5F1GA

Crystal structure of a class c beta lactamase
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
361
structure length
351
Chain Sequence
HHPQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPATKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPPEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVRSNMNPRDINDKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIINAAHPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVAAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Crystal structure of a class C beta lactamase
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 114
structure length 351
sequence length 361
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5f1gA00
5FQ9A 3VP0A 2EX6A 4P6BA 2BLSA 4OVDA 5KMWA 3M6HA 4OPRA 3N7WA 1BUEA 1JWZA 2Y2NA 3AGFA 4GZBA 4R3JA 3N8LA 4GD8A 4Y0UA 1LL5A 5F1GA 3S4XA 2WADA 4N1XA 5CGXA 5FAOA 4QY5A 4OONA 3W4QA 4DF6A 1MWSA 3N6IA 4D2OA 4B88A 3UE0A 5FQKA 3VP1A 3NIAA 4B4XA 4R4RA 3M2KA 2IWCA 3BFDA 2ZQ9A 5FDHA 3CZDA 2QZ6A 1KDWA 2C5WB 4GDNA 3VP3A 5DF8A 1I2WA 3A3EA 4LENA 4OP5A 5HFOA 1YLJA 5A91A 4GD6A 4PMAA 4KZ9A 4EBLA 4F94A 4KG5A 2EX9A 3QHYA 1NXYA 3OCLA 5EPHA 4B4ZA 4O7DA 5E2GA 4CPKA 3MKEA 3WRZA 1QMFA 4MNRA 5CTNA 1YLZA 4BENA 3IF6C 3WS0A 3NC8A 5F83A 4S2JA 4WMCA 4C75A 4S2PA 4EBNA 1VQQA 4IBRA 1RGZA 2WKEA 5F1FA 4LV1A 4QHCA 1KGGA 2WGIA 5A93A 1J9MA 1HD8A 3LO7A 3OPLA 2BG1A 4L0LA 3VMAA 4WEJA 3EQVA 4OOMA 3GQZA 5M18A 1Q2QA 1BLHA 3W4PA 5CGSA 2GDNA 3IHBA 1MWUA 2ZD8A 2EX2A 2ZC6B 3PBQA 4LV2A 2H0YA 4OPZA 2A49A 1KE0A 1FSYA 2R9XA 4DXBA 4ZJ3A 4NK3A 3N4IA 2J7VA 3G30A 1IYOA 4Y0OA 5FI2A 4JPMA 3CMZA 3IH9A 3DTMA 2CC1A 1W7FA 4KG6A 1SHVA 4DE3A 3V5MA 3DWKA 2R9WA 4GDBA 1CI8A 1LI0A 3OPRA 4WZ4A 2XH9A 1IYPA 1YLTA 3DW0A 4KZBA 4OPYA 1DY6A 1JVJA 2ZQDA 1DJAA 1NYYA 4U0XA 2H5SA 1FQGA 2G2WA 3G2YA 3IXHA 3PAEA 1TEMA 4KZ3A 4UA7A 4XUXA 1EWZA 2Z2LB 3VSKA 4FH4A 1W5DA 5DTKA 1K38A 3BFGA 1BLSA 1WE4A 3SS4A 4E3MA 4EWFA 1EROA 3AGEA 2E8IA 5CEDA 4K0WA 2Y2LA 4PM7A 2OSUA 4OH0A 2WZXA 3WS4A 5CGWA 2WK0A 4ZDXA 5CHUA 2HDUA 3IXGA 4N9KA 4E3KA 5KSHA 1ZC2A 5FSRA 3FKVA 5TR7A 5CEBA 3V3SA 2XD1A 1MPLA 3PTEA 1WYBA 3FV7A 1M40A 1FCMA 1K56A 4Z9QA 1YLYA 3C5AA 2WUQA 2P74A 4QU3A 3ZNTA 4CJNA 2Y2HA 1KGEA 1K57C 4OPQA 4WYYA 5E2EA 1K55C 1ZG4A 1XGJA 1KE3A 2XK1A 3MZFA 4HEFA 3G31A 4HESA 5FI6A 3V39A 4BD1A 1RP5A 4ID4A 4JXWA 1XA7A 4KZ4A 3PBNA 4KZAA 4PM9A 1RCJA 2Y2IA 5TGFA 2C6WB 4U3TA 4DKIA 1Y54A 2Y2GA 4PPRA 2XFSA 3HUNA 2XEPA 4RYEA 2HDSA 3PBSA 5HAIA 5BOHA 4KZ6A 5EECA 3GSGA 1ES4A 1S6RA 4JXGA 1JTDA 1W8QA 2WKIA 3FKWA 4RX3A 3N8SA 3ZG7B 4S2IA 3BFEA 3HUOA 3MZDA 3HLEA 5AQ9A 3QNBA 3ZG9B 5L2FA 1LHYA 2V1ZA 3OCNA 4GKUA 2Y2OA 1JTGA 2WGVA 1YLPA 3C7VA 5J8XA 5DF7A 5KSCA 4X68A 3FYZA 2PU4A 3O88A 4S2NC 4E6XA 1ERMA 1GCEA 2ZC3B 4ZJ1A 1L0DA 4P87A 4KZ7A 3JYIA 5KZHA 5A92A 3BEBA 3VP2A 2JC7A 3MFDA 1BLPA 1PIOA 4MBFA 4WBGA 3CG5A 1FSWA 1K57A 1MY8A 2HP5A 3AGDA 4OOYA 5HAPA 3C7UA 1K55A 3W4OA 2PU2A 1SKFA 3MXSA 2OLVA 4OQIA 4ZTKA 3GV9A 3Q07A 3ZCZA 3A3FA 5FAQA 3NDGA 2ZM8A 5GHXA 1BLCA 3ZG8B 2Y2KA 5CERA 4P85A 3HVFA 2H0TA 1CK3A 1PWCA 3UPNA 3VFFA 3UN7A 4UA6A 2Y59A 1W8YA 4N92A 4OQ0A 5CECA 3UY6A 3ZHHA 5HAQA 1ESIA 2OV5A 1K6RA 2V2FF 2ZQ7A 3WS1A 1XKZA 3E2KA 3GRJA 4Y7PA 1PWGA 5CTMA 4NETA 2Y55A 4P0MA 4OP8A 4EQIA 3OPHA 1MWRA 4KZ8A 2X01A 3WS2A 4WELA 4PM5A 5HW3A 3HLWA 1G68A 3S1YA 4S2NA 1GA0A 1FCNA 1FR6A 2RL3A 4U0TA 3MBZA 1FCOA 1K54C 2XQZA 4QD4A 4C3QA 1K56D 4DE2A 3NDEA 4R23A 3IHAA 3UPOA 1IYQA 3ZFZA 1SDNA 2EFXA 5HX9A 2Y2PA 4GOGA 3S22A 4HBTA 3OC2A 3ZG5A 4EBPA 2ZM0A 4HBUA 1NYMA 1K6SA 1PZOA 3G35A 1KVMA 1N9BA 2XGNA 4BQMA 1EI5A 3OZHA 5FQMA 2Q9NA 3HLFA 3MZEA 3HLDA 1YM1A 4LCLA 5GLAA 3UE3A 5F82A 1QMEA 2RCXA 3FWLA 1LLBA 1L0FA 4IEDA 1ERQA 3SH9A 3PAGA 3HREA 5CXWA 1MKIA 2Y2JA 4KQRA 1H5XA 1ESUA 1HZOA 3OPPA 4ZAMA 4E3LA 1CI9A 3HBRA 3ZDJA 3CJMA 2Y2MA 4QJGA 3NI9A 1LL9A 1TDLA 4Y0TA 4R0QA 3C4PA 4WM9A 4FH2A 3GR2A 3A3IA 3BLSA 1XGIA 2A3UA 4GNUA 3WS5A 4BL2A 4JF6A 4FD8A 3A3JA 5AQ7A 1AXBA 4OLDA 4E6WA 4KZ5A 1CEGA 2XD5A 3HL9A 4OKPA 1YT4A 3HLGA 5FI7A 1K54A 2P9VA 4JF5A 3VFHA 5DVAA 3Q7VA 4MBKA 1ALQA 2JBFA 4K91A 5HL1A 1DJCA 3IT9A 3RXWA 4UHUA 3O87A 5AQBA 4OLGA 3BLMA 2EX8A 5D3OA 3VP4A 3ZNYA 1IYSA 4DXCA 5HARA 3SH7A 1ZG6A 2HP9A 3SOIA 3IXDA 5GHYA 2XLNA 1OMEA 1N4OA 5EUAA 4DRTA 2EXBA 3RXXA 3SS5A 2HP6A 2EXAA 2J9OA 1CEFA 1XX2A 4N9LA 4QY6A 4R4SA 3BFFA 2HDRA 1H8ZA 1ES5A 1HTZA 3FZCA 1KE4A 3NCKA 3VOZA 2PBYA 4C6YA 3V50A 2JE5A 5I94A 3GVBA 4JXSA 4X56A 1IKGA 4A5RA 3ZG0A 4MEZA 3D4FA 4OQGA 3O86A 2X02A 2ZQ8A 1YMXA 3G2ZA 4DE0A 4BJPA 1BZAA 2VGJA 1G6AA 4IBXA 3IF5A 2OLUA 2XDMA 1HVBA 3I7JA 4S2OA 2HPBA 2P9VB 5IHVA 1K25A 1MBLA 4GN2A 3Q7VB 5FATA 5GLCA 1S0WA 2WKHA 4ZBEA 3A3DA 3M6BA 4FCFA 2V20A 1W79A 3ISGA 3LEZA 2Z2MB 3ITBA 1I2SA 3MXRA 3SS3A 2Y4AA 1GHPA 4KG2A 1SDEA 3Q1FA 4LCMA 5CHJA 3GTCA 1YMSA 1O07A 3B3XA 1LI9A 3IH8A 1BSGA 3LY3A 3N8RA 2H10A 4X6TA 1NZOA 5JYPA 1E4DA 1GHIA 3G32A 3BFCA 4FSFA 4JF4A 3BYDA 3SH8A 5JYOA 5DF9A 3W8KA 1KVLA 5FAPA 1KGFA 1TDGA 2ZC4B 1NRFA 1FOFA 5GHZA 4PM6A 4DDYA 1XXMA 1BT5A 5GL9A 1L2SA 1XP4A 2QMIA 4K0XA 4E3NA 4WZ5C 2Y91A 2WGWA 3GMWA 3QNCA 2EFUA 1H8YA 3NBLA 4WEKA 3PBRA 3ZVTA 5EOOA 2XR0A 2FFFB 1FR1A 3IQAA 3P09A 2I72A 3C4OA 2XF3A 1RGYA 3NY4A 1XPBA 1DJBA 2ZQCA 4Q8IA 3UO9A 2XFTA 2IWBA 4E3IA 1PYYA 3LCEA 5EVIA 4EV4A 4S2LA 3Q7ZA 2G2UA 2DCFA 3BM6A 1KDSA 1PWDA 4JKTA 3TG9A 3UDXA 3UDIA 2ZLYA 4UAAA 4BD0A 3TOIA 1ZKJA 2J8YA 3Q82A 1IKIA 4MLLA 1YLWA 5AQAA 2ZQAA 3ZGAB 5TFQA 4MBHA 1ES2A 5M1AA 2IWDA 3DWZA 4OQHA 3TSGA 4EUZA 5DTTA 2ZMAA 5GLBA 2JCHA 4LV3A 1BULA 2UWXA 4KQQA 4M3KA 5GLDA 2HDQA 1NZUA 5G18A 3UPPA 3IWQA 3UDFA 2Y2QA 1I5QA 5EE8A 4YINA 1ONGA 5FQQA 1L0GA 1C3BA 4JLFA 2WGWB 4WZ5A 3BRMA 2WAFA 3UNWA 3LY4A 1U60A 1XA1A 2VGKA 1ES3A 4JBFA 3ZVWA 4R1GA 2WYXA 1GHMA 1JWVA 2J9PA 3RJUA 1PI4A 5EVIB 5FQJA 1NY0A 4IVIA 3IXBA 4JXVA 3IF6A 1VM1A 3HUMA 4S2KA 3V3RA 4BLMA 1E25A 1E3UD 1Q2PA 3ITAA 4X53A 3PBTA 5E43A 4PM8A 4QB8A 3WWXA 2FFYA 5A90A 1SCWA 4IVKA 2B5RA 4YFMA 5E2HA 2WZZA 1NJ4A 1O7EA 5DTSA 2Q9MA 2ZM2A 1JWPA 4GB7A 4S2MA 3MKFA 4KENB 4BL3A 2X71A 3BECA 4E3OA 3PBOA 2ZC5B 1ONHA 2DRWA 3M2JA 4DE1A 3UE1A 1L0EA 3IWIA 4H8RA 3O3VA 5CHMA 4ZJ2A 3WRTA 4E3JA 4KQOA 4XXRA 2QPNA 5FA7A 1PW8A 3VSLA 1PZPA 1Z6FA 4R3BA 4XUZA 5FQIA 1K4EA 3E2LA 3G4PA 4RX2A 4OOLA 5CRFA 5M19A 2DNSA 1WYCA 3HLBA 3EQUA 3Q81A 4X55A 5U47A 1MWTA 3IF6B 4UA9A 5EVID 4DDSA 1PI5A 3G34A 3HLCA 3P98A 4WMCD 2WAEA 4X69A 1BTLA 1IEMA 1TVFA 4N1HA 2ZJ9A 3IWOA 4LV0A 5EVIC 1K4FA 4RVAA 1YQSA 5EVLA 5E2FA 1M6KA 1E3UA 1PW1A 2ZC7A 4RA7A 1IELA 1MXOA 5FASA 1GA9A 3VOYA 5EOEA
chains in the Genus database with same CATH superfamily
3MSHA 2EX6A 4OVDA 2O9CA 2R78A 2Y2NA 2OAQ1 4JGQA 4R3JA 4Y0UA 2WADA 4EEUA 4I38A 2XA7S 5EVEA 3VP1A 5FQKA 5IS1A 4R4RA 5KIZA 2IA2A 1OPXA 5DF8A 4OP5A 4M4XA 5A91A 2Q0OA 4F94A 3DTEA 3HJIA 2EX9A 3QHYA 4CPKA 2LB9A 1QMFA 4MNRA 1XJ4A 5CTNA 2H28A 4S2JA 4QHCA 1J9MA 2W1TA 3VMAA 4L0LA 1IOUA 3GQZA 5J3WA 2PDRA 3PYPA 2HGVA 3IHBA 2ZD8A 2ZC6B 3QP2A 4H6JA 2J7VA 4Y0OA 1IYOA 3IBJA 3U4LP 1OJGA 2D02A 4KG6A 1W7FA 1SHVA 3V5MA 3IS2A 4O8GA 3T4OA 3U2AA 4BBTA 3OPRA 1S4SA 1YLTA 5F69A 4OPYA 1DY6A 1JVJA 2ZQDA 1FQGA 3EEHA 3LEQA 3QP1A 2GNXA 4HI4A 5HWWA 3T4KA 2ZMFA 1EWZA 5DTKA 4E3MA 1BLSA 3NULA 4GW9A 2E8IA 2VGLM 4K0WA 4ZDXA 2J3TD 4H6JB 4N9KA 3EGXC 4Y13A 3F1OA 3F1PA 1WYBA 1K56A 4Z9QA 2W3EA 2WUQA 4QU3A 3ZNTA 2JKTM 1K57C 5DFXA 5MC7A 1XGJA 2JN7A 3MZFA 4BD1A 3V39A 1SZVA 3TW8A 4JXWA 2PR6A 5TGFA 4PPRA 3UB9A 2HDSA 4IJGA 1ES4A 4JXGA 3LUQA 3P7NA 2PBDP 5AQ9A 3OCNA 1SKOA 2Y2OA 2PR5A 1ACFA 3C8CA 4X68A 3F1OB 3O88A 1ERMA 4ZJ1A 2ZC3B 3F1PB 3TJZC 4P87A 3JYIA 3MFDA 4I39A 4JGOA 2VLGA 4OOYA 1G5UA 3MXSA 4OQIA 1DP9A 3GV9A 3IX4A 5G4YA 2VZWA 5CERA 4KUOA 3MMHA 4ZRRA 1XFNA 3C30A 3VFFA 4UA6A 2Y59A 3K3CA 5HAQA 2PAVP 1S66L 4Q0HA 1XKZA 1PWGA 1SKOB 4LRZE 1MWRA 5AVEA 2X01A 3WS2A 3NOUC 1GA0A 1FIKA 5L10A 1K54C 4LRYC 4QD4A 4DE2A 1K56D 3UPOA 1IYQA 2XA7M 5HX9A 3VOLA 4HBUA 1K6SA 1N9BA 3T4TA 5HWTA 4BQMA 3HLFA 3MZEA 1YM1A 3FWLA 3UE6A 3HREA 1TD5A 3OPPA 5FDSA 2JKTI 3NOPC 3NI9A 1TDLA 2ZOHA 1TS7A 2L1MA 1V9YA 4FH2A 3GR2A 5HSQA 4R6LA 4CLCA 3DAVA 5AQ7A 4OLDA 4HJ6A 1CEGA 2XD5A 4OKPA 3HLGA 4NXEA 1LSVA 1ALQA 2KX6A 3T4LA 4CQHA 5HL1A 3RXWA 3O87A 5AQBA 4OLGA 3KYQA 4DXCA 3CI6A 3SH7A 1ZG6A 1YSPA 4NEED 2EXBA 3SS5A 4QY6A 1CEFA 1XX2A 2WKQA 4R4SA 3BFFA 4DN0A 3S7PA 1KE4A 2PBYA 4X56A 4MEZA 2GJ3A 3PR6A 4MCWA 1IFQA 2X02A 1YMXA 1F2KA 4CLCB 5HL6A 2VGJA 4EERA 3UB8A 4IBXA 4B93A 3IF5A 2OLUA 4S2OA 2HPBA 5IHVA 5FATA 2P7JA 2WKHA 1W63M 2V20A 2BASA 3ITBA 3MXRA 5HPFA 3DTKA 3O5YA 1GHPA 1SDEA 4LCMA 3PHYA 2WKPA 1YSQA 5AVFA 1PFLA 3IH8A 3N8RA 3CUEC 2W3DA 3BYDA 4DDYA 5GHZA 4E3NA 4WZ5C 2WGWA 3MF0A 3QNCA 2NUPC 2EFUA 4NXBA 5CX7A 2FFFB 1RGYA 3NY4A 1XPBA 1DJBA 2EA9A 2XFTA 1T18A 1PYYA 5EVIA 4Y3IA 3A0SA 4FTXA 3TG9A 3UDXA 2ZLYA 4HOIA 2JKGA 1ZKJA 2J8YA 1IKIA 2ZOIA 3VV4A 3TSGA 4EUZA 4OQHA 5DTTA 2ZMAA 1LL8A 2UWXA 4KQQA 5GLDA 2HDQA 4BBVA 5G18A 5EE8A 1ONGA 3T4SA 3KO6A 2WGWB 1P9WA 2OAP1 3LY4A 1XA1A 1OTEA 1VETB 4HIAA 5EVIB 4IVIA 1E25A 1Q2PA 2VV7A 4E04A 3PBTA 5E43A 4MN5A 4PM8A 1ZHHB 3WWXA 1MZUA 5HDSA 1Y28A 3MKFA 5DKKA 4KENB 3JVVA 2PHYA 4BBUA 1XFQA 3PBOA 5DFYA 1ONHA 3UE1A 1AWIA 4H8RA 2V1AA 5CHMA 3WRTA 1X0OA 4LFUA 1Z6FA 1K4EA 5CRFA 1LSXA 4X55A 2A24A 5EVID 2PRFA 3IX8A 3L7HA 3HLCA 2VV8A 4WMCD 3IWOA 1STZA 1K4FA 1M6KA 5FL3A 1IELA 1P0ZA 2BLSA 4DJ2A 5KMWA 3LI9A 3N7WA 1BUEA 1JWZA 4GD8A 4N1XA 5CGXA 5FAOA 4QY5A 3W4QA 3QP4A 4RQ9A 2V9AA 3NIAA 4B4XA 3CHWP 3M2KA 3LIDA 3BFDA 4GDNA 3BQ8A 3B47A 4GD6A 4PMAA 2A24B 1XJ3A 4O7DA 4WL9A 1F5MA 5E2GA 3MKEA 2V8FA 1XJ6A 2P08A 4R38A 4BENA 3QP5A 2UV0E 4EXOA 1RGZA 2WGIA 1HD8A 2VJWA 2QKPA 3OPLA 4OOMA 3KSHA 1Q2QA 3S7QA 2EX2A 2H0YA 1ZTUA 1FSYA 1ODVA 3K2NA 3N4IA 1EW0A 4NK3A 3G30A 5FI2A 2HF6A 3CMZA 3IH9A 2CC1A 2R9WA 2K2NA 4GDBA 1CI8A 4PKYG 1LI0A 1JNUA 2XH9A 1IYPA 2H5SA 3KSGA 2G2WA 3TRCA 4KZ3A 4XUXA 2J80A 2Z2LB 4IUKA 2G7UA 1WE4A 2JKRI 4EWFA 4UQIM 5CEDA 4EEPA 4OH0A 3WS4A 3CAXA 5CHUA 4E3KA 2ZMVA 5FSRA 1FILA 5TR7A 4HH2A 4O0PA 1YLYA 3T1SA 2O0YA 1KGEA 4OPQA 5E2EA 1KE3A 2XK1A 4HESA 4ID4A 3T1RA 5K5BA 4KZAA 2C6WB 4DKIA 4IHQA 5HZHA 4RYEA 3PBSA 5HAIA 5BOHA 3GSGA 2ZL1A 1W8QA 3FKWA 3ZG7B 3N8SA 4S2IA 3L9KA 3HUOA 5L2FA 5AJGA 4GKUA 1JTGA 5J8XA 5DF7A 4WLAA 3D3OA 1L0DA 4KZ7A 5A92A 3BEBA 2HZ5A 3VP2A 3LR4A 4ME4A 2GZAA 5G4ZA 4JGPA 1K0KA 2HP5A 2BTFP 2PU2A 2O99A 3ZCZA 1UGUA 2OWJA 4YOFA 3NDGA 4P6ZS 5IU1A 5GHXA 1BLCA 4P85A 3HVFA 1CK3A 3ULFA 1W8YA 4OQ0A 5CECA 3ZHHA 3H7WA 1ESIA 4K08A 2ZL1B 1K6RA 2V2FF 3E2KA 3CLOA 3GRJA 4Y7PA 5CTMA 4NETA 4P0MA 4EQIA 3OPHA 4CLCC 4KZ8A 2KOIA 4WELA 3HLWA 5HWVA 1G68A 5EM1A 4S2NA 4GLQA 1FR6A 4U0TA 3MBZA 1FCOA 4C3QA 4R23A 3HCYA 4R3AA 3ZFZA 3S22A 4HBTA 3OC2A 4EBPA 1NYMA 3HLDA 5GLAA 5F82A 1QMEA 2RCXA 3SH9A 1L0FA 5DKLA 1MKIA 3P01A 1HZOA 4ZAMA 4HQAA 3H7WB 4Y0TA 4HY8A 3C4PA 1XGIA 2CMNA 4GNUA 4BL2A 2W27A 2EWVA 4FD8A 1AXBA 4DMZA 2P9VA 5F6AA 3Q7VA 2P04A 4K91A 3IT9A 4UHUA 4EU0A 2EX8A 3ZNYA 5EUAA 3RXXA 4HHDA 4ESPA 1HTZA 3FZCA 1OJ5A 3E98A 2JE5A 4JXSA 3ZG0A 2B18A 4Q0JA 3BY9A 2ZQ8A 3G2ZA 4ETZA 1G6AA 5L8MA 2VEAA 2P9VB 3Q7VB 1S0WA 4ZBEA 2K7SA 4Y15A 2O9BA 4HH3A 1I2SA 4Q0IA 3SS3A 4F3LA 2O9AA 2NUTC 3GTCA 1YMSA 3IX3A 2H10A 1E4DA 2HJEA 1GHIA 1H3QA 3SH8A 5JYOA 1KVLA 1FOFA 3RTYA 1XXMA 5GL9A 3G6OA 3LFVA 1N9OA 5HDCA 1H8YA 4WEKA 5EOOA 4Q8IA 4E3IA 4EV4A 2W3GA 3LCEA 4EESA 5F5YA 2W3HA 1KDSA 4JKTA 1TS6A 4F3LB 4MLLA 2WKRA 4IUHA 3ZGAB 4MBHA 5EV0A 3DWZA 2D01A 2J3WA 2JCHA 4GS9B 3BJNA 1NZUA 3UB6A 3IWQA 2Y2QA 4P6ZM 5FQQA 1C3BA 3BRMA 2WAFA 3UNWA 5DJUA 3ICYA 2XROA 4EW7A 1YPRA 3ZVWA 4KUKA 4R1GA 1JWVA 2J9PA 2JHEA 5F68A 4LPZA 3CITA 1S1ZA 3HUMA 4BMWA 1BYWA 4BLMA 3ITAA 4QB8A 1SCWA 5L09A 2WZZA 1T1AA 4E3OA 4Z1WA 2QJ5A 3M2JA 2VKSA 4QPRA 1PW8A 3SW1A 4R3BA 3G4PA 5M19A 2DNSA 3HLBA 3EQUA 3Q81A 5U47A 4GJ4A 2M7UA 3LIEA 3P98A 4X69A 1P97A 4WUJA 1OT6A 3T12B 1YQSA 5FEGA 5E2FA 2ZC7A 4RA7A 1VHMA 2QJ7A 1MXOA 3ZQ5A 1GA9A 5EOEA 5TBMA 2YKFA 4OPRA 1L3LA 3N8LA 3SZTA 3MQQA 3TE8A 4OONA 1MWSA 3N6IA 4D2OA 2IWCA 2ZQ9A 3CZDA 5A8BA 2QZ6A 1KDWA 3EWKA 1I2WA 3A3EA 4LENA 2VV6A 1VETA 4EBLA 4KG5A 3OCLA 4NG2A 3WRZA 4AFIA 3MJQA 1PRQA 3IF6C 3WS0A 3NC8A 5F83A 2GX5A 4WMCA 4EBNA 4IBRA 3PXPA 1KGGA 5TBMB 1W63Q 4WEJA 4B9OA 5M18A 5CGSA 2GDNA 4MDZA 4PHTA 3UMEA 4OPZA 1GSWA 2A49A 2JKFA 1KE0A 2R9XA 4DXBA 4ZJ3A 4JPMA 5J7EA 3DTMA 2V0WA 3A0RA 4G3KA 3DW0A 3C38A 4L9EA 5EM0A 1NYYA 4U0XA 3K3DA 3G2YA 3IXHA 3PAEA 3LR3A 1TEMA 4UA7A 3BFGA 3UB7A 3SS4A 4ARZA 1A0KA 2Y2LA 4PM7A 2WZXA 5CGWA 2HDUA 3IXGA 5CEBA 4EETB 3V3SA 1MPLA 2J3TC 3FV7A 3NHQA 1FCMA 3B33A 3C5AA 2P74A 4CJNA 2Y2HA 5HD3A 1ZG4A 5FI6A 3OLOA 4LRXC 1XA7A 4KZ4A 4PAUA 3PBNA 4PM9A 4U3TA 1Y54A 2Y2GA 1NLZA 2XSSA 2XFSA 4PKYA 3NECA 2XEPA 2PT7A 4I3IA 4KZ6A 4ARZB 3NJAA 2W3FA 4RX3A 3MZDA 3HLEA 3QNBA 1LHYA 3DBAA 2WGVA 3C7VA 2PU4A 4S2NC 5HPIA 4YWZA 4EQ1A 5KZHA 4WBGA 1FSWA 4R70A 1MY8A 1Z09A 3AGDA 3JVUA 1PNEA 1K55A 3GDIA 3T4JA 1SKFA 2OLVA 3Q07A 3A3FA 3BQAA 3S7OA 2ZM8A 3UPNA 3LIAA 4N92A 3UY6A 4I3JA 2ZQ7A 3RH8B 4G3WA 4EUVA 2Y55A 4OP8A 2ACGA 5HW3A 4D60A 3S1YA 1FCNA 2RL3A 4Y17A 3H9WA 2XQZA 3NDEA 2Y2PA 3ZG5A 2VGLS 1PZOA 3B42A 3KSIA 3OZHA 5FQMA 4LCLA 3UE3A 4IEDA 1LLBA 1ERQA 3PAGA 3OBFA 3T4QA 1H5XA 4E3LA 1CI9A 3HBRA 3ZDJA 3CJMA 4QJGA 1TS8A 3A3IA 2A3UA 4L9FA 1S67L 4JF6A 1OTIA 4KZ5A 3HL9A 2PD8A 4JF5A 3VFHA 5DVAA 2JBFA 2VX8A 2Y8HA 1DJCA 4MN6A 3HJKA 5D3OA 3VP4A 1IYSA 2HP9A 3SOIA 3IXDA 1P9RA 3E4PA 5GHYA 2XLNA 4DRTA 1N4OA 2HP6A 2EXAA 1NRJA 1H8ZA 3NCKA 3VOZA 1VEUB 3V50A 5I94A 4A5RA 3D4FA 5L07A 3VE3A 1MKMA 3JPUA 5TJJA 1DRMA 4FCFA 1W79A 3LEZA 2Z2MB 4JGRA 4HNBA 1XJ2A 4CLCE 3Q1FA 3B3XA 1LI9A 4BWIA 4GHIA 3LIFA 3LR5A 1BSGA 3LY3A 4X6TA 1NZOA 5JYPA 1NLYA 4I5SA 3G32A 3BFCA 4JF4A 3S7NA 3W8KA 1KGFA 2ZC4B 1NRFA 1L2SA 1XP4A 2QMIA 1OT9A 4K0XA 3NBLA 3PBRA 4FUWA 3KX0X 1FR1A 3T1XA 2I72A 3C4OA 3LIBA 3UO9A 2IWBA 1HLUP 3Q7ZA 2G2UA 5IT5A 3BM6A 2PD7A 3E4QA 3UDIA 4UAAA 4X1MA 3TOIA 3Q82A 3BWLA 4GHIB 5AQAA 2ZQAA 5TFQA 5M1AA 2IWDA 3E4OA 4HJ3A 4LV3A 1BULA 3UPPA 1LSWA 1I5QA 2QYBA 1L0GA 3D72A 4JLFA 1OTAA 1U60A 2VGKA 1ES3A 4JBFA 1CQAA 3V67A 2WYXA 1GHMA 3RJUA 3KSFA 1PI4A 5FQJA 1NY0A 3IXBA 4JXVA 1VM1A 4S2KA 3V3RA 1E3UD 5FEFA 2V0UA 2MJ6A 2W1TB 1UWNX 5E2HA 3LICA 2VA0A 1N9LA 4S2MA 4BL3A 3H82A 2ZC5B 1L0EA 3QP6A 3IWIA 4XXRA 2QPNA 1PZPA 5FQIA 3IS2B 1WYCA 4FOFA 1CF0A 1MWTA 2B02A 1D06A 2INWA 1D1JA 1BTLA 1IEMA 1TVFA 4N1HA 5EVIC 4LV0A 2L0WA 5EVLA 2VK3A 2OOLA 1LT0A 4UEYA 5HARA 3CPTA 5FQ9A 1VB6A 3VP0A 2Y79A 4P6BA 3M6HA 3FPWA 1T1BA 3FPVA 3H82B 4GZBA 3AGFA 3NOTC 1LL5A 5F1GA 3S4XA 3E0YA 4GS9A 4DF6A 2Z6CA 4B88A 3UE0A 5FDHA 4X1LA 5HD5A 3DTIA 1J3WA 2C5WB 3VP3A 2V1BA 5HFOA 1YLJA 4KZ9A 4B4ZA 5EPHA 1NXYA 1YLZA 4C75A 4S2PA 3IBRA 4WF0A 1V9ZA 1VQQA 3CPTB 5F1FA 2WKEA 3UMDA 4LV1A 5A93A 3LO7A 2BG1A 3EQVA 5C5KA 1BLHA 3W4PA 1YAXA 2A2LA 1MWUA 3PBQA 4LV2A 1H8MA 3LI8A 4NXGA 2K31A 2KLIA 4DE3A 3DWKA 4II7A 3A0VA 2FZ0A 4WZ4A 4KZBA 2M7VA 1DJAA 4Y2FA 1G6OA 3R7WA 1MC0A 3VSKA 4FH4A 1W5DA 1K38A 2I9VA 1EROA 3AGEA 4HP4A 2OSUA 4QWOA 1S4RA 1TS0A 2WK0A 3MQOA 5KSHA 1ZC2A 3FKVA 2XD1A 3PTEA 1M40A 4X25A 2KDKA 4WYYA 1K55C 3MFXA 1H0MA 4HEFA 3BY8A 3G31A 1RP5A 3MR0A 3VE4A 1RCJA 2Y2IA 1KOUA 3R7WB 3HUNA 5EECA 1S6RA 1JTDA 2WKIA 3BFEA 2B95A 3ZG9B 2V1ZA 1Y4OA 4XT2A 4L9GA 1YLPA 3T1QB 3C2WA 5KSCA 3FYZA 4DJ3A 4E6XA 1GCEA 3QP8A 2JC7A 4MBFA 1BLPA 1PIOA 3CG5A 3EGDC 1K57A 5HAPA 1WA9A 3C7UA 3W4OA 4MN7A 4ZTKA 4O01A 5FAQA 3GECA 3ZG8B 2Y2KA 2EWWA 2H0TA 2OWHA 1PWCA 3MS6A 3UN7A 2LB5A 2AVXA 2OV5A 3MXQA 3WS1A 4CLCD 4XT2B 3KYZA 5DJTA 4PM5A 3IHAA 1SDNA 2EFXA 4GOGA 4UQIS 2PYRA 2ZM0A 3G35A 1KVMA 2XGNA 1EI5A 3LYXA 1T1CA 3VOYA 2Q9NA 4G3VA 5CXWA 2Y2JA 4KQRA 1ESUA 1F9IA 2PYPA 4NXFA 2Y2MA 1OTDA 1LL9A 2Z6DA 4R0QA 4WM9A 4LGWA 3BLSA 3WS5A 2W0NA 3A3JA 1DP8A 4E6WA 5FI7A 1YT4A 1K54A 4MBKA 4I3AA 3F1NA 3BLMA 1F98A 2QWSA 1OMEA 3LR0A 2DMWA 2J9OA 4N9LA 2YKHA 2HDRA 4WN5A 1ES5A 4ETXA 4C6YA 3GVBA 3T50A 1IKGA 4OQGA 3FG8A 3O86A 3EEAA 4DE0A 4BJPA 3BW6A 1BZAA 2W1RA 2XRNA 1N9NA 2XDMA 1HVBA 3I7JA 1K25A 1MBLA 2JKRM 4GN2A 5GLCA 3A3DA 4HJ4A 3M6BA 2E8JA 3F1NB 3ISGA 2Y4AA 2QHKA 4KG2A 5CHJA 1O07A 1CJFA 5EFWA 4FSFA 5DF9A 5FAPA 1TDGA 2FH5A 4PM6A 3KYEA 1BT5A 2Y91A 3GMWA 4LLOB 4MMNA 3ZVTA 2XR0A 3IQAA 1DP6A 3P09A 3OOVA 2XF3A 3D9YA 2ZQCA 3MQ0A 4S2LA 2DCFA 1YKDA 2HV1A 3CWFA 1PWDA 4BD0A 1UWPX 3R4KA 1YLWA 2V8CA 1ES2A 1GSXA 1GSVA 5GLBA 3CUEA 4GCZA 4M3KA 3UDFA 4YINA 1VEUA 4WZ5A 5HDDA 3FC7A 4Y5FA 1D7EA 1S1YA 1T19A 2ZBBA 3IF6A 1TF1A 4X53A 2L4RA 3EOIA 2FFYA 5A90A 4IVKA 2B5RA 4YFMA 1NWZA 1NJ4A 1O7EA 5DTSA 2Q9MA 2ZM2A 1JWPA 4GB7A 3W2ZA 5I5LA 2M1CA 2X71A 3ZYTA 3BECA 1G28A 2DRWA 4DE1A 1OTBA 3O3VA 3LGOA 4ZJ2A 4E3JA 4KQOA 5J4EA 5FA7A 3VSLA 4XUZA 3E2LA 4RX2A 4OOLA 4YNRA 4HP9A 5LBRA 3UB5P 4UA9A 3IF6B 4DDSA 1PI5A 3G34A 4NKPA 2WAEA 4KQDA 2ZJ9A 4RVAA 2HJ9C 1E3UA 1PW1A 5FASA 3RFBA
chains in the Genus database with same CATH topology
5FQ9A 3VP0A 2EX6A 4P6BA 2BLSA 4OVDA 5KMWA 3M6HA 4OPRA 3N7WA 1BUEA 1JWZA 2Y2NA 3AGFA 4GZBA 4R3JA 3N8LA 4GD8A 4Y0UA 1LL5A 5F1GA 3S4XA 2WADA 4N1XA 5CGXA 5FAOA 4QY5A 4OONA 3W4QA 4DF6A 1MWSA 3N6IA 4D2OA 4B88A 3UE0A 5FQKA 3VP1A 3NIAA 4B4XA 4R4RA 3M2KA 2IWCA 3BFDA 2ZQ9A 5FDHA 3CZDA 2QZ6A 1KDWA 2C5WB 4GDNA 3VP3A 5DF8A 1I2WA 3A3EA 4LENA 4OP5A 5HFOA 1YLJA 5A91A 4GD6A 4PMAA 4KZ9A 4EBLA 4F94A 4KG5A 2EX9A 3QHYA 1NXYA 3OCLA 5EPHA 4B4ZA 4O7DA 5E2GA 4CPKA 3MKEA 3WRZA 1QMFA 4MNRA 5CTNA 1YLZA 4BENA 3IF6C 3WS0A 3NC8A 5F83A 4S2JA 4WMCA 4C75A 4S2PA 4EBNA 1VQQA 4IBRA 1RGZA 2WKEA 5F1FA 4LV1A 4QHCA 1KGGA 2WGIA 5A93A 1J9MA 1HD8A 3LO7A 3OPLA 2BG1A 4L0LA 3VMAA 4WEJA 3EQVA 4OOMA 3GQZA 5M18A 1Q2QA 1BLHA 3W4PA 5CGSA 2GDNA 3IHBA 1MWUA 2ZD8A 2EX2A 2ZC6B 3PBQA 4LV2A 2H0YA 4OPZA 2A49A 1KE0A 1FSYA 2R9XA 4DXBA 4ZJ3A 4NK3A 3N4IA 2J7VA 3G30A 1IYOA 4Y0OA 5FI2A 4JPMA 3CMZA 3IH9A 3DTMA 2CC1A 1W7FA 4KG6A 1SHVA 4DE3A 3V5MA 3DWKA 2R9WA 4GDBA 1CI8A 1LI0A 3OPRA 4WZ4A 2XH9A 1IYPA 1YLTA 3DW0A 4KZBA 4OPYA 1DY6A 1JVJA 2ZQDA 1DJAA 1NYYA 4U0XA 2H5SA 1FQGA 2G2WA 3G2YA 3IXHA 3PAEA 1TEMA 4KZ3A 4UA7A 4XUXA 1EWZA 2Z2LB 3VSKA 4FH4A 1W5DA 5DTKA 1K38A 3BFGA 1BLSA 1WE4A 3SS4A 4E3MA 4EWFA 1EROA 3AGEA 2E8IA 5CEDA 4K0WA 2Y2LA 4PM7A 2OSUA 4OH0A 2WZXA 3WS4A 5CGWA 2WK0A 4ZDXA 5CHUA 2HDUA 3IXGA 4N9KA 4E3KA 5KSHA 1ZC2A 5FSRA 3FKVA 5TR7A 5CEBA 3V3SA 2XD1A 1MPLA 3PTEA 1WYBA 3FV7A 1M40A 1FCMA 1K56A 4Z9QA 1YLYA 3C5AA 2WUQA 2P74A 4QU3A 3ZNTA 4CJNA 2Y2HA 1KGEA 1K57C 4OPQA 4WYYA 5E2EA 1K55C 1ZG4A 1XGJA 1KE3A 2XK1A 3MZFA 4HEFA 3G31A 4HESA 5FI6A 3V39A 4BD1A 1RP5A 4ID4A 4JXWA 1XA7A 4KZ4A 3PBNA 4KZAA 4PM9A 1RCJA 2Y2IA 5TGFA 2C6WB 4U3TA 4DKIA 1Y54A 2Y2GA 4PPRA 2XFSA 3HUNA 2XEPA 4RYEA 2HDSA 3PBSA 5HAIA 5BOHA 4KZ6A 5EECA 3GSGA 1ES4A 1S6RA 4JXGA 1JTDA 1W8QA 2WKIA 3FKWA 4RX3A 3N8SA 3ZG7B 4S2IA 3BFEA 3HUOA 3MZDA 3HLEA 5AQ9A 3QNBA 3ZG9B 5L2FA 1LHYA 2V1ZA 3OCNA 4GKUA 2Y2OA 1JTGA 2WGVA 1YLPA 3C7VA 5J8XA 5DF7A 5KSCA 4X68A 3FYZA 2PU4A 3O88A 4S2NC 4E6XA 1ERMA 1GCEA 2ZC3B 4ZJ1A 1L0DA 4P87A 4KZ7A 3JYIA 5KZHA 5A92A 3BEBA 3VP2A 2JC7A 3MFDA 1BLPA 1PIOA 4MBFA 4WBGA 3CG5A 1FSWA 1K57A 1MY8A 2HP5A 3AGDA 4OOYA 5HAPA 3C7UA 1K55A 3W4OA 2PU2A 1SKFA 3MXSA 2OLVA 4OQIA 4ZTKA 3GV9A 3Q07A 3ZCZA 3A3FA 5FAQA 3NDGA 2ZM8A 5GHXA 1BLCA 3ZG8B 2Y2KA 5CERA 4P85A 3HVFA 2H0TA 1CK3A 1PWCA 3UPNA 3VFFA 3UN7A 4UA6A 2Y59A 1W8YA 4N92A 4OQ0A 5CECA 3UY6A 3ZHHA 5HAQA 1ESIA 2OV5A 1K6RA 2V2FF 2ZQ7A 3WS1A 1XKZA 3E2KA 3GRJA 4Y7PA 1PWGA 5CTMA 4NETA 2Y55A 4P0MA 4OP8A 4EQIA 3OPHA 1MWRA 4KZ8A 2X01A 3WS2A 4WELA 4PM5A 5HW3A 3HLWA 1G68A 3S1YA 4S2NA 1GA0A 1FCNA 1FR6A 2RL3A 4U0TA 3MBZA 1FCOA 1K54C 2XQZA 4QD4A 4C3QA 1K56D 4DE2A 3NDEA 4R23A 3IHAA 3UPOA 1IYQA 3ZFZA 1SDNA 2EFXA 5HX9A 2Y2PA 4GOGA 3S22A 4HBTA 3OC2A 3ZG5A 4EBPA 2ZM0A 4HBUA 1NYMA 1K6SA 1PZOA 3G35A 1KVMA 1N9BA 2XGNA 4BQMA 1EI5A 3OZHA 5FQMA 2Q9NA 3HLFA 3MZEA 3HLDA 1YM1A 4LCLA 5GLAA 3UE3A 5F82A 1QMEA 2RCXA 3FWLA 1LLBA 1L0FA 4IEDA 1ERQA 3SH9A 3PAGA 3HREA 5CXWA 1MKIA 2Y2JA 4KQRA 1H5XA 1ESUA 1HZOA 3OPPA 4ZAMA 4E3LA 1CI9A 3HBRA 3ZDJA 3CJMA 2Y2MA 4QJGA 3NI9A 1LL9A 1TDLA 4Y0TA 4R0QA 3C4PA 4WM9A 4FH2A 3GR2A 3A3IA 3BLSA 1XGIA 2A3UA 4GNUA 3WS5A 4BL2A 4JF6A 4FD8A 3A3JA 5AQ7A 1AXBA 4OLDA 4E6WA 4KZ5A 1CEGA 2XD5A 3HL9A 4OKPA 1YT4A 3HLGA 5FI7A 1K54A 2P9VA 4JF5A 3VFHA 5DVAA 3Q7VA 4MBKA 1ALQA 2JBFA 4K91A 5HL1A 1DJCA 3IT9A 3RXWA 4UHUA 3O87A 5AQBA 4OLGA 3BLMA 2EX8A 5D3OA 3VP4A 3ZNYA 1IYSA 4DXCA 5HARA 3SH7A 1ZG6A 2HP9A 3SOIA 3IXDA 5GHYA 2XLNA 1OMEA 1N4OA 5EUAA 4DRTA 2EXBA 3RXXA 3SS5A 2HP6A 2EXAA 2J9OA 1CEFA 1XX2A 4N9LA 4QY6A 4R4SA 3BFFA 2HDRA 1H8ZA 1ES5A 1HTZA 3FZCA 1KE4A 3NCKA 3VOZA 2PBYA 4C6YA 3V50A 2JE5A 5I94A 3GVBA 4JXSA 4X56A 1IKGA 4A5RA 3ZG0A 4MEZA 3D4FA 4OQGA 3O86A 2X02A 2ZQ8A 1YMXA 3G2ZA 4DE0A 4BJPA 1BZAA 2VGJA 1G6AA 4IBXA 3IF5A 2OLUA 2XDMA 1HVBA 3I7JA 4S2OA 2HPBA 2P9VB 5IHVA 1K25A 1MBLA 4GN2A 3Q7VB 5FATA 5GLCA 1S0WA 2WKHA 4ZBEA 3A3DA 3M6BA 4FCFA 2V20A 1W79A 3ISGA 3LEZA 2Z2MB 3ITBA 1I2SA 3MXRA 3SS3A 2Y4AA 1GHPA 4KG2A 1SDEA 3Q1FA 4LCMA 5CHJA 3GTCA 1YMSA 1O07A 3B3XA 1LI9A 3IH8A 1BSGA 3LY3A 3N8RA 2H10A 4X6TA 1NZOA 5JYPA 1E4DA 1GHIA 3G32A 3BFCA 4FSFA 4JF4A 3BYDA 3SH8A 5JYOA 5DF9A 3W8KA 1KVLA 5FAPA 1KGFA 1TDGA 2ZC4B 1NRFA 1FOFA 5GHZA 4PM6A 4DDYA 1XXMA 1BT5A 5GL9A 1L2SA 1XP4A 2QMIA 4K0XA 4E3NA 4WZ5C 2Y91A 2WGWA 3GMWA 3QNCA 2EFUA 1H8YA 3NBLA 4WEKA 3PBRA 3ZVTA 5EOOA 2XR0A 2FFFB 1FR1A 3IQAA 3P09A 2I72A 3C4OA 2XF3A 1RGYA 3NY4A 1XPBA 1DJBA 2ZQCA 4Q8IA 3UO9A 2XFTA 2IWBA 4E3IA 1PYYA 3LCEA 5EVIA 4EV4A 4S2LA 3Q7ZA 2G2UA 2DCFA 3BM6A 1KDSA 1PWDA 4JKTA 3TG9A 3UDXA 3UDIA 2ZLYA 4UAAA 4BD0A 3TOIA 1ZKJA 2J8YA 3Q82A 1IKIA 4MLLA 1YLWA 5AQAA 2ZQAA 3ZGAB 5TFQA 4MBHA 1ES2A 5M1AA 2IWDA 3DWZA 4OQHA 3TSGA 4EUZA 5DTTA 2ZMAA 5GLBA 2JCHA 4LV3A 1BULA 2UWXA 4KQQA 4M3KA 5GLDA 2HDQA 1NZUA 5G18A 3UPPA 3IWQA 3UDFA 2Y2QA 1I5QA 5EE8A 4YINA 1ONGA 5FQQA 1L0GA 1C3BA 4JLFA 2WGWB 4WZ5A 3BRMA 2WAFA 3UNWA 3LY4A 1U60A 1XA1A 2VGKA 1ES3A 4JBFA 3ZVWA 4R1GA 2WYXA 1GHMA 1JWVA 2J9PA 3RJUA 1PI4A 5EVIB 5FQJA 1NY0A 4IVIA 3IXBA 4JXVA 3IF6A 1VM1A 3HUMA 4S2KA 3V3RA 4BLMA 1E25A 1E3UD 1Q2PA 3ITAA 4X53A 3PBTA 5E43A 4PM8A 4QB8A 3WWXA 2FFYA 5A90A 1SCWA 4IVKA 2B5RA 4YFMA 5E2HA 2WZZA 1NJ4A 1O7EA 5DTSA 2Q9MA 2ZM2A 1JWPA 4GB7A 4S2MA 3MKFA 4KENB 4BL3A 2X71A 3BECA 4E3OA 3PBOA 2ZC5B 1ONHA 2DRWA 3M2JA 4DE1A 3UE1A 1L0EA 3IWIA 4H8RA 3O3VA 5CHMA 4ZJ2A 3WRTA 4E3JA 4KQOA 4XXRA 2QPNA 5FA7A 1PW8A 3VSLA 1PZPA 1Z6FA 4R3BA 4XUZA 5FQIA 1K4EA 3E2LA 3G4PA 4RX2A 4OOLA 5CRFA 5M19A 2DNSA 1WYCA 3HLBA 3EQUA 3Q81A 4X55A 5U47A 1MWTA 3IF6B 4UA9A 5EVID 4DDSA 1PI5A 3G34A 3HLCA 3P98A 4WMCD 2WAEA 4X69A 1BTLA 1IEMA 1TVFA 4N1HA 2ZJ9A 3IWOA 4LV0A 5EVIC 1K4FA 4RVAA 1YQSA 5EVLA 5E2FA 1M6KA 1E3UA 1PW1A 2ZC7A 4RA7A 1IELA 1MXOA 5FASA 1GA9A 3VOYA 5EOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FQ9 A;  3VP0 A;  2EX6 A;  4P6B A;  2BLS A;  4OVD A;  5KMW A;  3M6H A;  4OPR A;  3N7W A;  1BUE A;  1JWZ A;  2Y2N A;  3AGF A;  4GZB A;  4R3J A;  3N8L A;  4GD8 A;  4Y0U A;  1LL5 A;  5F1G A;  3S4X A;  2WAD A;  4N1X A;  5CGX A;  5FAO A;  4QY5 A;  4OON A;  3W4Q A;  4DF6 A;  1MWS A;  3N6I A;  4D2O A;  4B88 A;  3UE0 A;  5FQK A;  3VP1 A;  3NIA A;  4B4X A;  4R4R A;  3M2K A;  2IWC A;  3BFD A;  2ZQ9 A;  5FDH A;  3CZD A;  2QZ6 A;  1KDW A;  2C5W B;  4GDN A;  3VP3 A;  5DF8 A;  1I2W A;  3A3E A;  4LEN A;  4OP5 A;  5HFO A;  1YLJ A;  5A91 A;  4GD6 A;  4PMA A;  4KZ9 A;  4EBL A;  4F94 A;  4KG5 A;  2EX9 A;  3QHY A;  1NXY A;  3OCL A;  5EPH A;  4B4Z A;  4O7D A;  5E2G A;  4CPK A;  3MKE A;  3WRZ A;  1QMF A;  4MNR A;  5CTN A;  1YLZ A;  4BEN A;  3IF6 C;  3WS0 A;  3NC8 A;  5F83 A;  4S2J A;  4WMC A;  4C75 A;  4S2P A;  4EBN A;  1VQQ A;  4IBR A;  1RGZ A;  2WKE A;  5F1F A;  4LV1 A;  4QHC A;  1KGG A;  2WGI A;  5A93 A;  1J9M A;  1HD8 A;  3LO7 A;  3OPL A;  2BG1 A;  4L0L A;  3VMA A;  4WEJ A;  3EQV A;  4OOM A;  3GQZ A;  5M18 A;  1Q2Q A;  1BLH A;  3W4P A;  5CGS A;  2GDN A;  3IHB A;  1MWU A;  2ZD8 A;  2EX2 A;  2ZC6 B;  3PBQ A;  4LV2 A;  2H0Y A;  4OPZ A;  2A49 A;  1KE0 A;  1FSY A;  2R9X A;  4DXB A;  4ZJ3 A;  4NK3 A;  3N4I A;  2J7V A;  3G30 A;  1IYO A;  4Y0O A;  5FI2 A;  4JPM A;  3CMZ A;  3IH9 A;  3DTM A;  2CC1 A;  1W7F A;  4KG6 A;  1SHV A;  4DE3 A;  3V5M A;  3DWK A;  2R9W A;  4GDB A;  1CI8 A;  1LI0 A;  3OPR A;  4WZ4 A;  2XH9 A;  1IYP A;  1YLT A;  3DW0 A;  4KZB A;  4OPY A;  1DY6 A;  1JVJ A;  2ZQD A;  1DJA A;  1NYY A;  4U0X A;  2H5S A;  1FQG A;  2G2W A;  3G2Y A;  3IXH A;  3PAE A;  1TEM A;  4KZ3 A;  4UA7 A;  4XUX A;  1EWZ A;  2Z2L B;  3VSK A;  4FH4 A;  1W5D A;  5DTK A;  1K38 A;  3BFG A;  1BLS A;  1WE4 A;  3SS4 A;  4E3M A;  4EWF A;  1ERO A;  3AGE A;  2E8I A;  5CED A;  4K0W A;  2Y2L A;  4PM7 A;  2OSU A;  4OH0 A;  2WZX A;  3WS4 A;  5CGW A;  2WK0 A;  4ZDX A;  5CHU A;  2HDU A;  3IXG A;  4N9K A;  4E3K A;  5KSH A;  1ZC2 A;  5FSR A;  3FKV A;  5TR7 A;  5CEB A;  3V3S A;  2XD1 A;  1MPL A;  3PTE A;  1WYB A;  3FV7 A;  1M40 A;  1FCM A;  1K56 A;  4Z9Q A;  1YLY A;  3C5A A;  2WUQ A;  2P74 A;  4QU3 A;  3ZNT A;  4CJN A;  2Y2H A;  1KGE A;  1K57 C;  4OPQ A;  4WYY A;  5E2E A;  1K55 C;  1ZG4 A;  1XGJ A;  1KE3 A;  2XK1 A;  3MZF A;  4HEF A;  3G31 A;  4HES A;  5FI6 A;  3V39 A;  4BD1 A;  1RP5 A;  4ID4 A;  4JXW A;  1XA7 A;  4KZ4 A;  3PBN A;  4KZA A;  4PM9 A;  1RCJ A;  2Y2I A;  5TGF A;  2C6W B;  4U3T A;  4DKI A;  1Y54 A;  2Y2G A;  4PPR A;  2XFS A;  3HUN A;  2XEP A;  4RYE A;  2HDS A;  3PBS A;  5HAI A;  5BOH A;  4KZ6 A;  5EEC A;  3GSG A;  1ES4 A;  1S6R A;  4JXG A;  1JTD A;  1W8Q A;  2WKI A;  3FKW A;  4RX3 A;  3N8S A;  3ZG7 B;  4S2I A;  3BFE A;  3HUO A;  3MZD A;  3HLE A;  5AQ9 A;  3QNB A;  3ZG9 B;  5L2F A;  1LHY A;  2V1Z A;  3OCN A;  4GKU A;  2Y2O A;  1JTG A;  2WGV A;  1YLP A;  3C7V A;  5J8X A;  5DF7 A;  5KSC A;  4X68 A;  3FYZ A;  2PU4 A;  3O88 A;  4S2N C;  4E6X A;  1ERM A;  1GCE A;  2ZC3 B;  4ZJ1 A;  1L0D A;  4P87 A;  4KZ7 A;  3JYI A;  5KZH A;  5A92 A;  3BEB A;  3VP2 A;  2JC7 A;  3MFD A;  1BLP A;  1PIO A;  4MBF A;  4WBG A;  3CG5 A;  1FSW A;  1K57 A;  1MY8 A;  2HP5 A;  3AGD A;  4OOY A;  5HAP A;  3C7U A;  1K55 A;  3W4O A;  2PU2 A;  1SKF A;  3MXS A;  2OLV A;  4OQI A;  4ZTK A;  3GV9 A;  3Q07 A;  3ZCZ A;  3A3F A;  5FAQ A;  3NDG A;  2ZM8 A;  5GHX A;  1BLC A;  3ZG8 B;  2Y2K A;  5CER A;  4P85 A;  3HVF A;  2H0T A;  1CK3 A;  1PWC A;  3UPN A;  3VFF A;  3UN7 A;  4UA6 A;  2Y59 A;  1W8Y A;  4N92 A;  4OQ0 A;  5CEC A;  3UY6 A;  3ZHH A;  5HAQ A;  1ESI A;  2OV5 A;  1K6R A;  2V2F F;  2ZQ7 A;  3WS1 A;  1XKZ A;  3E2K A;  3GRJ A;  4Y7P A;  1PWG A;  5CTM A;  4NET A;  2Y55 A;  4P0M A;  4OP8 A;  4EQI A;  3OPH A;  1MWR A;  4KZ8 A;  2X01 A;  3WS2 A;  4WEL A;  4PM5 A;  5HW3 A;  3HLW A;  1G68 A;  3S1Y A;  4S2N A;  1GA0 A;  1FCN A;  1FR6 A;  2RL3 A;  4U0T A;  3MBZ A;  1FCO A;  1K54 C;  2XQZ A;  4QD4 A;  4C3Q A;  1K56 D;  4DE2 A;  3NDE A;  4R23 A;  3IHA A;  3UPO A;  1IYQ A;  3ZFZ A;  1SDN A;  2EFX A;  5HX9 A;  2Y2P A;  4GOG A;  3S22 A;  4HBT A;  3OC2 A;  3ZG5 A;  4EBP A;  2ZM0 A;  4HBU A;  1NYM A;  1K6S A;  1PZO A;  3G35 A;  1KVM A;  1N9B A;  2XGN A;  4BQM A;  1EI5 A;  3OZH A;  5FQM A;  2Q9N A;  3HLF A;  3MZE A;  3HLD A;  1YM1 A;  4LCL A;  5GLA A;  3UE3 A;  5F82 A;  1QME A;  2RCX A;  3FWL A;  1LLB A;  1L0F A;  4IED A;  1ERQ A;  3SH9 A;  3PAG A;  3HRE A;  5CXW A;  1MKI A;  2Y2J A;  4KQR A;  1H5X A;  1ESU A;  1HZO A;  3OPP A;  4ZAM A;  4E3L A;  1CI9 A;  3HBR A;  3ZDJ A;  3CJM A;  2Y2M A;  4QJG A;  3NI9 A;  1LL9 A;  1TDL A;  4Y0T A;  4R0Q A;  3C4P A;  4WM9 A;  4FH2 A;  3GR2 A;  3A3I A;  3BLS A;  1XGI A;  2A3U A;  4GNU A;  3WS5 A;  4BL2 A;  4JF6 A;  4FD8 A;  3A3J A;  5AQ7 A;  1AXB A;  4OLD A;  4E6W A;  4KZ5 A;  1CEG A;  2XD5 A;  3HL9 A;  4OKP A;  1YT4 A;  3HLG A;  5FI7 A;  1K54 A;  2P9V A;  4JF5 A;  3VFH A;  5DVA A;  3Q7V A;  4MBK A;  1ALQ A;  2JBF A;  4K91 A;  5HL1 A;  1DJC A;  3IT9 A;  3RXW A;  4UHU A;  3O87 A;  5AQB A;  4OLG A;  3BLM A;  2EX8 A;  5D3O A;  3VP4 A;  3ZNY A;  1IYS A;  4DXC A;  5HAR A;  3SH7 A;  1ZG6 A;  2HP9 A;  3SOI A;  3IXD A;  5GHY A;  2XLN A;  1OME A;  1N4O A;  5EUA A;  4DRT A;  2EXB A;  3RXX A;  3SS5 A;  2HP6 A;  2EXA A;  2J9O A;  1CEF A;  1XX2 A;  4N9L A;  4QY6 A;  4R4S A;  3BFF A;  2HDR A;  1H8Z A;  1ES5 A;  1HTZ A;  3FZC A;  1KE4 A;  3NCK A;  3VOZ A;  2PBY A;  4C6Y A;  3V50 A;  2JE5 A;  5I94 A;  3GVB A;  4JXS A;  4X56 A;  1IKG A;  4A5R A;  3ZG0 A;  4MEZ A;  3D4F A;  4OQG A;  3O86 A;  2X02 A;  2ZQ8 A;  1YMX A;  3G2Z A;  4DE0 A;  4BJP A;  1BZA A;  2VGJ A;  1G6A A;  4IBX A;  3IF5 A;  2OLU A;  2XDM A;  1HVB A;  3I7J A;  4S2O A;  2HPB A;  2P9V B;  5IHV A;  1K25 A;  1MBL A;  4GN2 A;  3Q7V B;  5FAT A;  5GLC A;  1S0W A;  2WKH A;  4ZBE A;  3A3D A;  3M6B A;  4FCF A;  2V20 A;  1W79 A;  3ISG A;  3LEZ A;  2Z2M B;  3ITB A;  1I2S A;  3MXR A;  3SS3 A;  2Y4A A;  1GHP A;  4KG2 A;  1SDE A;  3Q1F A;  4LCM A;  5CHJ A;  3GTC A;  1YMS A;  1O07 A;  3B3X A;  1LI9 A;  3IH8 A;  1BSG A;  3LY3 A;  3N8R A;  2H10 A;  4X6T A;  1NZO A;  5JYP A;  1E4D A;  1GHI A;  3G32 A;  3BFC A;  4FSF A;  4JF4 A;  3BYD A;  3SH8 A;  5JYO A;  5DF9 A;  3W8K A;  1KVL A;  5FAP A;  1KGF A;  1TDG A;  2ZC4 B;  1NRF A;  1FOF A;  5GHZ A;  4PM6 A;  4DDY A;  1XXM A;  1BT5 A;  5GL9 A;  1L2S A;  1XP4 A;  2QMI A;  4K0X A;  4E3N A;  4WZ5 C;  2Y91 A;  2WGW A;  3GMW A;  3QNC A;  2EFU A;  1H8Y A;  3NBL A;  4WEK A;  3PBR A;  3ZVT A;  5EOO A;  2XR0 A;  2FFF B;  1FR1 A;  3IQA A;  3P09 A;  2I72 A;  3C4O A;  2XF3 A;  1RGY A;  3NY4 A;  1XPB A;  1DJB A;  2ZQC A;  4Q8I A;  3UO9 A;  2XFT A;  2IWB A;  4E3I A;  1PYY A;  3LCE A;  5EVI A;  4EV4 A;  4S2L A;  3Q7Z A;  2G2U A;  2DCF A;  3BM6 A;  1KDS A;  1PWD A;  4JKT A;  3TG9 A;  3UDX A;  3UDI A;  2ZLY A;  4UAA A;  4BD0 A;  3TOI A;  1ZKJ A;  2J8Y A;  3Q82 A;  1IKI A;  4MLL A;  1YLW A;  5AQA A;  2ZQA A;  3ZGA B;  5TFQ A;  4MBH A;  1ES2 A;  5M1A A;  2IWD A;  3DWZ A;  4OQH A;  3TSG A;  4EUZ A;  5DTT A;  2ZMA A;  5GLB A;  2JCH A;  4LV3 A;  1BUL A;  2UWX A;  4KQQ A;  4M3K A;  5GLD A;  2HDQ A;  1NZU A;  5G18 A;  3UPP A;  3IWQ A;  3UDF A;  2Y2Q A;  1I5Q A;  5EE8 A;  4YIN A;  1ONG A;  5FQQ A;  1L0G A;  1C3B A;  4JLF A;  2WGW B;  4WZ5 A;  3BRM A;  2WAF A;  3UNW A;  3LY4 A;  1U60 A;  1XA1 A;  2VGK A;  1ES3 A;  4JBF A;  3ZVW A;  4R1G A;  2WYX A;  1GHM A;  1JWV A;  2J9P A;  3RJU A;  1PI4 A;  5EVI B;  5FQJ A;  1NY0 A;  4IVI A;  3IXB A;  4JXV A;  3IF6 A;  1VM1 A;  3HUM A;  4S2K A;  3V3R A;  4BLM A;  1E25 A;  1E3U D;  1Q2P A;  3ITA A;  4X53 A;  3PBT A;  5E43 A;  4PM8 A;  4QB8 A;  3WWX A;  2FFY A;  5A90 A;  1SCW A;  4IVK A;  2B5R A;  4YFM A;  5E2H A;  2WZZ A;  1NJ4 A;  1O7E A;  5DTS A;  2Q9M A;  2ZM2 A;  1JWP A;  4GB7 A;  4S2M A;  3MKF A;  4KEN B;  4BL3 A;  2X71 A;  3BEC A;  4E3O A;  3PBO A;  2ZC5 B;  1ONH A;  2DRW A;  3M2J A;  4DE1 A;  3UE1 A;  1L0E A;  3IWI A;  4H8R A;  3O3V A;  5CHM A;  4ZJ2 A;  3WRT A;  4E3J A;  4KQO A;  4XXR A;  2QPN A;  5FA7 A;  1PW8 A;  3VSL A;  1PZP A;  1Z6F A;  4R3B A;  4XUZ A;  5FQI A;  1K4E A;  3E2L A;  3G4P A;  4RX2 A;  4OOL A;  5CRF A;  5M19 A;  2DNS A;  1WYC A;  3HLB A;  3EQU A;  3Q81 A;  4X55 A;  5U47 A;  1MWT A;  3IF6 B;  4UA9 A;  5EVI D;  4DDS A;  1PI5 A;  3G34 A;  3HLC A;  3P98 A;  4WMC D;  2WAE A;  4X69 A;  1BTL A;  1IEM A;  1TVF A;  4N1H A;  2ZJ9 A;  3IWO A;  4LV0 A;  5EVI C;  1K4F A;  4RVA A;  1YQS A;  5EVL A;  5E2F A;  1M6K A;  1E3U A;  1PW1 A;  2ZC7 A;  4RA7 A;  1IEL A;  1MXO A;  5FAS A;  1GA9 A;  3VOY A;  5EOE A; 
#chains in the Genus database with same CATH topology
 3MSH A;  2EX6 A;  4OVD A;  2O9C A;  2R78 A;  2Y2N A;  2OAQ 1;  4JGQ A;  4R3J A;  4Y0U A;  2WAD A;  4EEU A;  4I38 A;  2XA7 S;  5EVE A;  3VP1 A;  5FQK A;  5IS1 A;  4R4R A;  5KIZ A;  2IA2 A;  1OPX A;  5DF8 A;  4OP5 A;  4M4X A;  5A91 A;  2Q0O A;  4F94 A;  3DTE A;  3HJI A;  2EX9 A;  3QHY A;  4CPK A;  2LB9 A;  1QMF A;  4MNR A;  1XJ4 A;  5CTN A;  2H28 A;  4S2J A;  4QHC A;  1J9M A;  2W1T A;  3VMA A;  4L0L A;  1IOU A;  3GQZ A;  5J3W A;  2PDR A;  3PYP A;  2HGV A;  3IHB A;  2ZD8 A;  2ZC6 B;  3QP2 A;  4H6J A;  2J7V A;  4Y0O A;  1IYO A;  3IBJ A;  3U4L P;  1OJG A;  2D02 A;  4KG6 A;  1W7F A;  1SHV A;  3V5M A;  3IS2 A;  4O8G A;  3T4O A;  3U2A A;  4BBT A;  3OPR A;  1S4S A;  1YLT A;  5F69 A;  4OPY A;  1DY6 A;  1JVJ A;  2ZQD A;  1FQG A;  3EEH A;  3LEQ A;  3QP1 A;  2GNX A;  4HI4 A;  5HWW A;  3T4K A;  2ZMF A;  1EWZ A;  5DTK A;  4E3M A;  1BLS A;  3NUL A;  4GW9 A;  2E8I A;  2VGL M;  4K0W A;  4ZDX A;  2J3T D;  4H6J B;  4N9K A;  3EGX C;  4Y13 A;  3F1O A;  3F1P A;  1WYB A;  1K56 A;  4Z9Q A;  2W3E A;  2WUQ A;  4QU3 A;  3ZNT A;  2JKT M;  1K57 C;  5DFX A;  5MC7 A;  1XGJ A;  2JN7 A;  3MZF A;  4BD1 A;  3V39 A;  1SZV A;  3TW8 A;  4JXW A;  2PR6 A;  5TGF A;  4PPR A;  3UB9 A;  2HDS A;  4IJG A;  1ES4 A;  4JXG A;  3LUQ A;  3P7N A;  2PBD P;  5AQ9 A;  3OCN A;  1SKO A;  2Y2O A;  2PR5 A;  1ACF A;  3C8C A;  4X68 A;  3F1O B;  3O88 A;  1ERM A;  4ZJ1 A;  2ZC3 B;  3F1P B;  3TJZ C;  4P87 A;  3JYI A;  3MFD A;  4I39 A;  4JGO A;  2VLG A;  4OOY A;  1G5U A;  3MXS A;  4OQI A;  1DP9 A;  3GV9 A;  3IX4 A;  5G4Y A;  2VZW A;  5CER A;  4KUO A;  3MMH A;  4ZRR A;  1XFN A;  3C30 A;  3VFF A;  4UA6 A;  2Y59 A;  3K3C A;  5HAQ A;  2PAV P;  1S66 L;  4Q0H A;  1XKZ A;  1PWG A;  1SKO B;  4LRZ E;  1MWR A;  5AVE A;  2X01 A;  3WS2 A;  3NOU C;  1GA0 A;  1FIK A;  5L10 A;  1K54 C;  4LRY C;  4QD4 A;  4DE2 A;  1K56 D;  3UPO A;  1IYQ A;  2XA7 M;  5HX9 A;  3VOL A;  4HBU A;  1K6S A;  1N9B A;  3T4T A;  5HWT A;  4BQM A;  3HLF A;  3MZE A;  1YM1 A;  3FWL A;  3UE6 A;  3HRE A;  1TD5 A;  3OPP A;  5FDS A;  2JKT I;  3NOP C;  3NI9 A;  1TDL A;  2ZOH A;  1TS7 A;  2L1M A;  1V9Y A;  4FH2 A;  3GR2 A;  5HSQ A;  4R6L A;  4CLC A;  3DAV A;  5AQ7 A;  4OLD A;  4HJ6 A;  1CEG A;  2XD5 A;  4OKP A;  3HLG A;  4NXE A;  1LSV A;  1ALQ A;  2KX6 A;  3T4L A;  4CQH A;  5HL1 A;  3RXW A;  3O87 A;  5AQB A;  4OLG A;  3KYQ A;  4DXC A;  3CI6 A;  3SH7 A;  1ZG6 A;  1YSP A;  4NEE D;  2EXB A;  3SS5 A;  4QY6 A;  1CEF A;  1XX2 A;  2WKQ A;  4R4S A;  3BFF A;  4DN0 A;  3S7P A;  1KE4 A;  2PBY A;  4X56 A;  4MEZ A;  2GJ3 A;  3PR6 A;  4MCW A;  1IFQ A;  2X02 A;  1YMX A;  1F2K A;  4CLC B;  5HL6 A;  2VGJ A;  4EER A;  3UB8 A;  4IBX A;  4B93 A;  3IF5 A;  2OLU A;  4S2O A;  2HPB A;  5IHV A;  5FAT A;  2P7J A;  2WKH A;  1W63 M;  2V20 A;  2BAS A;  3ITB A;  3MXR A;  5HPF A;  3DTK A;  3O5Y A;  1GHP A;  1SDE A;  4LCM A;  3PHY A;  2WKP A;  1YSQ A;  5AVF A;  1PFL A;  3IH8 A;  3N8R A;  3CUE C;  2W3D A;  3BYD A;  4DDY A;  5GHZ A;  4E3N A;  4WZ5 C;  2WGW A;  3MF0 A;  3QNC A;  2NUP C;  2EFU A;  4NXB A;  5CX7 A;  2FFF B;  1RGY A;  3NY4 A;  1XPB A;  1DJB A;  2EA9 A;  2XFT A;  1T18 A;  1PYY A;  5EVI A;  4Y3I A;  3A0S A;  4FTX A;  3TG9 A;  3UDX A;  2ZLY A;  4HOI A;  2JKG A;  1ZKJ A;  2J8Y A;  1IKI A;  2ZOI A;  3VV4 A;  3TSG A;  4EUZ A;  4OQH A;  5DTT A;  2ZMA A;  1LL8 A;  2UWX A;  4KQQ A;  5GLD A;  2HDQ A;  4BBV A;  5G18 A;  5EE8 A;  1ONG A;  3T4S A;  3KO6 A;  2WGW B;  1P9W A;  2OAP 1;  3LY4 A;  1XA1 A;  1OTE A;  1VET B;  4HIA A;  5EVI B;  4IVI A;  1E25 A;  1Q2P A;  2VV7 A;  4E04 A;  3PBT A;  5E43 A;  4MN5 A;  4PM8 A;  1ZHH B;  3WWX A;  1MZU A;  5HDS A;  1Y28 A;  3MKF A;  5DKK A;  4KEN B;  3JVV A;  2PHY A;  4BBU A;  1XFQ A;  3PBO A;  5DFY A;  1ONH A;  3UE1 A;  1AWI A;  4H8R A;  2V1A A;  5CHM A;  3WRT A;  1X0O A;  4LFU A;  1Z6F A;  1K4E A;  5CRF A;  1LSX A;  4X55 A;  2A24 A;  5EVI D;  2PRF A;  3IX8 A;  3L7H A;  3HLC A;  2VV8 A;  4WMC D;  3IWO A;  1STZ A;  1K4F A;  1M6K A;  5FL3 A;  1IEL A;  1P0Z A;  2BLS A;  4DJ2 A;  5KMW A;  3LI9 A;  3N7W A;  1BUE A;  1JWZ A;  4GD8 A;  4N1X A;  5CGX A;  5FAO A;  4QY5 A;  3W4Q A;  3QP4 A;  4RQ9 A;  2V9A A;  3NIA A;  4B4X A;  3CHW P;  3M2K A;  3LID A;  3BFD A;  4GDN A;  3BQ8 A;  3B47 A;  4GD6 A;  4PMA A;  2A24 B;  1XJ3 A;  4O7D A;  4WL9 A;  1F5M A;  5E2G A;  3MKE A;  2V8F A;  1XJ6 A;  2P08 A;  4R38 A;  4BEN A;  3QP5 A;  2UV0 E;  4EXO A;  1RGZ A;  2WGI A;  1HD8 A;  2VJW A;  2QKP A;  3OPL A;  4OOM A;  3KSH A;  1Q2Q A;  3S7Q A;  2EX2 A;  2H0Y A;  1ZTU A;  1FSY A;  1ODV A;  3K2N A;  3N4I A;  1EW0 A;  4NK3 A;  3G30 A;  5FI2 A;  2HF6 A;  3CMZ A;  3IH9 A;  2CC1 A;  2R9W A;  2K2N A;  4GDB A;  1CI8 A;  4PKY G;  1LI0 A;  1JNU A;  2XH9 A;  1IYP A;  2H5S A;  3KSG A;  2G2W A;  3TRC A;  4KZ3 A;  4XUX A;  2J80 A;  2Z2L B;  4IUK A;  2G7U A;  1WE4 A;  2JKR I;  4EWF A;  4UQI M;  5CED A;  4EEP A;  4OH0 A;  3WS4 A;  3CAX A;  5CHU A;  4E3K A;  2ZMV A;  5FSR A;  1FIL A;  5TR7 A;  4HH2 A;  4O0P A;  1YLY A;  3T1S A;  2O0Y A;  1KGE A;  4OPQ A;  5E2E A;  1KE3 A;  2XK1 A;  4HES A;  4ID4 A;  3T1R A;  5K5B A;  4KZA A;  2C6W B;  4DKI A;  4IHQ A;  5HZH A;  4RYE A;  3PBS A;  5HAI A;  5BOH A;  3GSG A;  2ZL1 A;  1W8Q A;  3FKW A;  3ZG7 B;  3N8S A;  4S2I A;  3L9K A;  3HUO A;  5L2F A;  5AJG A;  4GKU A;  1JTG A;  5J8X A;  5DF7 A;  4WLA A;  3D3O A;  1L0D A;  4KZ7 A;  5A92 A;  3BEB A;  2HZ5 A;  3VP2 A;  3LR4 A;  4ME4 A;  2GZA A;  5G4Z A;  4JGP A;  1K0K A;  2HP5 A;  2BTF P;  2PU2 A;  2O99 A;  3ZCZ A;  1UGU A;  2OWJ A;  4YOF A;  3NDG A;  4P6Z S;  5IU1 A;  5GHX A;  1BLC A;  4P85 A;  3HVF A;  1CK3 A;  3ULF A;  1W8Y A;  4OQ0 A;  5CEC A;  3ZHH A;  3H7W A;  1ESI A;  4K08 A;  2ZL1 B;  1K6R A;  2V2F F;  3E2K A;  3CLO A;  3GRJ A;  4Y7P A;  5CTM A;  4NET A;  4P0M A;  4EQI A;  3OPH A;  4CLC C;  4KZ8 A;  2KOI A;  4WEL A;  3HLW A;  5HWV A;  1G68 A;  5EM1 A;  4S2N A;  4GLQ A;  1FR6 A;  4U0T A;  3MBZ A;  1FCO A;  4C3Q A;  4R23 A;  3HCY A;  4R3A A;  3ZFZ A;  3S22 A;  4HBT A;  3OC2 A;  4EBP A;  1NYM A;  3HLD A;  5GLA A;  5F82 A;  1QME A;  2RCX A;  3SH9 A;  1L0F A;  5DKL A;  1MKI A;  3P01 A;  1HZO A;  4ZAM A;  4HQA A;  3H7W B;  4Y0T A;  4HY8 A;  3C4P A;  1XGI A;  2CMN A;  4GNU A;  4BL2 A;  2W27 A;  2EWV A;  4FD8 A;  1AXB A;  4DMZ A;  2P9V A;  5F6A A;  3Q7V A;  2P04 A;  4K91 A;  3IT9 A;  4UHU A;  4EU0 A;  2EX8 A;  3ZNY A;  5EUA A;  3RXX A;  4HHD A;  4ESP A;  1HTZ A;  3FZC A;  1OJ5 A;  3E98 A;  2JE5 A;  4JXS A;  3ZG0 A;  2B18 A;  4Q0J A;  3BY9 A;  2ZQ8 A;  3G2Z A;  4ETZ A;  1G6A A;  5L8M A;  2VEA A;  2P9V B;  3Q7V B;  1S0W A;  4ZBE A;  2K7S A;  4Y15 A;  2O9B A;  4HH3 A;  1I2S A;  4Q0I A;  3SS3 A;  4F3L A;  2O9A A;  2NUT C;  3GTC A;  1YMS A;  3IX3 A;  2H10 A;  1E4D A;  2HJE A;  1GHI A;  1H3Q A;  3SH8 A;  5JYO A;  1KVL A;  1FOF A;  3RTY A;  1XXM A;  5GL9 A;  3G6O A;  3LFV A;  1N9O A;  5HDC A;  1H8Y A;  4WEK A;  5EOO A;  4Q8I A;  4E3I A;  4EV4 A;  2W3G A;  3LCE A;  4EES A;  5F5Y A;  2W3H A;  1KDS A;  4JKT A;  1TS6 A;  4F3L B;  4MLL A;  2WKR A;  4IUH A;  3ZGA B;  4MBH A;  5EV0 A;  3DWZ A;  2D01 A;  2J3W A;  2JCH A;  4GS9 B;  3BJN A;  1NZU A;  3UB6 A;  3IWQ A;  2Y2Q A;  4P6Z M;  5FQQ A;  1C3B A;  3BRM A;  2WAF A;  3UNW A;  5DJU A;  3ICY A;  2XRO A;  4EW7 A;  1YPR A;  3ZVW A;  4KUK A;  4R1G A;  1JWV A;  2J9P A;  2JHE A;  5F68 A;  4LPZ A;  3CIT A;  1S1Z A;  3HUM A;  4BMW A;  1BYW A;  4BLM A;  3ITA A;  4QB8 A;  1SCW A;  5L09 A;  2WZZ A;  1T1A A;  4E3O A;  4Z1W A;  2QJ5 A;  3M2J A;  2VKS A;  4QPR A;  1PW8 A;  3SW1 A;  4R3B A;  3G4P A;  5M19 A;  2DNS A;  3HLB A;  3EQU A;  3Q81 A;  5U47 A;  4GJ4 A;  2M7U A;  3LIE A;  3P98 A;  4X69 A;  1P97 A;  4WUJ A;  1OT6 A;  3T12 B;  1YQS A;  5FEG A;  5E2F A;  2ZC7 A;  4RA7 A;  1VHM A;  2QJ7 A;  1MXO A;  3ZQ5 A;  1GA9 A;  5EOE A;  5TBM A;  2YKF A;  4OPR A;  1L3L A;  3N8L A;  3SZT A;  3MQQ A;  3TE8 A;  4OON A;  1MWS A;  3N6I A;  4D2O A;  2IWC A;  2ZQ9 A;  3CZD A;  5A8B A;  2QZ6 A;  1KDW A;  3EWK A;  1I2W A;  3A3E A;  4LEN A;  2VV6 A;  1VET A;  4EBL A;  4KG5 A;  3OCL A;  4NG2 A;  3WRZ A;  4AFI A;  3MJQ A;  1PRQ A;  3IF6 C;  3WS0 A;  3NC8 A;  5F83 A;  2GX5 A;  4WMC A;  4EBN A;  4IBR A;  3PXP A;  1KGG A;  5TBM B;  1W63 Q;  4WEJ A;  4B9O A;  5M18 A;  5CGS A;  2GDN A;  4MDZ A;  4PHT A;  3UME A;  4OPZ A;  1GSW A;  2A49 A;  2JKF A;  1KE0 A;  2R9X A;  4DXB A;  4ZJ3 A;  4JPM A;  5J7E A;  3DTM A;  2V0W A;  3A0R A;  4G3K A;  3DW0 A;  3C38 A;  4L9E A;  5EM0 A;  1NYY A;  4U0X A;  3K3D A;  3G2Y A;  3IXH A;  3PAE A;  3LR3 A;  1TEM A;  4UA7 A;  3BFG A;  3UB7 A;  3SS4 A;  4ARZ A;  1A0K A;  2Y2L A;  4PM7 A;  2WZX A;  5CGW A;  2HDU A;  3IXG A;  5CEB A;  4EET B;  3V3S A;  1MPL A;  2J3T C;  3FV7 A;  3NHQ A;  1FCM A;  3B33 A;  3C5A A;  2P74 A;  4CJN A;  2Y2H A;  5HD3 A;  1ZG4 A;  5FI6 A;  3OLO A;  4LRX C;  1XA7 A;  4KZ4 A;  4PAU A;  3PBN A;  4PM9 A;  4U3T A;  1Y54 A;  2Y2G A;  1NLZ A;  2XSS A;  2XFS A;  4PKY A;  3NEC A;  2XEP A;  2PT7 A;  4I3I A;  4KZ6 A;  4ARZ B;  3NJA A;  2W3F A;  4RX3 A;  3MZD A;  3HLE A;  3QNB A;  1LHY A;  3DBA A;  2WGV A;  3C7V A;  2PU4 A;  4S2N C;  5HPI A;  4YWZ A;  4EQ1 A;  5KZH A;  4WBG A;  1FSW A;  4R70 A;  1MY8 A;  1Z09 A;  3AGD A;  3JVU A;  1PNE A;  1K55 A;  3GDI A;  3T4J A;  1SKF A;  2OLV A;  3Q07 A;  3A3F A;  3BQA A;  3S7O A;  2ZM8 A;  3UPN A;  3LIA A;  4N92 A;  3UY6 A;  4I3J A;  2ZQ7 A;  3RH8 B;  4G3W A;  4EUV A;  2Y55 A;  4OP8 A;  2ACG A;  5HW3 A;  4D60 A;  3S1Y A;  1FCN A;  2RL3 A;  4Y17 A;  3H9W A;  2XQZ A;  3NDE A;  2Y2P A;  3ZG5 A;  2VGL S;  1PZO A;  3B42 A;  3KSI A;  3OZH A;  5FQM A;  4LCL A;  3UE3 A;  4IED A;  1LLB A;  1ERQ A;  3PAG A;  3OBF A;  3T4Q A;  1H5X A;  4E3L A;  1CI9 A;  3HBR A;  3ZDJ A;  3CJM A;  4QJG A;  1TS8 A;  3A3I A;  2A3U A;  4L9F A;  1S67 L;  4JF6 A;  1OTI A;  4KZ5 A;  3HL9 A;  2PD8 A;  4JF5 A;  3VFH A;  5DVA A;  2JBF A;  2VX8 A;  2Y8H A;  1DJC A;  4MN6 A;  3HJK A;  5D3O A;  3VP4 A;  1IYS A;  2HP9 A;  3SOI A;  3IXD A;  1P9R A;  3E4P A;  5GHY A;  2XLN A;  4DRT A;  1N4O A;  2HP6 A;  2EXA A;  1NRJ A;  1H8Z A;  3NCK A;  3VOZ A;  1VEU B;  3V50 A;  5I94 A;  4A5R A;  3D4F A;  5L07 A;  3VE3 A;  1MKM A;  3JPU A;  5TJJ A;  1DRM A;  4FCF A;  1W79 A;  3LEZ A;  2Z2M B;  4JGR A;  4HNB A;  1XJ2 A;  4CLC E;  3Q1F A;  3B3X A;  1LI9 A;  4BWI A;  4GHI A;  3LIF A;  3LR5 A;  1BSG A;  3LY3 A;  4X6T A;  1NZO A;  5JYP A;  1NLY A;  4I5S A;  3G32 A;  3BFC A;  4JF4 A;  3S7N A;  3W8K A;  1KGF A;  2ZC4 B;  1NRF A;  1L2S A;  1XP4 A;  2QMI A;  1OT9 A;  4K0X A;  3NBL A;  3PBR A;  4FUW A;  3KX0 X;  1FR1 A;  3T1X A;  2I72 A;  3C4O A;  3LIB A;  3UO9 A;  2IWB A;  1HLU P;  3Q7Z A;  2G2U A;  5IT5 A;  3BM6 A;  2PD7 A;  3E4Q A;  3UDI A;  4UAA A;  4X1M A;  3TOI A;  3Q82 A;  3BWL A;  4GHI B;  5AQA A;  2ZQA A;  5TFQ A;  5M1A A;  2IWD A;  3E4O A;  4HJ3 A;  4LV3 A;  1BUL A;  3UPP A;  1LSW A;  1I5Q A;  2QYB A;  1L0G A;  3D72 A;  4JLF A;  1OTA A;  1U60 A;  2VGK A;  1ES3 A;  4JBF A;  1CQA A;  3V67 A;  2WYX A;  1GHM A;  3RJU A;  3KSF A;  1PI4 A;  5FQJ A;  1NY0 A;  3IXB A;  4JXV A;  1VM1 A;  4S2K A;  3V3R A;  1E3U D;  5FEF A;  2V0U A;  2MJ6 A;  2W1T B;  1UWN X;  5E2H A;  3LIC A;  2VA0 A;  1N9L A;  4S2M A;  4BL3 A;  3H82 A;  2ZC5 B;  1L0E A;  3QP6 A;  3IWI A;  4XXR A;  2QPN A;  1PZP A;  5FQI A;  3IS2 B;  1WYC A;  4FOF A;  1CF0 A;  1MWT A;  2B02 A;  1D06 A;  2INW A;  1D1J A;  1BTL A;  1IEM A;  1TVF A;  4N1H A;  5EVI C;  4LV0 A;  2L0W A;  5EVL A;  2VK3 A;  2OOL A;  1LT0 A;  4UEY A;  5HAR A;  3CPT A;  5FQ9 A;  1VB6 A;  3VP0 A;  2Y79 A;  4P6B A;  3M6H A;  3FPW A;  1T1B A;  3FPV A;  3H82 B;  4GZB A;  3AGF A;  3NOT C;  1LL5 A;  5F1G A;  3S4X A;  3E0Y A;  4GS9 A;  4DF6 A;  2Z6C A;  4B88 A;  3UE0 A;  5FDH A;  4X1L A;  5HD5 A;  3DTI A;  1J3W A;  2C5W B;  3VP3 A;  2V1B A;  5HFO A;  1YLJ A;  4KZ9 A;  4B4Z A;  5EPH A;  1NXY A;  1YLZ A;  4C75 A;  4S2P A;  3IBR A;  4WF0 A;  1V9Z A;  1VQQ A;  3CPT B;  5F1F A;  2WKE A;  3UMD A;  4LV1 A;  5A93 A;  3LO7 A;  2BG1 A;  3EQV A;  5C5K A;  1BLH A;  3W4P A;  1YAX A;  2A2L A;  1MWU A;  3PBQ A;  4LV2 A;  1H8M A;  3LI8 A;  4NXG A;  2K31 A;  2KLI A;  4DE3 A;  3DWK A;  4II7 A;  3A0V A;  2FZ0 A;  4WZ4 A;  4KZB A;  2M7V A;  1DJA A;  4Y2F A;  1G6O A;  3R7W A;  1MC0 A;  3VSK A;  4FH4 A;  1W5D A;  1K38 A;  2I9V A;  1ERO A;  3AGE A;  4HP4 A;  2OSU A;  4QWO A;  1S4R A;  1TS0 A;  2WK0 A;  3MQO A;  5KSH A;  1ZC2 A;  3FKV A;  2XD1 A;  3PTE A;  1M40 A;  4X25 A;  2KDK A;  4WYY A;  1K55 C;  3MFX A;  1H0M A;  4HEF A;  3BY8 A;  3G31 A;  1RP5 A;  3MR0 A;  3VE4 A;  1RCJ A;  2Y2I A;  1KOU A;  3R7W B;  3HUN A;  5EEC A;  1S6R A;  1JTD A;  2WKI A;  3BFE A;  2B95 A;  3ZG9 B;  2V1Z A;  1Y4O A;  4XT2 A;  4L9G A;  1YLP A;  3T1Q B;  3C2W A;  5KSC A;  3FYZ A;  4DJ3 A;  4E6X A;  1GCE A;  3QP8 A;  2JC7 A;  4MBF A;  1BLP A;  1PIO A;  3CG5 A;  3EGD C;  1K57 A;  5HAP A;  1WA9 A;  3C7U A;  3W4O A;  4MN7 A;  4ZTK A;  4O01 A;  5FAQ A;  3GEC A;  3ZG8 B;  2Y2K A;  2EWW A;  2H0T A;  2OWH A;  1PWC A;  3MS6 A;  3UN7 A;  2LB5 A;  2AVX A;  2OV5 A;  3MXQ A;  3WS1 A;  4CLC D;  4XT2 B;  3KYZ A;  5DJT A;  4PM5 A;  3IHA A;  1SDN A;  2EFX A;  4GOG A;  4UQI S;  2PYR A;  2ZM0 A;  3G35 A;  1KVM A;  2XGN A;  1EI5 A;  3LYX A;  1T1C A;  3VOY A;  2Q9N A;  4G3V A;  5CXW A;  2Y2J A;  4KQR A;  1ESU A;  1F9I A;  2PYP A;  4NXF A;  2Y2M A;  1OTD A;  1LL9 A;  2Z6D A;  4R0Q A;  4WM9 A;  4LGW A;  3BLS A;  3WS5 A;  2W0N A;  3A3J A;  1DP8 A;  4E6W A;  5FI7 A;  1YT4 A;  1K54 A;  4MBK A;  4I3A A;  3F1N A;  3BLM A;  1F98 A;  2QWS A;  1OME A;  3LR0 A;  2DMW A;  2J9O A;  4N9L A;  2YKH A;  2HDR A;  4WN5 A;  1ES5 A;  4ETX A;  4C6Y A;  3GVB A;  3T50 A;  1IKG A;  4OQG A;  3FG8 A;  3O86 A;  3EEA A;  4DE0 A;  4BJP A;  3BW6 A;  1BZA A;  2W1R A;  2XRN A;  1N9N A;  2XDM A;  1HVB A;  3I7J A;  1K25 A;  1MBL A;  2JKR M;  4GN2 A;  5GLC A;  3A3D A;  4HJ4 A;  3M6B A;  2E8J A;  3F1N B;  3ISG A;  2Y4A A;  2QHK A;  4KG2 A;  5CHJ A;  1O07 A;  1CJF A;  5EFW A;  4FSF A;  5DF9 A;  5FAP A;  1TDG A;  2FH5 A;  4PM6 A;  3KYE A;  1BT5 A;  2Y91 A;  3GMW A;  4LLO B;  4MMN A;  3ZVT A;  2XR0 A;  3IQA A;  1DP6 A;  3P09 A;  3OOV A;  2XF3 A;  3D9Y A;  2ZQC A;  3MQ0 A;  4S2L A;  2DCF A;  1YKD A;  2HV1 A;  3CWF A;  1PWD A;  4BD0 A;  1UWP X;  3R4K A;  1YLW A;  2V8C A;  1ES2 A;  1GSX A;  1GSV A;  5GLB A;  3CUE A;  4GCZ A;  4M3K A;  3UDF A;  4YIN A;  1VEU A;  4WZ5 A;  5HDD A;  3FC7 A;  4Y5F A;  1D7E A;  1S1Y A;  1T19 A;  2ZBB A;  3IF6 A;  1TF1 A;  4X53 A;  2L4R A;  3EOI A;  2FFY A;  5A90 A;  4IVK A;  2B5R A;  4YFM A;  1NWZ A;  1NJ4 A;  1O7E A;  5DTS A;  2Q9M A;  2ZM2 A;  1JWP A;  4GB7 A;  3W2Z A;  5I5L A;  2M1C A;  2X71 A;  3ZYT A;  3BEC A;  1G28 A;  2DRW A;  4DE1 A;  1OTB A;  3O3V A;  3LGO A;  4ZJ2 A;  4E3J A;  4KQO A;  5J4E A;  5FA7 A;  3VSL A;  4XUZ A;  3E2L A;  4RX2 A;  4OOL A;  4YNR A;  4HP9 A;  5LBR A;  3UB5 P;  4UA9 A;  3IF6 B;  4DDS A;  1PI5 A;  3G34 A;  4NKP A;  2WAE A;  4KQD A;  2ZJ9 A;  4RVA A;  2HJ9 C;  1E3U A;  1PW1 A;  5FAS A;  3RFB A; 
#chains in the Genus database with same CATH homology
 5FQ9 A;  3VP0 A;  2EX6 A;  4P6B A;  2BLS A;  4OVD A;  5KMW A;  3M6H A;  4OPR A;  3N7W A;  1BUE A;  1JWZ A;  2Y2N A;  3AGF A;  4GZB A;  4R3J A;  3N8L A;  4GD8 A;  4Y0U A;  1LL5 A;  5F1G A;  3S4X A;  2WAD A;  4N1X A;  5CGX A;  5FAO A;  4QY5 A;  4OON A;  3W4Q A;  4DF6 A;  1MWS A;  3N6I A;  4D2O A;  4B88 A;  3UE0 A;  5FQK A;  3VP1 A;  3NIA A;  4B4X A;  4R4R A;  3M2K A;  2IWC A;  3BFD A;  2ZQ9 A;  5FDH A;  3CZD A;  2QZ6 A;  1KDW A;  2C5W B;  4GDN A;  3VP3 A;  5DF8 A;  1I2W A;  3A3E A;  4LEN A;  4OP5 A;  5HFO A;  1YLJ A;  5A91 A;  4GD6 A;  4PMA A;  4KZ9 A;  4EBL A;  4F94 A;  4KG5 A;  2EX9 A;  3QHY A;  1NXY A;  3OCL A;  5EPH A;  4B4Z A;  4O7D A;  5E2G A;  4CPK A;  3MKE A;  3WRZ A;  1QMF A;  4MNR A;  5CTN A;  1YLZ A;  4BEN A;  3IF6 C;  3WS0 A;  3NC8 A;  5F83 A;  4S2J A;  4WMC A;  4C75 A;  4S2P A;  4EBN A;  1VQQ A;  4IBR A;  1RGZ A;  2WKE A;  5F1F A;  4LV1 A;  4QHC A;  1KGG A;  2WGI A;  5A93 A;  1J9M A;  1HD8 A;  3LO7 A;  3OPL A;  2BG1 A;  4L0L A;  3VMA A;  4WEJ A;  3EQV A;  4OOM A;  3GQZ A;  5M18 A;  1Q2Q A;  1BLH A;  3W4P A;  5CGS A;  2GDN A;  3IHB A;  1MWU A;  2ZD8 A;  2EX2 A;  2ZC6 B;  3PBQ A;  4LV2 A;  2H0Y A;  4OPZ A;  2A49 A;  1KE0 A;  1FSY A;  2R9X A;  4DXB A;  4ZJ3 A;  4NK3 A;  3N4I A;  2J7V A;  3G30 A;  1IYO A;  4Y0O A;  5FI2 A;  4JPM A;  3CMZ A;  3IH9 A;  3DTM A;  2CC1 A;  1W7F A;  4KG6 A;  1SHV A;  4DE3 A;  3V5M A;  3DWK A;  2R9W A;  4GDB A;  1CI8 A;  1LI0 A;  3OPR A;  4WZ4 A;  2XH9 A;  1IYP A;  1YLT A;  3DW0 A;  4KZB A;  4OPY A;  1DY6 A;  1JVJ A;  2ZQD A;  1DJA A;  1NYY A;  4U0X A;  2H5S A;  1FQG A;  2G2W A;  3G2Y A;  3IXH A;  3PAE A;  1TEM A;  4KZ3 A;  4UA7 A;  4XUX A;  1EWZ A;  2Z2L B;  3VSK A;  4FH4 A;  1W5D A;  5DTK A;  1K38 A;  3BFG A;  1BLS A;  1WE4 A;  3SS4 A;  4E3M A;  4EWF A;  1ERO A;  3AGE A;  2E8I A;  5CED A;  4K0W A;  2Y2L A;  4PM7 A;  2OSU A;  4OH0 A;  2WZX A;  3WS4 A;  5CGW A;  2WK0 A;  4ZDX A;  5CHU A;  2HDU A;  3IXG A;  4N9K A;  4E3K A;  5KSH A;  1ZC2 A;  5FSR A;  3FKV A;  5TR7 A;  5CEB A;  3V3S A;  2XD1 A;  1MPL A;  3PTE A;  1WYB A;  3FV7 A;  1M40 A;  1FCM A;  1K56 A;  4Z9Q A;  1YLY A;  3C5A A;  2WUQ A;  2P74 A;  4QU3 A;  3ZNT A;  4CJN A;  2Y2H A;  1KGE A;  1K57 C;  4OPQ A;  4WYY A;  5E2E A;  1K55 C;  1ZG4 A;  1XGJ A;  1KE3 A;  2XK1 A;  3MZF A;  4HEF A;  3G31 A;  4HES A;  5FI6 A;  3V39 A;  4BD1 A;  1RP5 A;  4ID4 A;  4JXW A;  1XA7 A;  4KZ4 A;  3PBN A;  4KZA A;  4PM9 A;  1RCJ A;  2Y2I A;  5TGF A;  2C6W B;  4U3T A;  4DKI A;  1Y54 A;  2Y2G A;  4PPR A;  2XFS A;  3HUN A;  2XEP A;  4RYE A;  2HDS A;  3PBS A;  5HAI A;  5BOH A;  4KZ6 A;  5EEC A;  3GSG A;  1ES4 A;  1S6R A;  4JXG A;  1JTD A;  1W8Q A;  2WKI A;  3FKW A;  4RX3 A;  3N8S A;  3ZG7 B;  4S2I A;  3BFE A;  3HUO A;  3MZD A;  3HLE A;  5AQ9 A;  3QNB A;  3ZG9 B;  5L2F A;  1LHY A;  2V1Z A;  3OCN A;  4GKU A;  2Y2O A;  1JTG A;  2WGV A;  1YLP A;  3C7V A;  5J8X A;  5DF7 A;  5KSC A;  4X68 A;  3FYZ A;  2PU4 A;  3O88 A;  4S2N C;  4E6X A;  1ERM A;  1GCE A;  2ZC3 B;  4ZJ1 A;  1L0D A;  4P87 A;  4KZ7 A;  3JYI A;  5KZH A;  5A92 A;  3BEB A;  3VP2 A;  2JC7 A;  3MFD A;  1BLP A;  1PIO A;  4MBF A;  4WBG A;  3CG5 A;  1FSW A;  1K57 A;  1MY8 A;  2HP5 A;  3AGD A;  4OOY A;  5HAP A;  3C7U A;  1K55 A;  3W4O A;  2PU2 A;  1SKF A;  3MXS A;  2OLV A;  4OQI A;  4ZTK A;  3GV9 A;  3Q07 A;  3ZCZ A;  3A3F A;  5FAQ A;  3NDG A;  2ZM8 A;  5GHX A;  1BLC A;  3ZG8 B;  2Y2K A;  5CER A;  4P85 A;  3HVF A;  2H0T A;  1CK3 A;  1PWC A;  3UPN A;  3VFF A;  3UN7 A;  4UA6 A;  2Y59 A;  1W8Y A;  4N92 A;  4OQ0 A;  5CEC A;  3UY6 A;  3ZHH A;  5HAQ A;  1ESI A;  2OV5 A;  1K6R A;  2V2F F;  2ZQ7 A;  3WS1 A;  1XKZ A;  3E2K A;  3GRJ A;  4Y7P A;  1PWG A;  5CTM A;  4NET A;  2Y55 A;  4P0M A;  4OP8 A;  4EQI A;  3OPH A;  1MWR A;  4KZ8 A;  2X01 A;  3WS2 A;  4WEL A;  4PM5 A;  5HW3 A;  3HLW A;  1G68 A;  3S1Y A;  4S2N A;  1GA0 A;  1FCN A;  1FR6 A;  2RL3 A;  4U0T A;  3MBZ A;  1FCO A;  1K54 C;  2XQZ A;  4QD4 A;  4C3Q A;  1K56 D;  4DE2 A;  3NDE A;  4R23 A;  3IHA A;  3UPO A;  1IYQ A;  3ZFZ A;  1SDN A;  2EFX A;  5HX9 A;  2Y2P A;  4GOG A;  3S22 A;  4HBT A;  3OC2 A;  3ZG5 A;  4EBP A;  2ZM0 A;  4HBU A;  1NYM A;  1K6S A;  1PZO A;  3G35 A;  1KVM A;  1N9B A;  2XGN A;  4BQM A;  1EI5 A;  3OZH A;  5FQM A;  2Q9N A;  3HLF A;  3MZE A;  3HLD A;  1YM1 A;  4LCL A;  5GLA A;  3UE3 A;  5F82 A;  1QME A;  2RCX A;  3FWL A;  1LLB A;  1L0F A;  4IED A;  1ERQ A;  3SH9 A;  3PAG A;  3HRE A;  5CXW A;  1MKI A;  2Y2J A;  4KQR A;  1H5X A;  1ESU A;  1HZO A;  3OPP A;  4ZAM A;  4E3L A;  1CI9 A;  3HBR A;  3ZDJ A;  3CJM A;  2Y2M A;  4QJG A;  3NI9 A;  1LL9 A;  1TDL A;  4Y0T A;  4R0Q A;  3C4P A;  4WM9 A;  4FH2 A;  3GR2 A;  3A3I A;  3BLS A;  1XGI A;  2A3U A;  4GNU A;  3WS5 A;  4BL2 A;  4JF6 A;  4FD8 A;  3A3J A;  5AQ7 A;  1AXB A;  4OLD A;  4E6W A;  4KZ5 A;  1CEG A;  2XD5 A;  3HL9 A;  4OKP A;  1YT4 A;  3HLG A;  5FI7 A;  1K54 A;  2P9V A;  4JF5 A;  3VFH A;  5DVA A;  3Q7V A;  4MBK A;  1ALQ A;  2JBF A;  4K91 A;  5HL1 A;  1DJC A;  3IT9 A;  3RXW A;  4UHU A;  3O87 A;  5AQB A;  4OLG A;  3BLM A;  2EX8 A;  5D3O A;  3VP4 A;  3ZNY A;  1IYS A;  4DXC A;  5HAR A;  3SH7 A;  1ZG6 A;  2HP9 A;  3SOI A;  3IXD A;  5GHY A;  2XLN A;  1OME A;  1N4O A;  5EUA A;  4DRT A;  2EXB A;  3RXX A;  3SS5 A;  2HP6 A;  2EXA A;  2J9O A;  1CEF A;  1XX2 A;  4N9L A;  4QY6 A;  4R4S A;  3BFF A;  2HDR A;  1H8Z A;  1ES5 A;  1HTZ A;  3FZC A;  1KE4 A;  3NCK A;  3VOZ A;  2PBY A;  4C6Y A;  3V50 A;  2JE5 A;  5I94 A;  3GVB A;  4JXS A;  4X56 A;  1IKG A;  4A5R A;  3ZG0 A;  4MEZ A;  3D4F A;  4OQG A;  3O86 A;  2X02 A;  2ZQ8 A;  1YMX A;  3G2Z A;  4DE0 A;  4BJP A;  1BZA A;  2VGJ A;  1G6A A;  4IBX A;  3IF5 A;  2OLU A;  2XDM A;  1HVB A;  3I7J A;  4S2O A;  2HPB A;  2P9V B;  5IHV A;  1K25 A;  1MBL A;  4GN2 A;  3Q7V B;  5FAT A;  5GLC A;  1S0W A;  2WKH A;  4ZBE A;  3A3D A;  3M6B A;  4FCF A;  2V20 A;  1W79 A;  3ISG A;  3LEZ A;  2Z2M B;  3ITB A;  1I2S A;  3MXR A;  3SS3 A;  2Y4A A;  1GHP A;  4KG2 A;  1SDE A;  3Q1F A;  4LCM A;  5CHJ A;  3GTC A;  1YMS A;  1O07 A;  3B3X A;  1LI9 A;  3IH8 A;  1BSG A;  3LY3 A;  3N8R A;  2H10 A;  4X6T A;  1NZO A;  5JYP A;  1E4D A;  1GHI A;  3G32 A;  3BFC A;  4FSF A;  4JF4 A;  3BYD A;  3SH8 A;  5JYO A;  5DF9 A;  3W8K A;  1KVL A;  5FAP A;  1KGF A;  1TDG A;  2ZC4 B;  1NRF A;  1FOF A;  5GHZ A;  4PM6 A;  4DDY A;  1XXM A;  1BT5 A;  5GL9 A;  1L2S A;  1XP4 A;  2QMI A;  4K0X A;  4E3N A;  4WZ5 C;  2Y91 A;  2WGW A;  3GMW A;  3QNC A;  2EFU A;  1H8Y A;  3NBL A;  4WEK A;  3PBR A;  3ZVT A;  5EOO A;  2XR0 A;  2FFF B;  1FR1 A;  3IQA A;  3P09 A;  2I72 A;  3C4O A;  2XF3 A;  1RGY A;  3NY4 A;  1XPB A;  1DJB A;  2ZQC A;  4Q8I A;  3UO9 A;  2XFT A;  2IWB A;  4E3I A;  1PYY A;  3LCE A;  5EVI A;  4EV4 A;  4S2L A;  3Q7Z A;  2G2U A;  2DCF A;  3BM6 A;  1KDS A;  1PWD A;  4JKT A;  3TG9 A;  3UDX A;  3UDI A;  2ZLY A;  4UAA A;  4BD0 A;  3TOI A;  1ZKJ A;  2J8Y A;  3Q82 A;  1IKI A;  4MLL A;  1YLW A;  5AQA A;  2ZQA A;  3ZGA B;  5TFQ A;  4MBH A;  1ES2 A;  5M1A A;  2IWD A;  3DWZ A;  4OQH A;  3TSG A;  4EUZ A;  5DTT A;  2ZMA A;  5GLB A;  2JCH A;  4LV3 A;  1BUL A;  2UWX A;  4KQQ A;  4M3K A;  5GLD A;  2HDQ A;  1NZU A;  5G18 A;  3UPP A;  3IWQ A;  3UDF A;  2Y2Q A;  1I5Q A;  5EE8 A;  4YIN A;  1ONG A;  5FQQ A;  1L0G A;  1C3B A;  4JLF A;  2WGW B;  4WZ5 A;  3BRM A;  2WAF A;  3UNW A;  3LY4 A;  1U60 A;  1XA1 A;  2VGK A;  1ES3 A;  4JBF A;  3ZVW A;  4R1G A;  2WYX A;  1GHM A;  1JWV A;  2J9P A;  3RJU A;  1PI4 A;  5EVI B;  5FQJ A;  1NY0 A;  4IVI A;  3IXB A;  4JXV A;  3IF6 A;  1VM1 A;  3HUM A;  4S2K A;  3V3R A;  4BLM A;  1E25 A;  1E3U D;  1Q2P A;  3ITA A;  4X53 A;  3PBT A;  5E43 A;  4PM8 A;  4QB8 A;  3WWX A;  2FFY A;  5A90 A;  1SCW A;  4IVK A;  2B5R A;  4YFM A;  5E2H A;  2WZZ A;  1NJ4 A;  1O7E A;  5DTS A;  2Q9M A;  2ZM2 A;  1JWP A;  4GB7 A;  4S2M A;  3MKF A;  4KEN B;  4BL3 A;  2X71 A;  3BEC A;  4E3O A;  3PBO A;  2ZC5 B;  1ONH A;  2DRW A;  3M2J A;  4DE1 A;  3UE1 A;  1L0E A;  3IWI A;  4H8R A;  3O3V A;  5CHM A;  4ZJ2 A;  3WRT A;  4E3J A;  4KQO A;  4XXR A;  2QPN A;  5FA7 A;  1PW8 A;  3VSL A;  1PZP A;  1Z6F A;  4R3B A;  4XUZ A;  5FQI A;  1K4E A;  3E2L A;  3G4P A;  4RX2 A;  4OOL A;  5CRF A;  5M19 A;  2DNS A;  1WYC A;  3HLB A;  3EQU A;  3Q81 A;  4X55 A;  5U47 A;  1MWT A;  3IF6 B;  4UA9 A;  5EVI D;  4DDS A;  1PI5 A;  3G34 A;  3HLC A;  3P98 A;  4WMC D;  2WAE A;  4X69 A;  1BTL A;  1IEM A;  1TVF A;  4N1H A;  2ZJ9 A;  3IWO A;  4LV0 A;  5EVI C;  1K4F A;  4RVA A;  1YQS A;  5EVL A;  5E2F A;  1M6K A;  1E3U A;  1PW1 A;  2ZC7 A;  4RA7 A;  1IEL A;  1MXO A;  5FAS A;  1GA9 A;  3VOY A;  5EOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...