3BFCA

Class a beta-lactamase sed-g238c complexed with imipenem
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
262
structure length
262
Chain Sequence
VQQVQKKLAALEKQSGGRLGVALINTADNSQVLYRADERFAMCSTSKVMTAAAVLKQSETHDGILQQKMTIKKADLTNWNPVTEKYVGNTMTLAELSAATLQYSDNTAMNKLLAHLGGPGNVTAFARSIGDTTFRLDRKEPELNTAIPGDERDTTSPLAMAKSLRKLTLGDALAGPQRAQLVDWLKGNTTGGQSIRAGLPAHWVVGDKTGACDYGTTNDIAVIWPEDRAPLVLVTYFTQPQQDAKWRKDVLAAAAKIVTEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Class A beta-lactamase Sed1
publication title Acyl-intermediate structures of the class A beta-lactamase SED-G238C
rcsb
source organism Citrobacter sedlakii
total genus 95
structure length 262
sequence length 262
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3bfcA00
3BLMA 1MWUA 3CMZA 2WKIA 3UNWA 3AGDA 3IWQA 1KVLA 4IVKA 4U3TA 4DXCA 3N6IA 3G2ZA 1CI9A 1LHYA 1U60A 2VGJA 1DJBA 1XP4A 4IBRA 3HLFA 5HFOA 4FSFA 5TGFA 3UDXA 3HUOA 2PU2A 2HDQA 4R23A 3NDEA 2Y55A 5EVIC 5GHYA 4S2KA 4X56A 5F1FA 1ESUA 2IWDA 3QNBA 4OONA 1PI4A 1FCOA 2PU4A 4WELA 5HAQA 4BL3A 2FFYA 5EVID 4JXWA 4O7DA 4Y0TA 2J7VA 5TFQA 5HW3A 3ZGAB 4S2JA 3C4OA 1ES5A 3IHAA 3HLWA 2DNSA 4E6XA 5A93A 4OPZA 3S1YA 1GA9A 4PPRA 3GR2A 1JTDA 4E3IA 4E3JA 1PW1A 2ZC4B 1E3UD 3ZG5A 3HLDA 4KQOA 3HBRA 4JXVA 2WADA 5FI2A 5M1AA 3V50A 1CEFA 3CZDA 4DE3A 5M19A 2ZQ9A 2WGIA 2XD5A 4PM9A 3MZFA 5KZHA 3WRTA 3EQVA 5J8XA 2Y59A 4JPMA 4E3NA 2JCHA 2J9PA 1HVBA 1JVJA 5GHXA 2Y2QA 3O3VA 2B5RA 4KZ3A 4WZ5A 1BZAA 4UA6A 4KG5A 5KSCA 1ES4A 3WS1A 2EFUA 2HP9A 1K57C 3W4PA 4HBTA 1W79A 4FH2A 1FOFA 4P6BA 5GL9A 4FCFA 3AGFA 4IBXA 4OLDA 1H5XA 5EVIB 1ZG4A 1O07A 1BLPA 3A3FA 3N8SA 4LV2A 3V3SA 3W4OA 2ZQDA 4KQRA 5FASA 4A5RA 4JF6A 5E2EA 1NXYA 2DCFA 5IHVA 4PM5A 3GVBA 1SDNA 5EVIA 4JF5A 2Y2GA 1PWDA 4X68A 4QJGA 3PBRA 1BUEA 1DJAA 1IYQA 1FR1A 1BULA 2V20A 1E3UA 1K6SA 2FFFB 3TG9A 2WAEA 2ZC3B 3UO9A 4DF6A 1LLBA 1MWTA 1FR6A 3TOIA 3ZHHA 1YLYA 3PBNA 1TVFA 4OOMA 3HUNA 3ITBA 2Y2LA 4EUZA 4KZ7A 4R4SA 1BSGA 4GDBA 1VQQA 2QPNA 1XGIA 5A92A 2GDNA 1MPLA 1EI5A 1RP5A 2EX8A 2XH9A 4DXBA 1Q2QA 1PI5A 1IKIA 1FCNA 5GHZA 4OH0A 3IXGA 1IYOA 4R3BA 3GRJA 4X53A 1ERQA 2P9VA 4OVDA 2XK1A 5CGXA 3EQUA 3ISGA 1K57A 3G2YA 3M6BA 3WWXA 1ZG6A 4HESA 1LL9A 3BFEA 2I72A 1PW8A 4JXSA 3IXDA 3V3RA 3E2LA 5JYOA 1L0GA 1CK3A 3UE3A 1QMFA 1XKZA 3P09A 3PAEA 4HEFA 1KDWA 2H0YA 4EBNA 3C7UA 3IQAA 2EX9A 3BFCA 1W8QA 3PBTA 3PBSA 4RVAA 3RXWA 4ZTKA 3G35A 3IT9A 3GMWA 5CRFA 3SH9A 1PZOA 3LY4A 5E2GA 2ZC5B 2J9OA 2IWCA 3WS4A 4GN2A 3MBZA 3G4PA 1E25A 3IHBA 5CHMA 4Q8IA 3DTMA 5FAOA 1H8YA 3FZCA 3MKEA 4UHUA 4MBKA 5FQJA 3P98A 4GDNA 1NJ4A 1PYYA 4JXGA 4YINA 4NK3A 4WEKA 4QY5A 2OSUA 5M18A 4N9LA 2XD1A 4U0XA 1VM1A 2QZ6A 5CEDA 4NETA 5U47A 3RXXA 4D2OA 1ZC2A 3BECA 3G32A 2EXAA 5E2FA 2XEPA 3HREA 3PBOA 1ONGA 3IWIA 4PMAA 3HLGA 4ZJ3A 3ZCZA 5TR7A 1MY8A 4WMCD 1WE4A 5FQKA 3GV9A 4P0MA 2X01A 2JE5A 2ZM8A 4JF4A 2OLVA 1BT5A 3N8RA 1IYSA 1W5DA 5KSHA 1GHMA 2Z2LB 3OCNA 5EOEA 4BL2A 3N8LA 1M40A 4LV3A 3MZEA 3OPLA 2Q9NA 3VOYA 1PIOA 3N4IA 4C3QA 4UAAA 5FA7A 3ZG0A 4DDYA 2ZM2A 3HL9A 4S2LA 1MKIA 4LV1A 1GHIA 4WYYA 1K56D 4FD8A 4BJPA 1K4EA 2HDUA 4MEZA 2UWXA 1EROA 1OMEA 2WZXA 1YLWA 3IXBA 4JLFA 3HUMA 4XXRA 2ZMAA 5CXWA 3Q7ZA 4R1GA 2BLSA 5F1GA 5AQ7A 2HDRA 1NRFA 1XGJA 3LY3A 3UPNA 2EXBA 3ZVWA 3DWZA 4LCLA 2ZQCA 2ZLYA 2WKEA 4UA7A 1E4DA 2Q9MA 4MNRA 4OQHA 1K6RA 4LCMA 3M2KA 2OV5A 4WBGA 1N9BA 3WS0A 5CGWA 1NZUA 4S2IA 2HPBA 3Q7VB 3M6HA 2JBFA 2XLNA 5FAQA 4X6TA 3UPPA 1KE4A 3GSGA 4RX2A 4S2PA 3OPRA 5A91A 3RJUA 3WS2A 3O86A 2ZQ8A 1I2WA 1YLTA 5DF7A 3IH8A 2Y91A 1K54C 5GLAA 5DF8A 1G68A 4OQGA 1CEGA 1LI0A 3FV7A 4OKPA 2ZM0A 3I7JA 1S6RA 1YLZA 3VP1A 5FQMA 4KG6A 3ZNYA 1EWZA 5EPHA 3ZDJA 4C6YA 1K56A 4KZBA 3OZHA 2ZQAA 5AQBA 1KGEA 3SS5A 3SH8A 2WGVA 1YQSA 5AQAA 3VSLA 2R9WA 4PM7A 1GCEA 5CGSA 3HLCA 4M3KA 2XGNA 5CHUA 3UE0A 4KQQA 2ZC7A 3B3XA 5EECA 5EOOA 5HAPA 1ERMA 1C3BA 4KENB 1BLCA 1IYPA 1W7FA 2Y2IA 1WYCA 3A3EA 1MBLA 5A90A 3LCEA 1QMEA 5CTNA 2WK0A 3Q81A 3AGEA 4DE2A 3UDFA 3W8KA 2XFSA 3NDGA 3N7WA 2P74A 1YMXA 4FH4A 5GLCA 4BD1A 4WZ4A 4BQMA 4BENA 3BFFA 2WGWB 3V39A 5KMWA 2WAFA 3IF5A 3ITAA 4DKIA 4GD8A 4WM9A 4R4RA 3BEBA 4K91A 4CPKA 1KE3A 4C75A 1TDGA 3BFGA 1N4OA 1XA7A 1L0DA 1PWCA 2WGWA 4IEDA 3E2KA 5BOHA 1XX2A 3MKFA 5F83A 1IEMA 4E3OA 3CG5A 4RYEA 4BD0A 3UE1A 1K54A 1ALQA 1KDSA 1Y54A 4N92A 1KGFA 2CC1A 1GHPA 3VMAA 2A3UA 3BM6A 3SH7A 3DW0A 3Q82A 3NC8A 2HP5A 1H8ZA 3Q1FA 3SOIA 5CECA 4PM6A 3PTEA 3IF6C 2RCXA 3FYZA 2H10A 3NIAA 5HARA 4PM8A 4ID4A 1XPBA 2V2FF 1JWZA 3GTCA 4CJNA 1LI9A 2WUQA 3MZDA 3VFFA 1DY6A 1FCMA 3HLEA 1K55A 3IXHA 2H0TA 2XR0A 1IELA 1LL5A 2XQZA 3PAGA 5DTSA 5FATA 4BLMA 3MXRA 4GOGA 2C6WB 1WYBA 4L0LA 4IVIA 1MWRA 2VGKA 1PWGA 3O87A 3S4XA 3G31A 1YM1A 2EX2A 1XA1A 5L2FA 4OPYA 4MBHA 3W4QA 4DE1A 2XDMA 3C5AA 5CHJA 2RL3A 4ZJ1A 5FQIA 2X02A 4ZDXA 2J8YA 4DDSA 4EV4A 2ZQ7A 1FSYA 1KGGA 4EWFA 5CEBA 1MWSA 4OP5A 1FSWA 4KZAA 4XUZA 3NCKA 4OOYA 5G18A 5CERA 4UA9A 4WEJA 4P85A 4ZJ2A 3A3JA 5GLDA 3HVFA 3PBQA 3IF6B 1NYYA 4Y0UA 1BLHA 3FWLA 5F82A 4S2NC 4Z9QA 4N9KA 1S0WA 1KVMA 2Y2NA 1FQGA 2Y2OA 2Y2KA 2QMIA 1HD8A 3S22A 1Z6FA 4LENA 5FI6A 3IWOA 4S2OA 3CJMA 3IF6A 4H8RA 1YLPA 2HP6A 2WYXA 1ZKJA 3QNCA 4N1HA 2E8IA 3FKVA 4XUXA 1HTZA 3VP2A 5CTMA 3ZVTA 4WMCA 3VP3A 5EUAA 4QD4A 5FQ9A 1W8YA 2H5SA 2Y2HA 3UN7A 1K25A 4RA7A 4GZBA 4X55A 3M2JA 4GD6A 4EBLA 4QB8A 4KZ9A 4R0QA 4ZAMA 3WRZA 1ES3A 4JKTA 3Q7VA 1G6AA 1MXOA 4QY6A 1J9MA 5HL1A 2WZZA 4GB7A 4OLGA 5DF9A 4JBFA 4OQIA 3NBLA 1BLSA 5DTKA 2HDSA 1ONHA 2EFXA 1ES2A 3QHYA 4MLLA 2XFTA 3VSKA 4OQ0A 3LO7A 1YMSA 3ZNTA 4ZBEA 4K0WA 3A3IA 4KG2A 4E3LA 4EQIA 1NZOA 3TSGA 5FSRA 2ZC6B 4RX3A 4U0TA 2C5WB 3OPPA 2OLUA 3IH9A 2G2WA 2V1ZA 1Q2PA 1K55C 2A49A 3VP0A 2PBYA 4OPQA 4Y7PA 3BLSA 4Y0OA 4OPRA 1SCWA 4F94A 1NY0A 5FAPA 3ZG9B 1JTGA 1SKFA 4QHCA 4S2NA 4KZ5A 4YFMA 4B88A 1I5QA 3LEZA 4X69A 3OPHA 1RGZA 5I94A 5DTTA 1JWPA 1YT4A 1KE0A 3BYDA 4N1XA 4OP8A 1XXMA 4GKUA 1IKGA 3A3DA 2P9VB 1RCJA 3BRMA 4MBFA 1CI8A 5E43A 5D3OA 5FI7A 3C4PA 3VFHA 3VOZA 3D4FA 3UPOA 5JYPA 1PZPA 1JWVA 4E3MA 3ZG8B 3SS4A 2Y2JA 2Y2MA 5GLBA 5FQQA 3Q07A 3UY6A 2JC7A 3ZG7B 3VP4A 2ZD8A 1ESIA 5DVAA 4KZ8A 2IWBA 1O7EA 5FDHA 4B4XA 3WS5A 4GNUA 5EVLA 4B4ZA 3G30A 1AXBA 3SS3A 5HAIA 2G2UA 2BG1A 3JYIA 1M6KA 3UDIA 2Y2PA 1SDEA 3G34A 1GA0A 2XF3A 2EX6A 2R9XA 2X71A 4DE0A 1TDLA 2ZJ9A 4KZ6A 4R3JA 4S2MA 1HZOA 3C7VA 4E3KA 1L0FA 3MXSA 5EE8A 3ZFZA 2Z2MB 4LV0A 1RGYA 4P87A 4K0XA 3BFDA 3V5MA 4EBPA 3MFDA 4E6WA 1DJCA 1I2SA 1K4FA 1BTLA 1L2SA 3DWKA 1K38A 2DRWA 3HLBA 4KZ4A 4HBUA 4DRTA 3GQZA 4WZ5C 3NY4A 3FKWA 3NI9A 5HX9A 3OC2A 1SHVA 3OCLA 3O88A 5E2HA 5AQ9A 2WKHA 1TEMA 2Y4AA 1NYMA 4OOLA 4QU3A 1YLJA 1L0EA
chains in the Genus database with same CATH superfamily
3CMZA 2WKIA 3CWFA 3OOVA 3G2ZA 2VGJA 1DJBA 4FSFA 4R23A 4X56A 5F1FA 2OAQ1 3QNBA 1PI4A 1FCOA 2HV1A 4Y0TA 3VV4A 2K2NA 3RH8B 5HW3A 3ZGAB 4S2JA 1ES5A 3IHAA 3S1YA 3BY9A 3GR2A 1E3UD 4KQOA 1D06A 2XD5A 5J8XA 3KX0X 2J9PA 1PFLA 2Y2QA 4ME4A 2B5RA 3DBAA 3WS1A 2HP9A 1K57C 5GL9A 4OLDA 2VGLS 3W4OA 3U4LP 4A5RA 5IHVA 3CITA 3T1QB 4JF5A 3PR6A 1D7EA 2Y2GA 4X68A 1FR1A 2FFFB 4Y13A 4DF6A 4Q0HA 1FR6A 3LIFA 1YLYA 3PBNA 4Y2FA 1F2KA 4KZ7A 2L1MA 2GDNA 2EX8A 2XH9A 2W3FA 3MS6A 2P9VA 4OVDA 1A0KA 3G2YA 3QP8A 4HESA 3BFEA 3CI6A 3H9WA 1PW8A 2QWSA 3V3RA 4MN7A 5AVEA 4CLCD 3LYXA 3T4QA 2GX5A 3C7UA 3LIBA 3RXWA 4EEUA 1PZOA 3LY4A 2J9OA 2ACGA 1S1YA 4GN2A 2OWJA 4UHUA 4MBKA 5IU1A 3P98A 4YINA 4NEED 1ZC2A 2M7UA 3G32A 2EXAA 2XEPA 3PBOA 1ONGA 4KQDA 4PMAA 5FQKA 2OLVA 2PBDP 1GHMA 4EXOA 5EOEA 2W27A 5G4ZA 3VOYA 4C3QA 1MKIA 4LV1A 4WYYA 1K56D 2W1TA 4RQ9A 2HDUA 2YKFA 4EERA 4JLFA 3HUMA 3E4PA 4R1GA 2HDRA 1DP9A 1NRFA 1XGJA 4FTXA 4LCLA 2ZLYA 4R6LA 4OQHA 1K6RA 3M2KA 4Y17A 2HPBA 3Q7VB 1KE4A 4S2PA 5HWVA 3T1XA 3IX4A 2ZQ8A 1I2WA 1YLTA 2YKHA 4HH2A 2W3GA 2A2LA 3C2WA 4IJGA 1EWZA 3ULFA 3VSLA 5HD3A 2R9WA 3HLCA 2JKRM 2KLIA 5HAPA 1W7FA 4GW9A 1V9YA 2VKSA 3Q81A 3AGEA 4F3LA 4DE2A 3LR0A 5GLCA 3N7WA 4FH4A 2L4RA 2BTFP 2Y8HA 3EGDC 4BQMA 4BENA 4CLCC 5KMWA 4WM9A 3QP5A 3BFGA 1PWCA 5CX7A 4IEDA 3GECA 4R3AA 1XX2A 1IEMA 4RYEA 4IUKA 2D02A 3UE1A 1KGFA 3QP4A 2VGLM 3BM6A 3SH7A 3DW0A 2BASA 2V9AA 1H8ZA 4O01A 2P04A 3K3DA 3FYZA 2H10A 5HARA 3MFXA 4ID4A 2V2FF 1JWZA 3GTCA 4CJNA 3E98A 2WUQA 3HLEA 1IELA 1XFQA 4L0LA 4IVIA 1MWRA 4HHDA 3O87A 2EX2A 3EWKA 1VHMA 3C5AA 2JKFA 2J8YA 3IBRA 4DDSA 4EV4A 4EWFA 5CEBA 3E4OA 3A3JA 3HVFA 2VLGA 3IF6B 1NYYA 5F6AA 1ZTUA 4N9KA 2ZOHA 1KVMA 1ACFA 5FI6A 3IF6A 4H8RA 1W63M 1ZKJA 3LR5A 5CTMA 3S7PA 3HJKA 4WMCA 4QD4A 3JVUA 2K31A 4BBVA 1K25A 4BWIA 3MF0A 3KSIA 3WRZA 4JKTA 3DTEA 4ZRRA 4OQIA 1VEUB 3S7QA 5DTKA 4MLLA 3LICA 4K0WA 4KG2A 3OPPA 4GS9B 4UEYA 2OLUA 2G2WA 1V9ZA 1K55C 4Y7PA 3W2ZA 4Y0OA 4F94A 3HJIA 4OPRA 1NY0A 5FAPA 1SKFA 4S2NA 4YFMA 3LEZA 4I3AA 4I3IA 1KE0A 3BYDA 1IKGA 5D3OA 5AVFA 3VOZA 3D4FA 3K3CA 5JYPA 4NXEA 5KIZA 2Y2JA 5HWTA 2JC7A 3ZG7B 2ZD8A 1ESIA 5FDHA 1X0OA 5EVLA 4B4ZA 1AXBA 3TE8A 2XF3A 2R9XA 5EM1A 4S2MA 5EE8A 2Z2MB 4LV0A 1RGYA 4K0XA 1K4FA 1L2SA 3DWKA 3K2NA 2DRWA 4KZ4A 2H28A 5F69A 3NI9A 3F1PB 4I5SA 2PHYA 4NKPA 4K08A 2WKHA 4QU3A 3QNCA 2E8JA 3AGDA 3IWQA 3F1PA 1KVLA 4Y15A 1XP4A 3HLFA 5HFOA 3R4KA 4EQ1A 5EVIC 2Y55A 2PR5A 3EEHA 4S2KA 2PU4A 4WELA 3G6OA 5TFQA 4Y5FA 2B95A 3DTIA 2DNSA 5A93A 3KSFA 4OPZA 3V67A 3ZG5A 3HLDA 5FI2A 5M1AA 5M19A 3EQVA 2VJWA 4PAUA 5DFYA 2JCHA 5GHXA 4WZ5A 1BZAA 3NOTC 4UA6A 4KUKA 5KSCA 3PHYA 3AGFA 4IBXA 1ZG4A 1O07A 4LV2A 5E2EA 3BY8A 1MKMA 1IYQA 2PD8A 2PDRA 1E3UA 1K6SA 1OTBA 3TG9A 2ZC3B 3UO9A 1MWTA 2VX8A 3FPVA 3ZYTA 2QYBA 3TOIA 3ITBA 4HI4A 2Y2LA 3F1NA 4CLCE 1SKOB 1BSGA 4GDBA 2QPNA 5A92A 5J4EA 1OTIA 5EFWA 1P0ZA 1IYOA 4R3BA 3GRJA 4X53A 3EGXC 1SKOA 3EQUA 1Z09A 2INWA 4CQHA 1BYWA 1N9NA 2I72A 1QMFA 2M1CA 3SZTA 3P09A 1H0MA 1KDWA 3IQAA 3VOLA 4R70A 1W8QA 2OOLA 3IT9A 5E2GA 2ZC5B 2IWCA 3WS4A 3G4PA 1E25A 3IHBA 2ZMFA 1GSVA 3DTMA 3FG8A 3LGOA 5FQJA 1YKDA 4GDNA 1PYYA 4GCZA 4WEKA 4N9LA 4NETA 3RXXA 3H7WB 4JGRA 4CLCB 4ZJ3A 3ZCZA 5TR7A 1MY8A 1WE4A 2X01A 4P0MA 4Q0IA 4JF4A 3H7WA 3T12B 1W5DA 4I39A 2Z2LB 3N8LA 3P7NA 1M40A 4LV3A 3OPLA 5FDSA 3ZG0A 4DDYA 2ZL1B 2V1AA 2ZM2A 5DKLA 4FD8A 2HJEA 1K4EA 4MEZA 1YLWA 1F98A 3LI9A 5I5LA 5CXWA 5F1GA 2BLSA 3LY3A 2NUPC 4JGOA 1E4DA 4LCMA 2OV5A 1N9BA 5CGWA 1NZUA 4S2IA 4X1LA 1NLYA 4X6TA 3UPPA 3RJUA 3O86A 2JKTI 5DF7A 1K54C 5GLAA 1LSVA 4OQGA 1LI0A 3FV7A 2ZM0A 5FQMA 1YSQA 1K56A 3SS5A 5HZHA 2WGVA 1YQSA 4ETXA 2W3HA 5AQAA 1W63Q 5CGSA 5CHUA 1Y28A 2ZC7A 1BLCA 3A3EA 5A90A 2R78A 3BQAA 1QMEA 3W8KA 3C30A 2XFSA 1YMXA 4WZ4A 3BFFA 3IF5A 1TS7A 3BEBA 2WKRA 1N4OA 1XA7A 4ETZA 1OPXA 5BOHA 3CG5A 1H8MA 3UB6A 1KDSA 3BWLA 2CC1A 4ARZB 1TF1A 2DMWA 5J7EA 3Q1FA 3SOIA 5CECA 4ARZA 1XPBA 1T1CA 2O9AA 1DY6A 1K55A 4Q0JA 2H0TA 4PKYA 2XR0A 1LL5A 3PAGA 5DTSA 1HLUP 2VGKA 3BJNA 1YM1A 2GJ3A 5L2FA 3CUEC 4MBHA 3W4QA 2XDMA 4ZJ1A 3E0YA 5FQIA 4ZDXA 2O99A 1MWSA 4IUHA 3NCKA 4P6ZM 1LT0A 3PBQA 4ESPA 4WL9A 5L10A 4LFUA 4XT2B 1FQGA 3TJZC 1HD8A 2J3WA 2QMIA 3VE4A 3S22A 1Z6FA 3DTKA 4S2OA 1YAXA 1UWNX 2WYXA 2E8IA 3FKVA 4XT2A 3VP2A 2GNXA 5EUAA 3BW6A 2H5SA 2Y2HA 4RA7A 3NULA 4EBLA 2W3DA 5J3WA 3T4SA 3Q7VA 3MJQA 1J9MA 3LI8A 3KYEA 3NBLA 3VSKA 3LO7A 1YMSA 3ZNTA 2EWWA 1NZOA 2ZC6B 4RX3A 4LRXC 4MN6A 3BLSA 1SCWA 3DAVA 4B88A 1STZA 4L9GA 1RGZA 5I94A 5DTTA 2VV6A 2ZBBA 1XXMA 2VEAA 3C4PA 1OT9A 1PZPA 1JWVA 2Y2MA 4HOIA 5FQQA 3UY6A 3VP4A 4HIAA 2QJ5A 3H82B 5DVAA 4KZ8A 2IWBA 2HZ5A 4GNUA 3G30A 5HAIA 2BG1A 1M6KA 3E4QA 3IS2B 2Y2PA 2EX6A 2X71A 3H82A 4R3JA 4X25A 1CQAA 3ZQ5A 4YWZA 2PR6A 4GHIB 2K7SA 3BFDA 3V5MA 4GJ4A 4EBPA 4E6WA 1DJCA 1I2SA 1K38A 4EESA 5HX9A 3OCLA 3NOUC 3O88A 3BLMA 1MWUA 3UNWA 3MXQA 4WLAA 4LPZA 4U3TA 4DXCA 3N6IA 3FPWA 1CI9A 2M7VA 4IBRA 1NLZA 5TGFA 3HUOA 2PU2A 3NDEA 2IWDA 2XRNA 3UB8A 5HAQA 2FFYA 5EVID 2QHKA 3D9YA 1T1AA 3HLWA 4E3IA 4NXGA 4PPRA 1JTDA 2VK3A 3IX8A 1PW1A 2ZC4B 1H3QA 4JXVA 3V50A 1CEFA 3JPUA 4DE3A 2ZQ9A 4UQIM 4PM9A 3MZFA 3WRTA 1MZUA 2Y59A 4JPMA 4D60A 5HSQA 3O3VA 4KG5A 4O0PA 3W4PA 1W79A 4WF0A 1FOFA 3MR0A 4DJ3A 1H5XA 3NOPC 1TS0A 1BLPA 2ZQDA 3T4JA 2DCFA 1K0KA 3GVBA 2GZAA 2ZOIA 1SDNA 1S67L 1VEUA 3UB9A 2FZ0A 1BUEA 5F5YA 1FILA 1J3WA 2V20A 3L7HA 4GS9A 3KYZA 1LLBA 5HWWA 1TVFA 4OOMA 5HDCA 3LR3A 1VQQA 1XGIA 4PHTA 4DXBA 2HGVA 3SW1A 1PI5A 1IKIA 5GHZA 2MJ6A 2XK1A 4LRYC 5CGXA 1K57A 4JXSA 3IXDA 3UE3A 5DKKA 4EW7A 1XKZA 2D01A 4HEFA 3PAEA 3F1OB 3UMEA 2H0YA 2EX9A 3BFCA 3PBTA 3PBSA 4RVAA 4LGWA 4ZTKA 3SH9A 3GMWA 5CRFA 2PAVP 3MBZA 1JNUA 5CHMA 1VETB 3FZCA 1NJ4A 4JXGA 2A24B 4QY5A 3BQ8A 2OSUA 5M18A 2XD1A 5CEDA 5U47A 1G28A 3T4KA 3HREA 2B18A 1PNEA 2A24A 2HJ9C 2JN7A 3IWIA 2XROA 3HLGA 4WMCD 2JE5A 2ZM8A 3D3OA 3UMDA 3N8RA 1IYSA 4BBTA 3OCNA 4BL2A 3CLOA 1P97A 2Z6DA 2Q9NA 5TJJA 4S2LA 4BJPA 2UWXA 3T4OA 2KOIA 2ZMAA 4FOFA 5AQ7A 2EXBA 5EV0A 3DWZA 2V0WA 2WKEA 2Q9MA 5G4YA 2JBFA 2XLNA 4EEPA 1LSXA 4RX2A 5A91A 3OPRA 4Z1WA 5A8BA 3WS2A 2Y91A 3I7JA 1YLZA 2KDKA 4KG6A 3ZNYA 3ZDJA 4KZBA 5AQBA 2ZQAA 1KGEA 3MMHA 3SH8A 4M4XA 3GDIA 2PT7A 1CJFA 4X1MA 4Y3IA 2XGNA 3UE0A 4KQQA 3B3XA 1T1BA 4KENB 1IYPA 2Y2IA 1WYCA 2Z6CA 1KOUA 4P6ZS 1LL8A 4YNRA 3UDFA 4I38A 3NDGA 4BD1A 1F5MA 2V0UA 3VE3A 2WAFA 4JGQA 3ITAA 4DKIA 4CPKA 2EWVA 1KE3A 4C75A 4H6JB 3E2KA 3A0SA 3MKFA 5F83A 4E3OA 5EM0A 5HDSA 4BD0A 4N92A 1Y54A 3VMAA 2A3UA 4H6JA 3Q82A 2HP5A 2L0WA 3IF6C 2RCXA 1ZHHB 4PM8A 1LI9A 2JKTM 1FCMA 3P01A 2XQZA 4BLMA 3MXRA 4GOGA 4NXBA 2C6WB 4HY8A 1PWGA 3IX3A 4KUOA 3G31A 4HH3A 4CLCA 2X02A 3L9KA 1KGGA 2PYRA 3A0RA 4OP5A 5FEGA 1FSWA 5IS1A 4XUZA 2VV8A 4OOYA 5CERA 4UA9A 4WEJA 2PD7A 5HPFA 1S4RA 4G3VA 3S7NA 1Y4OA 3D72A 2ZL1A 1BLHA 3FWLA 5F82A 5L07A 4S2NC 2Y2NA 2Y2KA 3LFVA 2UV0E 4N1HA 2KX6A 1YPRA 4XUXA 1HTZA 3ZVTA 1EW0A 1W8YA 3UN7A 4GZBA 3M2JA 4KZ9A 2W3EA 1G6AA 1MXOA 3ICYA 2WZZA 4GB7A 5DF9A 3CPTB 3UB5P 4JBFA 2Q0OA 1BLSA 4DJ2A 2EFXA 3QHYA 1ES2A 4O8GA 4ZBEA 3A3IA 3T4LA 4EQIA 2LB9A 3UB7A 3CPTA 3TSGA 4U0TA 4EU0A 1GSWA 2V1ZA 4I3JA 5LBRA 3JVVA 1N9LA 4EETB 1JTGA 4QHCA 1I5QA 4X69A 1JWPA 1YT4A 4N1XA 1XFNA 2O9CA 3A3DA 2P9VB 1RCJA 4MBFA 5E43A 2PYPA 1OT6A 3SS4A 2IA2A 5EVEA 5GLBA 3Q07A 4UQIS 2XA7S 3QP2A 4B4XA 4MDZA 3WS5A 5F68A 1XJ2A 3SS3A 4HNBA 2G2UA 3JYIA 3UDIA 2QJ7A 1ODVA 1SDEA 3G34A 4DE0A 4KZ6A 2ZJ9A 3T4TA 1OJGA 1HZOA 4E3KA 1L0FA 3MXSA 3R7WB 4MN5A 3MFDA 3QP1A 5HL6A 4HBUA 3MQOA 4DRTA 3GQZA 1FIKA 4WZ5C 4EUVA 3FKWA 4PKYG 3R7WA 3OC2A 4AFIA 1TEMA 1NYMA 4OOLA 1YLJA 1L0EA 5L8MA 3PYPA 4IVKA 1LHYA 1U60A 3UDXA 2HDQA 1L3LA 5GHYA 1TS8A 4WN5A 3MQQA 1ESUA 4OONA 4HP9A 4BL3A 4JXWA 4O7DA 2J7VA 4MCWA 1G5UA 2W1TB 3C4OA 4E6XA 5C5KA 1GA9A 1XJ4A 4E3JA 3HBRA 2WADA 3CZDA 1D1JA 2WGIA 5KZHA 3EOIA 1OJ5A 3LR4A 4E3NA 1HVBA 1JVJA 4KZ3A 1CF0A 2B02A 1ES4A 2EFUA 3LIAA 4HBTA 4FH2A 4P6BA 3LUQA 4FCFA 1SZVA 5EVIB 2J80A 1OTDA 4BBUA 4HJ3A 4IHQA 3A3FA 3N8SA 3V3SA 4KQRA 3LIEA 5FASA 4JF6A 1NXYA 4PM5A 1AWIA 5EVIA 4YOFA 1PWDA 4QJGA 3PBRA 1YSPA 1DJAA 3QP6A 4B9OA 1BULA 4B93A 5HDDA 2WAEA 2FH5A 4E04A 1IFQA 3IBJA 3ZHHA 2CMNA 3HUNA 3MQ0A 4EUZA 4R4SA 4F3LB 1MPLA 1EI5A 1RP5A 1Q2QA 1FCNA 4OH0A 3IXGA 1ERQA 1NWZA 3ISGA 3RTYA 3M6BA 3WWXA 3U2AA 1ZG6A 1LL9A 3LIDA 5JYOA 3E2LA 1L0GA 3T50A 1CK3A 3CHWP 4EBNA 2Y79A 3IS2A 4LRZE 3G35A 3NECA 4Q8IA 5FAOA 4GHIA 1H8YA 3MKEA 5MC7A 3T1RA 2W0NA 4GLQA 4NK3A 2V1BA 4U0XA 1VM1A 2QZ6A 4D2OA 3BECA 5E2FA 4NXFA 2XSSA 2JKRI 3GV9A 1G6OA 1BT5A 2G7UA 5KSHA 3FC7A 2J3TD 2O9BA 5AJGA 2LB5A 1OTAA 2JKGA 3MZEA 3B47A 1PIOA 5TBMB 2PRFA 3N4IA 4UAAA 5FA7A 3MSHA 3HL9A 1GHIA 2XA7M 1EROA 1OMEA 2WZXA 1WA9A 3IXBA 4WUJA 5TBMA 4XXRA 3Q7ZA 3UPNA 4BMWA 3ZVWA 2ZQCA 4UA7A 4MNRA 5DJUA 3NJAA 5HPIA 4WBGA 5IT5A 3WS0A 4R38A 3B42A 3M6HA 5FEFA 3HCYA 5FAQA 3GSGA 3PXPA 1DRMA 4QWOA 3IH8A 5DF8A 1G68A 1CEGA 2OWHA 4G3WA 4OKPA 2VZWA 1S6RA 3VP1A 5EPHA 4C6YA 2O0YA 3OZHA 4PM7A 1GCEA 3OBFA 4M3KA 3KYQA 5EOOA 5EECA 1T19A 1ERMA 1C3BA 2HF6A 3NHQA 1MBLA 3LCEA 1N9OA 4HJ4A 2AVXA 5CTNA 2WK0A 2P74A 1P9WA 1OTEA 5FL3A 2WGWB 3V39A 1P9RA 3KSGA 4GD8A 4R4RA 4K91A 2I9VA 1TDGA 1L0DA 2NUTC 2WGWA 1DP8A 4HP4A 1K54A 1ALQA 3F1OA 1GHPA 1VB6A 3NC8A 4DN0A 4PM6A 3PTEA 2QKPA 3NIAA 1S4SA 2OAP1 4HQAA 3MZDA 1VETA 3VFFA 2WKQA 3IXHA 1T18A 3KSHA 5FATA 2J3TC 1WYBA 2JHEA 3RFBA 3S4XA 1XJ6A 1XA1A 4OPYA 3A0VA 4QPRA 4DE1A 1IOUA 5CHJA 2RL3A 1NRJA 4L9EA 1DP6A 3TW8A 2ZQ7A 1FSYA 3C8CA 3EEAA 4KZAA 5G18A 4P85A 3KO6A 2EA9A 4MMNA 4ZJ2A 5GLDA 4Y0UA 4HJ6A 4Z9QA 1S0WA 2V8FA 1PRQA 2Y2OA 4LENA 3IWOA 3TRCA 3CJMA 1YLPA 2HP6A 2VA0A 3UE6A 3VP3A 1UWPX 5FQ9A 4FUWA 4GD6A 4X55A 4QB8A 4R0QA 4ZAMA 1ES3A 5K5BA 4QY6A 5HL1A 4OLGA 5HD5A 3CUEA 3CAXA 2HDSA 1ONHA 2XFTA 4OQ0A 1XJ3A 3B33A 4E3LA 1F9IA 5FSRA 3LEQA 3T1SA 2C5WB 3O5YA 3IH9A 1Q2PA 2A49A 1GSXA 5DJTA 3VP0A 2V8CA 4II7A 2PBYA 4OPQA 3F1NB 4NG2A 3ZG9B 2W1RA 4KZ5A 3OPHA 3C38A 4OP8A 4L9FA 4GKUA 4DMZA 3BRMA 1CI8A 2VV7A 4JGPA 5FI7A 3VFHA 3UPOA 4E3MA 1TD5A 1S1ZA 3ZG8B 5L09A 2P7JA 3S7OA 2P08A 3OLOA 4G3KA 1O7EA 1MC0A 1LSWA 2WKPA 1GA0A 1TDLA 1UGUA 5DFXA 3C7VA 3ZFZA 4P87A 2ZMVA 1BTLA 3HLBA 4LLOB 3NY4A 1TS6A 1SHVA 5E2HA 5AQ9A 2Y4AA 1S66L
chains in the Genus database with same CATH topology
3BLMA 1MWUA 3CMZA 2WKIA 3UNWA 3AGDA 3IWQA 1KVLA 4IVKA 4U3TA 4DXCA 3N6IA 3G2ZA 1CI9A 1LHYA 1U60A 2VGJA 1DJBA 1XP4A 4IBRA 3HLFA 5HFOA 4FSFA 5TGFA 3UDXA 3HUOA 2PU2A 2HDQA 4R23A 3NDEA 2Y55A 5EVIC 5GHYA 4S2KA 4X56A 5F1FA 1ESUA 2IWDA 3QNBA 4OONA 1PI4A 1FCOA 2PU4A 4WELA 5HAQA 4BL3A 2FFYA 5EVID 4JXWA 4O7DA 4Y0TA 2J7VA 5TFQA 5HW3A 3ZGAB 4S2JA 3C4OA 1ES5A 3IHAA 3HLWA 2DNSA 4E6XA 5A93A 4OPZA 3S1YA 1GA9A 4PPRA 3GR2A 1JTDA 4E3IA 4E3JA 1PW1A 2ZC4B 1E3UD 3ZG5A 3HLDA 4KQOA 3HBRA 4JXVA 2WADA 5FI2A 5M1AA 3V50A 1CEFA 3CZDA 4DE3A 5M19A 2ZQ9A 2WGIA 2XD5A 4PM9A 3MZFA 5KZHA 3WRTA 3EQVA 5J8XA 2Y59A 4JPMA 4E3NA 2JCHA 2J9PA 1HVBA 1JVJA 5GHXA 2Y2QA 3O3VA 2B5RA 4KZ3A 4WZ5A 1BZAA 4UA6A 4KG5A 5KSCA 1ES4A 3WS1A 2EFUA 2HP9A 1K57C 3W4PA 4HBTA 1W79A 4FH2A 1FOFA 4P6BA 5GL9A 4FCFA 3AGFA 4IBXA 4OLDA 1H5XA 5EVIB 1ZG4A 1O07A 1BLPA 3A3FA 3N8SA 4LV2A 3V3SA 3W4OA 2ZQDA 4KQRA 5FASA 4A5RA 4JF6A 5E2EA 1NXYA 2DCFA 5IHVA 4PM5A 3GVBA 1SDNA 5EVIA 4JF5A 2Y2GA 1PWDA 4X68A 4QJGA 3PBRA 1BUEA 1DJAA 1IYQA 1FR1A 1BULA 2V20A 1E3UA 1K6SA 2FFFB 3TG9A 2WAEA 2ZC3B 3UO9A 4DF6A 1LLBA 1MWTA 1FR6A 3TOIA 3ZHHA 1YLYA 3PBNA 1TVFA 4OOMA 3HUNA 3ITBA 2Y2LA 4EUZA 4KZ7A 4R4SA 1BSGA 4GDBA 1VQQA 2QPNA 1XGIA 5A92A 2GDNA 1MPLA 1EI5A 1RP5A 2EX8A 2XH9A 4DXBA 1Q2QA 1PI5A 1IKIA 1FCNA 5GHZA 4OH0A 3IXGA 1IYOA 4R3BA 3GRJA 4X53A 1ERQA 2P9VA 4OVDA 2XK1A 5CGXA 3EQUA 3ISGA 1K57A 3G2YA 3M6BA 3WWXA 1ZG6A 4HESA 1LL9A 3BFEA 2I72A 1PW8A 4JXSA 3IXDA 3V3RA 3E2LA 5JYOA 1L0GA 1CK3A 3UE3A 1QMFA 1XKZA 3P09A 3PAEA 4HEFA 1KDWA 2H0YA 4EBNA 3C7UA 3IQAA 2EX9A 3BFCA 1W8QA 3PBTA 3PBSA 4RVAA 3RXWA 4ZTKA 3G35A 3IT9A 3GMWA 5CRFA 3SH9A 1PZOA 3LY4A 5E2GA 2ZC5B 2J9OA 2IWCA 3WS4A 4GN2A 3MBZA 3G4PA 1E25A 3IHBA 5CHMA 4Q8IA 3DTMA 5FAOA 1H8YA 3FZCA 3MKEA 4UHUA 4MBKA 5FQJA 3P98A 4GDNA 1NJ4A 1PYYA 4JXGA 4YINA 4NK3A 4WEKA 4QY5A 2OSUA 5M18A 4N9LA 2XD1A 4U0XA 1VM1A 2QZ6A 5CEDA 4NETA 5U47A 3RXXA 4D2OA 1ZC2A 3BECA 3G32A 2EXAA 5E2FA 2XEPA 3HREA 3PBOA 1ONGA 3IWIA 4PMAA 3HLGA 4ZJ3A 3ZCZA 5TR7A 1MY8A 4WMCD 1WE4A 5FQKA 3GV9A 4P0MA 2X01A 2JE5A 2ZM8A 4JF4A 2OLVA 1BT5A 3N8RA 1IYSA 1W5DA 5KSHA 1GHMA 2Z2LB 3OCNA 5EOEA 4BL2A 3N8LA 1M40A 4LV3A 3MZEA 3OPLA 2Q9NA 3VOYA 1PIOA 3N4IA 4C3QA 4UAAA 5FA7A 3ZG0A 4DDYA 2ZM2A 3HL9A 4S2LA 1MKIA 4LV1A 1GHIA 4WYYA 1K56D 4FD8A 4BJPA 1K4EA 2HDUA 4MEZA 2UWXA 1EROA 1OMEA 2WZXA 1YLWA 3IXBA 4JLFA 3HUMA 4XXRA 2ZMAA 5CXWA 3Q7ZA 4R1GA 2BLSA 5F1GA 5AQ7A 2HDRA 1NRFA 1XGJA 3LY3A 3UPNA 2EXBA 3ZVWA 3DWZA 4LCLA 2ZQCA 2ZLYA 2WKEA 4UA7A 1E4DA 2Q9MA 4MNRA 4OQHA 1K6RA 4LCMA 3M2KA 2OV5A 4WBGA 1N9BA 3WS0A 5CGWA 1NZUA 4S2IA 2HPBA 3Q7VB 3M6HA 2JBFA 2XLNA 5FAQA 4X6TA 3UPPA 1KE4A 3GSGA 4RX2A 4S2PA 3OPRA 5A91A 3RJUA 3WS2A 3O86A 2ZQ8A 1I2WA 1YLTA 5DF7A 3IH8A 2Y91A 1K54C 5GLAA 5DF8A 1G68A 4OQGA 1CEGA 1LI0A 3FV7A 4OKPA 2ZM0A 3I7JA 1S6RA 1YLZA 3VP1A 5FQMA 4KG6A 3ZNYA 1EWZA 5EPHA 3ZDJA 4C6YA 1K56A 4KZBA 3OZHA 2ZQAA 5AQBA 1KGEA 3SS5A 3SH8A 2WGVA 1YQSA 5AQAA 3VSLA 2R9WA 4PM7A 1GCEA 5CGSA 3HLCA 4M3KA 2XGNA 5CHUA 3UE0A 4KQQA 2ZC7A 3B3XA 5EECA 5EOOA 5HAPA 1ERMA 1C3BA 4KENB 1BLCA 1IYPA 1W7FA 2Y2IA 1WYCA 3A3EA 1MBLA 5A90A 3LCEA 1QMEA 5CTNA 2WK0A 3Q81A 3AGEA 4DE2A 3UDFA 3W8KA 2XFSA 3NDGA 3N7WA 2P74A 1YMXA 4FH4A 5GLCA 4BD1A 4WZ4A 4BQMA 4BENA 3BFFA 2WGWB 3V39A 5KMWA 2WAFA 3IF5A 3ITAA 4DKIA 4GD8A 4WM9A 4R4RA 3BEBA 4K91A 4CPKA 1KE3A 4C75A 1TDGA 3BFGA 1N4OA 1XA7A 1L0DA 1PWCA 2WGWA 4IEDA 3E2KA 5BOHA 1XX2A 3MKFA 5F83A 1IEMA 4E3OA 3CG5A 4RYEA 4BD0A 3UE1A 1K54A 1ALQA 1KDSA 1Y54A 4N92A 1KGFA 2CC1A 1GHPA 3VMAA 2A3UA 3BM6A 3SH7A 3DW0A 3Q82A 3NC8A 2HP5A 1H8ZA 3Q1FA 3SOIA 5CECA 4PM6A 3PTEA 3IF6C 2RCXA 3FYZA 2H10A 3NIAA 5HARA 4PM8A 4ID4A 1XPBA 2V2FF 1JWZA 3GTCA 4CJNA 1LI9A 2WUQA 3MZDA 3VFFA 1DY6A 1FCMA 3HLEA 1K55A 3IXHA 2H0TA 2XR0A 1IELA 1LL5A 2XQZA 3PAGA 5DTSA 5FATA 4BLMA 3MXRA 4GOGA 2C6WB 1WYBA 4L0LA 4IVIA 1MWRA 2VGKA 1PWGA 3O87A 3S4XA 3G31A 1YM1A 2EX2A 1XA1A 5L2FA 4OPYA 4MBHA 3W4QA 4DE1A 2XDMA 3C5AA 5CHJA 2RL3A 4ZJ1A 5FQIA 2X02A 4ZDXA 2J8YA 4DDSA 4EV4A 2ZQ7A 1FSYA 1KGGA 4EWFA 5CEBA 1MWSA 4OP5A 1FSWA 4KZAA 4XUZA 3NCKA 4OOYA 5G18A 5CERA 4UA9A 4WEJA 4P85A 4ZJ2A 3A3JA 5GLDA 3HVFA 3PBQA 3IF6B 1NYYA 4Y0UA 1BLHA 3FWLA 5F82A 4S2NC 4Z9QA 4N9KA 1S0WA 1KVMA 2Y2NA 1FQGA 2Y2OA 2Y2KA 2QMIA 1HD8A 3S22A 1Z6FA 4LENA 5FI6A 3IWOA 4S2OA 3CJMA 3IF6A 4H8RA 1YLPA 2HP6A 2WYXA 1ZKJA 3QNCA 4N1HA 2E8IA 3FKVA 4XUXA 1HTZA 3VP2A 5CTMA 3ZVTA 4WMCA 3VP3A 5EUAA 4QD4A 5FQ9A 1W8YA 2H5SA 2Y2HA 3UN7A 1K25A 4RA7A 4GZBA 4X55A 3M2JA 4GD6A 4EBLA 4QB8A 4KZ9A 4R0QA 4ZAMA 3WRZA 1ES3A 4JKTA 3Q7VA 1G6AA 1MXOA 4QY6A 1J9MA 5HL1A 2WZZA 4GB7A 4OLGA 5DF9A 4JBFA 4OQIA 3NBLA 1BLSA 5DTKA 2HDSA 1ONHA 2EFXA 1ES2A 3QHYA 4MLLA 2XFTA 3VSKA 4OQ0A 3LO7A 1YMSA 3ZNTA 4ZBEA 4K0WA 3A3IA 4KG2A 4E3LA 4EQIA 1NZOA 3TSGA 5FSRA 2ZC6B 4RX3A 4U0TA 2C5WB 3OPPA 2OLUA 3IH9A 2G2WA 2V1ZA 1Q2PA 1K55C 2A49A 3VP0A 2PBYA 4OPQA 4Y7PA 3BLSA 4Y0OA 4OPRA 1SCWA 4F94A 1NY0A 5FAPA 3ZG9B 1JTGA 1SKFA 4QHCA 4S2NA 4KZ5A 4YFMA 4B88A 1I5QA 3LEZA 4X69A 3OPHA 1RGZA 5I94A 5DTTA 1JWPA 1YT4A 1KE0A 3BYDA 4N1XA 4OP8A 1XXMA 4GKUA 1IKGA 3A3DA 2P9VB 1RCJA 3BRMA 4MBFA 1CI8A 5E43A 5D3OA 5FI7A 3C4PA 3VFHA 3VOZA 3D4FA 3UPOA 5JYPA 1PZPA 1JWVA 4E3MA 3ZG8B 3SS4A 2Y2JA 2Y2MA 5GLBA 5FQQA 3Q07A 3UY6A 2JC7A 3ZG7B 3VP4A 2ZD8A 1ESIA 5DVAA 4KZ8A 2IWBA 1O7EA 5FDHA 4B4XA 3WS5A 4GNUA 5EVLA 4B4ZA 3G30A 1AXBA 3SS3A 5HAIA 2G2UA 2BG1A 3JYIA 1M6KA 3UDIA 2Y2PA 1SDEA 3G34A 1GA0A 2XF3A 2EX6A 2R9XA 2X71A 4DE0A 1TDLA 2ZJ9A 4KZ6A 4R3JA 4S2MA 1HZOA 3C7VA 4E3KA 1L0FA 3MXSA 5EE8A 3ZFZA 2Z2MB 4LV0A 1RGYA 4P87A 4K0XA 3BFDA 3V5MA 4EBPA 3MFDA 4E6WA 1DJCA 1I2SA 1K4FA 1BTLA 1L2SA 3DWKA 1K38A 2DRWA 3HLBA 4KZ4A 4HBUA 4DRTA 3GQZA 4WZ5C 3NY4A 3FKWA 3NI9A 5HX9A 3OC2A 1SHVA 3OCLA 3O88A 5E2HA 5AQ9A 2WKHA 1TEMA 2Y4AA 1NYMA 4OOLA 4QU3A 1YLJA 1L0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BLM A;  1MWU A;  3CMZ A;  2WKI A;  3UNW A;  3AGD A;  3IWQ A;  1KVL A;  4IVK A;  4U3T A;  4DXC A;  3N6I A;  3G2Z A;  1CI9 A;  1LHY A;  1U60 A;  2VGJ A;  1DJB A;  1XP4 A;  4IBR A;  3HLF A;  5HFO A;  4FSF A;  5TGF A;  3UDX A;  3HUO A;  2PU2 A;  2HDQ A;  4R23 A;  3NDE A;  2Y55 A;  5EVI C;  5GHY A;  4S2K A;  4X56 A;  5F1F A;  1ESU A;  2IWD A;  3QNB A;  4OON A;  1PI4 A;  1FCO A;  2PU4 A;  4WEL A;  5HAQ A;  4BL3 A;  2FFY A;  5EVI D;  4JXW A;  4O7D A;  4Y0T A;  2J7V A;  5TFQ A;  5HW3 A;  3ZGA B;  4S2J A;  3C4O A;  1ES5 A;  3IHA A;  3HLW A;  2DNS A;  4E6X A;  5A93 A;  4OPZ A;  3S1Y A;  1GA9 A;  4PPR A;  3GR2 A;  1JTD A;  4E3I A;  4E3J A;  1PW1 A;  2ZC4 B;  1E3U D;  3ZG5 A;  3HLD A;  4KQO A;  3HBR A;  4JXV A;  2WAD A;  5FI2 A;  5M1A A;  3V50 A;  1CEF A;  3CZD A;  4DE3 A;  5M19 A;  2ZQ9 A;  2WGI A;  2XD5 A;  4PM9 A;  3MZF A;  5KZH A;  3WRT A;  3EQV A;  5J8X A;  2Y59 A;  4JPM A;  4E3N A;  2JCH A;  2J9P A;  1HVB A;  1JVJ A;  5GHX A;  2Y2Q A;  3O3V A;  2B5R A;  4KZ3 A;  4WZ5 A;  1BZA A;  4UA6 A;  4KG5 A;  5KSC A;  1ES4 A;  3WS1 A;  2EFU A;  2HP9 A;  1K57 C;  3W4P A;  4HBT A;  1W79 A;  4FH2 A;  1FOF A;  4P6B A;  5GL9 A;  4FCF A;  3AGF A;  4IBX A;  4OLD A;  1H5X A;  5EVI B;  1ZG4 A;  1O07 A;  1BLP A;  3A3F A;  3N8S A;  4LV2 A;  3V3S A;  3W4O A;  2ZQD A;  4KQR A;  5FAS A;  4A5R A;  4JF6 A;  5E2E A;  1NXY A;  2DCF A;  5IHV A;  4PM5 A;  3GVB A;  1SDN A;  5EVI A;  4JF5 A;  2Y2G A;  1PWD A;  4X68 A;  4QJG A;  3PBR A;  1BUE A;  1DJA A;  1IYQ A;  1FR1 A;  1BUL A;  2V20 A;  1E3U A;  1K6S A;  2FFF B;  3TG9 A;  2WAE A;  2ZC3 B;  3UO9 A;  4DF6 A;  1LLB A;  1MWT A;  1FR6 A;  3TOI A;  3ZHH A;  1YLY A;  3PBN A;  1TVF A;  4OOM A;  3HUN A;  3ITB A;  2Y2L A;  4EUZ A;  4KZ7 A;  4R4S A;  1BSG A;  4GDB A;  1VQQ A;  2QPN A;  1XGI A;  5A92 A;  2GDN A;  1MPL A;  1EI5 A;  1RP5 A;  2EX8 A;  2XH9 A;  4DXB A;  1Q2Q A;  1PI5 A;  1IKI A;  1FCN A;  5GHZ A;  4OH0 A;  3IXG A;  1IYO A;  4R3B A;  3GRJ A;  4X53 A;  1ERQ A;  2P9V A;  4OVD A;  2XK1 A;  5CGX A;  3EQU A;  3ISG A;  1K57 A;  3G2Y A;  3M6B A;  3WWX A;  1ZG6 A;  4HES A;  1LL9 A;  3BFE A;  2I72 A;  1PW8 A;  4JXS A;  3IXD A;  3V3R A;  3E2L A;  5JYO A;  1L0G A;  1CK3 A;  3UE3 A;  1QMF A;  1XKZ A;  3P09 A;  3PAE A;  4HEF A;  1KDW A;  2H0Y A;  4EBN A;  3C7U A;  3IQA A;  2EX9 A;  3BFC A;  1W8Q A;  3PBT A;  3PBS A;  4RVA A;  3RXW A;  4ZTK A;  3G35 A;  3IT9 A;  3GMW A;  5CRF A;  3SH9 A;  1PZO A;  3LY4 A;  5E2G A;  2ZC5 B;  2J9O A;  2IWC A;  3WS4 A;  4GN2 A;  3MBZ A;  3G4P A;  1E25 A;  3IHB A;  5CHM A;  4Q8I A;  3DTM A;  5FAO A;  1H8Y A;  3FZC A;  3MKE A;  4UHU A;  4MBK A;  5FQJ A;  3P98 A;  4GDN A;  1NJ4 A;  1PYY A;  4JXG A;  4YIN A;  4NK3 A;  4WEK A;  4QY5 A;  2OSU A;  5M18 A;  4N9L A;  2XD1 A;  4U0X A;  1VM1 A;  2QZ6 A;  5CED A;  4NET A;  5U47 A;  3RXX A;  4D2O A;  1ZC2 A;  3BEC A;  3G32 A;  2EXA A;  5E2F A;  2XEP A;  3HRE A;  3PBO A;  1ONG A;  3IWI A;  4PMA A;  3HLG A;  4ZJ3 A;  3ZCZ A;  5TR7 A;  1MY8 A;  4WMC D;  1WE4 A;  5FQK A;  3GV9 A;  4P0M A;  2X01 A;  2JE5 A;  2ZM8 A;  4JF4 A;  2OLV A;  1BT5 A;  3N8R A;  1IYS A;  1W5D A;  5KSH A;  1GHM A;  2Z2L B;  3OCN A;  5EOE A;  4BL2 A;  3N8L A;  1M40 A;  4LV3 A;  3MZE A;  3OPL A;  2Q9N A;  3VOY A;  1PIO A;  3N4I A;  4C3Q A;  4UAA A;  5FA7 A;  3ZG0 A;  4DDY A;  2ZM2 A;  3HL9 A;  4S2L A;  1MKI A;  4LV1 A;  1GHI A;  4WYY A;  1K56 D;  4FD8 A;  4BJP A;  1K4E A;  2HDU A;  4MEZ A;  2UWX A;  1ERO A;  1OME A;  2WZX A;  1YLW A;  3IXB A;  4JLF A;  3HUM A;  4XXR A;  2ZMA A;  5CXW A;  3Q7Z A;  4R1G A;  2BLS A;  5F1G A;  5AQ7 A;  2HDR A;  1NRF A;  1XGJ A;  3LY3 A;  3UPN A;  2EXB A;  3ZVW A;  3DWZ A;  4LCL A;  2ZQC A;  2ZLY A;  2WKE A;  4UA7 A;  1E4D A;  2Q9M A;  4MNR A;  4OQH A;  1K6R A;  4LCM A;  3M2K A;  2OV5 A;  4WBG A;  1N9B A;  3WS0 A;  5CGW A;  1NZU A;  4S2I A;  2HPB A;  3Q7V B;  3M6H A;  2JBF A;  2XLN A;  5FAQ A;  4X6T A;  3UPP A;  1KE4 A;  3GSG A;  4RX2 A;  4S2P A;  3OPR A;  5A91 A;  3RJU A;  3WS2 A;  3O86 A;  2ZQ8 A;  1I2W A;  1YLT A;  5DF7 A;  3IH8 A;  2Y91 A;  1K54 C;  5GLA A;  5DF8 A;  1G68 A;  4OQG A;  1CEG A;  1LI0 A;  3FV7 A;  4OKP A;  2ZM0 A;  3I7J A;  1S6R A;  1YLZ A;  3VP1 A;  5FQM A;  4KG6 A;  3ZNY A;  1EWZ A;  5EPH A;  3ZDJ A;  4C6Y A;  1K56 A;  4KZB A;  3OZH A;  2ZQA A;  5AQB A;  1KGE A;  3SS5 A;  3SH8 A;  2WGV A;  1YQS A;  5AQA A;  3VSL A;  2R9W A;  4PM7 A;  1GCE A;  5CGS A;  3HLC A;  4M3K A;  2XGN A;  5CHU A;  3UE0 A;  4KQQ A;  2ZC7 A;  3B3X A;  5EEC A;  5EOO A;  5HAP A;  1ERM A;  1C3B A;  4KEN B;  1BLC A;  1IYP A;  1W7F A;  2Y2I A;  1WYC A;  3A3E A;  1MBL A;  5A90 A;  3LCE A;  1QME A;  5CTN A;  2WK0 A;  3Q81 A;  3AGE A;  4DE2 A;  3UDF A;  3W8K A;  2XFS A;  3NDG A;  3N7W A;  2P74 A;  1YMX A;  4FH4 A;  5GLC A;  4BD1 A;  4WZ4 A;  4BQM A;  4BEN A;  3BFF A;  2WGW B;  3V39 A;  5KMW A;  2WAF A;  3IF5 A;  3ITA A;  4DKI A;  4GD8 A;  4WM9 A;  4R4R A;  3BEB A;  4K91 A;  4CPK A;  1KE3 A;  4C75 A;  1TDG A;  3BFG A;  1N4O A;  1XA7 A;  1L0D A;  1PWC A;  2WGW A;  4IED A;  3E2K A;  5BOH A;  1XX2 A;  3MKF A;  5F83 A;  1IEM A;  4E3O A;  3CG5 A;  4RYE A;  4BD0 A;  3UE1 A;  1K54 A;  1ALQ A;  1KDS A;  1Y54 A;  4N92 A;  1KGF A;  2CC1 A;  1GHP A;  3VMA A;  2A3U A;  3BM6 A;  3SH7 A;  3DW0 A;  3Q82 A;  3NC8 A;  2HP5 A;  1H8Z A;  3Q1F A;  3SOI A;  5CEC A;  4PM6 A;  3PTE A;  3IF6 C;  2RCX A;  3FYZ A;  2H10 A;  3NIA A;  5HAR A;  4PM8 A;  4ID4 A;  1XPB A;  2V2F F;  1JWZ A;  3GTC A;  4CJN A;  1LI9 A;  2WUQ A;  3MZD A;  3VFF A;  1DY6 A;  1FCM A;  3HLE A;  1K55 A;  3IXH A;  2H0T A;  2XR0 A;  1IEL A;  1LL5 A;  2XQZ A;  3PAG A;  5DTS A;  5FAT A;  4BLM A;  3MXR A;  4GOG A;  2C6W B;  1WYB A;  4L0L A;  4IVI A;  1MWR A;  2VGK A;  1PWG A;  3O87 A;  3S4X A;  3G31 A;  1YM1 A;  2EX2 A;  1XA1 A;  5L2F A;  4OPY A;  4MBH A;  3W4Q A;  4DE1 A;  2XDM A;  3C5A A;  5CHJ A;  2RL3 A;  4ZJ1 A;  5FQI A;  2X02 A;  4ZDX A;  2J8Y A;  4DDS A;  4EV4 A;  2ZQ7 A;  1FSY A;  1KGG A;  4EWF A;  5CEB A;  1MWS A;  4OP5 A;  1FSW A;  4KZA A;  4XUZ A;  3NCK A;  4OOY A;  5G18 A;  5CER A;  4UA9 A;  4WEJ A;  4P85 A;  4ZJ2 A;  3A3J A;  5GLD A;  3HVF A;  3PBQ A;  3IF6 B;  1NYY A;  4Y0U A;  1BLH A;  3FWL A;  5F82 A;  4S2N C;  4Z9Q A;  4N9K A;  1S0W A;  1KVM A;  2Y2N A;  1FQG A;  2Y2O A;  2Y2K A;  2QMI A;  1HD8 A;  3S22 A;  1Z6F A;  4LEN A;  5FI6 A;  3IWO A;  4S2O A;  3CJM A;  3IF6 A;  4H8R A;  1YLP A;  2HP6 A;  2WYX A;  1ZKJ A;  3QNC A;  4N1H A;  2E8I A;  3FKV A;  4XUX A;  1HTZ A;  3VP2 A;  5CTM A;  3ZVT A;  4WMC A;  3VP3 A;  5EUA A;  4QD4 A;  5FQ9 A;  1W8Y A;  2H5S A;  2Y2H A;  3UN7 A;  1K25 A;  4RA7 A;  4GZB A;  4X55 A;  3M2J A;  4GD6 A;  4EBL A;  4QB8 A;  4KZ9 A;  4R0Q A;  4ZAM A;  3WRZ A;  1ES3 A;  4JKT A;  3Q7V A;  1G6A A;  1MXO A;  4QY6 A;  1J9M A;  5HL1 A;  2WZZ A;  4GB7 A;  4OLG A;  5DF9 A;  4JBF A;  4OQI A;  3NBL A;  1BLS A;  5DTK A;  2HDS A;  1ONH A;  2EFX A;  1ES2 A;  3QHY A;  4MLL A;  2XFT A;  3VSK A;  4OQ0 A;  3LO7 A;  1YMS A;  3ZNT A;  4ZBE A;  4K0W A;  3A3I A;  4KG2 A;  4E3L A;  4EQI A;  1NZO A;  3TSG A;  5FSR A;  2ZC6 B;  4RX3 A;  4U0T A;  2C5W B;  3OPP A;  2OLU A;  3IH9 A;  2G2W A;  2V1Z A;  1Q2P A;  1K55 C;  2A49 A;  3VP0 A;  2PBY A;  4OPQ A;  4Y7P A;  3BLS A;  4Y0O A;  4OPR A;  1SCW A;  4F94 A;  1NY0 A;  5FAP A;  3ZG9 B;  1JTG A;  1SKF A;  4QHC A;  4S2N A;  4KZ5 A;  4YFM A;  4B88 A;  1I5Q A;  3LEZ A;  4X69 A;  3OPH A;  1RGZ A;  5I94 A;  5DTT A;  1JWP A;  1YT4 A;  1KE0 A;  3BYD A;  4N1X A;  4OP8 A;  1XXM A;  4GKU A;  1IKG A;  3A3D A;  2P9V B;  1RCJ A;  3BRM A;  4MBF A;  1CI8 A;  5E43 A;  5D3O A;  5FI7 A;  3C4P A;  3VFH A;  3VOZ A;  3D4F A;  3UPO A;  5JYP A;  1PZP A;  1JWV A;  4E3M A;  3ZG8 B;  3SS4 A;  2Y2J A;  2Y2M A;  5GLB A;  5FQQ A;  3Q07 A;  3UY6 A;  2JC7 A;  3ZG7 B;  3VP4 A;  2ZD8 A;  1ESI A;  5DVA A;  4KZ8 A;  2IWB A;  1O7E A;  5FDH A;  4B4X A;  3WS5 A;  4GNU A;  5EVL A;  4B4Z A;  3G30 A;  1AXB A;  3SS3 A;  5HAI A;  2G2U A;  2BG1 A;  3JYI A;  1M6K A;  3UDI A;  2Y2P A;  1SDE A;  3G34 A;  1GA0 A;  2XF3 A;  2EX6 A;  2R9X A;  2X71 A;  4DE0 A;  1TDL A;  2ZJ9 A;  4KZ6 A;  4R3J A;  4S2M A;  1HZO A;  3C7V A;  4E3K A;  1L0F A;  3MXS A;  5EE8 A;  3ZFZ A;  2Z2M B;  4LV0 A;  1RGY A;  4P87 A;  4K0X A;  3BFD A;  3V5M A;  4EBP A;  3MFD A;  4E6W A;  1DJC A;  1I2S A;  1K4F A;  1BTL A;  1L2S A;  3DWK A;  1K38 A;  2DRW A;  3HLB A;  4KZ4 A;  4HBU A;  4DRT A;  3GQZ A;  4WZ5 C;  3NY4 A;  3FKW A;  3NI9 A;  5HX9 A;  3OC2 A;  1SHV A;  3OCL A;  3O88 A;  5E2H A;  5AQ9 A;  2WKH A;  1TEM A;  2Y4A A;  1NYM A;  4OOL A;  4QU3 A;  1YLJ A;  1L0E A; 
#chains in the Genus database with same CATH topology
 3CMZ A;  2WKI A;  3CWF A;  3OOV A;  3G2Z A;  2VGJ A;  1DJB A;  4FSF A;  4R23 A;  4X56 A;  5F1F A;  2OAQ 1;  3QNB A;  1PI4 A;  1FCO A;  2HV1 A;  4Y0T A;  3VV4 A;  2K2N A;  3RH8 B;  5HW3 A;  3ZGA B;  4S2J A;  1ES5 A;  3IHA A;  3S1Y A;  3BY9 A;  3GR2 A;  1E3U D;  4KQO A;  1D06 A;  2XD5 A;  5J8X A;  3KX0 X;  2J9P A;  1PFL A;  2Y2Q A;  4ME4 A;  2B5R A;  3DBA A;  3WS1 A;  2HP9 A;  1K57 C;  5GL9 A;  4OLD A;  2VGL S;  3W4O A;  3U4L P;  4A5R A;  5IHV A;  3CIT A;  3T1Q B;  4JF5 A;  3PR6 A;  1D7E A;  2Y2G A;  4X68 A;  1FR1 A;  2FFF B;  4Y13 A;  4DF6 A;  4Q0H A;  1FR6 A;  3LIF A;  1YLY A;  3PBN A;  4Y2F A;  1F2K A;  4KZ7 A;  2L1M A;  2GDN A;  2EX8 A;  2XH9 A;  2W3F A;  3MS6 A;  2P9V A;  4OVD A;  1A0K A;  3G2Y A;  3QP8 A;  4HES A;  3BFE A;  3CI6 A;  3H9W A;  1PW8 A;  2QWS A;  3V3R A;  4MN7 A;  5AVE A;  4CLC D;  3LYX A;  3T4Q A;  2GX5 A;  3C7U A;  3LIB A;  3RXW A;  4EEU A;  1PZO A;  3LY4 A;  2J9O A;  2ACG A;  1S1Y A;  4GN2 A;  2OWJ A;  4UHU A;  4MBK A;  5IU1 A;  3P98 A;  4YIN A;  4NEE D;  1ZC2 A;  2M7U A;  3G32 A;  2EXA A;  2XEP A;  3PBO A;  1ONG A;  4KQD A;  4PMA A;  5FQK A;  2OLV A;  2PBD P;  1GHM A;  4EXO A;  5EOE A;  2W27 A;  5G4Z A;  3VOY A;  4C3Q A;  1MKI A;  4LV1 A;  4WYY A;  1K56 D;  2W1T A;  4RQ9 A;  2HDU A;  2YKF A;  4EER A;  4JLF A;  3HUM A;  3E4P A;  4R1G A;  2HDR A;  1DP9 A;  1NRF A;  1XGJ A;  4FTX A;  4LCL A;  2ZLY A;  4R6L A;  4OQH A;  1K6R A;  3M2K A;  4Y17 A;  2HPB A;  3Q7V B;  1KE4 A;  4S2P A;  5HWV A;  3T1X A;  3IX4 A;  2ZQ8 A;  1I2W A;  1YLT A;  2YKH A;  4HH2 A;  2W3G A;  2A2L A;  3C2W A;  4IJG A;  1EWZ A;  3ULF A;  3VSL A;  5HD3 A;  2R9W A;  3HLC A;  2JKR M;  2KLI A;  5HAP A;  1W7F A;  4GW9 A;  1V9Y A;  2VKS A;  3Q81 A;  3AGE A;  4F3L A;  4DE2 A;  3LR0 A;  5GLC A;  3N7W A;  4FH4 A;  2L4R A;  2BTF P;  2Y8H A;  3EGD C;  4BQM A;  4BEN A;  4CLC C;  5KMW A;  4WM9 A;  3QP5 A;  3BFG A;  1PWC A;  5CX7 A;  4IED A;  3GEC A;  4R3A A;  1XX2 A;  1IEM A;  4RYE A;  4IUK A;  2D02 A;  3UE1 A;  1KGF A;  3QP4 A;  2VGL M;  3BM6 A;  3SH7 A;  3DW0 A;  2BAS A;  2V9A A;  1H8Z A;  4O01 A;  2P04 A;  3K3D A;  3FYZ A;  2H10 A;  5HAR A;  3MFX A;  4ID4 A;  2V2F F;  1JWZ A;  3GTC A;  4CJN A;  3E98 A;  2WUQ A;  3HLE A;  1IEL A;  1XFQ A;  4L0L A;  4IVI A;  1MWR A;  4HHD A;  3O87 A;  2EX2 A;  3EWK A;  1VHM A;  3C5A A;  2JKF A;  2J8Y A;  3IBR A;  4DDS A;  4EV4 A;  4EWF A;  5CEB A;  3E4O A;  3A3J A;  3HVF A;  2VLG A;  3IF6 B;  1NYY A;  5F6A A;  1ZTU A;  4N9K A;  2ZOH A;  1KVM A;  1ACF A;  5FI6 A;  3IF6 A;  4H8R A;  1W63 M;  1ZKJ A;  3LR5 A;  5CTM A;  3S7P A;  3HJK A;  4WMC A;  4QD4 A;  3JVU A;  2K31 A;  4BBV A;  1K25 A;  4BWI A;  3MF0 A;  3KSI A;  3WRZ A;  4JKT A;  3DTE A;  4ZRR A;  4OQI A;  1VEU B;  3S7Q A;  5DTK A;  4MLL A;  3LIC A;  4K0W A;  4KG2 A;  3OPP A;  4GS9 B;  4UEY A;  2OLU A;  2G2W A;  1V9Z A;  1K55 C;  4Y7P A;  3W2Z A;  4Y0O A;  4F94 A;  3HJI A;  4OPR A;  1NY0 A;  5FAP A;  1SKF A;  4S2N A;  4YFM A;  3LEZ A;  4I3A A;  4I3I A;  1KE0 A;  3BYD A;  1IKG A;  5D3O A;  5AVF A;  3VOZ A;  3D4F A;  3K3C A;  5JYP A;  4NXE A;  5KIZ A;  2Y2J A;  5HWT A;  2JC7 A;  3ZG7 B;  2ZD8 A;  1ESI A;  5FDH A;  1X0O A;  5EVL A;  4B4Z A;  1AXB A;  3TE8 A;  2XF3 A;  2R9X A;  5EM1 A;  4S2M A;  5EE8 A;  2Z2M B;  4LV0 A;  1RGY A;  4K0X A;  1K4F A;  1L2S A;  3DWK A;  3K2N A;  2DRW A;  4KZ4 A;  2H28 A;  5F69 A;  3NI9 A;  3F1P B;  4I5S A;  2PHY A;  4NKP A;  4K08 A;  2WKH A;  4QU3 A;  3QNC A;  2E8J A;  3AGD A;  3IWQ A;  3F1P A;  1KVL A;  4Y15 A;  1XP4 A;  3HLF A;  5HFO A;  3R4K A;  4EQ1 A;  5EVI C;  2Y55 A;  2PR5 A;  3EEH A;  4S2K A;  2PU4 A;  4WEL A;  3G6O A;  5TFQ A;  4Y5F A;  2B95 A;  3DTI A;  2DNS A;  5A93 A;  3KSF A;  4OPZ A;  3V67 A;  3ZG5 A;  3HLD A;  5FI2 A;  5M1A A;  5M19 A;  3EQV A;  2VJW A;  4PAU A;  5DFY A;  2JCH A;  5GHX A;  4WZ5 A;  1BZA A;  3NOT C;  4UA6 A;  4KUK A;  5KSC A;  3PHY A;  3AGF A;  4IBX A;  1ZG4 A;  1O07 A;  4LV2 A;  5E2E A;  3BY8 A;  1MKM A;  1IYQ A;  2PD8 A;  2PDR A;  1E3U A;  1K6S A;  1OTB A;  3TG9 A;  2ZC3 B;  3UO9 A;  1MWT A;  2VX8 A;  3FPV A;  3ZYT A;  2QYB A;  3TOI A;  3ITB A;  4HI4 A;  2Y2L A;  3F1N A;  4CLC E;  1SKO B;  1BSG A;  4GDB A;  2QPN A;  5A92 A;  5J4E A;  1OTI A;  5EFW A;  1P0Z A;  1IYO A;  4R3B A;  3GRJ A;  4X53 A;  3EGX C;  1SKO A;  3EQU A;  1Z09 A;  2INW A;  4CQH A;  1BYW A;  1N9N A;  2I72 A;  1QMF A;  2M1C A;  3SZT A;  3P09 A;  1H0M A;  1KDW A;  3IQA A;  3VOL A;  4R70 A;  1W8Q A;  2OOL A;  3IT9 A;  5E2G A;  2ZC5 B;  2IWC A;  3WS4 A;  3G4P A;  1E25 A;  3IHB A;  2ZMF A;  1GSV A;  3DTM A;  3FG8 A;  3LGO A;  5FQJ A;  1YKD A;  4GDN A;  1PYY A;  4GCZ A;  4WEK A;  4N9L A;  4NET A;  3RXX A;  3H7W B;  4JGR A;  4CLC B;  4ZJ3 A;  3ZCZ A;  5TR7 A;  1MY8 A;  1WE4 A;  2X01 A;  4P0M A;  4Q0I A;  4JF4 A;  3H7W A;  3T12 B;  1W5D A;  4I39 A;  2Z2L B;  3N8L A;  3P7N A;  1M40 A;  4LV3 A;  3OPL A;  5FDS A;  3ZG0 A;  4DDY A;  2ZL1 B;  2V1A A;  2ZM2 A;  5DKL A;  4FD8 A;  2HJE A;  1K4E A;  4MEZ A;  1YLW A;  1F98 A;  3LI9 A;  5I5L A;  5CXW A;  5F1G A;  2BLS A;  3LY3 A;  2NUP C;  4JGO A;  1E4D A;  4LCM A;  2OV5 A;  1N9B A;  5CGW A;  1NZU A;  4S2I A;  4X1L A;  1NLY A;  4X6T A;  3UPP A;  3RJU A;  3O86 A;  2JKT I;  5DF7 A;  1K54 C;  5GLA A;  1LSV A;  4OQG A;  1LI0 A;  3FV7 A;  2ZM0 A;  5FQM A;  1YSQ A;  1K56 A;  3SS5 A;  5HZH A;  2WGV A;  1YQS A;  4ETX A;  2W3H A;  5AQA A;  1W63 Q;  5CGS A;  5CHU A;  1Y28 A;  2ZC7 A;  1BLC A;  3A3E A;  5A90 A;  2R78 A;  3BQA A;  1QME A;  3W8K A;  3C30 A;  2XFS A;  1YMX A;  4WZ4 A;  3BFF A;  3IF5 A;  1TS7 A;  3BEB A;  2WKR A;  1N4O A;  1XA7 A;  4ETZ A;  1OPX A;  5BOH A;  3CG5 A;  1H8M A;  3UB6 A;  1KDS A;  3BWL A;  2CC1 A;  4ARZ B;  1TF1 A;  2DMW A;  5J7E A;  3Q1F A;  3SOI A;  5CEC A;  4ARZ A;  1XPB A;  1T1C A;  2O9A A;  1DY6 A;  1K55 A;  4Q0J A;  2H0T A;  4PKY A;  2XR0 A;  1LL5 A;  3PAG A;  5DTS A;  1HLU P;  2VGK A;  3BJN A;  1YM1 A;  2GJ3 A;  5L2F A;  3CUE C;  4MBH A;  3W4Q A;  2XDM A;  4ZJ1 A;  3E0Y A;  5FQI A;  4ZDX A;  2O99 A;  1MWS A;  4IUH A;  3NCK A;  4P6Z M;  1LT0 A;  3PBQ A;  4ESP A;  4WL9 A;  5L10 A;  4LFU A;  4XT2 B;  1FQG A;  3TJZ C;  1HD8 A;  2J3W A;  2QMI A;  3VE4 A;  3S22 A;  1Z6F A;  3DTK A;  4S2O A;  1YAX A;  1UWN X;  2WYX A;  2E8I A;  3FKV A;  4XT2 A;  3VP2 A;  2GNX A;  5EUA A;  3BW6 A;  2H5S A;  2Y2H A;  4RA7 A;  3NUL A;  4EBL A;  2W3D A;  5J3W A;  3T4S A;  3Q7V A;  3MJQ A;  1J9M A;  3LI8 A;  3KYE A;  3NBL A;  3VSK A;  3LO7 A;  1YMS A;  3ZNT A;  2EWW A;  1NZO A;  2ZC6 B;  4RX3 A;  4LRX C;  4MN6 A;  3BLS A;  1SCW A;  3DAV A;  4B88 A;  1STZ A;  4L9G A;  1RGZ A;  5I94 A;  5DTT A;  2VV6 A;  2ZBB A;  1XXM A;  2VEA A;  3C4P A;  1OT9 A;  1PZP A;  1JWV A;  2Y2M A;  4HOI A;  5FQQ A;  3UY6 A;  3VP4 A;  4HIA A;  2QJ5 A;  3H82 B;  5DVA A;  4KZ8 A;  2IWB A;  2HZ5 A;  4GNU A;  3G30 A;  5HAI A;  2BG1 A;  1M6K A;  3E4Q A;  3IS2 B;  2Y2P A;  2EX6 A;  2X71 A;  3H82 A;  4R3J A;  4X25 A;  1CQA A;  3ZQ5 A;  4YWZ A;  2PR6 A;  4GHI B;  2K7S A;  3BFD A;  3V5M A;  4GJ4 A;  4EBP A;  4E6W A;  1DJC A;  1I2S A;  1K38 A;  4EES A;  5HX9 A;  3OCL A;  3NOU C;  3O88 A;  3BLM A;  1MWU A;  3UNW A;  3MXQ A;  4WLA A;  4LPZ A;  4U3T A;  4DXC A;  3N6I A;  3FPW A;  1CI9 A;  2M7V A;  4IBR A;  1NLZ A;  5TGF A;  3HUO A;  2PU2 A;  3NDE A;  2IWD A;  2XRN A;  3UB8 A;  5HAQ A;  2FFY A;  5EVI D;  2QHK A;  3D9Y A;  1T1A A;  3HLW A;  4E3I A;  4NXG A;  4PPR A;  1JTD A;  2VK3 A;  3IX8 A;  1PW1 A;  2ZC4 B;  1H3Q A;  4JXV A;  3V50 A;  1CEF A;  3JPU A;  4DE3 A;  2ZQ9 A;  4UQI M;  4PM9 A;  3MZF A;  3WRT A;  1MZU A;  2Y59 A;  4JPM A;  4D60 A;  5HSQ A;  3O3V A;  4KG5 A;  4O0P A;  3W4P A;  1W79 A;  4WF0 A;  1FOF A;  3MR0 A;  4DJ3 A;  1H5X A;  3NOP C;  1TS0 A;  1BLP A;  2ZQD A;  3T4J A;  2DCF A;  1K0K A;  3GVB A;  2GZA A;  2ZOI A;  1SDN A;  1S67 L;  1VEU A;  3UB9 A;  2FZ0 A;  1BUE A;  5F5Y A;  1FIL A;  1J3W A;  2V20 A;  3L7H A;  4GS9 A;  3KYZ A;  1LLB A;  5HWW A;  1TVF A;  4OOM A;  5HDC A;  3LR3 A;  1VQQ A;  1XGI A;  4PHT A;  4DXB A;  2HGV A;  3SW1 A;  1PI5 A;  1IKI A;  5GHZ A;  2MJ6 A;  2XK1 A;  4LRY C;  5CGX A;  1K57 A;  4JXS A;  3IXD A;  3UE3 A;  5DKK A;  4EW7 A;  1XKZ A;  2D01 A;  4HEF A;  3PAE A;  3F1O B;  3UME A;  2H0Y A;  2EX9 A;  3BFC A;  3PBT A;  3PBS A;  4RVA A;  4LGW A;  4ZTK A;  3SH9 A;  3GMW A;  5CRF A;  2PAV P;  3MBZ A;  1JNU A;  5CHM A;  1VET B;  3FZC A;  1NJ4 A;  4JXG A;  2A24 B;  4QY5 A;  3BQ8 A;  2OSU A;  5M18 A;  2XD1 A;  5CED A;  5U47 A;  1G28 A;  3T4K A;  3HRE A;  2B18 A;  1PNE A;  2A24 A;  2HJ9 C;  2JN7 A;  3IWI A;  2XRO A;  3HLG A;  4WMC D;  2JE5 A;  2ZM8 A;  3D3O A;  3UMD A;  3N8R A;  1IYS A;  4BBT A;  3OCN A;  4BL2 A;  3CLO A;  1P97 A;  2Z6D A;  2Q9N A;  5TJJ A;  4S2L A;  4BJP A;  2UWX A;  3T4O A;  2KOI A;  2ZMA A;  4FOF A;  5AQ7 A;  2EXB A;  5EV0 A;  3DWZ A;  2V0W A;  2WKE A;  2Q9M A;  5G4Y A;  2JBF A;  2XLN A;  4EEP A;  1LSX A;  4RX2 A;  5A91 A;  3OPR A;  4Z1W A;  5A8B A;  3WS2 A;  2Y91 A;  3I7J A;  1YLZ A;  2KDK A;  4KG6 A;  3ZNY A;  3ZDJ A;  4KZB A;  5AQB A;  2ZQA A;  1KGE A;  3MMH A;  3SH8 A;  4M4X A;  3GDI A;  2PT7 A;  1CJF A;  4X1M A;  4Y3I A;  2XGN A;  3UE0 A;  4KQQ A;  3B3X A;  1T1B A;  4KEN B;  1IYP A;  2Y2I A;  1WYC A;  2Z6C A;  1KOU A;  4P6Z S;  1LL8 A;  4YNR A;  3UDF A;  4I38 A;  3NDG A;  4BD1 A;  1F5M A;  2V0U A;  3VE3 A;  2WAF A;  4JGQ A;  3ITA A;  4DKI A;  4CPK A;  2EWV A;  1KE3 A;  4C75 A;  4H6J B;  3E2K A;  3A0S A;  3MKF A;  5F83 A;  4E3O A;  5EM0 A;  5HDS A;  4BD0 A;  4N92 A;  1Y54 A;  3VMA A;  2A3U A;  4H6J A;  3Q82 A;  2HP5 A;  2L0W A;  3IF6 C;  2RCX A;  1ZHH B;  4PM8 A;  1LI9 A;  2JKT M;  1FCM A;  3P01 A;  2XQZ A;  4BLM A;  3MXR A;  4GOG A;  4NXB A;  2C6W B;  4HY8 A;  1PWG A;  3IX3 A;  4KUO A;  3G31 A;  4HH3 A;  4CLC A;  2X02 A;  3L9K A;  1KGG A;  2PYR A;  3A0R A;  4OP5 A;  5FEG A;  1FSW A;  5IS1 A;  4XUZ A;  2VV8 A;  4OOY A;  5CER A;  4UA9 A;  4WEJ A;  2PD7 A;  5HPF A;  1S4R A;  4G3V A;  3S7N A;  1Y4O A;  3D72 A;  2ZL1 A;  1BLH A;  3FWL A;  5F82 A;  5L07 A;  4S2N C;  2Y2N A;  2Y2K A;  3LFV A;  2UV0 E;  4N1H A;  2KX6 A;  1YPR A;  4XUX A;  1HTZ A;  3ZVT A;  1EW0 A;  1W8Y A;  3UN7 A;  4GZB A;  3M2J A;  4KZ9 A;  2W3E A;  1G6A A;  1MXO A;  3ICY A;  2WZZ A;  4GB7 A;  5DF9 A;  3CPT B;  3UB5 P;  4JBF A;  2Q0O A;  1BLS A;  4DJ2 A;  2EFX A;  3QHY A;  1ES2 A;  4O8G A;  4ZBE A;  3A3I A;  3T4L A;  4EQI A;  2LB9 A;  3UB7 A;  3CPT A;  3TSG A;  4U0T A;  4EU0 A;  1GSW A;  2V1Z A;  4I3J A;  5LBR A;  3JVV A;  1N9L A;  4EET B;  1JTG A;  4QHC A;  1I5Q A;  4X69 A;  1JWP A;  1YT4 A;  4N1X A;  1XFN A;  2O9C A;  3A3D A;  2P9V B;  1RCJ A;  4MBF A;  5E43 A;  2PYP A;  1OT6 A;  3SS4 A;  2IA2 A;  5EVE A;  5GLB A;  3Q07 A;  4UQI S;  2XA7 S;  3QP2 A;  4B4X A;  4MDZ A;  3WS5 A;  5F68 A;  1XJ2 A;  3SS3 A;  4HNB A;  2G2U A;  3JYI A;  3UDI A;  2QJ7 A;  1ODV A;  1SDE A;  3G34 A;  4DE0 A;  4KZ6 A;  2ZJ9 A;  3T4T A;  1OJG A;  1HZO A;  4E3K A;  1L0F A;  3MXS A;  3R7W B;  4MN5 A;  3MFD A;  3QP1 A;  5HL6 A;  4HBU A;  3MQO A;  4DRT A;  3GQZ A;  1FIK A;  4WZ5 C;  4EUV A;  3FKW A;  4PKY G;  3R7W A;  3OC2 A;  4AFI A;  1TEM A;  1NYM A;  4OOL A;  1YLJ A;  1L0E A;  5L8M A;  3PYP A;  4IVK A;  1LHY A;  1U60 A;  3UDX A;  2HDQ A;  1L3L A;  5GHY A;  1TS8 A;  4WN5 A;  3MQQ A;  1ESU A;  4OON A;  4HP9 A;  4BL3 A;  4JXW A;  4O7D A;  2J7V A;  4MCW A;  1G5U A;  2W1T B;  3C4O A;  4E6X A;  5C5K A;  1GA9 A;  1XJ4 A;  4E3J A;  3HBR A;  2WAD A;  3CZD A;  1D1J A;  2WGI A;  5KZH A;  3EOI A;  1OJ5 A;  3LR4 A;  4E3N A;  1HVB A;  1JVJ A;  4KZ3 A;  1CF0 A;  2B02 A;  1ES4 A;  2EFU A;  3LIA A;  4HBT A;  4FH2 A;  4P6B A;  3LUQ A;  4FCF A;  1SZV A;  5EVI B;  2J80 A;  1OTD A;  4BBU A;  4HJ3 A;  4IHQ A;  3A3F A;  3N8S A;  3V3S A;  4KQR A;  3LIE A;  5FAS A;  4JF6 A;  1NXY A;  4PM5 A;  1AWI A;  5EVI A;  4YOF A;  1PWD A;  4QJG A;  3PBR A;  1YSP A;  1DJA A;  3QP6 A;  4B9O A;  1BUL A;  4B93 A;  5HDD A;  2WAE A;  2FH5 A;  4E04 A;  1IFQ A;  3IBJ A;  3ZHH A;  2CMN A;  3HUN A;  3MQ0 A;  4EUZ A;  4R4S A;  4F3L B;  1MPL A;  1EI5 A;  1RP5 A;  1Q2Q A;  1FCN A;  4OH0 A;  3IXG A;  1ERQ A;  1NWZ A;  3ISG A;  3RTY A;  3M6B A;  3WWX A;  3U2A A;  1ZG6 A;  1LL9 A;  3LID A;  5JYO A;  3E2L A;  1L0G A;  3T50 A;  1CK3 A;  3CHW P;  4EBN A;  2Y79 A;  3IS2 A;  4LRZ E;  3G35 A;  3NEC A;  4Q8I A;  5FAO A;  4GHI A;  1H8Y A;  3MKE A;  5MC7 A;  3T1R A;  2W0N A;  4GLQ A;  4NK3 A;  2V1B A;  4U0X A;  1VM1 A;  2QZ6 A;  4D2O A;  3BEC A;  5E2F A;  4NXF A;  2XSS A;  2JKR I;  3GV9 A;  1G6O A;  1BT5 A;  2G7U A;  5KSH A;  3FC7 A;  2J3T D;  2O9B A;  5AJG A;  2LB5 A;  1OTA A;  2JKG A;  3MZE A;  3B47 A;  1PIO A;  5TBM B;  2PRF A;  3N4I A;  4UAA A;  5FA7 A;  3MSH A;  3HL9 A;  1GHI A;  2XA7 M;  1ERO A;  1OME A;  2WZX A;  1WA9 A;  3IXB A;  4WUJ A;  5TBM A;  4XXR A;  3Q7Z A;  3UPN A;  4BMW A;  3ZVW A;  2ZQC A;  4UA7 A;  4MNR A;  5DJU A;  3NJA A;  5HPI A;  4WBG A;  5IT5 A;  3WS0 A;  4R38 A;  3B42 A;  3M6H A;  5FEF A;  3HCY A;  5FAQ A;  3GSG A;  3PXP A;  1DRM A;  4QWO A;  3IH8 A;  5DF8 A;  1G68 A;  1CEG A;  2OWH A;  4G3W A;  4OKP A;  2VZW A;  1S6R A;  3VP1 A;  5EPH A;  4C6Y A;  2O0Y A;  3OZH A;  4PM7 A;  1GCE A;  3OBF A;  4M3K A;  3KYQ A;  5EOO A;  5EEC A;  1T19 A;  1ERM A;  1C3B A;  2HF6 A;  3NHQ A;  1MBL A;  3LCE A;  1N9O A;  4HJ4 A;  2AVX A;  5CTN A;  2WK0 A;  2P74 A;  1P9W A;  1OTE A;  5FL3 A;  2WGW B;  3V39 A;  1P9R A;  3KSG A;  4GD8 A;  4R4R A;  4K91 A;  2I9V A;  1TDG A;  1L0D A;  2NUT C;  2WGW A;  1DP8 A;  4HP4 A;  1K54 A;  1ALQ A;  3F1O A;  1GHP A;  1VB6 A;  3NC8 A;  4DN0 A;  4PM6 A;  3PTE A;  2QKP A;  3NIA A;  1S4S A;  2OAP 1;  4HQA A;  3MZD A;  1VET A;  3VFF A;  2WKQ A;  3IXH A;  1T18 A;  3KSH A;  5FAT A;  2J3T C;  1WYB A;  2JHE A;  3RFB A;  3S4X A;  1XJ6 A;  1XA1 A;  4OPY A;  3A0V A;  4QPR A;  4DE1 A;  1IOU A;  5CHJ A;  2RL3 A;  1NRJ A;  4L9E A;  1DP6 A;  3TW8 A;  2ZQ7 A;  1FSY A;  3C8C A;  3EEA A;  4KZA A;  5G18 A;  4P85 A;  3KO6 A;  2EA9 A;  4MMN A;  4ZJ2 A;  5GLD A;  4Y0U A;  4HJ6 A;  4Z9Q A;  1S0W A;  2V8F A;  1PRQ A;  2Y2O A;  4LEN A;  3IWO A;  3TRC A;  3CJM A;  1YLP A;  2HP6 A;  2VA0 A;  3UE6 A;  3VP3 A;  1UWP X;  5FQ9 A;  4FUW A;  4GD6 A;  4X55 A;  4QB8 A;  4R0Q A;  4ZAM A;  1ES3 A;  5K5B A;  4QY6 A;  5HL1 A;  4OLG A;  5HD5 A;  3CUE A;  3CAX A;  2HDS A;  1ONH A;  2XFT A;  4OQ0 A;  1XJ3 A;  3B33 A;  4E3L A;  1F9I A;  5FSR A;  3LEQ A;  3T1S A;  2C5W B;  3O5Y A;  3IH9 A;  1Q2P A;  2A49 A;  1GSX A;  5DJT A;  3VP0 A;  2V8C A;  4II7 A;  2PBY A;  4OPQ A;  3F1N B;  4NG2 A;  3ZG9 B;  2W1R A;  4KZ5 A;  3OPH A;  3C38 A;  4OP8 A;  4L9F A;  4GKU A;  4DMZ A;  3BRM A;  1CI8 A;  2VV7 A;  4JGP A;  5FI7 A;  3VFH A;  3UPO A;  4E3M A;  1TD5 A;  1S1Z A;  3ZG8 B;  5L09 A;  2P7J A;  3S7O A;  2P08 A;  3OLO A;  4G3K A;  1O7E A;  1MC0 A;  1LSW A;  2WKP A;  1GA0 A;  1TDL A;  1UGU A;  5DFX A;  3C7V A;  3ZFZ A;  4P87 A;  2ZMV A;  1BTL A;  3HLB A;  4LLO B;  3NY4 A;  1TS6 A;  1SHV A;  5E2H A;  5AQ9 A;  2Y4A A;  1S66 L; 
#chains in the Genus database with same CATH homology
 3BLM A;  1MWU A;  3CMZ A;  2WKI A;  3UNW A;  3AGD A;  3IWQ A;  1KVL A;  4IVK A;  4U3T A;  4DXC A;  3N6I A;  3G2Z A;  1CI9 A;  1LHY A;  1U60 A;  2VGJ A;  1DJB A;  1XP4 A;  4IBR A;  3HLF A;  5HFO A;  4FSF A;  5TGF A;  3UDX A;  3HUO A;  2PU2 A;  2HDQ A;  4R23 A;  3NDE A;  2Y55 A;  5EVI C;  5GHY A;  4S2K A;  4X56 A;  5F1F A;  1ESU A;  2IWD A;  3QNB A;  4OON A;  1PI4 A;  1FCO A;  2PU4 A;  4WEL A;  5HAQ A;  4BL3 A;  2FFY A;  5EVI D;  4JXW A;  4O7D A;  4Y0T A;  2J7V A;  5TFQ A;  5HW3 A;  3ZGA B;  4S2J A;  3C4O A;  1ES5 A;  3IHA A;  3HLW A;  2DNS A;  4E6X A;  5A93 A;  4OPZ A;  3S1Y A;  1GA9 A;  4PPR A;  3GR2 A;  1JTD A;  4E3I A;  4E3J A;  1PW1 A;  2ZC4 B;  1E3U D;  3ZG5 A;  3HLD A;  4KQO A;  3HBR A;  4JXV A;  2WAD A;  5FI2 A;  5M1A A;  3V50 A;  1CEF A;  3CZD A;  4DE3 A;  5M19 A;  2ZQ9 A;  2WGI A;  2XD5 A;  4PM9 A;  3MZF A;  5KZH A;  3WRT A;  3EQV A;  5J8X A;  2Y59 A;  4JPM A;  4E3N A;  2JCH A;  2J9P A;  1HVB A;  1JVJ A;  5GHX A;  2Y2Q A;  3O3V A;  2B5R A;  4KZ3 A;  4WZ5 A;  1BZA A;  4UA6 A;  4KG5 A;  5KSC A;  1ES4 A;  3WS1 A;  2EFU A;  2HP9 A;  1K57 C;  3W4P A;  4HBT A;  1W79 A;  4FH2 A;  1FOF A;  4P6B A;  5GL9 A;  4FCF A;  3AGF A;  4IBX A;  4OLD A;  1H5X A;  5EVI B;  1ZG4 A;  1O07 A;  1BLP A;  3A3F A;  3N8S A;  4LV2 A;  3V3S A;  3W4O A;  2ZQD A;  4KQR A;  5FAS A;  4A5R A;  4JF6 A;  5E2E A;  1NXY A;  2DCF A;  5IHV A;  4PM5 A;  3GVB A;  1SDN A;  5EVI A;  4JF5 A;  2Y2G A;  1PWD A;  4X68 A;  4QJG A;  3PBR A;  1BUE A;  1DJA A;  1IYQ A;  1FR1 A;  1BUL A;  2V20 A;  1E3U A;  1K6S A;  2FFF B;  3TG9 A;  2WAE A;  2ZC3 B;  3UO9 A;  4DF6 A;  1LLB A;  1MWT A;  1FR6 A;  3TOI A;  3ZHH A;  1YLY A;  3PBN A;  1TVF A;  4OOM A;  3HUN A;  3ITB A;  2Y2L A;  4EUZ A;  4KZ7 A;  4R4S A;  1BSG A;  4GDB A;  1VQQ A;  2QPN A;  1XGI A;  5A92 A;  2GDN A;  1MPL A;  1EI5 A;  1RP5 A;  2EX8 A;  2XH9 A;  4DXB A;  1Q2Q A;  1PI5 A;  1IKI A;  1FCN A;  5GHZ A;  4OH0 A;  3IXG A;  1IYO A;  4R3B A;  3GRJ A;  4X53 A;  1ERQ A;  2P9V A;  4OVD A;  2XK1 A;  5CGX A;  3EQU A;  3ISG A;  1K57 A;  3G2Y A;  3M6B A;  3WWX A;  1ZG6 A;  4HES A;  1LL9 A;  3BFE A;  2I72 A;  1PW8 A;  4JXS A;  3IXD A;  3V3R A;  3E2L A;  5JYO A;  1L0G A;  1CK3 A;  3UE3 A;  1QMF A;  1XKZ A;  3P09 A;  3PAE A;  4HEF A;  1KDW A;  2H0Y A;  4EBN A;  3C7U A;  3IQA A;  2EX9 A;  3BFC A;  1W8Q A;  3PBT A;  3PBS A;  4RVA A;  3RXW A;  4ZTK A;  3G35 A;  3IT9 A;  3GMW A;  5CRF A;  3SH9 A;  1PZO A;  3LY4 A;  5E2G A;  2ZC5 B;  2J9O A;  2IWC A;  3WS4 A;  4GN2 A;  3MBZ A;  3G4P A;  1E25 A;  3IHB A;  5CHM A;  4Q8I A;  3DTM A;  5FAO A;  1H8Y A;  3FZC A;  3MKE A;  4UHU A;  4MBK A;  5FQJ A;  3P98 A;  4GDN A;  1NJ4 A;  1PYY A;  4JXG A;  4YIN A;  4NK3 A;  4WEK A;  4QY5 A;  2OSU A;  5M18 A;  4N9L A;  2XD1 A;  4U0X A;  1VM1 A;  2QZ6 A;  5CED A;  4NET A;  5U47 A;  3RXX A;  4D2O A;  1ZC2 A;  3BEC A;  3G32 A;  2EXA A;  5E2F A;  2XEP A;  3HRE A;  3PBO A;  1ONG A;  3IWI A;  4PMA A;  3HLG A;  4ZJ3 A;  3ZCZ A;  5TR7 A;  1MY8 A;  4WMC D;  1WE4 A;  5FQK A;  3GV9 A;  4P0M A;  2X01 A;  2JE5 A;  2ZM8 A;  4JF4 A;  2OLV A;  1BT5 A;  3N8R A;  1IYS A;  1W5D A;  5KSH A;  1GHM A;  2Z2L B;  3OCN A;  5EOE A;  4BL2 A;  3N8L A;  1M40 A;  4LV3 A;  3MZE A;  3OPL A;  2Q9N A;  3VOY A;  1PIO A;  3N4I A;  4C3Q A;  4UAA A;  5FA7 A;  3ZG0 A;  4DDY A;  2ZM2 A;  3HL9 A;  4S2L A;  1MKI A;  4LV1 A;  1GHI A;  4WYY A;  1K56 D;  4FD8 A;  4BJP A;  1K4E A;  2HDU A;  4MEZ A;  2UWX A;  1ERO A;  1OME A;  2WZX A;  1YLW A;  3IXB A;  4JLF A;  3HUM A;  4XXR A;  2ZMA A;  5CXW A;  3Q7Z A;  4R1G A;  2BLS A;  5F1G A;  5AQ7 A;  2HDR A;  1NRF A;  1XGJ A;  3LY3 A;  3UPN A;  2EXB A;  3ZVW A;  3DWZ A;  4LCL A;  2ZQC A;  2ZLY A;  2WKE A;  4UA7 A;  1E4D A;  2Q9M A;  4MNR A;  4OQH A;  1K6R A;  4LCM A;  3M2K A;  2OV5 A;  4WBG A;  1N9B A;  3WS0 A;  5CGW A;  1NZU A;  4S2I A;  2HPB A;  3Q7V B;  3M6H A;  2JBF A;  2XLN A;  5FAQ A;  4X6T A;  3UPP A;  1KE4 A;  3GSG A;  4RX2 A;  4S2P A;  3OPR A;  5A91 A;  3RJU A;  3WS2 A;  3O86 A;  2ZQ8 A;  1I2W A;  1YLT A;  5DF7 A;  3IH8 A;  2Y91 A;  1K54 C;  5GLA A;  5DF8 A;  1G68 A;  4OQG A;  1CEG A;  1LI0 A;  3FV7 A;  4OKP A;  2ZM0 A;  3I7J A;  1S6R A;  1YLZ A;  3VP1 A;  5FQM A;  4KG6 A;  3ZNY A;  1EWZ A;  5EPH A;  3ZDJ A;  4C6Y A;  1K56 A;  4KZB A;  3OZH A;  2ZQA A;  5AQB A;  1KGE A;  3SS5 A;  3SH8 A;  2WGV A;  1YQS A;  5AQA A;  3VSL A;  2R9W A;  4PM7 A;  1GCE A;  5CGS A;  3HLC A;  4M3K A;  2XGN A;  5CHU A;  3UE0 A;  4KQQ A;  2ZC7 A;  3B3X A;  5EEC A;  5EOO A;  5HAP A;  1ERM A;  1C3B A;  4KEN B;  1BLC A;  1IYP A;  1W7F A;  2Y2I A;  1WYC A;  3A3E A;  1MBL A;  5A90 A;  3LCE A;  1QME A;  5CTN A;  2WK0 A;  3Q81 A;  3AGE A;  4DE2 A;  3UDF A;  3W8K A;  2XFS A;  3NDG A;  3N7W A;  2P74 A;  1YMX A;  4FH4 A;  5GLC A;  4BD1 A;  4WZ4 A;  4BQM A;  4BEN A;  3BFF A;  2WGW B;  3V39 A;  5KMW A;  2WAF A;  3IF5 A;  3ITA A;  4DKI A;  4GD8 A;  4WM9 A;  4R4R A;  3BEB A;  4K91 A;  4CPK A;  1KE3 A;  4C75 A;  1TDG A;  3BFG A;  1N4O A;  1XA7 A;  1L0D A;  1PWC A;  2WGW A;  4IED A;  3E2K A;  5BOH A;  1XX2 A;  3MKF A;  5F83 A;  1IEM A;  4E3O A;  3CG5 A;  4RYE A;  4BD0 A;  3UE1 A;  1K54 A;  1ALQ A;  1KDS A;  1Y54 A;  4N92 A;  1KGF A;  2CC1 A;  1GHP A;  3VMA A;  2A3U A;  3BM6 A;  3SH7 A;  3DW0 A;  3Q82 A;  3NC8 A;  2HP5 A;  1H8Z A;  3Q1F A;  3SOI A;  5CEC A;  4PM6 A;  3PTE A;  3IF6 C;  2RCX A;  3FYZ A;  2H10 A;  3NIA A;  5HAR A;  4PM8 A;  4ID4 A;  1XPB A;  2V2F F;  1JWZ A;  3GTC A;  4CJN A;  1LI9 A;  2WUQ A;  3MZD A;  3VFF A;  1DY6 A;  1FCM A;  3HLE A;  1K55 A;  3IXH A;  2H0T A;  2XR0 A;  1IEL A;  1LL5 A;  2XQZ A;  3PAG A;  5DTS A;  5FAT A;  4BLM A;  3MXR A;  4GOG A;  2C6W B;  1WYB A;  4L0L A;  4IVI A;  1MWR A;  2VGK A;  1PWG A;  3O87 A;  3S4X A;  3G31 A;  1YM1 A;  2EX2 A;  1XA1 A;  5L2F A;  4OPY A;  4MBH A;  3W4Q A;  4DE1 A;  2XDM A;  3C5A A;  5CHJ A;  2RL3 A;  4ZJ1 A;  5FQI A;  2X02 A;  4ZDX A;  2J8Y A;  4DDS A;  4EV4 A;  2ZQ7 A;  1FSY A;  1KGG A;  4EWF A;  5CEB A;  1MWS A;  4OP5 A;  1FSW A;  4KZA A;  4XUZ A;  3NCK A;  4OOY A;  5G18 A;  5CER A;  4UA9 A;  4WEJ A;  4P85 A;  4ZJ2 A;  3A3J A;  5GLD A;  3HVF A;  3PBQ A;  3IF6 B;  1NYY A;  4Y0U A;  1BLH A;  3FWL A;  5F82 A;  4S2N C;  4Z9Q A;  4N9K A;  1S0W A;  1KVM A;  2Y2N A;  1FQG A;  2Y2O A;  2Y2K A;  2QMI A;  1HD8 A;  3S22 A;  1Z6F A;  4LEN A;  5FI6 A;  3IWO A;  4S2O A;  3CJM A;  3IF6 A;  4H8R A;  1YLP A;  2HP6 A;  2WYX A;  1ZKJ A;  3QNC A;  4N1H A;  2E8I A;  3FKV A;  4XUX A;  1HTZ A;  3VP2 A;  5CTM A;  3ZVT A;  4WMC A;  3VP3 A;  5EUA A;  4QD4 A;  5FQ9 A;  1W8Y A;  2H5S A;  2Y2H A;  3UN7 A;  1K25 A;  4RA7 A;  4GZB A;  4X55 A;  3M2J A;  4GD6 A;  4EBL A;  4QB8 A;  4KZ9 A;  4R0Q A;  4ZAM A;  3WRZ A;  1ES3 A;  4JKT A;  3Q7V A;  1G6A A;  1MXO A;  4QY6 A;  1J9M A;  5HL1 A;  2WZZ A;  4GB7 A;  4OLG A;  5DF9 A;  4JBF A;  4OQI A;  3NBL A;  1BLS A;  5DTK A;  2HDS A;  1ONH A;  2EFX A;  1ES2 A;  3QHY A;  4MLL A;  2XFT A;  3VSK A;  4OQ0 A;  3LO7 A;  1YMS A;  3ZNT A;  4ZBE A;  4K0W A;  3A3I A;  4KG2 A;  4E3L A;  4EQI A;  1NZO A;  3TSG A;  5FSR A;  2ZC6 B;  4RX3 A;  4U0T A;  2C5W B;  3OPP A;  2OLU A;  3IH9 A;  2G2W A;  2V1Z A;  1Q2P A;  1K55 C;  2A49 A;  3VP0 A;  2PBY A;  4OPQ A;  4Y7P A;  3BLS A;  4Y0O A;  4OPR A;  1SCW A;  4F94 A;  1NY0 A;  5FAP A;  3ZG9 B;  1JTG A;  1SKF A;  4QHC A;  4S2N A;  4KZ5 A;  4YFM A;  4B88 A;  1I5Q A;  3LEZ A;  4X69 A;  3OPH A;  1RGZ A;  5I94 A;  5DTT A;  1JWP A;  1YT4 A;  1KE0 A;  3BYD A;  4N1X A;  4OP8 A;  1XXM A;  4GKU A;  1IKG A;  3A3D A;  2P9V B;  1RCJ A;  3BRM A;  4MBF A;  1CI8 A;  5E43 A;  5D3O A;  5FI7 A;  3C4P A;  3VFH A;  3VOZ A;  3D4F A;  3UPO A;  5JYP A;  1PZP A;  1JWV A;  4E3M A;  3ZG8 B;  3SS4 A;  2Y2J A;  2Y2M A;  5GLB A;  5FQQ A;  3Q07 A;  3UY6 A;  2JC7 A;  3ZG7 B;  3VP4 A;  2ZD8 A;  1ESI A;  5DVA A;  4KZ8 A;  2IWB A;  1O7E A;  5FDH A;  4B4X A;  3WS5 A;  4GNU A;  5EVL A;  4B4Z A;  3G30 A;  1AXB A;  3SS3 A;  5HAI A;  2G2U A;  2BG1 A;  3JYI A;  1M6K A;  3UDI A;  2Y2P A;  1SDE A;  3G34 A;  1GA0 A;  2XF3 A;  2EX6 A;  2R9X A;  2X71 A;  4DE0 A;  1TDL A;  2ZJ9 A;  4KZ6 A;  4R3J A;  4S2M A;  1HZO A;  3C7V A;  4E3K A;  1L0F A;  3MXS A;  5EE8 A;  3ZFZ A;  2Z2M B;  4LV0 A;  1RGY A;  4P87 A;  4K0X A;  3BFD A;  3V5M A;  4EBP A;  3MFD A;  4E6W A;  1DJC A;  1I2S A;  1K4F A;  1BTL A;  1L2S A;  3DWK A;  1K38 A;  2DRW A;  3HLB A;  4KZ4 A;  4HBU A;  4DRT A;  3GQZ A;  4WZ5 C;  3NY4 A;  3FKW A;  3NI9 A;  5HX9 A;  3OC2 A;  1SHV A;  3OCL A;  3O88 A;  5E2H A;  5AQ9 A;  2WKH A;  1TEM A;  2Y4A A;  1NYM A;  4OOL A;  4QU3 A;  1YLJ A;  1L0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...