5F1GA

Crystal structure of a class c beta lactamase
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
361
structure length
351
Chain Sequence
HHPQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPATKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPPEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVRSNMNPRDINDKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIINAAHPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVAAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Crystal structure of a class C beta lactamase
rcsb
source organism Escherichia coli
total genus 114
structure length 351
sequence length 361
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5f1gA00
5FI6A 3C7UA 4M3KA 1XKZA 2BLSA 3UO9A 3NDGA 1BLPA 1IELA 1CI8A 1O7EA 4QHCA 5FQJA 1PYYA 4OPZA 1NYYA 3IF6C 1PI5A 1M40A 3MFDA 1DJCA 3E2LA 4OVDA 1ES2A 3NCKA 3A3FA 3DWZA 1K4FA 2HP6A 4GN2A 4OQGA 4R4SA 1XA7A 3HUMA 4RX3A 3TG9A 2WGIA 4MBFA 1FSYA 1MXOA 4E3KA 4L0LA 4S2KA 4QY6A 4RYEA 3SH9A 1K54C 4DXBA 1G68A 4S2JA 5AQAA 3ZNTA 4KQRA 1K55A 2Y4AA 5GHZA 3NY4A 1L2SA 2E8IA 1I5QA 5FQ9A 2CC1A 2HDSA 1GA9A 3B3XA 4U0XA 4FD8A 1K56A 3IWQA 3ZG9B 1YLWA 1YLPA 4HESA 4OPRA 1ES3A 1BLHA 3V39A 5JYPA 1ZG4A 5EUAA 3ISGA 5A90A 3N7WA 4NETA 1TDLA 4LCLA 4X56A 3VP0A 2OV5A 3ZDJA 4BJPA 2WZZA 2R9XA 1Z6FA 3QNCA 1H8YA 3DTMA 1FCMA 1Q2QA 2Y2QA 1LHYA 1LL9A 2OLVA 1W8YA 3A3EA 4KZ4A 2IWBA 4WM9A 4MLLA 2XGNA 3V50A 1Y54A 1FCOA 4KZ6A 1YM1A 2C5WB 2HDQA 4KG2A 1YLTA 4WEKA 1H8ZA 3ZG0A 2P9VB 4OPYA 4C6YA 5M19A 5DF8A 4R23A 3WS4A 4X55A 4E6XA 3BRMA 4IBXA 1GHIA 3EQVA 1M6KA 1W8QA 3ZG7B 5M18A 4P85A 3BFFA 3FKWA 3SH8A 2PU4A 2WGWA 2XQZA 3BM6A 3CZDA 4RX2A 5F82A 4WBGA 5FDHA 3OPPA 1K6RA 2OSUA 3G34A 2H0TA 3SS5A 2Y2PA 1W7FA 3OZHA 4ZJ1A 1VQQA 4B88A 2Q9MA 5JYOA 3HUNA 2WKIA 3V3SA 4KZ7A 5CXWA 1IYPA 3FYZA 3IF6B 3E2KA 2XEPA 4R1GA 3UY6A 3ZG8B 1TDGA 1LLBA 4S2PA 3NIAA 1QMFA 4KZAA 1GHMA 3ITBA 4DE2A 4E3IA 3QNBA 5GLDA 4NK3A 2XR0A 2Y2JA 4O7DA 5HW3A 1PIOA 1ESIA 1XP4A 3BFEA 2ZM2A 1ERMA 3C4OA 2ZQCA 2XF3A 4JXSA 4X6TA 4BLMA 1ZC2A 5EOEA 4HEFA 2ZQDA 5A93A 4EUZA 3C4PA 2HP5A 3HLEA 3Q7VB 3PBQA 3WS1A 4R3JA 2XD5A 2Y2KA 5FAPA 2ZC5B 1KVLA 4OONA 2C6WB 2XLNA 4LV1A 1E3UD 4OQHA 5EE8A 4MNRA 3PBOA 3PTEA 5EVIC 3UNWA 3WRTA 2ZMAA 4IEDA 2ZC4B 4OH0A 4OQ0A 3V3RA 4GKUA 1MY8A 5FSRA 1BTLA 3HLGA 4U0TA 4RA7A 4S2NA 5KZHA 3LEZA 2V20A 2ZQ8A 4P0MA 2XFTA 1RGYA 2EX9A 5FQMA 3DWKA 2JC7A 1SCWA 4OOLA 4YINA 3RXXA 1J9MA 4Q8IA 4ZJ2A 4ZBEA 4E3JA 3S22A 4UA6A 1SKFA 3VSLA 4GDBA 1FR1A 3PBNA 1JWPA 2UWXA 5A91A 3IHAA 4IVKA 4C3QA 3UN7A 5EVLA 1MBLA 4JF6A 3VOYA 4P6BA 3N6IA 1RCJA 3CMZA 4WZ5A 1MWTA 4N92A 4MEZA 5HARA 2HDUA 2FFYA 4WMCD 4ZTKA 4EBLA 1ZG6A 1WYCA 3MKEA 2WUQA 4EWFA 3WS2A 5FQKA 1BUEA 3OCLA 3RXWA 3HUOA 2X01A 5GL9A 3LO7A 4WZ4A 1S6RA 4WMCA 5FQQA 2Y2GA 5KSCA 5E2GA 3UPNA 3BYDA 4P87A 5E2HA 4KZ9A 2BG1A 1TEMA 3GSGA 4KZ5A 3OC2A 3D4FA 4GNUA 3VSKA 2Y91A 4OOMA 1CEGA 4R0QA 1KDSA 3PAEA 5F83A 5KSHA 3UDXA 3BLMA 5HAQA 2XH9A 1IYQA 1JWZA 4UA9A 4UHUA 4PM5A 5I94A 2ZC3B 3GV9A 4JXWA 1K57A 2WK0A 3UDIA 1YLZA 4QU3A 1HVBA 4QD4A 1FOFA 4JPMA 2GDNA 3MXSA 2A49A 3HLCA 1GHPA 2DRWA 4IVIA 4JBFA 1GCEA 4K0XA 4ZAMA 4Y0OA 3AGFA 4Y7PA 5EVIB 3A3DA 5TFQA 1YMXA 3VOZA 4GD6A 3IXHA 1KGEA 4S2IA 1L0DA 4X69A 2XDMA 4QY5A 1L0EA 3SH7A 3UDFA 5GHXA 5FI2A 3SOIA 5F1GA 2J7VA 1E25A 1NYMA 1XGJA 2ZD8A 1FR6A 2VGJA 3IHBA 5CEDA 1XA1A 2ZM0A 1CEFA 5FA7A 5FI7A 2IWDA 2J9OA 1XX2A 2Z2MB 3DW0A 3HREA 5DTSA 2G2WA 4OPQA 2Y2HA 3LY4A 4H8RA 5CHUA 5TGFA 4DRTA 3IXBA 5M1AA 1EI5A 4PPRA 3VFFA 3G32A 2Y2LA 1HD8A 4HBTA 3MZFA 4UA7A 3UE1A 4F94A 4RVAA 4B4XA 1XGIA 3TSGA 3PBTA 1NY0A 5EECA 4BL2A 3IF5A 3O88A 3C7VA 1ONHA 3HLWA 4JXGA 1WE4A 4WEJA 1ZKJA 3W4PA 1N9BA 1YLJA 1KGGA 2V1ZA 3GVBA 3N8LA 4DXCA 2EFXA 1ES4A 2PU2A 5F1FA 1AXBA 1K38A 1U60A 5CGWA 1CI9A 1MWSA 3OPRA 1JVJA 4R4RA 2ZM8A 1G6AA 4D2OA 1HTZA 1SDEA 3IH9A 3MBZA 3NDEA 3G4PA 2I72A 3W8KA 3HL9A 1I2WA 1QMEA 4BD1A 5GLAA 4MBKA 3PAGA 4ZDXA 1DJAA 2Y2IA 2ZQAA 3VFHA 4BL3A 5TR7A 3IT9A 5CTNA 1ALQA 1PWGA 5CRFA 4KG5A 4GDNA 4PMAA 2QMIA 2ZQ7A 5GHYA 1Q2PA 3S4XA 1JTDA 1PZPA 5FAQA 2OLUA 1MWUA 1MKIA 3MKFA 3P09A 1E3UA 2WZXA 4KQOA 3O86A 3TOIA 5HAIA 3I7JA 5EVID 3WS0A 1KE4A 4LV2A 4LV0A 4N1HA 2EX6A 4S2NC 3ZCZA 2WAFA 4KQQA 3G2ZA 2Q9NA 2RCXA 3IH8A 2HDRA 3IXGA 1LI9A 3LCEA 2EX8A 3GMWA 1BZAA 3BECA 5D3OA 1H5XA 4Y0UA 2JCHA 3HLFA 5DTTA 3Q82A 3HBRA 4JKTA 2QZ6A 2DNSA 4JF5A 1FCNA 4GD8A 1IKGA 5CHMA 3QHYA 3OPHA 2J9PA 1O07A 1NJ4A 3OPLA 1CK3A 5FATA 1BULA 4KZ8A 4WZ5C 2P9VA 5U47A 5EOOA 2WGWB 2JE5A 3N8SA 4LCMA 3P98A 4PM6A 2HP9A 4A5RA 4S2LA 3ZHHA 4E3LA 5HFOA 3NI9A 1KGFA 2XFSA 4MBHA 4LV3A 5FQIA 2Y2NA 3AGEA 5CERA 3O3VA 4N9KA 5CHJA 1IKIA 4KENB 4X53A 1PWDA 3W4QA 3WWXA 4UAAA 1I2SA 4Z9QA 1EWZA 3ZNYA 4E3NA 4DE3A 3UPPA 5AQ7A 3Q7ZA 4OLGA 5DF7A 3UPOA 3V5MA 4OOYA 5CGSA 2HPBA 1EROA 2QPNA 3IF6A 4OQIA 3ZFZA 1K55C 2ZC6B 4PM8A 1MPLA 2WADA 2XD1A 4WELA 4DDYA 3VP2A 1GA0A 2Y55A 4FH2A 3PBSA 1KE3A 1TVFA 1JTGA 3UE0A 1K57C 1L0FA 4PM7A 4FSFA 4OP5A 5FAOA 2A3UA 5E2FA 4LENA 1PW8A 4KG6A 1K6SA 5AQBA 1PW1A 3UE3A 1K54A 4DE0A 3M2JA 3Q7VA 5L2FA 3Q1FA 3M2KA 3M6HA 5HAPA 1K56D 4K91A 4E3MA 2EXBA 3MZDA 1KVMA 1VM1A 1OMEA 1YT4A 3VMAA 4DF6A 4B4ZA 1KE0A 1W79A 1E4DA 1LI0A 5CECA 2ZQ9A 4OP8A 4BD0A 1NZUA 2Z2LB 4E6WA 4E3OA 3OCNA 3CJMA 3VP1A 3BFGA 4ID4A 3BEBA 3IWOA 3O87A 1RGZA 2V2FF 3N8RA 1BLCA 2Y59A 1PWCA 5GLBA 2ZLYA 4FCFA 1YQSA 2EXAA 5CTMA 3VP4A 1DJBA 3GR2A 3A3JA 2PBYA 2FFFB 3PBRA 4CPKA 3HLDA 1NRFA 3GTCA 5GLCA 1L0GA 3HLBA 1YLYA 1SDNA 3IQAA 3GRJA 2EX2A 4HBUA 4WYYA 3G2YA 1MWRA 3BFCA 3MXRA 2H10A 3ZVTA 2Y2OA 4S2MA 1ES5A 3FKVA 1WYBA 5CGXA 4R3BA 1N4OA 3AGDA 1YMSA 1S0WA 2RL3A 2IWCA 3HVFA 3BLSA 2XK1A 3IWIA 4EQIA 1ESUA 1IEMA 4JF4A 4PM9A 1PI4A 1BSGA 2R9WA 1FSWA 3ZVWA 3ITAA 2P74A 1NZOA 1LL5A 3MZEA 5G18A 1ONGA 1IYSA 4DDSA 3WS5A 2DCFA 3S1YA 4Y0TA 4IBRA 3FWLA 5FASA 3SS4A 4EBNA 2WKHA 1DY6A 4JXVA 5E2EA 4C75A 3GQZA 2X02A 4X68A 3NBLA 3ZG5A 2H0YA 3G31A 3EQUA 1KDWA 4K0WA 4OKPA 1C3BA 2WKEA 4JLFA 4QB8A 5HL1A 3G35A 1XXMA 4QJGA 1W5DA 4N1XA 1BLSA 5A92A 2J8YA 4GB7A 5EPHA 3LY3A 4BQMA 4DKIA 2VGKA 3JYIA 4GZBA 4XUZA 5EVIA 3IXDA 1HZOA 3G30A 1K25A 2ZJ9A 3SS3A 1K4EA 1FQGA 5DF9A 4N9LA 5DTKA 5BOHA 2ZC7A 4YFMA 1BT5A 2G2UA 4KZ3A 5HX9A 5DVAA 2H5SA 3VP3A 4FH4A 4S2OA 1JWVA 1IYOA 4GOGA 3W4OA 4BENA 5J8XA 3CG5A 1ERQA 3C5AA 2JBFA 4OLDA 3M6BA 1NXYA 1PZOA 1RP5A 4EV4A 2EFUA 3Q81A 3ZGAB 4CJNA 3NC8A 4XXRA 3WRZA 5CEBA 2WGVA 1SHVA 3RJUA 4KZBA 2WYXA 4EBPA 4U3TA 4XUXA 3Q07A 3BFDA 1XPBA 5KMWA 3A3IA 3FV7A 2WAEA 2X71A 4ZJ3A 5IHVA 2Y2MA 5AQ9A 3N4IA 2B5RA 5E43A 4DE1A 3FZCA
chains in the Genus database with same CATH superfamily
3IS2A 1BLPA 1IELA 1CI8A 3IF6C 1M40A 1DJCA 4HI4A 1OTAA 2HP6A 3TG9A 3EGDC 1FSYA 4L0LA 4DXBA 4S2JA 2E8IA 2V0WA 2CC1A 4P6ZM 3B3XA 3TE8A 4U0XA 4CLCB 4FD8A 3ZG9B 1AWIA 1BLHA 5JYPA 1TDLA 3VP0A 3F1PB 3ZDJA 1SZVA 4R6LA 1X0OA 4BJPA 1Z6FA 3QNCA 1H8YA 1FCMA 1W8YA 3A3EA 2IWBA 3CPTB 1Y54A 1YM1A 4KG2A 2PR6A 2P9VB 5EM0A 2VGLM 3BRMA 1OTIA 3EQVA 3CI6A 2BTFP 2VEAA 2WGWA 3BM6A 3QP6A 1K6RA 2H0TA 4B93A 3SS5A 4ZJ1A 4F3LB 1G5UA 5CXWA 1IYPA 3UY6A 3IF6B 3E2KA 3ZG8B 1YKDA 1OT6A 1P97A 1QMFA 1GHMA 3FG8A 4YOFA 2Y2JA 4O7DA 1PIOA 4HOIA 4X6TA 4EUZA 3WS1A 3PBQA 4R3JA 2Y2KA 4IUKA 5FAPA 5HDSA 3LIEA 4OQHA 4LV1A 3EEAA 1UWPX 4CLCD 5CX7A 3NULA 4OQ0A 3V3RA 5FSRA 3OBFA 4U0TA 4RA7A 4S2NA 5KZHA 4I3JA 2V20A 4P0MA 2XFTA 1RGYA 3DWKA 1SCWA 3F1PA 4OOLA 4YINA 3RXXA 3LICA 3P01A 4E3JA 3S22A 4IVKA 4JF6A 1SKOB 1TD5A 3VOYA 3N6IA 3CMZA 4WZ5A 5HARA 4WMCD 1ZG6A 3F1NA 2XRNA 4EWFA 2JN7A 3E4QA 2VZWA 3HUOA 4R70A 3CITA 3LO7A 2X01A 4WMCA 5FQQA 5DJUA 2VV6A 4WF0A 4KZ5A 1MZUA 3FPVA 3S7QA 1T1AA 3PHYA 4UA9A 4EQ1A 3U4LP 3OLOA 3MXSA 2A49A 4K0XA 4ZJ2A 4JBFA 1GCEA 4WUJA 2Y79A 5DFXA 2E8JA 2JKFA 3SH7A 1PRQA 4YNRA 2XDMA 3UDFA 4GS9B 5FI2A 3KSIA 3A0VA 5CEDA 3DTEA 2J80A 2P7JA 4PHTA 3BY8A 3R4KA 5FI7A 1XX2A 4Q0JA 2I9VA 2D01A 4HJ3A 3UE1A 4F94A 4QWOA 1OT9A 1SKOA 1XJ6A 4BL2A 2W3EA 3GVBA 4DXCA 5AJGA 4NG2A 5F6AA 5F1FA 2PBDP 1MWSA 1JVJA 3IH9A 2I72A 1I2WA 1LSVA 4MBKA 4ZDXA 2ZQAA 4HH2A 1ALQA 5CRFA 2QMIA 2ZQ7A 1Q2PA 2OWHA 5FDSA 1JTDA 1PZPA 5FAQA 2OLUA 3MKFA 1E3UA 4KQOA 3O86A 3TOIA 3I7JA 3NOPC 1YAXA 3NECA 2EX6A 3ZCZA 5FEGA 3G2ZA 4LRYC 4JGPA 3IXGA 5AVFA 3LCEA 3GMWA 1BZAA 5IS1A 2JCHA 4RQ9A 1N9NA 1FCNA 4GD8A 5CHMA 4GS9A 3QHYA 5G4ZA 2J9PA 2PRFA 1TF1A 4EU0A 5FATA 4YWZA 4A5RA 3ZHHA 3NI9A 3AGEA 3O3VA 5CHJA 4ARZB 3UB9A 1PWDA 3WWXA 5TBMB 4Z9QA 2B02A 4DE3A 4E04A 5AQ7A 4OLGA 5DF7A 3V5MA 4OQIA 1K55C 3LIFA 4WELA 1S67L 3VP2A 3LGOA 5I5LA 3PBSA 3UE0A 1K57C 4OP5A 3IBJA 4LENA 4KG6A 1K6SA 1PW1A 1OTBA 2VLGA 5J7EA 2W3HA 5L2FA 3M2KA 4K91A 4MCWA 1KVMA 3VMAA 1YT4A 2Q0OA 5CECA 2ZQ9A 4Q0IA 4JGRA 3MSHA 4ETXA 3O87A 1BLCA 1S1ZA 5GLBA 1YQSA 2EXAA 4MMNA 4CLCE 4ME4A 5DKLA 4BWIA 4CPKA 1T1BA 1NLZA 5LBRA 1SDNA 3GRJA 4HBUA 2WKQA 2NUPC 1G6OA 2H10A 3JPUA 1H8MA 1WYBA 4R3BA 3SZTA 2O99A 1S0WA 4UQIS 2OAQ1 2EA9A 4NXGA 4H6JB 1BSGA 3ZVWA 3LR5A 2P74A 1CQAA 1G28A 5G18A 3RH8B 5KIZA 3V67A 3MQQA 2HGVA 4X68A 2X02A 3NBLA 2R78A 4K0WA 4QB8A 5DJTA 2W3FA 1BLSA 1CJFA 3IX3A 5HDCA 2K2NA 3KX0X 4BQMA 4DKIA 1HZOA 3B42A 4N9LA 2W1RA 4YFMA 1F9IA 2H5SA 3VP3A 1JWVA 1IYOA 5J8XA 3C5AA 4LRXC 1WA9A 4G3VA 4XXRA 1T1CA 3WRZA 4XUXA 5KMWA 1L3LA 2X71A 3OOVA 3IX8A 3FZCA 4NXFA 4I3IA 4M3KA 3S7NA 2BLSA 3NDGA 4OPZA 1NYYA 3LEQA 3E2LA 3O5YA 3DWZA 1P9RA 4ETZA 4EETB 2IA2A 2PDRA 4S2KA 3SH9A 1G68A 5AQAA 5C5KA 3ZNTA 3EOIA 4KQRA 4FTXA 1K55A 2Y4AA 5GHZA 1L2SA 1I5QA 1MC0A 2HDSA 3IWQA 3N7WA 4NETA 4LCLA 2OV5A 2R9XA 5HSQA 3H82B 1LL9A 4KZ4A 1S1YA 4WM9A 3F1OB 1FCOA 4WEKA 3LR0A 4R3AA 3B47A 5M19A 3UMDA 4IBXA 1M6KA 1YPRA 1W8QA 5M18A 3BFFA 3FKWA 4ESPA 3OPPA 3BQAA 3H7WB 2V0UA 2Y2PA 3LR4A 1VQQA 2Q9MA 3FYZA 1W63Q 4I5SA 3QNBA 2XR0A 4BBVA 2ZM2A 1S66L 1ZC2A 5EOEA 2ZQDA 4HP4A 3Q7VB 2HP5A 2JKRM 4MN6A 2XLNA 1OTEA 5EE8A 3UNWA 3KYEA 3WRTA 1XJ3A 5AVEA 1PFLA 3UE6A 4GKUA 1BTLA 3HLGA 3LUQA 2G7UA 3MFXA 2EX9A 2VX8A 1J9MA 4UA6A 3FPWA 3T4QA 4XT2A 4GDBA 3PBNA 3VSLA 2UWXA 3IHAA 4EESA 3F1OA 1RCJA 3HCYA 1MWTA 4JGQA 4MEZA 2HDUA 2FFYA 4EBLA 1XFNA 2P08A 3WS2A 3RXWA 3OCLA 4WZ4A 2Y2GA 5KSCA 5E2GA 3BYDA 1TEMA 3H7WA 3QP5A 3GSGA 3OC2A 3VSKA 5HWWA 4R0QA 3PAEA 5KSHA 5HAQA 1NWZA 3HJKA 2PHYA 4QD4A 3R7WA 2GDNA 3AGFA 3A0RA 2Z6DA 1KGEA 4QY5A 1L0EA 2JKTM 3SOIA 5F5YA 4GLQA 3IHBA 1E25A 3C30A 2L4RA 1CEFA 2IWDA 2J9OA 4PKYG 4DJ3A 1STZA 5TGFA 3T50A 1HLUP 3MMHA 5M1AA 1EI5A 4PPRA 2Y2LA 3MJQA 4NXEA 4UA7A 2JKTI 2AVXA 3LIAA 4B4XA 3PBTA 2L0WA 2XSSA 5EECA 1ONHA 4WEJA 1ZKJA 1K0KA 2PAVP 1YLJA 2V1BA 2V1ZA 3N8LA 1AXBA 3MS6A 3OPRA 1G6AA 1HTZA 3MBZA 3NDEA 3C2WA 3HL9A 2O9AA 4DMZA 5GLAA 3PAGA 3VFHA 2Y2IA 2W0NA 5TR7A 1LT0A 4PMAA 2WKPA 1D06A 4KUOA 3NJAA 1MKIA 1T19A 5HAIA 4CLCA 4LV0A 5HPFA 2PR5A 1YSQA 3ULFA 4KQQA 2HDRA 2VK3A 1LI9A 5D3OA 5DTTA 3HLFA 3HBRA 4JF5A 1IKGA 3CPTA 3OPHA 3LI8A 4X25A 2P9VA 5EOOA 4LCMA 3P98A 4E3LA 1KGFA 2XFSA 4MBHA 2XA7S 5HDDA 1N9LA 4N9KA 5TJJA 4X53A 4UAAA 3ZNYA 3UPPA 3DBAA 4R38A 4F3LA 1EROA 3IF6A 1FILA 4WN5A 2ZC6B 2WADA 2XD1A 5J3WA 2LB9A 4DDYA 5DKKA 3TW8A 4FH2A 1KE3A 4BBUA 3UE3A 2PD7A 1K56D 4CQHA 4O0PA 3MZDA 1OMEA 4B4ZA 1KE0A 1LI0A 2CMNA 4E6WA 4E3OA 3OCNA 3VP1A 2HJ9C 3L7HA 1RGZA 4FCFA 3A3JA 1J3WA 3PYPA 2GJ3A 2FFFB 3PBRA 1NRFA 3GTCA 3IQAA 5IT5A 3G6OA 1GSXA 3LFVA 3ZVTA 1ES5A 2UV0E 4Y17A 3FKVA 2GX5A 2RL3A 2IWCA 2KX6A 3BLSA 2XK1A 3IWIA 4JF4A 1CF0A 2R9WA 4GW9A 3K3DA 3ITAA 1YSPA 1NZOA 3LIBA 1LL5A 2VV7A 1ONGA 2L1MA 2DCFA 3S1YA 3FWLA 5FASA 2VA0A 4HH3A 3BJNA 1KDWA 5HL1A 3G35A 5HPIA 5A92A 3LY3A 5F69A 1DP8A 2VGKA 5HL6A 2PYPA 4MN7A 1BT5A 4LGWA 4KZ3A 3CG5A 4EV4A 2EFUA 3Q81A 1DRMA 4CJNA 3NC8A 4G3WA 3RJUA 2V8CA 2WYXA 3Q07A 3BFDA 4X1MA 3EWKA 4WLAA 5L8MA 4ZJ3A 5FEFA 5AQ9A 3N4IA 3S7OA 3ZQ5A 1OTDA 3KO6A 5FI6A 3C7UA 1XKZA 2W1TB 2PYRA 3UO9A 5FQJA 3T4OA 3K3CA 1PYYA 1F2KA 3MFDA 3CWFA 3A3FA 1K4FA 4FOFA 4GN2A 4OQGA 3PXPA 1XA7A 3HUMA 4RX3A 2WGIA 4MBFA 1MXOA 4QY6A 4RYEA 1K54C 1VB6A 2W3GA 3CAXA 3NY4A 5FQ9A 4PKYA 1YLWA 1YLPA 4HESA 3C8CA 3V39A 3ISGA 5A90A 3T12B 4X56A 4D60A 3HJIA 3QP4A 5HD5A 4AFIA 2Y2QA 2OLVA 3RTYA 3V50A 1LSXA 2C5WB 1YLTA 3T4JA 1H8ZA 3ZG0A 4JGOA 4OPYA 5DF8A 4R23A 3WS4A 4X55A 4E6XA 1GHIA 1LSWA 3ZG7B 3SH8A 2XQZA 5F82A 5EVEA 4ARZA 4B88A 5JYOA 2ZL1B 3HUNA 3V3SA 4KZ7A 5TBMA 5L07A 4S2PA 3UMEA 2B18A 3NIAA 2A24B 3BW6A 4KZAA 4EEPA 5HW3A 1XP4A 3BFEA 1TS8A 1NLYA 2ZQCA 2XF3A 4BLMA 4HEFA 1P9WA 4I39A 5A93A 3UPOA 3HLEA 2XD5A 2ZC5B 1KVLA 4OONA 3E0YA 2YKFA 4MNRA 3PBOA 3PTEA 1VETB 5EVIC 2ZMAA 4IEDA 1JNUA 2ZC4B 2PT7A 1MY8A 4P6ZS 3ICYA 2ZQ8A 5FQMA 2QKPA 1T18A 2VJWA 4ZBEA 4FUWA 1SKFA 1FR1A 1JWPA 3UN7A 5EVLA 1MBLA 4P6BA 4Q0HA 1XFQA 4ZTKA 3MKEA 2WUQA 2VGLS 5J4EA 3QP1A 1W63M 3GECA 1S6RA 4H6JA 4P87A 3NOUC 1DP6A 4UEYA 2ZL1A 2Y91A 1KDSA 3UDXA 2XH9A 1IYQA 4PM5A 2A24A 2ZC3B 3GV9A 1ZTUA 3GDIA 3UDIA 1K57A 1HVBA 2BASA 4JPMA 1GHPA 4ZAMA 1VEUB 2ZOIA 5EVIB 4X69A 3IXHA 4S2IA 3LYXA 5F1GA 2J7VA 1NYMA 2ZD8A 1XA1A 1FIKA 4GJ4A 2G2WA 4OPQA 3RFBA 5CHUA 3LY4A 4H8RA 1P0ZA 2V1AA 3G32A 4RVAA 3TSGA 3IS2B 2LB5A 2QJ7A 3IF5A 3O88A 3B33A 3E4PA 3W4PA 1KGGA 3SW1A 2VV8A 1ES4A 2PU2A 1U60A 5CGWA 1CI9A 1MKMA 1SDEA 3EGXC 3KSFA 3W8KA 2EWVA 1DJAA 3IT9A 5CTNA 3TRCA 1PWGA 4GDNA 5GHYA 3S4XA 2K7SA 1VHMA 2HJEA 2WZXA 5EVID 1KE4A 4EUVA 4MDZA 4S2NC 3CLOA 2RCXA 1VEUA 3H82A 1H5XA 4Y0UA 3Q82A 4JKTA 2QZ6A 2DNSA 3VOLA 1BYWA 3OPLA 3QP2A 4WZ5C 5U47A 2WGWB 2M7VA 1D1JA 4PM6A 2Y2NA 5CERA 2M7UA 2ZOHA 3D72A 2W3DA 3D3OA 3K2NA 4IHQA 2QHKA 1I2SA 1EWZA 5K5BA 1A0KA 1GSVA 4E3NA 4HQAA 3Q7ZA 4OOYA 5CGSA 2QPNA 4PM8A 5HD3A 2Y55A 1V9ZA 2FH5A 1TVFA 2J3WA 4PM7A 4FSFA 5FAOA 3QP8A 5E2FA 1PW8A 4HIAA 1EW0A 5AQBA 1ZHHB 3S7PA 4DE0A 3M2JA 3Q7VA 3Q1FA 5HAPA 2EXBA 1VM1A 2OOLA 1W79A 4BD0A 3BFGA 3BY9A 5L09A 4BBTA 2V2FF 2Y59A 1PWCA 1DJBA 3GR2A 4B9OA 2O9CA 4NKPA 4LLOB 2WKRA 3KYZA 3HLDA 1ODVA 5GLCA 1L0GA 2EX2A 4Y2FA 1MWRA 2H28A 1UWNX 3F1NB 2Y2OA 1D7EA 1H3QA 3AGDA 1YMSA 4PAUA 1F5MA 3HVFA 4EQIA 1IEMA 4PM9A 1PI4A 4IUHA 2JKGA 3MZEA 4LRZE 3KSHA 4DDSA 4Y0TA 4IBRA 3SS4A 2WKHA 3D9YA 5E2EA 4C75A 3ZG5A 3G31A 4OKPA 1C3BA 4JLFA 1XXMA 3DAVA 1W5DA 2J8YA 4GB7A 5EPHA 3JYIA 4XUZA 3BWLA 2ZJ9A 3SS3A 1K4EA 1FQGA 4O8GA 4Y3IA 5DTKA 2HZ5A 5FL3A 4EERA 2ZC7A 2G2UA 5DVAA 4FH4A 4S2OA 1IOUA 4GOGA 3W4OA 4BENA 4OLDA 1V9YA 3M6BA 1NXYA 2KLIA 2INWA 1SHVA 3EEHA 4KZBA 4EBPA 3A3IA 3W2ZA 1LL8A 5EFWA 5EM1A 5IHVA 2Y2MA 3A0SA 2B5RA 1NRJA 4DE1A 1OJ5A 4QHCA 1O7EA 1PI5A 1OPXA 3MF0A 4OVDA 1ES2A 3NCKA 4R4SA 2ZMVA 3MQOA 3KYQA 4E3KA 4HP9A 4EW7A 2PD8A 2DMWA 4L9EA 1GA9A 4I3AA 3FC7A 1K56A 4OPRA 1ES3A 5MC7A 1ZG4A 5EUAA 2WZZA 4HJ6A 3T4KA 3DTMA 4BMWA 4K08A 1Q2QA 1LHYA 1GSWA 2ZMFA 4MLLA 2XGNA 4KZ6A 2HDQA 1Y28A 1TS6A 3E98A 4DJ2A 4C6YA 1Y4OA 4L9GA 4NXBA 4P85A 2PU4A 3CZDA 4RX2A 4WBGA 2HF6A 5FDHA 2OSUA 3G34A 3P7NA 4HJ4A 1XJ4A 1W7FA 3OZHA 2WKIA 2XEPA 4R1GA 1TDGA 1LLBA 4L9FA 4DE2A 4E3IA 3ITBA 5GLDA 4NK3A 1KOUA 3UB7A 2B95A 1ESIA 1ERMA 3C4OA 4JXSA 3C4PA 1XJ2A 2C6WB 2Y8HA 2QWSA 1E3UD 3H9WA 2OWJA 3CUEC 4OH0A 2Z6CA 3LEZA 2JC7A 3MQ0A 2GNXA 2MJ6A 4Q8IA 2D02A 3VV4A 3LR3A 2J3TC 4C3QA 5A91A 4HNBA 3U2AA 2P04A 4N92A 1WYCA 3DTKA 4Y15A 5FQKA 2O9BA 1BUEA 5GL9A 2EWWA 3T4LA 3UPNA 5E2HA 4EEUA 4KZ9A 2BG1A 2NUTC 3E4OA 3UB6A 3MR0A 4GNUA 3D4FA 3JVVA 3JVUA 5A8BA 4OOMA 1CEGA 3BQ8A 5F83A 3BLMA 1JWZA 4UHUA 5I94A 4JXWA 2WK0A 1YLZA 4QU3A 4I38A 1FOFA 1H0MA 3HLCA 4IVIA 2DRWA 4Y0OA 3IX4A 4Y7PA 5TFQA 3A3DA 3VOZA 1YMXA 4GD6A 1Z09A 1L0DA 4Y5FA 5GHXA 1XGJA 1FR6A 2VGJA 4DN0A 3IBRA 2ZM0A 5FA7A 2Z2MB 2XA7M 3DW0A 3HREA 5DTSA 1IFQA 2Y2HA 3VE4A 4DRTA 3IXBA 3VFFA 5DFYA 1HD8A 4HBTA 3T4SA 3MXQA 3MZFA 3VE3A 2OAP1 1XGIA 4II7A 1NY0A 4LFUA 2YKHA 4ZRRA 3C7VA 3DTIA 3HLWA 2W1TA 4JXGA 4M4XA 1WE4A 3T1XA 1N9BA 4MN5A 2EFXA 4QPRA 4X1LA 2A2LA 1K38A 4LPZA 4R4RA 2ZM8A 4D2OA 3G4PA 1QMEA 4BD1A 4KUKA 4BL3A 3ZYTA 4KG5A 5IU1A 1UGUA 4GCZA 1MWUA 3P09A 4GHIB 2HV1A 2ZBBA 3WS0A 2W27A 4LV2A 5EV0A 3PR6A 4N1HA 2WAFA 1ACFA 2Q9NA 3IH8A 5HZHA 1DP9A 2EX8A 3BECA 3CHWP 3CUEA 1TS0A 2FZ0A 1O07A 1NJ4A 1CK3A 1BULA 2JHEA 4KZ8A 2QYBA 2JE5A 2J3TD 3N8SA 2HP9A 4IJGA 4S2LA 5HFOA 5FQIA 4LV3A 1IKIA 3KSGA 4KENB 3W4QA 3C38A 3UB5P 3NHQA 2HPBA 3ZFZA 2K31A 1MPLA 1GA0A 3T1SA 1JTGA 3UB8A 1L0FA 2V9AA 2A3UA 1K54A 1F98A 1S4RA 1N9OA 3M6HA 4E3MA 4DF6A 1E4DA 1VETA 4OP8A 1NZUA 2GZAA 2ACGA 2Z2LB 2QJ5A 3CJMA 4ID4A 3BEBA 3IWOA 4GHIA 4KQDA 3N8RA 2ZLYA 4HY8A 5CTMA 3VP4A 2KDKA 4XT2B 2PBYA 3L9KA 3LI9A 3HLBA 1YLYA 4WYYA 4Z1WA 3G2YA 3MXRA 3BFCA 5G4YA 4S2MA 4WL9A 5CGXA 1N4OA 4NEED 4G3KA 2O0YA 2KOIA 5HWTA 1ESUA 5L10A 1S4SA 1FSWA 2V8FA 1IYSA 3NOTC 1OJGA 3WS5A 3T1RA 4EBNA 1DY6A 1TS7A 4JXVA 3GQZA 2H0YA 3EQUA 4EXOA 3R7WB 2WKEA 4Y13A 4QJGA 4CLCC 5F68A 4N1XA 4HHDA 2XROA 4GZBA 5EVIA 3IXDA 3G30A 1K25A 3TJZC 5DF9A 5BOHA 5HWVA 2M1CA 1PNEA 5HX9A 1ERQA 2JBFA 4UQIM 1PZOA 1RP5A 3ZGAB 5CEBA 2WGVA 4O01A 3LIDA 4U3TA 2JKRI 1XPBA 3FV7A 2VKSA 2WAEA 5E43A 3T1QB 3T4TA
chains in the Genus database with same CATH topology
5FI6A 3C7UA 4M3KA 1XKZA 2BLSA 3UO9A 3NDGA 1BLPA 1IELA 1CI8A 1O7EA 4QHCA 5FQJA 1PYYA 4OPZA 1NYYA 3IF6C 1PI5A 1M40A 3MFDA 1DJCA 3E2LA 4OVDA 1ES2A 3NCKA 3A3FA 3DWZA 1K4FA 2HP6A 4GN2A 4OQGA 4R4SA 1XA7A 3HUMA 4RX3A 3TG9A 2WGIA 4MBFA 1FSYA 1MXOA 4E3KA 4L0LA 4S2KA 4QY6A 4RYEA 3SH9A 1K54C 4DXBA 1G68A 4S2JA 5AQAA 3ZNTA 4KQRA 1K55A 2Y4AA 5GHZA 3NY4A 1L2SA 2E8IA 1I5QA 5FQ9A 2CC1A 2HDSA 1GA9A 3B3XA 4U0XA 4FD8A 1K56A 3IWQA 3ZG9B 1YLWA 1YLPA 4HESA 4OPRA 1ES3A 1BLHA 3V39A 5JYPA 1ZG4A 5EUAA 3ISGA 5A90A 3N7WA 4NETA 1TDLA 4LCLA 4X56A 3VP0A 2OV5A 3ZDJA 4BJPA 2WZZA 2R9XA 1Z6FA 3QNCA 1H8YA 3DTMA 1FCMA 1Q2QA 2Y2QA 1LHYA 1LL9A 2OLVA 1W8YA 3A3EA 4KZ4A 2IWBA 4WM9A 4MLLA 2XGNA 3V50A 1Y54A 1FCOA 4KZ6A 1YM1A 2C5WB 2HDQA 4KG2A 1YLTA 4WEKA 1H8ZA 3ZG0A 2P9VB 4OPYA 4C6YA 5M19A 5DF8A 4R23A 3WS4A 4X55A 4E6XA 3BRMA 4IBXA 1GHIA 3EQVA 1M6KA 1W8QA 3ZG7B 5M18A 4P85A 3BFFA 3FKWA 3SH8A 2PU4A 2WGWA 2XQZA 3BM6A 3CZDA 4RX2A 5F82A 4WBGA 5FDHA 3OPPA 1K6RA 2OSUA 3G34A 2H0TA 3SS5A 2Y2PA 1W7FA 3OZHA 4ZJ1A 1VQQA 4B88A 2Q9MA 5JYOA 3HUNA 2WKIA 3V3SA 4KZ7A 5CXWA 1IYPA 3FYZA 3IF6B 3E2KA 2XEPA 4R1GA 3UY6A 3ZG8B 1TDGA 1LLBA 4S2PA 3NIAA 1QMFA 4KZAA 1GHMA 3ITBA 4DE2A 4E3IA 3QNBA 5GLDA 4NK3A 2XR0A 2Y2JA 4O7DA 5HW3A 1PIOA 1ESIA 1XP4A 3BFEA 2ZM2A 1ERMA 3C4OA 2ZQCA 2XF3A 4JXSA 4X6TA 4BLMA 1ZC2A 5EOEA 4HEFA 2ZQDA 5A93A 4EUZA 3C4PA 2HP5A 3HLEA 3Q7VB 3PBQA 3WS1A 4R3JA 2XD5A 2Y2KA 5FAPA 2ZC5B 1KVLA 4OONA 2C6WB 2XLNA 4LV1A 1E3UD 4OQHA 5EE8A 4MNRA 3PBOA 3PTEA 5EVIC 3UNWA 3WRTA 2ZMAA 4IEDA 2ZC4B 4OH0A 4OQ0A 3V3RA 4GKUA 1MY8A 5FSRA 1BTLA 3HLGA 4U0TA 4RA7A 4S2NA 5KZHA 3LEZA 2V20A 2ZQ8A 4P0MA 2XFTA 1RGYA 2EX9A 5FQMA 3DWKA 2JC7A 1SCWA 4OOLA 4YINA 3RXXA 1J9MA 4Q8IA 4ZJ2A 4ZBEA 4E3JA 3S22A 4UA6A 1SKFA 3VSLA 4GDBA 1FR1A 3PBNA 1JWPA 2UWXA 5A91A 3IHAA 4IVKA 4C3QA 3UN7A 5EVLA 1MBLA 4JF6A 3VOYA 4P6BA 3N6IA 1RCJA 3CMZA 4WZ5A 1MWTA 4N92A 4MEZA 5HARA 2HDUA 2FFYA 4WMCD 4ZTKA 4EBLA 1ZG6A 1WYCA 3MKEA 2WUQA 4EWFA 3WS2A 5FQKA 1BUEA 3OCLA 3RXWA 3HUOA 2X01A 5GL9A 3LO7A 4WZ4A 1S6RA 4WMCA 5FQQA 2Y2GA 5KSCA 5E2GA 3UPNA 3BYDA 4P87A 5E2HA 4KZ9A 2BG1A 1TEMA 3GSGA 4KZ5A 3OC2A 3D4FA 4GNUA 3VSKA 2Y91A 4OOMA 1CEGA 4R0QA 1KDSA 3PAEA 5F83A 5KSHA 3UDXA 3BLMA 5HAQA 2XH9A 1IYQA 1JWZA 4UA9A 4UHUA 4PM5A 5I94A 2ZC3B 3GV9A 4JXWA 1K57A 2WK0A 3UDIA 1YLZA 4QU3A 1HVBA 4QD4A 1FOFA 4JPMA 2GDNA 3MXSA 2A49A 3HLCA 1GHPA 2DRWA 4IVIA 4JBFA 1GCEA 4K0XA 4ZAMA 4Y0OA 3AGFA 4Y7PA 5EVIB 3A3DA 5TFQA 1YMXA 3VOZA 4GD6A 3IXHA 1KGEA 4S2IA 1L0DA 4X69A 2XDMA 4QY5A 1L0EA 3SH7A 3UDFA 5GHXA 5FI2A 3SOIA 5F1GA 2J7VA 1E25A 1NYMA 1XGJA 2ZD8A 1FR6A 2VGJA 3IHBA 5CEDA 1XA1A 2ZM0A 1CEFA 5FA7A 5FI7A 2IWDA 2J9OA 1XX2A 2Z2MB 3DW0A 3HREA 5DTSA 2G2WA 4OPQA 2Y2HA 3LY4A 4H8RA 5CHUA 5TGFA 4DRTA 3IXBA 5M1AA 1EI5A 4PPRA 3VFFA 3G32A 2Y2LA 1HD8A 4HBTA 3MZFA 4UA7A 3UE1A 4F94A 4RVAA 4B4XA 1XGIA 3TSGA 3PBTA 1NY0A 5EECA 4BL2A 3IF5A 3O88A 3C7VA 1ONHA 3HLWA 4JXGA 1WE4A 4WEJA 1ZKJA 3W4PA 1N9BA 1YLJA 1KGGA 2V1ZA 3GVBA 3N8LA 4DXCA 2EFXA 1ES4A 2PU2A 5F1FA 1AXBA 1K38A 1U60A 5CGWA 1CI9A 1MWSA 3OPRA 1JVJA 4R4RA 2ZM8A 1G6AA 4D2OA 1HTZA 1SDEA 3IH9A 3MBZA 3NDEA 3G4PA 2I72A 3W8KA 3HL9A 1I2WA 1QMEA 4BD1A 5GLAA 4MBKA 3PAGA 4ZDXA 1DJAA 2Y2IA 2ZQAA 3VFHA 4BL3A 5TR7A 3IT9A 5CTNA 1ALQA 1PWGA 5CRFA 4KG5A 4GDNA 4PMAA 2QMIA 2ZQ7A 5GHYA 1Q2PA 3S4XA 1JTDA 1PZPA 5FAQA 2OLUA 1MWUA 1MKIA 3MKFA 3P09A 1E3UA 2WZXA 4KQOA 3O86A 3TOIA 5HAIA 3I7JA 5EVID 3WS0A 1KE4A 4LV2A 4LV0A 4N1HA 2EX6A 4S2NC 3ZCZA 2WAFA 4KQQA 3G2ZA 2Q9NA 2RCXA 3IH8A 2HDRA 3IXGA 1LI9A 3LCEA 2EX8A 3GMWA 1BZAA 3BECA 5D3OA 1H5XA 4Y0UA 2JCHA 3HLFA 5DTTA 3Q82A 3HBRA 4JKTA 2QZ6A 2DNSA 4JF5A 1FCNA 4GD8A 1IKGA 5CHMA 3QHYA 3OPHA 2J9PA 1O07A 1NJ4A 3OPLA 1CK3A 5FATA 1BULA 4KZ8A 4WZ5C 2P9VA 5U47A 5EOOA 2WGWB 2JE5A 3N8SA 4LCMA 3P98A 4PM6A 2HP9A 4A5RA 4S2LA 3ZHHA 4E3LA 5HFOA 3NI9A 1KGFA 2XFSA 4MBHA 4LV3A 5FQIA 2Y2NA 3AGEA 5CERA 3O3VA 4N9KA 5CHJA 1IKIA 4KENB 4X53A 1PWDA 3W4QA 3WWXA 4UAAA 1I2SA 4Z9QA 1EWZA 3ZNYA 4E3NA 4DE3A 3UPPA 5AQ7A 3Q7ZA 4OLGA 5DF7A 3UPOA 3V5MA 4OOYA 5CGSA 2HPBA 1EROA 2QPNA 3IF6A 4OQIA 3ZFZA 1K55C 2ZC6B 4PM8A 1MPLA 2WADA 2XD1A 4WELA 4DDYA 3VP2A 1GA0A 2Y55A 4FH2A 3PBSA 1KE3A 1TVFA 1JTGA 3UE0A 1K57C 1L0FA 4PM7A 4FSFA 4OP5A 5FAOA 2A3UA 5E2FA 4LENA 1PW8A 4KG6A 1K6SA 5AQBA 1PW1A 3UE3A 1K54A 4DE0A 3M2JA 3Q7VA 5L2FA 3Q1FA 3M2KA 3M6HA 5HAPA 1K56D 4K91A 4E3MA 2EXBA 3MZDA 1KVMA 1VM1A 1OMEA 1YT4A 3VMAA 4DF6A 4B4ZA 1KE0A 1W79A 1E4DA 1LI0A 5CECA 2ZQ9A 4OP8A 4BD0A 1NZUA 2Z2LB 4E6WA 4E3OA 3OCNA 3CJMA 3VP1A 3BFGA 4ID4A 3BEBA 3IWOA 3O87A 1RGZA 2V2FF 3N8RA 1BLCA 2Y59A 1PWCA 5GLBA 2ZLYA 4FCFA 1YQSA 2EXAA 5CTMA 3VP4A 1DJBA 3GR2A 3A3JA 2PBYA 2FFFB 3PBRA 4CPKA 3HLDA 1NRFA 3GTCA 5GLCA 1L0GA 3HLBA 1YLYA 1SDNA 3IQAA 3GRJA 2EX2A 4HBUA 4WYYA 3G2YA 1MWRA 3BFCA 3MXRA 2H10A 3ZVTA 2Y2OA 4S2MA 1ES5A 3FKVA 1WYBA 5CGXA 4R3BA 1N4OA 3AGDA 1YMSA 1S0WA 2RL3A 2IWCA 3HVFA 3BLSA 2XK1A 3IWIA 4EQIA 1ESUA 1IEMA 4JF4A 4PM9A 1PI4A 1BSGA 2R9WA 1FSWA 3ZVWA 3ITAA 2P74A 1NZOA 1LL5A 3MZEA 5G18A 1ONGA 1IYSA 4DDSA 3WS5A 2DCFA 3S1YA 4Y0TA 4IBRA 3FWLA 5FASA 3SS4A 4EBNA 2WKHA 1DY6A 4JXVA 5E2EA 4C75A 3GQZA 2X02A 4X68A 3NBLA 3ZG5A 2H0YA 3G31A 3EQUA 1KDWA 4K0WA 4OKPA 1C3BA 2WKEA 4JLFA 4QB8A 5HL1A 3G35A 1XXMA 4QJGA 1W5DA 4N1XA 1BLSA 5A92A 2J8YA 4GB7A 5EPHA 3LY3A 4BQMA 4DKIA 2VGKA 3JYIA 4GZBA 4XUZA 5EVIA 3IXDA 1HZOA 3G30A 1K25A 2ZJ9A 3SS3A 1K4EA 1FQGA 5DF9A 4N9LA 5DTKA 5BOHA 2ZC7A 4YFMA 1BT5A 2G2UA 4KZ3A 5HX9A 5DVAA 2H5SA 3VP3A 4FH4A 4S2OA 1JWVA 1IYOA 4GOGA 3W4OA 4BENA 5J8XA 3CG5A 1ERQA 3C5AA 2JBFA 4OLDA 3M6BA 1NXYA 1PZOA 1RP5A 4EV4A 2EFUA 3Q81A 3ZGAB 4CJNA 3NC8A 4XXRA 3WRZA 5CEBA 2WGVA 1SHVA 3RJUA 4KZBA 2WYXA 4EBPA 4U3TA 4XUXA 3Q07A 3BFDA 1XPBA 5KMWA 3A3IA 3FV7A 2WAEA 2X71A 4ZJ3A 5IHVA 2Y2MA 5AQ9A 3N4IA 2B5RA 5E43A 4DE1A 3FZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FI6 A;  3C7U A;  4M3K A;  1XKZ A;  2BLS A;  3UO9 A;  3NDG A;  1BLP A;  1IEL A;  1CI8 A;  1O7E A;  4QHC A;  5FQJ A;  1PYY A;  4OPZ A;  1NYY A;  3IF6 C;  1PI5 A;  1M40 A;  3MFD A;  1DJC A;  3E2L A;  4OVD A;  1ES2 A;  3NCK A;  3A3F A;  3DWZ A;  1K4F A;  2HP6 A;  4GN2 A;  4OQG A;  4R4S A;  1XA7 A;  3HUM A;  4RX3 A;  3TG9 A;  2WGI A;  4MBF A;  1FSY A;  1MXO A;  4E3K A;  4L0L A;  4S2K A;  4QY6 A;  4RYE A;  3SH9 A;  1K54 C;  4DXB A;  1G68 A;  4S2J A;  5AQA A;  3ZNT A;  4KQR A;  1K55 A;  2Y4A A;  5GHZ A;  3NY4 A;  1L2S A;  2E8I A;  1I5Q A;  5FQ9 A;  2CC1 A;  2HDS A;  1GA9 A;  3B3X A;  4U0X A;  4FD8 A;  1K56 A;  3IWQ A;  3ZG9 B;  1YLW A;  1YLP A;  4HES A;  4OPR A;  1ES3 A;  1BLH A;  3V39 A;  5JYP A;  1ZG4 A;  5EUA A;  3ISG A;  5A90 A;  3N7W A;  4NET A;  1TDL A;  4LCL A;  4X56 A;  3VP0 A;  2OV5 A;  3ZDJ A;  4BJP A;  2WZZ A;  2R9X A;  1Z6F A;  3QNC A;  1H8Y A;  3DTM A;  1FCM A;  1Q2Q A;  2Y2Q A;  1LHY A;  1LL9 A;  2OLV A;  1W8Y A;  3A3E A;  4KZ4 A;  2IWB A;  4WM9 A;  4MLL A;  2XGN A;  3V50 A;  1Y54 A;  1FCO A;  4KZ6 A;  1YM1 A;  2C5W B;  2HDQ A;  4KG2 A;  1YLT A;  4WEK A;  1H8Z A;  3ZG0 A;  2P9V B;  4OPY A;  4C6Y A;  5M19 A;  5DF8 A;  4R23 A;  3WS4 A;  4X55 A;  4E6X A;  3BRM A;  4IBX A;  1GHI A;  3EQV A;  1M6K A;  1W8Q A;  3ZG7 B;  5M18 A;  4P85 A;  3BFF A;  3FKW A;  3SH8 A;  2PU4 A;  2WGW A;  2XQZ A;  3BM6 A;  3CZD A;  4RX2 A;  5F82 A;  4WBG A;  5FDH A;  3OPP A;  1K6R A;  2OSU A;  3G34 A;  2H0T A;  3SS5 A;  2Y2P A;  1W7F A;  3OZH A;  4ZJ1 A;  1VQQ A;  4B88 A;  2Q9M A;  5JYO A;  3HUN A;  2WKI A;  3V3S A;  4KZ7 A;  5CXW A;  1IYP A;  3FYZ A;  3IF6 B;  3E2K A;  2XEP A;  4R1G A;  3UY6 A;  3ZG8 B;  1TDG A;  1LLB A;  4S2P A;  3NIA A;  1QMF A;  4KZA A;  1GHM A;  3ITB A;  4DE2 A;  4E3I A;  3QNB A;  5GLD A;  4NK3 A;  2XR0 A;  2Y2J A;  4O7D A;  5HW3 A;  1PIO A;  1ESI A;  1XP4 A;  3BFE A;  2ZM2 A;  1ERM A;  3C4O A;  2ZQC A;  2XF3 A;  4JXS A;  4X6T A;  4BLM A;  1ZC2 A;  5EOE A;  4HEF A;  2ZQD A;  5A93 A;  4EUZ A;  3C4P A;  2HP5 A;  3HLE A;  3Q7V B;  3PBQ A;  3WS1 A;  4R3J A;  2XD5 A;  2Y2K A;  5FAP A;  2ZC5 B;  1KVL A;  4OON A;  2C6W B;  2XLN A;  4LV1 A;  1E3U D;  4OQH A;  5EE8 A;  4MNR A;  3PBO A;  3PTE A;  5EVI C;  3UNW A;  3WRT A;  2ZMA A;  4IED A;  2ZC4 B;  4OH0 A;  4OQ0 A;  3V3R A;  4GKU A;  1MY8 A;  5FSR A;  1BTL A;  3HLG A;  4U0T A;  4RA7 A;  4S2N A;  5KZH A;  3LEZ A;  2V20 A;  2ZQ8 A;  4P0M A;  2XFT A;  1RGY A;  2EX9 A;  5FQM A;  3DWK A;  2JC7 A;  1SCW A;  4OOL A;  4YIN A;  3RXX A;  1J9M A;  4Q8I A;  4ZJ2 A;  4ZBE A;  4E3J A;  3S22 A;  4UA6 A;  1SKF A;  3VSL A;  4GDB A;  1FR1 A;  3PBN A;  1JWP A;  2UWX A;  5A91 A;  3IHA A;  4IVK A;  4C3Q A;  3UN7 A;  5EVL A;  1MBL A;  4JF6 A;  3VOY A;  4P6B A;  3N6I A;  1RCJ A;  3CMZ A;  4WZ5 A;  1MWT A;  4N92 A;  4MEZ A;  5HAR A;  2HDU A;  2FFY A;  4WMC D;  4ZTK A;  4EBL A;  1ZG6 A;  1WYC A;  3MKE A;  2WUQ A;  4EWF A;  3WS2 A;  5FQK A;  1BUE A;  3OCL A;  3RXW A;  3HUO A;  2X01 A;  5GL9 A;  3LO7 A;  4WZ4 A;  1S6R A;  4WMC A;  5FQQ A;  2Y2G A;  5KSC A;  5E2G A;  3UPN A;  3BYD A;  4P87 A;  5E2H A;  4KZ9 A;  2BG1 A;  1TEM A;  3GSG A;  4KZ5 A;  3OC2 A;  3D4F A;  4GNU A;  3VSK A;  2Y91 A;  4OOM A;  1CEG A;  4R0Q A;  1KDS A;  3PAE A;  5F83 A;  5KSH A;  3UDX A;  3BLM A;  5HAQ A;  2XH9 A;  1IYQ A;  1JWZ A;  4UA9 A;  4UHU A;  4PM5 A;  5I94 A;  2ZC3 B;  3GV9 A;  4JXW A;  1K57 A;  2WK0 A;  3UDI A;  1YLZ A;  4QU3 A;  1HVB A;  4QD4 A;  1FOF A;  4JPM A;  2GDN A;  3MXS A;  2A49 A;  3HLC A;  1GHP A;  2DRW A;  4IVI A;  4JBF A;  1GCE A;  4K0X A;  4ZAM A;  4Y0O A;  3AGF A;  4Y7P A;  5EVI B;  3A3D A;  5TFQ A;  1YMX A;  3VOZ A;  4GD6 A;  3IXH A;  1KGE A;  4S2I A;  1L0D A;  4X69 A;  2XDM A;  4QY5 A;  1L0E A;  3SH7 A;  3UDF A;  5GHX A;  5FI2 A;  3SOI A;  5F1G A;  2J7V A;  1E25 A;  1NYM A;  1XGJ A;  2ZD8 A;  1FR6 A;  2VGJ A;  3IHB A;  5CED A;  1XA1 A;  2ZM0 A;  1CEF A;  5FA7 A;  5FI7 A;  2IWD A;  2J9O A;  1XX2 A;  2Z2M B;  3DW0 A;  3HRE A;  5DTS A;  2G2W A;  4OPQ A;  2Y2H A;  3LY4 A;  4H8R A;  5CHU A;  5TGF A;  4DRT A;  3IXB A;  5M1A A;  1EI5 A;  4PPR A;  3VFF A;  3G32 A;  2Y2L A;  1HD8 A;  4HBT A;  3MZF A;  4UA7 A;  3UE1 A;  4F94 A;  4RVA A;  4B4X A;  1XGI A;  3TSG A;  3PBT A;  1NY0 A;  5EEC A;  4BL2 A;  3IF5 A;  3O88 A;  3C7V A;  1ONH A;  3HLW A;  4JXG A;  1WE4 A;  4WEJ A;  1ZKJ A;  3W4P A;  1N9B A;  1YLJ A;  1KGG A;  2V1Z A;  3GVB A;  3N8L A;  4DXC A;  2EFX A;  1ES4 A;  2PU2 A;  5F1F A;  1AXB A;  1K38 A;  1U60 A;  5CGW A;  1CI9 A;  1MWS A;  3OPR A;  1JVJ A;  4R4R A;  2ZM8 A;  1G6A A;  4D2O A;  1HTZ A;  1SDE A;  3IH9 A;  3MBZ A;  3NDE A;  3G4P A;  2I72 A;  3W8K A;  3HL9 A;  1I2W A;  1QME A;  4BD1 A;  5GLA A;  4MBK A;  3PAG A;  4ZDX A;  1DJA A;  2Y2I A;  2ZQA A;  3VFH A;  4BL3 A;  5TR7 A;  3IT9 A;  5CTN A;  1ALQ A;  1PWG A;  5CRF A;  4KG5 A;  4GDN A;  4PMA A;  2QMI A;  2ZQ7 A;  5GHY A;  1Q2P A;  3S4X A;  1JTD A;  1PZP A;  5FAQ A;  2OLU A;  1MWU A;  1MKI A;  3MKF A;  3P09 A;  1E3U A;  2WZX A;  4KQO A;  3O86 A;  3TOI A;  5HAI A;  3I7J A;  5EVI D;  3WS0 A;  1KE4 A;  4LV2 A;  4LV0 A;  4N1H A;  2EX6 A;  4S2N C;  3ZCZ A;  2WAF A;  4KQQ A;  3G2Z A;  2Q9N A;  2RCX A;  3IH8 A;  2HDR A;  3IXG A;  1LI9 A;  3LCE A;  2EX8 A;  3GMW A;  1BZA A;  3BEC A;  5D3O A;  1H5X A;  4Y0U A;  2JCH A;  3HLF A;  5DTT A;  3Q82 A;  3HBR A;  4JKT A;  2QZ6 A;  2DNS A;  4JF5 A;  1FCN A;  4GD8 A;  1IKG A;  5CHM A;  3QHY A;  3OPH A;  2J9P A;  1O07 A;  1NJ4 A;  3OPL A;  1CK3 A;  5FAT A;  1BUL A;  4KZ8 A;  4WZ5 C;  2P9V A;  5U47 A;  5EOO A;  2WGW B;  2JE5 A;  3N8S A;  4LCM A;  3P98 A;  4PM6 A;  2HP9 A;  4A5R A;  4S2L A;  3ZHH A;  4E3L A;  5HFO A;  3NI9 A;  1KGF A;  2XFS A;  4MBH A;  4LV3 A;  5FQI A;  2Y2N A;  3AGE A;  5CER A;  3O3V A;  4N9K A;  5CHJ A;  1IKI A;  4KEN B;  4X53 A;  1PWD A;  3W4Q A;  3WWX A;  4UAA A;  1I2S A;  4Z9Q A;  1EWZ A;  3ZNY A;  4E3N A;  4DE3 A;  3UPP A;  5AQ7 A;  3Q7Z A;  4OLG A;  5DF7 A;  3UPO A;  3V5M A;  4OOY A;  5CGS A;  2HPB A;  1ERO A;  2QPN A;  3IF6 A;  4OQI A;  3ZFZ A;  1K55 C;  2ZC6 B;  4PM8 A;  1MPL A;  2WAD A;  2XD1 A;  4WEL A;  4DDY A;  3VP2 A;  1GA0 A;  2Y55 A;  4FH2 A;  3PBS A;  1KE3 A;  1TVF A;  1JTG A;  3UE0 A;  1K57 C;  1L0F A;  4PM7 A;  4FSF A;  4OP5 A;  5FAO A;  2A3U A;  5E2F A;  4LEN A;  1PW8 A;  4KG6 A;  1K6S A;  5AQB A;  1PW1 A;  3UE3 A;  1K54 A;  4DE0 A;  3M2J A;  3Q7V A;  5L2F A;  3Q1F A;  3M2K A;  3M6H A;  5HAP A;  1K56 D;  4K91 A;  4E3M A;  2EXB A;  3MZD A;  1KVM A;  1VM1 A;  1OME A;  1YT4 A;  3VMA A;  4DF6 A;  4B4Z A;  1KE0 A;  1W79 A;  1E4D A;  1LI0 A;  5CEC A;  2ZQ9 A;  4OP8 A;  4BD0 A;  1NZU A;  2Z2L B;  4E6W A;  4E3O A;  3OCN A;  3CJM A;  3VP1 A;  3BFG A;  4ID4 A;  3BEB A;  3IWO A;  3O87 A;  1RGZ A;  2V2F F;  3N8R A;  1BLC A;  2Y59 A;  1PWC A;  5GLB A;  2ZLY A;  4FCF A;  1YQS A;  2EXA A;  5CTM A;  3VP4 A;  1DJB A;  3GR2 A;  3A3J A;  2PBY A;  2FFF B;  3PBR A;  4CPK A;  3HLD A;  1NRF A;  3GTC A;  5GLC A;  1L0G A;  3HLB A;  1YLY A;  1SDN A;  3IQA A;  3GRJ A;  2EX2 A;  4HBU A;  4WYY A;  3G2Y A;  1MWR A;  3BFC A;  3MXR A;  2H10 A;  3ZVT A;  2Y2O A;  4S2M A;  1ES5 A;  3FKV A;  1WYB A;  5CGX A;  4R3B A;  1N4O A;  3AGD A;  1YMS A;  1S0W A;  2RL3 A;  2IWC A;  3HVF A;  3BLS A;  2XK1 A;  3IWI A;  4EQI A;  1ESU A;  1IEM A;  4JF4 A;  4PM9 A;  1PI4 A;  1BSG A;  2R9W A;  1FSW A;  3ZVW A;  3ITA A;  2P74 A;  1NZO A;  1LL5 A;  3MZE A;  5G18 A;  1ONG A;  1IYS A;  4DDS A;  3WS5 A;  2DCF A;  3S1Y A;  4Y0T A;  4IBR A;  3FWL A;  5FAS A;  3SS4 A;  4EBN A;  2WKH A;  1DY6 A;  4JXV A;  5E2E A;  4C75 A;  3GQZ A;  2X02 A;  4X68 A;  3NBL A;  3ZG5 A;  2H0Y A;  3G31 A;  3EQU A;  1KDW A;  4K0W A;  4OKP A;  1C3B A;  2WKE A;  4JLF A;  4QB8 A;  5HL1 A;  3G35 A;  1XXM A;  4QJG A;  1W5D A;  4N1X A;  1BLS A;  5A92 A;  2J8Y A;  4GB7 A;  5EPH A;  3LY3 A;  4BQM A;  4DKI A;  2VGK A;  3JYI A;  4GZB A;  4XUZ A;  5EVI A;  3IXD A;  1HZO A;  3G30 A;  1K25 A;  2ZJ9 A;  3SS3 A;  1K4E A;  1FQG A;  5DF9 A;  4N9L A;  5DTK A;  5BOH A;  2ZC7 A;  4YFM A;  1BT5 A;  2G2U A;  4KZ3 A;  5HX9 A;  5DVA A;  2H5S A;  3VP3 A;  4FH4 A;  4S2O A;  1JWV A;  1IYO A;  4GOG A;  3W4O A;  4BEN A;  5J8X A;  3CG5 A;  1ERQ A;  3C5A A;  2JBF A;  4OLD A;  3M6B A;  1NXY A;  1PZO A;  1RP5 A;  4EV4 A;  2EFU A;  3Q81 A;  3ZGA B;  4CJN A;  3NC8 A;  4XXR A;  3WRZ A;  5CEB A;  2WGV A;  1SHV A;  3RJU A;  4KZB A;  2WYX A;  4EBP A;  4U3T A;  4XUX A;  3Q07 A;  3BFD A;  1XPB A;  5KMW A;  3A3I A;  3FV7 A;  2WAE A;  2X71 A;  4ZJ3 A;  5IHV A;  2Y2M A;  5AQ9 A;  3N4I A;  2B5R A;  5E43 A;  4DE1 A;  3FZC A; 
#chains in the Genus database with same CATH topology
 3IS2 A;  1BLP A;  1IEL A;  1CI8 A;  3IF6 C;  1M40 A;  1DJC A;  4HI4 A;  1OTA A;  2HP6 A;  3TG9 A;  3EGD C;  1FSY A;  4L0L A;  4DXB A;  4S2J A;  2E8I A;  2V0W A;  2CC1 A;  4P6Z M;  3B3X A;  3TE8 A;  4U0X A;  4CLC B;  4FD8 A;  3ZG9 B;  1AWI A;  1BLH A;  5JYP A;  1TDL A;  3VP0 A;  3F1P B;  3ZDJ A;  1SZV A;  4R6L A;  1X0O A;  4BJP A;  1Z6F A;  3QNC A;  1H8Y A;  1FCM A;  1W8Y A;  3A3E A;  2IWB A;  3CPT B;  1Y54 A;  1YM1 A;  4KG2 A;  2PR6 A;  2P9V B;  5EM0 A;  2VGL M;  3BRM A;  1OTI A;  3EQV A;  3CI6 A;  2BTF P;  2VEA A;  2WGW A;  3BM6 A;  3QP6 A;  1K6R A;  2H0T A;  4B93 A;  3SS5 A;  4ZJ1 A;  4F3L B;  1G5U A;  5CXW A;  1IYP A;  3UY6 A;  3IF6 B;  3E2K A;  3ZG8 B;  1YKD A;  1OT6 A;  1P97 A;  1QMF A;  1GHM A;  3FG8 A;  4YOF A;  2Y2J A;  4O7D A;  1PIO A;  4HOI A;  4X6T A;  4EUZ A;  3WS1 A;  3PBQ A;  4R3J A;  2Y2K A;  4IUK A;  5FAP A;  5HDS A;  3LIE A;  4OQH A;  4LV1 A;  3EEA A;  1UWP X;  4CLC D;  5CX7 A;  3NUL A;  4OQ0 A;  3V3R A;  5FSR A;  3OBF A;  4U0T A;  4RA7 A;  4S2N A;  5KZH A;  4I3J A;  2V20 A;  4P0M A;  2XFT A;  1RGY A;  3DWK A;  1SCW A;  3F1P A;  4OOL A;  4YIN A;  3RXX A;  3LIC A;  3P01 A;  4E3J A;  3S22 A;  4IVK A;  4JF6 A;  1SKO B;  1TD5 A;  3VOY A;  3N6I A;  3CMZ A;  4WZ5 A;  5HAR A;  4WMC D;  1ZG6 A;  3F1N A;  2XRN A;  4EWF A;  2JN7 A;  3E4Q A;  2VZW A;  3HUO A;  4R70 A;  3CIT A;  3LO7 A;  2X01 A;  4WMC A;  5FQQ A;  5DJU A;  2VV6 A;  4WF0 A;  4KZ5 A;  1MZU A;  3FPV A;  3S7Q A;  1T1A A;  3PHY A;  4UA9 A;  4EQ1 A;  3U4L P;  3OLO A;  3MXS A;  2A49 A;  4K0X A;  4ZJ2 A;  4JBF A;  1GCE A;  4WUJ A;  2Y79 A;  5DFX A;  2E8J A;  2JKF A;  3SH7 A;  1PRQ A;  4YNR A;  2XDM A;  3UDF A;  4GS9 B;  5FI2 A;  3KSI A;  3A0V A;  5CED A;  3DTE A;  2J80 A;  2P7J A;  4PHT A;  3BY8 A;  3R4K A;  5FI7 A;  1XX2 A;  4Q0J A;  2I9V A;  2D01 A;  4HJ3 A;  3UE1 A;  4F94 A;  4QWO A;  1OT9 A;  1SKO A;  1XJ6 A;  4BL2 A;  2W3E A;  3GVB A;  4DXC A;  5AJG A;  4NG2 A;  5F6A A;  5F1F A;  2PBD P;  1MWS A;  1JVJ A;  3IH9 A;  2I72 A;  1I2W A;  1LSV A;  4MBK A;  4ZDX A;  2ZQA A;  4HH2 A;  1ALQ A;  5CRF A;  2QMI A;  2ZQ7 A;  1Q2P A;  2OWH A;  5FDS A;  1JTD A;  1PZP A;  5FAQ A;  2OLU A;  3MKF A;  1E3U A;  4KQO A;  3O86 A;  3TOI A;  3I7J A;  3NOP C;  1YAX A;  3NEC A;  2EX6 A;  3ZCZ A;  5FEG A;  3G2Z A;  4LRY C;  4JGP A;  3IXG A;  5AVF A;  3LCE A;  3GMW A;  1BZA A;  5IS1 A;  2JCH A;  4RQ9 A;  1N9N A;  1FCN A;  4GD8 A;  5CHM A;  4GS9 A;  3QHY A;  5G4Z A;  2J9P A;  2PRF A;  1TF1 A;  4EU0 A;  5FAT A;  4YWZ A;  4A5R A;  3ZHH A;  3NI9 A;  3AGE A;  3O3V A;  5CHJ A;  4ARZ B;  3UB9 A;  1PWD A;  3WWX A;  5TBM B;  4Z9Q A;  2B02 A;  4DE3 A;  4E04 A;  5AQ7 A;  4OLG A;  5DF7 A;  3V5M A;  4OQI A;  1K55 C;  3LIF A;  4WEL A;  1S67 L;  3VP2 A;  3LGO A;  5I5L A;  3PBS A;  3UE0 A;  1K57 C;  4OP5 A;  3IBJ A;  4LEN A;  4KG6 A;  1K6S A;  1PW1 A;  1OTB A;  2VLG A;  5J7E A;  2W3H A;  5L2F A;  3M2K A;  4K91 A;  4MCW A;  1KVM A;  3VMA A;  1YT4 A;  2Q0O A;  5CEC A;  2ZQ9 A;  4Q0I A;  4JGR A;  3MSH A;  4ETX A;  3O87 A;  1BLC A;  1S1Z A;  5GLB A;  1YQS A;  2EXA A;  4MMN A;  4CLC E;  4ME4 A;  5DKL A;  4BWI A;  4CPK A;  1T1B A;  1NLZ A;  5LBR A;  1SDN A;  3GRJ A;  4HBU A;  2WKQ A;  2NUP C;  1G6O A;  2H10 A;  3JPU A;  1H8M A;  1WYB A;  4R3B A;  3SZT A;  2O99 A;  1S0W A;  4UQI S;  2OAQ 1;  2EA9 A;  4NXG A;  4H6J B;  1BSG A;  3ZVW A;  3LR5 A;  2P74 A;  1CQA A;  1G28 A;  5G18 A;  3RH8 B;  5KIZ A;  3V67 A;  3MQQ A;  2HGV A;  4X68 A;  2X02 A;  3NBL A;  2R78 A;  4K0W A;  4QB8 A;  5DJT A;  2W3F A;  1BLS A;  1CJF A;  3IX3 A;  5HDC A;  2K2N A;  3KX0 X;  4BQM A;  4DKI A;  1HZO A;  3B42 A;  4N9L A;  2W1R A;  4YFM A;  1F9I A;  2H5S A;  3VP3 A;  1JWV A;  1IYO A;  5J8X A;  3C5A A;  4LRX C;  1WA9 A;  4G3V A;  4XXR A;  1T1C A;  3WRZ A;  4XUX A;  5KMW A;  1L3L A;  2X71 A;  3OOV A;  3IX8 A;  3FZC A;  4NXF A;  4I3I A;  4M3K A;  3S7N A;  2BLS A;  3NDG A;  4OPZ A;  1NYY A;  3LEQ A;  3E2L A;  3O5Y A;  3DWZ A;  1P9R A;  4ETZ A;  4EET B;  2IA2 A;  2PDR A;  4S2K A;  3SH9 A;  1G68 A;  5AQA A;  5C5K A;  3ZNT A;  3EOI A;  4KQR A;  4FTX A;  1K55 A;  2Y4A A;  5GHZ A;  1L2S A;  1I5Q A;  1MC0 A;  2HDS A;  3IWQ A;  3N7W A;  4NET A;  4LCL A;  2OV5 A;  2R9X A;  5HSQ A;  3H82 B;  1LL9 A;  4KZ4 A;  1S1Y A;  4WM9 A;  3F1O B;  1FCO A;  4WEK A;  3LR0 A;  4R3A A;  3B47 A;  5M19 A;  3UMD A;  4IBX A;  1M6K A;  1YPR A;  1W8Q A;  5M18 A;  3BFF A;  3FKW A;  4ESP A;  3OPP A;  3BQA A;  3H7W B;  2V0U A;  2Y2P A;  3LR4 A;  1VQQ A;  2Q9M A;  3FYZ A;  1W63 Q;  4I5S A;  3QNB A;  2XR0 A;  4BBV A;  2ZM2 A;  1S66 L;  1ZC2 A;  5EOE A;  2ZQD A;  4HP4 A;  3Q7V B;  2HP5 A;  2JKR M;  4MN6 A;  2XLN A;  1OTE A;  5EE8 A;  3UNW A;  3KYE A;  3WRT A;  1XJ3 A;  5AVE A;  1PFL A;  3UE6 A;  4GKU A;  1BTL A;  3HLG A;  3LUQ A;  2G7U A;  3MFX A;  2EX9 A;  2VX8 A;  1J9M A;  4UA6 A;  3FPW A;  3T4Q A;  4XT2 A;  4GDB A;  3PBN A;  3VSL A;  2UWX A;  3IHA A;  4EES A;  3F1O A;  1RCJ A;  3HCY A;  1MWT A;  4JGQ A;  4MEZ A;  2HDU A;  2FFY A;  4EBL A;  1XFN A;  2P08 A;  3WS2 A;  3RXW A;  3OCL A;  4WZ4 A;  2Y2G A;  5KSC A;  5E2G A;  3BYD A;  1TEM A;  3H7W A;  3QP5 A;  3GSG A;  3OC2 A;  3VSK A;  5HWW A;  4R0Q A;  3PAE A;  5KSH A;  5HAQ A;  1NWZ A;  3HJK A;  2PHY A;  4QD4 A;  3R7W A;  2GDN A;  3AGF A;  3A0R A;  2Z6D A;  1KGE A;  4QY5 A;  1L0E A;  2JKT M;  3SOI A;  5F5Y A;  4GLQ A;  3IHB A;  1E25 A;  3C30 A;  2L4R A;  1CEF A;  2IWD A;  2J9O A;  4PKY G;  4DJ3 A;  1STZ A;  5TGF A;  3T50 A;  1HLU P;  3MMH A;  5M1A A;  1EI5 A;  4PPR A;  2Y2L A;  3MJQ A;  4NXE A;  4UA7 A;  2JKT I;  2AVX A;  3LIA A;  4B4X A;  3PBT A;  2L0W A;  2XSS A;  5EEC A;  1ONH A;  4WEJ A;  1ZKJ A;  1K0K A;  2PAV P;  1YLJ A;  2V1B A;  2V1Z A;  3N8L A;  1AXB A;  3MS6 A;  3OPR A;  1G6A A;  1HTZ A;  3MBZ A;  3NDE A;  3C2W A;  3HL9 A;  2O9A A;  4DMZ A;  5GLA A;  3PAG A;  3VFH A;  2Y2I A;  2W0N A;  5TR7 A;  1LT0 A;  4PMA A;  2WKP A;  1D06 A;  4KUO A;  3NJA A;  1MKI A;  1T19 A;  5HAI A;  4CLC A;  4LV0 A;  5HPF A;  2PR5 A;  1YSQ A;  3ULF A;  4KQQ A;  2HDR A;  2VK3 A;  1LI9 A;  5D3O A;  5DTT A;  3HLF A;  3HBR A;  4JF5 A;  1IKG A;  3CPT A;  3OPH A;  3LI8 A;  4X25 A;  2P9V A;  5EOO A;  4LCM A;  3P98 A;  4E3L A;  1KGF A;  2XFS A;  4MBH A;  2XA7 S;  5HDD A;  1N9L A;  4N9K A;  5TJJ A;  4X53 A;  4UAA A;  3ZNY A;  3UPP A;  3DBA A;  4R38 A;  4F3L A;  1ERO A;  3IF6 A;  1FIL A;  4WN5 A;  2ZC6 B;  2WAD A;  2XD1 A;  5J3W A;  2LB9 A;  4DDY A;  5DKK A;  3TW8 A;  4FH2 A;  1KE3 A;  4BBU A;  3UE3 A;  2PD7 A;  1K56 D;  4CQH A;  4O0P A;  3MZD A;  1OME A;  4B4Z A;  1KE0 A;  1LI0 A;  2CMN A;  4E6W A;  4E3O A;  3OCN A;  3VP1 A;  2HJ9 C;  3L7H A;  1RGZ A;  4FCF A;  3A3J A;  1J3W A;  3PYP A;  2GJ3 A;  2FFF B;  3PBR A;  1NRF A;  3GTC A;  3IQA A;  5IT5 A;  3G6O A;  1GSX A;  3LFV A;  3ZVT A;  1ES5 A;  2UV0 E;  4Y17 A;  3FKV A;  2GX5 A;  2RL3 A;  2IWC A;  2KX6 A;  3BLS A;  2XK1 A;  3IWI A;  4JF4 A;  1CF0 A;  2R9W A;  4GW9 A;  3K3D A;  3ITA A;  1YSP A;  1NZO A;  3LIB A;  1LL5 A;  2VV7 A;  1ONG A;  2L1M A;  2DCF A;  3S1Y A;  3FWL A;  5FAS A;  2VA0 A;  4HH3 A;  3BJN A;  1KDW A;  5HL1 A;  3G35 A;  5HPI A;  5A92 A;  3LY3 A;  5F69 A;  1DP8 A;  2VGK A;  5HL6 A;  2PYP A;  4MN7 A;  1BT5 A;  4LGW A;  4KZ3 A;  3CG5 A;  4EV4 A;  2EFU A;  3Q81 A;  1DRM A;  4CJN A;  3NC8 A;  4G3W A;  3RJU A;  2V8C A;  2WYX A;  3Q07 A;  3BFD A;  4X1M A;  3EWK A;  4WLA A;  5L8M A;  4ZJ3 A;  5FEF A;  5AQ9 A;  3N4I A;  3S7O A;  3ZQ5 A;  1OTD A;  3KO6 A;  5FI6 A;  3C7U A;  1XKZ A;  2W1T B;  2PYR A;  3UO9 A;  5FQJ A;  3T4O A;  3K3C A;  1PYY A;  1F2K A;  3MFD A;  3CWF A;  3A3F A;  1K4F A;  4FOF A;  4GN2 A;  4OQG A;  3PXP A;  1XA7 A;  3HUM A;  4RX3 A;  2WGI A;  4MBF A;  1MXO A;  4QY6 A;  4RYE A;  1K54 C;  1VB6 A;  2W3G A;  3CAX A;  3NY4 A;  5FQ9 A;  4PKY A;  1YLW A;  1YLP A;  4HES A;  3C8C A;  3V39 A;  3ISG A;  5A90 A;  3T12 B;  4X56 A;  4D60 A;  3HJI A;  3QP4 A;  5HD5 A;  4AFI A;  2Y2Q A;  2OLV A;  3RTY A;  3V50 A;  1LSX A;  2C5W B;  1YLT A;  3T4J A;  1H8Z A;  3ZG0 A;  4JGO A;  4OPY A;  5DF8 A;  4R23 A;  3WS4 A;  4X55 A;  4E6X A;  1GHI A;  1LSW A;  3ZG7 B;  3SH8 A;  2XQZ A;  5F82 A;  5EVE A;  4ARZ A;  4B88 A;  5JYO A;  2ZL1 B;  3HUN A;  3V3S A;  4KZ7 A;  5TBM A;  5L07 A;  4S2P A;  3UME A;  2B18 A;  3NIA A;  2A24 B;  3BW6 A;  4KZA A;  4EEP A;  5HW3 A;  1XP4 A;  3BFE A;  1TS8 A;  1NLY A;  2ZQC A;  2XF3 A;  4BLM A;  4HEF A;  1P9W A;  4I39 A;  5A93 A;  3UPO A;  3HLE A;  2XD5 A;  2ZC5 B;  1KVL A;  4OON A;  3E0Y A;  2YKF A;  4MNR A;  3PBO A;  3PTE A;  1VET B;  5EVI C;  2ZMA A;  4IED A;  1JNU A;  2ZC4 B;  2PT7 A;  1MY8 A;  4P6Z S;  3ICY A;  2ZQ8 A;  5FQM A;  2QKP A;  1T18 A;  2VJW A;  4ZBE A;  4FUW A;  1SKF A;  1FR1 A;  1JWP A;  3UN7 A;  5EVL A;  1MBL A;  4P6B A;  4Q0H A;  1XFQ A;  4ZTK A;  3MKE A;  2WUQ A;  2VGL S;  5J4E A;  3QP1 A;  1W63 M;  3GEC A;  1S6R A;  4H6J A;  4P87 A;  3NOU C;  1DP6 A;  4UEY A;  2ZL1 A;  2Y91 A;  1KDS A;  3UDX A;  2XH9 A;  1IYQ A;  4PM5 A;  2A24 A;  2ZC3 B;  3GV9 A;  1ZTU A;  3GDI A;  3UDI A;  1K57 A;  1HVB A;  2BAS A;  4JPM A;  1GHP A;  4ZAM A;  1VEU B;  2ZOI A;  5EVI B;  4X69 A;  3IXH A;  4S2I A;  3LYX A;  5F1G A;  2J7V A;  1NYM A;  2ZD8 A;  1XA1 A;  1FIK A;  4GJ4 A;  2G2W A;  4OPQ A;  3RFB A;  5CHU A;  3LY4 A;  4H8R A;  1P0Z A;  2V1A A;  3G32 A;  4RVA A;  3TSG A;  3IS2 B;  2LB5 A;  2QJ7 A;  3IF5 A;  3O88 A;  3B33 A;  3E4P A;  3W4P A;  1KGG A;  3SW1 A;  2VV8 A;  1ES4 A;  2PU2 A;  1U60 A;  5CGW A;  1CI9 A;  1MKM A;  1SDE A;  3EGX C;  3KSF A;  3W8K A;  2EWV A;  1DJA A;  3IT9 A;  5CTN A;  3TRC A;  1PWG A;  4GDN A;  5GHY A;  3S4X A;  2K7S A;  1VHM A;  2HJE A;  2WZX A;  5EVI D;  1KE4 A;  4EUV A;  4MDZ A;  4S2N C;  3CLO A;  2RCX A;  1VEU A;  3H82 A;  1H5X A;  4Y0U A;  3Q82 A;  4JKT A;  2QZ6 A;  2DNS A;  3VOL A;  1BYW A;  3OPL A;  3QP2 A;  4WZ5 C;  5U47 A;  2WGW B;  2M7V A;  1D1J A;  4PM6 A;  2Y2N A;  5CER A;  2M7U A;  2ZOH A;  3D72 A;  2W3D A;  3D3O A;  3K2N A;  4IHQ A;  2QHK A;  1I2S A;  1EWZ A;  5K5B A;  1A0K A;  1GSV A;  4E3N A;  4HQA A;  3Q7Z A;  4OOY A;  5CGS A;  2QPN A;  4PM8 A;  5HD3 A;  2Y55 A;  1V9Z A;  2FH5 A;  1TVF A;  2J3W A;  4PM7 A;  4FSF A;  5FAO A;  3QP8 A;  5E2F A;  1PW8 A;  4HIA A;  1EW0 A;  5AQB A;  1ZHH B;  3S7P A;  4DE0 A;  3M2J A;  3Q7V A;  3Q1F A;  5HAP A;  2EXB A;  1VM1 A;  2OOL A;  1W79 A;  4BD0 A;  3BFG A;  3BY9 A;  5L09 A;  4BBT A;  2V2F F;  2Y59 A;  1PWC A;  1DJB A;  3GR2 A;  4B9O A;  2O9C A;  4NKP A;  4LLO B;  2WKR A;  3KYZ A;  3HLD A;  1ODV A;  5GLC A;  1L0G A;  2EX2 A;  4Y2F A;  1MWR A;  2H28 A;  1UWN X;  3F1N B;  2Y2O A;  1D7E A;  1H3Q A;  3AGD A;  1YMS A;  4PAU A;  1F5M A;  3HVF A;  4EQI A;  1IEM A;  4PM9 A;  1PI4 A;  4IUH A;  2JKG A;  3MZE A;  4LRZ E;  3KSH A;  4DDS A;  4Y0T A;  4IBR A;  3SS4 A;  2WKH A;  3D9Y A;  5E2E A;  4C75 A;  3ZG5 A;  3G31 A;  4OKP A;  1C3B A;  4JLF A;  1XXM A;  3DAV A;  1W5D A;  2J8Y A;  4GB7 A;  5EPH A;  3JYI A;  4XUZ A;  3BWL A;  2ZJ9 A;  3SS3 A;  1K4E A;  1FQG A;  4O8G A;  4Y3I A;  5DTK A;  2HZ5 A;  5FL3 A;  4EER A;  2ZC7 A;  2G2U A;  5DVA A;  4FH4 A;  4S2O A;  1IOU A;  4GOG A;  3W4O A;  4BEN A;  4OLD A;  1V9Y A;  3M6B A;  1NXY A;  2KLI A;  2INW A;  1SHV A;  3EEH A;  4KZB A;  4EBP A;  3A3I A;  3W2Z A;  1LL8 A;  5EFW A;  5EM1 A;  5IHV A;  2Y2M A;  3A0S A;  2B5R A;  1NRJ A;  4DE1 A;  1OJ5 A;  4QHC A;  1O7E A;  1PI5 A;  1OPX A;  3MF0 A;  4OVD A;  1ES2 A;  3NCK A;  4R4S A;  2ZMV A;  3MQO A;  3KYQ A;  4E3K A;  4HP9 A;  4EW7 A;  2PD8 A;  2DMW A;  4L9E A;  1GA9 A;  4I3A A;  3FC7 A;  1K56 A;  4OPR A;  1ES3 A;  5MC7 A;  1ZG4 A;  5EUA A;  2WZZ A;  4HJ6 A;  3T4K A;  3DTM A;  4BMW A;  4K08 A;  1Q2Q A;  1LHY A;  1GSW A;  2ZMF A;  4MLL A;  2XGN A;  4KZ6 A;  2HDQ A;  1Y28 A;  1TS6 A;  3E98 A;  4DJ2 A;  4C6Y A;  1Y4O A;  4L9G A;  4NXB A;  4P85 A;  2PU4 A;  3CZD A;  4RX2 A;  4WBG A;  2HF6 A;  5FDH A;  2OSU A;  3G34 A;  3P7N A;  4HJ4 A;  1XJ4 A;  1W7F A;  3OZH A;  2WKI A;  2XEP A;  4R1G A;  1TDG A;  1LLB A;  4L9F A;  4DE2 A;  4E3I A;  3ITB A;  5GLD A;  4NK3 A;  1KOU A;  3UB7 A;  2B95 A;  1ESI A;  1ERM A;  3C4O A;  4JXS A;  3C4P A;  1XJ2 A;  2C6W B;  2Y8H A;  2QWS A;  1E3U D;  3H9W A;  2OWJ A;  3CUE C;  4OH0 A;  2Z6C A;  3LEZ A;  2JC7 A;  3MQ0 A;  2GNX A;  2MJ6 A;  4Q8I A;  2D02 A;  3VV4 A;  3LR3 A;  2J3T C;  4C3Q A;  5A91 A;  4HNB A;  3U2A A;  2P04 A;  4N92 A;  1WYC A;  3DTK A;  4Y15 A;  5FQK A;  2O9B A;  1BUE A;  5GL9 A;  2EWW A;  3T4L A;  3UPN A;  5E2H A;  4EEU A;  4KZ9 A;  2BG1 A;  2NUT C;  3E4O A;  3UB6 A;  3MR0 A;  4GNU A;  3D4F A;  3JVV A;  3JVU A;  5A8B A;  4OOM A;  1CEG A;  3BQ8 A;  5F83 A;  3BLM A;  1JWZ A;  4UHU A;  5I94 A;  4JXW A;  2WK0 A;  1YLZ A;  4QU3 A;  4I38 A;  1FOF A;  1H0M A;  3HLC A;  4IVI A;  2DRW A;  4Y0O A;  3IX4 A;  4Y7P A;  5TFQ A;  3A3D A;  3VOZ A;  1YMX A;  4GD6 A;  1Z09 A;  1L0D A;  4Y5F A;  5GHX A;  1XGJ A;  1FR6 A;  2VGJ A;  4DN0 A;  3IBR A;  2ZM0 A;  5FA7 A;  2Z2M B;  2XA7 M;  3DW0 A;  3HRE A;  5DTS A;  1IFQ A;  2Y2H A;  3VE4 A;  4DRT A;  3IXB A;  3VFF A;  5DFY A;  1HD8 A;  4HBT A;  3T4S A;  3MXQ A;  3MZF A;  3VE3 A;  2OAP 1;  1XGI A;  4II7 A;  1NY0 A;  4LFU A;  2YKH A;  4ZRR A;  3C7V A;  3DTI A;  3HLW A;  2W1T A;  4JXG A;  4M4X A;  1WE4 A;  3T1X A;  1N9B A;  4MN5 A;  2EFX A;  4QPR A;  4X1L A;  2A2L A;  1K38 A;  4LPZ A;  4R4R A;  2ZM8 A;  4D2O A;  3G4P A;  1QME A;  4BD1 A;  4KUK A;  4BL3 A;  3ZYT A;  4KG5 A;  5IU1 A;  1UGU A;  4GCZ A;  1MWU A;  3P09 A;  4GHI B;  2HV1 A;  2ZBB A;  3WS0 A;  2W27 A;  4LV2 A;  5EV0 A;  3PR6 A;  4N1H A;  2WAF A;  1ACF A;  2Q9N A;  3IH8 A;  5HZH A;  1DP9 A;  2EX8 A;  3BEC A;  3CHW P;  3CUE A;  1TS0 A;  2FZ0 A;  1O07 A;  1NJ4 A;  1CK3 A;  1BUL A;  2JHE A;  4KZ8 A;  2QYB A;  2JE5 A;  2J3T D;  3N8S A;  2HP9 A;  4IJG A;  4S2L A;  5HFO A;  5FQI A;  4LV3 A;  1IKI A;  3KSG A;  4KEN B;  3W4Q A;  3C38 A;  3UB5 P;  3NHQ A;  2HPB A;  3ZFZ A;  2K31 A;  1MPL A;  1GA0 A;  3T1S A;  1JTG A;  3UB8 A;  1L0F A;  2V9A A;  2A3U A;  1K54 A;  1F98 A;  1S4R A;  1N9O A;  3M6H A;  4E3M A;  4DF6 A;  1E4D A;  1VET A;  4OP8 A;  1NZU A;  2GZA A;  2ACG A;  2Z2L B;  2QJ5 A;  3CJM A;  4ID4 A;  3BEB A;  3IWO A;  4GHI A;  4KQD A;  3N8R A;  2ZLY A;  4HY8 A;  5CTM A;  3VP4 A;  2KDK A;  4XT2 B;  2PBY A;  3L9K A;  3LI9 A;  3HLB A;  1YLY A;  4WYY A;  4Z1W A;  3G2Y A;  3MXR A;  3BFC A;  5G4Y A;  4S2M A;  4WL9 A;  5CGX A;  1N4O A;  4NEE D;  4G3K A;  2O0Y A;  2KOI A;  5HWT A;  1ESU A;  5L10 A;  1S4S A;  1FSW A;  2V8F A;  1IYS A;  3NOT C;  1OJG A;  3WS5 A;  3T1R A;  4EBN A;  1DY6 A;  1TS7 A;  4JXV A;  3GQZ A;  2H0Y A;  3EQU A;  4EXO A;  3R7W B;  2WKE A;  4Y13 A;  4QJG A;  4CLC C;  5F68 A;  4N1X A;  4HHD A;  2XRO A;  4GZB A;  5EVI A;  3IXD A;  3G30 A;  1K25 A;  3TJZ C;  5DF9 A;  5BOH A;  5HWV A;  2M1C A;  1PNE A;  5HX9 A;  1ERQ A;  2JBF A;  4UQI M;  1PZO A;  1RP5 A;  3ZGA B;  5CEB A;  2WGV A;  4O01 A;  3LID A;  4U3T A;  2JKR I;  1XPB A;  3FV7 A;  2VKS A;  2WAE A;  5E43 A;  3T1Q B;  3T4T A; 
#chains in the Genus database with same CATH homology
 5FI6 A;  3C7U A;  4M3K A;  1XKZ A;  2BLS A;  3UO9 A;  3NDG A;  1BLP A;  1IEL A;  1CI8 A;  1O7E A;  4QHC A;  5FQJ A;  1PYY A;  4OPZ A;  1NYY A;  3IF6 C;  1PI5 A;  1M40 A;  3MFD A;  1DJC A;  3E2L A;  4OVD A;  1ES2 A;  3NCK A;  3A3F A;  3DWZ A;  1K4F A;  2HP6 A;  4GN2 A;  4OQG A;  4R4S A;  1XA7 A;  3HUM A;  4RX3 A;  3TG9 A;  2WGI A;  4MBF A;  1FSY A;  1MXO A;  4E3K A;  4L0L A;  4S2K A;  4QY6 A;  4RYE A;  3SH9 A;  1K54 C;  4DXB A;  1G68 A;  4S2J A;  5AQA A;  3ZNT A;  4KQR A;  1K55 A;  2Y4A A;  5GHZ A;  3NY4 A;  1L2S A;  2E8I A;  1I5Q A;  5FQ9 A;  2CC1 A;  2HDS A;  1GA9 A;  3B3X A;  4U0X A;  4FD8 A;  1K56 A;  3IWQ A;  3ZG9 B;  1YLW A;  1YLP A;  4HES A;  4OPR A;  1ES3 A;  1BLH A;  3V39 A;  5JYP A;  1ZG4 A;  5EUA A;  3ISG A;  5A90 A;  3N7W A;  4NET A;  1TDL A;  4LCL A;  4X56 A;  3VP0 A;  2OV5 A;  3ZDJ A;  4BJP A;  2WZZ A;  2R9X A;  1Z6F A;  3QNC A;  1H8Y A;  3DTM A;  1FCM A;  1Q2Q A;  2Y2Q A;  1LHY A;  1LL9 A;  2OLV A;  1W8Y A;  3A3E A;  4KZ4 A;  2IWB A;  4WM9 A;  4MLL A;  2XGN A;  3V50 A;  1Y54 A;  1FCO A;  4KZ6 A;  1YM1 A;  2C5W B;  2HDQ A;  4KG2 A;  1YLT A;  4WEK A;  1H8Z A;  3ZG0 A;  2P9V B;  4OPY A;  4C6Y A;  5M19 A;  5DF8 A;  4R23 A;  3WS4 A;  4X55 A;  4E6X A;  3BRM A;  4IBX A;  1GHI A;  3EQV A;  1M6K A;  1W8Q A;  3ZG7 B;  5M18 A;  4P85 A;  3BFF A;  3FKW A;  3SH8 A;  2PU4 A;  2WGW A;  2XQZ A;  3BM6 A;  3CZD A;  4RX2 A;  5F82 A;  4WBG A;  5FDH A;  3OPP A;  1K6R A;  2OSU A;  3G34 A;  2H0T A;  3SS5 A;  2Y2P A;  1W7F A;  3OZH A;  4ZJ1 A;  1VQQ A;  4B88 A;  2Q9M A;  5JYO A;  3HUN A;  2WKI A;  3V3S A;  4KZ7 A;  5CXW A;  1IYP A;  3FYZ A;  3IF6 B;  3E2K A;  2XEP A;  4R1G A;  3UY6 A;  3ZG8 B;  1TDG A;  1LLB A;  4S2P A;  3NIA A;  1QMF A;  4KZA A;  1GHM A;  3ITB A;  4DE2 A;  4E3I A;  3QNB A;  5GLD A;  4NK3 A;  2XR0 A;  2Y2J A;  4O7D A;  5HW3 A;  1PIO A;  1ESI A;  1XP4 A;  3BFE A;  2ZM2 A;  1ERM A;  3C4O A;  2ZQC A;  2XF3 A;  4JXS A;  4X6T A;  4BLM A;  1ZC2 A;  5EOE A;  4HEF A;  2ZQD A;  5A93 A;  4EUZ A;  3C4P A;  2HP5 A;  3HLE A;  3Q7V B;  3PBQ A;  3WS1 A;  4R3J A;  2XD5 A;  2Y2K A;  5FAP A;  2ZC5 B;  1KVL A;  4OON A;  2C6W B;  2XLN A;  4LV1 A;  1E3U D;  4OQH A;  5EE8 A;  4MNR A;  3PBO A;  3PTE A;  5EVI C;  3UNW A;  3WRT A;  2ZMA A;  4IED A;  2ZC4 B;  4OH0 A;  4OQ0 A;  3V3R A;  4GKU A;  1MY8 A;  5FSR A;  1BTL A;  3HLG A;  4U0T A;  4RA7 A;  4S2N A;  5KZH A;  3LEZ A;  2V20 A;  2ZQ8 A;  4P0M A;  2XFT A;  1RGY A;  2EX9 A;  5FQM A;  3DWK A;  2JC7 A;  1SCW A;  4OOL A;  4YIN A;  3RXX A;  1J9M A;  4Q8I A;  4ZJ2 A;  4ZBE A;  4E3J A;  3S22 A;  4UA6 A;  1SKF A;  3VSL A;  4GDB A;  1FR1 A;  3PBN A;  1JWP A;  2UWX A;  5A91 A;  3IHA A;  4IVK A;  4C3Q A;  3UN7 A;  5EVL A;  1MBL A;  4JF6 A;  3VOY A;  4P6B A;  3N6I A;  1RCJ A;  3CMZ A;  4WZ5 A;  1MWT A;  4N92 A;  4MEZ A;  5HAR A;  2HDU A;  2FFY A;  4WMC D;  4ZTK A;  4EBL A;  1ZG6 A;  1WYC A;  3MKE A;  2WUQ A;  4EWF A;  3WS2 A;  5FQK A;  1BUE A;  3OCL A;  3RXW A;  3HUO A;  2X01 A;  5GL9 A;  3LO7 A;  4WZ4 A;  1S6R A;  4WMC A;  5FQQ A;  2Y2G A;  5KSC A;  5E2G A;  3UPN A;  3BYD A;  4P87 A;  5E2H A;  4KZ9 A;  2BG1 A;  1TEM A;  3GSG A;  4KZ5 A;  3OC2 A;  3D4F A;  4GNU A;  3VSK A;  2Y91 A;  4OOM A;  1CEG A;  4R0Q A;  1KDS A;  3PAE A;  5F83 A;  5KSH A;  3UDX A;  3BLM A;  5HAQ A;  2XH9 A;  1IYQ A;  1JWZ A;  4UA9 A;  4UHU A;  4PM5 A;  5I94 A;  2ZC3 B;  3GV9 A;  4JXW A;  1K57 A;  2WK0 A;  3UDI A;  1YLZ A;  4QU3 A;  1HVB A;  4QD4 A;  1FOF A;  4JPM A;  2GDN A;  3MXS A;  2A49 A;  3HLC A;  1GHP A;  2DRW A;  4IVI A;  4JBF A;  1GCE A;  4K0X A;  4ZAM A;  4Y0O A;  3AGF A;  4Y7P A;  5EVI B;  3A3D A;  5TFQ A;  1YMX A;  3VOZ A;  4GD6 A;  3IXH A;  1KGE A;  4S2I A;  1L0D A;  4X69 A;  2XDM A;  4QY5 A;  1L0E A;  3SH7 A;  3UDF A;  5GHX A;  5FI2 A;  3SOI A;  5F1G A;  2J7V A;  1E25 A;  1NYM A;  1XGJ A;  2ZD8 A;  1FR6 A;  2VGJ A;  3IHB A;  5CED A;  1XA1 A;  2ZM0 A;  1CEF A;  5FA7 A;  5FI7 A;  2IWD A;  2J9O A;  1XX2 A;  2Z2M B;  3DW0 A;  3HRE A;  5DTS A;  2G2W A;  4OPQ A;  2Y2H A;  3LY4 A;  4H8R A;  5CHU A;  5TGF A;  4DRT A;  3IXB A;  5M1A A;  1EI5 A;  4PPR A;  3VFF A;  3G32 A;  2Y2L A;  1HD8 A;  4HBT A;  3MZF A;  4UA7 A;  3UE1 A;  4F94 A;  4RVA A;  4B4X A;  1XGI A;  3TSG A;  3PBT A;  1NY0 A;  5EEC A;  4BL2 A;  3IF5 A;  3O88 A;  3C7V A;  1ONH A;  3HLW A;  4JXG A;  1WE4 A;  4WEJ A;  1ZKJ A;  3W4P A;  1N9B A;  1YLJ A;  1KGG A;  2V1Z A;  3GVB A;  3N8L A;  4DXC A;  2EFX A;  1ES4 A;  2PU2 A;  5F1F A;  1AXB A;  1K38 A;  1U60 A;  5CGW A;  1CI9 A;  1MWS A;  3OPR A;  1JVJ A;  4R4R A;  2ZM8 A;  1G6A A;  4D2O A;  1HTZ A;  1SDE A;  3IH9 A;  3MBZ A;  3NDE A;  3G4P A;  2I72 A;  3W8K A;  3HL9 A;  1I2W A;  1QME A;  4BD1 A;  5GLA A;  4MBK A;  3PAG A;  4ZDX A;  1DJA A;  2Y2I A;  2ZQA A;  3VFH A;  4BL3 A;  5TR7 A;  3IT9 A;  5CTN A;  1ALQ A;  1PWG A;  5CRF A;  4KG5 A;  4GDN A;  4PMA A;  2QMI A;  2ZQ7 A;  5GHY A;  1Q2P A;  3S4X A;  1JTD A;  1PZP A;  5FAQ A;  2OLU A;  1MWU A;  1MKI A;  3MKF A;  3P09 A;  1E3U A;  2WZX A;  4KQO A;  3O86 A;  3TOI A;  5HAI A;  3I7J A;  5EVI D;  3WS0 A;  1KE4 A;  4LV2 A;  4LV0 A;  4N1H A;  2EX6 A;  4S2N C;  3ZCZ A;  2WAF A;  4KQQ A;  3G2Z A;  2Q9N A;  2RCX A;  3IH8 A;  2HDR A;  3IXG A;  1LI9 A;  3LCE A;  2EX8 A;  3GMW A;  1BZA A;  3BEC A;  5D3O A;  1H5X A;  4Y0U A;  2JCH A;  3HLF A;  5DTT A;  3Q82 A;  3HBR A;  4JKT A;  2QZ6 A;  2DNS A;  4JF5 A;  1FCN A;  4GD8 A;  1IKG A;  5CHM A;  3QHY A;  3OPH A;  2J9P A;  1O07 A;  1NJ4 A;  3OPL A;  1CK3 A;  5FAT A;  1BUL A;  4KZ8 A;  4WZ5 C;  2P9V A;  5U47 A;  5EOO A;  2WGW B;  2JE5 A;  3N8S A;  4LCM A;  3P98 A;  4PM6 A;  2HP9 A;  4A5R A;  4S2L A;  3ZHH A;  4E3L A;  5HFO A;  3NI9 A;  1KGF A;  2XFS A;  4MBH A;  4LV3 A;  5FQI A;  2Y2N A;  3AGE A;  5CER A;  3O3V A;  4N9K A;  5CHJ A;  1IKI A;  4KEN B;  4X53 A;  1PWD A;  3W4Q A;  3WWX A;  4UAA A;  1I2S A;  4Z9Q A;  1EWZ A;  3ZNY A;  4E3N A;  4DE3 A;  3UPP A;  5AQ7 A;  3Q7Z A;  4OLG A;  5DF7 A;  3UPO A;  3V5M A;  4OOY A;  5CGS A;  2HPB A;  1ERO A;  2QPN A;  3IF6 A;  4OQI A;  3ZFZ A;  1K55 C;  2ZC6 B;  4PM8 A;  1MPL A;  2WAD A;  2XD1 A;  4WEL A;  4DDY A;  3VP2 A;  1GA0 A;  2Y55 A;  4FH2 A;  3PBS A;  1KE3 A;  1TVF A;  1JTG A;  3UE0 A;  1K57 C;  1L0F A;  4PM7 A;  4FSF A;  4OP5 A;  5FAO A;  2A3U A;  5E2F A;  4LEN A;  1PW8 A;  4KG6 A;  1K6S A;  5AQB A;  1PW1 A;  3UE3 A;  1K54 A;  4DE0 A;  3M2J A;  3Q7V A;  5L2F A;  3Q1F A;  3M2K A;  3M6H A;  5HAP A;  1K56 D;  4K91 A;  4E3M A;  2EXB A;  3MZD A;  1KVM A;  1VM1 A;  1OME A;  1YT4 A;  3VMA A;  4DF6 A;  4B4Z A;  1KE0 A;  1W79 A;  1E4D A;  1LI0 A;  5CEC A;  2ZQ9 A;  4OP8 A;  4BD0 A;  1NZU A;  2Z2L B;  4E6W A;  4E3O A;  3OCN A;  3CJM A;  3VP1 A;  3BFG A;  4ID4 A;  3BEB A;  3IWO A;  3O87 A;  1RGZ A;  2V2F F;  3N8R A;  1BLC A;  2Y59 A;  1PWC A;  5GLB A;  2ZLY A;  4FCF A;  1YQS A;  2EXA A;  5CTM A;  3VP4 A;  1DJB A;  3GR2 A;  3A3J A;  2PBY A;  2FFF B;  3PBR A;  4CPK A;  3HLD A;  1NRF A;  3GTC A;  5GLC A;  1L0G A;  3HLB A;  1YLY A;  1SDN A;  3IQA A;  3GRJ A;  2EX2 A;  4HBU A;  4WYY A;  3G2Y A;  1MWR A;  3BFC A;  3MXR A;  2H10 A;  3ZVT A;  2Y2O A;  4S2M A;  1ES5 A;  3FKV A;  1WYB A;  5CGX A;  4R3B A;  1N4O A;  3AGD A;  1YMS A;  1S0W A;  2RL3 A;  2IWC A;  3HVF A;  3BLS A;  2XK1 A;  3IWI A;  4EQI A;  1ESU A;  1IEM A;  4JF4 A;  4PM9 A;  1PI4 A;  1BSG A;  2R9W A;  1FSW A;  3ZVW A;  3ITA A;  2P74 A;  1NZO A;  1LL5 A;  3MZE A;  5G18 A;  1ONG A;  1IYS A;  4DDS A;  3WS5 A;  2DCF A;  3S1Y A;  4Y0T A;  4IBR A;  3FWL A;  5FAS A;  3SS4 A;  4EBN A;  2WKH A;  1DY6 A;  4JXV A;  5E2E A;  4C75 A;  3GQZ A;  2X02 A;  4X68 A;  3NBL A;  3ZG5 A;  2H0Y A;  3G31 A;  3EQU A;  1KDW A;  4K0W A;  4OKP A;  1C3B A;  2WKE A;  4JLF A;  4QB8 A;  5HL1 A;  3G35 A;  1XXM A;  4QJG A;  1W5D A;  4N1X A;  1BLS A;  5A92 A;  2J8Y A;  4GB7 A;  5EPH A;  3LY3 A;  4BQM A;  4DKI A;  2VGK A;  3JYI A;  4GZB A;  4XUZ A;  5EVI A;  3IXD A;  1HZO A;  3G30 A;  1K25 A;  2ZJ9 A;  3SS3 A;  1K4E A;  1FQG A;  5DF9 A;  4N9L A;  5DTK A;  5BOH A;  2ZC7 A;  4YFM A;  1BT5 A;  2G2U A;  4KZ3 A;  5HX9 A;  5DVA A;  2H5S A;  3VP3 A;  4FH4 A;  4S2O A;  1JWV A;  1IYO A;  4GOG A;  3W4O A;  4BEN A;  5J8X A;  3CG5 A;  1ERQ A;  3C5A A;  2JBF A;  4OLD A;  3M6B A;  1NXY A;  1PZO A;  1RP5 A;  4EV4 A;  2EFU A;  3Q81 A;  3ZGA B;  4CJN A;  3NC8 A;  4XXR A;  3WRZ A;  5CEB A;  2WGV A;  1SHV A;  3RJU A;  4KZB A;  2WYX A;  4EBP A;  4U3T A;  4XUX A;  3Q07 A;  3BFD A;  1XPB A;  5KMW A;  3A3I A;  3FV7 A;  2WAE A;  2X71 A;  4ZJ3 A;  5IHV A;  2Y2M A;  5AQ9 A;  3N4I A;  2B5R A;  5E43 A;  4DE1 A;  3FZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...