5F1GA

Crystal structure of a class c beta lactamase
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
361
structure length
351
Chain Sequence
HHPQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPATKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPPEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVRSNMNPRDINDKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIINAAHPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVAAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Crystal structure of a class C beta lactamase
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 114
structure length 351
sequence length 361
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5f1gA00
4P85A 2J9PA 1MWRA 3BEBA 4EBNA 1GA0A 1Q2PA 4P87A 4Z9QA 1KDSA 3N6IA 5A91A 3GRJA 1L0EA 5GLAA 1K6SA 5DTKA 3DTMA 1S6RA 5EVIA 1KDWA 3V50A 4S2MA 1YLJA 3EQUA 2PU2A 4MNRA 4OP8A 5GLBA 5DTSA 4FD8A 1YLYA 3OCNA 3FWLA 3VOZA 1CEFA 1BLSA 2Y2NA 3W4OA 3RXWA 5CXWA 4WYYA 3PAEA 1KE0A 1IYSA 1E25A 4JLFA 3WS0A 5DTTA 1L2SA 2WKIA 4WMCD 1LL9A 5CTMA 1KGEA 4KZ9A 1GHPA 1RGYA 4KZAA 5HL1A 4K0WA 4OOMA 4C3QA 4PPRA 4WEJA 1ES2A 1BLCA 4OQIA 2ZQAA 3O3VA 5EOEA 3VSLA 1TDGA 2VGKA 4KZ4A 3PAGA 3CJMA 1BULA 4DE0A 1HVBA 3FKVA 1BTLA 1YLPA 5FATA 2V20A 2EX8A 4FH4A 3WS4A 4OP5A 1K55A 3C4PA 5FQJA 3S1YA 1XX2A 2A49A 3UPOA 3TOIA 4GOGA 4ZJ2A 4KZ8A 3IF6A 4GN2A 5A92A 1PZOA 2P9VB 3PBNA 3QNBA 1H5XA 2WKEA 1K57A 3NI9A 4E6WA 5M19A 2EXAA 5U47A 1EI5A 4U0TA 4JKTA 2B5RA 3PBOA 2Z2LB 3VSKA 2WZZA 3M6BA 2H0TA 3GTCA 1QMFA 2GDNA 2Y59A 5I94A 1BSGA 1IELA 1DJCA 5EVIC 4MBKA 3RXXA 4N9KA 2OLUA 4FH2A 1WE4A 1PWGA 4RX3A 5CEBA 3MXRA 3NCKA 1XA7A 1XPBA 2JE5A 3BRMA 4HEFA 4A5RA 2XGNA 1PI4A 1EROA 5DF9A 4DDYA 3ZGAB 3S4XA 1BUEA 5FQKA 4JF4A 4R4RA 4QB8A 4BJPA 4EBPA 4XUZA 5GLCA 1MWUA 2ZC4B 1N4OA 3HVFA 3MZFA 3CMZA 3GQZA 3UE3A 4OKPA 2EFXA 3CZDA 2ZQDA 3HLGA 4QY5A 4RYEA 3SOIA 4WBGA 3UDFA 4F94A 1KVLA 2XDMA 2XR0A 4ZAMA 2Y2KA 2H0YA 3DW0A 1KE4A 1GCEA 2QZ6A 4E3IA 2HDSA 4LV3A 2V2FF 3A3IA 2ZJ9A 1Z6FA 2QMIA 4QJGA 1SCWA 3N8SA 2FFYA 1K55C 2Y2OA 4Y0OA 1FCOA 4MLLA 3N8RA 1M40A 1DJBA 3VP1A 2WZXA 2Q9MA 3TG9A 3WS2A 4S2NA 2XFTA 3PBSA 3IF6C 4PM8A 5EOOA 3C7VA 1XGJA 4HESA 3FYZA 1K57C 1C3BA 2Y91A 3G35A 4EQIA 1HTZA 5AQAA 3OC2A 3GR2A 3NBLA 1CEGA 5FA7A 3HL9A 1U60A 3ISGA 2WKHA 2XFSA 3OPRA 3ITAA 3GSGA 4GDNA 2XEPA 1H8YA 3IH9A 1TEMA 5FQMA 3ZG0A 4WELA 3A3FA 3N8LA 2ZQ8A 2WGVA 4CJNA 1PI5A 1LL5A 1Q2QA 4IVIA 3VFHA 5E2EA 2EX6A 1NZOA 3C7UA 3WS1A 4EWFA 3UDXA 3BFDA 4PM7A 4P6BA 4C75A 4ZTKA 3BYDA 4NETA 2BG1A 4KG5A 2WK0A 5E43A 1HD8A 3P98A 1DY6A 1XXMA 4Y7PA 1JTDA 1G6AA 3BFGA 3BLMA 4N1XA 4OH0A 1KVMA 2EXBA 1YMSA 3E2LA 3EQVA 4D2OA 5CEDA 5HARA 3W4PA 4JF6A 2WYXA 2Y2HA 3UE1A 5F83A 3ZNYA 1YLWA 5IHVA 3MKFA 4DE2A 4E3OA 3Q82A 4FSFA 2WGWB 5AQ9A 5HAIA 4ZDXA 4KQRA 5GHZA 4U0XA 5TGFA 2IWCA 3I7JA 2ZC7A 2ZC6B 3GV9A 1IEMA 1FOFA 3LO7A 4S2KA 4GDBA 1KGFA 1I5QA 2WGIA 3BFCA 1I2SA 3G2ZA 2EX2A 2ZMAA 3OCLA 5JYPA 1NRFA 1XP4A 4E3NA 5A90A 3OZHA 3NC8A 2XLNA 1K54C 4OQ0A 3SS5A 4DE1A 5HX9A 2P74A 4CPKA 4S2IA 3PBTA 3WRTA 4S2NC 2J9OA 2I72A 4PM9A 5AQ7A 2IWBA 1SDNA 2E8IA 3IXHA 4KG6A 4OLGA 1E4DA 4X69A 4LCLA 5EVIB 3AGFA 3VOYA 2J8YA 5CGWA 5TFQA 5CRFA 1L0GA 1S0WA 1E3UD 3Q1FA 2EFUA 1IKIA 2Y2LA 1TVFA 1MKIA 2ZQ9A 1K38A 1CI9A 1M6KA 3HLFA 3BFFA 3NDEA 4MBHA 4OQGA 2WUQA 4UA6A 4JXGA 2C5WB 5F1GA 2Z2MB 4M3KA 2DRWA 5EE8A 4IEDA 3ZFZA 1L0DA 3MBZA 4OPYA 1W8YA 3SH7A 1VQQA 4DRTA 1YT4A 2HPBA 1K6RA 1JWZA 1IKGA 5CGSA 3NDGA 1SDEA 1FR1A 4O7DA 1FSYA 1IYQA 4N1HA 3O86A 2Y2JA 3Q81A 3MZEA 1WYCA 5J8XA 5KSCA 2PU4A 3CG5A 1MBLA 3V5MA 1ERMA 1L0FA 4OOYA 4S2LA 5FQQA 3QNCA 5D3OA 3M2JA 4QY6A 4GB7A 5F82A 2X02A 3N7WA 5DF8A 1XGIA 4L0LA 4BL3A 5FASA 3ZG7B 4LV2A 1I2WA 1PWCA 3DWZA 4WZ5A 4KZ3A 1NJ4A 4OOLA 4OVDA 2XQZA 4PMAA 5EVID 3IF6B 1MXOA 2C6WB 2DNSA 2A3UA 1NYMA 4GD8A 5HW3A 4WM9A 4UHUA 3MXSA 3UDIA 2OSUA 5FI7A 5CECA 1NYYA 4DXBA 2CC1A 3AGDA 4P0MA 5EPHA 3SH9A 3M2KA 1BLPA 2WADA 5GL9A 4EV4A 4R3BA 1FQGA 3IT9A 1ZG6A 3G34A 4BD1A 1PYYA 4KQQA 3G32A 1YLTA 1VM1A 1YMXA 4UA7A 3TSGA 5GHXA 1BLHA 3IXDA 1K54A 3Q7ZA 3WWXA 1J9MA 5E2FA 1NZUA 4BD0A 4KZBA 4WMCA 3UN7A 3BM6A 2JCHA 5HAQA 4DDSA 4OQHA 1SHVA 1PW8A 1Y54A 4B88A 1NXYA 2XK1A 1ERQA 3ZG9B 1ESIA 1ONHA 3Q7VA 5CGXA 5E2HA 2Y2PA 1K56D 2BLSA 4IBRA 4WZ4A 4DXCA 2ZC3B 2IWDA 1RCJA 3G31A 3GMWA 1O7EA 1GA9A 3NY4A 1FCNA 3ZNTA 2FFFB 4OLDA 2JBFA 4YINA 4ZJ1A 2XF3A 4IVKA 4X55A 1E3UA 5E2GA 4XXRA 4KZ6A 4UAAA 1RP5A 4NK3A 5KZHA 1LI0A 3HUNA 2Y4AA 1KGGA 3IWOA 1BZAA 5GLDA 3ZG5A 3ITBA 1AXBA 2HDQA 4H8RA 3O88A 1JVJA 4R4SA 3VP0A 3ZG8B 4WZ5C 5JYOA 3D4FA 3FKWA 4JXVA 3VMAA 3V3SA 3AGEA 3LEZA 3HLBA 3UPNA 3HUMA 3UY6A 1PW1A 3DWKA 3Q7VB 3IF5A 2ZM0A 3G2YA 4R1GA 5AQBA 4GZBA 3ZVWA 4KG2A 1RGZA 3JYIA 1K4EA 1HZOA 4JBFA 4BQMA 3SH8A 3W4QA 3UE0A 1W5DA 2Q9NA 5CTNA 4HBTA 1XKZA 3IWQA 2XD1A 1PIOA 4WEKA 3G4PA 4LV0A 3C5AA 4X68A 3ZDJA 3HREA 5BOHA 2WAFA 1ONGA 4N9LA 2UWXA 1K4FA 3PTEA 2ZQ7A 4B4ZA 2QPNA 3M6HA 2R9WA 1ES4A 3MFDA 4BENA 3LY4A 1NY0A 4E6XA 5M18A 3SS4A 3IXGA 1GHMA 4ZJ3A 2G2UA 2Y55A 2OV5A 4N92A 2WAEA 4S2OA 4E3KA 4DF6A 5M1AA 2HP5A 2P9VA 4JF5A 5FAPA 1IYOA 2X01A 1LLBA 4OPZA 5A93A 2Y2GA 4KENB 1CI8A 5CHJA 3IH8A 5HAPA 3C4OA 5FQIA 2J7VA 3SS3A 4DE3A 3S22A 3WRZA 3MKEA 2PBYA 3UNWA 3G30A 3PBRA 3ZHHA 4BL2A 4ID4A 1MWTA 2ZC5B 3FV7A 1MPLA 1PZPA 4FCFA 1ES3A 2ZD8A 3IXBA 3HLCA 1SKFA 3E2KA 4X53A 2V1ZA 4RX2A 1OMEA 1K56A 3LCEA 4QU3A 2VGJA 2HP6A 4S2PA 4QD4A 4R23A 4Y0TA 1W8QA 5EVLA 5FI2A 3B3XA 3NIAA 4R0QA 3UO9A 3HUOA 4XUXA 2XH9A 2HDUA 1WYBA 3UPPA 3OPHA 4GD6A 1ALQA 1H8ZA 4OONA 3Q07A 5KMWA 1GHIA 1MY8A 2EX9A 1K25A 4K91A 2RCXA 4MEZA 4Y0UA 4JPMA 3OPLA 4R3JA 1YLZA 2Y2MA 3W8KA 4EUZA 5DF7A 4UA9A 1BT5A 2ZM8A 2H10A 3OPPA 1IYPA 3A3JA 4JXWA 4RA7A 3MZDA 4KZ5A 5DVAA 5FDHA 5CERA 4RVAA 3ZVTA 4GKUA 3BLSA 1FSWA 5GHYA 3VFFA 4E3JA 4DKIA 1KE3A 4E3LA 2JC7A 1ES5A 1XA1A 1G68A 4LV1A 4QHCA 2HP9A 3RJUA 3V3RA 2ZM2A 1LHYA 5EUAA 1FCMA 3WS5A 5FI6A 3IQAA 4S2JA 4X56A 3BFEA 1ZG4A 5FAQA 1CK3A 1JWPA 5F1FA 2R9XA 1ESUA 5CHMA 1MWSA 2RL3A 3O87A 1LI9A 2ZQCA 3IHAA 4K0XA 5CHUA 3HLWA 1ZKJA 2OLVA 3IWIA 4JXSA 5KSHA 1TDLA 3P09A 3PBQA 1N9BA 4LENA 4HBUA 3A3DA 4KQOA 4LCMA 1YM1A 3N4IA 5L2FA 1W7FA 2Y2QA 5G18A 3VP4A 3VP2A 3A3EA 4OPRA 4OPQA 3IHBA 4MBFA 1QMEA 4YFMA 1EWZA 4ZBEA 1O07A 4Q8IA 1ZC2A 5HFOA 2Y2IA 5FQ9A 3FZCA 5FSRA 5TR7A 1FR6A 3HLEA 2ZLYA 5FAOA 4IBXA 2DCFA 2WGWA 1JWVA 2G2WA 4BLMA 3V39A 4PM5A 1DJAA 3BECA 2HDRA 4GNUA 4U3TA 2XD5A 2X71A 1W79A 2H5SA 4E3MA 4C6YA 3LY3A 1JTGA 3HLDA 4X6TA 3GVBA 3VP3A 4B4XA 1YQSA 4EBLA 3HBRA 1PWDA 3QHYA 3ZCZA 4KZ7A 5EECA 4PM6A
chains in the Genus database with same CATH superfamily
4P85A 3BEBA 1GA0A 4P87A 4BBTA 4P6ZM 1L0EA 1K6SA 2LB9A 3EQUA 4EETB 5TJJA 1G28A 4JGOA 5F5YA 4DN0A 2ZMVA 1S4SA 3NHQA 3WS0A 5DTTA 1L2SA 2WKIA 1DP8A 4WMCD 5EM0A 1LL9A 5CTMA 1P0ZA 3SZTA 5MC7A 4WEJA 1MZUA 4OQIA 3O3VA 3VSLA 4KZ4A 3E4OA 3FKVA 3NOUC 2V20A 2EX8A 4FH4A 3T1SA 3WS4A 1K55A 4O8GA 4ZJ2A 4DJ2A 4GN2A 3IF6A 1N9LA 4HI4A 3QNBA 2BASA 3NOPC 5M19A 1OJGA 2B5RA 4Y17A 2Z2LB 2L4RA 2WZZA 3A0RA 2KX6A 3GTCA 1BSGA 1DJCA 3BQAA 2V9AA 1SZVA 4N9KA 2V8FA 3LR4A 2W3HA 3MXRA 1EROA 1VEUB 5DF9A 4BBUA 4GHIB 2VJWA 4DDYA 2NUPC 3CI6A 1FIKA 4R4RA 4QB8A 4XUZA 1N4OA 3CMZA 3CZDA 2OAQ1 3SOIA 4WBGA 4F94A 2J80A 2VV8A 1OTIA 5HDCA 3HJIA 4IUKA 4Y0OA 1FCOA 3VP1A 5J4EA 3TG9A 3WS2A 2XFTA 3MQOA 5EOOA 1XGJA 4HESA 1K57C 1C3BA 3OC2A 4YOFA 3OPRA 3GSGA 5FQMA 3MR0A 5L09A 2M7VA 4FOFA 1LL5A 3VFHA 3WS1A 4PM7A 4C75A 3BYDA 4NETA 4KG5A 2W1RA 5G4ZA 3CPTA 4OH0A 2EXBA 3K3CA 3EQVA 2DMWA 4JF6A 5AQ9A 5HAIA 2E8JA 2QWSA 4KQRA 4U0XA 4JGRA 2ZC6B 1PFLA 4G3KA 1I2SA 2ZMAA 4E04A 3LI9A 5HZHA 1NRFA 1XP4A 2JKGA 5A90A 3NC8A 1K54C 3B33A 5HX9A 4Y3IA 1OTEA 2J9OA 4PM9A 5AQ7A 3NJAA 1W63Q 3KYZA 3BJNA 5CGWA 5TFQA 5CRFA 1OPXA 4MN5A 1E3UD 1TVFA 3HJKA 4MBHA 1K38A 4FUWA 5EFWA 2WUQA 4JXGA 2DRWA 3CAXA 4I5SA 3T4OA 4QPRA 1SDEA 2GNXA 2KLIA 3O86A 1DRMA 3H7WB 3UB8A 1L0FA 4OOYA 3M2JA 5F82A 4GB7A 2PYPA 1XGIA 4LV2A 3DTEA 4KZ3A 4CLCB 2C6WB 1Y4OA 2A3UA 4UHUA 4CQHA 3UDIA 4P0MA 4R6LA 2V8CA 3P01A 1FQGA 1ZG6A 4BD1A 3JPUA 4KQQA 1VM1A 1YMXA 1K54A 3IBRA 3WWXA 1YAXA 3UE6A 4F3LA 2Q0OA 5HWVA 1SHVA 4B88A 1NXYA 3ZG9B 5E2HA 1OT9A 2Z6DA 2BLSA 4WZ4A 4DXCA 1LL8A 4II7A 1O7EA 1FCNA 3ZNTA 2D01A 4YINA 4XXRA 2XSSA 1RP5A 4MCWA 4NK3A 5KZHA 2Y4AA 1KGGA 5GLDA 3K2NA 3CLOA 3VP0A 4JGQA 3AGEA 3LEZA 3UY6A 2L0WA 5L10A 4KG2A 1HZOA 1W5DA 5DFXA 3EEAA 4X25A 3O5YA 4WEKA 2P7JA 4EEPA 3C5AA 4X68A 4B93A 5BOHA 1ONGA 1GSXA 2PR6A 5M18A 3IXGA 2G2UA 4GS9A 4JF5A 5A93A 1CI8A 3IH8A 4NG2A 3C4OA 3H82B 3S7PA 1VHMA 1XJ3A 2HV1A 3E98A 3MKEA 4DE3A 4BBVA 3IXBA 1SKFA 1OTDA 1OMEA 4HQAA 4HNBA 4QD4A 1T19A 2W1TB 3B3XA 3NIAA 3HUOA 2XH9A 2HDUA 2YKFA 2ZOHA 2Y79A 3MMHA 1LSVA 1GHIA 1MY8A 2EX9A 2M7UA 5HD5A 4JPMA 2OWHA 3BY8A 4NXBA 3LIEA 4UA9A 1Y28A 2ZMFA 4PKYA 3A3JA 4L9FA 4Q0JA 5FDHA 4RVAA 3T4JA 4GKUA 4NXGA 4D60A 5GHYA 4DKIA 2M1CA 4NXEA 1ES5A 2HP9A 2ZM2A 1ZHHB 2OOLA 5EUAA 3LI8A 4S2JA 2A2LA 1ZG4A 3BFEA 2J3WA 1OT6A 1ESUA 5CHMA 2RL3A 5TBMA 2ZQCA 3U2AA 3IWIA 1TDLA 3P09A 3PBQA 4ARZB 4LENA 3FPWA 1G5UA 2Y2QA 5G18A 3VP4A 4OPQA 2G7UA 5J7EA 1NWZA 1ZC2A 3HLEA 2ZLYA 2QHKA 2WGWA 4BLMA 5EV0A 3BECA 4Q0HA 1W79A 2H5SA 1W63M 4B4XA 2L1MA 2J3TD 4HIAA 1PWDA 4KZ7A 5EECA 3BW6A 2PR5A 1MWRA 1KDSA 1NLZA 1F5MA 5DTKA 4HJ3A 3DTMA 1S6RA 5EVIA 4B9OA 1YLJA 4MNRA 4OP8A 1YLYA 4PKYG 3E0YA 4LRYC 2VKSA 2O9AA 4WYYA 2V0UA 5G4YA 3UB5P 1RGYA 3R4KA 4OOMA 5EOEA 4MN6A 2EWVA 1BULA 1HVBA 4IUHA 2W3FA 5CX7A 1YLPA 4OP5A 3MXQA 3C4PA 5FQJA 3S1YA 1XX2A 4EW7A 2A49A 5A92A 1H5XA 2WKEA 3M6BA 2GDNA 3VE4A 5I94A 4JGPA 4MBKA 3PHYA 4IJGA 3D72A 4A5RA 2R78A 1PI4A 3FG8A 4HH3A 1BUEA 4JF4A 2Z6CA 2I9VA 5GLCA 2O9BA 4OKPA 4QY5A 3UDFA 2XR0A 3R7WA 2Y2KA 3DW0A 3S7OA 4LV3A 3A3IA 1SCWA 3N8SA 2NUTC 1K55C 3N8RA 1DJBA 3CHWP 3IBJA 4S2NA 3PBSA 3IF6C 5AQAA 3GR2A 3GECA 3NBLA 1U60A 3ISGA 2VK3A 3FC7A 4GDNA 4XT2B 3F1OA 1H8YA 3IH9A 1ODVA 3ZG0A 3A3FA 1S67L 3N8LA 4WF0A 2WGVA 4CJNA 1VB6A 1Q2QA 4HHDA 4G3VA 4H6JA 5DJTA 2WK0A 1DY6A 2PDRA 3BLMA 4WUJA 1UWPX 1G6OA 3KX0X 2XA7S 1YMSA 1T1BA 3E2LA 2VX8A 5CEDA 3RH8B 3W4PA 2VGLS 4FSFA 2OAP1 1EW0A 1KGFA 2EX2A 4E3NA 2XLNA 1BYWA 4DE1A 3KSHA 3IS2B 3PBTA 4KUOA 2I72A 3CPTB 5AJGA 3IXHA 3LYXA 4Y2FA 1E4DA 4LCLA 2HJ9C 3U4LP 2W3DA 1L0GA 1S0WA 2VLGA 2P04A 3Q1FA 4L9GA 1IKIA 1VETA 2Y2LA 4OQGA 1M6KA 3NDEA 3C30A 2V1BA 5FEGA 1PRQA 3L7HA 5HPFA 1K6RA 5CGSA 1FR1A 4O7DA 3HCYA 4AFIA 3Q81A 2Y2JA 1F98A 3V67A 2PT7A 5J8XA 4I38A 4FTXA 2O99A 2X02A 4HP9A 3N7WA 1N9OA 4WZ5A 1NJ4A 4OVDA 5EVID 1MXOA 4KUKA 2DNSA 5HW3A 4WM9A 3MXSA 1Z09A 4LPZA 3AGDA 4BMWA 1BLPA 5GL9A 4EV4A 2P08A 1SKOA 5GHXA 4LGWA 1BLHA 1JNUA 1NZUA 3KYQA 3BM6A 5HAQA 4OQHA 2XK1A 5L07A 3Q7VA 4IBRA 2IWDA 5FDSA 1RCJA 3G31A 3GMWA 1L3LA 2HZ5A 3BQ8A 3NY4A 3EGXC 2JBFA 2XF3A 4IVKA 4KZ6A 3HUNA 2J3TC 2FH5A 1BZAA 3ZG5A 1AXBA 1T18A 3ZG8B 4GJ4A 2A24A 2VA0A 3MSHA 4DJ3A 2B18A 3UPNA 4UQIS 5AQBA 3G2YA 3T4LA 1RGZA 3JYIA 3UE0A 2Q9NA 4HOIA 1PIOA 2LB5A 4LV0A 3HREA 2V1AA 2ZQ7A 4M4XA 2V0WA 4BENA 4E6XA 3SS4A 4NEED 2OV5A 4E3KA 1STZA 3PR6A 4LFUA 3OLOA 2PBYA 4BL2A 3PBRA 1MPLA 1V9ZA 3QP4A 3A0SA 3HLCA 3E2KA 4RX2A 1K56A 5HD3A 1VEUA 2VGJA 4Y0TA 4GHIA 1W8QA 5EVLA 3UO9A 3T4KA 3OPHA 4GS9B 4GD6A 5HSQA 1H8ZA 4OONA 4K91A 1XFQA 3OPLA 2H28A 3W8KA 3OPPA 2H10A 3LIAA 4RA7A 3VFFA 3KSGA 1H8MA 4E3JA 4YNRA 2JC7A 3RJUA 5IT5A 1FCMA 3WS5A 3DTIA 4I3JA 2W3EA 3O87A 1LI9A 4K0XA 5CHUA 3P7NA 2OLVA 4Y13A 4L9EA 5F68A 5KSHA 1N9BA 4NKPA 1IOUA 1YM1A 4MMNA 5L2FA 4MN7A 3IHBA 1K0KA 4YFMA 5HWTA 5HFOA 5FQ9A 3CUEA 1FR6A 3NULA 2G2WA 4PM5A 3T4QA 4GNUA 2XD5A 4ESPA 4C6YA 3VP3A 1YQSA 4EBLA 3QHYA 3ZCZA 4PM6A 4EBNA 1Q2PA 3OOVA 5A91A 3GRJA 1UWNX 3V50A 4S2MA 2PU2A 5DTSA 1CEFA 3CITA 1BLSA 3RXWA 5CXWA 3PAEA 1KE0A 2EWWA 1IYSA 1E25A 3K3DA 1GSWA 1CQAA 3KO6A 5DKKA 3L9KA 3F1NB 4C3QA 1ES2A 2K31A 1BLCA 3UMEA 2ZQAA 3IX8A 5C5KA 1TDGA 2VGKA 3H7WA 3PAGA 5HDDA 5K5BA 3PXPA 5FL3A 4UEYA 5FEFA 2W3GA 3TOIA 3PYPA 3EGDC 4PAUA 2P9VB 5DJUA 3T50A 4E6WA 5U47A 1EI5A 4JKTA 4I3AA 3VSKA 2H0TA 2EA9A 2O0YA 5EVIC 1S66L 3RXXA 3SW1A 1WE4A 1PWGA 2PHYA 5AVFA 2JE5A 3TE8A 3EEHA 3S4XA 4BJPA 4EBPA 1MWUA 4ETZA 3MZFA 2GZAA 3HVFA 3GQZA 2EFXA 2ZQDA 3HLGA 4RYEA 2XDMA 5A8BA 4ZAMA 2H0YA 1GCEA 2QZ6A 4E3IA 2HDSA 5IS1A 2ZJ9A 2QMIA 4QJGA 3F1PB 1TS8A 4IHQA 4PM8A 2QJ7A 3FYZA 4RQ9A 4EQ1A 2Y91A 3LUQA 3T4SA 4EQIA 1CEGA 3HL9A 2WKHA 2XFSA 2ZL1B 2XEPA 1TEMA 4WELA 1HLUP 5KIZA 1PI5A 4IVIA 2EX6A 3C7UA 3GDIA 3BFDA 4ZTKA 2BG1A 3P98A 1XXMA 4Y7PA 1JTDA 4N1XA 2PD7A 1KVMA 4GLQA 4D2OA 2WYXA 2Y2HA 5DFYA 4DE2A 3MKFA 5GHZA 3LEQA 3C2WA 2D02A 4S2KA 1FOFA 3LO7A 3VV4A 2CMNA 2WGIA 5AVEA 3BFCA 3G2ZA 3OCLA 2UV0E 1FILA 3OZHA 2P74A 4S2IA 4S2NC 2W1TA 4P6ZS 2JKFA 1SDNA 1YSQA 4KG6A 4WLAA 1GSVA 1D1JA 2EFUA 1MKIA 1CI9A 3HLFA 3BFFA 2PRFA 4UA6A 3MJQA 2B95A 2C5WB 2Z2MB 4ME4A 4M3KA 3TRCA 4K08A 5EE8A 4IEDA 1L0DA 3MBZA 4OPYA 3SH7A 4DRTA 1VQQA 1JWZA 1FSYA 1IYQA 4N1HA 4PHTA 1F9IA 3MZEA 2PU4A 3CG5A 1MBLA 1ERMA 1YSPA 4S2LA 5FQQA 3QNCA 5DF8A 1I2WA 3DWZA 4PMAA 3IF6B 1NYMA 4ZRRA 5CECA 2OSUA 5FI7A 1NYYA 4DXBA 1N9NA 3SH9A 3M2KA 3G34A 1J3WA 1PYYA 1XJ2A 3G32A 1YLTA 3TSGA 3IXDA 5E2FA 4BD0A 4DDSA 1D06A 1F2KA 1ESIA 5CGXA 4EERA 2ZC3B 1GA9A 2MJ6A 3G6OA 1IFQA 3LR3A 5E2GA 1E3UA 4UAAA 3RFBA 1P9RA 1CJFA 2HDQA 3QP1A 4H8RA 3O88A 3OBFA 4R4SA 4WZ5C 1S1YA 5JYOA 3FKWA 3HLBA 4R3AA 3HUMA 4Y5FA 3DWKA 1MKMA 3Q7VB 3IF5A 3LGOA 3ZVWA 1K4EA 4BQMA 4JBFA 3SH8A 2QKPA 5CTNA 4DMZA 3G4PA 3QP6A 3ZDJA 2WAFA 3T4TA 1X0OA 3MF0A 1AWIA 3PTEA 1ZTUA 4QWOA 2QPNA 2VEAA 1ES4A 3KSIA 1NY0A 1GHMA 4ZJ3A 2A24B 4N92A 2WAEA 4S2OA 5M1AA 5FAPA 2X01A 1LLBA 1OTAA 3E4QA 3VE3A 5HWWA 5CHJA 5HAPA 5FQIA 3WRZA 3G30A 1DP6A 3ZHHA 4ID4A 1MWTA 2ZC5B 3FV7A 1PZPA 4FCFA 3QP8A 2ZD8A 2V1ZA 1WA9A 1LSWA 4S2PA 2HP6A 4HJ6A 3ZYTA 4XUXA 1WYBA 3UPPA 4I39A 1TS0A 3Q07A 5KMWA 1A0KA 5F69A 4MEZA 1UGUA 3MQQA 5J3WA 1YLZA 4EUZA 2WKPA 1IYPA 4JXWA 5CERA 3BLSA 1FSWA 3A0VA 3MS6A 2FZ0A 3ULFA 4QHCA 1G68A 3V3RA 1LHYA 4BWIA 5FAQA 5F1FA 2JKTI 1JWPA 4EU0A 3S7QA 2R9XA 4XT2A 1TS6A 3T1XA 2WKRA 3IHAA 4JXSA 4EUVA 3A3DA 2JKRI 1W7FA 3VP2A 3A3EA 2XA7M 1NRJA 1EWZA 4X1LA 1O07A 4ZBEA 4Q8IA 5FSRA 1YKDA 2GX5A 2VGLM 4IBXA 2DCFA 4F3LB 1JWVA 2GJ3A 1DJAA 4O01A 1H0MA 3DTKA 3LY3A 3HLDA 3HBRA 3LICA 2J9PA 3IS2A 4R38A 3QP5A 2BTFP 3JVUA 4Z9QA 3N6IA 2IA2A 1TD5A 4KQDA 5GLAA 3CWFA 2PAVP 1KDWA 5GLBA 1LSXA 3EWKA 3OCNA 4FD8A 3FWLA 3VOZA 3W2ZA 2Y8HA 2XROA 2Y2NA 3W4OA 4WL9A 2AVXA 4JLFA 1KGEA 4KZ9A 1GHPA 4KZAA 5HL1A 2OWJA 4K0WA 4PPRA 3D9YA 4HJ4A 3CUEC 3CJMA 4WN5A 3TW8A 5EM1A 4DE0A 2W0NA 1BTLA 4GW9A 5FATA 4CLCE 3UPOA 4GOGA 4KZ8A 5DKLA 3LIFA 1PZOA 3PBNA 3LFVA 1K57A 3NI9A 2EXAA 4U0TA 3PBOA 3NOTC 1QMFA 2Y59A 1IELA 2B02A 2OLUA 2WKQA 4FH2A 3EOIA 4RX3A 5CEBA 3NCKA 1XPBA 1XA7A 3BRMA 4HEFA 4ETXA 2XGNA 1D7EA 3ZGAB 3UB6A 5FQKA 2ZC4B 3BWLA 3UE3A 2VV6A 2QYBA 1KVLA 4X1MA 2PYRA 1KE4A 1OJ5A 2V2FF 1Z6FA 2FFYA 2PD8A 2Y2OA 4MLLA 3UMDA 1M40A 2WZXA 2Q9MA 4CLCC 1P9WA 3C7VA 2K7SA 1YPRA 4UQIM 3G35A 1HTZA 5LBRA 5FA7A 5HL6A 3ITAA 1P97A 2INWA 5TBMB 2ZQ8A 2K2NA 4GCZA 5I5LA 5E2EA 1NZOA 1PNEA 4EWFA 3KYEA 3UDXA 4P6BA 3E4PA 2W27A 5E43A 1HD8A 4HY8A 1NLYA 1G6AA 3BFGA 5HARA 2O9CA 5F83A 3H9WA 1YLWA 5IHVA 3UE1A 3ZNYA 4E3OA 5HPIA 3Q82A 2HF6A 2WGWB 4ZDXA 3T12B 5TGFA 2IWCA 3I7JA 2ZC7A 3GV9A 1IEMA 4O0PA 4GDBA 1I5QA 1ACFA 3BY9A 4G3WA 5JYPA 3QP2A 1KOUA 4OQ0A 3SS5A 4CPKA 3WRTA 2IWBA 2E8IA 4OLGA 5EVIB 4X69A 3AGFA 3VOYA 2J8YA 1T1AA 3LIDA 3FPVA 4QU3A 2ZQ9A 4CLCA 3VOLA 5F1GA 2ACGA 3B47A 3ZFZA 3D3OA 1W8YA 1YT4A 2HPBA 3DAVA 3ZQ5A 1IKGA 3NDGA 1CF0A 2ZOIA 1WYCA 5KSCA 4Q0IA 3V5MA 5D3OA 3C38A 4QY6A 4L0LA 4BL3A 5FASA 3ZG7B 1PWCA 4OOLA 2XQZA 3C8CA 4GD8A 4Y15A 1S4RA 2CC1A 5EPHA 2KOIA 2WADA 4R3BA 3IT9A 5F6AA 4UA7A 3Q7ZA 1J9MA 3MQ0A 4KZBA 4WMCA 5IU1A 3UN7A 2JCHA 1PW8A 1Y54A 5HDSA 1ERQA 5L8MA 1ONHA 2Y2PA 1K56D 4LRXC 4NXFA 2PBDP 2FFFB 4OLDA 4ZJ1A 1DP9A 3R7WB 4X55A 2QJ5A 4EXOA 1LI0A 3IWOA 3ITBA 1JVJA 3D4FA 4JXVA 2XRNA 1S1ZA 3VMAA 3V3SA 4MDZA 1PW1A 4EESA 2ZM0A 2YKHA 4R1GA 4GZBA 3W4QA 1XFNA 3F1OB 3F1NA 3H82A 3B42A 4HBTA 1XKZA 3IWQA 2XD1A 4Z1WA 4N9LA 4H6JB 2UWXA 1K4FA 1LT0A 1T1CA 4B4ZA 2ZBBA 3M6HA 2R9WA 3MFDA 1TS7A 3LY4A 2Y55A 1MC0A 4DF6A 2HP5A 2P9VA 3DBAA 1IYOA 4OPZA 2Y2GA 4KENB 3SS3A 2J7VA 3S22A 3UNWA 4I3IA 1ES3A 4HH2A 4X53A 2JN7A 3LCEA 3IX4A 2HGVA 4R23A 4EEUA 5FI2A 4R0QA 3S7NA 1ALQA 3ICYA 1K25A 2VZWA 2RCXA 5EVEA 1VETB 3LR5A 4Y0UA 1OTBA 4YWZA 2JHEA 4R3JA 2Y2MA 4ARZA 5DF7A 1BT5A 2ZM8A 3F1PA 2KDKA 3MZDA 3NECA 4KZ5A 5DVAA 2VV7A 3ZVTA 1KE3A 1H3QA 3T1RA 4E3LA 1XA1A 2HJEA 4LV1A 3IX3A 3T1QB 4HP4A 3KSFA 5FI6A 3IQAA 4X56A 1CK3A 2ZL1A 4R70A 1MWSA 3LIBA 3HLWA 1ZKJA 1XJ4A 1TF1A 1V9YA 4HBUA 2JKTM 4KQOA 3UB9A 4CLCD 4LCMA 3N4IA 4OPRA 4MBFA 1QMEA 3JVVA 3RTYA 1SKOB 4LRZE 2Y2IA 3FZCA 5TR7A 3MFXA 5FAOA 3TJZC 2JKRM 3UB7A 3V39A 3LR0A 2HDRA 4U3TA 1XJ6A 2X71A 4E3MA 4LLOB 1JTGA 4X6TA 3GVBA
chains in the Genus database with same CATH topology
4P85A 2J9PA 1MWRA 3BEBA 4EBNA 1GA0A 1Q2PA 4P87A 4Z9QA 1KDSA 3N6IA 5A91A 3GRJA 1L0EA 5GLAA 1K6SA 5DTKA 3DTMA 1S6RA 5EVIA 1KDWA 3V50A 4S2MA 1YLJA 3EQUA 2PU2A 4MNRA 4OP8A 5GLBA 5DTSA 4FD8A 1YLYA 3OCNA 3FWLA 3VOZA 1CEFA 1BLSA 2Y2NA 3W4OA 3RXWA 5CXWA 4WYYA 3PAEA 1KE0A 1IYSA 1E25A 4JLFA 3WS0A 5DTTA 1L2SA 2WKIA 4WMCD 1LL9A 5CTMA 1KGEA 4KZ9A 1GHPA 1RGYA 4KZAA 5HL1A 4K0WA 4OOMA 4C3QA 4PPRA 4WEJA 1ES2A 1BLCA 4OQIA 2ZQAA 3O3VA 5EOEA 3VSLA 1TDGA 2VGKA 4KZ4A 3PAGA 3CJMA 1BULA 4DE0A 1HVBA 3FKVA 1BTLA 1YLPA 5FATA 2V20A 2EX8A 4FH4A 3WS4A 4OP5A 1K55A 3C4PA 5FQJA 3S1YA 1XX2A 2A49A 3UPOA 3TOIA 4GOGA 4ZJ2A 4KZ8A 3IF6A 4GN2A 5A92A 1PZOA 2P9VB 3PBNA 3QNBA 1H5XA 2WKEA 1K57A 3NI9A 4E6WA 5M19A 2EXAA 5U47A 1EI5A 4U0TA 4JKTA 2B5RA 3PBOA 2Z2LB 3VSKA 2WZZA 3M6BA 2H0TA 3GTCA 1QMFA 2GDNA 2Y59A 5I94A 1BSGA 1IELA 1DJCA 5EVIC 4MBKA 3RXXA 4N9KA 2OLUA 4FH2A 1WE4A 1PWGA 4RX3A 5CEBA 3MXRA 3NCKA 1XA7A 1XPBA 2JE5A 3BRMA 4HEFA 4A5RA 2XGNA 1PI4A 1EROA 5DF9A 4DDYA 3ZGAB 3S4XA 1BUEA 5FQKA 4JF4A 4R4RA 4QB8A 4BJPA 4EBPA 4XUZA 5GLCA 1MWUA 2ZC4B 1N4OA 3HVFA 3MZFA 3CMZA 3GQZA 3UE3A 4OKPA 2EFXA 3CZDA 2ZQDA 3HLGA 4QY5A 4RYEA 3SOIA 4WBGA 3UDFA 4F94A 1KVLA 2XDMA 2XR0A 4ZAMA 2Y2KA 2H0YA 3DW0A 1KE4A 1GCEA 2QZ6A 4E3IA 2HDSA 4LV3A 2V2FF 3A3IA 2ZJ9A 1Z6FA 2QMIA 4QJGA 1SCWA 3N8SA 2FFYA 1K55C 2Y2OA 4Y0OA 1FCOA 4MLLA 3N8RA 1M40A 1DJBA 3VP1A 2WZXA 2Q9MA 3TG9A 3WS2A 4S2NA 2XFTA 3PBSA 3IF6C 4PM8A 5EOOA 3C7VA 1XGJA 4HESA 3FYZA 1K57C 1C3BA 2Y91A 3G35A 4EQIA 1HTZA 5AQAA 3OC2A 3GR2A 3NBLA 1CEGA 5FA7A 3HL9A 1U60A 3ISGA 2WKHA 2XFSA 3OPRA 3ITAA 3GSGA 4GDNA 2XEPA 1H8YA 3IH9A 1TEMA 5FQMA 3ZG0A 4WELA 3A3FA 3N8LA 2ZQ8A 2WGVA 4CJNA 1PI5A 1LL5A 1Q2QA 4IVIA 3VFHA 5E2EA 2EX6A 1NZOA 3C7UA 3WS1A 4EWFA 3UDXA 3BFDA 4PM7A 4P6BA 4C75A 4ZTKA 3BYDA 4NETA 2BG1A 4KG5A 2WK0A 5E43A 1HD8A 3P98A 1DY6A 1XXMA 4Y7PA 1JTDA 1G6AA 3BFGA 3BLMA 4N1XA 4OH0A 1KVMA 2EXBA 1YMSA 3E2LA 3EQVA 4D2OA 5CEDA 5HARA 3W4PA 4JF6A 2WYXA 2Y2HA 3UE1A 5F83A 3ZNYA 1YLWA 5IHVA 3MKFA 4DE2A 4E3OA 3Q82A 4FSFA 2WGWB 5AQ9A 5HAIA 4ZDXA 4KQRA 5GHZA 4U0XA 5TGFA 2IWCA 3I7JA 2ZC7A 2ZC6B 3GV9A 1IEMA 1FOFA 3LO7A 4S2KA 4GDBA 1KGFA 1I5QA 2WGIA 3BFCA 1I2SA 3G2ZA 2EX2A 2ZMAA 3OCLA 5JYPA 1NRFA 1XP4A 4E3NA 5A90A 3OZHA 3NC8A 2XLNA 1K54C 4OQ0A 3SS5A 4DE1A 5HX9A 2P74A 4CPKA 4S2IA 3PBTA 3WRTA 4S2NC 2J9OA 2I72A 4PM9A 5AQ7A 2IWBA 1SDNA 2E8IA 3IXHA 4KG6A 4OLGA 1E4DA 4X69A 4LCLA 5EVIB 3AGFA 3VOYA 2J8YA 5CGWA 5TFQA 5CRFA 1L0GA 1S0WA 1E3UD 3Q1FA 2EFUA 1IKIA 2Y2LA 1TVFA 1MKIA 2ZQ9A 1K38A 1CI9A 1M6KA 3HLFA 3BFFA 3NDEA 4MBHA 4OQGA 2WUQA 4UA6A 4JXGA 2C5WB 5F1GA 2Z2MB 4M3KA 2DRWA 5EE8A 4IEDA 3ZFZA 1L0DA 3MBZA 4OPYA 1W8YA 3SH7A 1VQQA 4DRTA 1YT4A 2HPBA 1K6RA 1JWZA 1IKGA 5CGSA 3NDGA 1SDEA 1FR1A 4O7DA 1FSYA 1IYQA 4N1HA 3O86A 2Y2JA 3Q81A 3MZEA 1WYCA 5J8XA 5KSCA 2PU4A 3CG5A 1MBLA 3V5MA 1ERMA 1L0FA 4OOYA 4S2LA 5FQQA 3QNCA 5D3OA 3M2JA 4QY6A 4GB7A 5F82A 2X02A 3N7WA 5DF8A 1XGIA 4L0LA 4BL3A 5FASA 3ZG7B 4LV2A 1I2WA 1PWCA 3DWZA 4WZ5A 4KZ3A 1NJ4A 4OOLA 4OVDA 2XQZA 4PMAA 5EVID 3IF6B 1MXOA 2C6WB 2DNSA 2A3UA 1NYMA 4GD8A 5HW3A 4WM9A 4UHUA 3MXSA 3UDIA 2OSUA 5FI7A 5CECA 1NYYA 4DXBA 2CC1A 3AGDA 4P0MA 5EPHA 3SH9A 3M2KA 1BLPA 2WADA 5GL9A 4EV4A 4R3BA 1FQGA 3IT9A 1ZG6A 3G34A 4BD1A 1PYYA 4KQQA 3G32A 1YLTA 1VM1A 1YMXA 4UA7A 3TSGA 5GHXA 1BLHA 3IXDA 1K54A 3Q7ZA 3WWXA 1J9MA 5E2FA 1NZUA 4BD0A 4KZBA 4WMCA 3UN7A 3BM6A 2JCHA 5HAQA 4DDSA 4OQHA 1SHVA 1PW8A 1Y54A 4B88A 1NXYA 2XK1A 1ERQA 3ZG9B 1ESIA 1ONHA 3Q7VA 5CGXA 5E2HA 2Y2PA 1K56D 2BLSA 4IBRA 4WZ4A 4DXCA 2ZC3B 2IWDA 1RCJA 3G31A 3GMWA 1O7EA 1GA9A 3NY4A 1FCNA 3ZNTA 2FFFB 4OLDA 2JBFA 4YINA 4ZJ1A 2XF3A 4IVKA 4X55A 1E3UA 5E2GA 4XXRA 4KZ6A 4UAAA 1RP5A 4NK3A 5KZHA 1LI0A 3HUNA 2Y4AA 1KGGA 3IWOA 1BZAA 5GLDA 3ZG5A 3ITBA 1AXBA 2HDQA 4H8RA 3O88A 1JVJA 4R4SA 3VP0A 3ZG8B 4WZ5C 5JYOA 3D4FA 3FKWA 4JXVA 3VMAA 3V3SA 3AGEA 3LEZA 3HLBA 3UPNA 3HUMA 3UY6A 1PW1A 3DWKA 3Q7VB 3IF5A 2ZM0A 3G2YA 4R1GA 5AQBA 4GZBA 3ZVWA 4KG2A 1RGZA 3JYIA 1K4EA 1HZOA 4JBFA 4BQMA 3SH8A 3W4QA 3UE0A 1W5DA 2Q9NA 5CTNA 4HBTA 1XKZA 3IWQA 2XD1A 1PIOA 4WEKA 3G4PA 4LV0A 3C5AA 4X68A 3ZDJA 3HREA 5BOHA 2WAFA 1ONGA 4N9LA 2UWXA 1K4FA 3PTEA 2ZQ7A 4B4ZA 2QPNA 3M6HA 2R9WA 1ES4A 3MFDA 4BENA 3LY4A 1NY0A 4E6XA 5M18A 3SS4A 3IXGA 1GHMA 4ZJ3A 2G2UA 2Y55A 2OV5A 4N92A 2WAEA 4S2OA 4E3KA 4DF6A 5M1AA 2HP5A 2P9VA 4JF5A 5FAPA 1IYOA 2X01A 1LLBA 4OPZA 5A93A 2Y2GA 4KENB 1CI8A 5CHJA 3IH8A 5HAPA 3C4OA 5FQIA 2J7VA 3SS3A 4DE3A 3S22A 3WRZA 3MKEA 2PBYA 3UNWA 3G30A 3PBRA 3ZHHA 4BL2A 4ID4A 1MWTA 2ZC5B 3FV7A 1MPLA 1PZPA 4FCFA 1ES3A 2ZD8A 3IXBA 3HLCA 1SKFA 3E2KA 4X53A 2V1ZA 4RX2A 1OMEA 1K56A 3LCEA 4QU3A 2VGJA 2HP6A 4S2PA 4QD4A 4R23A 4Y0TA 1W8QA 5EVLA 5FI2A 3B3XA 3NIAA 4R0QA 3UO9A 3HUOA 4XUXA 2XH9A 2HDUA 1WYBA 3UPPA 3OPHA 4GD6A 1ALQA 1H8ZA 4OONA 3Q07A 5KMWA 1GHIA 1MY8A 2EX9A 1K25A 4K91A 2RCXA 4MEZA 4Y0UA 4JPMA 3OPLA 4R3JA 1YLZA 2Y2MA 3W8KA 4EUZA 5DF7A 4UA9A 1BT5A 2ZM8A 2H10A 3OPPA 1IYPA 3A3JA 4JXWA 4RA7A 3MZDA 4KZ5A 5DVAA 5FDHA 5CERA 4RVAA 3ZVTA 4GKUA 3BLSA 1FSWA 5GHYA 3VFFA 4E3JA 4DKIA 1KE3A 4E3LA 2JC7A 1ES5A 1XA1A 1G68A 4LV1A 4QHCA 2HP9A 3RJUA 3V3RA 2ZM2A 1LHYA 5EUAA 1FCMA 3WS5A 5FI6A 3IQAA 4S2JA 4X56A 3BFEA 1ZG4A 5FAQA 1CK3A 1JWPA 5F1FA 2R9XA 1ESUA 5CHMA 1MWSA 2RL3A 3O87A 1LI9A 2ZQCA 3IHAA 4K0XA 5CHUA 3HLWA 1ZKJA 2OLVA 3IWIA 4JXSA 5KSHA 1TDLA 3P09A 3PBQA 1N9BA 4LENA 4HBUA 3A3DA 4KQOA 4LCMA 1YM1A 3N4IA 5L2FA 1W7FA 2Y2QA 5G18A 3VP4A 3VP2A 3A3EA 4OPRA 4OPQA 3IHBA 4MBFA 1QMEA 4YFMA 1EWZA 4ZBEA 1O07A 4Q8IA 1ZC2A 5HFOA 2Y2IA 5FQ9A 3FZCA 5FSRA 5TR7A 1FR6A 3HLEA 2ZLYA 5FAOA 4IBXA 2DCFA 2WGWA 1JWVA 2G2WA 4BLMA 3V39A 4PM5A 1DJAA 3BECA 2HDRA 4GNUA 4U3TA 2XD5A 2X71A 1W79A 2H5SA 4E3MA 4C6YA 3LY3A 1JTGA 3HLDA 4X6TA 3GVBA 3VP3A 4B4XA 1YQSA 4EBLA 3HBRA 1PWDA 3QHYA 3ZCZA 4KZ7A 5EECA 4PM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P85 A;  2J9P A;  1MWR A;  3BEB A;  4EBN A;  1GA0 A;  1Q2P A;  4P87 A;  4Z9Q A;  1KDS A;  3N6I A;  5A91 A;  3GRJ A;  1L0E A;  5GLA A;  1K6S A;  5DTK A;  3DTM A;  1S6R A;  5EVI A;  1KDW A;  3V50 A;  4S2M A;  1YLJ A;  3EQU A;  2PU2 A;  4MNR A;  4OP8 A;  5GLB A;  5DTS A;  4FD8 A;  1YLY A;  3OCN A;  3FWL A;  3VOZ A;  1CEF A;  1BLS A;  2Y2N A;  3W4O A;  3RXW A;  5CXW A;  4WYY A;  3PAE A;  1KE0 A;  1IYS A;  1E25 A;  4JLF A;  3WS0 A;  5DTT A;  1L2S A;  2WKI A;  4WMC D;  1LL9 A;  5CTM A;  1KGE A;  4KZ9 A;  1GHP A;  1RGY A;  4KZA A;  5HL1 A;  4K0W A;  4OOM A;  4C3Q A;  4PPR A;  4WEJ A;  1ES2 A;  1BLC A;  4OQI A;  2ZQA A;  3O3V A;  5EOE A;  3VSL A;  1TDG A;  2VGK A;  4KZ4 A;  3PAG A;  3CJM A;  1BUL A;  4DE0 A;  1HVB A;  3FKV A;  1BTL A;  1YLP A;  5FAT A;  2V20 A;  2EX8 A;  4FH4 A;  3WS4 A;  4OP5 A;  1K55 A;  3C4P A;  5FQJ A;  3S1Y A;  1XX2 A;  2A49 A;  3UPO A;  3TOI A;  4GOG A;  4ZJ2 A;  4KZ8 A;  3IF6 A;  4GN2 A;  5A92 A;  1PZO A;  2P9V B;  3PBN A;  3QNB A;  1H5X A;  2WKE A;  1K57 A;  3NI9 A;  4E6W A;  5M19 A;  2EXA A;  5U47 A;  1EI5 A;  4U0T A;  4JKT A;  2B5R A;  3PBO A;  2Z2L B;  3VSK A;  2WZZ A;  3M6B A;  2H0T A;  3GTC A;  1QMF A;  2GDN A;  2Y59 A;  5I94 A;  1BSG A;  1IEL A;  1DJC A;  5EVI C;  4MBK A;  3RXX A;  4N9K A;  2OLU A;  4FH2 A;  1WE4 A;  1PWG A;  4RX3 A;  5CEB A;  3MXR A;  3NCK A;  1XA7 A;  1XPB A;  2JE5 A;  3BRM A;  4HEF A;  4A5R A;  2XGN A;  1PI4 A;  1ERO A;  5DF9 A;  4DDY A;  3ZGA B;  3S4X A;  1BUE A;  5FQK A;  4JF4 A;  4R4R A;  4QB8 A;  4BJP A;  4EBP A;  4XUZ A;  5GLC A;  1MWU A;  2ZC4 B;  1N4O A;  3HVF A;  3MZF A;  3CMZ A;  3GQZ A;  3UE3 A;  4OKP A;  2EFX A;  3CZD A;  2ZQD A;  3HLG A;  4QY5 A;  4RYE A;  3SOI A;  4WBG A;  3UDF A;  4F94 A;  1KVL A;  2XDM A;  2XR0 A;  4ZAM A;  2Y2K A;  2H0Y A;  3DW0 A;  1KE4 A;  1GCE A;  2QZ6 A;  4E3I A;  2HDS A;  4LV3 A;  2V2F F;  3A3I A;  2ZJ9 A;  1Z6F A;  2QMI A;  4QJG A;  1SCW A;  3N8S A;  2FFY A;  1K55 C;  2Y2O A;  4Y0O A;  1FCO A;  4MLL A;  3N8R A;  1M40 A;  1DJB A;  3VP1 A;  2WZX A;  2Q9M A;  3TG9 A;  3WS2 A;  4S2N A;  2XFT A;  3PBS A;  3IF6 C;  4PM8 A;  5EOO A;  3C7V A;  1XGJ A;  4HES A;  3FYZ A;  1K57 C;  1C3B A;  2Y91 A;  3G35 A;  4EQI A;  1HTZ A;  5AQA A;  3OC2 A;  3GR2 A;  3NBL A;  1CEG A;  5FA7 A;  3HL9 A;  1U60 A;  3ISG A;  2WKH A;  2XFS A;  3OPR A;  3ITA A;  3GSG A;  4GDN A;  2XEP A;  1H8Y A;  3IH9 A;  1TEM A;  5FQM A;  3ZG0 A;  4WEL A;  3A3F A;  3N8L A;  2ZQ8 A;  2WGV A;  4CJN A;  1PI5 A;  1LL5 A;  1Q2Q A;  4IVI A;  3VFH A;  5E2E A;  2EX6 A;  1NZO A;  3C7U A;  3WS1 A;  4EWF A;  3UDX A;  3BFD A;  4PM7 A;  4P6B A;  4C75 A;  4ZTK A;  3BYD A;  4NET A;  2BG1 A;  4KG5 A;  2WK0 A;  5E43 A;  1HD8 A;  3P98 A;  1DY6 A;  1XXM A;  4Y7P A;  1JTD A;  1G6A A;  3BFG A;  3BLM A;  4N1X A;  4OH0 A;  1KVM A;  2EXB A;  1YMS A;  3E2L A;  3EQV A;  4D2O A;  5CED A;  5HAR A;  3W4P A;  4JF6 A;  2WYX A;  2Y2H A;  3UE1 A;  5F83 A;  3ZNY A;  1YLW A;  5IHV A;  3MKF A;  4DE2 A;  4E3O A;  3Q82 A;  4FSF A;  2WGW B;  5AQ9 A;  5HAI A;  4ZDX A;  4KQR A;  5GHZ A;  4U0X A;  5TGF A;  2IWC A;  3I7J A;  2ZC7 A;  2ZC6 B;  3GV9 A;  1IEM A;  1FOF A;  3LO7 A;  4S2K A;  4GDB A;  1KGF A;  1I5Q A;  2WGI A;  3BFC A;  1I2S A;  3G2Z A;  2EX2 A;  2ZMA A;  3OCL A;  5JYP A;  1NRF A;  1XP4 A;  4E3N A;  5A90 A;  3OZH A;  3NC8 A;  2XLN A;  1K54 C;  4OQ0 A;  3SS5 A;  4DE1 A;  5HX9 A;  2P74 A;  4CPK A;  4S2I A;  3PBT A;  3WRT A;  4S2N C;  2J9O A;  2I72 A;  4PM9 A;  5AQ7 A;  2IWB A;  1SDN A;  2E8I A;  3IXH A;  4KG6 A;  4OLG A;  1E4D A;  4X69 A;  4LCL A;  5EVI B;  3AGF A;  3VOY A;  2J8Y A;  5CGW A;  5TFQ A;  5CRF A;  1L0G A;  1S0W A;  1E3U D;  3Q1F A;  2EFU A;  1IKI A;  2Y2L A;  1TVF A;  1MKI A;  2ZQ9 A;  1K38 A;  1CI9 A;  1M6K A;  3HLF A;  3BFF A;  3NDE A;  4MBH A;  4OQG A;  2WUQ A;  4UA6 A;  4JXG A;  2C5W B;  5F1G A;  2Z2M B;  4M3K A;  2DRW A;  5EE8 A;  4IED A;  3ZFZ A;  1L0D A;  3MBZ A;  4OPY A;  1W8Y A;  3SH7 A;  1VQQ A;  4DRT A;  1YT4 A;  2HPB A;  1K6R A;  1JWZ A;  1IKG A;  5CGS A;  3NDG A;  1SDE A;  1FR1 A;  4O7D A;  1FSY A;  1IYQ A;  4N1H A;  3O86 A;  2Y2J A;  3Q81 A;  3MZE A;  1WYC A;  5J8X A;  5KSC A;  2PU4 A;  3CG5 A;  1MBL A;  3V5M A;  1ERM A;  1L0F A;  4OOY A;  4S2L A;  5FQQ A;  3QNC A;  5D3O A;  3M2J A;  4QY6 A;  4GB7 A;  5F82 A;  2X02 A;  3N7W A;  5DF8 A;  1XGI A;  4L0L A;  4BL3 A;  5FAS A;  3ZG7 B;  4LV2 A;  1I2W A;  1PWC A;  3DWZ A;  4WZ5 A;  4KZ3 A;  1NJ4 A;  4OOL A;  4OVD A;  2XQZ A;  4PMA A;  5EVI D;  3IF6 B;  1MXO A;  2C6W B;  2DNS A;  2A3U A;  1NYM A;  4GD8 A;  5HW3 A;  4WM9 A;  4UHU A;  3MXS A;  3UDI A;  2OSU A;  5FI7 A;  5CEC A;  1NYY A;  4DXB A;  2CC1 A;  3AGD A;  4P0M A;  5EPH A;  3SH9 A;  3M2K A;  1BLP A;  2WAD A;  5GL9 A;  4EV4 A;  4R3B A;  1FQG A;  3IT9 A;  1ZG6 A;  3G34 A;  4BD1 A;  1PYY A;  4KQQ A;  3G32 A;  1YLT A;  1VM1 A;  1YMX A;  4UA7 A;  3TSG A;  5GHX A;  1BLH A;  3IXD A;  1K54 A;  3Q7Z A;  3WWX A;  1J9M A;  5E2F A;  1NZU A;  4BD0 A;  4KZB A;  4WMC A;  3UN7 A;  3BM6 A;  2JCH A;  5HAQ A;  4DDS A;  4OQH A;  1SHV A;  1PW8 A;  1Y54 A;  4B88 A;  1NXY A;  2XK1 A;  1ERQ A;  3ZG9 B;  1ESI A;  1ONH A;  3Q7V A;  5CGX A;  5E2H A;  2Y2P A;  1K56 D;  2BLS A;  4IBR A;  4WZ4 A;  4DXC A;  2ZC3 B;  2IWD A;  1RCJ A;  3G31 A;  3GMW A;  1O7E A;  1GA9 A;  3NY4 A;  1FCN A;  3ZNT A;  2FFF B;  4OLD A;  2JBF A;  4YIN A;  4ZJ1 A;  2XF3 A;  4IVK A;  4X55 A;  1E3U A;  5E2G A;  4XXR A;  4KZ6 A;  4UAA A;  1RP5 A;  4NK3 A;  5KZH A;  1LI0 A;  3HUN A;  2Y4A A;  1KGG A;  3IWO A;  1BZA A;  5GLD A;  3ZG5 A;  3ITB A;  1AXB A;  2HDQ A;  4H8R A;  3O88 A;  1JVJ A;  4R4S A;  3VP0 A;  3ZG8 B;  4WZ5 C;  5JYO A;  3D4F A;  3FKW A;  4JXV A;  3VMA A;  3V3S A;  3AGE A;  3LEZ A;  3HLB A;  3UPN A;  3HUM A;  3UY6 A;  1PW1 A;  3DWK A;  3Q7V B;  3IF5 A;  2ZM0 A;  3G2Y A;  4R1G A;  5AQB A;  4GZB A;  3ZVW A;  4KG2 A;  1RGZ A;  3JYI A;  1K4E A;  1HZO A;  4JBF A;  4BQM A;  3SH8 A;  3W4Q A;  3UE0 A;  1W5D A;  2Q9N A;  5CTN A;  4HBT A;  1XKZ A;  3IWQ A;  2XD1 A;  1PIO A;  4WEK A;  3G4P A;  4LV0 A;  3C5A A;  4X68 A;  3ZDJ A;  3HRE A;  5BOH A;  2WAF A;  1ONG A;  4N9L A;  2UWX A;  1K4F A;  3PTE A;  2ZQ7 A;  4B4Z A;  2QPN A;  3M6H A;  2R9W A;  1ES4 A;  3MFD A;  4BEN A;  3LY4 A;  1NY0 A;  4E6X A;  5M18 A;  3SS4 A;  3IXG A;  1GHM A;  4ZJ3 A;  2G2U A;  2Y55 A;  2OV5 A;  4N92 A;  2WAE A;  4S2O A;  4E3K A;  4DF6 A;  5M1A A;  2HP5 A;  2P9V A;  4JF5 A;  5FAP A;  1IYO A;  2X01 A;  1LLB A;  4OPZ A;  5A93 A;  2Y2G A;  4KEN B;  1CI8 A;  5CHJ A;  3IH8 A;  5HAP A;  3C4O A;  5FQI A;  2J7V A;  3SS3 A;  4DE3 A;  3S22 A;  3WRZ A;  3MKE A;  2PBY A;  3UNW A;  3G30 A;  3PBR A;  3ZHH A;  4BL2 A;  4ID4 A;  1MWT A;  2ZC5 B;  3FV7 A;  1MPL A;  1PZP A;  4FCF A;  1ES3 A;  2ZD8 A;  3IXB A;  3HLC A;  1SKF A;  3E2K A;  4X53 A;  2V1Z A;  4RX2 A;  1OME A;  1K56 A;  3LCE A;  4QU3 A;  2VGJ A;  2HP6 A;  4S2P A;  4QD4 A;  4R23 A;  4Y0T A;  1W8Q A;  5EVL A;  5FI2 A;  3B3X A;  3NIA A;  4R0Q A;  3UO9 A;  3HUO A;  4XUX A;  2XH9 A;  2HDU A;  1WYB A;  3UPP A;  3OPH A;  4GD6 A;  1ALQ A;  1H8Z A;  4OON A;  3Q07 A;  5KMW A;  1GHI A;  1MY8 A;  2EX9 A;  1K25 A;  4K91 A;  2RCX A;  4MEZ A;  4Y0U A;  4JPM A;  3OPL A;  4R3J A;  1YLZ A;  2Y2M A;  3W8K A;  4EUZ A;  5DF7 A;  4UA9 A;  1BT5 A;  2ZM8 A;  2H10 A;  3OPP A;  1IYP A;  3A3J A;  4JXW A;  4RA7 A;  3MZD A;  4KZ5 A;  5DVA A;  5FDH A;  5CER A;  4RVA A;  3ZVT A;  4GKU A;  3BLS A;  1FSW A;  5GHY A;  3VFF A;  4E3J A;  4DKI A;  1KE3 A;  4E3L A;  2JC7 A;  1ES5 A;  1XA1 A;  1G68 A;  4LV1 A;  4QHC A;  2HP9 A;  3RJU A;  3V3R A;  2ZM2 A;  1LHY A;  5EUA A;  1FCM A;  3WS5 A;  5FI6 A;  3IQA A;  4S2J A;  4X56 A;  3BFE A;  1ZG4 A;  5FAQ A;  1CK3 A;  1JWP A;  5F1F A;  2R9X A;  1ESU A;  5CHM A;  1MWS A;  2RL3 A;  3O87 A;  1LI9 A;  2ZQC A;  3IHA A;  4K0X A;  5CHU A;  3HLW A;  1ZKJ A;  2OLV A;  3IWI A;  4JXS A;  5KSH A;  1TDL A;  3P09 A;  3PBQ A;  1N9B A;  4LEN A;  4HBU A;  3A3D A;  4KQO A;  4LCM A;  1YM1 A;  3N4I A;  5L2F A;  1W7F A;  2Y2Q A;  5G18 A;  3VP4 A;  3VP2 A;  3A3E A;  4OPR A;  4OPQ A;  3IHB A;  4MBF A;  1QME A;  4YFM A;  1EWZ A;  4ZBE A;  1O07 A;  4Q8I A;  1ZC2 A;  5HFO A;  2Y2I A;  5FQ9 A;  3FZC A;  5FSR A;  5TR7 A;  1FR6 A;  3HLE A;  2ZLY A;  5FAO A;  4IBX A;  2DCF A;  2WGW A;  1JWV A;  2G2W A;  4BLM A;  3V39 A;  4PM5 A;  1DJA A;  3BEC A;  2HDR A;  4GNU A;  4U3T A;  2XD5 A;  2X71 A;  1W79 A;  2H5S A;  4E3M A;  4C6Y A;  3LY3 A;  1JTG A;  3HLD A;  4X6T A;  3GVB A;  3VP3 A;  4B4X A;  1YQS A;  4EBL A;  3HBR A;  1PWD A;  3QHY A;  3ZCZ A;  4KZ7 A;  5EEC A;  4PM6 A; 
#chains in the Genus database with same CATH topology
 4P85 A;  3BEB A;  1GA0 A;  4P87 A;  4BBT A;  4P6Z M;  1L0E A;  1K6S A;  2LB9 A;  3EQU A;  4EET B;  5TJJ A;  1G28 A;  4JGO A;  5F5Y A;  4DN0 A;  2ZMV A;  1S4S A;  3NHQ A;  3WS0 A;  5DTT A;  1L2S A;  2WKI A;  1DP8 A;  4WMC D;  5EM0 A;  1LL9 A;  5CTM A;  1P0Z A;  3SZT A;  5MC7 A;  4WEJ A;  1MZU A;  4OQI A;  3O3V A;  3VSL A;  4KZ4 A;  3E4O A;  3FKV A;  3NOU C;  2V20 A;  2EX8 A;  4FH4 A;  3T1S A;  3WS4 A;  1K55 A;  4O8G A;  4ZJ2 A;  4DJ2 A;  4GN2 A;  3IF6 A;  1N9L A;  4HI4 A;  3QNB A;  2BAS A;  3NOP C;  5M19 A;  1OJG A;  2B5R A;  4Y17 A;  2Z2L B;  2L4R A;  2WZZ A;  3A0R A;  2KX6 A;  3GTC A;  1BSG A;  1DJC A;  3BQA A;  2V9A A;  1SZV A;  4N9K A;  2V8F A;  3LR4 A;  2W3H A;  3MXR A;  1ERO A;  1VEU B;  5DF9 A;  4BBU A;  4GHI B;  2VJW A;  4DDY A;  2NUP C;  3CI6 A;  1FIK A;  4R4R A;  4QB8 A;  4XUZ A;  1N4O A;  3CMZ A;  3CZD A;  2OAQ 1;  3SOI A;  4WBG A;  4F94 A;  2J80 A;  2VV8 A;  1OTI A;  5HDC A;  3HJI A;  4IUK A;  4Y0O A;  1FCO A;  3VP1 A;  5J4E A;  3TG9 A;  3WS2 A;  2XFT A;  3MQO A;  5EOO A;  1XGJ A;  4HES A;  1K57 C;  1C3B A;  3OC2 A;  4YOF A;  3OPR A;  3GSG A;  5FQM A;  3MR0 A;  5L09 A;  2M7V A;  4FOF A;  1LL5 A;  3VFH A;  3WS1 A;  4PM7 A;  4C75 A;  3BYD A;  4NET A;  4KG5 A;  2W1R A;  5G4Z A;  3CPT A;  4OH0 A;  2EXB A;  3K3C A;  3EQV A;  2DMW A;  4JF6 A;  5AQ9 A;  5HAI A;  2E8J A;  2QWS A;  4KQR A;  4U0X A;  4JGR A;  2ZC6 B;  1PFL A;  4G3K A;  1I2S A;  2ZMA A;  4E04 A;  3LI9 A;  5HZH A;  1NRF A;  1XP4 A;  2JKG A;  5A90 A;  3NC8 A;  1K54 C;  3B33 A;  5HX9 A;  4Y3I A;  1OTE A;  2J9O A;  4PM9 A;  5AQ7 A;  3NJA A;  1W63 Q;  3KYZ A;  3BJN A;  5CGW A;  5TFQ A;  5CRF A;  1OPX A;  4MN5 A;  1E3U D;  1TVF A;  3HJK A;  4MBH A;  1K38 A;  4FUW A;  5EFW A;  2WUQ A;  4JXG A;  2DRW A;  3CAX A;  4I5S A;  3T4O A;  4QPR A;  1SDE A;  2GNX A;  2KLI A;  3O86 A;  1DRM A;  3H7W B;  3UB8 A;  1L0F A;  4OOY A;  3M2J A;  5F82 A;  4GB7 A;  2PYP A;  1XGI A;  4LV2 A;  3DTE A;  4KZ3 A;  4CLC B;  2C6W B;  1Y4O A;  2A3U A;  4UHU A;  4CQH A;  3UDI A;  4P0M A;  4R6L A;  2V8C A;  3P01 A;  1FQG A;  1ZG6 A;  4BD1 A;  3JPU A;  4KQQ A;  1VM1 A;  1YMX A;  1K54 A;  3IBR A;  3WWX A;  1YAX A;  3UE6 A;  4F3L A;  2Q0O A;  5HWV A;  1SHV A;  4B88 A;  1NXY A;  3ZG9 B;  5E2H A;  1OT9 A;  2Z6D A;  2BLS A;  4WZ4 A;  4DXC A;  1LL8 A;  4II7 A;  1O7E A;  1FCN A;  3ZNT A;  2D01 A;  4YIN A;  4XXR A;  2XSS A;  1RP5 A;  4MCW A;  4NK3 A;  5KZH A;  2Y4A A;  1KGG A;  5GLD A;  3K2N A;  3CLO A;  3VP0 A;  4JGQ A;  3AGE A;  3LEZ A;  3UY6 A;  2L0W A;  5L10 A;  4KG2 A;  1HZO A;  1W5D A;  5DFX A;  3EEA A;  4X25 A;  3O5Y A;  4WEK A;  2P7J A;  4EEP A;  3C5A A;  4X68 A;  4B93 A;  5BOH A;  1ONG A;  1GSX A;  2PR6 A;  5M18 A;  3IXG A;  2G2U A;  4GS9 A;  4JF5 A;  5A93 A;  1CI8 A;  3IH8 A;  4NG2 A;  3C4O A;  3H82 B;  3S7P A;  1VHM A;  1XJ3 A;  2HV1 A;  3E98 A;  3MKE A;  4DE3 A;  4BBV A;  3IXB A;  1SKF A;  1OTD A;  1OME A;  4HQA A;  4HNB A;  4QD4 A;  1T19 A;  2W1T B;  3B3X A;  3NIA A;  3HUO A;  2XH9 A;  2HDU A;  2YKF A;  2ZOH A;  2Y79 A;  3MMH A;  1LSV A;  1GHI A;  1MY8 A;  2EX9 A;  2M7U A;  5HD5 A;  4JPM A;  2OWH A;  3BY8 A;  4NXB A;  3LIE A;  4UA9 A;  1Y28 A;  2ZMF A;  4PKY A;  3A3J A;  4L9F A;  4Q0J A;  5FDH A;  4RVA A;  3T4J A;  4GKU A;  4NXG A;  4D60 A;  5GHY A;  4DKI A;  2M1C A;  4NXE A;  1ES5 A;  2HP9 A;  2ZM2 A;  1ZHH B;  2OOL A;  5EUA A;  3LI8 A;  4S2J A;  2A2L A;  1ZG4 A;  3BFE A;  2J3W A;  1OT6 A;  1ESU A;  5CHM A;  2RL3 A;  5TBM A;  2ZQC A;  3U2A A;  3IWI A;  1TDL A;  3P09 A;  3PBQ A;  4ARZ B;  4LEN A;  3FPW A;  1G5U A;  2Y2Q A;  5G18 A;  3VP4 A;  4OPQ A;  2G7U A;  5J7E A;  1NWZ A;  1ZC2 A;  3HLE A;  2ZLY A;  2QHK A;  2WGW A;  4BLM A;  5EV0 A;  3BEC A;  4Q0H A;  1W79 A;  2H5S A;  1W63 M;  4B4X A;  2L1M A;  2J3T D;  4HIA A;  1PWD A;  4KZ7 A;  5EEC A;  3BW6 A;  2PR5 A;  1MWR A;  1KDS A;  1NLZ A;  1F5M A;  5DTK A;  4HJ3 A;  3DTM A;  1S6R A;  5EVI A;  4B9O A;  1YLJ A;  4MNR A;  4OP8 A;  1YLY A;  4PKY G;  3E0Y A;  4LRY C;  2VKS A;  2O9A A;  4WYY A;  2V0U A;  5G4Y A;  3UB5 P;  1RGY A;  3R4K A;  4OOM A;  5EOE A;  4MN6 A;  2EWV A;  1BUL A;  1HVB A;  4IUH A;  2W3F A;  5CX7 A;  1YLP A;  4OP5 A;  3MXQ A;  3C4P A;  5FQJ A;  3S1Y A;  1XX2 A;  4EW7 A;  2A49 A;  5A92 A;  1H5X A;  2WKE A;  3M6B A;  2GDN A;  3VE4 A;  5I94 A;  4JGP A;  4MBK A;  3PHY A;  4IJG A;  3D72 A;  4A5R A;  2R78 A;  1PI4 A;  3FG8 A;  4HH3 A;  1BUE A;  4JF4 A;  2Z6C A;  2I9V A;  5GLC A;  2O9B A;  4OKP A;  4QY5 A;  3UDF A;  2XR0 A;  3R7W A;  2Y2K A;  3DW0 A;  3S7O A;  4LV3 A;  3A3I A;  1SCW A;  3N8S A;  2NUT C;  1K55 C;  3N8R A;  1DJB A;  3CHW P;  3IBJ A;  4S2N A;  3PBS A;  3IF6 C;  5AQA A;  3GR2 A;  3GEC A;  3NBL A;  1U60 A;  3ISG A;  2VK3 A;  3FC7 A;  4GDN A;  4XT2 B;  3F1O A;  1H8Y A;  3IH9 A;  1ODV A;  3ZG0 A;  3A3F A;  1S67 L;  3N8L A;  4WF0 A;  2WGV A;  4CJN A;  1VB6 A;  1Q2Q A;  4HHD A;  4G3V A;  4H6J A;  5DJT A;  2WK0 A;  1DY6 A;  2PDR A;  3BLM A;  4WUJ A;  1UWP X;  1G6O A;  3KX0 X;  2XA7 S;  1YMS A;  1T1B A;  3E2L A;  2VX8 A;  5CED A;  3RH8 B;  3W4P A;  2VGL S;  4FSF A;  2OAP 1;  1EW0 A;  1KGF A;  2EX2 A;  4E3N A;  2XLN A;  1BYW A;  4DE1 A;  3KSH A;  3IS2 B;  3PBT A;  4KUO A;  2I72 A;  3CPT B;  5AJG A;  3IXH A;  3LYX A;  4Y2F A;  1E4D A;  4LCL A;  2HJ9 C;  3U4L P;  2W3D A;  1L0G A;  1S0W A;  2VLG A;  2P04 A;  3Q1F A;  4L9G A;  1IKI A;  1VET A;  2Y2L A;  4OQG A;  1M6K A;  3NDE A;  3C30 A;  2V1B A;  5FEG A;  1PRQ A;  3L7H A;  5HPF A;  1K6R A;  5CGS A;  1FR1 A;  4O7D A;  3HCY A;  4AFI A;  3Q81 A;  2Y2J A;  1F98 A;  3V67 A;  2PT7 A;  5J8X A;  4I38 A;  4FTX A;  2O99 A;  2X02 A;  4HP9 A;  3N7W A;  1N9O A;  4WZ5 A;  1NJ4 A;  4OVD A;  5EVI D;  1MXO A;  4KUK A;  2DNS A;  5HW3 A;  4WM9 A;  3MXS A;  1Z09 A;  4LPZ A;  3AGD A;  4BMW A;  1BLP A;  5GL9 A;  4EV4 A;  2P08 A;  1SKO A;  5GHX A;  4LGW A;  1BLH A;  1JNU A;  1NZU A;  3KYQ A;  3BM6 A;  5HAQ A;  4OQH A;  2XK1 A;  5L07 A;  3Q7V A;  4IBR A;  2IWD A;  5FDS A;  1RCJ A;  3G31 A;  3GMW A;  1L3L A;  2HZ5 A;  3BQ8 A;  3NY4 A;  3EGX C;  2JBF A;  2XF3 A;  4IVK A;  4KZ6 A;  3HUN A;  2J3T C;  2FH5 A;  1BZA A;  3ZG5 A;  1AXB A;  1T18 A;  3ZG8 B;  4GJ4 A;  2A24 A;  2VA0 A;  3MSH A;  4DJ3 A;  2B18 A;  3UPN A;  4UQI S;  5AQB A;  3G2Y A;  3T4L A;  1RGZ A;  3JYI A;  3UE0 A;  2Q9N A;  4HOI A;  1PIO A;  2LB5 A;  4LV0 A;  3HRE A;  2V1A A;  2ZQ7 A;  4M4X A;  2V0W A;  4BEN A;  4E6X A;  3SS4 A;  4NEE D;  2OV5 A;  4E3K A;  1STZ A;  3PR6 A;  4LFU A;  3OLO A;  2PBY A;  4BL2 A;  3PBR A;  1MPL A;  1V9Z A;  3QP4 A;  3A0S A;  3HLC A;  3E2K A;  4RX2 A;  1K56 A;  5HD3 A;  1VEU A;  2VGJ A;  4Y0T A;  4GHI A;  1W8Q A;  5EVL A;  3UO9 A;  3T4K A;  3OPH A;  4GS9 B;  4GD6 A;  5HSQ A;  1H8Z A;  4OON A;  4K91 A;  1XFQ A;  3OPL A;  2H28 A;  3W8K A;  3OPP A;  2H10 A;  3LIA A;  4RA7 A;  3VFF A;  3KSG A;  1H8M A;  4E3J A;  4YNR A;  2JC7 A;  3RJU A;  5IT5 A;  1FCM A;  3WS5 A;  3DTI A;  4I3J A;  2W3E A;  3O87 A;  1LI9 A;  4K0X A;  5CHU A;  3P7N A;  2OLV A;  4Y13 A;  4L9E A;  5F68 A;  5KSH A;  1N9B A;  4NKP A;  1IOU A;  1YM1 A;  4MMN A;  5L2F A;  4MN7 A;  3IHB A;  1K0K A;  4YFM A;  5HWT A;  5HFO A;  5FQ9 A;  3CUE A;  1FR6 A;  3NUL A;  2G2W A;  4PM5 A;  3T4Q A;  4GNU A;  2XD5 A;  4ESP A;  4C6Y A;  3VP3 A;  1YQS A;  4EBL A;  3QHY A;  3ZCZ A;  4PM6 A;  4EBN A;  1Q2P A;  3OOV A;  5A91 A;  3GRJ A;  1UWN X;  3V50 A;  4S2M A;  2PU2 A;  5DTS A;  1CEF A;  3CIT A;  1BLS A;  3RXW A;  5CXW A;  3PAE A;  1KE0 A;  2EWW A;  1IYS A;  1E25 A;  3K3D A;  1GSW A;  1CQA A;  3KO6 A;  5DKK A;  3L9K A;  3F1N B;  4C3Q A;  1ES2 A;  2K31 A;  1BLC A;  3UME A;  2ZQA A;  3IX8 A;  5C5K A;  1TDG A;  2VGK A;  3H7W A;  3PAG A;  5HDD A;  5K5B A;  3PXP A;  5FL3 A;  4UEY A;  5FEF A;  2W3G A;  3TOI A;  3PYP A;  3EGD C;  4PAU A;  2P9V B;  5DJU A;  3T50 A;  4E6W A;  5U47 A;  1EI5 A;  4JKT A;  4I3A A;  3VSK A;  2H0T A;  2EA9 A;  2O0Y A;  5EVI C;  1S66 L;  3RXX A;  3SW1 A;  1WE4 A;  1PWG A;  2PHY A;  5AVF A;  2JE5 A;  3TE8 A;  3EEH A;  3S4X A;  4BJP A;  4EBP A;  1MWU A;  4ETZ A;  3MZF A;  2GZA A;  3HVF A;  3GQZ A;  2EFX A;  2ZQD A;  3HLG A;  4RYE A;  2XDM A;  5A8B A;  4ZAM A;  2H0Y A;  1GCE A;  2QZ6 A;  4E3I A;  2HDS A;  5IS1 A;  2ZJ9 A;  2QMI A;  4QJG A;  3F1P B;  1TS8 A;  4IHQ A;  4PM8 A;  2QJ7 A;  3FYZ A;  4RQ9 A;  4EQ1 A;  2Y91 A;  3LUQ A;  3T4S A;  4EQI A;  1CEG A;  3HL9 A;  2WKH A;  2XFS A;  2ZL1 B;  2XEP A;  1TEM A;  4WEL A;  1HLU P;  5KIZ A;  1PI5 A;  4IVI A;  2EX6 A;  3C7U A;  3GDI A;  3BFD A;  4ZTK A;  2BG1 A;  3P98 A;  1XXM A;  4Y7P A;  1JTD A;  4N1X A;  2PD7 A;  1KVM A;  4GLQ A;  4D2O A;  2WYX A;  2Y2H A;  5DFY A;  4DE2 A;  3MKF A;  5GHZ A;  3LEQ A;  3C2W A;  2D02 A;  4S2K A;  1FOF A;  3LO7 A;  3VV4 A;  2CMN A;  2WGI A;  5AVE A;  3BFC A;  3G2Z A;  3OCL A;  2UV0 E;  1FIL A;  3OZH A;  2P74 A;  4S2I A;  4S2N C;  2W1T A;  4P6Z S;  2JKF A;  1SDN A;  1YSQ A;  4KG6 A;  4WLA A;  1GSV A;  1D1J A;  2EFU A;  1MKI A;  1CI9 A;  3HLF A;  3BFF A;  2PRF A;  4UA6 A;  3MJQ A;  2B95 A;  2C5W B;  2Z2M B;  4ME4 A;  4M3K A;  3TRC A;  4K08 A;  5EE8 A;  4IED A;  1L0D A;  3MBZ A;  4OPY A;  3SH7 A;  4DRT A;  1VQQ A;  1JWZ A;  1FSY A;  1IYQ A;  4N1H A;  4PHT A;  1F9I A;  3MZE A;  2PU4 A;  3CG5 A;  1MBL A;  1ERM A;  1YSP A;  4S2L A;  5FQQ A;  3QNC A;  5DF8 A;  1I2W A;  3DWZ A;  4PMA A;  3IF6 B;  1NYM A;  4ZRR A;  5CEC A;  2OSU A;  5FI7 A;  1NYY A;  4DXB A;  1N9N A;  3SH9 A;  3M2K A;  3G34 A;  1J3W A;  1PYY A;  1XJ2 A;  3G32 A;  1YLT A;  3TSG A;  3IXD A;  5E2F A;  4BD0 A;  4DDS A;  1D06 A;  1F2K A;  1ESI A;  5CGX A;  4EER A;  2ZC3 B;  1GA9 A;  2MJ6 A;  3G6O A;  1IFQ A;  3LR3 A;  5E2G A;  1E3U A;  4UAA A;  3RFB A;  1P9R A;  1CJF A;  2HDQ A;  3QP1 A;  4H8R A;  3O88 A;  3OBF A;  4R4S A;  4WZ5 C;  1S1Y A;  5JYO A;  3FKW A;  3HLB A;  4R3A A;  3HUM A;  4Y5F A;  3DWK A;  1MKM A;  3Q7V B;  3IF5 A;  3LGO A;  3ZVW A;  1K4E A;  4BQM A;  4JBF A;  3SH8 A;  2QKP A;  5CTN A;  4DMZ A;  3G4P A;  3QP6 A;  3ZDJ A;  2WAF A;  3T4T A;  1X0O A;  3MF0 A;  1AWI A;  3PTE A;  1ZTU A;  4QWO A;  2QPN A;  2VEA A;  1ES4 A;  3KSI A;  1NY0 A;  1GHM A;  4ZJ3 A;  2A24 B;  4N92 A;  2WAE A;  4S2O A;  5M1A A;  5FAP A;  2X01 A;  1LLB A;  1OTA A;  3E4Q A;  3VE3 A;  5HWW A;  5CHJ A;  5HAP A;  5FQI A;  3WRZ A;  3G30 A;  1DP6 A;  3ZHH A;  4ID4 A;  1MWT A;  2ZC5 B;  3FV7 A;  1PZP A;  4FCF A;  3QP8 A;  2ZD8 A;  2V1Z A;  1WA9 A;  1LSW A;  4S2P A;  2HP6 A;  4HJ6 A;  3ZYT A;  4XUX A;  1WYB A;  3UPP A;  4I39 A;  1TS0 A;  3Q07 A;  5KMW A;  1A0K A;  5F69 A;  4MEZ A;  1UGU A;  3MQQ A;  5J3W A;  1YLZ A;  4EUZ A;  2WKP A;  1IYP A;  4JXW A;  5CER A;  3BLS A;  1FSW A;  3A0V A;  3MS6 A;  2FZ0 A;  3ULF A;  4QHC A;  1G68 A;  3V3R A;  1LHY A;  4BWI A;  5FAQ A;  5F1F A;  2JKT I;  1JWP A;  4EU0 A;  3S7Q A;  2R9X A;  4XT2 A;  1TS6 A;  3T1X A;  2WKR A;  3IHA A;  4JXS A;  4EUV A;  3A3D A;  2JKR I;  1W7F A;  3VP2 A;  3A3E A;  2XA7 M;  1NRJ A;  1EWZ A;  4X1L A;  1O07 A;  4ZBE A;  4Q8I A;  5FSR A;  1YKD A;  2GX5 A;  2VGL M;  4IBX A;  2DCF A;  4F3L B;  1JWV A;  2GJ3 A;  1DJA A;  4O01 A;  1H0M A;  3DTK A;  3LY3 A;  3HLD A;  3HBR A;  3LIC A;  2J9P A;  3IS2 A;  4R38 A;  3QP5 A;  2BTF P;  3JVU A;  4Z9Q A;  3N6I A;  2IA2 A;  1TD5 A;  4KQD A;  5GLA A;  3CWF A;  2PAV P;  1KDW A;  5GLB A;  1LSX A;  3EWK A;  3OCN A;  4FD8 A;  3FWL A;  3VOZ A;  3W2Z A;  2Y8H A;  2XRO A;  2Y2N A;  3W4O A;  4WL9 A;  2AVX A;  4JLF A;  1KGE A;  4KZ9 A;  1GHP A;  4KZA A;  5HL1 A;  2OWJ A;  4K0W A;  4PPR A;  3D9Y A;  4HJ4 A;  3CUE C;  3CJM A;  4WN5 A;  3TW8 A;  5EM1 A;  4DE0 A;  2W0N A;  1BTL A;  4GW9 A;  5FAT A;  4CLC E;  3UPO A;  4GOG A;  4KZ8 A;  5DKL A;  3LIF A;  1PZO A;  3PBN A;  3LFV A;  1K57 A;  3NI9 A;  2EXA A;  4U0T A;  3PBO A;  3NOT C;  1QMF A;  2Y59 A;  1IEL A;  2B02 A;  2OLU A;  2WKQ A;  4FH2 A;  3EOI A;  4RX3 A;  5CEB A;  3NCK A;  1XPB A;  1XA7 A;  3BRM A;  4HEF A;  4ETX A;  2XGN A;  1D7E A;  3ZGA B;  3UB6 A;  5FQK A;  2ZC4 B;  3BWL A;  3UE3 A;  2VV6 A;  2QYB A;  1KVL A;  4X1M A;  2PYR A;  1KE4 A;  1OJ5 A;  2V2F F;  1Z6F A;  2FFY A;  2PD8 A;  2Y2O A;  4MLL A;  3UMD A;  1M40 A;  2WZX A;  2Q9M A;  4CLC C;  1P9W A;  3C7V A;  2K7S A;  1YPR A;  4UQI M;  3G35 A;  1HTZ A;  5LBR A;  5FA7 A;  5HL6 A;  3ITA A;  1P97 A;  2INW A;  5TBM B;  2ZQ8 A;  2K2N A;  4GCZ A;  5I5L A;  5E2E A;  1NZO A;  1PNE A;  4EWF A;  3KYE A;  3UDX A;  4P6B A;  3E4P A;  2W27 A;  5E43 A;  1HD8 A;  4HY8 A;  1NLY A;  1G6A A;  3BFG A;  5HAR A;  2O9C A;  5F83 A;  3H9W A;  1YLW A;  5IHV A;  3UE1 A;  3ZNY A;  4E3O A;  5HPI A;  3Q82 A;  2HF6 A;  2WGW B;  4ZDX A;  3T12 B;  5TGF A;  2IWC A;  3I7J A;  2ZC7 A;  3GV9 A;  1IEM A;  4O0P A;  4GDB A;  1I5Q A;  1ACF A;  3BY9 A;  4G3W A;  5JYP A;  3QP2 A;  1KOU A;  4OQ0 A;  3SS5 A;  4CPK A;  3WRT A;  2IWB A;  2E8I A;  4OLG A;  5EVI B;  4X69 A;  3AGF A;  3VOY A;  2J8Y A;  1T1A A;  3LID A;  3FPV A;  4QU3 A;  2ZQ9 A;  4CLC A;  3VOL A;  5F1G A;  2ACG A;  3B47 A;  3ZFZ A;  3D3O A;  1W8Y A;  1YT4 A;  2HPB A;  3DAV A;  3ZQ5 A;  1IKG A;  3NDG A;  1CF0 A;  2ZOI A;  1WYC A;  5KSC A;  4Q0I A;  3V5M A;  5D3O A;  3C38 A;  4QY6 A;  4L0L A;  4BL3 A;  5FAS A;  3ZG7 B;  1PWC A;  4OOL A;  2XQZ A;  3C8C A;  4GD8 A;  4Y15 A;  1S4R A;  2CC1 A;  5EPH A;  2KOI A;  2WAD A;  4R3B A;  3IT9 A;  5F6A A;  4UA7 A;  3Q7Z A;  1J9M A;  3MQ0 A;  4KZB A;  4WMC A;  5IU1 A;  3UN7 A;  2JCH A;  1PW8 A;  1Y54 A;  5HDS A;  1ERQ A;  5L8M A;  1ONH A;  2Y2P A;  1K56 D;  4LRX C;  4NXF A;  2PBD P;  2FFF B;  4OLD A;  4ZJ1 A;  1DP9 A;  3R7W B;  4X55 A;  2QJ5 A;  4EXO A;  1LI0 A;  3IWO A;  3ITB A;  1JVJ A;  3D4F A;  4JXV A;  2XRN A;  1S1Z A;  3VMA A;  3V3S A;  4MDZ A;  1PW1 A;  4EES A;  2ZM0 A;  2YKH A;  4R1G A;  4GZB A;  3W4Q A;  1XFN A;  3F1O B;  3F1N A;  3H82 A;  3B42 A;  4HBT A;  1XKZ A;  3IWQ A;  2XD1 A;  4Z1W A;  4N9L A;  4H6J B;  2UWX A;  1K4F A;  1LT0 A;  1T1C A;  4B4Z A;  2ZBB A;  3M6H A;  2R9W A;  3MFD A;  1TS7 A;  3LY4 A;  2Y55 A;  1MC0 A;  4DF6 A;  2HP5 A;  2P9V A;  3DBA A;  1IYO A;  4OPZ A;  2Y2G A;  4KEN B;  3SS3 A;  2J7V A;  3S22 A;  3UNW A;  4I3I A;  1ES3 A;  4HH2 A;  4X53 A;  2JN7 A;  3LCE A;  3IX4 A;  2HGV A;  4R23 A;  4EEU A;  5FI2 A;  4R0Q A;  3S7N A;  1ALQ A;  3ICY A;  1K25 A;  2VZW A;  2RCX A;  5EVE A;  1VET B;  3LR5 A;  4Y0U A;  1OTB A;  4YWZ A;  2JHE A;  4R3J A;  2Y2M A;  4ARZ A;  5DF7 A;  1BT5 A;  2ZM8 A;  3F1P A;  2KDK A;  3MZD A;  3NEC A;  4KZ5 A;  5DVA A;  2VV7 A;  3ZVT A;  1KE3 A;  1H3Q A;  3T1R A;  4E3L A;  1XA1 A;  2HJE A;  4LV1 A;  3IX3 A;  3T1Q B;  4HP4 A;  3KSF A;  5FI6 A;  3IQA A;  4X56 A;  1CK3 A;  2ZL1 A;  4R70 A;  1MWS A;  3LIB A;  3HLW A;  1ZKJ A;  1XJ4 A;  1TF1 A;  1V9Y A;  4HBU A;  2JKT M;  4KQO A;  3UB9 A;  4CLC D;  4LCM A;  3N4I A;  4OPR A;  4MBF A;  1QME A;  3JVV A;  3RTY A;  1SKO B;  4LRZ E;  2Y2I A;  3FZC A;  5TR7 A;  3MFX A;  5FAO A;  3TJZ C;  2JKR M;  3UB7 A;  3V39 A;  3LR0 A;  2HDR A;  4U3T A;  1XJ6 A;  2X71 A;  4E3M A;  4LLO B;  1JTG A;  4X6T A;  3GVB A; 
#chains in the Genus database with same CATH homology
 4P85 A;  2J9P A;  1MWR A;  3BEB A;  4EBN A;  1GA0 A;  1Q2P A;  4P87 A;  4Z9Q A;  1KDS A;  3N6I A;  5A91 A;  3GRJ A;  1L0E A;  5GLA A;  1K6S A;  5DTK A;  3DTM A;  1S6R A;  5EVI A;  1KDW A;  3V50 A;  4S2M A;  1YLJ A;  3EQU A;  2PU2 A;  4MNR A;  4OP8 A;  5GLB A;  5DTS A;  4FD8 A;  1YLY A;  3OCN A;  3FWL A;  3VOZ A;  1CEF A;  1BLS A;  2Y2N A;  3W4O A;  3RXW A;  5CXW A;  4WYY A;  3PAE A;  1KE0 A;  1IYS A;  1E25 A;  4JLF A;  3WS0 A;  5DTT A;  1L2S A;  2WKI A;  4WMC D;  1LL9 A;  5CTM A;  1KGE A;  4KZ9 A;  1GHP A;  1RGY A;  4KZA A;  5HL1 A;  4K0W A;  4OOM A;  4C3Q A;  4PPR A;  4WEJ A;  1ES2 A;  1BLC A;  4OQI A;  2ZQA A;  3O3V A;  5EOE A;  3VSL A;  1TDG A;  2VGK A;  4KZ4 A;  3PAG A;  3CJM A;  1BUL A;  4DE0 A;  1HVB A;  3FKV A;  1BTL A;  1YLP A;  5FAT A;  2V20 A;  2EX8 A;  4FH4 A;  3WS4 A;  4OP5 A;  1K55 A;  3C4P A;  5FQJ A;  3S1Y A;  1XX2 A;  2A49 A;  3UPO A;  3TOI A;  4GOG A;  4ZJ2 A;  4KZ8 A;  3IF6 A;  4GN2 A;  5A92 A;  1PZO A;  2P9V B;  3PBN A;  3QNB A;  1H5X A;  2WKE A;  1K57 A;  3NI9 A;  4E6W A;  5M19 A;  2EXA A;  5U47 A;  1EI5 A;  4U0T A;  4JKT A;  2B5R A;  3PBO A;  2Z2L B;  3VSK A;  2WZZ A;  3M6B A;  2H0T A;  3GTC A;  1QMF A;  2GDN A;  2Y59 A;  5I94 A;  1BSG A;  1IEL A;  1DJC A;  5EVI C;  4MBK A;  3RXX A;  4N9K A;  2OLU A;  4FH2 A;  1WE4 A;  1PWG A;  4RX3 A;  5CEB A;  3MXR A;  3NCK A;  1XA7 A;  1XPB A;  2JE5 A;  3BRM A;  4HEF A;  4A5R A;  2XGN A;  1PI4 A;  1ERO A;  5DF9 A;  4DDY A;  3ZGA B;  3S4X A;  1BUE A;  5FQK A;  4JF4 A;  4R4R A;  4QB8 A;  4BJP A;  4EBP A;  4XUZ A;  5GLC A;  1MWU A;  2ZC4 B;  1N4O A;  3HVF A;  3MZF A;  3CMZ A;  3GQZ A;  3UE3 A;  4OKP A;  2EFX A;  3CZD A;  2ZQD A;  3HLG A;  4QY5 A;  4RYE A;  3SOI A;  4WBG A;  3UDF A;  4F94 A;  1KVL A;  2XDM A;  2XR0 A;  4ZAM A;  2Y2K A;  2H0Y A;  3DW0 A;  1KE4 A;  1GCE A;  2QZ6 A;  4E3I A;  2HDS A;  4LV3 A;  2V2F F;  3A3I A;  2ZJ9 A;  1Z6F A;  2QMI A;  4QJG A;  1SCW A;  3N8S A;  2FFY A;  1K55 C;  2Y2O A;  4Y0O A;  1FCO A;  4MLL A;  3N8R A;  1M40 A;  1DJB A;  3VP1 A;  2WZX A;  2Q9M A;  3TG9 A;  3WS2 A;  4S2N A;  2XFT A;  3PBS A;  3IF6 C;  4PM8 A;  5EOO A;  3C7V A;  1XGJ A;  4HES A;  3FYZ A;  1K57 C;  1C3B A;  2Y91 A;  3G35 A;  4EQI A;  1HTZ A;  5AQA A;  3OC2 A;  3GR2 A;  3NBL A;  1CEG A;  5FA7 A;  3HL9 A;  1U60 A;  3ISG A;  2WKH A;  2XFS A;  3OPR A;  3ITA A;  3GSG A;  4GDN A;  2XEP A;  1H8Y A;  3IH9 A;  1TEM A;  5FQM A;  3ZG0 A;  4WEL A;  3A3F A;  3N8L A;  2ZQ8 A;  2WGV A;  4CJN A;  1PI5 A;  1LL5 A;  1Q2Q A;  4IVI A;  3VFH A;  5E2E A;  2EX6 A;  1NZO A;  3C7U A;  3WS1 A;  4EWF A;  3UDX A;  3BFD A;  4PM7 A;  4P6B A;  4C75 A;  4ZTK A;  3BYD A;  4NET A;  2BG1 A;  4KG5 A;  2WK0 A;  5E43 A;  1HD8 A;  3P98 A;  1DY6 A;  1XXM A;  4Y7P A;  1JTD A;  1G6A A;  3BFG A;  3BLM A;  4N1X A;  4OH0 A;  1KVM A;  2EXB A;  1YMS A;  3E2L A;  3EQV A;  4D2O A;  5CED A;  5HAR A;  3W4P A;  4JF6 A;  2WYX A;  2Y2H A;  3UE1 A;  5F83 A;  3ZNY A;  1YLW A;  5IHV A;  3MKF A;  4DE2 A;  4E3O A;  3Q82 A;  4FSF A;  2WGW B;  5AQ9 A;  5HAI A;  4ZDX A;  4KQR A;  5GHZ A;  4U0X A;  5TGF A;  2IWC A;  3I7J A;  2ZC7 A;  2ZC6 B;  3GV9 A;  1IEM A;  1FOF A;  3LO7 A;  4S2K A;  4GDB A;  1KGF A;  1I5Q A;  2WGI A;  3BFC A;  1I2S A;  3G2Z A;  2EX2 A;  2ZMA A;  3OCL A;  5JYP A;  1NRF A;  1XP4 A;  4E3N A;  5A90 A;  3OZH A;  3NC8 A;  2XLN A;  1K54 C;  4OQ0 A;  3SS5 A;  4DE1 A;  5HX9 A;  2P74 A;  4CPK A;  4S2I A;  3PBT A;  3WRT A;  4S2N C;  2J9O A;  2I72 A;  4PM9 A;  5AQ7 A;  2IWB A;  1SDN A;  2E8I A;  3IXH A;  4KG6 A;  4OLG A;  1E4D A;  4X69 A;  4LCL A;  5EVI B;  3AGF A;  3VOY A;  2J8Y A;  5CGW A;  5TFQ A;  5CRF A;  1L0G A;  1S0W A;  1E3U D;  3Q1F A;  2EFU A;  1IKI A;  2Y2L A;  1TVF A;  1MKI A;  2ZQ9 A;  1K38 A;  1CI9 A;  1M6K A;  3HLF A;  3BFF A;  3NDE A;  4MBH A;  4OQG A;  2WUQ A;  4UA6 A;  4JXG A;  2C5W B;  5F1G A;  2Z2M B;  4M3K A;  2DRW A;  5EE8 A;  4IED A;  3ZFZ A;  1L0D A;  3MBZ A;  4OPY A;  1W8Y A;  3SH7 A;  1VQQ A;  4DRT A;  1YT4 A;  2HPB A;  1K6R A;  1JWZ A;  1IKG A;  5CGS A;  3NDG A;  1SDE A;  1FR1 A;  4O7D A;  1FSY A;  1IYQ A;  4N1H A;  3O86 A;  2Y2J A;  3Q81 A;  3MZE A;  1WYC A;  5J8X A;  5KSC A;  2PU4 A;  3CG5 A;  1MBL A;  3V5M A;  1ERM A;  1L0F A;  4OOY A;  4S2L A;  5FQQ A;  3QNC A;  5D3O A;  3M2J A;  4QY6 A;  4GB7 A;  5F82 A;  2X02 A;  3N7W A;  5DF8 A;  1XGI A;  4L0L A;  4BL3 A;  5FAS A;  3ZG7 B;  4LV2 A;  1I2W A;  1PWC A;  3DWZ A;  4WZ5 A;  4KZ3 A;  1NJ4 A;  4OOL A;  4OVD A;  2XQZ A;  4PMA A;  5EVI D;  3IF6 B;  1MXO A;  2C6W B;  2DNS A;  2A3U A;  1NYM A;  4GD8 A;  5HW3 A;  4WM9 A;  4UHU A;  3MXS A;  3UDI A;  2OSU A;  5FI7 A;  5CEC A;  1NYY A;  4DXB A;  2CC1 A;  3AGD A;  4P0M A;  5EPH A;  3SH9 A;  3M2K A;  1BLP A;  2WAD A;  5GL9 A;  4EV4 A;  4R3B A;  1FQG A;  3IT9 A;  1ZG6 A;  3G34 A;  4BD1 A;  1PYY A;  4KQQ A;  3G32 A;  1YLT A;  1VM1 A;  1YMX A;  4UA7 A;  3TSG A;  5GHX A;  1BLH A;  3IXD A;  1K54 A;  3Q7Z A;  3WWX A;  1J9M A;  5E2F A;  1NZU A;  4BD0 A;  4KZB A;  4WMC A;  3UN7 A;  3BM6 A;  2JCH A;  5HAQ A;  4DDS A;  4OQH A;  1SHV A;  1PW8 A;  1Y54 A;  4B88 A;  1NXY A;  2XK1 A;  1ERQ A;  3ZG9 B;  1ESI A;  1ONH A;  3Q7V A;  5CGX A;  5E2H A;  2Y2P A;  1K56 D;  2BLS A;  4IBR A;  4WZ4 A;  4DXC A;  2ZC3 B;  2IWD A;  1RCJ A;  3G31 A;  3GMW A;  1O7E A;  1GA9 A;  3NY4 A;  1FCN A;  3ZNT A;  2FFF B;  4OLD A;  2JBF A;  4YIN A;  4ZJ1 A;  2XF3 A;  4IVK A;  4X55 A;  1E3U A;  5E2G A;  4XXR A;  4KZ6 A;  4UAA A;  1RP5 A;  4NK3 A;  5KZH A;  1LI0 A;  3HUN A;  2Y4A A;  1KGG A;  3IWO A;  1BZA A;  5GLD A;  3ZG5 A;  3ITB A;  1AXB A;  2HDQ A;  4H8R A;  3O88 A;  1JVJ A;  4R4S A;  3VP0 A;  3ZG8 B;  4WZ5 C;  5JYO A;  3D4F A;  3FKW A;  4JXV A;  3VMA A;  3V3S A;  3AGE A;  3LEZ A;  3HLB A;  3UPN A;  3HUM A;  3UY6 A;  1PW1 A;  3DWK A;  3Q7V B;  3IF5 A;  2ZM0 A;  3G2Y A;  4R1G A;  5AQB A;  4GZB A;  3ZVW A;  4KG2 A;  1RGZ A;  3JYI A;  1K4E A;  1HZO A;  4JBF A;  4BQM A;  3SH8 A;  3W4Q A;  3UE0 A;  1W5D A;  2Q9N A;  5CTN A;  4HBT A;  1XKZ A;  3IWQ A;  2XD1 A;  1PIO A;  4WEK A;  3G4P A;  4LV0 A;  3C5A A;  4X68 A;  3ZDJ A;  3HRE A;  5BOH A;  2WAF A;  1ONG A;  4N9L A;  2UWX A;  1K4F A;  3PTE A;  2ZQ7 A;  4B4Z A;  2QPN A;  3M6H A;  2R9W A;  1ES4 A;  3MFD A;  4BEN A;  3LY4 A;  1NY0 A;  4E6X A;  5M18 A;  3SS4 A;  3IXG A;  1GHM A;  4ZJ3 A;  2G2U A;  2Y55 A;  2OV5 A;  4N92 A;  2WAE A;  4S2O A;  4E3K A;  4DF6 A;  5M1A A;  2HP5 A;  2P9V A;  4JF5 A;  5FAP A;  1IYO A;  2X01 A;  1LLB A;  4OPZ A;  5A93 A;  2Y2G A;  4KEN B;  1CI8 A;  5CHJ A;  3IH8 A;  5HAP A;  3C4O A;  5FQI A;  2J7V A;  3SS3 A;  4DE3 A;  3S22 A;  3WRZ A;  3MKE A;  2PBY A;  3UNW A;  3G30 A;  3PBR A;  3ZHH A;  4BL2 A;  4ID4 A;  1MWT A;  2ZC5 B;  3FV7 A;  1MPL A;  1PZP A;  4FCF A;  1ES3 A;  2ZD8 A;  3IXB A;  3HLC A;  1SKF A;  3E2K A;  4X53 A;  2V1Z A;  4RX2 A;  1OME A;  1K56 A;  3LCE A;  4QU3 A;  2VGJ A;  2HP6 A;  4S2P A;  4QD4 A;  4R23 A;  4Y0T A;  1W8Q A;  5EVL A;  5FI2 A;  3B3X A;  3NIA A;  4R0Q A;  3UO9 A;  3HUO A;  4XUX A;  2XH9 A;  2HDU A;  1WYB A;  3UPP A;  3OPH A;  4GD6 A;  1ALQ A;  1H8Z A;  4OON A;  3Q07 A;  5KMW A;  1GHI A;  1MY8 A;  2EX9 A;  1K25 A;  4K91 A;  2RCX A;  4MEZ A;  4Y0U A;  4JPM A;  3OPL A;  4R3J A;  1YLZ A;  2Y2M A;  3W8K A;  4EUZ A;  5DF7 A;  4UA9 A;  1BT5 A;  2ZM8 A;  2H10 A;  3OPP A;  1IYP A;  3A3J A;  4JXW A;  4RA7 A;  3MZD A;  4KZ5 A;  5DVA A;  5FDH A;  5CER A;  4RVA A;  3ZVT A;  4GKU A;  3BLS A;  1FSW A;  5GHY A;  3VFF A;  4E3J A;  4DKI A;  1KE3 A;  4E3L A;  2JC7 A;  1ES5 A;  1XA1 A;  1G68 A;  4LV1 A;  4QHC A;  2HP9 A;  3RJU A;  3V3R A;  2ZM2 A;  1LHY A;  5EUA A;  1FCM A;  3WS5 A;  5FI6 A;  3IQA A;  4S2J A;  4X56 A;  3BFE A;  1ZG4 A;  5FAQ A;  1CK3 A;  1JWP A;  5F1F A;  2R9X A;  1ESU A;  5CHM A;  1MWS A;  2RL3 A;  3O87 A;  1LI9 A;  2ZQC A;  3IHA A;  4K0X A;  5CHU A;  3HLW A;  1ZKJ A;  2OLV A;  3IWI A;  4JXS A;  5KSH A;  1TDL A;  3P09 A;  3PBQ A;  1N9B A;  4LEN A;  4HBU A;  3A3D A;  4KQO A;  4LCM A;  1YM1 A;  3N4I A;  5L2F A;  1W7F A;  2Y2Q A;  5G18 A;  3VP4 A;  3VP2 A;  3A3E A;  4OPR A;  4OPQ A;  3IHB A;  4MBF A;  1QME A;  4YFM A;  1EWZ A;  4ZBE A;  1O07 A;  4Q8I A;  1ZC2 A;  5HFO A;  2Y2I A;  5FQ9 A;  3FZC A;  5FSR A;  5TR7 A;  1FR6 A;  3HLE A;  2ZLY A;  5FAO A;  4IBX A;  2DCF A;  2WGW A;  1JWV A;  2G2W A;  4BLM A;  3V39 A;  4PM5 A;  1DJA A;  3BEC A;  2HDR A;  4GNU A;  4U3T A;  2XD5 A;  2X71 A;  1W79 A;  2H5S A;  4E3M A;  4C6Y A;  3LY3 A;  1JTG A;  3HLD A;  4X6T A;  3GVB A;  3VP3 A;  4B4X A;  1YQS A;  4EBL A;  3HBR A;  1PWD A;  3QHY A;  3ZCZ A;  4KZ7 A;  5EEC A;  4PM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...