3BFCA

Class a beta-lactamase sed-g238c complexed with imipenem
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
262
structure length
262
Chain Sequence
b'VQQVQKKLAALEKQSGGRLGVALINTADNSQVLYRADERFAMCSTSKVMTAAAVLKQSETHDGILQQKMTIKKADLTNWNPVTEKYVGNTMTLAELSAATLQYSDNTAMNKLLAHLGGPGNVTAFARSIGDTTFRLDRKEPELNTAIPGDERDTTSPLAMAKSLRKLTLGDALAGPQRAQLVDWLKGNTTGGQSIRAGLPAHWVVGDKTGACDYGTTNDIAVIWPEDRAPLVLVTYFTQPQQDAKWRKDVLAAAAKIVTEGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class A beta-lactamase Sed1
publication title Acyl-intermediate structures of the class A beta-lactamase SED-G238C
rcsb
source organism Citrobacter sedlakii
molecule tags Hydrolase
total genus 95
structure length 262
sequence length 262
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3bfcA00
1NYYA 3MZDA 2JE5A 3HVFA 4OVDA 3WS1A 1GA9A 4UA7A 5DTSA 3G30A 1IEMA 4FCFA 3UDFA 1YQSA 4KZ4A 1BUEA 1GHMA 3VP1A 5FQQA 2WYXA 3MZFA 3PBQA 4P0MA 4BJPA 3G35A 1KVMA 2OLVA 1SHVA 1YLPA 3EQUA 2XH9A 5EVLA 2XK1A 3FWLA 4A5RA 5HAPA 3NIAA 3ZNYA 1ERQA 3HUMA 3Q7ZA 3EQVA 3MZEA 1K55C 4M3KA 2CC1A 4BD1A 1XGJA 5GLBA 1FCNA 1ONHA 3FV7A 3BEBA 4ZJ1A 2JBFA 3IWOA 4JXSA 1YLJA 3PBNA 5M18A 4OQIA 4E6WA 1ES4A 2UWXA 3MBZA 4OLDA 1GCEA 1XX2A 4S2OA 2BG1A 2ZC3B 1VM1A 3CJMA 3OCNA 5AQBA 2ZJ9A 5EOEA 3BYDA 4KZ9A 2Q9MA 3WS5A 4GDBA 3UE1A 2EFXA 3HREA 2HDQA 5CGXA 1NRFA 2Y2OA 5CTNA 1CK3A 2VGJA 2ZQDA 4E3IA 3UNWA 5KMWA 3S22A 3VOZA 4KZBA 4OQHA 5FQJA 5CXWA 1ESIA 2XFTA 3ZCZA 3QNBA 1ESUA 1MBLA 1PZPA 2WK0A 3CG5A 3HLFA 3C5AA 3IF6C 2Y55A 1PZOA 1KE3A 2VGKA 4Q8IA 3FKVA 1L0FA 4Y0UA 4OPZA 4LV0A 3GSGA 4GD8A 1FSYA 4K0XA 3IF6B 3BECA 2HP5A 2Y2MA 4GD6A 5A91A 5CERA 1NXYA 4BD0A 3OPRA 4IVIA 2H5SA 4IBRA 3BLMA 4Y0TA 2EXAA 1XKZA 3W4QA 1JTGA 4JF4A 3S1YA 1K56D 1E3UD 3O87A 1XPBA 1YLTA 4P85A 4UHUA 2ZD8A 5E2HA 4ZJ3A 4EBLA 4QY5A 3TSGA 4MBFA 1FOFA 1LL9A 2JCHA 3GMWA 4WZ5A 2WZXA 1XA1A 3WWXA 4S2NC 1GHPA 1CI9A 4YFMA 5HX9A 3UO9A 3ZGAB 3IWIA 1H8ZA 3UPPA 2G2UA 3PBOA 2Y2KA 4WYYA 5FQ9A 2ZC4B 2C5WB 4R23A 4DRTA 4ZJ2A 4MEZA 1L0EA 3GVBA 4R4RA 4OOYA 4DKIA 4RYEA 1RGYA 3OZHA 1FR1A 1WYBA 1IYOA 3IH8A 4XXRA 4HESA 3LCEA 5EVIC 1MWRA 5DVAA 1E4DA 3AGFA 3WRZA 4OOLA 3M6BA 3LY3A 3V3RA 2OSUA 3ZNTA 4E3LA 5FAQA 2J9OA 2ZC5B 3WS4A 3HLCA 3IXDA 2ZM8A 4MBHA 1BLCA 2Z2LB 4DE3A 1BTLA 5A92A 2Y2QA 2QMIA 4N9LA 1ZG4A 2ZQ8A 5DF7A 1NYMA 5U47A 3IXBA 4C6YA 4OQ0A 4XUXA 1PYYA 4S2JA 1K4EA 2X71A 2XQZA 4BENA 2BLSA 2H0YA 1HVBA 2HDRA 3I7JA 3IF5A 4E3JA 4LV1A 3BM6A 3QHYA 5D3OA 3Q7VA 4OP8A 3OPHA 2DNSA 2ZQAA 4D2OA 3BFEA 3ISGA 4FH4A 2EXBA 5HL1A 1MY8A 2IWCA 3ITAA 2V1ZA 3IQAA 4LCMA 4OOMA 5IHVA 4OPYA 4DDSA 2WADA 4S2PA 1LLBA 2WGVA 4N1HA 3UDXA 1ZKJA 5BOHA 2ZC7A 2EFUA 3OCLA 2ZQCA 4R3JA 4R1GA 2WGWA 4QHCA 5FI7A 3W4OA 2E8IA 4H8RA 4C75A 1EWZA 4E6XA 2Y2NA 3SOIA 3B3XA 4L0LA 5FQIA 2XEPA 3O3VA 3ZG0A 1HTZA 2ZLYA 2J8YA 4DE2A 3ZFZA 3A3EA 4X68A 1ERMA 2GDNA 5M19A 3HUNA 5GHXA 4P6BA 5EECA 1W8QA 2FFFB 3GQZA 1BLPA 5CHUA 1E3UA 2P74A 4PMAA 1ONGA 2X02A 1N9BA 5JYPA 3UE0A 1HZOA 3FKWA 3VOYA 1W5DA 5E43A 1I2SA 1MXOA 1GHIA 3VSKA 2WGIA 3A3IA 5F1FA 4HBTA 1HD8A 4X53A 2P9VA 1K54C 3NCKA 3VP0A 1CI8A 1LL5A 4S2IA 3ZG5A 4B4ZA 4E3KA 4WEJA 5GHZA 3TG9A 1IELA 2A3UA 2Y2IA 2ZQ7A 3G32A 5KSHA 4OONA 2XF3A 1FCMA 2R9XA 4WZ5C 3ZDJA 4JPMA 3ZG9B 3PBSA 4PM5A 1SCWA 5A93A 5KSCA 1JWZA 3ZVWA 4RX3A 4X55A 2QZ6A 2H0TA 5DF8A 3HLWA 1GA0A 3UDIA 3GRJA 1TDGA 5TGFA 3WRTA 5DF9A 4DE0A 3FYZA 4JLFA 4QU3A 3ZG8B 1MWSA 4WELA 1BT5A 1NZOA 3C7UA 3DWKA 5CHJA 4X56A 4Y7PA 1BLSA 3G2ZA 5F1GA 3C4PA 3E2KA 3OPLA 3PAGA 1PWCA 1K4FA 1K54A 2XR0A 3BRMA 4U0TA 1W8YA 1JVJA 1TEMA 3MKEA 4OQGA 2J9PA 2XFSA 3BFGA 4NK3A 4RA7A 1L0GA 2Y2HA 3V50A 3CMZA 4GB7A 3LY4A 4ZAMA 2XDMA 1PIOA 4U0XA 5FSRA 4GN2A 1CEGA 3HLDA 3PBTA 2Y2PA 3SS3A 3Q81A 3NC8A 3N6IA 1IKGA 5EUAA 4CPKA 5CGWA 4WM9A 1FQGA 2H10A 4LENA 1YLYA 3LEZA 2J7VA 5KZHA 3Q07A 2HP9A 2HDUA 1NZUA 1W7FA 3G34A 2PBYA 4KZ5A 4WZ4A 1MWTA 1FCOA 2WKEA 4EV4A 3VSLA 4IBXA 2Y59A 4MBKA 2IWDA 2B5RA 5CGSA 4ZTKA 3UY6A 3C7VA 2FFYA 4N9KA 5CTMA 1M40A 1QMFA 5F83A 2Q9NA 2ZQ9A 5CECA 3DWZA 3AGDA 3JYIA 5GLCA 1RCJA 3UE3A 3VFHA 1IYSA 2EX2A 3V39A 3O88A 4R4SA 1MPLA 3VP4A 2WKHA 2Y2JA 4LCLA 3E2LA 2JC7A 1L0DA 1J9MA 3G31A 3ZG7B 2V2FF 5FQKA 1KVLA 4GDNA 1IYPA 1TVFA 3Q7VB 4KG6A 4KQQA 5EVIB 5E2EA 1TDLA 2ZM2A 1JTDA 5HFOA 2XD5A 1ALQA 3BFCA 3MXRA 5TFQA 3NDGA 3WS0A 1ZG6A 3A3JA 4KZ3A 1ES3A 3HBRA 2WGWB 3DTMA 2HDSA 4GZBA 4OLGA 3SH7A 4FSFA 2RL3A 4DE1A 5AQ7A 1RP5A 2ZC6B 3FZCA 4PM8A 1YM1A 3Q82A 2C6WB 2WAEA 5FAPA 5AQ9A 2IWBA 4BL3A 2EX9A 3IXHA 1LI9A 4FD8A 3Q1FA 1JWPA 4R0QA 3PTEA 1DJAA 3MKFA 1Y54A 3MXSA 4EWFA 4PM6A 3OPPA 4WMCD 3GTCA 5HARA 1BULA 4BLMA 4HBUA 3G2YA 5FATA 2Y91A 3BFDA 4RX2A 2RCXA 3M2KA 1IYQA 5GHYA 1FR6A 4N92A 1G6AA 3RJUA 3W8KA 4O7DA 2Z2MB 1S0WA 3M2JA 5FQMA 4PM9A 3QNCA 2A49A 1KE0A 1ZC2A 5FA7A 3UPOA 1K57A 1PWGA 2P9VB 1N4OA 1L2SA 3VP2A 3RXWA 3ITBA 1K56A 3LO7A 1U60A 2XLNA 4OH0A 4C3QA 4F94A 4GKUA 3NY4A 2Y4AA 3NDEA 3VP3A 1SKFA 5FAOA 3UN7A 2WUQA 1BLHA 2Y2GA 5E2GA 5TR7A 2ZM0A 1IKIA 1NJ4A 3SH8A 4KENB 1LI0A 5A90A 3GR2A 5FDHA 1DY6A 2OV5A 1K38A 1K25A 4QY6A 3A3DA 4PPRA 4YINA 2PU2A 3IT9A 3PBRA 4BQMA 5HW3A 5CRFA 5J8XA 4S2KA 5GLDA 4N1XA 5L2FA 2DCFA 1Q2QA 1XA7A 4JBFA 3O86A 4S2MA 4Z9QA 4UA6A 5FASA 4OPQA 4JF5A 1YMXA 5EVID 3IHBA 2WKIA 2V20A 3TOIA 1PI5A 5I94A 2I72A 5FI6A 4R3BA 1KE4A 1PW1A 4DXCA 4EQIA 3C4OA 5GL9A 3MFDA 3NBLA 4DDYA 1YMSA 4OP5A 4PM7A 1KDSA 4JKTA 1I2WA 2WAFA 1KGFA 1YT4A 1G68A 4QB8A 5EOOA 4Y0OA 5EPHA 3V5MA 4DF6A 1K55A 3PAEA 4KZ8A 2XGNA 1DJCA 3UPNA 4JXWA 1YLWA 3S4XA 5FI2A 1KGGA 2EX8A 2HP6A 1BZAA 5DTKA 1PI4A 4IEDA 4X6TA 3V3SA 1FSWA 4GOGA 5G18A 3IXGA 1MKIA 1MWUA 3W4PA 4K0WA 4U3TA 3G4PA 1E25A 4KZ7A 2G2WA 1C3BA 4CJNA 5DTTA 2R9WA 4P87A 4EUZA 1ES2A 1VQQA 3M6HA 4JXGA 4MLLA 5CHMA 1NY0A 1WE4A 1H8YA 2HPBA 3N8LA 4KZAA 4E3NA 5CEDA 4GNUA 1LHYA 3IWQA 4RVAA 1KDWA 1XXMA 3IF6A 4IVKA 5HAQA 1BSGA 1JWVA 3HL9A 3P09A 1RGZA 1SDNA 3OC2A 1CEFA 3D4FA 1W79A 3N8SA 1Q2PA 4XUZA 4WMCA 2OLUA 1DJBA 3ZVTA 4LV3A 4OKPA 1EI5A 4UA9A 3P98A 5HAIA 4KG5A 2XD1A 4WBGA 3VFFA 1H5XA 3N4IA 4E3MA 5GLAA 1WYCA 4EBPA 4KZ6A 3DW0A 3HLGA 3N8RA 4KG2A 4JXVA 3SS5A 3A3FA 5EE8A 5AQAA 1SDEA 3IH9A 1K6RA 2Y2LA 4K91A 4BL2A 5CEBA 4HEFA 4QJGA 3AGEA 5E2FA 1EROA 1I5QA 4KQRA 3N7WA 1OMEA 1QMEA 1K57C 4NETA 3HLBA 4S2NA 1M6KA 3ZHHA 4E3OA 2EX6A 4S2LA 4EBNA 4KQOA 4WEKA 2DRWA 4B4XA 4ZBEA 4LV2A 5M1AA 3IHAA 3RXXA 1AXBA 4ZDXA 4QD4A 5JYOA 3GV9A 4JF6A 2PU4A 4B88A 1YLZA 1XP4A 1Z6FA 4UAAA 2ZMAA 1ES5A 1PW8A 3SH9A 3WS2A 4FH2A 3BFFA 3HUOA 3HLEA 2WZZA 1O7EA 4MNRA 4DXBA 2X01A 1S6RA 1O07A 4X69A 1K6SA 4ID4A 2QPNA 3CZDA 5F82A 3BLSA 3NI9A 5EVIA 4OPRA 1PWDA 1XGIA 1KGEA 3VMAA 3SS4A
chains in the Genus database with same CATH superfamily
3HVFA 3WS1A 3BY9A 3G30A 1YQSA 5FQQA 1H0MA 3PBQA 4P0MA 4BJPA 2OLVA 1SHVA 5HZHA 5EVLA 2XK1A 3FWLA 2P08A 5FEFA 3NIAA 3KSIA 2M7VA 3HUMA 3MZEA 1YKDA 1K55C 4M3KA 2Y79A 4BD1A 4AFIA 3EWKA 1ONHA 3FV7A 4BMWA 2V1BA 5IT5A 1YLJA 4E6WA 3HJKA 1XX2A 4H6JB 4Y15A 2ZC3B 2ZMFA 1VM1A 4MMNA 3CPTB 4UEYA 1OJ5A 3ULFA 2EFXA 5CTNA 3L7HA 2ZQDA 3UNWA 3U2AA 3S22A 1ACFA 2W0NA 5FQJA 5CXWA 1ESUA 3OOVA 1P9WA 1YAXA 4Y0UA 4MDZA 1SKOB 3IBRA 5EV0A 3IF6B 1OTBA 4IVIA 4Q0HA 1T19A 4P85A 3TSGA 4WZ5A 1XA1A 2WZXA 4FUWA 3ZGAB 4BBVA 4YWZA 3JPUA 4WYYA 2M1CA 2ZC4B 4ZJ2A 4MEZA 1A0KA 3OZHA 1T1CA 1IYOA 4HESA 5EM0A 5DVAA 2GX5A 3WRZA 3M6BA 3F1OA 2J9OA 3MS6A 4DE3A 4N9LA 4Y17A 1ZG4A 4RQ9A 4F3LA 3IXBA 4C6YA 4S2JA 2QYBA 1CQAA 3FG8A 4EETB 4OP8A 3ISGA 2K7SA 2IWCA 4Q0JA 4S2PA 1LLBA 1NWZA 1XJ3A 4E6XA 5G4ZA 3SOIA 3B3XA 2J8YA 5M19A 3HUNA 5GHXA 3DAVA 1LT0A 1BLPA 2HV1A 5CHUA 1E3UA 1P97A 2ZMVA 2O0YA 4PMAA 4B93A 4JGOA 3VOYA 1W5DA 4O8GA 3A3IA 2PYRA 1K54C 1LL5A 4B4ZA 5GHZA 5KSHA 3ZDJA 1FCMA 3EOIA 4XT2B 3PBSA 5F5YA 1Y28A 4X55A 2XRNA 3HLWA 4HNBA 3UDIA 2H28A 1TDGA 4JLFA 3ZG8B 4X56A 2OAQ1 3UMEA 4E04A 2GNXA 3BRMA 1W8YA 1JVJA 2J9PA 3V50A 3CMZA 4ZAMA 1PIOA 1CEGA 2Y2PA 4LRZE 3SS3A 3KX0X 4D60A 4WM9A 1YLYA 3LEZA 3Q07A 3IBJA 2HP9A 4WZ4A 1MWTA 1FCOA 1XFNA 2Y59A 5CGSA 4N9KA 3LR5A 1CF0A 4BBUA 5CECA 5HDDA 3V39A 1MPLA 3VP4A 2WKHA 2Y2JA 3E2LA 3ZG7B 1XFQA 5CX7A 4GDNA 4KQQA 5EVIB 4DJ3A 2ZM2A 1JTDA 1DP8A 2XD5A 3RTYA 1ZG6A 2JKTM 5L09A 1T18A 4GZBA 2WGWB 1S1YA 4FSFA 3C30A 2ZC6B 3FZCA 2A2LA 3Q82A 1OT6A 3PR6A 4BL3A 3Q1FA 3LR3A 2GJ3A 5HPFA 5DFXA 4HBUA 2RCXA 3M2KA 3W8KA 4N92A 4O7DA 5DFYA 1TD5A 1ZC2A 2P9VB 3VP2A 1TS7A 1U60A 4F94A 4GKUA 4EQ1A 5AJGA 1W63M 3SH8A 2J3WA 4KENB 1LI0A 1CJFA 2OV5A 1K38A 1K25A 3KSHA 4P6ZS 4YINA 3PBRA 5HW3A 4S2KA 1DP9A 5HWVA 4Z9QA 5FASA 2J3TD 5FI6A 4R3BA 1ZTUA 4EQIA 1YMSA 4PM7A 4EEUA 3V5MA 1YT4A 3PXPA 3TJZC 4Y0OA 4H6JA 3CPTA 1YLWA 3S4XA 5DTKA 2VGLM 3V3SA 4GOGA 2KLIA 3W4PA 3KO6A 4KZ7A 2R9WA 4P87A 4MLLA 1VQQA 3S7QA 1VB6A 1NY0A 4KZAA 5FEGA 3F1OB 5CEDA 3CUEA 1SKOA 3LEQA 1KDWA 3IF6A 1XJ4A 4L9GA 2Q0OA 3VV4A 3EEAA 4WMCA 4LV3A 4FOFA 4UA9A 3P01A 2XD1A 4E3MA 3N4IA 3B47A 4JXVA 5EE8A 1SDEA 3IH9A 1FILA 2V0UA 5HD5A 1EROA 4I38A 1OMEA 1NLYA 4EBNA 4CQHA 2DRWA 4ZBEA 1OTEA 4LV2A 4O01A 3IHAA 4QD4A 2EWWA 2AVXA 2K2NA 4UAAA 1N9OA 3WS2A 3HLEA 2WZZA 4LGWA 4DXBA 3C2WA 3E0YA 3A0SA 1VETB 1PWDA 3VMAA 3MZDA 3GECA 4NG2A 2JE5A 2L4RA 2HZ5A 1GA9A 1IEMA 1GHMA 3UB9A 3VP1A 3MZFA 2UV0E 3D72A 3G35A 4A5RA 3ZNYA 4G3WA 4PKYG 5GLBA 3BEBA 2JBFA 1TF1A 1Z09A 4JXSA 2OWHA 5M18A 4OQIA 4S2OA 2BG1A 3CJMA 3OCNA 5EOEA 3BYDA 2Q9MA 3WS5A 2YKHA 3UE1A 2QJ5A 1NRFA 1CK3A 5KMWA 2JHEA 4KZBA 3P7NA 1MBLA 2Y55A 1F2KA 3E4PA 2VGKA 4OPZA 4LV0A 4GD8A 5EVEA 2Y2MA 1J3WA 2PD8A 3W4QA 4XT2A 2D01A 4L9FA 4UHUA 1YLTA 5FDSA 2ZD8A 1V9YA 3VOLA 4MBFA 3GMWA 3WWXA 3RFBA 4S2NC 1CI9A 4UQIS 4YFMA 3UO9A 3UPPA 2G2UA 2NUTC 5FQ9A 4G3VA 4R38A 2C5WB 4GS9A 1ZHHB 3LR0A 4X25A 4R4RA 3GVBA 4DKIA 4RYEA 1RGYA 5DJUA 1WYBA 3MSHA 4XXRA 3FPWA 1MWRA 2J3TC 4B9OA 4EUVA 4OOLA 3LFVA 3ZNTA 4E3LA 4HY8A 2R78A 3T4QA 4MBHA 1BTLA 3MQ0A 1NYMA 5U47A 4XUXA 1PYYA 2X71A 4BENA 2HDRA 1HVBA 3QHYA 5D3OA 4LFUA 2EXBA 1MY8A 2LB5A 4OPYA 3E4OA 4ME4A 1ZKJA 4LPZA 5BOHA 2ZC7A 3MMHA 4R1GA 4GCZA 2WGWA 4QHCA 2OOLA 4H8RA 2Y2NA 4NEED 5FQIA 4L0LA 4CLCB 3O3VA 1HTZA 4P6BA 2FFFB 4KUKA 2GZAA 1HZOA 3FKWA 1Y4OA 2P9VA 3QP4A 3NCKA 3T4LA 4S2IA 3ZG5A 2Z6CA 5L10A 3H7WB 2QHKA 4WEJA 2Y2IA 3G32A 1D06A 3ZG9B 4PM5A 5A93A 2PT7A 5KSCA 3ZQ5A 4RX3A 2QZ6A 3QP1A 1PRQA 5DF8A 1GA0A 3FYZA 4WELA 1BT5A 5HD3A 4Y7PA 4GHIA 3E2KA 1PWCA 3E4QA 1K0KA 2XFSA 1L0GA 3LIEA 3LY4A 4I5SA 4MN5A 4WUJA 3N6IA 5CGWA 3TE8A 2H10A 3T1QB 3NOTC 4LENA 1S1ZA 2HDUA 1NZUA 1W7FA 2WKEA 1LSWA 3VSLA 2FFYA 3A0VA 1M40A 1QMFA 1RCJA 4QWOA 4LCLA 1L0DA 3G31A 2V2FF 1KVLA 2DMWA 4JGQA 1TDLA 3LYXA 4NXGA 3BFCA 3A3JA 2INWA 4KZ3A 3HBRA 3DTMA 4ETXA 5AQ7A 4EXOA 1RP5A 1YM1A 3R7WB 2WAEA 1T1BA 5AQ9A 2IWBA 2EX9A 5HDCA 4FD8A 4R0QA 3S7PA 1Y54A 1PNEA 2ZOHA 4K08A 3CWFA 5FATA 2Z6DA 4RX2A 1IYQA 1FR6A 3NHQA 1DRMA 2Z2MB 5FQMA 4PM9A 2A49A 4HHDA 1K57A 1N4OA 2V9AA 2B18A 2L0WA 3UMDA 3LIFA 1FIKA 2XLNA 4HJ3A 3K3CA 3MR0A 2E8JA 3NY4A 1VETA 1SKFA 2WUQA 1PFLA 3QP8A 1NJ4A 5A90A 3A3DA 4DJ2A 2JKRI 5GLDA 5L2FA 2DCFA 1Q2QA 1OPXA 4UA6A 3NULA 5EVID 3TOIA 1PI5A 4Y13A 4WL9A 1KE4A 1PW1A 5GL9A 3MFDA 3NBLA 4OP5A 2NUPC 1I2WA 4X1LA 4DF6A 2ACGA 4ETZA 1K55A 2JKFA 3PAEA 4GS9B 2XGNA 3MQQA 5J7EA 1PI4A 4NXEA 5G18A 1MKIA 4U3TA 4HJ4A 3KYZA 4PAUA 3M6HA 4JXGA 4HJ6A 4NKPA 1H8YA 3W2ZA 4Z1WA 4GNUA 1MKMA 4RVAA 1XXMA 5HAQA 2D02A 1OTAA 3HL9A 3OC2A 1CEFA 1W79A 3N8SA 1Q2PA 5F69A 1DJBA 1P9RA 3P98A 3H82A 4WBGA 1H5XA 5G4YA 3KYEA 1WYCA 4KZ6A 4GW9A 3HLGA 2PHYA 4HOIA 3SS5A 5AQAA 4K91A 4BL2A 4QJGA 1I5QA 2G7UA 3OBFA 2OAP1 2M7UA 2EX6A 4S2LA 2O99A 4B4XA 3KSGA 3RXXA 2V0WA 5JYOA 3GV9A 3KYQA 1S4SA 1BYWA 1XP4A 1Z6FA 1PW8A 3BY8A 1YSPA 4FH2A 3HUOA 3S7NA 1T1AA 1O07A 4X69A 4KQDA 3R4KA 2QPNA 2Y8HA 3SS4A 1NYYA 4OVDA 5DTSA 4KZ4A 1BUEA 2WYXA 5HWTA 2HF6A 2V8FA 2XH9A 1UWNX 4Y5FA 5HAPA 1ERQA 3EQVA 1XGJA 1FCNA 4GHIB 4HIAA 3PBNA 1GCEA 4KZ9A 4CLCA 4GDBA 1H3QA 5EM1A 3HREA 2HDQA 2JN7A 4E3IA 2VGJA 3B33A 3VOZA 4OQHA 2XFTA 4NXFA 3ZCZA 4WF0A 1PZOA 4Q8IA 3FPVA 1GSWA 4K0XA 3BECA 2HP5A 2YKFA 3H7WA 2H5SA 2PRFA 4IBRA 2W3DA 3BLMA 4MCWA 1JTGA 2I9VA 2XROA 3S1YA 4NXBA 1E3UD 1XPBA 4ZJ3A 4ARZB 1L3LA 4QY5A 1OT9A 1GHPA 5HX9A 5EFWA 1UWPX 1H8ZA 2Y2KA 3IX8A 2VV6A 2P7JA 4R23A 4DRTA 2P04A 2VX8A 1D7EA 1L0EA 4L9EA 4OOYA 3ZYTA 1FR1A 5EVIC 5C5KA 2A24A 3AGFA 3IX4A 2HJEA 3LY3A 3TW8A 3V3RA 2OSUA 5FAQA 3WS4A 3HLCA 3IXDA 2ZM8A 1G6OA 1H8MA 4CLCE 2QMIA 3U4LP 1TS0A 3LIBA 4OQ0A 2XQZA 3IF5A 4LV1A 3BM6A 2ZQAA 4D2OA 1W63Q 3CITA 3V67A 4OOMA 4DDSA 2PAVP 1S66L 3UDXA 3UE6A 4WLAA 1YPRA 4R3JA 3UB8A 5FI7A 5A8BA 2KDKA 2E8IA 4X1MA 4MN7A 4C75A 3T4SA 1XJ6A 5MC7A 3R7WA 3T12B 2XEPA 4DE2A 2L1MA 4PHTA 2VGLS 3A3EA 1ERMA 2W3FA 5EECA 1W8QA 3GQZA 4JGPA 1ONGA 2X02A 1N9BA 5JYPA 2V8CA 3E98A 3UE0A 5E43A 1UGUA 1MXOA 4IUKA 2WGIA 5TBMB 5DJTA 1CI8A 3DBAA 2ZQ7A 2PYPA 4OONA 2R9XA 4WZ5C 3T50A 4JPMA 1SCWA 1JWZA 3NOUC 3ZVWA 3UB6A 2QKPA 4EESA 5TGFA 4DE0A 4QU3A 1NZOA 3T4OA 2W3HA 5CHJA 5HWWA 3C4PA 3OPLA 3PAGA 3PHYA 2XR0A 1TEMA 2ZBBA 3MKEA 4OQGA 1IFQA 3BFGA 4NK3A 2Y2HA 3H82B 2W1RA 4EERA 5FSRA 4GN2A 3PBTA 3OLOA 1IKGA 5EUAA 3GDIA 1FQGA 3DTIA 5KZHA 3T4TA 4Q0IA 4KZ5A 2PBYA 4EV4A 4IBXA 3JVVA 2IWDA 4R70A 3UY6A 5CTMA 3QP2A 3MFXA 4CLCD 2Q9NA 1P0ZA 3DWZA 3AGDA 3JYIA 2PBDP 3VFHA 1IYSA 3O88A 3KSFA 3T4JA 1J9MA 3MF0A 1OJGA 1TVFA 3Q7VB 4KG6A 2B02A 2W1TA 2VV7A 4GJ4A 2VEAA 2XA7M 3WS0A 1F9IA 1ES3A 3SH7A 3HJIA 2HDSA 2B95A 2C6WB 3LGOA 3T1XA 5FAPA 5L8MA 5HDSA 1LI9A 4KUOA 1JWPA 2KX6A 3PTEA 3MKFA 4ZRRA 2JKTI 3MXSA 4PM6A 4WMCD 2VA0A 3GTCA 5HARA 3SZTA 5HPIA 2Y91A 5GHYA 4BBTA 1G6AA 2KOIA 3M2JA 1EW0A 3QNCA 1KE0A 1PWGA 1L2SA 3RXWA 3ITBA 1K56A 5HSQA 3LO7A 4C3QA 2WKRA 3NDEA 3VP3A 2VJWA 3F1NB 5TR7A 2ZM0A 1IKIA 5TJJA 2CMNA 4LLOB 3GR2A 5FDHA 3LIAA 4QY6A 2W3GA 2OWJA 1VEUA 2PU2A 5J8XA 3DTKA 4N1XA 1XA7A 3O86A 4S2MA 4OPQA 4JF5A 1YMXA 4I39A 2WKIA 3C4OA 3IS2B 3G6OA 1KDSA 4JKTA 1KGFA 4QB8A 1G68A 4LRYC 5EPHA 4KZ8A 3RH8B 3UPNA 2BASA 1MZUA 2EX8A 1BZAA 5J3WA 3C38A 4IJGA 1FSWA 3IX3A 4HP4A 5L07A 3IXGA 3CAXA 4K0WA 3G4PA 1E25A 1WA9A 4HP9A 2XA7S 1C3BA 2A24B 5DTTA 4EUZA 5CHMA 2FZ0A 3N8LA 2HPBA 4E3NA 1LHYA 1LSXA 3L9KA 1JWVA 1RGZA 4DN0A 4MN6A 3ZVTA 4JGRA 2QJ7A 1EI5A 4ARZA 4KG5A 3NJAA 5GLAA 4EBPA 3N8RA 4KG2A 3A3FA 1K6RA 4R3AA 5CEBA 4HEFA 3AGEA 5E2FA 4KQRA 3N7WA 1QMEA 4S2NA 3HLBA 3LUQA 2WKPA 2O9AA 4KQOA 2O9BA 3QP5A 2PU4A 3B42A 2ZMAA 3SH9A 1O7EA 1S6RA 4M4XA 3BQ8A 3O5YA 5AVFA 4ID4A 3CZDA 5F82A 4OPRA 4HI4A 4I3JA 1KGEA 3WRTA 4DMZA 2PR6A 2PDRA 3TRCA 5KIZA 4UA7A 4FCFA 3UDFA 4CLCC 4EU0A 3LI9A 3S7OA 1KVMA 1YLPA 3EQUA 1MC0A 2O9CA 3Q7ZA 2CC1A 1KOUA 3MXQA 4ZJ1A 3IWOA 1VHMA 1ES4A 2UWXA 3MBZA 4OLDA 4EW7A 5AQBA 2VZWA 2ZJ9A 1N9LA 2VKSA 4HH2A 2VV8A 5CGXA 4GLQA 2Y2OA 4I3IA 1ESIA 3CUEC 3QNBA 5I5LA 1PZPA 3CG5A 2WK0A 3HLFA 3C5AA 3IF6C 1KE3A 3F1PB 3FKVA 1L0FA 5TBMA 3EEHA 3GSGA 1FSYA 5DKLA 4GD6A 5A91A 5IU1A 3H9WA 1NXYA 5CERA 3OPRA 4BD0A 4Y0TA 2EXAA 1XKZA 1DP6A 4JF4A 1K56D 3O87A 5E2HA 4EBLA 1YSQA 3DTEA 2W1TB 1FOFA 1LL9A 2FH5A 2JCHA 3IWIA 3CI6A 1XJ2A 4P6ZM 3PBOA 1OTDA 1HLUP 5IS1A 3CLOA 2K31A 3IH8A 3D3OA 4IHQA 3LCEA 1E4DA 2W3EA 3SW1A 4II7A 4G3KA 2ZC5B 1BLCA 2Z2LB 5A92A 2Y2QA 2ZQ8A 5DF7A 1TS6A 1N9NA 1K4EA 2MJ6A 2BLSA 2H0YA 3I7JA 4E3JA 3Q7VA 3OPHA 2DNSA 3BFEA 4YOFA 4FH4A 5HL1A 3ITAA 2V1ZA 3IQAA 4LCMA 5IHVA 2WADA 2WGVA 4N1HA 3A0RA 5AVEA 3OCLA 2EFUA 2ZQCA 5K5BA 3W4OA 2BTFP 1VEUB 3LR4A 3ICYA 4FTXA 1LSVA 2LB9A 1EWZA 3LI8A 2HJ9C 2ZL1A 4R6LA 3ZG0A 3LIDA 2ZLYA 3ZFZA 4X68A 3EGDC 2GDNA 5HL6A 5F6AA 4O0PA 2P74A 2JKGA 1I2SA 1GHIA 3VSKA 2XSSA 5F1FA 4HBTA 1HD8A 4X53A 3VP0A 1X0OA 4LRXC 4E3KA 3TG9A 1IELA 2A3UA 1NLZA 2XF3A 1D1JA 2EWVA 2H0TA 3F1NA 4I3AA 3GRJA 5DF9A 1MWSA 5FL3A 3C7UA 2ZOIA 3DWKA 1BLSA 3G2ZA 2HGVA 5F1GA 4IUHA 1K4FA 3HCYA 1K54A 4U0TA 2QWSA 3BWLA 4RA7A 4GB7A 5DKKA 2XDMA 4U0XA 3HLDA 3Q81A 3NC8A 4CPKA 3IS2A 5LBRA 2J7VA 3PYPA 3G34A 3NECA 4MBKA 3MQOA 2B5RA 4ZTKA 3C7VA 5F83A 4PKYA 2ZQ9A 5GLCA 4F3LB 1IOUA 3UE3A 2EX2A 3LICA 4R4SA 4EEPA 2JC7A 5FQKA 1IYPA 4WN5A 4ESPA 5E2EA 5HFOA 3D9YA 3FC7A 1ALQA 3MXRA 5TFQA 3NDGA 3QP6A 1GSVA 4OLGA 1JNUA 2RL3A 4DE1A 4YNRA 4PM8A 4UQIM 5J4EA 1V9ZA 3IXHA 1TS8A 1DJAA 4EWFA 3OPPA 1BULA 4BLMA 3G2YA 3BFDA 3RJUA 3BJNA 2EA9A 1S0WA 3C8CA 2PD7A 5FA7A 1AWIA 1NRJA 3UPOA 4Y3IA 2JKRM 3EGXC 1G28A 4OH0A 2Y4AA 4QPRA 5FAOA 3UN7A 1BLHA 2Y2GA 5E2GA 3BW6A 4HH3A 2WKQA 1DY6A 1S67L 4PPRA 3IT9A 4BQMA 5CRFA 1SZVA 3VE4A 4JBFA 5F68A 3IHBA 2V20A 5I94A 2I72A 4DXCA 3UB5P 4DDYA 1LL8A 4ZDXA 1F98A 2WAFA 5EOOA 1STZA 1DJCA 4JXWA 5FI2A 2V1AA 1KGGA 2HP6A 4IEDA 4X6TA 1F5MA 1MWUA 3T1SA 2G2WA 1ODVA 2W27A 4CJNA 1ES2A 1WE4A 3F1PA 2J80A 1GSXA 3IWQA 4IVKA 3JVUA 3T4KA 1BSGA 3VE3A 3P09A 1SDNA 4XUZA 3D4FA 1S4RA 3NOPC 2OLUA 3BQAA 1G5UA 4OKPA 5HAIA 3VFFA 3K2NA 3DW0A 4BWIA 1OTIA 2Y2LA 3MJQA 3CHWP 3UB7A 2VK3A 4Y2FA 1K57C 4NETA 1M6KA 3ZHHA 4E3OA 4WEKA 2ZL1B 4HQAA 5M1AA 2VLGA 1AXBA 4JF6A 4B88A 1YLZA 2PR5A 3K3DA 1ES5A 3BFFA 4MNRA 2X01A 3T1RA 1K6SA 2IA2A 3BLSA 3NI9A 5EVIA 1XGIA
chains in the Genus database with same CATH topology
1NYYA 3MZDA 2JE5A 3HVFA 4OVDA 3WS1A 1GA9A 4UA7A 5DTSA 3G30A 1IEMA 4FCFA 3UDFA 1YQSA 4KZ4A 1BUEA 1GHMA 3VP1A 5FQQA 2WYXA 3MZFA 3PBQA 4P0MA 4BJPA 3G35A 1KVMA 2OLVA 1SHVA 1YLPA 3EQUA 2XH9A 5EVLA 2XK1A 3FWLA 4A5RA 5HAPA 3NIAA 3ZNYA 1ERQA 3HUMA 3Q7ZA 3EQVA 3MZEA 1K55C 4M3KA 2CC1A 4BD1A 1XGJA 5GLBA 1FCNA 1ONHA 3FV7A 3BEBA 4ZJ1A 2JBFA 3IWOA 4JXSA 1YLJA 3PBNA 5M18A 4OQIA 4E6WA 1ES4A 2UWXA 3MBZA 4OLDA 1GCEA 1XX2A 4S2OA 2BG1A 2ZC3B 1VM1A 3CJMA 3OCNA 5AQBA 2ZJ9A 5EOEA 3BYDA 4KZ9A 2Q9MA 3WS5A 4GDBA 3UE1A 2EFXA 3HREA 2HDQA 5CGXA 1NRFA 2Y2OA 5CTNA 1CK3A 2VGJA 2ZQDA 4E3IA 3UNWA 5KMWA 3S22A 3VOZA 4KZBA 4OQHA 5FQJA 5CXWA 1ESIA 2XFTA 3ZCZA 3QNBA 1ESUA 1MBLA 1PZPA 2WK0A 3CG5A 3HLFA 3C5AA 3IF6C 2Y55A 1PZOA 1KE3A 2VGKA 4Q8IA 3FKVA 1L0FA 4Y0UA 4OPZA 4LV0A 3GSGA 4GD8A 1FSYA 4K0XA 3IF6B 3BECA 2HP5A 2Y2MA 4GD6A 5A91A 5CERA 1NXYA 4BD0A 3OPRA 4IVIA 2H5SA 4IBRA 3BLMA 4Y0TA 2EXAA 1XKZA 3W4QA 1JTGA 4JF4A 3S1YA 1K56D 1E3UD 3O87A 1XPBA 1YLTA 4P85A 4UHUA 2ZD8A 5E2HA 4ZJ3A 4EBLA 4QY5A 3TSGA 4MBFA 1FOFA 1LL9A 2JCHA 3GMWA 4WZ5A 2WZXA 1XA1A 3WWXA 4S2NC 1GHPA 1CI9A 4YFMA 5HX9A 3UO9A 3ZGAB 3IWIA 1H8ZA 3UPPA 2G2UA 3PBOA 2Y2KA 4WYYA 5FQ9A 2ZC4B 2C5WB 4R23A 4DRTA 4ZJ2A 4MEZA 1L0EA 3GVBA 4R4RA 4OOYA 4DKIA 4RYEA 1RGYA 3OZHA 1FR1A 1WYBA 1IYOA 3IH8A 4XXRA 4HESA 3LCEA 5EVIC 1MWRA 5DVAA 1E4DA 3AGFA 3WRZA 4OOLA 3M6BA 3LY3A 3V3RA 2OSUA 3ZNTA 4E3LA 5FAQA 2J9OA 2ZC5B 3WS4A 3HLCA 3IXDA 2ZM8A 4MBHA 1BLCA 2Z2LB 4DE3A 1BTLA 5A92A 2Y2QA 2QMIA 4N9LA 1ZG4A 2ZQ8A 5DF7A 1NYMA 5U47A 3IXBA 4C6YA 4OQ0A 4XUXA 1PYYA 4S2JA 1K4EA 2X71A 2XQZA 4BENA 2BLSA 2H0YA 1HVBA 2HDRA 3I7JA 3IF5A 4E3JA 4LV1A 3BM6A 3QHYA 5D3OA 3Q7VA 4OP8A 3OPHA 2DNSA 2ZQAA 4D2OA 3BFEA 3ISGA 4FH4A 2EXBA 5HL1A 1MY8A 2IWCA 3ITAA 2V1ZA 3IQAA 4LCMA 4OOMA 5IHVA 4OPYA 4DDSA 2WADA 4S2PA 1LLBA 2WGVA 4N1HA 3UDXA 1ZKJA 5BOHA 2ZC7A 2EFUA 3OCLA 2ZQCA 4R3JA 4R1GA 2WGWA 4QHCA 5FI7A 3W4OA 2E8IA 4H8RA 4C75A 1EWZA 4E6XA 2Y2NA 3SOIA 3B3XA 4L0LA 5FQIA 2XEPA 3O3VA 3ZG0A 1HTZA 2ZLYA 2J8YA 4DE2A 3ZFZA 3A3EA 4X68A 1ERMA 2GDNA 5M19A 3HUNA 5GHXA 4P6BA 5EECA 1W8QA 2FFFB 3GQZA 1BLPA 5CHUA 1E3UA 2P74A 4PMAA 1ONGA 2X02A 1N9BA 5JYPA 3UE0A 1HZOA 3FKWA 3VOYA 1W5DA 5E43A 1I2SA 1MXOA 1GHIA 3VSKA 2WGIA 3A3IA 5F1FA 4HBTA 1HD8A 4X53A 2P9VA 1K54C 3NCKA 3VP0A 1CI8A 1LL5A 4S2IA 3ZG5A 4B4ZA 4E3KA 4WEJA 5GHZA 3TG9A 1IELA 2A3UA 2Y2IA 2ZQ7A 3G32A 5KSHA 4OONA 2XF3A 1FCMA 2R9XA 4WZ5C 3ZDJA 4JPMA 3ZG9B 3PBSA 4PM5A 1SCWA 5A93A 5KSCA 1JWZA 3ZVWA 4RX3A 4X55A 2QZ6A 2H0TA 5DF8A 3HLWA 1GA0A 3UDIA 3GRJA 1TDGA 5TGFA 3WRTA 5DF9A 4DE0A 3FYZA 4JLFA 4QU3A 3ZG8B 1MWSA 4WELA 1BT5A 1NZOA 3C7UA 3DWKA 5CHJA 4X56A 4Y7PA 1BLSA 3G2ZA 5F1GA 3C4PA 3E2KA 3OPLA 3PAGA 1PWCA 1K4FA 1K54A 2XR0A 3BRMA 4U0TA 1W8YA 1JVJA 1TEMA 3MKEA 4OQGA 2J9PA 2XFSA 3BFGA 4NK3A 4RA7A 1L0GA 2Y2HA 3V50A 3CMZA 4GB7A 3LY4A 4ZAMA 2XDMA 1PIOA 4U0XA 5FSRA 4GN2A 1CEGA 3HLDA 3PBTA 2Y2PA 3SS3A 3Q81A 3NC8A 3N6IA 1IKGA 5EUAA 4CPKA 5CGWA 4WM9A 1FQGA 2H10A 4LENA 1YLYA 3LEZA 2J7VA 5KZHA 3Q07A 2HP9A 2HDUA 1NZUA 1W7FA 3G34A 2PBYA 4KZ5A 4WZ4A 1MWTA 1FCOA 2WKEA 4EV4A 3VSLA 4IBXA 2Y59A 4MBKA 2IWDA 2B5RA 5CGSA 4ZTKA 3UY6A 3C7VA 2FFYA 4N9KA 5CTMA 1M40A 1QMFA 5F83A 2Q9NA 2ZQ9A 5CECA 3DWZA 3AGDA 3JYIA 5GLCA 1RCJA 3UE3A 3VFHA 1IYSA 2EX2A 3V39A 3O88A 4R4SA 1MPLA 3VP4A 2WKHA 2Y2JA 4LCLA 3E2LA 2JC7A 1L0DA 1J9MA 3G31A 3ZG7B 2V2FF 5FQKA 1KVLA 4GDNA 1IYPA 1TVFA 3Q7VB 4KG6A 4KQQA 5EVIB 5E2EA 1TDLA 2ZM2A 1JTDA 5HFOA 2XD5A 1ALQA 3BFCA 3MXRA 5TFQA 3NDGA 3WS0A 1ZG6A 3A3JA 4KZ3A 1ES3A 3HBRA 2WGWB 3DTMA 2HDSA 4GZBA 4OLGA 3SH7A 4FSFA 2RL3A 4DE1A 5AQ7A 1RP5A 2ZC6B 3FZCA 4PM8A 1YM1A 3Q82A 2C6WB 2WAEA 5FAPA 5AQ9A 2IWBA 4BL3A 2EX9A 3IXHA 1LI9A 4FD8A 3Q1FA 1JWPA 4R0QA 3PTEA 1DJAA 3MKFA 1Y54A 3MXSA 4EWFA 4PM6A 3OPPA 4WMCD 3GTCA 5HARA 1BULA 4BLMA 4HBUA 3G2YA 5FATA 2Y91A 3BFDA 4RX2A 2RCXA 3M2KA 1IYQA 5GHYA 1FR6A 4N92A 1G6AA 3RJUA 3W8KA 4O7DA 2Z2MB 1S0WA 3M2JA 5FQMA 4PM9A 3QNCA 2A49A 1KE0A 1ZC2A 5FA7A 3UPOA 1K57A 1PWGA 2P9VB 1N4OA 1L2SA 3VP2A 3RXWA 3ITBA 1K56A 3LO7A 1U60A 2XLNA 4OH0A 4C3QA 4F94A 4GKUA 3NY4A 2Y4AA 3NDEA 3VP3A 1SKFA 5FAOA 3UN7A 2WUQA 1BLHA 2Y2GA 5E2GA 5TR7A 2ZM0A 1IKIA 1NJ4A 3SH8A 4KENB 1LI0A 5A90A 3GR2A 5FDHA 1DY6A 2OV5A 1K38A 1K25A 4QY6A 3A3DA 4PPRA 4YINA 2PU2A 3IT9A 3PBRA 4BQMA 5HW3A 5CRFA 5J8XA 4S2KA 5GLDA 4N1XA 5L2FA 2DCFA 1Q2QA 1XA7A 4JBFA 3O86A 4S2MA 4Z9QA 4UA6A 5FASA 4OPQA 4JF5A 1YMXA 5EVID 3IHBA 2WKIA 2V20A 3TOIA 1PI5A 5I94A 2I72A 5FI6A 4R3BA 1KE4A 1PW1A 4DXCA 4EQIA 3C4OA 5GL9A 3MFDA 3NBLA 4DDYA 1YMSA 4OP5A 4PM7A 1KDSA 4JKTA 1I2WA 2WAFA 1KGFA 1YT4A 1G68A 4QB8A 5EOOA 4Y0OA 5EPHA 3V5MA 4DF6A 1K55A 3PAEA 4KZ8A 2XGNA 1DJCA 3UPNA 4JXWA 1YLWA 3S4XA 5FI2A 1KGGA 2EX8A 2HP6A 1BZAA 5DTKA 1PI4A 4IEDA 4X6TA 3V3SA 1FSWA 4GOGA 5G18A 3IXGA 1MKIA 1MWUA 3W4PA 4K0WA 4U3TA 3G4PA 1E25A 4KZ7A 2G2WA 1C3BA 4CJNA 5DTTA 2R9WA 4P87A 4EUZA 1ES2A 1VQQA 3M6HA 4JXGA 4MLLA 5CHMA 1NY0A 1WE4A 1H8YA 2HPBA 3N8LA 4KZAA 4E3NA 5CEDA 4GNUA 1LHYA 3IWQA 4RVAA 1KDWA 1XXMA 3IF6A 4IVKA 5HAQA 1BSGA 1JWVA 3HL9A 3P09A 1RGZA 1SDNA 3OC2A 1CEFA 3D4FA 1W79A 3N8SA 1Q2PA 4XUZA 4WMCA 2OLUA 1DJBA 3ZVTA 4LV3A 4OKPA 1EI5A 4UA9A 3P98A 5HAIA 4KG5A 2XD1A 4WBGA 3VFFA 1H5XA 3N4IA 4E3MA 5GLAA 1WYCA 4EBPA 4KZ6A 3DW0A 3HLGA 3N8RA 4KG2A 4JXVA 3SS5A 3A3FA 5EE8A 5AQAA 1SDEA 3IH9A 1K6RA 2Y2LA 4K91A 4BL2A 5CEBA 4HEFA 4QJGA 3AGEA 5E2FA 1EROA 1I5QA 4KQRA 3N7WA 1OMEA 1QMEA 1K57C 4NETA 3HLBA 4S2NA 1M6KA 3ZHHA 4E3OA 2EX6A 4S2LA 4EBNA 4KQOA 4WEKA 2DRWA 4B4XA 4ZBEA 4LV2A 5M1AA 3IHAA 3RXXA 1AXBA 4ZDXA 4QD4A 5JYOA 3GV9A 4JF6A 2PU4A 4B88A 1YLZA 1XP4A 1Z6FA 4UAAA 2ZMAA 1ES5A 1PW8A 3SH9A 3WS2A 4FH2A 3BFFA 3HUOA 3HLEA 2WZZA 1O7EA 4MNRA 4DXBA 2X01A 1S6RA 1O07A 4X69A 1K6SA 4ID4A 2QPNA 3CZDA 5F82A 3BLSA 3NI9A 5EVIA 4OPRA 1PWDA 1XGIA 1KGEA 3VMAA 3SS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NYY A;  3MZD A;  2JE5 A;  3HVF A;  4OVD A;  3WS1 A;  1GA9 A;  4UA7 A;  5DTS A;  3G30 A;  1IEM A;  4FCF A;  3UDF A;  1YQS A;  4KZ4 A;  1BUE A;  1GHM A;  3VP1 A;  5FQQ A;  2WYX A;  3MZF A;  3PBQ A;  4P0M A;  4BJP A;  3G35 A;  1KVM A;  2OLV A;  1SHV A;  1YLP A;  3EQU A;  2XH9 A;  5EVL A;  2XK1 A;  3FWL A;  4A5R A;  5HAP A;  3NIA A;  3ZNY A;  1ERQ A;  3HUM A;  3Q7Z A;  3EQV A;  3MZE A;  1K55 C;  4M3K A;  2CC1 A;  4BD1 A;  1XGJ A;  5GLB A;  1FCN A;  1ONH A;  3FV7 A;  3BEB A;  4ZJ1 A;  2JBF A;  3IWO A;  4JXS A;  1YLJ A;  3PBN A;  5M18 A;  4OQI A;  4E6W A;  1ES4 A;  2UWX A;  3MBZ A;  4OLD A;  1GCE A;  1XX2 A;  4S2O A;  2BG1 A;  2ZC3 B;  1VM1 A;  3CJM A;  3OCN A;  5AQB A;  2ZJ9 A;  5EOE A;  3BYD A;  4KZ9 A;  2Q9M A;  3WS5 A;  4GDB A;  3UE1 A;  2EFX A;  3HRE A;  2HDQ A;  5CGX A;  1NRF A;  2Y2O A;  5CTN A;  1CK3 A;  2VGJ A;  2ZQD A;  4E3I A;  3UNW A;  5KMW A;  3S22 A;  3VOZ A;  4KZB A;  4OQH A;  5FQJ A;  5CXW A;  1ESI A;  2XFT A;  3ZCZ A;  3QNB A;  1ESU A;  1MBL A;  1PZP A;  2WK0 A;  3CG5 A;  3HLF A;  3C5A A;  3IF6 C;  2Y55 A;  1PZO A;  1KE3 A;  2VGK A;  4Q8I A;  3FKV A;  1L0F A;  4Y0U A;  4OPZ A;  4LV0 A;  3GSG A;  4GD8 A;  1FSY A;  4K0X A;  3IF6 B;  3BEC A;  2HP5 A;  2Y2M A;  4GD6 A;  5A91 A;  5CER A;  1NXY A;  4BD0 A;  3OPR A;  4IVI A;  2H5S A;  4IBR A;  3BLM A;  4Y0T A;  2EXA A;  1XKZ A;  3W4Q A;  1JTG A;  4JF4 A;  3S1Y A;  1K56 D;  1E3U D;  3O87 A;  1XPB A;  1YLT A;  4P85 A;  4UHU A;  2ZD8 A;  5E2H A;  4ZJ3 A;  4EBL A;  4QY5 A;  3TSG A;  4MBF A;  1FOF A;  1LL9 A;  2JCH A;  3GMW A;  4WZ5 A;  2WZX A;  1XA1 A;  3WWX A;  4S2N C;  1GHP A;  1CI9 A;  4YFM A;  5HX9 A;  3UO9 A;  3ZGA B;  3IWI A;  1H8Z A;  3UPP A;  2G2U A;  3PBO A;  2Y2K A;  4WYY A;  5FQ9 A;  2ZC4 B;  2C5W B;  4R23 A;  4DRT A;  4ZJ2 A;  4MEZ A;  1L0E A;  3GVB A;  4R4R A;  4OOY A;  4DKI A;  4RYE A;  1RGY A;  3OZH A;  1FR1 A;  1WYB A;  1IYO A;  3IH8 A;  4XXR A;  4HES A;  3LCE A;  5EVI C;  1MWR A;  5DVA A;  1E4D A;  3AGF A;  3WRZ A;  4OOL A;  3M6B A;  3LY3 A;  3V3R A;  2OSU A;  3ZNT A;  4E3L A;  5FAQ A;  2J9O A;  2ZC5 B;  3WS4 A;  3HLC A;  3IXD A;  2ZM8 A;  4MBH A;  1BLC A;  2Z2L B;  4DE3 A;  1BTL A;  5A92 A;  2Y2Q A;  2QMI A;  4N9L A;  1ZG4 A;  2ZQ8 A;  5DF7 A;  1NYM A;  5U47 A;  3IXB A;  4C6Y A;  4OQ0 A;  4XUX A;  1PYY A;  4S2J A;  1K4E A;  2X71 A;  2XQZ A;  4BEN A;  2BLS A;  2H0Y A;  1HVB A;  2HDR A;  3I7J A;  3IF5 A;  4E3J A;  4LV1 A;  3BM6 A;  3QHY A;  5D3O A;  3Q7V A;  4OP8 A;  3OPH A;  2DNS A;  2ZQA A;  4D2O A;  3BFE A;  3ISG A;  4FH4 A;  2EXB A;  5HL1 A;  1MY8 A;  2IWC A;  3ITA A;  2V1Z A;  3IQA A;  4LCM A;  4OOM A;  5IHV A;  4OPY A;  4DDS A;  2WAD A;  4S2P A;  1LLB A;  2WGV A;  4N1H A;  3UDX A;  1ZKJ A;  5BOH A;  2ZC7 A;  2EFU A;  3OCL A;  2ZQC A;  4R3J A;  4R1G A;  2WGW A;  4QHC A;  5FI7 A;  3W4O A;  2E8I A;  4H8R A;  4C75 A;  1EWZ A;  4E6X A;  2Y2N A;  3SOI A;  3B3X A;  4L0L A;  5FQI A;  2XEP A;  3O3V A;  3ZG0 A;  1HTZ A;  2ZLY A;  2J8Y A;  4DE2 A;  3ZFZ A;  3A3E A;  4X68 A;  1ERM A;  2GDN A;  5M19 A;  3HUN A;  5GHX A;  4P6B A;  5EEC A;  1W8Q A;  2FFF B;  3GQZ A;  1BLP A;  5CHU A;  1E3U A;  2P74 A;  4PMA A;  1ONG A;  2X02 A;  1N9B A;  5JYP A;  3UE0 A;  1HZO A;  3FKW A;  3VOY A;  1W5D A;  5E43 A;  1I2S A;  1MXO A;  1GHI A;  3VSK A;  2WGI A;  3A3I A;  5F1F A;  4HBT A;  1HD8 A;  4X53 A;  2P9V A;  1K54 C;  3NCK A;  3VP0 A;  1CI8 A;  1LL5 A;  4S2I A;  3ZG5 A;  4B4Z A;  4E3K A;  4WEJ A;  5GHZ A;  3TG9 A;  1IEL A;  2A3U A;  2Y2I A;  2ZQ7 A;  3G32 A;  5KSH A;  4OON A;  2XF3 A;  1FCM A;  2R9X A;  4WZ5 C;  3ZDJ A;  4JPM A;  3ZG9 B;  3PBS A;  4PM5 A;  1SCW A;  5A93 A;  5KSC A;  1JWZ A;  3ZVW A;  4RX3 A;  4X55 A;  2QZ6 A;  2H0T A;  5DF8 A;  3HLW A;  1GA0 A;  3UDI A;  3GRJ A;  1TDG A;  5TGF A;  3WRT A;  5DF9 A;  4DE0 A;  3FYZ A;  4JLF A;  4QU3 A;  3ZG8 B;  1MWS A;  4WEL A;  1BT5 A;  1NZO A;  3C7U A;  3DWK A;  5CHJ A;  4X56 A;  4Y7P A;  1BLS A;  3G2Z A;  5F1G A;  3C4P A;  3E2K A;  3OPL A;  3PAG A;  1PWC A;  1K4F A;  1K54 A;  2XR0 A;  3BRM A;  4U0T A;  1W8Y A;  1JVJ A;  1TEM A;  3MKE A;  4OQG A;  2J9P A;  2XFS A;  3BFG A;  4NK3 A;  4RA7 A;  1L0G A;  2Y2H A;  3V50 A;  3CMZ A;  4GB7 A;  3LY4 A;  4ZAM A;  2XDM A;  1PIO A;  4U0X A;  5FSR A;  4GN2 A;  1CEG A;  3HLD A;  3PBT A;  2Y2P A;  3SS3 A;  3Q81 A;  3NC8 A;  3N6I A;  1IKG A;  5EUA A;  4CPK A;  5CGW A;  4WM9 A;  1FQG A;  2H10 A;  4LEN A;  1YLY A;  3LEZ A;  2J7V A;  5KZH A;  3Q07 A;  2HP9 A;  2HDU A;  1NZU A;  1W7F A;  3G34 A;  2PBY A;  4KZ5 A;  4WZ4 A;  1MWT A;  1FCO A;  2WKE A;  4EV4 A;  3VSL A;  4IBX A;  2Y59 A;  4MBK A;  2IWD A;  2B5R A;  5CGS A;  4ZTK A;  3UY6 A;  3C7V A;  2FFY A;  4N9K A;  5CTM A;  1M40 A;  1QMF A;  5F83 A;  2Q9N A;  2ZQ9 A;  5CEC A;  3DWZ A;  3AGD A;  3JYI A;  5GLC A;  1RCJ A;  3UE3 A;  3VFH A;  1IYS A;  2EX2 A;  3V39 A;  3O88 A;  4R4S A;  1MPL A;  3VP4 A;  2WKH A;  2Y2J A;  4LCL A;  3E2L A;  2JC7 A;  1L0D A;  1J9M A;  3G31 A;  3ZG7 B;  2V2F F;  5FQK A;  1KVL A;  4GDN A;  1IYP A;  1TVF A;  3Q7V B;  4KG6 A;  4KQQ A;  5EVI B;  5E2E A;  1TDL A;  2ZM2 A;  1JTD A;  5HFO A;  2XD5 A;  1ALQ A;  3BFC A;  3MXR A;  5TFQ A;  3NDG A;  3WS0 A;  1ZG6 A;  3A3J A;  4KZ3 A;  1ES3 A;  3HBR A;  2WGW B;  3DTM A;  2HDS A;  4GZB A;  4OLG A;  3SH7 A;  4FSF A;  2RL3 A;  4DE1 A;  5AQ7 A;  1RP5 A;  2ZC6 B;  3FZC A;  4PM8 A;  1YM1 A;  3Q82 A;  2C6W B;  2WAE A;  5FAP A;  5AQ9 A;  2IWB A;  4BL3 A;  2EX9 A;  3IXH A;  1LI9 A;  4FD8 A;  3Q1F A;  1JWP A;  4R0Q A;  3PTE A;  1DJA A;  3MKF A;  1Y54 A;  3MXS A;  4EWF A;  4PM6 A;  3OPP A;  4WMC D;  3GTC A;  5HAR A;  1BUL A;  4BLM A;  4HBU A;  3G2Y A;  5FAT A;  2Y91 A;  3BFD A;  4RX2 A;  2RCX A;  3M2K A;  1IYQ A;  5GHY A;  1FR6 A;  4N92 A;  1G6A A;  3RJU A;  3W8K A;  4O7D A;  2Z2M B;  1S0W A;  3M2J A;  5FQM A;  4PM9 A;  3QNC A;  2A49 A;  1KE0 A;  1ZC2 A;  5FA7 A;  3UPO A;  1K57 A;  1PWG A;  2P9V B;  1N4O A;  1L2S A;  3VP2 A;  3RXW A;  3ITB A;  1K56 A;  3LO7 A;  1U60 A;  2XLN A;  4OH0 A;  4C3Q A;  4F94 A;  4GKU A;  3NY4 A;  2Y4A A;  3NDE A;  3VP3 A;  1SKF A;  5FAO A;  3UN7 A;  2WUQ A;  1BLH A;  2Y2G A;  5E2G A;  5TR7 A;  2ZM0 A;  1IKI A;  1NJ4 A;  3SH8 A;  4KEN B;  1LI0 A;  5A90 A;  3GR2 A;  5FDH A;  1DY6 A;  2OV5 A;  1K38 A;  1K25 A;  4QY6 A;  3A3D A;  4PPR A;  4YIN A;  2PU2 A;  3IT9 A;  3PBR A;  4BQM A;  5HW3 A;  5CRF A;  5J8X A;  4S2K A;  5GLD A;  4N1X A;  5L2F A;  2DCF A;  1Q2Q A;  1XA7 A;  4JBF A;  3O86 A;  4S2M A;  4Z9Q A;  4UA6 A;  5FAS A;  4OPQ A;  4JF5 A;  1YMX A;  5EVI D;  3IHB A;  2WKI A;  2V20 A;  3TOI A;  1PI5 A;  5I94 A;  2I72 A;  5FI6 A;  4R3B A;  1KE4 A;  1PW1 A;  4DXC A;  4EQI A;  3C4O A;  5GL9 A;  3MFD A;  3NBL A;  4DDY A;  1YMS A;  4OP5 A;  4PM7 A;  1KDS A;  4JKT A;  1I2W A;  2WAF A;  1KGF A;  1YT4 A;  1G68 A;  4QB8 A;  5EOO A;  4Y0O A;  5EPH A;  3V5M A;  4DF6 A;  1K55 A;  3PAE A;  4KZ8 A;  2XGN A;  1DJC A;  3UPN A;  4JXW A;  1YLW A;  3S4X A;  5FI2 A;  1KGG A;  2EX8 A;  2HP6 A;  1BZA A;  5DTK A;  1PI4 A;  4IED A;  4X6T A;  3V3S A;  1FSW A;  4GOG A;  5G18 A;  3IXG A;  1MKI A;  1MWU A;  3W4P A;  4K0W A;  4U3T A;  3G4P A;  1E25 A;  4KZ7 A;  2G2W A;  1C3B A;  4CJN A;  5DTT A;  2R9W A;  4P87 A;  4EUZ A;  1ES2 A;  1VQQ A;  3M6H A;  4JXG A;  4MLL A;  5CHM A;  1NY0 A;  1WE4 A;  1H8Y A;  2HPB A;  3N8L A;  4KZA A;  4E3N A;  5CED A;  4GNU A;  1LHY A;  3IWQ A;  4RVA A;  1KDW A;  1XXM A;  3IF6 A;  4IVK A;  5HAQ A;  1BSG A;  1JWV A;  3HL9 A;  3P09 A;  1RGZ A;  1SDN A;  3OC2 A;  1CEF A;  3D4F A;  1W79 A;  3N8S A;  1Q2P A;  4XUZ A;  4WMC A;  2OLU A;  1DJB A;  3ZVT A;  4LV3 A;  4OKP A;  1EI5 A;  4UA9 A;  3P98 A;  5HAI A;  4KG5 A;  2XD1 A;  4WBG A;  3VFF A;  1H5X A;  3N4I A;  4E3M A;  5GLA A;  1WYC A;  4EBP A;  4KZ6 A;  3DW0 A;  3HLG A;  3N8R A;  4KG2 A;  4JXV A;  3SS5 A;  3A3F A;  5EE8 A;  5AQA A;  1SDE A;  3IH9 A;  1K6R A;  2Y2L A;  4K91 A;  4BL2 A;  5CEB A;  4HEF A;  4QJG A;  3AGE A;  5E2F A;  1ERO A;  1I5Q A;  4KQR A;  3N7W A;  1OME A;  1QME A;  1K57 C;  4NET A;  3HLB A;  4S2N A;  1M6K A;  3ZHH A;  4E3O A;  2EX6 A;  4S2L A;  4EBN A;  4KQO A;  4WEK A;  2DRW A;  4B4X A;  4ZBE A;  4LV2 A;  5M1A A;  3IHA A;  3RXX A;  1AXB A;  4ZDX A;  4QD4 A;  5JYO A;  3GV9 A;  4JF6 A;  2PU4 A;  4B88 A;  1YLZ A;  1XP4 A;  1Z6F A;  4UAA A;  2ZMA A;  1ES5 A;  1PW8 A;  3SH9 A;  3WS2 A;  4FH2 A;  3BFF A;  3HUO A;  3HLE A;  2WZZ A;  1O7E A;  4MNR A;  4DXB A;  2X01 A;  1S6R A;  1O07 A;  4X69 A;  1K6S A;  4ID4 A;  2QPN A;  3CZD A;  5F82 A;  3BLS A;  3NI9 A;  5EVI A;  4OPR A;  1PWD A;  1XGI A;  1KGE A;  3VMA A;  3SS4 A; 
#chains in the Genus database with same CATH topology
 3HVF A;  3WS1 A;  3BY9 A;  3G30 A;  1YQS A;  5FQQ A;  1H0M A;  3PBQ A;  4P0M A;  4BJP A;  2OLV A;  1SHV A;  5HZH A;  5EVL A;  2XK1 A;  3FWL A;  2P08 A;  5FEF A;  3NIA A;  3KSI A;  2M7V A;  3HUM A;  3MZE A;  1YKD A;  1K55 C;  4M3K A;  2Y79 A;  4BD1 A;  4AFI A;  3EWK A;  1ONH A;  3FV7 A;  4BMW A;  2V1B A;  5IT5 A;  1YLJ A;  4E6W A;  3HJK A;  1XX2 A;  4H6J B;  4Y15 A;  2ZC3 B;  2ZMF A;  1VM1 A;  4MMN A;  3CPT B;  4UEY A;  1OJ5 A;  3ULF A;  2EFX A;  5CTN A;  3L7H A;  2ZQD A;  3UNW A;  3U2A A;  3S22 A;  1ACF A;  2W0N A;  5FQJ A;  5CXW A;  1ESU A;  3OOV A;  1P9W A;  1YAX A;  4Y0U A;  4MDZ A;  1SKO B;  3IBR A;  5EV0 A;  3IF6 B;  1OTB A;  4IVI A;  4Q0H A;  1T19 A;  4P85 A;  3TSG A;  4WZ5 A;  1XA1 A;  2WZX A;  4FUW A;  3ZGA B;  4BBV A;  4YWZ A;  3JPU A;  4WYY A;  2M1C A;  2ZC4 B;  4ZJ2 A;  4MEZ A;  1A0K A;  3OZH A;  1T1C A;  1IYO A;  4HES A;  5EM0 A;  5DVA A;  2GX5 A;  3WRZ A;  3M6B A;  3F1O A;  2J9O A;  3MS6 A;  4DE3 A;  4N9L A;  4Y17 A;  1ZG4 A;  4RQ9 A;  4F3L A;  3IXB A;  4C6Y A;  4S2J A;  2QYB A;  1CQA A;  3FG8 A;  4EET B;  4OP8 A;  3ISG A;  2K7S A;  2IWC A;  4Q0J A;  4S2P A;  1LLB A;  1NWZ A;  1XJ3 A;  4E6X A;  5G4Z A;  3SOI A;  3B3X A;  2J8Y A;  5M19 A;  3HUN A;  5GHX A;  3DAV A;  1LT0 A;  1BLP A;  2HV1 A;  5CHU A;  1E3U A;  1P97 A;  2ZMV A;  2O0Y A;  4PMA A;  4B93 A;  4JGO A;  3VOY A;  1W5D A;  4O8G A;  3A3I A;  2PYR A;  1K54 C;  1LL5 A;  4B4Z A;  5GHZ A;  5KSH A;  3ZDJ A;  1FCM A;  3EOI A;  4XT2 B;  3PBS A;  5F5Y A;  1Y28 A;  4X55 A;  2XRN A;  3HLW A;  4HNB A;  3UDI A;  2H28 A;  1TDG A;  4JLF A;  3ZG8 B;  4X56 A;  2OAQ 1;  3UME A;  4E04 A;  2GNX A;  3BRM A;  1W8Y A;  1JVJ A;  2J9P A;  3V50 A;  3CMZ A;  4ZAM A;  1PIO A;  1CEG A;  2Y2P A;  4LRZ E;  3SS3 A;  3KX0 X;  4D60 A;  4WM9 A;  1YLY A;  3LEZ A;  3Q07 A;  3IBJ A;  2HP9 A;  4WZ4 A;  1MWT A;  1FCO A;  1XFN A;  2Y59 A;  5CGS A;  4N9K A;  3LR5 A;  1CF0 A;  4BBU A;  5CEC A;  5HDD A;  3V39 A;  1MPL A;  3VP4 A;  2WKH A;  2Y2J A;  3E2L A;  3ZG7 B;  1XFQ A;  5CX7 A;  4GDN A;  4KQQ A;  5EVI B;  4DJ3 A;  2ZM2 A;  1JTD A;  1DP8 A;  2XD5 A;  3RTY A;  1ZG6 A;  2JKT M;  5L09 A;  1T18 A;  4GZB A;  2WGW B;  1S1Y A;  4FSF A;  3C30 A;  2ZC6 B;  3FZC A;  2A2L A;  3Q82 A;  1OT6 A;  3PR6 A;  4BL3 A;  3Q1F A;  3LR3 A;  2GJ3 A;  5HPF A;  5DFX A;  4HBU A;  2RCX A;  3M2K A;  3W8K A;  4N92 A;  4O7D A;  5DFY A;  1TD5 A;  1ZC2 A;  2P9V B;  3VP2 A;  1TS7 A;  1U60 A;  4F94 A;  4GKU A;  4EQ1 A;  5AJG A;  1W63 M;  3SH8 A;  2J3W A;  4KEN B;  1LI0 A;  1CJF A;  2OV5 A;  1K38 A;  1K25 A;  3KSH A;  4P6Z S;  4YIN A;  3PBR A;  5HW3 A;  4S2K A;  1DP9 A;  5HWV A;  4Z9Q A;  5FAS A;  2J3T D;  5FI6 A;  4R3B A;  1ZTU A;  4EQI A;  1YMS A;  4PM7 A;  4EEU A;  3V5M A;  1YT4 A;  3PXP A;  3TJZ C;  4Y0O A;  4H6J A;  3CPT A;  1YLW A;  3S4X A;  5DTK A;  2VGL M;  3V3S A;  4GOG A;  2KLI A;  3W4P A;  3KO6 A;  4KZ7 A;  2R9W A;  4P87 A;  4MLL A;  1VQQ A;  3S7Q A;  1VB6 A;  1NY0 A;  4KZA A;  5FEG A;  3F1O B;  5CED A;  3CUE A;  1SKO A;  3LEQ A;  1KDW A;  3IF6 A;  1XJ4 A;  4L9G A;  2Q0O A;  3VV4 A;  3EEA A;  4WMC A;  4LV3 A;  4FOF A;  4UA9 A;  3P01 A;  2XD1 A;  4E3M A;  3N4I A;  3B47 A;  4JXV A;  5EE8 A;  1SDE A;  3IH9 A;  1FIL A;  2V0U A;  5HD5 A;  1ERO A;  4I38 A;  1OME A;  1NLY A;  4EBN A;  4CQH A;  2DRW A;  4ZBE A;  1OTE A;  4LV2 A;  4O01 A;  3IHA A;  4QD4 A;  2EWW A;  2AVX A;  2K2N A;  4UAA A;  1N9O A;  3WS2 A;  3HLE A;  2WZZ A;  4LGW A;  4DXB A;  3C2W A;  3E0Y A;  3A0S A;  1VET B;  1PWD A;  3VMA A;  3MZD A;  3GEC A;  4NG2 A;  2JE5 A;  2L4R A;  2HZ5 A;  1GA9 A;  1IEM A;  1GHM A;  3UB9 A;  3VP1 A;  3MZF A;  2UV0 E;  3D72 A;  3G35 A;  4A5R A;  3ZNY A;  4G3W A;  4PKY G;  5GLB A;  3BEB A;  2JBF A;  1TF1 A;  1Z09 A;  4JXS A;  2OWH A;  5M18 A;  4OQI A;  4S2O A;  2BG1 A;  3CJM A;  3OCN A;  5EOE A;  3BYD A;  2Q9M A;  3WS5 A;  2YKH A;  3UE1 A;  2QJ5 A;  1NRF A;  1CK3 A;  5KMW A;  2JHE A;  4KZB A;  3P7N A;  1MBL A;  2Y55 A;  1F2K A;  3E4P A;  2VGK A;  4OPZ A;  4LV0 A;  4GD8 A;  5EVE A;  2Y2M A;  1J3W A;  2PD8 A;  3W4Q A;  4XT2 A;  2D01 A;  4L9F A;  4UHU A;  1YLT A;  5FDS A;  2ZD8 A;  1V9Y A;  3VOL A;  4MBF A;  3GMW A;  3WWX A;  3RFB A;  4S2N C;  1CI9 A;  4UQI S;  4YFM A;  3UO9 A;  3UPP A;  2G2U A;  2NUT C;  5FQ9 A;  4G3V A;  4R38 A;  2C5W B;  4GS9 A;  1ZHH B;  3LR0 A;  4X25 A;  4R4R A;  3GVB A;  4DKI A;  4RYE A;  1RGY A;  5DJU A;  1WYB A;  3MSH A;  4XXR A;  3FPW A;  1MWR A;  2J3T C;  4B9O A;  4EUV A;  4OOL A;  3LFV A;  3ZNT A;  4E3L A;  4HY8 A;  2R78 A;  3T4Q A;  4MBH A;  1BTL A;  3MQ0 A;  1NYM A;  5U47 A;  4XUX A;  1PYY A;  2X71 A;  4BEN A;  2HDR A;  1HVB A;  3QHY A;  5D3O A;  4LFU A;  2EXB A;  1MY8 A;  2LB5 A;  4OPY A;  3E4O A;  4ME4 A;  1ZKJ A;  4LPZ A;  5BOH A;  2ZC7 A;  3MMH A;  4R1G A;  4GCZ A;  2WGW A;  4QHC A;  2OOL A;  4H8R A;  2Y2N A;  4NEE D;  5FQI A;  4L0L A;  4CLC B;  3O3V A;  1HTZ A;  4P6B A;  2FFF B;  4KUK A;  2GZA A;  1HZO A;  3FKW A;  1Y4O A;  2P9V A;  3QP4 A;  3NCK A;  3T4L A;  4S2I A;  3ZG5 A;  2Z6C A;  5L10 A;  3H7W B;  2QHK A;  4WEJ A;  2Y2I A;  3G32 A;  1D06 A;  3ZG9 B;  4PM5 A;  5A93 A;  2PT7 A;  5KSC A;  3ZQ5 A;  4RX3 A;  2QZ6 A;  3QP1 A;  1PRQ A;  5DF8 A;  1GA0 A;  3FYZ A;  4WEL A;  1BT5 A;  5HD3 A;  4Y7P A;  4GHI A;  3E2K A;  1PWC A;  3E4Q A;  1K0K A;  2XFS A;  1L0G A;  3LIE A;  3LY4 A;  4I5S A;  4MN5 A;  4WUJ A;  3N6I A;  5CGW A;  3TE8 A;  2H10 A;  3T1Q B;  3NOT C;  4LEN A;  1S1Z A;  2HDU A;  1NZU A;  1W7F A;  2WKE A;  1LSW A;  3VSL A;  2FFY A;  3A0V A;  1M40 A;  1QMF A;  1RCJ A;  4QWO A;  4LCL A;  1L0D A;  3G31 A;  2V2F F;  1KVL A;  2DMW A;  4JGQ A;  1TDL A;  3LYX A;  4NXG A;  3BFC A;  3A3J A;  2INW A;  4KZ3 A;  3HBR A;  3DTM A;  4ETX A;  5AQ7 A;  4EXO A;  1RP5 A;  1YM1 A;  3R7W B;  2WAE A;  1T1B A;  5AQ9 A;  2IWB A;  2EX9 A;  5HDC A;  4FD8 A;  4R0Q A;  3S7P A;  1Y54 A;  1PNE A;  2ZOH A;  4K08 A;  3CWF A;  5FAT A;  2Z6D A;  4RX2 A;  1IYQ A;  1FR6 A;  3NHQ A;  1DRM A;  2Z2M B;  5FQM A;  4PM9 A;  2A49 A;  4HHD A;  1K57 A;  1N4O A;  2V9A A;  2B18 A;  2L0W A;  3UMD A;  3LIF A;  1FIK A;  2XLN A;  4HJ3 A;  3K3C A;  3MR0 A;  2E8J A;  3NY4 A;  1VET A;  1SKF A;  2WUQ A;  1PFL A;  3QP8 A;  1NJ4 A;  5A90 A;  3A3D A;  4DJ2 A;  2JKR I;  5GLD A;  5L2F A;  2DCF A;  1Q2Q A;  1OPX A;  4UA6 A;  3NUL A;  5EVI D;  3TOI A;  1PI5 A;  4Y13 A;  4WL9 A;  1KE4 A;  1PW1 A;  5GL9 A;  3MFD A;  3NBL A;  4OP5 A;  2NUP C;  1I2W A;  4X1L A;  4DF6 A;  2ACG A;  4ETZ A;  1K55 A;  2JKF A;  3PAE A;  4GS9 B;  2XGN A;  3MQQ A;  5J7E A;  1PI4 A;  4NXE A;  5G18 A;  1MKI A;  4U3T A;  4HJ4 A;  3KYZ A;  4PAU A;  3M6H A;  4JXG A;  4HJ6 A;  4NKP A;  1H8Y A;  3W2Z A;  4Z1W A;  4GNU A;  1MKM A;  4RVA A;  1XXM A;  5HAQ A;  2D02 A;  1OTA A;  3HL9 A;  3OC2 A;  1CEF A;  1W79 A;  3N8S A;  1Q2P A;  5F69 A;  1DJB A;  1P9R A;  3P98 A;  3H82 A;  4WBG A;  1H5X A;  5G4Y A;  3KYE A;  1WYC A;  4KZ6 A;  4GW9 A;  3HLG A;  2PHY A;  4HOI A;  3SS5 A;  5AQA A;  4K91 A;  4BL2 A;  4QJG A;  1I5Q A;  2G7U A;  3OBF A;  2OAP 1;  2M7U A;  2EX6 A;  4S2L A;  2O99 A;  4B4X A;  3KSG A;  3RXX A;  2V0W A;  5JYO A;  3GV9 A;  3KYQ A;  1S4S A;  1BYW A;  1XP4 A;  1Z6F A;  1PW8 A;  3BY8 A;  1YSP A;  4FH2 A;  3HUO A;  3S7N A;  1T1A A;  1O07 A;  4X69 A;  4KQD A;  3R4K A;  2QPN A;  2Y8H A;  3SS4 A;  1NYY A;  4OVD A;  5DTS A;  4KZ4 A;  1BUE A;  2WYX A;  5HWT A;  2HF6 A;  2V8F A;  2XH9 A;  1UWN X;  4Y5F A;  5HAP A;  1ERQ A;  3EQV A;  1XGJ A;  1FCN A;  4GHI B;  4HIA A;  3PBN A;  1GCE A;  4KZ9 A;  4CLC A;  4GDB A;  1H3Q A;  5EM1 A;  3HRE A;  2HDQ A;  2JN7 A;  4E3I A;  2VGJ A;  3B33 A;  3VOZ A;  4OQH A;  2XFT A;  4NXF A;  3ZCZ A;  4WF0 A;  1PZO A;  4Q8I A;  3FPV A;  1GSW A;  4K0X A;  3BEC A;  2HP5 A;  2YKF A;  3H7W A;  2H5S A;  2PRF A;  4IBR A;  2W3D A;  3BLM A;  4MCW A;  1JTG A;  2I9V A;  2XRO A;  3S1Y A;  4NXB A;  1E3U D;  1XPB A;  4ZJ3 A;  4ARZ B;  1L3L A;  4QY5 A;  1OT9 A;  1GHP A;  5HX9 A;  5EFW A;  1UWP X;  1H8Z A;  2Y2K A;  3IX8 A;  2VV6 A;  2P7J A;  4R23 A;  4DRT A;  2P04 A;  2VX8 A;  1D7E A;  1L0E A;  4L9E A;  4OOY A;  3ZYT A;  1FR1 A;  5EVI C;  5C5K A;  2A24 A;  3AGF A;  3IX4 A;  2HJE A;  3LY3 A;  3TW8 A;  3V3R A;  2OSU A;  5FAQ A;  3WS4 A;  3HLC A;  3IXD A;  2ZM8 A;  1G6O A;  1H8M A;  4CLC E;  2QMI A;  3U4L P;  1TS0 A;  3LIB A;  4OQ0 A;  2XQZ A;  3IF5 A;  4LV1 A;  3BM6 A;  2ZQA A;  4D2O A;  1W63 Q;  3CIT A;  3V67 A;  4OOM A;  4DDS A;  2PAV P;  1S66 L;  3UDX A;  3UE6 A;  4WLA A;  1YPR A;  4R3J A;  3UB8 A;  5FI7 A;  5A8B A;  2KDK A;  2E8I A;  4X1M A;  4MN7 A;  4C75 A;  3T4S A;  1XJ6 A;  5MC7 A;  3R7W A;  3T12 B;  2XEP A;  4DE2 A;  2L1M A;  4PHT A;  2VGL S;  3A3E A;  1ERM A;  2W3F A;  5EEC A;  1W8Q A;  3GQZ A;  4JGP A;  1ONG A;  2X02 A;  1N9B A;  5JYP A;  2V8C A;  3E98 A;  3UE0 A;  5E43 A;  1UGU A;  1MXO A;  4IUK A;  2WGI A;  5TBM B;  5DJT A;  1CI8 A;  3DBA A;  2ZQ7 A;  2PYP A;  4OON A;  2R9X A;  4WZ5 C;  3T50 A;  4JPM A;  1SCW A;  1JWZ A;  3NOU C;  3ZVW A;  3UB6 A;  2QKP A;  4EES A;  5TGF A;  4DE0 A;  4QU3 A;  1NZO A;  3T4O A;  2W3H A;  5CHJ A;  5HWW A;  3C4P A;  3OPL A;  3PAG A;  3PHY A;  2XR0 A;  1TEM A;  2ZBB A;  3MKE A;  4OQG A;  1IFQ A;  3BFG A;  4NK3 A;  2Y2H A;  3H82 B;  2W1R A;  4EER A;  5FSR A;  4GN2 A;  3PBT A;  3OLO A;  1IKG A;  5EUA A;  3GDI A;  1FQG A;  3DTI A;  5KZH A;  3T4T A;  4Q0I A;  4KZ5 A;  2PBY A;  4EV4 A;  4IBX A;  3JVV A;  2IWD A;  4R70 A;  3UY6 A;  5CTM A;  3QP2 A;  3MFX A;  4CLC D;  2Q9N A;  1P0Z A;  3DWZ A;  3AGD A;  3JYI A;  2PBD P;  3VFH A;  1IYS A;  3O88 A;  3KSF A;  3T4J A;  1J9M A;  3MF0 A;  1OJG A;  1TVF A;  3Q7V B;  4KG6 A;  2B02 A;  2W1T A;  2VV7 A;  4GJ4 A;  2VEA A;  2XA7 M;  3WS0 A;  1F9I A;  1ES3 A;  3SH7 A;  3HJI A;  2HDS A;  2B95 A;  2C6W B;  3LGO A;  3T1X A;  5FAP A;  5L8M A;  5HDS A;  1LI9 A;  4KUO A;  1JWP A;  2KX6 A;  3PTE A;  3MKF A;  4ZRR A;  2JKT I;  3MXS A;  4PM6 A;  4WMC D;  2VA0 A;  3GTC A;  5HAR A;  3SZT A;  5HPI A;  2Y91 A;  5GHY A;  4BBT A;  1G6A A;  2KOI A;  3M2J A;  1EW0 A;  3QNC A;  1KE0 A;  1PWG A;  1L2S A;  3RXW A;  3ITB A;  1K56 A;  5HSQ A;  3LO7 A;  4C3Q A;  2WKR A;  3NDE A;  3VP3 A;  2VJW A;  3F1N B;  5TR7 A;  2ZM0 A;  1IKI A;  5TJJ A;  2CMN A;  4LLO B;  3GR2 A;  5FDH A;  3LIA A;  4QY6 A;  2W3G A;  2OWJ A;  1VEU A;  2PU2 A;  5J8X A;  3DTK A;  4N1X A;  1XA7 A;  3O86 A;  4S2M A;  4OPQ A;  4JF5 A;  1YMX A;  4I39 A;  2WKI A;  3C4O A;  3IS2 B;  3G6O A;  1KDS A;  4JKT A;  1KGF A;  4QB8 A;  1G68 A;  4LRY C;  5EPH A;  4KZ8 A;  3RH8 B;  3UPN A;  2BAS A;  1MZU A;  2EX8 A;  1BZA A;  5J3W A;  3C38 A;  4IJG A;  1FSW A;  3IX3 A;  4HP4 A;  5L07 A;  3IXG A;  3CAX A;  4K0W A;  3G4P A;  1E25 A;  1WA9 A;  4HP9 A;  2XA7 S;  1C3B A;  2A24 B;  5DTT A;  4EUZ A;  5CHM A;  2FZ0 A;  3N8L A;  2HPB A;  4E3N A;  1LHY A;  1LSX A;  3L9K A;  1JWV A;  1RGZ A;  4DN0 A;  4MN6 A;  3ZVT A;  4JGR A;  2QJ7 A;  1EI5 A;  4ARZ A;  4KG5 A;  3NJA A;  5GLA A;  4EBP A;  3N8R A;  4KG2 A;  3A3F A;  1K6R A;  4R3A A;  5CEB A;  4HEF A;  3AGE A;  5E2F A;  4KQR A;  3N7W A;  1QME A;  4S2N A;  3HLB A;  3LUQ A;  2WKP A;  2O9A A;  4KQO A;  2O9B A;  3QP5 A;  2PU4 A;  3B42 A;  2ZMA A;  3SH9 A;  1O7E A;  1S6R A;  4M4X A;  3BQ8 A;  3O5Y A;  5AVF A;  4ID4 A;  3CZD A;  5F82 A;  4OPR A;  4HI4 A;  4I3J A;  1KGE A;  3WRT A;  4DMZ A;  2PR6 A;  2PDR A;  3TRC A;  5KIZ A;  4UA7 A;  4FCF A;  3UDF A;  4CLC C;  4EU0 A;  3LI9 A;  3S7O A;  1KVM A;  1YLP A;  3EQU A;  1MC0 A;  2O9C A;  3Q7Z A;  2CC1 A;  1KOU A;  3MXQ A;  4ZJ1 A;  3IWO A;  1VHM A;  1ES4 A;  2UWX A;  3MBZ A;  4OLD A;  4EW7 A;  5AQB A;  2VZW A;  2ZJ9 A;  1N9L A;  2VKS A;  4HH2 A;  2VV8 A;  5CGX A;  4GLQ A;  2Y2O A;  4I3I A;  1ESI A;  3CUE C;  3QNB A;  5I5L A;  1PZP A;  3CG5 A;  2WK0 A;  3HLF A;  3C5A A;  3IF6 C;  1KE3 A;  3F1P B;  3FKV A;  1L0F A;  5TBM A;  3EEH A;  3GSG A;  1FSY A;  5DKL A;  4GD6 A;  5A91 A;  5IU1 A;  3H9W A;  1NXY A;  5CER A;  3OPR A;  4BD0 A;  4Y0T A;  2EXA A;  1XKZ A;  1DP6 A;  4JF4 A;  1K56 D;  3O87 A;  5E2H A;  4EBL A;  1YSQ A;  3DTE A;  2W1T B;  1FOF A;  1LL9 A;  2FH5 A;  2JCH A;  3IWI A;  3CI6 A;  1XJ2 A;  4P6Z M;  3PBO A;  1OTD A;  1HLU P;  5IS1 A;  3CLO A;  2K31 A;  3IH8 A;  3D3O A;  4IHQ A;  3LCE A;  1E4D A;  2W3E A;  3SW1 A;  4II7 A;  4G3K A;  2ZC5 B;  1BLC A;  2Z2L B;  5A92 A;  2Y2Q A;  2ZQ8 A;  5DF7 A;  1TS6 A;  1N9N A;  1K4E A;  2MJ6 A;  2BLS A;  2H0Y A;  3I7J A;  4E3J A;  3Q7V A;  3OPH A;  2DNS A;  3BFE A;  4YOF A;  4FH4 A;  5HL1 A;  3ITA A;  2V1Z A;  3IQA A;  4LCM A;  5IHV A;  2WAD A;  2WGV A;  4N1H A;  3A0R A;  5AVE A;  3OCL A;  2EFU A;  2ZQC A;  5K5B A;  3W4O A;  2BTF P;  1VEU B;  3LR4 A;  3ICY A;  4FTX A;  1LSV A;  2LB9 A;  1EWZ A;  3LI8 A;  2HJ9 C;  2ZL1 A;  4R6L A;  3ZG0 A;  3LID A;  2ZLY A;  3ZFZ A;  4X68 A;  3EGD C;  2GDN A;  5HL6 A;  5F6A A;  4O0P A;  2P74 A;  2JKG A;  1I2S A;  1GHI A;  3VSK A;  2XSS A;  5F1F A;  4HBT A;  1HD8 A;  4X53 A;  3VP0 A;  1X0O A;  4LRX C;  4E3K A;  3TG9 A;  1IEL A;  2A3U A;  1NLZ A;  2XF3 A;  1D1J A;  2EWV A;  2H0T A;  3F1N A;  4I3A A;  3GRJ A;  5DF9 A;  1MWS A;  5FL3 A;  3C7U A;  2ZOI A;  3DWK A;  1BLS A;  3G2Z A;  2HGV A;  5F1G A;  4IUH A;  1K4F A;  3HCY A;  1K54 A;  4U0T A;  2QWS A;  3BWL A;  4RA7 A;  4GB7 A;  5DKK A;  2XDM A;  4U0X A;  3HLD A;  3Q81 A;  3NC8 A;  4CPK A;  3IS2 A;  5LBR A;  2J7V A;  3PYP A;  3G34 A;  3NEC A;  4MBK A;  3MQO A;  2B5R A;  4ZTK A;  3C7V A;  5F83 A;  4PKY A;  2ZQ9 A;  5GLC A;  4F3L B;  1IOU A;  3UE3 A;  2EX2 A;  3LIC A;  4R4S A;  4EEP A;  2JC7 A;  5FQK A;  1IYP A;  4WN5 A;  4ESP A;  5E2E A;  5HFO A;  3D9Y A;  3FC7 A;  1ALQ A;  3MXR A;  5TFQ A;  3NDG A;  3QP6 A;  1GSV A;  4OLG A;  1JNU A;  2RL3 A;  4DE1 A;  4YNR A;  4PM8 A;  4UQI M;  5J4E A;  1V9Z A;  3IXH A;  1TS8 A;  1DJA A;  4EWF A;  3OPP A;  1BUL A;  4BLM A;  3G2Y A;  3BFD A;  3RJU A;  3BJN A;  2EA9 A;  1S0W A;  3C8C A;  2PD7 A;  5FA7 A;  1AWI A;  1NRJ A;  3UPO A;  4Y3I A;  2JKR M;  3EGX C;  1G28 A;  4OH0 A;  2Y4A A;  4QPR A;  5FAO A;  3UN7 A;  1BLH A;  2Y2G A;  5E2G A;  3BW6 A;  4HH3 A;  2WKQ A;  1DY6 A;  1S67 L;  4PPR A;  3IT9 A;  4BQM A;  5CRF A;  1SZV A;  3VE4 A;  4JBF A;  5F68 A;  3IHB A;  2V20 A;  5I94 A;  2I72 A;  4DXC A;  3UB5 P;  4DDY A;  1LL8 A;  4ZDX A;  1F98 A;  2WAF A;  5EOO A;  1STZ A;  1DJC A;  4JXW A;  5FI2 A;  2V1A A;  1KGG A;  2HP6 A;  4IED A;  4X6T A;  1F5M A;  1MWU A;  3T1S A;  2G2W A;  1ODV A;  2W27 A;  4CJN A;  1ES2 A;  1WE4 A;  3F1P A;  2J80 A;  1GSX A;  3IWQ A;  4IVK A;  3JVU A;  3T4K A;  1BSG A;  3VE3 A;  3P09 A;  1SDN A;  4XUZ A;  3D4F A;  1S4R A;  3NOP C;  2OLU A;  3BQA A;  1G5U A;  4OKP A;  5HAI A;  3VFF A;  3K2N A;  3DW0 A;  4BWI A;  1OTI A;  2Y2L A;  3MJQ A;  3CHW P;  3UB7 A;  2VK3 A;  4Y2F A;  1K57 C;  4NET A;  1M6K A;  3ZHH A;  4E3O A;  4WEK A;  2ZL1 B;  4HQA A;  5M1A A;  2VLG A;  1AXB A;  4JF6 A;  4B88 A;  1YLZ A;  2PR5 A;  3K3D A;  1ES5 A;  3BFF A;  4MNR A;  2X01 A;  3T1R A;  1K6S A;  2IA2 A;  3BLS A;  3NI9 A;  5EVI A;  1XGI A; 
#chains in the Genus database with same CATH homology
 1NYY A;  3MZD A;  2JE5 A;  3HVF A;  4OVD A;  3WS1 A;  1GA9 A;  4UA7 A;  5DTS A;  3G30 A;  1IEM A;  4FCF A;  3UDF A;  1YQS A;  4KZ4 A;  1BUE A;  1GHM A;  3VP1 A;  5FQQ A;  2WYX A;  3MZF A;  3PBQ A;  4P0M A;  4BJP A;  3G35 A;  1KVM A;  2OLV A;  1SHV A;  1YLP A;  3EQU A;  2XH9 A;  5EVL A;  2XK1 A;  3FWL A;  4A5R A;  5HAP A;  3NIA A;  3ZNY A;  1ERQ A;  3HUM A;  3Q7Z A;  3EQV A;  3MZE A;  1K55 C;  4M3K A;  2CC1 A;  4BD1 A;  1XGJ A;  5GLB A;  1FCN A;  1ONH A;  3FV7 A;  3BEB A;  4ZJ1 A;  2JBF A;  3IWO A;  4JXS A;  1YLJ A;  3PBN A;  5M18 A;  4OQI A;  4E6W A;  1ES4 A;  2UWX A;  3MBZ A;  4OLD A;  1GCE A;  1XX2 A;  4S2O A;  2BG1 A;  2ZC3 B;  1VM1 A;  3CJM A;  3OCN A;  5AQB A;  2ZJ9 A;  5EOE A;  3BYD A;  4KZ9 A;  2Q9M A;  3WS5 A;  4GDB A;  3UE1 A;  2EFX A;  3HRE A;  2HDQ A;  5CGX A;  1NRF A;  2Y2O A;  5CTN A;  1CK3 A;  2VGJ A;  2ZQD A;  4E3I A;  3UNW A;  5KMW A;  3S22 A;  3VOZ A;  4KZB A;  4OQH A;  5FQJ A;  5CXW A;  1ESI A;  2XFT A;  3ZCZ A;  3QNB A;  1ESU A;  1MBL A;  1PZP A;  2WK0 A;  3CG5 A;  3HLF A;  3C5A A;  3IF6 C;  2Y55 A;  1PZO A;  1KE3 A;  2VGK A;  4Q8I A;  3FKV A;  1L0F A;  4Y0U A;  4OPZ A;  4LV0 A;  3GSG A;  4GD8 A;  1FSY A;  4K0X A;  3IF6 B;  3BEC A;  2HP5 A;  2Y2M A;  4GD6 A;  5A91 A;  5CER A;  1NXY A;  4BD0 A;  3OPR A;  4IVI A;  2H5S A;  4IBR A;  3BLM A;  4Y0T A;  2EXA A;  1XKZ A;  3W4Q A;  1JTG A;  4JF4 A;  3S1Y A;  1K56 D;  1E3U D;  3O87 A;  1XPB A;  1YLT A;  4P85 A;  4UHU A;  2ZD8 A;  5E2H A;  4ZJ3 A;  4EBL A;  4QY5 A;  3TSG A;  4MBF A;  1FOF A;  1LL9 A;  2JCH A;  3GMW A;  4WZ5 A;  2WZX A;  1XA1 A;  3WWX A;  4S2N C;  1GHP A;  1CI9 A;  4YFM A;  5HX9 A;  3UO9 A;  3ZGA B;  3IWI A;  1H8Z A;  3UPP A;  2G2U A;  3PBO A;  2Y2K A;  4WYY A;  5FQ9 A;  2ZC4 B;  2C5W B;  4R23 A;  4DRT A;  4ZJ2 A;  4MEZ A;  1L0E A;  3GVB A;  4R4R A;  4OOY A;  4DKI A;  4RYE A;  1RGY A;  3OZH A;  1FR1 A;  1WYB A;  1IYO A;  3IH8 A;  4XXR A;  4HES A;  3LCE A;  5EVI C;  1MWR A;  5DVA A;  1E4D A;  3AGF A;  3WRZ A;  4OOL A;  3M6B A;  3LY3 A;  3V3R A;  2OSU A;  3ZNT A;  4E3L A;  5FAQ A;  2J9O A;  2ZC5 B;  3WS4 A;  3HLC A;  3IXD A;  2ZM8 A;  4MBH A;  1BLC A;  2Z2L B;  4DE3 A;  1BTL A;  5A92 A;  2Y2Q A;  2QMI A;  4N9L A;  1ZG4 A;  2ZQ8 A;  5DF7 A;  1NYM A;  5U47 A;  3IXB A;  4C6Y A;  4OQ0 A;  4XUX A;  1PYY A;  4S2J A;  1K4E A;  2X71 A;  2XQZ A;  4BEN A;  2BLS A;  2H0Y A;  1HVB A;  2HDR A;  3I7J A;  3IF5 A;  4E3J A;  4LV1 A;  3BM6 A;  3QHY A;  5D3O A;  3Q7V A;  4OP8 A;  3OPH A;  2DNS A;  2ZQA A;  4D2O A;  3BFE A;  3ISG A;  4FH4 A;  2EXB A;  5HL1 A;  1MY8 A;  2IWC A;  3ITA A;  2V1Z A;  3IQA A;  4LCM A;  4OOM A;  5IHV A;  4OPY A;  4DDS A;  2WAD A;  4S2P A;  1LLB A;  2WGV A;  4N1H A;  3UDX A;  1ZKJ A;  5BOH A;  2ZC7 A;  2EFU A;  3OCL A;  2ZQC A;  4R3J A;  4R1G A;  2WGW A;  4QHC A;  5FI7 A;  3W4O A;  2E8I A;  4H8R A;  4C75 A;  1EWZ A;  4E6X A;  2Y2N A;  3SOI A;  3B3X A;  4L0L A;  5FQI A;  2XEP A;  3O3V A;  3ZG0 A;  1HTZ A;  2ZLY A;  2J8Y A;  4DE2 A;  3ZFZ A;  3A3E A;  4X68 A;  1ERM A;  2GDN A;  5M19 A;  3HUN A;  5GHX A;  4P6B A;  5EEC A;  1W8Q A;  2FFF B;  3GQZ A;  1BLP A;  5CHU A;  1E3U A;  2P74 A;  4PMA A;  1ONG A;  2X02 A;  1N9B A;  5JYP A;  3UE0 A;  1HZO A;  3FKW A;  3VOY A;  1W5D A;  5E43 A;  1I2S A;  1MXO A;  1GHI A;  3VSK A;  2WGI A;  3A3I A;  5F1F A;  4HBT A;  1HD8 A;  4X53 A;  2P9V A;  1K54 C;  3NCK A;  3VP0 A;  1CI8 A;  1LL5 A;  4S2I A;  3ZG5 A;  4B4Z A;  4E3K A;  4WEJ A;  5GHZ A;  3TG9 A;  1IEL A;  2A3U A;  2Y2I A;  2ZQ7 A;  3G32 A;  5KSH A;  4OON A;  2XF3 A;  1FCM A;  2R9X A;  4WZ5 C;  3ZDJ A;  4JPM A;  3ZG9 B;  3PBS A;  4PM5 A;  1SCW A;  5A93 A;  5KSC A;  1JWZ A;  3ZVW A;  4RX3 A;  4X55 A;  2QZ6 A;  2H0T A;  5DF8 A;  3HLW A;  1GA0 A;  3UDI A;  3GRJ A;  1TDG A;  5TGF A;  3WRT A;  5DF9 A;  4DE0 A;  3FYZ A;  4JLF A;  4QU3 A;  3ZG8 B;  1MWS A;  4WEL A;  1BT5 A;  1NZO A;  3C7U A;  3DWK A;  5CHJ A;  4X56 A;  4Y7P A;  1BLS A;  3G2Z A;  5F1G A;  3C4P A;  3E2K A;  3OPL A;  3PAG A;  1PWC A;  1K4F A;  1K54 A;  2XR0 A;  3BRM A;  4U0T A;  1W8Y A;  1JVJ A;  1TEM A;  3MKE A;  4OQG A;  2J9P A;  2XFS A;  3BFG A;  4NK3 A;  4RA7 A;  1L0G A;  2Y2H A;  3V50 A;  3CMZ A;  4GB7 A;  3LY4 A;  4ZAM A;  2XDM A;  1PIO A;  4U0X A;  5FSR A;  4GN2 A;  1CEG A;  3HLD A;  3PBT A;  2Y2P A;  3SS3 A;  3Q81 A;  3NC8 A;  3N6I A;  1IKG A;  5EUA A;  4CPK A;  5CGW A;  4WM9 A;  1FQG A;  2H10 A;  4LEN A;  1YLY A;  3LEZ A;  2J7V A;  5KZH A;  3Q07 A;  2HP9 A;  2HDU A;  1NZU A;  1W7F A;  3G34 A;  2PBY A;  4KZ5 A;  4WZ4 A;  1MWT A;  1FCO A;  2WKE A;  4EV4 A;  3VSL A;  4IBX A;  2Y59 A;  4MBK A;  2IWD A;  2B5R A;  5CGS A;  4ZTK A;  3UY6 A;  3C7V A;  2FFY A;  4N9K A;  5CTM A;  1M40 A;  1QMF A;  5F83 A;  2Q9N A;  2ZQ9 A;  5CEC A;  3DWZ A;  3AGD A;  3JYI A;  5GLC A;  1RCJ A;  3UE3 A;  3VFH A;  1IYS A;  2EX2 A;  3V39 A;  3O88 A;  4R4S A;  1MPL A;  3VP4 A;  2WKH A;  2Y2J A;  4LCL A;  3E2L A;  2JC7 A;  1L0D A;  1J9M A;  3G31 A;  3ZG7 B;  2V2F F;  5FQK A;  1KVL A;  4GDN A;  1IYP A;  1TVF A;  3Q7V B;  4KG6 A;  4KQQ A;  5EVI B;  5E2E A;  1TDL A;  2ZM2 A;  1JTD A;  5HFO A;  2XD5 A;  1ALQ A;  3BFC A;  3MXR A;  5TFQ A;  3NDG A;  3WS0 A;  1ZG6 A;  3A3J A;  4KZ3 A;  1ES3 A;  3HBR A;  2WGW B;  3DTM A;  2HDS A;  4GZB A;  4OLG A;  3SH7 A;  4FSF A;  2RL3 A;  4DE1 A;  5AQ7 A;  1RP5 A;  2ZC6 B;  3FZC A;  4PM8 A;  1YM1 A;  3Q82 A;  2C6W B;  2WAE A;  5FAP A;  5AQ9 A;  2IWB A;  4BL3 A;  2EX9 A;  3IXH A;  1LI9 A;  4FD8 A;  3Q1F A;  1JWP A;  4R0Q A;  3PTE A;  1DJA A;  3MKF A;  1Y54 A;  3MXS A;  4EWF A;  4PM6 A;  3OPP A;  4WMC D;  3GTC A;  5HAR A;  1BUL A;  4BLM A;  4HBU A;  3G2Y A;  5FAT A;  2Y91 A;  3BFD A;  4RX2 A;  2RCX A;  3M2K A;  1IYQ A;  5GHY A;  1FR6 A;  4N92 A;  1G6A A;  3RJU A;  3W8K A;  4O7D A;  2Z2M B;  1S0W A;  3M2J A;  5FQM A;  4PM9 A;  3QNC A;  2A49 A;  1KE0 A;  1ZC2 A;  5FA7 A;  3UPO A;  1K57 A;  1PWG A;  2P9V B;  1N4O A;  1L2S A;  3VP2 A;  3RXW A;  3ITB A;  1K56 A;  3LO7 A;  1U60 A;  2XLN A;  4OH0 A;  4C3Q A;  4F94 A;  4GKU A;  3NY4 A;  2Y4A A;  3NDE A;  3VP3 A;  1SKF A;  5FAO A;  3UN7 A;  2WUQ A;  1BLH A;  2Y2G A;  5E2G A;  5TR7 A;  2ZM0 A;  1IKI A;  1NJ4 A;  3SH8 A;  4KEN B;  1LI0 A;  5A90 A;  3GR2 A;  5FDH A;  1DY6 A;  2OV5 A;  1K38 A;  1K25 A;  4QY6 A;  3A3D A;  4PPR A;  4YIN A;  2PU2 A;  3IT9 A;  3PBR A;  4BQM A;  5HW3 A;  5CRF A;  5J8X A;  4S2K A;  5GLD A;  4N1X A;  5L2F A;  2DCF A;  1Q2Q A;  1XA7 A;  4JBF A;  3O86 A;  4S2M A;  4Z9Q A;  4UA6 A;  5FAS A;  4OPQ A;  4JF5 A;  1YMX A;  5EVI D;  3IHB A;  2WKI A;  2V20 A;  3TOI A;  1PI5 A;  5I94 A;  2I72 A;  5FI6 A;  4R3B A;  1KE4 A;  1PW1 A;  4DXC A;  4EQI A;  3C4O A;  5GL9 A;  3MFD A;  3NBL A;  4DDY A;  1YMS A;  4OP5 A;  4PM7 A;  1KDS A;  4JKT A;  1I2W A;  2WAF A;  1KGF A;  1YT4 A;  1G68 A;  4QB8 A;  5EOO A;  4Y0O A;  5EPH A;  3V5M A;  4DF6 A;  1K55 A;  3PAE A;  4KZ8 A;  2XGN A;  1DJC A;  3UPN A;  4JXW A;  1YLW A;  3S4X A;  5FI2 A;  1KGG A;  2EX8 A;  2HP6 A;  1BZA A;  5DTK A;  1PI4 A;  4IED A;  4X6T A;  3V3S A;  1FSW A;  4GOG A;  5G18 A;  3IXG A;  1MKI A;  1MWU A;  3W4P A;  4K0W A;  4U3T A;  3G4P A;  1E25 A;  4KZ7 A;  2G2W A;  1C3B A;  4CJN A;  5DTT A;  2R9W A;  4P87 A;  4EUZ A;  1ES2 A;  1VQQ A;  3M6H A;  4JXG A;  4MLL A;  5CHM A;  1NY0 A;  1WE4 A;  1H8Y A;  2HPB A;  3N8L A;  4KZA A;  4E3N A;  5CED A;  4GNU A;  1LHY A;  3IWQ A;  4RVA A;  1KDW A;  1XXM A;  3IF6 A;  4IVK A;  5HAQ A;  1BSG A;  1JWV A;  3HL9 A;  3P09 A;  1RGZ A;  1SDN A;  3OC2 A;  1CEF A;  3D4F A;  1W79 A;  3N8S A;  1Q2P A;  4XUZ A;  4WMC A;  2OLU A;  1DJB A;  3ZVT A;  4LV3 A;  4OKP A;  1EI5 A;  4UA9 A;  3P98 A;  5HAI A;  4KG5 A;  2XD1 A;  4WBG A;  3VFF A;  1H5X A;  3N4I A;  4E3M A;  5GLA A;  1WYC A;  4EBP A;  4KZ6 A;  3DW0 A;  3HLG A;  3N8R A;  4KG2 A;  4JXV A;  3SS5 A;  3A3F A;  5EE8 A;  5AQA A;  1SDE A;  3IH9 A;  1K6R A;  2Y2L A;  4K91 A;  4BL2 A;  5CEB A;  4HEF A;  4QJG A;  3AGE A;  5E2F A;  1ERO A;  1I5Q A;  4KQR A;  3N7W A;  1OME A;  1QME A;  1K57 C;  4NET A;  3HLB A;  4S2N A;  1M6K A;  3ZHH A;  4E3O A;  2EX6 A;  4S2L A;  4EBN A;  4KQO A;  4WEK A;  2DRW A;  4B4X A;  4ZBE A;  4LV2 A;  5M1A A;  3IHA A;  3RXX A;  1AXB A;  4ZDX A;  4QD4 A;  5JYO A;  3GV9 A;  4JF6 A;  2PU4 A;  4B88 A;  1YLZ A;  1XP4 A;  1Z6F A;  4UAA A;  2ZMA A;  1ES5 A;  1PW8 A;  3SH9 A;  3WS2 A;  4FH2 A;  3BFF A;  3HUO A;  3HLE A;  2WZZ A;  1O7E A;  4MNR A;  4DXB A;  2X01 A;  1S6R A;  1O07 A;  4X69 A;  1K6S A;  4ID4 A;  2QPN A;  3CZD A;  5F82 A;  3BLS A;  3NI9 A;  5EVI A;  4OPR A;  1PWD A;  1XGI A;  1KGE A;  3VMA A;  3SS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...