2VA0A

Differential regulation of the xylan degrading apparatus of cellvibrio japonicus by a novel two component system
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
99
structure length
99
Chain Sequence
SPAKRLLFQMVGNAINRNTQQLTQDLRAMPNWSLRFVYIVDRNNQDLLKRPLPPGIMVLAPRLTAKHPYDKVQDRNRKLYGRHITLNDGNSVKVVTISA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Regulation of the Xylan-Degrading Apparatus of Cellvibrio Japonicus by a Novel Two-Component System.
pubmed doi rcsb
source organism Cellvibrio japonicus
molecule tags Transferase
molecule keywords ABFS ARABINOFURANOSIDASE TWO COMPONENT SYSTEM SENSOR PROTEIN
total genus 26
structure length 99
sequence length 99
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18225 AbfS_sensor Sensor histidine kinase (AbfS) sensor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.160 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2va0A00
2VA0A
chains in the Genus database with same CATH superfamily
2J3TC 2O9CA 4KG6A 4S2NC 1HLUP 1TVFA 3RFBA 5HSQA 1OTAA 5GHYA 5L07A 3UE0A 4KZ8A 4PHTA 4NXBA 3OPPA 1CEFA 4ZDXA 1C3BA 1G6OA 2VKSA 2A3UA 4GCZA 4U0TA 3CPTB 4P6ZM 3MXRA 1T19A 4WEJA 1ES4A 3LO7A 1TEMA 3ITBA 3NY4A 1NRFA 2OV5A 3G34A 2R78A 4X6TA 3Q82A 2J8YA 2I72A 1NYMA 1T1CA 3IF6B 5HARA 3CUEA 3UPOA 3CMZA 4CLCB 4KENB 4HI4A 3LGOA 3PAEA 4ZTKA 4OPRA 4S2NA 4ZJ3A 2P04A 4GLQA 5L2FA 3O3VA 4PKYA 5FAQA 1PI5A 3LY4A 4O0PA 4QU3A 4CJNA 3IF6A 2HF6A 2ZOHA 3RJUA 2P7JA 4H6JB 4MLLA 1GA9A 1P9WA 1BTLA 5L09A 3QHYA 4JXSA 4CPKA 3UDFA 5FQJA 5FL3A 3DTKA 2Z6DA 1EWZA 2W3GA 4JGOA 5EOOA 4WM9A 3UB8A 3Q07A 4MNRA 1ACFA 4E6WA 3S7NA 4KUOA 3S7OA 3SS3A 3LEZA 3NOPC 4LRYC 4C6YA 3TW8A 2IWCA 2ZC4B 3MBZA 4G3KA 2ZQ8A 2VEAA 5KIZA 2Q9MA 1GHIA 3M2KA 3GMWA 3HLDA 3ZYTA 3PBQA 4ETXA 1EROA 4PM7A 1OTEA 1W79A 2PAVP 5IU1A 3T1SA 3E4QA 2MJ6A 1K25A 3U4LP 4KZ4A 2X02A 1HTZA 1DJAA 3V3RA 1PYYA 1AWIA 3RH8B 2WGVA 4Y0TA 1XGJA 3KSIA 3Q81A 3DAVA 4YNRA 3BLMA 5DJTA 3BECA 2HDRA 1YSQA 4G3VA 5CRFA 1JWZA 3T12B 5IS1A 2FZ0A 1DP6A 1EW0A 4BL3A 1WYBA 3MR0A 3F1OB 3UMDA 4N9KA 5DVAA 1DJBA 4DF6A 4ME4A 5CHMA 3HJIA 4FUWA 1D7EA 4S2KA 2Q0OA 4OH0A 4PM9A 1CI9A 4O8GA 1YKDA 1BLHA 1YMSA 1K57A 3R7WA 4WL9A 1NZOA 5GLDA 1KVLA 2ZL1A 4D2OA 2VV8A 3NDEA 3MMHA 1Q2PA 5KZHA 1IEMA 2PBDP 4PM5A 2E8JA 2P9VA 5KSHA 4EEPA 2ZQ9A 2JHEA 4FH2A 1EI5A 3CUEC 4NG2A 1S66L 3C2WA 3DW0A 1YT4A 2QJ7A 4C75A 4WMCD 1PW1A 1RP5A 5HDCA 4IHQA 3IXHA 2J3WA 2JKTI 4EETB 2JC7A 2PD8A 3RTYA 1N9OA 3KX0X 4QWOA 1XXMA 4KQOA 1DP9A 2PD7A 2JCHA 1XA7A 2FFFB 3RXWA 3GDIA 3JVUA 1W63M 5KSCA 4K0XA 4BBVA 3BW6A 3S7PA 2W3DA 4OOYA 4ESPA 4QY6A 2ZC7A 5D3OA 1W5DA 2JKFA 4F3LA 3W2ZA 3C30A 3MFDA 2LB9A 1L0GA 2WKIA 1XJ2A 3M2JA 1D1JA 3IF5A 4WZ5C 1QMFA 2V0UA 2H5SA 4EQ1A 1H3QA 5FQKA 5MC7A 3O88A 5EUAA 2ZQAA 1UGUA 2WKQA 3HREA 3K2NA 2B5RA 3LICA 4GDBA 2HP5A 2Y2IA 2VJWA 2W0NA 3LI9A 3IWIA 1K38A 2EX6A 2HPBA 3T1RA 2G2UA 4MBHA 5CXWA 3BEBA 4KQQA 3G2ZA 3ICYA 3PBSA 4K0WA 3R4KA 2HJ9C 2VGLM 5CECA 4N9LA 1NZUA 3K3DA 5CEDA 2VV7A 3HL9A 4N1XA 5J7EA 3ZVWA 1BSGA 3B42A 1T1AA 5EVID 1BULA 5IHVA 2WYXA 4U3TA 4IUKA 2JKRI 3KSGA 4HBUA 4OQIA 2Y2KA 1KGFA 2PYRA 3W8KA 2VGKA 4GS9A 4RQ9A 2XEPA 4QHCA 2OAP1 5FI6A 4Q0IA 2WGIA 1I2WA 2JKRM 4Z1WA 1K4FA 2V8CA 2ZM0A 3C8CA 2ZQCA 4EERA 2K7SA 4S2OA 3V39A 4XUZA 1ERMA 3T1XA 1KOUA 4HNBA 3LEQA 5HAPA 4HJ3A 2R9XA 2WADA 5IT5A 3IWOA 5EOEA 4Q8IA 2QWSA 5CEBA 4OQ0A 4YINA 1NWZA 2L1MA 2BASA 3CG5A 4WELA 4O7DA 2JBFA 4S2PA 4IBRA 3P01A 2XH9A 4HH2A 4R3JA 4R3BA 5CTNA 3E2KA 1ONHA 3WRZA 4UQIM 3TE8A 5DFYA 1O7EA 4OOLA 2A24B 3MZEA 5EVEA 2VK3A 3P98A 4P0MA 4OVDA 4YWZA 1DP8A 4QPRA 1WA9A 1TS0A 3O86A 3FPVA 3PBNA 1O07A 1G28A 4NXGA 3DTIA 4OQHA 1WE4A 1PI4A 5F69A 5JYPA 1BLSA 2EXBA 3QP4A 3IS2A 4B88A 1XJ4A 2O99A 1IYSA 1W7FA 5EVIA 3KO6A 1KDWA 3UDIA 5FEGA 4E3JA 3A3DA 4DRTA 1SZVA 5FDSA 5J8XA 4QD4A 4BD0A 1FOFA 3F1PA 3IS2B 4Y0UA 1H8YA 2M1CA 3VFFA 3W4OA 1KE4A 2UWXA 2ZMVA 3H9WA 2Z2MB 4R4SA 2EWWA 1XFQA 2Y8HA 1YQSA 2XR0A 5DF7A 3C4OA 5G4ZA 3PHYA 1PWCA 4MN7A 1OTDA 4MN6A 2J80A 1IYQA 2WKRA 2ZMFA 1MY8A 2KLIA 3CHWP 5DKLA 2XD5A 3L9KA 2V20A 2XRNA 1S0WA 2NUTC 3G30A 1W63Q 4WN5A 3T4JA 5L8MA 2Y2MA 1KE3A 2A49A 4CLCC 3N7WA 1TS8A 2O0YA 1L0FA 2M7UA 3UNWA 4KZ7A 5DF9A 2CC1A 4F94A 2W1TB 1IFQA 3ISGA 1J9MA 3K3CA 3TJZC 2GDNA 4X56A 2Y79A 2XGNA 5GL9A 4R4RA 1CK3A 3NECA 3QP1A 2Y4AA 4HESA 1ONGA 2V1ZA 1LSWA 5TBMB 3WRTA 1JVJA 3N6IA 4ARZB 1FR1A 3NOTC 4C3QA 3DWZA 2L0WA 1MWRA 4GDNA 3AGEA 4LLOB 3C4PA 4KZ5A 4L0LA 5GLBA 2DNSA 3Q7VA 4DXCA 2EFUA 2DRWA 2INWA 3ULFA 3BFEA 3GECA 1XFNA 2B02A 2P74A 3HUOA 4EQIA 1J3WA 4PPRA 5KMWA 1MZUA 4LV1A 4B4ZA 1OTIA 2IA2A 5EM1A 4PM6A 3IHAA 3AGDA 4L9GA 3NULA 4JGQA 2EXAA 4LV0A 2W3FA 1GSWA 2GNXA 1PZOA 3KYEA 5EM0A 3H7WA 4HEFA 5E43A 3T4LA 5F83A 5EV0A 4G3WA 3IXGA 4WZ4A 3T1QB 3IXBA 3UB7A 3O87A 4CLCA 1XJ6A 1K54C 2EX2A 2HV1A 2GX5A 3PYPA 3PBTA 1S4SA 1H0MA 4JXVA 5M19A 5K5BA 5A93A 5HPFA 3IX3A 3UDXA 2JKTM 3A3JA 4GOGA 3OCLA 5AVEA 4X53A 3BLSA 5AJGA 5C5KA 2PU2A 5F82A 3GSGA 1G6AA 1BLPA 4P85A 3IWQA 1ODVA 4OQGA 1YLPA 1P0ZA 2E8IA 1NLZA 2VLGA 3MKEA 4OP8A 4FH4A 3NHQA 5TR7A 3CWFA 5FAPA 1RGZA 2XSSA 2WAEA 2W3HA 5HAIA 2BLSA 3M6HA 1CI8A 3HVFA 5GLAA 4OLGA 2ZM2A 2OWHA 3TSGA 5CERA 2XA7M 3A0VA 3IF6C 4S2LA 1SDEA 4GHIB 1H8MA 3EGXC 3SOIA 2WKPA 4NXEA 3ZG8B 5TFQA 2ZQDA 3OPHA 2GZAA 2XLNA 3S1YA 3GTCA 3OBFA 1JNUA 4IBXA 2J9PA 1IELA 4LRZE 3VE3A 5F68A 4EW7A 1ZG4A 3DWKA 1OJGA 1RGYA 4Y7PA 5I94A 5A90A 1M6KA 2ZMAA 1FIKA 4DXBA 4DDYA 1LSXA 3IX8A 3N8RA 2PR6A 1VQQA 3MFXA 4RVAA 1M40A 5U47A 4DE2A 3LCEA 4WF0A 4R0QA 1CEGA 3JYIA 4JXGA 4RX2A 1OT9A 4R70A 1E4DA 4JPMA 3FKWA 4WMCA 3CAXA 2RL3A 4PKYG 2V1AA 3FPWA 2BG1A 1SKOA 2Y55A 1G5UA 3GR2A 1SKFA 1LL8A 3NIAA 1YLWA 1H5XA 5FQMA 2X01A 2V0WA 3EEHA 4GS9B 5FDHA 3LIAA 5DF8A 1WYCA 1TDGA 4IUHA 4R1GA 2XF3A 4HH3A 2P08A 4KZ3A 4MCWA 3GVBA 4P6BA 1H8ZA 5AQ9A 4UA9A 3A3FA 4ZJ1A 1TS6A 3SW1A 4Z9QA 3WS4A 3MSHA 3ZG9B 1ALQA 1K55C 5AQAA 2PHYA 2ZC5B 4UA7A 2J3TD 1GSVA 2QJ5A 3BQ8A 3S7QA 3TG9A 4KZAA 3ZNYA 4S2JA 2FH5A 4UAAA 2AVXA 1K6SA 4ZRRA 2HJEA 5JYOA 3Q1FA 4Y13A 4JF5A 1KE0A 4DKIA 1ZKJA 5DTSA 1PRQA 2J9OA 1ZC2A 4NXFA 2LB5A 2ZJ9A 4HJ4A 4FD8A 1OTBA 3VMAA 2BTFP 1JWPA 1KDSA 5F6AA 4MBKA 5A92A 3PBOA 4BWIA 3E4PA 4QB8A 3BY9A 4EUZA 1V9ZA 3D9YA 4LCMA 4LENA 4Y0OA 4GD8A 1PW8A 4E3OA 2M7VA 3FYZA 5L10A 5HW3A 3LIFA 3MZDA 3E98A 4ETZA 3EQUA 3UY6A 5E2FA 3OPRA 1LI9A 3G35A 4A5RA 4E3NA 3T4OA 1L0EA 5EVIB 3VOLA 5CGXA 2KX6A 4HBTA 3VP2A 1V9YA 1UWPX 3MS6A 4E04A 3ZQ5A 1FSYA 2IWDA 3IXDA 5G18A 3WS5A 2HZ5A 3KSFA 1BUEA 2P9VB 4Y2FA 4GZBA 4EWFA 4RA7A 1FCMA 5J4EA 2XFSA 4OOMA 4ZAMA 5FASA 2Y59A 3PBRA 5HL1A 1QMEA 2O9AA 3DBAA 2XDMA 4XXRA 3FWLA 3C5AA 1ESIA 3FC7A 3MQQA 3IQAA 4I3IA 4UHUA 3E0YA 1PFLA 4EBLA 1OT6A 4R3AA 3ZHHA 1STZA 3LIEA 4Y3IA 3E4OA 2VGJA 2EX9A 2L4RA 3N8SA 3PAGA 3LIDA 4JF4A 1YAXA 2K31A 3C38A 1VEUA 5HAQA 1YPRA 2OAQ1 3IT9A 4JBFA 4XT2B 5GLCA 3LR0A 3F1NB 1MC0A 3H82A 5HPIA 4Q0HA 4GNUA 1Q2QA 5FQQA 1YLZA 3VP4A 4P87A 4S2IA 3A0SA 3IHBA 5EECA 3UB9A 3BJNA 3H82B 1FR6A 2PT7A 2Y2PA 3NBLA 3FV7A 4WUJA 4MMNA 1PNEA 3FKVA 3G2YA 4GJ4A 4Y17A 4OP5A 5EFWA 4WYYA 4ZJ2A 3NC8A 4LFUA 3FG8A 1N9LA 1P97A 3L7HA 4S2MA 1XKZA 1K55A 3SS4A 4XUXA 3BFDA 3UN7A 1XJ3A 3B47A 2XD1A 1KVMA 3Q7VB 3HUNA 3R7WB 3MXQA 2OOLA 2ZL1B 1IKGA 3WWXA 4E3IA 3CPTA 3UPNA 1PIOA 4HP9A 5HD5A 4DMZA 4ID4A 2Y91A 3NJAA 3LR3A 2OWJA 4PAUA 3LY3A 4RX3A 1W8YA 2OLUA 1BZAA 5AVFA 5F5YA 2V2FF 3VOYA 3W4PA 3VOZA 5CHJA 1N9BA 2WZXA 3FZCA 2RCXA 3G31A 3KSHA 2QHKA 4X55A 4GN2A 2R9WA 3OLOA 5HWWA 3MQ0A 4WZ5A 1P9RA 2Y2HA 4H6JA 3CI6A 5E2GA 4DJ2A 4BL2A 4CLCD 5TGFA 3VP0A 3HLCA 1XX2A 1CJFA 1TD5A 5GHXA 1LHYA 2EFXA 4EUVA 3UE3A 3P09A 2V9AA 4LRXC 1ZG6A 2Y2NA 2ZC6B 5BOHA 2XQZA 4JGPA 2EA9A 3NI9A 3EOIA 2ZOIA 2EX8A 1FSWA 4WLAA 4UA6A 3SS5A 2WKHA 1N4OA 2YKFA 3HLGA 1KGGA 3O5YA 1LT0A 3IBJA 5E2HA 4JLFA 4KZBA 1PWGA 4GHIA 3A0RA 1CQAA 3QP6A 3V3SA 5CX7A 3N8LA 3T50A 1IYOA 4I5SA 2Y2QA 5HX9A 1SHVA 3MKFA 5A91A 3T4KA 5EVLA 3T4QA 4DN0A 3UB6A 3W4QA 1MKMA 1Z6FA 4EU0A 4FCFA 1NJ4A 1ZHHB 2IWBA 4DE1A 4LPZA 3V5MA 3M6BA 3B3XA 3WS1A 3F1OA 3VSLA 1IYPA 1ES3A 5TJJA 4BENA 4KZ6A 3CZDA 3SH8A 1K56A 3HLWA 3BFGA 2DCFA 3ZDJA 4B93A 1VM1A 1YLJA 5J3WA 3LR4A 3D72A 3UO9A 3TOIA 3RXXA 3SH7A 1HD8A 3DTMA 5E2EA 3DTEA 1T18A 4DE3A 3UMEA 4OPZA 4HJ6A 3IBRA 4R38A 1SKOB 1GHPA 2NUPC 5FI2A 1L3LA 1U60A 2YKHA 3PR6A 3G6OA 3D3OA 2Y2GA 2WZZA 3A3EA 4JKTA 4I38A 1ESUA 2VA0A 5LBRA 1VHMA 2HDUA 4MDZA 3U2AA 3IH9A 3MZFA 3ZG7B 3PXPA 1X0OA 4FSFA 4BBTA 1FCOA 5FAOA 5F1GA 1XGIA 3LR5A 2GJ3A 1NYYA 2WAFA 4GD6A 3KYQA 1S1ZA 4BD1A 3QNBA 1F5MA 1Z09A 3LUQA 2W1TA 4N92A 2VZWA 3BRMA 4DJ3A 1LL9A 5AQ7A 4AFIA 2ZBBA 3VP3A 5G4YA 1RCJA 2JN7A 2QZ6A 4NK3A 5GHZA 1OJ5A 3ZG0A 1MKIA 3CLOA 2UV0E 3LI8A 2C5WB 2HDSA 3BWLA 1HVBA 4I3AA 4BQMA 4E6XA 2J7VA 3LFVA 4EEUA 2HGVA 3I7JA 1YM1A 3HUMA 3MJQA 4M3KA 1F98A 1OPXA 4Y15A 5FSRA 1NY0A 4UQIS 3S4XA 1NXYA 3ZFZA 3UPPA 2B18A 1ES5A 4KZ9A 4H8RA 1DJCA 5AQBA 4GB7A 3A3IA 3QNCA 1ERQA 4N1HA 2HP6A 3BYDA 4GW9A 1IKIA 3F1PB 3QP5A 1VETA 1JWVA 1GSXA 3EGDC 4X1MA 3GQZA 2VX8A 3ZVTA 1FCNA 2W1RA 5HDDA 1LI0A 5FATA 3OPLA 4RYEA 1S6RA 2PR5A 2FFYA 4KG5A 4X1LA 1VB6A 2Y2LA 3P7NA 1E3UD 1Y28A 2ZC3B 1MBLA 5HFOA 2G2WA 3V50A 1K54A 4MBFA 3WS2A 2Y2JA 1I5QA 1PZPA 3T4SA 4CQHA 4KG2A 4EBPA 4JF6A 3UB5P 3VV4A 2C6WB 2XFTA 2A2LA 3EWKA 4YOFA 3ZG5A 4LCLA 4MEZA 1BLCA 5A8BA 4WBGA 1K0KA 3F1NA 5FQIA 1E25A 1ES2A 4EV4A 4FOFA 1BYWA 1MPLA 3SZTA 5EPHA 5HZHA 5CGSA 4BBUA 3HJKA 3AGFA 4HY8A 4IVIA 1SDNA 1YLTA 5HWVA 4XT2A 2D02A 2I9VA 2CMNA 2ZLYA 4HP4A 1K57C 3MQOA 4I3JA 5M18A 4HQAA 4KQDA 4QJGA 2OSUA 1TDLA 3PTEA 3OC2A 5TBMA 2OLVA 4FTXA 3VSKA 4UEYA 2A24A 5FQ9A 3BY8A 4BMWA 1JTDA 1L0DA 4NETA 4M4XA 1Y4OA 1JTGA 3WS0A 5CTMA 4X68A 4HOIA 2O9BA 1ZTUA 4I39A 2ZQ7A 3H7WB 2DMWA 1DY6A 2H10A 1YLYA 3D4FA 1N9NA 2JKGA 4EESA 2K2NA 1VETB 3EEAA 3NDGA 4NKPA 2VV6A 4P6ZS 4NEED 3UE1A 3JPUA 5F1FA 3JVVA 1XP4A 5HL6A 4EBNA 4K91A 5HWTA 5DKKA 4E3KA 2Q9NA 2XK1A 3HCYA 3E2LA 2H28A 2QKPA 4WEKA 4R23A 4U0XA 4IVKA 3LYXA 1YSPA 4OKPA 5CGWA 4K08A 3ZGAB 1XPBA 2W27A 3IH8A 4YFMA 2WGWA 2PYPA 3OZHA 4LV2A 3GRJA 5EVIC 4IJGA 5HDSA 3MF0A 1MXOA 4X69A 3VFHA 1MWSA 2PRFA 3QP2A 3HBRA 4JGRA 4HHDA 5EE8A 4Y5FA 1XA1A 2WKEA 3S22A 4KQRA 4LV3A 2PDRA 2PBYA 4II7A 2QPNA 4PM8A 4R6LA 5DTKA 4OLDA 1YMXA 2ZD8A 3V67A 4OONA 1TF1A 3KYZA 1E3UA 1GA0A 2V1BA 2W3EA 1MWUA 1F2KA 1NRJA 1Y54A 2HDQA 1FILA 1CF0A 1S67L 1TS7A 3HLFA 2B95A 4BLMA 1S4RA 3NCKA 2D01A 3T4TA 4E3MA 1K4EA 1LLBA 3B33A 2QYBA 4B9OA 1D06A 3ZCZA 2V8FA 4CLCE 3GV9A 4OPYA 1OMEA 5M1AA 4DDSA 4E3LA 2XROA 2JE5A 1K56D 3IX4A 1NLYA 4L9FA 2KDKA 2VGLS 1UWNX 1K6RA 3TRCA 5DTTA 3CJMA 3VE4A 1A0KA 1S1YA 4O01A 4DE0A 2H0TA 3Q7ZA 1AXBA 3QP8A 3SH9A 2Z2LB 1KGEA 3ITAA 4D60A 3LIBA 1DRMA 3BQAA 3MXSA 3ZNTA 1BT5A 1I2SA 4QY5A 3C7VA 5DFXA 3OOVA 3HLEA 4ZBEA 4L9EA 2XA7S 2ZM8A 4MN5A 5HD3A 3VP1A 1SCWA 4BJPA 4KUKA 1L2SA 1MWTA 1GHMA 4X25A 1GCEA 3BFCA 3EQVA 2EWVA 3NOUC 1FQGA 1W8QA 4Q0JA 1T1BA 2WGWB 2WUQA 3N4IA 2X71A 3BFFA 4EXOA 1G68A 4IEDA 4PMAA 3HLBA 2KOIA 5DJUA 2Y2OA 1PWDA 2WK0A 1VEUB 3G4PA 5FA7A 4OPQA 2G7UA 5I5LA 4JXWA 1F9IA 3BM6A 2Z6CA 2ACGA 4HIAA 3OCNA 5FEFA 1IOUA 4LGWA 4B4XA 1HZOA 2H0YA 1LSVA 3G32A 3CITA 3C7UA 3UE6A 4GKUA 2PU4A 4F3LB 4ARZA 2QMIA 1LL5A 5CHUA 2HP9A 5FI7A
chains in the Genus database with same CATH topology
3BY9A 1V9ZA 2J3TC 4UQIM 2O9CA 3TE8A 3MJQA 5DFYA 3RFBA 5HSQA 1OTAA 4OOLA 2A24B 1F98A 1OPXA 2M7VA 4PHTA 3LIFA 4YWZA 4NXBA 1DP8A 3E98A 4ETZA 3EQUA 4QPRA 4UQIS 2B18A 1WA9A 1TS0A 3FPVA 1G6OA 3PBNA 2VKSA 1G28A 4NXGA 3T4OA 4GCZA 3VOLA 4P6ZM 1T19A 5F69A 2KX6A 4WEJA 4GW9A 3F1PB 3IS2A 1GSXA 1V9YA 1UWPX 4E04A 3EGDC 1XJ4A 2O99A 3ZQ5A 2R78A 2VX8A 3KO6A 3KSFA 2W1RA 5HDDA 1T1CA 4Y2FA 3CUEA 2PR5A 3F1PA 3IS2B 4CLCB 4HI4A 2M1CA 5J4EA 4OOMA 1VB6A 2P04A 4GLQA 3P7NA 1Y28A 2ZMVA 3H9WA 4PKYA 3PBRA 4O0PA 2HF6A 2ZOHA 2O9AA 2EWWA 1XFQA 2P7JA 2Y8HA 3DBAA 4H6JB 1P9WA 5G4ZA 3FC7A 3PHYA 3T4SA 3MQQA 4CQHA 4I3IA 4MN7A 3E0YA 1OTDA 3VV4A 5FL3A 4MN6A 2J80A 2Z6DA 2WKRA 2ZMFA 2KLIA 2W3GA 2A2LA 3EWKA 4JGOA 4YOFA 1OT6A 5DKLA 4R3AA 3UB8A 5A8BA 2XRNA 1STZA 3LIEA 3S7NA 2NUTC 4KUOA 1W63Q 4WN5A 3E4OA 4Y3IA 3S7OA 3F1NA 5L8MA 2L4RA 3T4JA 3NOPC 4CLCC 3LIDA 1TS8A 2O0YA 4LRYC 1YAXA 2K31A 2M7UA 3TW8A 3C38A 4FOFA 1BYWA 5DF9A 4G3KA 2OAQ1 2VEAA 4XT2B 5KIZA 3LR0A 2W1TB 1IFQA 3F1NB 1MC0A 5HZHA 3K3CA 3TJZC 3ZYTA 4BBUA 3H82A 3PBQA 2Y79A 4Q0HA 4ETXA 5HPIA 1OTEA 3HJKA 4HY8A 5IU1A 3E4QA 2MJ6A 1LSWA 5TBMB 5HWVA 4XT2A 2D02A 2I9VA 2CMNA 3A0SA 4HP4A 3UB9A 3BJNA 3H82B 3MQOA 4I3JA 2PT7A 4WUJA 4ARZB 3NOTC 4HQAA 4KQDA 4MMNA 3RH8B 2L0WA 4GJ4A 3KSIA 3OC2A 5TBMA 4YNRA 4LLOB 4L0LA 5EFWA 5DJTA 1YSQA 4G3VA 4UEYA 2A24A 3FG8A 1N9LA 3BY8A 1P97A 4BMWA 5IS1A 2FZ0A 1DP6A 2INWA 3ULFA 1EW0A 3GECA 1XFNA 2B02A 4M4XA 3MR0A 3F1OB 1MZUA 1XJ3A 3B47A 4HOIA 3UMDA 2O9BA 4ME4A 3R7WB 1ZTUA 3HJIA 4I39A 1OTIA 2IA2A 3MXQA 3H7WB 2DMWA 2OOLA 1D7EA 4HP9A 5HD5A 4L9GA 4DMZA 4O8GA 1N9NA 4JGQA 4EESA 1YKDA 2W3FA 3NJAA 3LR3A 1GSWA 2GNXA 2K2NA 2OWJA 3EEAA 4NKPA 3R7WA 2VV6A 4PAUA 4WL9A 3H7WA 4P6ZS 3T4LA 4NEED 2VV8A 4G3WA 3MMHA 3JVVA 5KSHA 4EEPA 5AVFA 5HL6A 3UB7A 4CLCA 1XJ6A 2JHEA 5F5YA 2HV1A 2GX5A 3PYPA 5HWTA 3CUEC 3PBTA 1S4SA 1S66L 3C2WA 5DKKA 2QJ7A 3HCYA 3KSHA 2QHKA 2H28A 2QKPA 4WEKA 3OLOA 3LYXA 5K5BA 5HWWA 5HPFA 1YSPA 3MQ0A 1P9RA 4H6JA 5HDCA 3CI6A 4K08A 4DJ2A 2JKTM 4CLCD 4IHQA 3OCLA 5AVEA 2J3WA 2W27A 5AJGA 2JKTI 1TD5A 4EETB 5C5KA 2PD8A 3RTYA 1N9OA 2PYPA 3KX0X 4EUVA 3UE3A 4IJGA 5HDSA 1ODVA 3MF0A 4KQOA 2V9AA 4LRXC 1DP9A 1P0ZA 2PD7A 1NLZA 2VLGA 4JGPA 4JGRA 4HHDA 3NHQA 4Y5FA 3GDIA 2EA9A 3CWFA 3JVUA 2XSSA 3EOIA 2ZOIA 1W63M 2W3HA 2PDRA 4II7A 4BBVA 3BW6A 4WLAA 2OWHA 3S7PA 2W3DA 2XA7M 3A0VA 4R6LA 4GHIB 1H8MA 3EGXC 2YKFA 2WKPA 4NXEA 3V67A 3O5YA 1TF1A 1LT0A 3KYZA 3IBJA 2V1BA 4F3LA 2W3EA 3W2ZA 2GZAA 1NRJA 4GHIA 3C30A 3A0RA 2LB9A 1XJ2A 3OBFA 1JNUA 5CX7A 4LRZE 1S67L 1TS7A 3T50A 3VE3A 5F68A 4I5SA 4EW7A 1OJGA 2V0UA 1S4RA 3T4KA 4EQ1A 1H3QA 1LSXA 2D01A 3T4TA 5MC7A 3T4QA 4DN0A 1UGUA 2WKQA 3B33A 3K2NA 2PR6A 3UB6A 2QYBA 4B9OA 1D06A 1MKMA 3LICA 3MFXA 4CLCE 4EU0A 2VJWA 1ZHHB 2W0NA 3LI9A 4WF0A 2XROA 4LPZA 1OT9A 4R70A 3F1OA 3CAXA 1NLYA 4L9FA 5TJJA 2KDKA 2VGLS 4PKYG 1UWNX 3TRCA 3VE4A 2V1AA 3FPWA 1S1YA 3ICYA 3PBSA 4B93A 5J3WA 4O01A 3LR4A 3D72A 3R4KA 2HJ9C 2VGLM 1LL8A 3K3DA 3LIBA 1T18A 1DRMA 2V0WA 3BQAA 3UMEA 4HJ6A 3IBRA 4R38A 3EEHA 2VV7A 2NUPC 5DFXA 5J7EA 3OOVA 2YKHA 4GS9B 3B42A 3PR6A 1T1AA 3G6OA 3LIAA 3D3OA 4L9EA 2XA7S 5HD3A 4MN5A 4IUHA 4BJPA 4HH3A 2P08A 4KUKA 4IUKA 2JKRI 4MCWA 3KSGA 2PYRA 4I38A 2VA0A 5LBRA 4GS9A 1VHMA 1TS6A 4RQ9A 4MDZA 3SW1A 3U2AA 3EQVA 2OAP1 2EWVA 3NOUC 3PXPA 4Q0JA 1T1BA 1X0OA 4Q0IA 4FSFA 4EXOA 4BBTA 2JKRM 2PHYA 4Z1WA 3LR5A 2GJ3A 2KOIA 5DJUA 2J3TD 1GSVA 3KYQA 1S1ZA 3C8CA 2QJ5A 3BQ8A 3S7QA 4EERA 2K7SA 1F5MA 2G7UA 5I5LA 3LUQA 1F9IA 1KOUA 2W1TA 4HNBA 2Z6CA 2VZWA 2FH5A 4HJ3A 4HIAA 3OCNA 1IOUA 4DJ3A 5IT5A 4ZRRA 2HJEA 2QWSA 4AFIA 2ZBBA 1LSVA 4NXFA 5G4YA 3CITA 2LB5A 2JN7A 3UE6A 1OJ5A 1NWZA 2L1MA 2BASA 4HJ4A 4F3LB 4WELA 3CLOA 4ARZA 1OTBA 3LI8A 3BWLA 4I3AA 3P01A 5F6AA 3LFVA 4EEUA 3PBOA 2HGVA 4BWIA 3E4PA 4HH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VA0 A; 
#chains in the Genus database with same CATH topology
 2J3T C;  2O9C A;  4KG6 A;  4S2N C;  1HLU P;  1TVF A;  3RFB A;  5HSQ A;  1OTA A;  5GHY A;  5L07 A;  3UE0 A;  4KZ8 A;  4PHT A;  4NXB A;  3OPP A;  1CEF A;  4ZDX A;  1C3B A;  1G6O A;  2VKS A;  2A3U A;  4GCZ A;  4U0T A;  3CPT B;  4P6Z M;  3MXR A;  1T19 A;  4WEJ A;  1ES4 A;  3LO7 A;  1TEM A;  3ITB A;  3NY4 A;  1NRF A;  2OV5 A;  3G34 A;  2R78 A;  4X6T A;  3Q82 A;  2J8Y A;  2I72 A;  1NYM A;  1T1C A;  3IF6 B;  5HAR A;  3CUE A;  3UPO A;  3CMZ A;  4CLC B;  4KEN B;  4HI4 A;  3LGO A;  3PAE A;  4ZTK A;  4OPR A;  4S2N A;  4ZJ3 A;  2P04 A;  4GLQ A;  5L2F A;  3O3V A;  4PKY A;  5FAQ A;  1PI5 A;  3LY4 A;  4O0P A;  4QU3 A;  4CJN A;  3IF6 A;  2HF6 A;  2ZOH A;  3RJU A;  2P7J A;  4H6J B;  4MLL A;  1GA9 A;  1P9W A;  1BTL A;  5L09 A;  3QHY A;  4JXS A;  4CPK A;  3UDF A;  5FQJ A;  5FL3 A;  3DTK A;  2Z6D A;  1EWZ A;  2W3G A;  4JGO A;  5EOO A;  4WM9 A;  3UB8 A;  3Q07 A;  4MNR A;  1ACF A;  4E6W A;  3S7N A;  4KUO A;  3S7O A;  3SS3 A;  3LEZ A;  3NOP C;  4LRY C;  4C6Y A;  3TW8 A;  2IWC A;  2ZC4 B;  3MBZ A;  4G3K A;  2ZQ8 A;  2VEA A;  5KIZ A;  2Q9M A;  1GHI A;  3M2K A;  3GMW A;  3HLD A;  3ZYT A;  3PBQ A;  4ETX A;  1ERO A;  4PM7 A;  1OTE A;  1W79 A;  2PAV P;  5IU1 A;  3T1S A;  3E4Q A;  2MJ6 A;  1K25 A;  3U4L P;  4KZ4 A;  2X02 A;  1HTZ A;  1DJA A;  3V3R A;  1PYY A;  1AWI A;  3RH8 B;  2WGV A;  4Y0T A;  1XGJ A;  3KSI A;  3Q81 A;  3DAV A;  4YNR A;  3BLM A;  5DJT A;  3BEC A;  2HDR A;  1YSQ A;  4G3V A;  5CRF A;  1JWZ A;  3T12 B;  5IS1 A;  2FZ0 A;  1DP6 A;  1EW0 A;  4BL3 A;  1WYB A;  3MR0 A;  3F1O B;  3UMD A;  4N9K A;  5DVA A;  1DJB A;  4DF6 A;  4ME4 A;  5CHM A;  3HJI A;  4FUW A;  1D7E A;  4S2K A;  2Q0O A;  4OH0 A;  4PM9 A;  1CI9 A;  4O8G A;  1YKD A;  1BLH A;  1YMS A;  1K57 A;  3R7W A;  4WL9 A;  1NZO A;  5GLD A;  1KVL A;  2ZL1 A;  4D2O A;  2VV8 A;  3NDE A;  3MMH A;  1Q2P A;  5KZH A;  1IEM A;  2PBD P;  4PM5 A;  2E8J A;  2P9V A;  5KSH A;  4EEP A;  2ZQ9 A;  2JHE A;  4FH2 A;  1EI5 A;  3CUE C;  4NG2 A;  1S66 L;  3C2W A;  3DW0 A;  1YT4 A;  2QJ7 A;  4C75 A;  4WMC D;  1PW1 A;  1RP5 A;  5HDC A;  4IHQ A;  3IXH A;  2J3W A;  2JKT I;  4EET B;  2JC7 A;  2PD8 A;  3RTY A;  1N9O A;  3KX0 X;  4QWO A;  1XXM A;  4KQO A;  1DP9 A;  2PD7 A;  2JCH A;  1XA7 A;  2FFF B;  3RXW A;  3GDI A;  3JVU A;  1W63 M;  5KSC A;  4K0X A;  4BBV A;  3BW6 A;  3S7P A;  2W3D A;  4OOY A;  4ESP A;  4QY6 A;  2ZC7 A;  5D3O A;  1W5D A;  2JKF A;  4F3L A;  3W2Z A;  3C30 A;  3MFD A;  2LB9 A;  1L0G A;  2WKI A;  1XJ2 A;  3M2J A;  1D1J A;  3IF5 A;  4WZ5 C;  1QMF A;  2V0U A;  2H5S A;  4EQ1 A;  1H3Q A;  5FQK A;  5MC7 A;  3O88 A;  5EUA A;  2ZQA A;  1UGU A;  2WKQ A;  3HRE A;  3K2N A;  2B5R A;  3LIC A;  4GDB A;  2HP5 A;  2Y2I A;  2VJW A;  2W0N A;  3LI9 A;  3IWI A;  1K38 A;  2EX6 A;  2HPB A;  3T1R A;  2G2U A;  4MBH A;  5CXW A;  3BEB A;  4KQQ A;  3G2Z A;  3ICY A;  3PBS A;  4K0W A;  3R4K A;  2HJ9 C;  2VGL M;  5CEC A;  4N9L A;  1NZU A;  3K3D A;  5CED A;  2VV7 A;  3HL9 A;  4N1X A;  5J7E A;  3ZVW A;  1BSG A;  3B42 A;  1T1A A;  5EVI D;  1BUL A;  5IHV A;  2WYX A;  4U3T A;  4IUK A;  2JKR I;  3KSG A;  4HBU A;  4OQI A;  2Y2K A;  1KGF A;  2PYR A;  3W8K A;  2VGK A;  4GS9 A;  4RQ9 A;  2XEP A;  4QHC A;  2OAP 1;  5FI6 A;  4Q0I A;  2WGI A;  1I2W A;  2JKR M;  4Z1W A;  1K4F A;  2V8C A;  2ZM0 A;  3C8C A;  2ZQC A;  4EER A;  2K7S A;  4S2O A;  3V39 A;  4XUZ A;  1ERM A;  3T1X A;  1KOU A;  4HNB A;  3LEQ A;  5HAP A;  4HJ3 A;  2R9X A;  2WAD A;  5IT5 A;  3IWO A;  5EOE A;  4Q8I A;  2QWS A;  5CEB A;  4OQ0 A;  4YIN A;  1NWZ A;  2L1M A;  2BAS A;  3CG5 A;  4WEL A;  4O7D A;  2JBF A;  4S2P A;  4IBR A;  3P01 A;  2XH9 A;  4HH2 A;  4R3J A;  4R3B A;  5CTN A;  3E2K A;  1ONH A;  3WRZ A;  4UQI M;  3TE8 A;  5DFY A;  1O7E A;  4OOL A;  2A24 B;  3MZE A;  5EVE A;  2VK3 A;  3P98 A;  4P0M A;  4OVD A;  4YWZ A;  1DP8 A;  4QPR A;  1WA9 A;  1TS0 A;  3O86 A;  3FPV A;  3PBN A;  1O07 A;  1G28 A;  4NXG A;  3DTI A;  4OQH A;  1WE4 A;  1PI4 A;  5F69 A;  5JYP A;  1BLS A;  2EXB A;  3QP4 A;  3IS2 A;  4B88 A;  1XJ4 A;  2O99 A;  1IYS A;  1W7F A;  5EVI A;  3KO6 A;  1KDW A;  3UDI A;  5FEG A;  4E3J A;  3A3D A;  4DRT A;  1SZV A;  5FDS A;  5J8X A;  4QD4 A;  4BD0 A;  1FOF A;  3F1P A;  3IS2 B;  4Y0U A;  1H8Y A;  2M1C A;  3VFF A;  3W4O A;  1KE4 A;  2UWX A;  2ZMV A;  3H9W A;  2Z2M B;  4R4S A;  2EWW A;  1XFQ A;  2Y8H A;  1YQS A;  2XR0 A;  5DF7 A;  3C4O A;  5G4Z A;  3PHY A;  1PWC A;  4MN7 A;  1OTD A;  4MN6 A;  2J80 A;  1IYQ A;  2WKR A;  2ZMF A;  1MY8 A;  2KLI A;  3CHW P;  5DKL A;  2XD5 A;  3L9K A;  2V20 A;  2XRN A;  1S0W A;  2NUT C;  3G30 A;  1W63 Q;  4WN5 A;  3T4J A;  5L8M A;  2Y2M A;  1KE3 A;  2A49 A;  4CLC C;  3N7W A;  1TS8 A;  2O0Y A;  1L0F A;  2M7U A;  3UNW A;  4KZ7 A;  5DF9 A;  2CC1 A;  4F94 A;  2W1T B;  1IFQ A;  3ISG A;  1J9M A;  3K3C A;  3TJZ C;  2GDN A;  4X56 A;  2Y79 A;  2XGN A;  5GL9 A;  4R4R A;  1CK3 A;  3NEC A;  3QP1 A;  2Y4A A;  4HES A;  1ONG A;  2V1Z A;  1LSW A;  5TBM B;  3WRT A;  1JVJ A;  3N6I A;  4ARZ B;  1FR1 A;  3NOT C;  4C3Q A;  3DWZ A;  2L0W A;  1MWR A;  4GDN A;  3AGE A;  4LLO B;  3C4P A;  4KZ5 A;  4L0L A;  5GLB A;  2DNS A;  3Q7V A;  4DXC A;  2EFU A;  2DRW A;  2INW A;  3ULF A;  3BFE A;  3GEC A;  1XFN A;  2B02 A;  2P74 A;  3HUO A;  4EQI A;  1J3W A;  4PPR A;  5KMW A;  1MZU A;  4LV1 A;  4B4Z A;  1OTI A;  2IA2 A;  5EM1 A;  4PM6 A;  3IHA A;  3AGD A;  4L9G A;  3NUL A;  4JGQ A;  2EXA A;  4LV0 A;  2W3F A;  1GSW A;  2GNX A;  1PZO A;  3KYE A;  5EM0 A;  3H7W A;  4HEF A;  5E43 A;  3T4L A;  5F83 A;  5EV0 A;  4G3W A;  3IXG A;  4WZ4 A;  3T1Q B;  3IXB A;  3UB7 A;  3O87 A;  4CLC A;  1XJ6 A;  1K54 C;  2EX2 A;  2HV1 A;  2GX5 A;  3PYP A;  3PBT A;  1S4S A;  1H0M A;  4JXV A;  5M19 A;  5K5B A;  5A93 A;  5HPF A;  3IX3 A;  3UDX A;  2JKT M;  3A3J A;  4GOG A;  3OCL A;  5AVE A;  4X53 A;  3BLS A;  5AJG A;  5C5K A;  2PU2 A;  5F82 A;  3GSG A;  1G6A A;  1BLP A;  4P85 A;  3IWQ A;  1ODV A;  4OQG A;  1YLP A;  1P0Z A;  2E8I A;  1NLZ A;  2VLG A;  3MKE A;  4OP8 A;  4FH4 A;  3NHQ A;  5TR7 A;  3CWF A;  5FAP A;  1RGZ A;  2XSS A;  2WAE A;  2W3H A;  5HAI A;  2BLS A;  3M6H A;  1CI8 A;  3HVF A;  5GLA A;  4OLG A;  2ZM2 A;  2OWH A;  3TSG A;  5CER A;  2XA7 M;  3A0V A;  3IF6 C;  4S2L A;  1SDE A;  4GHI B;  1H8M A;  3EGX C;  3SOI A;  2WKP A;  4NXE A;  3ZG8 B;  5TFQ A;  2ZQD A;  3OPH A;  2GZA A;  2XLN A;  3S1Y A;  3GTC A;  3OBF A;  1JNU A;  4IBX A;  2J9P A;  1IEL A;  4LRZ E;  3VE3 A;  5F68 A;  4EW7 A;  1ZG4 A;  3DWK A;  1OJG A;  1RGY A;  4Y7P A;  5I94 A;  5A90 A;  1M6K A;  2ZMA A;  1FIK A;  4DXB A;  4DDY A;  1LSX A;  3IX8 A;  3N8R A;  2PR6 A;  1VQQ A;  3MFX A;  4RVA A;  1M40 A;  5U47 A;  4DE2 A;  3LCE A;  4WF0 A;  4R0Q A;  1CEG A;  3JYI A;  4JXG A;  4RX2 A;  1OT9 A;  4R70 A;  1E4D A;  4JPM A;  3FKW A;  4WMC A;  3CAX A;  2RL3 A;  4PKY G;  2V1A A;  3FPW A;  2BG1 A;  1SKO A;  2Y55 A;  1G5U A;  3GR2 A;  1SKF A;  1LL8 A;  3NIA A;  1YLW A;  1H5X A;  5FQM A;  2X01 A;  2V0W A;  3EEH A;  4GS9 B;  5FDH A;  3LIA A;  5DF8 A;  1WYC A;  1TDG A;  4IUH A;  4R1G A;  2XF3 A;  4HH3 A;  2P08 A;  4KZ3 A;  4MCW A;  3GVB A;  4P6B A;  1H8Z A;  5AQ9 A;  4UA9 A;  3A3F A;  4ZJ1 A;  1TS6 A;  3SW1 A;  4Z9Q A;  3WS4 A;  3MSH A;  3ZG9 B;  1ALQ A;  1K55 C;  5AQA A;  2PHY A;  2ZC5 B;  4UA7 A;  2J3T D;  1GSV A;  2QJ5 A;  3BQ8 A;  3S7Q A;  3TG9 A;  4KZA A;  3ZNY A;  4S2J A;  2FH5 A;  4UAA A;  2AVX A;  1K6S A;  4ZRR A;  2HJE A;  5JYO A;  3Q1F A;  4Y13 A;  4JF5 A;  1KE0 A;  4DKI A;  1ZKJ A;  5DTS A;  1PRQ A;  2J9O A;  1ZC2 A;  4NXF A;  2LB5 A;  2ZJ9 A;  4HJ4 A;  4FD8 A;  1OTB A;  3VMA A;  2BTF P;  1JWP A;  1KDS A;  5F6A A;  4MBK A;  5A92 A;  3PBO A;  4BWI A;  3E4P A;  4QB8 A;  3BY9 A;  4EUZ A;  1V9Z A;  3D9Y A;  4LCM A;  4LEN A;  4Y0O A;  4GD8 A;  1PW8 A;  4E3O A;  2M7V A;  3FYZ A;  5L10 A;  5HW3 A;  3LIF A;  3MZD A;  3E98 A;  4ETZ A;  3EQU A;  3UY6 A;  5E2F A;  3OPR A;  1LI9 A;  3G35 A;  4A5R A;  4E3N A;  3T4O A;  1L0E A;  5EVI B;  3VOL A;  5CGX A;  2KX6 A;  4HBT A;  3VP2 A;  1V9Y A;  1UWP X;  3MS6 A;  4E04 A;  3ZQ5 A;  1FSY A;  2IWD A;  3IXD A;  5G18 A;  3WS5 A;  2HZ5 A;  3KSF A;  1BUE A;  2P9V B;  4Y2F A;  4GZB A;  4EWF A;  4RA7 A;  1FCM A;  5J4E A;  2XFS A;  4OOM A;  4ZAM A;  5FAS A;  2Y59 A;  3PBR A;  5HL1 A;  1QME A;  2O9A A;  3DBA A;  2XDM A;  4XXR A;  3FWL A;  3C5A A;  1ESI A;  3FC7 A;  3MQQ A;  3IQA A;  4I3I A;  4UHU A;  3E0Y A;  1PFL A;  4EBL A;  1OT6 A;  4R3A A;  3ZHH A;  1STZ A;  3LIE A;  4Y3I A;  3E4O A;  2VGJ A;  2EX9 A;  2L4R A;  3N8S A;  3PAG A;  3LID A;  4JF4 A;  1YAX A;  2K31 A;  3C38 A;  1VEU A;  5HAQ A;  1YPR A;  2OAQ 1;  3IT9 A;  4JBF A;  4XT2 B;  5GLC A;  3LR0 A;  3F1N B;  1MC0 A;  3H82 A;  5HPI A;  4Q0H A;  4GNU A;  1Q2Q A;  5FQQ A;  1YLZ A;  3VP4 A;  4P87 A;  4S2I A;  3A0S A;  3IHB A;  5EEC A;  3UB9 A;  3BJN A;  3H82 B;  1FR6 A;  2PT7 A;  2Y2P A;  3NBL A;  3FV7 A;  4WUJ A;  4MMN A;  1PNE A;  3FKV A;  3G2Y A;  4GJ4 A;  4Y17 A;  4OP5 A;  5EFW A;  4WYY A;  4ZJ2 A;  3NC8 A;  4LFU A;  3FG8 A;  1N9L A;  1P97 A;  3L7H A;  4S2M A;  1XKZ A;  1K55 A;  3SS4 A;  4XUX A;  3BFD A;  3UN7 A;  1XJ3 A;  3B47 A;  2XD1 A;  1KVM A;  3Q7V B;  3HUN A;  3R7W B;  3MXQ A;  2OOL A;  2ZL1 B;  1IKG A;  3WWX A;  4E3I A;  3CPT A;  3UPN A;  1PIO A;  4HP9 A;  5HD5 A;  4DMZ A;  4ID4 A;  2Y91 A;  3NJA A;  3LR3 A;  2OWJ A;  4PAU A;  3LY3 A;  4RX3 A;  1W8Y A;  2OLU A;  1BZA A;  5AVF A;  5F5Y A;  2V2F F;  3VOY A;  3W4P A;  3VOZ A;  5CHJ A;  1N9B A;  2WZX A;  3FZC A;  2RCX A;  3G31 A;  3KSH A;  2QHK A;  4X55 A;  4GN2 A;  2R9W A;  3OLO A;  5HWW A;  3MQ0 A;  4WZ5 A;  1P9R A;  2Y2H A;  4H6J A;  3CI6 A;  5E2G A;  4DJ2 A;  4BL2 A;  4CLC D;  5TGF A;  3VP0 A;  3HLC A;  1XX2 A;  1CJF A;  1TD5 A;  5GHX A;  1LHY A;  2EFX A;  4EUV A;  3UE3 A;  3P09 A;  2V9A A;  4LRX C;  1ZG6 A;  2Y2N A;  2ZC6 B;  5BOH A;  2XQZ A;  4JGP A;  2EA9 A;  3NI9 A;  3EOI A;  2ZOI A;  2EX8 A;  1FSW A;  4WLA A;  4UA6 A;  3SS5 A;  2WKH A;  1N4O A;  2YKF A;  3HLG A;  1KGG A;  3O5Y A;  1LT0 A;  3IBJ A;  5E2H A;  4JLF A;  4KZB A;  1PWG A;  4GHI A;  3A0R A;  1CQA A;  3QP6 A;  3V3S A;  5CX7 A;  3N8L A;  3T50 A;  1IYO A;  4I5S A;  2Y2Q A;  5HX9 A;  1SHV A;  3MKF A;  5A91 A;  3T4K A;  5EVL A;  3T4Q A;  4DN0 A;  3UB6 A;  3W4Q A;  1MKM A;  1Z6F A;  4EU0 A;  4FCF A;  1NJ4 A;  1ZHH B;  2IWB A;  4DE1 A;  4LPZ A;  3V5M A;  3M6B A;  3B3X A;  3WS1 A;  3F1O A;  3VSL A;  1IYP A;  1ES3 A;  5TJJ A;  4BEN A;  4KZ6 A;  3CZD A;  3SH8 A;  1K56 A;  3HLW A;  3BFG A;  2DCF A;  3ZDJ A;  4B93 A;  1VM1 A;  1YLJ A;  5J3W A;  3LR4 A;  3D72 A;  3UO9 A;  3TOI A;  3RXX A;  3SH7 A;  1HD8 A;  3DTM A;  5E2E A;  3DTE A;  1T18 A;  4DE3 A;  3UME A;  4OPZ A;  4HJ6 A;  3IBR A;  4R38 A;  1SKO B;  1GHP A;  2NUP C;  5FI2 A;  1L3L A;  1U60 A;  2YKH A;  3PR6 A;  3G6O A;  3D3O A;  2Y2G A;  2WZZ A;  3A3E A;  4JKT A;  4I38 A;  1ESU A;  2VA0 A;  5LBR A;  1VHM A;  2HDU A;  4MDZ A;  3U2A A;  3IH9 A;  3MZF A;  3ZG7 B;  3PXP A;  1X0O A;  4FSF A;  4BBT A;  1FCO A;  5FAO A;  5F1G A;  1XGI A;  3LR5 A;  2GJ3 A;  1NYY A;  2WAF A;  4GD6 A;  3KYQ A;  1S1Z A;  4BD1 A;  3QNB A;  1F5M A;  1Z09 A;  3LUQ A;  2W1T A;  4N92 A;  2VZW A;  3BRM A;  4DJ3 A;  1LL9 A;  5AQ7 A;  4AFI A;  2ZBB A;  3VP3 A;  5G4Y A;  1RCJ A;  2JN7 A;  2QZ6 A;  4NK3 A;  5GHZ A;  1OJ5 A;  3ZG0 A;  1MKI A;  3CLO A;  2UV0 E;  3LI8 A;  2C5W B;  2HDS A;  3BWL A;  1HVB A;  4I3A A;  4BQM A;  4E6X A;  2J7V A;  3LFV A;  4EEU A;  2HGV A;  3I7J A;  1YM1 A;  3HUM A;  3MJQ A;  4M3K A;  1F98 A;  1OPX A;  4Y15 A;  5FSR A;  1NY0 A;  4UQI S;  3S4X A;  1NXY A;  3ZFZ A;  3UPP A;  2B18 A;  1ES5 A;  4KZ9 A;  4H8R A;  1DJC A;  5AQB A;  4GB7 A;  3A3I A;  3QNC A;  1ERQ A;  4N1H A;  2HP6 A;  3BYD A;  4GW9 A;  1IKI A;  3F1P B;  3QP5 A;  1VET A;  1JWV A;  1GSX A;  3EGD C;  4X1M A;  3GQZ A;  2VX8 A;  3ZVT A;  1FCN A;  2W1R A;  5HDD A;  1LI0 A;  5FAT A;  3OPL A;  4RYE A;  1S6R A;  2PR5 A;  2FFY A;  4KG5 A;  4X1L A;  1VB6 A;  2Y2L A;  3P7N A;  1E3U D;  1Y28 A;  2ZC3 B;  1MBL A;  5HFO A;  2G2W A;  3V50 A;  1K54 A;  4MBF A;  3WS2 A;  2Y2J A;  1I5Q A;  1PZP A;  3T4S A;  4CQH A;  4KG2 A;  4EBP A;  4JF6 A;  3UB5 P;  3VV4 A;  2C6W B;  2XFT A;  2A2L A;  3EWK A;  4YOF A;  3ZG5 A;  4LCL A;  4MEZ A;  1BLC A;  5A8B A;  4WBG A;  1K0K A;  3F1N A;  5FQI A;  1E25 A;  1ES2 A;  4EV4 A;  4FOF A;  1BYW A;  1MPL A;  3SZT A;  5EPH A;  5HZH A;  5CGS A;  4BBU A;  3HJK A;  3AGF A;  4HY8 A;  4IVI A;  1SDN A;  1YLT A;  5HWV A;  4XT2 A;  2D02 A;  2I9V A;  2CMN A;  2ZLY A;  4HP4 A;  1K57 C;  3MQO A;  4I3J A;  5M18 A;  4HQA A;  4KQD A;  4QJG A;  2OSU A;  1TDL A;  3PTE A;  3OC2 A;  5TBM A;  2OLV A;  4FTX A;  3VSK A;  4UEY A;  2A24 A;  5FQ9 A;  3BY8 A;  4BMW A;  1JTD A;  1L0D A;  4NET A;  4M4X A;  1Y4O A;  1JTG A;  3WS0 A;  5CTM A;  4X68 A;  4HOI A;  2O9B A;  1ZTU A;  4I39 A;  2ZQ7 A;  3H7W B;  2DMW A;  1DY6 A;  2H10 A;  1YLY A;  3D4F A;  1N9N A;  2JKG A;  4EES A;  2K2N A;  1VET B;  3EEA A;  3NDG A;  4NKP A;  2VV6 A;  4P6Z S;  4NEE D;  3UE1 A;  3JPU A;  5F1F A;  3JVV A;  1XP4 A;  5HL6 A;  4EBN A;  4K91 A;  5HWT A;  5DKK A;  4E3K A;  2Q9N A;  2XK1 A;  3HCY A;  3E2L A;  2H28 A;  2QKP A;  4WEK A;  4R23 A;  4U0X A;  4IVK A;  3LYX A;  1YSP A;  4OKP A;  5CGW A;  4K08 A;  3ZGA B;  1XPB A;  2W27 A;  3IH8 A;  4YFM A;  2WGW A;  2PYP A;  3OZH A;  4LV2 A;  3GRJ A;  5EVI C;  4IJG A;  5HDS A;  3MF0 A;  1MXO A;  4X69 A;  3VFH A;  1MWS A;  2PRF A;  3QP2 A;  3HBR A;  4JGR A;  4HHD A;  5EE8 A;  4Y5F A;  1XA1 A;  2WKE A;  3S22 A;  4KQR A;  4LV3 A;  2PDR A;  2PBY A;  4II7 A;  2QPN A;  4PM8 A;  4R6L A;  5DTK A;  4OLD A;  1YMX A;  2ZD8 A;  3V67 A;  4OON A;  1TF1 A;  3KYZ A;  1E3U A;  1GA0 A;  2V1B A;  2W3E A;  1MWU A;  1F2K A;  1NRJ A;  1Y54 A;  2HDQ A;  1FIL A;  1CF0 A;  1S67 L;  1TS7 A;  3HLF A;  2B95 A;  4BLM A;  1S4R A;  3NCK A;  2D01 A;  3T4T A;  4E3M A;  1K4E A;  1LLB A;  3B33 A;  2QYB A;  4B9O A;  1D06 A;  3ZCZ A;  2V8F A;  4CLC E;  3GV9 A;  4OPY A;  1OME A;  5M1A A;  4DDS A;  4E3L A;  2XRO A;  2JE5 A;  1K56 D;  3IX4 A;  1NLY A;  4L9F A;  2KDK A;  2VGL S;  1UWN X;  1K6R A;  3TRC A;  5DTT A;  3CJM A;  3VE4 A;  1A0K A;  1S1Y A;  4O01 A;  4DE0 A;  2H0T A;  3Q7Z A;  1AXB A;  3QP8 A;  3SH9 A;  2Z2L B;  1KGE A;  3ITA A;  4D60 A;  3LIB A;  1DRM A;  3BQA A;  3MXS A;  3ZNT A;  1BT5 A;  1I2S A;  4QY5 A;  3C7V A;  5DFX A;  3OOV A;  3HLE A;  4ZBE A;  4L9E A;  2XA7 S;  2ZM8 A;  4MN5 A;  5HD3 A;  3VP1 A;  1SCW A;  4BJP A;  4KUK A;  1L2S A;  1MWT A;  1GHM A;  4X25 A;  1GCE A;  3BFC A;  3EQV A;  2EWV A;  3NOU C;  1FQG A;  1W8Q A;  4Q0J A;  1T1B A;  2WGW B;  2WUQ A;  3N4I A;  2X71 A;  3BFF A;  4EXO A;  1G68 A;  4IED A;  4PMA A;  3HLB A;  2KOI A;  5DJU A;  2Y2O A;  1PWD A;  2WK0 A;  1VEU B;  3G4P A;  5FA7 A;  4OPQ A;  2G7U A;  5I5L A;  4JXW A;  1F9I A;  3BM6 A;  2Z6C A;  2ACG A;  4HIA A;  3OCN A;  5FEF A;  1IOU A;  4LGW A;  4B4X A;  1HZO A;  2H0Y A;  1LSV A;  3G32 A;  3CIT A;  3C7U A;  3UE6 A;  4GKU A;  2PU4 A;  4F3L B;  4ARZ A;  2QMI A;  1LL5 A;  5CHU A;  2HP9 A;  5FI7 A; 
#chains in the Genus database with same CATH homology
 3BY9 A;  1V9Z A;  2J3T C;  4UQI M;  2O9C A;  3TE8 A;  3MJQ A;  5DFY A;  3RFB A;  5HSQ A;  1OTA A;  4OOL A;  2A24 B;  1F98 A;  1OPX A;  2M7V A;  4PHT A;  3LIF A;  4YWZ A;  4NXB A;  1DP8 A;  3E98 A;  4ETZ A;  3EQU A;  4QPR A;  4UQI S;  2B18 A;  1WA9 A;  1TS0 A;  3FPV A;  1G6O A;  3PBN A;  2VKS A;  1G28 A;  4NXG A;  3T4O A;  4GCZ A;  3VOL A;  4P6Z M;  1T19 A;  5F69 A;  2KX6 A;  4WEJ A;  4GW9 A;  3F1P B;  3IS2 A;  1GSX A;  1V9Y A;  1UWP X;  4E04 A;  3EGD C;  1XJ4 A;  2O99 A;  3ZQ5 A;  2R78 A;  2VX8 A;  3KO6 A;  3KSF A;  2W1R A;  5HDD A;  1T1C A;  4Y2F A;  3CUE A;  2PR5 A;  3F1P A;  3IS2 B;  4CLC B;  4HI4 A;  2M1C A;  5J4E A;  4OOM A;  1VB6 A;  2P04 A;  4GLQ A;  3P7N A;  1Y28 A;  2ZMV A;  3H9W A;  4PKY A;  3PBR A;  4O0P A;  2HF6 A;  2ZOH A;  2O9A A;  2EWW A;  1XFQ A;  2P7J A;  2Y8H A;  3DBA A;  4H6J B;  1P9W A;  5G4Z A;  3FC7 A;  3PHY A;  3T4S A;  3MQQ A;  4CQH A;  4I3I A;  4MN7 A;  3E0Y A;  1OTD A;  3VV4 A;  5FL3 A;  4MN6 A;  2J80 A;  2Z6D A;  2WKR A;  2ZMF A;  2KLI A;  2W3G A;  2A2L A;  3EWK A;  4JGO A;  4YOF A;  1OT6 A;  5DKL A;  4R3A A;  3UB8 A;  5A8B A;  2XRN A;  1STZ A;  3LIE A;  3S7N A;  2NUT C;  4KUO A;  1W63 Q;  4WN5 A;  3E4O A;  4Y3I A;  3S7O A;  3F1N A;  5L8M A;  2L4R A;  3T4J A;  3NOP C;  4CLC C;  3LID A;  1TS8 A;  2O0Y A;  4LRY C;  1YAX A;  2K31 A;  2M7U A;  3TW8 A;  3C38 A;  4FOF A;  1BYW A;  5DF9 A;  4G3K A;  2OAQ 1;  2VEA A;  4XT2 B;  5KIZ A;  3LR0 A;  2W1T B;  1IFQ A;  3F1N B;  1MC0 A;  5HZH A;  3K3C A;  3TJZ C;  3ZYT A;  4BBU A;  3H82 A;  3PBQ A;  2Y79 A;  4Q0H A;  4ETX A;  5HPI A;  1OTE A;  3HJK A;  4HY8 A;  5IU1 A;  3E4Q A;  2MJ6 A;  1LSW A;  5TBM B;  5HWV A;  4XT2 A;  2D02 A;  2I9V A;  2CMN A;  3A0S A;  4HP4 A;  3UB9 A;  3BJN A;  3H82 B;  3MQO A;  4I3J A;  2PT7 A;  4WUJ A;  4ARZ B;  3NOT C;  4HQA A;  4KQD A;  4MMN A;  3RH8 B;  2L0W A;  4GJ4 A;  3KSI A;  3OC2 A;  5TBM A;  4YNR A;  4LLO B;  4L0L A;  5EFW A;  5DJT A;  1YSQ A;  4G3V A;  4UEY A;  2A24 A;  3FG8 A;  1N9L A;  3BY8 A;  1P97 A;  4BMW A;  5IS1 A;  2FZ0 A;  1DP6 A;  2INW A;  3ULF A;  1EW0 A;  3GEC A;  1XFN A;  2B02 A;  4M4X A;  3MR0 A;  3F1O B;  1MZU A;  1XJ3 A;  3B47 A;  4HOI A;  3UMD A;  2O9B A;  4ME4 A;  3R7W B;  1ZTU A;  3HJI A;  4I39 A;  1OTI A;  2IA2 A;  3MXQ A;  3H7W B;  2DMW A;  2OOL A;  1D7E A;  4HP9 A;  5HD5 A;  4L9G A;  4DMZ A;  4O8G A;  1N9N A;  4JGQ A;  4EES A;  1YKD A;  2W3F A;  3NJA A;  3LR3 A;  1GSW A;  2GNX A;  2K2N A;  2OWJ A;  3EEA A;  4NKP A;  3R7W A;  2VV6 A;  4PAU A;  4WL9 A;  3H7W A;  4P6Z S;  3T4L A;  4NEE D;  2VV8 A;  4G3W A;  3MMH A;  3JVV A;  5KSH A;  4EEP A;  5AVF A;  5HL6 A;  3UB7 A;  4CLC A;  1XJ6 A;  2JHE A;  5F5Y A;  2HV1 A;  2GX5 A;  3PYP A;  5HWT A;  3CUE C;  3PBT A;  1S4S A;  1S66 L;  3C2W A;  5DKK A;  2QJ7 A;  3HCY A;  3KSH A;  2QHK A;  2H28 A;  2QKP A;  4WEK A;  3OLO A;  3LYX A;  5K5B A;  5HWW A;  5HPF A;  1YSP A;  3MQ0 A;  1P9R A;  4H6J A;  5HDC A;  3CI6 A;  4K08 A;  4DJ2 A;  2JKT M;  4CLC D;  4IHQ A;  3OCL A;  5AVE A;  2J3W A;  2W27 A;  5AJG A;  2JKT I;  1TD5 A;  4EET B;  5C5K A;  2PD8 A;  3RTY A;  1N9O A;  2PYP A;  3KX0 X;  4EUV A;  3UE3 A;  4IJG A;  5HDS A;  1ODV A;  3MF0 A;  4KQO A;  2V9A A;  4LRX C;  1DP9 A;  1P0Z A;  2PD7 A;  1NLZ A;  2VLG A;  4JGP A;  4JGR A;  4HHD A;  3NHQ A;  4Y5F A;  3GDI A;  2EA9 A;  3CWF A;  3JVU A;  2XSS A;  3EOI A;  2ZOI A;  1W63 M;  2W3H A;  2PDR A;  4II7 A;  4BBV A;  3BW6 A;  4WLA A;  2OWH A;  3S7P A;  2W3D A;  2XA7 M;  3A0V A;  4R6L A;  4GHI B;  1H8M A;  3EGX C;  2YKF A;  2WKP A;  4NXE A;  3V67 A;  3O5Y A;  1TF1 A;  1LT0 A;  3KYZ A;  3IBJ A;  2V1B A;  4F3L A;  2W3E A;  3W2Z A;  2GZA A;  1NRJ A;  4GHI A;  3C30 A;  3A0R A;  2LB9 A;  1XJ2 A;  3OBF A;  1JNU A;  5CX7 A;  4LRZ E;  1S67 L;  1TS7 A;  3T50 A;  3VE3 A;  5F68 A;  4I5S A;  4EW7 A;  1OJG A;  2V0U A;  1S4R A;  3T4K A;  4EQ1 A;  1H3Q A;  1LSX A;  2D01 A;  3T4T A;  5MC7 A;  3T4Q A;  4DN0 A;  1UGU A;  2WKQ A;  3B33 A;  3K2N A;  2PR6 A;  3UB6 A;  2QYB A;  4B9O A;  1D06 A;  1MKM A;  3LIC A;  3MFX A;  4CLC E;  4EU0 A;  2VJW A;  1ZHH B;  2W0N A;  3LI9 A;  4WF0 A;  2XRO A;  4LPZ A;  1OT9 A;  4R70 A;  3F1O A;  3CAX A;  1NLY A;  4L9F A;  5TJJ A;  2KDK A;  2VGL S;  4PKY G;  1UWN X;  3TRC A;  3VE4 A;  2V1A A;  3FPW A;  1S1Y A;  3ICY A;  3PBS A;  4B93 A;  5J3W A;  4O01 A;  3LR4 A;  3D72 A;  3R4K A;  2HJ9 C;  2VGL M;  1LL8 A;  3K3D A;  3LIB A;  1T18 A;  1DRM A;  2V0W A;  3BQA A;  3UME A;  4HJ6 A;  3IBR A;  4R38 A;  3EEH A;  2VV7 A;  2NUP C;  5DFX A;  5J7E A;  3OOV A;  2YKH A;  4GS9 B;  3B42 A;  3PR6 A;  1T1A A;  3G6O A;  3LIA A;  3D3O A;  4L9E A;  2XA7 S;  5HD3 A;  4MN5 A;  4IUH A;  4BJP A;  4HH3 A;  2P08 A;  4KUK A;  4IUK A;  2JKR I;  4MCW A;  3KSG A;  2PYR A;  4I38 A;  2VA0 A;  5LBR A;  4GS9 A;  1VHM A;  1TS6 A;  4RQ9 A;  4MDZ A;  3SW1 A;  3U2A A;  3EQV A;  2OAP 1;  2EWV A;  3NOU C;  3PXP A;  4Q0J A;  1T1B A;  1X0O A;  4Q0I A;  4FSF A;  4EXO A;  4BBT A;  2JKR M;  2PHY A;  4Z1W A;  3LR5 A;  2GJ3 A;  2KOI A;  5DJU A;  2J3T D;  1GSV A;  3KYQ A;  1S1Z A;  3C8C A;  2QJ5 A;  3BQ8 A;  3S7Q A;  4EER A;  2K7S A;  1F5M A;  2G7U A;  5I5L A;  3LUQ A;  1F9I A;  1KOU A;  2W1T A;  4HNB A;  2Z6C A;  2VZW A;  2FH5 A;  4HJ3 A;  4HIA A;  3OCN A;  1IOU A;  4DJ3 A;  5IT5 A;  4ZRR A;  2HJE A;  2QWS A;  4AFI A;  2ZBB A;  1LSV A;  4NXF A;  5G4Y A;  3CIT A;  2LB5 A;  2JN7 A;  3UE6 A;  1OJ5 A;  1NWZ A;  2L1M A;  2BAS A;  4HJ4 A;  4F3L B;  4WEL A;  3CLO A;  4ARZ A;  1OTB A;  3LI8 A;  3BWL A;  4I3A A;  3P01 A;  5F6A A;  3LFV A;  4EEU A;  3PBO A;  2HGV A;  4BWI A;  3E4P A;  4HH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...