 A;  4IJG A;  2V0W A;  2V0U A;  4GJ4 A;  1L2S A;  1Z09 A;  2XH9 A;  5HAQ A;  1K57 A;  3M2J A;  1ONH A;  3G6O A;  4RA7 A;  3VSL A;  3IH9 A;  3CG5 A;  4X53 A;  4UQI M;  4S2O A;  2XGN A;  1JWZ A;  4EQI A;  4LLO B;  4LRX C;  1TS8 A;  3LID A;  1NXY A;  2FH5 A;  5FAP A;  5FQK A;  1PW8 A;  3EQU A;  2G2U A;  1W63 M;  4KQQ A;  2ZLY A;  1BTL A;  2ZC6 B;  3OBF A;  2PRF A;  1H8M A;  4FH2 A;  1TS6 A;  2PU2 A;  4DE2 A;  4ME4 A;  1ACF A;  3KYZ A;  1EI5 A;  3IX4 A;  3UPP A;  3KX0 X;  3ZNY A;  2Y2K A;  1CI8 A;  4PMA A;  2ZOH A;  3WRT A;  1Y4O A;  2YKH A;  1T1A A;  4IUH A;  1TEM A;  3GQZ A;  1SDN A;  3IXG A;  4LEN A;  3AGE A;  1CI9 A;  1JTD A;  3M6H A;  3C5A A;  4KZA A;  2G7U A;  5IS1 A;  3QP5 A;  1AXB A;  2HP5 A;  1ESI A;  3T50 A;  3CAX A;  1OME A;  2WGV A;  4B4X A;  1RGZ A;  1ES2 A;  3OPH A;  5GHZ A;  2Y59 A;  2OWJ A;  4C6Y A;  2O0Y A;  2UV0 E;  1GHI A;  3PBR A;  4ID4 A;  2CMN A;  3HCY A;  4XT2 B;  3A0V A;  1XJ4 A;  4KZ4 A;  1MKM A;  4JGR A;  2QPN A;  4RYE A;  3S7O A;  2VGK A;  3MKF A;  3DTK A;  3F1P A;  2W1T B;  1S1Z A;  3DWZ A;  4PKY A;  3V67 A;  2W1T A;  1ERQ A;  3VE4 A;  1OJ5 A;  2INW A;  3T12 B;  4HBU A;  1G68 A;  4R6L A;  2D02 A;  3UPN A;  4BJP A;  4OPY A;  5HL6 A;  4R3A A;  1XKZ A;  2A49 A;  5CER A;  2GNX A;  3P01 A;  1XJ2 A;  3RXW A;  4P6B A;  1IKI A;  3Q82 A;  3U2A A;  1ZKJ A;  3SH7 A;  4YNR A;  3WS2 A;  5KIZ A;  4OQI A;  5HD5 A;  3EEH A;  1K56 D;  4NKP A;  3O86 A;  3WS5 A;  4KZ3 A;  1YLT A;  2FFY A;  2JKR M;  3VV4 A;  2WKP A;  1J9M A;  2RCX A;  3V3R A;  3HBR A;  4D2O A;  4OLG A;  3NC8 A;  3LY3 A;  4GD8 A;  4UA6 A;  3UNW A;  1L0G A;  3TG9 A;  3FG8 A;  4JLF A;  1Q2Q A;  4JGQ A;  3T1S A;  4EUZ A;  2ZQ9 A;  2XFT A;  4JXW A;  2MJ6 A;  2H10 A;  2ZC5 B;  1LT0 A;  3A3I A;  1P9W A;  2VGJ A;  4OON A;  4EBN A;  2VX8 A;  3MQQ A;  4X68 A;  2QJ5 A;  4XXR A;  4RX2 A;  1SKO A;  1TDG A;  3IHA A;  1L0F A;  3UDF A;  4AFI A;  4OKP A;  2ZM0 A;  5AQ7 A;  3OC2 A;  4X55 A;  1Q2P A;  4E3M A;  4E3J A;  3G34 A;  1MBL A;  1PWG A;  2HPB A;  4NK3 A;  1RCJ A;  2JN7 A;  4K91 A;  1VM1 A;  2ZMV A;  1BLS A;  2I9V A;  1K38 A;  2XQZ A;  2OAP 1;  3CWF A;  2WAD A;  2W0N A;  4QD4 A;  4DF6 A;  1VB6 A;  4RQ9 A;  3NJA A;  2IA2 A;  4FSF A;  3C4O A;  3BWL A;  1P97 A;  2O9C A;  4WZ5 C;  5FQI A;  4HH3 A;  3SOI A;  1I2W A;  4RX3 A;  2WKR A;  5EM1 A;  3FYZ A;  5EPH A;  2J80 A;  5C5K A;  4H6J B;  4G3K A;  4H6J A;  4X25 A;  4YWZ A;  5TBM B;  5TBM A;  1W5D A;  5L2F A;  1K54 A;  1H8Z A;  3C8C A;  4ZJ2 A;  3ICY A;  1IFQ A;  2O9B A;  1FCM A;  4PM5 A;  3E98 A;  1KGF A;  2JKG A;  3ITB A;  1RP5 A;  2XD1 A;  1BLP A;  2X71 A;  3Q1F A;  1PI4 A;  4FD8 A;  5M18 A;  1LLB A;  3DBA A;  3G30 A;  2M7U A;  4CLC C;  5AJG A;  2W27 A;  3E2K A;  2IWD A;  3L9K A;  4P6Z S;  4F3L A;  5EFW A;  3HLB A;  4P85 A;  3H82 B;  1GSV A;  3H82 A;  3NOU C;  3LR0 A;  4KUK A;  4R0Q A;  1FQG A;  1JNU A;  1S4R A;  4U0T A;  1D1J A;  3C2W A;  4PM8 A;  2VV6 A;  1IYS A;  1LSX A;  4KZ6 A;  1IEL A;  4KQO A;  2VV7 A;  1N9N A;  2ZQ8 A;  5HW3 A;  4JGO A;  2WZZ A;  2Q9N A;  4M4X A;  2QWS A;  4WEL A;  4BMW A;  5HDC A;  1LSW A;  1KVL A;  3O87 A;  3T1R A;  2A3U A;  3R7W B;  4KQR A;  3KYE A;  3R7W A;  4ARZ B;  1CEF A;  1K55 C;  4P6Z M;  1I2S A;  3BY8 A;  3LCE A;  1PI5 A;  5IHV A;  3FC7 A;  3BFC A;  3VFH A;  5MC7 A;  2J8Y A;  1T18 A;  4L9G A;  1WE4 A;  4N1X A;  1ZHH B;  3UDX A;  5J7E A;  3LY4 A;  2O9A A;  2NUP C;  4GB7 A;  1M6K A;  3A3J A;  5J4E A;  2IWC A;  3IS2 B;  3IS2 A;  4DJ3 A;  2Y2J A;  5DTT A;  2AVX A;  3LIA A;  4LV3 A;  2OSU A;  2XFS A;  1DJB A;  3WS1 A;  3JYI A;  2HDR A;  4EEU A;  3VOL A;  4S2N C;  2J9O A;  4LFU A;  2J9P A;  2XA7 S;  5GLA A;  3S7P A;  2Y2Q A;  1GSW A;  5K5B A;  3UMD A;  5FQ9 A;  4ESP A;  4BBT A;  4R3J A;  4R4S A;  4OPQ A;  2QJ7 A;  1C3B A;  3MQ0 A;  2EFU A;  1OPX A;  4E3K A;  3UN7 A;  3VOY A;  3H9W A;  3TRC A;  3IQA A;  2B5R A;  1F2K A;  4S2M A;  1FIK A;  2Y2N A;  4WMC A;  4Q0I A;  4HOI A;  3E4Q A;  2W3H A;  2VKS A;  3DW0 A;  2CC1 A;  3ZQ5 A;  2H0Y A;  2WGW B;  4UA9 A;  1TVF A;  2WGW A;  4DKI A;  5KSH A;  2V1A A;  2XK1 A;  3CIT A;  2V9A A;  4LV1 A;  3GRJ A;  3FZC A;  2KLI A;  3ZDJ A;  2GJ3 A;  1YM1 A;  3LI8 A;  4HNB A;  4XUZ A;  3T4J A;  3MKE A;  3BEB A;  1K6R A;  3WS0 A;  1NRJ A;  3B33 A;  1S6R A;  4WEK A;  1FSY A;  3AGF A;  4KQD A;  3MBZ A;  3V5M A;  5E43 A;  4EUV A;  2R78 A;  3MFD A;  2JCH A;  4ETX A;  3EOI A;  2B02 A;  4NXE A;  2QMI A;  1DJA A;  1OT9 A;  2Y2I A;  3MXQ A;  3O88 A;  2LB9 A;  4BEN A;  4R38 A;  3PAG A;  3UO9 A;  5BOH A;  1S66 L;  4DDY A;  5FQQ A;  4YIN A;  2P9V A;  5FAT A;  2DMW A;  3FPV A;  5F1F A;  1LI9 A;  3PR6 A;  2YKF A;  3A3E A;  5EVI B;  4FUW A;  1TS7 A;  5FQM A;  4OVD A;  2B18 A;  4QB8 A;  3IX3 A;  1I5Q A;  5FEG A;  1FIL A;  4CLC E;  1JVJ A;  4X56 A;  1PZP A;  3P09 A;  1YSQ A;  3G32 A;  1OT6 A;  5AQA A;  2HJ9 C;  3MFX A;  1TF1 A;  3V39 A;  4MBF A;  3P7N A;  5HPI A;  1U60 A;  4KZ5 A;  3IHB A;  5F82 A;  1DP6 A;  2EWW A;  1XA1 A;  1YLY A;  4HJ6 A;  3BRM A;  5HZH A;  3DTM A;  3Q7V B;  4I38 A;  1J3W A;  3Q7V A;  3UY6 A;  2KOI A;  4OOM A;  1ZG4 A;  1JTG A;  2EXA A;  1VET B;  4QY5 A;  4I3I A;  5U47 A;  1VET A;  2BAS A;  4PPR A;  1PZO A;  3AGD A;  1HLU P;  3CLO A;  4GS9 B;  2BG1 A;  2OOL A;  2E8J A;  3GTC A;  4GS9 A;  1E3U A;  4R3B A;  4E3L A;  3NBL A;  1IKG A;  2Y2G A;  2GX5 A;  2ZQD A;  4KG6 A;  3IWO A;  4GW9 A;  4K08 A;  2WKH A;  5CGW A;  3M2K A;  3LR3 A;  4P87 A;  2XRN A;  4KG2 A;  3EGX C;  4DXC A;  3ZFZ A;  4I5S A;  2L1M A;  1LI0 A;  4HP9 A;  1G5U A;  3BFD A;  2XR0 A;  1AWI A;  3K3D A;  2WK0 A;  2PR6 A;  3QP1 A;  3PBQ A;  4LPZ A;  3BFE A;  3LIC A;  5HFO A;  2WZX A;  1LL5 A;  4EQ1 A;  4X1M A;  2M1C A;  2B95 A;  4S2L A;  2Y2M A;  2ZD8 A;  3MXR A;  3LIE A;  3MQO A;  4FTX A;  3S7N A;  1D7E A;  4DE3 A;  3F1P B;  3OPL A;  5AQ9 A;  4QWO A;  4KG5 A;  1KGE A;  4EXO A;  5HWT A;  5EVI C;  3BYD A;  2EFX A;  1PNE A;  1Z6F A;  1S1Y A;  5GLD A;  3GSG A;  2UWX A;  2Y8H A;  1XP4 A;  2VLG A;  4MN5 A;  3KSG A;  4U3T A;  3ZG0 A;  1DP8 A;  3Q07 A;  4DN0 A;  3QHY A;  1PWD A;  2XD5 A;  3LEZ A;  1T1B A;  3K3C A;  1HTZ A;  3IF6 B;  1H8Y A;  4IBR A;  3VP3 A;  3IF6 A;  3GEC A;  3HUN A;  3SS3 A;  3NEC A;  1N9L A;  4PHT A;  4DJ2 A;  3ZVW A;  1ALQ A;  2V1B A;  4QU3 A;  2J7V A;  2Z6D A;  1K57 C;  1FR1 A;  3KSI A;  1K6S A;  3T1Q B;  1NLY A;  1ERO A;  3WRZ A;  4G3V A;  1YPR A;  1OTB A;  1NY0 A;  4E04 A;  4B88 A;  1NZU A;  4KEN B;  4GDN A;  2E8I A;  4HP4 A;  5EOO A;  5HWV A;  5E2E A;  1MY8 A;  2Y79 A;  4GLQ A;  3HUO A;  2PAV P;  1FSW A;  4UAA A;  3KO6 A;  3D72 A;  5DTK A;  1ERM A;  1IOU A;  3DTI A;  3E0Y A;  1W8Y A;  3M6B A;  2EA9 A;  4ZAM A;  5EM0 A;  5L09 A;  4LV2 A;  3PTE A;  3NOT C;  4G3W A;  1SKF A;  5CGX A;  3F1O A;  1XJ3 A;  1SKO B;  3G2Z A;  4WMC D;  3BM6 A;  5EUA A;  2K7S A;  3LIB A;  5DJU A;  4GCZ A;  2V1Z A;  2HF6 A;  1V9Y A;  4MBK A;  4OOY A;  3NIA A;  3UB9 A;  1DP9 A;  2W3E A;  4LCM A;  3RJU A;  4OPR A;  4OQH A;  4PM9 A;  4EV4 A;  3A3D A;  2PBD P;  3CMZ A;  3ULF A;  3UME A;  4L0L A;  1IYP A;  4NXB A;  4K0X A;  4Q0J A;  4C3Q A;  2V8F A;  1VQQ A;  3HLC A;  3BQ8 A;  2JHE A;  3C7V A;  4L9F A;  2EX9 A;  2Y4A A;  1NRF A;  3MS6 A;  1S67 L;  3NCK A;  1XPB A;  1FOF A;  1T1C A;  3UB5 P;  3N8S A;  3WWX A;  3WS4 A;  5HAP A;  3C7U A;  4GZB A;  5J3W A;  3RXX A;  4Q0H A;  1CF0 A;  3FKW A;  1PFL A;  1BZA A;  4IED A;  4GDB A;  1BLH A;  3LFV A;  4K0W A;  1KE4 A;  4JBF A;  2HDS A;  5F1G A;  4E3N A;  2JKT M;  4S2P A;  2JKF A;  3T4O A;  5GLC A;  1ES5 A;  3SH9 A;  4F94 A;  5EVL A;  1DJC A;  2ZC4 B;  3A0R A;  2HGV A;  5EVI D;  4KZ8 A;  4BBU A;  4X6T A;  1L3L A;  4IVI A;  4S2J A;  3TE8 A;  1QME A;  3IT9 A;  2BTF P;  4EER A;  4L9E A;  1YSP A;  5E2F A;  3TOI A;  3T4K A;  1P9R A;  2JKR I;  1OTA A;  4F3L B;  2JBF A;  3T4L A;  3B47 A;  4E3I A;  2WGI A;  1IEM A;  3VP4 A;  4LV0 A;  4WF0 A;  4HY8 A;  1MXO A;  2Q9M A;  3CUE A;  5DKL A;  1ZC2 A;  4JXV A;  3OLO A;  2GZA A;  5L10 A;  3V3S A;  2WYX A;  4B4Z A;  3DAV A;  4WN5 A;  1JWP A;  3GDI A;  4MLL A;  5FDH A;  4FCF A;  5FAQ A;  4Z9Q A;  1JWV A;  2BLS A;  4MCW A;  5DF7 A;  5FQJ A;  1TD5 A;  1W8Q A;  3IWQ A;  4DDS A;  4R70 A;  1ODV A;  3HL9 A;  1E3U D;  3IF5 A;  1XJ6 A;  1K4F A;  1D06 A;  4NET A;  3LR4 A;  3W4Q A;  3G4P A;  4Y15 A;  3HUM A;  3HJK A;  4MN7 A;  2HP6 A;  2PD7 A;  3IXD A;  5EVE A;  4S2K A;  1ONG A;  2PR5 A;  2PU4 A;  4M3K A;  5FI6 A;  5CTM A;  1PW1 A;  3QP8 A;  5TFQ A;  4DXB A;  1PYY A;  5F6A A;  5CGS A;  2QYB A;  2J3W A;  5GLB A;  1N9O A;  4DMZ A;  2ZMF A;  1QMF A;  5CTN A;  3LGO A;  2HDQ A;  4Y0T A;  1STZ A;  5HDS A;  1K4E A;  1K54 C;  4RVA A;  3UE3 A;  1G28 A;  4Y3I A;  3E4P A;  3P98 A;  5CX7 A;  3UE1 A;  2VA0 A;  4MBH A;  2VEA A;  4IHQ A;  4PKY G;  3N6I A;  3UB6 A;  2WKE A;  4WLA A;  5L8M A;  1BSG A;  1XA7 A;  3IXB A;  2KX6 A;  3NHQ A;  4O7D A;  5KSC A;  2DRW A;  4N92 A;  3GMW A;  3JVU A;  3ZG9 B;  1SDE A;  2Y91 A;  4JXG A;  3CUE C;  5G4Z A;  5L07 A;  3BLM A;  4EES A;  4JF6 A;  3OCL A;  1ESU A;  4EWF A;  4Y5F A;  2Y2O A;  4X1L A;  1G6A A;  3K2N A;  1KVM A;  2XA7 M;  2OLU A;  3KSF A;  3VP0 A;  5M19 A;  3BFF A;  5A90 A;  2Y55 A;  4R4R A;  2Z2L B;  5I94 A;  3LIF A;  1GHM A;  5HD3 A;  4O01 A;  1HD8 A;  5FI2 A;  5F5Y A;  3QP4 A;  3IBR A;  2QZ6 A;  5E2H A;  3R4K A;  5FI7 A;  4KUO A;  4LGW A;  2JE5 A;  2XLN A;  3GR2 A;  2L0W A;  1TDL A;  3EGD C;  3HRE A;  5G4Y A;  1NYM A;  2HP9 A;  5AVF A;  1MKI A;  3UE6 A;  3H7W B;  2Z2M B;  3H7W A;  2WAF A;  1KDS A;  3W4P A;  3LR5 A;  4UHU A;  3HLG A;  4HQA A;  2HJE A;  2P9V B;  4U0X A;  4QY6 A;  2XEP A;  3A3F A;  2WKI A;  1K25 A;  4FH4 A;  3EQV A;  1YAX A;  1XGJ A;  3CI6 A;  4Y0O A;  1W7F A;  3T4S A;  2LB5 A;  5HAI A;  2WAE A;  1DY6 A;  3TSG A;  2NUT C;  1ES4 A;  4JKT A;  3HLF A;  3TJZ C;  2J3T D;  4OP8 A;  4CPK A;  2X01 A;  3W2Z A;  2Y2H A;  5FAO A;  1KE0 A;  3HLE A;  2ZJ9 A;  5TR7 A;  3OPP A;  1XGI A;  4P0M A;  1KE3 A;  3CPT A;  3Q81 A;  4CJN A;  5CEB A;  4WM9 A;  1BYW A;  1F9I A;  1SZV A;  1E4D A;  2ZOI A;  1FR6 A;  1MZU A;  1NYY A;  4N1H A;  4WUJ A;  3CZD A;  5DFX A;  2X02 A;  4Y2F A;  3DWK A;  2ZBB A;  3B3X A;  2P7J A;  3ZCZ A;  2P04 A;  3BFG A;  4OLD A;  2V8C A;  3V50 A;  2A2L A;  4OP5 A;  2G2W A;  3ZVT A;  4D60 A;  3RFB A;  4MN6 A;  5FL3 A;  3PHY A;  1WYC A;  3PXP A;  4R23 A;  3JPU A;  3ISG A;  4Y17 A;  1NZO A;  4Q8I A;  3IX8 A;  3BLS A;  4QHC A;  3IWI A;  4UA7 A;  1WA9 A;  1S0W A;  3MSH A;  4BLM A;  5KZH A;  2XF3 A;  3PBS A;  2H5S A;  3ZGA B;  1K55 A;  3RTY A;  5CED A;  5TGF A;  1HZO A;  2ZC7 A;  5FAS A;  4CQH A;  3VE3 A;  1HVB A;  3VP1 A;  1GSX A;  3OPR A;  4IUK A;  2H0T A;  3C30 A;  4KZ9 A;  3MZE A;  4OPZ A;  1EW0 A;  5HPF A;  2W1R A;  1MC0 A;  1Y28 A;  1VHM A;  5CHJ A;  3UPO A;  4HJ4 A;  3SZT A;  3SH8 A;  3ZG5 A;  2ZM8 A;  4I39 A;  2ZC3 B;  1UWP X;  5DF8 A;  3TW8 A;  3FV7 A;  4XT2 A;  4Y0U A;  1M40 A;  4KZ7 A;  4EU0 A;  2DNS A;  4E6W A;  5M1A A;  4HBT A;  3LYX A;  3PBT A;  1GA9 A;  4YOF A;  1O7E A;  3QP2 A;  1LL8 A;  4WZ5 A;  5AVE A;  2ZMA A;  1IYQ A;  3GVB A;  1MWT A;  5TJJ A;  3MXS A;  1O07 A;  3BQA A;  4H8R A;  4I3J A;  4BL3 A;  2XDM A;  4IBX A;  4HES A;  1N4O A;  3EWK A;  1YLP A;  5AQB A;  5GL9 A;  3L7H A;  2FZ0 A;  3LI9 A;  1BLC A;  4GD6 A;  5IT5 A;  4NXF A;  3PBO A;  4Y13 A;  3E2L A;  4GN2 A;  2Y2L A;  1PWC A;  3D4F A;  4GOG A;  2C5W B;  1L0E A;  4CLC B;  3OOV A;  2EX2 A;  4JF4 A;  3HVF A;  4CLC A;  1KGG A;  3PYP A;  4HEF A;  3A0S A;  3ZHH A;  3ZNT A;  1GA0 A;  4B93 A;  1KOU A;  3BY9 A;  3F1O B;  3N4I A;  2DCF A;  1NLZ A;  4NG2 A;  1MWU A;  3N8R A;  2XSS A;  3SS4 A;  3OCN A;  1W79 A;  5HL1 A;  2PHY A;  2V20 A;  3MF0 A;  3VOZ A;  5I5L A;  4PAU A;  3HLD A;  1L0D A;  3RH8 B;  5GHY A;  4PM7 A;  2PYR A;  1NWZ A;  3NY4 A;  3BEC A;  3VP2 A;  2VGL S;  3MMH A;  2H28 A;  1UWN X;  3S7Q A;  1PRQ A;  4UEY A;  5EOE A;  2KDK A;  2I72 A;  1TS0 A;  4BQM A;  3F1N B;  3IH8 A;  3F1N A; 
#chains in the Genus database with same CATH homology
 4ZJ3 A;  5TFQ A;  4DXB A;  4C6Y A;  1PYY A;  1YT4 A;  1ES3 A;  3LO7 A;  5A91 A;  5CGS A;  4R1G A;  1WYB A;  1GHI A;  3O88 A;  4BEN A;  3PBR A;  5GLB A;  3PAG A;  4ID4 A;  3UO9 A;  5BOH A;  4KZ4 A;  4DDY A;  1QMF A;  5FQQ A;  2QPN A;  4YIN A;  2P9V A;  4RYE A;  5CTN A;  5FAT A;  2ZQC A;  1BUE A;  2VGK A;  3MKF A;  5F1F A;  1LI9 A;  3DWZ A;  3A3E A;  3IXH A;  5EVI B;  2HDQ A;  1ERQ A;  4Y0T A;  5FQM A;  1YLJ A;  4OVD A;  4QB8 A;  1I5Q A;  3IF6 C;  1K4E A;  1K54 C;  3MZD A;  1JVJ A;  4HBU A;  1FCO A;  1G68 A;  4RVA A;  4MEZ A;  4X56 A;  1PZP A;  3UE3 A;  3UPN A;  3P09 A;  3G32 A;  4BJP A;  5AQA A;  4OPY A;  1XKZ A;  2V2F F;  2A49 A;  5CER A;  2ZQA A;  3S22 A;  4EBP A;  3P98 A;  2EXB A;  3V39 A;  4MBF A;  3UE1 A;  3RXW A;  4P6B A;  4MBH A;  1IKI A;  1U60 A;  3N6I A;  3Q82 A;  5CXW A;  3ZG8 B;  4S2N A;  4WBG A;  1GHP A;  4KZ5 A;  2WKE A;  5DF9 A;  1ZKJ A;  3IHB A;  1BSG A;  1XA7 A;  4OQG A;  3SH7 A;  5F82 A;  3IXB A;  3G2Y A;  3WS2 A;  5D3O A;  1XA1 A;  4O7D A;  5GHX A;  3VSK A;  4OQI A;  1PIO A;  1K56 D;  1YLY A;  1YMS A;  5KSC A;  2DRW A;  4N92 A;  3BRM A;  3O86 A;  3GMW A;  4XUX A;  3ZG9 B;  3WS5 A;  1SDE A;  5CHU A;  2Y91 A;  5F83 A;  5JYP A;  3DTM A;  3Q7V B;  4KZ3 A;  3Q7V A;  1YLT A;  2FFY A;  3UY6 A;  1SCW A;  4OOM A;  1ZG4 A;  4JXG A;  1JTG A;  3BLM A;  5CRF A;  4JF6 A;  1J9M A;  3OCL A;  2EXA A;  2RCX A;  3I7J A;  3HBR A;  3V3R A;  4D2O A;  1ESU A;  4QY5 A;  4OLG A;  3NC8 A;  3LY3 A;  5U47 A;  4EWF A;  1NJ4 A;  4GD8 A;  4UA6 A;  3UNW A;  2Y2O A;  1L0G A;  3TG9 A;  4JLF A;  3G35 A;  1G6A A;  1Q2Q A;  1KVM A;  4GKU A;  4PPR A;  3ZG7 B;  1PZO A;  2OLU A;  3AGD A;  4JF5 A;  1Y54 A;  2BG1 A;  3GTC A;  4KZB A;  4EUZ A;  1E3U A;  2ZQ9 A;  2XFT A;  5E2G A;  4R3B A;  3S1Y A;  3NBL A;  4JXW A;  3VP0 A;  2P74 A;  4E3L A;  5M19 A;  2H10 A;  1IKG A;  2Y2G A;  3BFF A;  5A90 A;  2Y55 A;  1EWZ A;  4R4R A;  2ZC5 B;  4N9L A;  4PM6 A;  1LL9 A;  3A3I A;  2ZQD A;  2Z2L B;  3NI9 A;  4KG6 A;  3IWO A;  5I94 A;  1GHM A;  1H5X A;  1KDW A;  2VGJ A;  2WKH A;  3S4X A;  5HAR A;  4OON A;  5CGW A;  4EBN A;  4ZJ1 A;  3M2K A;  5HX9 A;  1HD8 A;  3OZH A;  4P87 A;  3NDE A;  5FI2 A;  4KG2 A;  4X68 A;  3QNB A;  4XXR A;  4RX2 A;  4DXC A;  3ZFZ A;  2QZ6 A;  5E2H A;  5FI7 A;  1TDG A;  1LI0 A;  3IHA A;  2JE5 A;  2XLN A;  1L0F A;  3GR2 A;  4WYY A;  3UDF A;  3BFD A;  1GCE A;  2XR0 A;  3UDI A;  4BL2 A;  4OKP A;  1TDL A;  2ZM0 A;  4EBL A;  5AQ7 A;  2WK0 A;  3HRE A;  3NDG A;  3OC2 A;  1NYM A;  2HP9 A;  3PBQ A;  4OOL A;  4X55 A;  1Q2P A;  4E3M A;  4E3J A;  3G34 A;  1MKI A;  4DRT A;  2FFF B;  3BFE A;  1MBL A;  1PWG A;  2HPB A;  4NK3 A;  3GV9 A;  1RCJ A;  5HFO A;  2Z2M B;  4JXS A;  2WZX A;  1LL5 A;  4K91 A;  2WAF A;  1KDS A;  3ITA A;  3W4P A;  3UE0 A;  4BQM A;  2IWB A;  4UHU A;  1VM1 A;  4S2L A;  2Y2M A;  3HLG A;  1BLS A;  2ZD8 A;  3MXR A;  4BD1 A;  2P9V B;  4U0X A;  4OQ0 A;  1ZG6 A;  4QY6 A;  2XQZ A;  1K38 A;  2XEP A;  1CK3 A;  3A3F A;  2WKI A;  1K25 A;  4DE3 A;  3OPL A;  4GNU A;  5AQ9 A;  4FH4 A;  5CHM A;  5EEC A;  3EQV A;  2WAD A;  4DF6 A;  4KG5 A;  4QD4 A;  1KGE A;  4ZTK A;  3G31 A;  1XGJ A;  5EVI C;  3BYD A;  4Y0O A;  1W7F A;  5A92 A;  2EFX A;  1Z6F A;  5HAI A;  4FSF A;  3C4O A;  2WAE A;  5GLD A;  1IYO A;  1BT5 A;  1DY6 A;  1N9B A;  4WZ5 C;  5FQI A;  3SOI A;  3TSG A;  1I2W A;  1ES4 A;  1YLZ A;  3W4O A;  3GSG A;  4JKT A;  2UWX A;  3HLF A;  4RX3 A;  3FYZ A;  1XP4 A;  5EPH A;  3VFF A;  4OP8 A;  1BUL A;  4U3T A;  3ZG0 A;  4CPK A;  3Q07 A;  4LCL A;  2X01 A;  2HDU A;  2Y2H A;  1CEG A;  5FAO A;  1K56 A;  1KE0 A;  3HLE A;  3QHY A;  2ZJ9 A;  1PWD A;  2XD5 A;  1YQS A;  5TR7 A;  3LEZ A;  3OPP A;  3PBN A;  1HTZ A;  1MWR A;  1H8Y A;  1W5D A;  3IF6 B;  5L2F A;  4IBR A;  4MNR A;  3IF6 A;  3VP3 A;  3FWL A;  1XGI A;  4P0M A;  4YFM A;  3HUN A;  1K54 A;  1H8Z A;  1KE3 A;  3FKV A;  3Q81 A;  3SS3 A;  4ZJ2 A;  4CJN A;  2RL3 A;  5JYO A;  5CEB A;  3SS5 A;  4S2I A;  4WM9 A;  1FCM A;  3ZVW A;  1ALQ A;  4E3O A;  4PM5 A;  4WZ4 A;  1KGF A;  3ITB A;  1E4D A;  1RP5 A;  4QU3 A;  1FR6 A;  2J7V A;  2XD1 A;  1BLP A;  1K57 C;  1NYY A;  4N1H A;  2X71 A;  3Q1F A;  3CZD A;  1FR1 A;  1K6S A;  1PI4 A;  3Q7Z A;  2X02 A;  3DWK A;  1ERO A;  3O3V A;  3WRZ A;  4FD8 A;  5M18 A;  1NY0 A;  1LLB A;  3G30 A;  4B88 A;  1MWS A;  3E2K A;  2R9X A;  2IWD A;  3B3X A;  1NZU A;  4KEN B;  3ZCZ A;  4GDN A;  2E8I A;  5EOO A;  3BFG A;  5CEC A;  4OLD A;  5E2E A;  1MY8 A;  4E6X A;  3V50 A;  3HLB A;  3HUO A;  4OP5 A;  3N7W A;  1FSW A;  4P85 A;  2G2W A;  5FA7 A;  4UAA A;  3ZVT A;  2EX8 A;  5DTK A;  3C4P A;  1ERM A;  4BD0 A;  4R0Q A;  1FQG A;  3MZF A;  4U0T A;  1WYC A;  1W8Y A;  3M6B A;  4PM8 A;  4R23 A;  1IYS A;  4ZAM A;  1LHY A;  3HLW A;  2EX6 A;  4KZ6 A;  1IEL A;  3ISG A;  4LV2 A;  2OV5 A;  4KQO A;  1NZO A;  4Q8I A;  3PTE A;  2ZQ8 A;  3BLS A;  1SKF A;  4QHC A;  5CGX A;  3IWI A;  5HW3 A;  4UA7 A;  4C75 A;  2WZZ A;  1E25 A;  1YLW A;  1S0W A;  2Q9N A;  3G2Z A;  4WMC D;  3BM6 A;  5EUA A;  5FSR A;  5DVA A;  4BLM A;  1SHV A;  2V1Z A;  2XF3 A;  4WEL A;  5KZH A;  3PBS A;  2H5S A;  4MBK A;  3ZGA B;  4OOY A;  1KVL A;  3O87 A;  3NIA A;  2A3U A;  3QNC A;  4QJG A;  4X69 A;  4KQR A;  5CED A;  4LCM A;  5TGF A;  1HZO A;  2ZC7 A;  3RJU A;  5FAS A;  1CEF A;  4OPR A;  4OQH A;  4PM9 A;  5G18 A;  4EV4 A;  1K55 C;  3A3D A;  3CJM A;  4OH0 A;  1HVB A;  1XX2 A;  4JPM A;  1I2S A;  3CMZ A;  3VP1 A;  3LCE A;  5KMW A;  3OPR A;  1RGY A;  1PI5 A;  5IHV A;  4L0L A;  1IYP A;  3BFC A;  3VFH A;  2JC7 A;  2GDN A;  2J8Y A;  2H0T A;  4KZ9 A;  4Y7P A;  4K0X A;  3MZE A;  4C3Q A;  4OPZ A;  2Y2P A;  1WE4 A;  1VQQ A;  3HLC A;  4N1X A;  3UDX A;  3C7V A;  3PAE A;  5CHJ A;  3UPO A;  2EX9 A;  2Y4A A;  1NRF A;  4A5R A;  3LY4 A;  5EE8 A;  3NCK A;  3SH8 A;  1XPB A;  3ZG5 A;  1FOF A;  2ZM8 A;  2ZC3 B;  4GB7 A;  5DF8 A;  1M6K A;  3A3J A;  3N8S A;  3WWX A;  2IWC A;  3FV7 A;  3WS4 A;  4Y0U A;  5HAP A;  1M40 A;  3C7U A;  4GZB A;  2R9W A;  4IVK A;  3RXX A;  4KZ7 A;  3FKW A;  1YMX A;  3N8L A;  1BZA A;  2DNS A;  5J8X A;  2Y2J A;  4E6W A;  5M1A A;  4HBT A;  5DTT A;  2OLV A;  5EVI A;  4DE1 A;  2ZQ7 A;  4LV3 A;  2OSU A;  2XFS A;  4GDB A;  1BLH A;  3PBT A;  4IED A;  4WEJ A;  2C6W B;  1DJB A;  1GA9 A;  4K0W A;  1KE4 A;  3WS1 A;  3JYI A;  4JBF A;  2ZM2 A;  1O7E A;  2HDS A;  2HDR A;  4ZDX A;  5A93 A;  4WZ5 A;  3VMA A;  5F1G A;  4S2N C;  2J9O A;  4E3N A;  4DE0 A;  1XXM A;  2ZMA A;  4N9K A;  1IYQ A;  2J9P A;  2WUQ A;  4S2P A;  3GVB A;  4ZBE A;  1MPL A;  1ES5 A;  1MWT A;  5GLC A;  5DTS A;  3SH9 A;  3MXS A;  5GLA A;  4F94 A;  5EVL A;  1O07 A;  1DJC A;  4H8R A;  2Y2Q A;  2ZC4 B;  4BL3 A;  2XDM A;  5EVI D;  4KZ8 A;  4IBX A;  4HES A;  4X6T A;  1N4O A;  4IVI A;  1FCN A;  4S2J A;  5FQ9 A;  3W8K A;  1QME A;  2PBY A;  3IT9 A;  4R3J A;  4R4S A;  4OPQ A;  5E2F A;  3TOI A;  1C3B A;  2EFU A;  1L2S A;  1YLP A;  5AQB A;  5GL9 A;  2XH9 A;  4E3K A;  3UN7 A;  3VOY A;  1BLC A;  4GD6 A;  5HAQ A;  2JBF A;  3PBO A;  4E3I A;  1K57 A;  3M2J A;  2WGI A;  1IEM A;  1ONH A;  3VP4 A;  4LV0 A;  3IQA A;  4RA7 A;  3E2L A;  4GN2 A;  2Y2L A;  3VSL A;  1MXO A;  3IH9 A;  2B5R A;  2Q9M A;  1PWC A;  3CG5 A;  4S2M A;  3D4F A;  4X53 A;  1ZC2 A;  2Y2N A;  2C5W B;  1L0E A;  4GOG A;  4WMC A;  4S2O A;  2EX2 A;  4JF4 A;  2XGN A;  3HVF A;  4JXV A;  1JWZ A;  3V3S A;  2WYX A;  1KGG A;  4EQI A;  4HEF A;  4B4Z A;  3DW0 A;  3ZHH A;  1NXY A;  2CC1 A;  1JWP A;  3ZNT A;  5FAP A;  5FQK A;  1GA0 A;  4MLL A;  1PW8 A;  3EQU A;  2G2U A;  5FDH A;  4FCF A;  2H0Y A;  5FAQ A;  2WGW B;  4UA9 A;  4KQQ A;  4Z9Q A;  1JWV A;  2ZLY A;  1TVF A;  2WGW A;  1BTL A;  3N4I A;  2BLS A;  2ZC6 B;  4DKI A;  2DCF A;  5DF7 A;  5FQJ A;  5KSH A;  2XK1 A;  1W8Q A;  1MWU A;  4FH2 A;  3N8R A;  4LV1 A;  2PU2 A;  3GRJ A;  3SS4 A;  3FZC A;  3ZDJ A;  3OCN A;  4DE2 A;  1YM1 A;  1W79 A;  5HL1 A;  1EI5 A;  2V20 A;  4XUZ A;  3IWQ A;  3UPP A;  3VOZ A;  4DDS A;  3ZNY A;  2Y2K A;  1CI8 A;  4PMA A;  3MKE A;  3HLD A;  1L0D A;  3WRT A;  5GHY A;  4PM7 A;  3BEB A;  3HL9 A;  3NY4 A;  1K6R A;  1TEM A;  3GQZ A;  3WS0 A;  1SDN A;  1E3U D;  1S6R A;  3AGE A;  3BEC A;  3IXG A;  4LEN A;  1CI9 A;  4WEK A;  3VP2 A;  1FSY A;  1JTD A;  3IF5 A;  3M6H A;  1K4F A;  3AGF A;  3C5A A;  3MBZ A;  3V5M A;  5EOE A;  4KZA A;  4NET A;  5E43 A;  3W4Q A;  2JCH A;  1AXB A;  2HP5 A;  3G4P A;  1ESI A;  3HUM A;  2I72 A;  3MFD A;  1OME A;  2WGV A;  2HP6 A;  2QMI A;  1RGZ A;  4B4X A;  1DJA A;  3IXD A;  1ES2 A;  1ONG A;  2PU4 A;  2Y2I A;  3OPH A;  4M3K A;  4S2K A;  5CTM A;  5FI6 A;  1PW1 A;  2Y59 A;  5GHZ A;  3IH8 A;  1K55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...