1DJBA

Structure of beta-lactamase precursor, s70a mutant, at 298k
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYAATSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
publication title Structure and kinetics of the beta-lactamase mutants S70A and K73H from Staphylococcus aureus PC1.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 96
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1996-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1djbA00
1NJ4A 2Z2LB 4KENB 1YM1A 3HLFA 3V3RA 1H5XA 3IWQA 4JXVA 5HAPA 2HDSA 2XF3A 5F1FA 4EBLA 4KZ8A 1AXBA 4GZBA 5FSRA 1C3BA 1FCMA 4WEKA 5EVIB 3ZVTA 3HLWA 3M2KA 2R9WA 2EX8A 4S2PA 1FQGA 2P9VB 3C4OA 4RYEA 3N8RA 4LV1A 3BM6A 3IXGA 4FH4A 5FI7A 5TGFA 4ZAMA 4KZ7A 3G4PA 3O3VA 2Y2IA 1K4FA 3GTCA 1K4EA 2ZC3B 3IT9A 2FFFB 3IF6B 1N9BA 3M6BA 1HD8A 1E4DA 2EFXA 4HBUA 5A90A 5IHVA 5M1AA 1PIOA 4JLFA 4Z9QA 1W5DA 1NYYA 4NETA 1O7EA 2XFSA 2J9OA 4BQMA 3Q1FA 5E2FA 1CI8A 5FA7A 3G31A 1EROA 4PM6A 1YLYA 3VOYA 1GCEA 1K57C 1E25A 3OCNA 2HP6A 1LI0A 3OZHA 4OQ0A 1ES4A 2ZQ7A 2XDMA 2PU4A 2WKHA 3IHAA 5F1GA 4U0XA 3HUOA 2Y2QA 3NBLA 3ITBA 3ZCZA 1I5QA 1K56D 2G2WA 2V2FF 5GL9A 3OPHA 5FI6A 1PWDA 5FQMA 3ZNYA 2WKEA 1WYCA 3G2ZA 3CZDA 1LI9A 1DY6A 1TEMA 4DKIA 2BG1A 2WADA 4OP8A 4S2LA 4DF6A 2DCFA 5E2GA 3ZGAB 5GLBA 3VMAA 1MPLA 3Q7VA 4ZJ1A 4EWFA 1CI9A 3G30A 4LCMA 4YFMA 5FQQA 4N1XA 2EX2A 5HW3A 2C5WB 2ZJ9A 2ZM2A 5JYOA 2JE5A 4KG5A 4C75A 3WS5A 3VFFA 1XKZA 2VGJA 4UHUA 5AQ9A 5EVIA 4BLMA 1ES5A 1W7FA 5GLDA 3QNBA 2H10A 1NY0A 2WZXA 3LCEA 3NC8A 2Y2KA 1ERMA 5FI2A 5HAIA 2OLVA 2P9VA 3A3JA 3IXHA 5DVAA 3MBZA 3OC2A 3C7UA 1ERQA 3BFCA 4OOMA 2V1ZA 4PM9A 4Y0UA 4E3MA 4B4ZA 1IKIA 3PTEA 2ZD8A 2QPNA 3HUMA 2Y2JA 3IH9A 5CECA 3HLGA 4LENA 4ZDXA 5FASA 5EUAA 3WS4A 1HVBA 1M6KA 4CPKA 4OP5A 3FV7A 1GHPA 1I2SA 2QZ6A 4WYYA 3HLEA 3MKEA 4EBNA 1IYOA 2X02A 5AQ7A 2RL3A 3GSGA 1PI5A 4BD0A 1YT4A 3WS0A 1W8QA 3W8KA 2C6WB 4X6TA 5DTSA 4R4RA 5E2EA 2WKIA 1JWVA 1Y54A 5CEDA 1ZG4A 3SS5A 4BL3A 5EVLA 4QY5A 1K56A 3BECA 3LEZA 1BUEA 3NCKA 3UPOA 4OONA 4XUXA 5CGWA 4GB7A 1H8ZA 3IF5A 1MXOA 3DWKA 3IXBA 5CGSA 4O7DA 4MBFA 4LV2A 4Q8IA 5M19A 3Q7VB 5CRFA 1J9MA 1RGYA 4DXBA 4P87A 1IYPA 3OCLA 1JWZA 4B4XA 1LL9A 2WZZA 4B88A 5EVIC 3UDXA 1H8YA 5A92A 2XR0A 1IYQA 3M6HA 5FAPA 3OPPA 3HL9A 4DXCA 1MY8A 1KGGA 3BFDA 5HX9A 4WM9A 5KSCA 3IWIA 2Y55A 1FOFA 1L0GA 2ZQ9A 4R0QA 5HL1A 3UE1A 4Y0OA 4BJPA 3TOIA 4R23A 4S2NA 4X55A 4E3KA 3A3IA 3SOIA 2G2UA 1KVMA 5HARA 1XGJA 3NDEA 3UO9A 4E3IA 1GA0A 2XD5A 1LL5A 3CJMA 2BLSA 3M2JA 4GOGA 3IF6C 2XLNA 3OPRA 3ZG0A 5EE8A 3FYZA 3BRMA 3PAGA 3GMWA 1TDGA 1XPBA 3RXWA 1KE3A 5GHZA 3RXXA 3BEBA 3BFEA 1XX2A 3HLDA 1BSGA 4E3NA 3MZFA 3C4PA 1JTDA 4IVKA 2EX6A 2XK1A 2OSUA 4DE1A 4C6YA 1IYSA 3NI9A 1YLPA 4X69A 2A3UA 1HZOA 1ALQA 3BLSA 3P09A 4WMCD 5AQBA 4QY6A 4WEJA 1L0FA 4OQIA 4WZ5A 1QMEA 2ZC7A 5CHMA 2J7VA 3G35A 1U60A 4U0TA 4A5RA 1K55A 4K0XA 4K91A 4R4SA 1L0EA 4OOLA 4KQQA 2Y4AA 2Y59A 3I7JA 4N1HA 2Q9NA 4FD8A 4UA9A 3VP0A 4DE2A 2ZQ8A 3ZHHA 2DRWA 4KQOA 2WGWA 1ONGA 4RVAA 3UE3A 5CEBA 1MKIA 3N7WA 3E2LA 5KMWA 1GHMA 3BYDA 5BOHA 1FCNA 5FQ9A 1NRFA 2ZQCA 4YINA 4BD1A 1ONHA 3UN7A 2WUQA 1LHYA 3SH7A 4MLLA 3LY4A 4M3KA 3S1YA 4OPQA 1YLTA 2OV5A 5GHXA 2Q9MA 2V20A 1K54A 3VSLA 3ITAA 2DNSA 1G6AA 3Q81A 3N6IA 2ZC4B 3ZG8B 1WE4A 4EUZA 1XGIA 4DDSA 1ESIA 1ZKJA 5CERA 3NY4A 1S6RA 5DTKA 3VP2A 1WYBA 3WS2A 4IBXA 1EWZA 3VP4A 4E3JA 1PW1A 3BFGA 2Z2MB 1S0WA 2ZC6B 5A91A 3SS4A 1RP5A 3AGFA 1MWRA 2A49A 2Y2GA 4R3JA 4E3LA 4N9LA 5M18A 4WELA 4CJNA 5E43A 4S2OA 1FSWA 2J8YA 2WGVA 3CG5A 4JXWA 2RCXA 4S2MA 1VM1A 4JF4A 2JBFA 1E3UD 5JYPA 1G68A 4R3BA 1PWCA 4KG6A 2PU2A 1JWPA 2Y2NA 4OLGA 5CHJA 1KE4A 1Z6FA 4Y0TA 3ZDJA 3UY6A 3DWZA 4C3QA 1DJAA 4S2KA 3IHBA 1W8YA 3V50A 4S2JA 5GLCA 1FSYA 4LV0A 4N9KA 5FATA 4BL2A 4DE0A 4WMCA 5I94A 4NK3A 3A3DA 4ZBEA 1SDEA 3HREA 3W4PA 2IWBA 3FZCA 1M40A 1EI5A 1ESUA 3MZEA 3PBRA 4EV4A 3MKFA 2CC1A 5E2HA 5FQJA 1MWUA 1BLPA 3MXSA 4E6XA 1PWGA 1BLSA 1FR6A 3FKVA 3N4IA 4LCLA 5G18A 4RA7A 5KZHA 4R1GA 2WGWB 1DJBA 1MWSA 1TDLA 4KZBA 2P74A 2PBYA 1KGEA 3G34A 4FSFA 3WRTA 4KZ5A 2J9PA 2XD1A 3VOZA 4L0LA 3N8SA 1BZAA 2ZLYA 3FWLA 3FKWA 2HDRA 3PBSA 4JPMA 5DF8A 1ES3A 4GDBA 5FQKA 1ZC2A 3JYIA 2JCHA 3DTMA 3TG9A 1JVJA 1MWTA 1Q2PA 1CEFA 1PZOA 5FDHA 3W4QA 4ZJ3A 3A3EA 1QMFA 2XEPA 4DDYA 2EFUA 5D3OA 2EXBA 5FAQA 4KZ3A 3HVFA 2I72A 3PBNA 4GN2A 3AGEA 3ISGA 3UNWA 3B3XA 5GLAA 1SDNA 1FR1A 5CHUA 2ZQAA 4X53A 4X68A 3ZFZA 4EQIA 4KZAA 1NZUA 3MZDA 3S4XA 4OPYA 4KZ4A 4QU3A 2Y2HA 5TR7A 3TSGA 1Q2QA 2XH9A 5KSHA 5U47A 3HBRA 3UDFA 5CTNA 3C5AA 4N92A 4PM8A 3SS3A 2Y2LA 2IWCA 2OLUA 4KZ9A 4RX2A 5CGXA 3P98A 5EVID 1NXYA 2IWDA 5EOEA 3PBTA 1MBLA 1BT5A 4OKPA 1RGZA 4OQGA 1E3UA 2B5RA 2WAEA 2Y2MA 3WS1A 3PAEA 4IVIA 4ZJ2A 4QHCA 4OH0A 4WZ4A 2HP5A 4XXRA 4RX3A 2WK0A 3UPNA 3O87A 1YQSA 4QJGA 1K25A 1BLHA 3WWXA 1PYYA 5F82A 1W79A 3W4OA 1O07A 2E8IA 2Y2OA 4PM7A 5A93A 3UPPA 1PI4A 3VFHA 3V39A 3LY3A 4D2OA 1K6RA 4X56A 1FCOA 1NZOA 4JXGA 3RJUA 3UDIA 2ZM0A 1YLZA 3HLCA 4QD4A 1GHIA 2EXAA 3IH8A 4U3TA 1BLCA 3IXDA 3O86A 3PBOA 5CXWA 2ZC5B 4P6BA 1N4OA 2WYXA 1VQQA 1YLJA 2XQZA 3EQVA 4JBFA 4UA6A 4PM5A 2XFTA 2JC7A 1IEMA 1KGFA 4H8RA 4ZTKA 3ZVWA 1SKFA 3ZG9B 4IBRA 4XUZA 4MEZA 3GV9A 1CEGA 5FQIA 3VP1A 4GKUA 3Q07A 3G32A 4OQHA 5DF7A 4S2NC 1GA9A 3AGDA 5EPHA 1I2WA 2GDNA 4HBTA 3S22A 4EBPA 4MNRA 3GQZA 3OPLA 5AQAA 2WAFA 5TFQA 3BFFA 4JKTA 2EX9A 1TVFA 1ZG6A 3V3SA 4KZ6A 4QB8A 1KVLA 1K6SA 5CTMA 4OOYA 3C7VA 3E2KA 1YLWA 3HUNA 3MFDA 4JF5A 3NDGA 3ZNTA 1XXMA 1PW8A 1SCWA 2Y2PA 3QHYA 4OPRA 5J8XA 1KE0A 4BENA 3UE0A 4GNUA 3GRJA 4OVDA 4GD8A 3ZG7B 2QMIA 1SHVA 3LO7A 3VP3A 2X71A 2HPBA 3GR2A 4WZ5C 1YMSA 4S2IA 4E6WA 2HP9A 4P85A 1K55C 5L2FA 2VGKA 1HTZA 3CMZA 2HDQA 4P0MA 3WRZA 5HAQA 1KDSA 4PPRA 5HFOA 4OPZA 2ZQDA 5DF9A 1ES2A 2ZMAA 4HESA 4FH2A 4ID4A 2H0TA 5F83A 3PBQA 4UAAA 4WBGA 2X01A 2ZM8A 3IF6A 4MBHA 4OLDA 2XGNA 4GDNA 1BTLA 3A3FA 1K38A 3D4FA 3Q82A 4UA7A 5GHYA 3O88A 4IEDA 3SH8A 4LV3A 1BULA 1YMXA 1XA7A 3GVBA 5FAOA 2FFYA 3IWOA 5DTTA 5EECA 3EQUA 4Y7PA 4F94A 1K54C 1L2SA 4MBKA 2R9XA 2Y91A 4DRTA 1OMEA 3DW0A 1PZPA 1IELA 4KG2A 1XP4A 4E3OA 3HLBA 1CK3A 4GD6A 3V5MA 1K57A 2UWXA 2H0YA 5EOOA 4DE3A 4FCFA 1DJCA 2H5SA 4K0WA 1KDWA 2HDUA 1XA1A 3QNCA 4HEFA 4PMAA 3SH9A 3Q7ZA 3MXRA 1NYMA 3IQAA 1L0DA 3ZG5A 1LLBA 3VSKA 1IKGA 3N8LA 3NIAA 4KQRA 3BLMA 2WGIA 4JF6A 4JXSA 1RCJA 1JTGA 3G2YA
chains in the Genus database with same CATH superfamily
3HLFA 5HAPA 4HJ3A 4EEPA 4KUOA 1FCMA 2VV7A 5HWVA 3HLWA 5EV0A 2R9WA 4RYEA 4EETB 4FH4A 3G4PA 2Y2IA 3GTCA 1T19A 2ZC3B 4I38A 4Q0IA 2FFFB 3M6BA 1E4DA 1F98A 5A90A 4HBUA 1PIOA 1EW0A 4LRYC 4NG2A 2XFSA 2J9OA 5E2FA 3KSIA 3G31A 4PM6A 1UWNX 3OCNA 2HP6A 3OZHA 4EESA 3HUOA 3NBLA 5TJJA 4GCZA 1I5QA 2G2WA 5GL9A 4WUJA 3OPHA 5FQMA 1FIKA 3IX8A 3C30A 3CZDA 3E98A 2WADA 4OP8A 4DF6A 2WKPA 2NUPC 3B33A 3FG8A 4E04A 4YFMA 3T12B 2J3WA 3WS5A 3A0SA 4UHUA 5AQ9A 5GLDA 3LCEA 2OLVA 1S66L 4GW9A 5DVAA 3MBZA 3KSGA 2V1ZA 4PM9A 3IBRA 4JGPA 3QP2A 2ZL1B 5F5YA 5CECA 1XFQA 5FASA 2K7SA 1HVBA 1M6KA 1D1JA 4I5SA 4OP5A 4JGOA 5FEGA 2JN7A 5AVFA 5E2EA 2KX6A 1JWVA 3BWLA 1TD5A 1DP8A 2VZWA 4BL3A 5EVLA 4QY5A 3NOUC 1LT0A 3UPOA 4OONA 1H8ZA 1MXOA 4IHQA 5CGSA 4O7DA 4MBFA 4Q8IA 3G6OA 3LGOA 3E4QA 4I39A 1LL9A 2WZZA 1H8YA 3M6HA 5L8MA 3HL9A 2KDKA 3BFDA 5DJTA 2O9BA 5KSCA 2ZQ9A 5HL1A 4R23A 4HJ4A 4HY8A 2G2UA 1GA0A 2XD5A 5FL3A 3M2JA 4HJ6A 3OPRA 1LL8A 3GMWA 3MQOA 3RXWA 1KE3A 3BFEA 4F3LB 2ZL1A 2ZBBA 3LR3A 4C6YA 1IYSA 1YLPA 1HZOA 3P09A 4WEJA 2GJ3A 1L0FA 1A0KA 1QMEA 2HJ9C 3EGDC 5DFYA 4R4SA 2Y59A 2ACGA 2Y8HA 4II7A 2ZQ8A 3ZHHA 4KQOA 4DJ2A 4RVAA 5CEBA 3FC7A 4WF0A 3E2LA 3S7PA 1VHMA 1FCNA 5FQ9A 2BTFP 4PAUA 4G3KA 3UN7A 2P08A 3S1YA 3ITAA 1ZTUA 1WE4A 2Z6DA 5CERA 1ZKJA 2UV0E 2ZMFA 1FILA 2O0YA 5J7EA 4YWZA 3VP4A 4E3JA 2QJ5A 2ZC6B 1S0WA 1NWZA 3SS4A 1RP5A 3KYEA 1FSWA 2WGVA 2RCXA 4S2MA 4JF4A 2JBFA 1W63Q 1X0OA 3BW6A 4KG6A 2HZ5A 2PU2A 5EVEA 5J3WA 5CHJA 1Z6FA 3ZDJA 4C3QA 2LB9A 3LIBA 4S2JA 5GLCA 4DE0A 4BL2A 1N9LA 2IWBA 1ESUA 2V0UA 4LGWA 1MWUA 2HV1A 1BLSA 1FR6A 4LCLA 3SZTA 4LPZA 3GDIA 4MN6A 3T4OA 4LRZE 2P74A 2PBYA 4FSFA 2J9PA 4NKPA 4L0LA 1BZAA 5HWWA 2HDRA 3PBSA 3A0RA 1ES3A 3HJKA 5FQKA 5AJGA 1JVJA 5I5LA 3S7OA 1PZOA 3A3EA 2EFUA 5EM0A 3HVFA 3LEQA 3B3XA 5GLAA 1SDNA 2GX5A 2ZQAA 5DKLA 4KZ4A 3TSGA 2Y2HA 5KSHA 3DBAA 2EWVA 2OLUA 3P98A 1NXYA 1MBLA 4OKPA 2QKPA 4L9EA 4WL9A 4QHCA 2HP5A 4XXRA 3CHWP 3O87A 3ULFA 3WWXA 1T1CA 1W79A 1O07A 1D7EA 3QP6A 1J3WA 5TBMB 3VFHA 3V39A 3TJZC 1H3QA 4UQIS 3F1NA 4U3TA 2EXAA 5F69A 1N4OA 2XQZA 4WLAA 4UA6A 1UWPX 4PM5A 4IBRA 4XUZA 4MEZA 3UB8A 5DFXA 5FQIA 3VP1A 3G32A 4S2NC 4HBTA 4Y5FA 3GQZA 5AQAA 2WAFA 3LICA 1TVFA 3V3SA 2G7UA 2GZAA 4QB8A 1PW8A 3QHYA 4OPRA 5J8XA 1KE0A 2JKTM 3E4OA 3UE0A 4GD8A 3GR2A 4WZ5C 1F9IA 4O01A 4P0MA 3WRZA 5HAQA 4OPZA 5DF9A 4ID4A 2H0TA 5TBMA 3IF6A 3F1OB 3D4FA 3KYZA 1YMXA 3GVBA 3IWOA 3EQUA 1K54C 1L2SA 1TS7A 4MBKA 1GSXA 2Y91A 5HD3A 1XP4A 4E3OA 1K57A 5FDSA 1K0KA 4FTXA 1KDWA 4HEFA 1L0DA 3BLMA 2WGIA 1JTGA 3G2YA 1L3LA 1NJ4A 4P6ZM 1YM1A 3IWQA 4JXVA 5F1FA 4EBLA 1AXBA 4HP4A 4B9OA 5EVIB 3ZVTA 1VEUB 3LYXA 3L7HA 3UMEA 3M2KA 4H6JB 4EW7A 1GSVA 4S2PA 3H7WA 3N8RA 4LV1A 1PFLA 1VB6A 4ZAMA 3O3VA 3IT9A 1S1YA 1N9BA 1HD8A 2EFXA 3F1OA 5IHVA 1NLYA 4JLFA 4NETA 4BQMA 4G3VA 1K57C 1LI0A 4OQ0A 2WKHA 2Y2QA 3ITBA 3ZCZA 3G2ZA 2OOLA 4L9GA 2BG1A 2ZMVA 4S2LA 2DCFA 4HI4A 5F68A 3VMAA 1OTEA 4MDZA 1CI9A 4K08A 4N1XA 2VV6A 4GS9A 2ZJ9A 1OTDA 2JE5A 5L09A 4KG5A 4C75A 1P0ZA 3IS2A 5EVIA 4BLMA 1ES5A 1W7FA 3NJAA 2H10A 1NY0A 3NC8A 2W3EA 2QYBA 2E8JA 3IXHA 3BJNA 2YKFA 3BFCA 4E3MA 2VK3A 4B4ZA 2M1CA 3PTEA 3HUMA 2Y2JA 3HLGA 4LENA 4QPRA 4PHTA 5EUAA 3WS4A 4CPKA 1GHPA 3HLEA 3QP1A 2X02A 4BD0A 1YT4A 2C6WB 4X6TA 4QWOA 4NXEA 1Y54A 2PT7A 1DRMA 4DN0A 4XUXA 4GB7A 3JVVA 3DWKA 3GECA 4LV2A 5M19A 1RGYA 4DXBA 1D06A 1IYPA 4B4XA 5EVIC 3UDXA 5A92A 2XR0A 1IYQA 4BBTA 1YSPA 4DXCA 1KGGA 5HX9A 4WM9A 2Y55A 1FOFA 1CQAA 4NXGA 4E3KA 4X55A 3SOIA 1F5MA 3L9KA 3CJMA 2BLSA 4GOGA 5DKKA 2XLNA 2JHEA 1OTIA 1LSWA 5EE8A 2A24A 2W1TB 1XPBA 3EOIA 1LSXA 1XX2A 3HLDA 2EX6A 1KOUA 4DE1A 3QP8A 5AQBA 3IX3A 5CHMA 3MXQA 3VOLA 4A5RA 1K55A 4Q0HA 1L0EA 4OOLA 4N1HA 4FD8A 3ZYTA 1ONGA 1OT9A 4KQDA 3FPVA 1NRFA 3VV4A 1Z09A 3LR4A 4BD1A 3SH7A 4MLLA 4O0PA 3VSLA 2DNSA 3FPWA 3Q81A 5MC7A 3WS2A 3BFGA 2Z2MB 5A91A 2Y79A 3AGFA 4R3JA 1W63M 5M18A 4R3AA 5HPFA 2W1TA 3CG5A 1CF0A 5JYPA 2PYRA 1G68A 2VA0A 4R3BA 1JWPA 3LIAA 1KE4A 3UY6A 4EQ1A 4S2KA 3IHBA 2PHYA 3LIEA 1OT6A 5FATA 5I94A 4NK3A 4CQHA 3FZCA 1M40A 4CLCB 5FQJA 1BLPA 3N4IA 5G18A 1TDLA 1SKOA 4KZ5A 5IS1A 1VETA 3PXPA 3FKWA 4JPMA 1OJGA 4GDBA 3JYIA 2JCHA 3SW1A 1MWTA 1CEFA 3T4LA 2V1AA 3W4QA 2XEPA 2AVXA 4KZ3A 2I72A 2W3GA 3ZFZA 3MZDA 4OPYA 5TR7A 3OBFA 5L10A 2XH9A 3HBRA 2IWDA 3UMDA 3PBTA 4OQGA 3PAEA 4WZ4A 2PR5A 1BLHA 1PYYA 2E8IA 3LIDA 1PI4A 3P7NA 4CLCA 3TRCA 4D2OA 4X56A 2PYPA 3IH8A 3IXDA 3O86A 4PKYG 5CXWA 2ZC5B 4P6BA 1OTBA 2VV8A 2XFTA 2JC7A 2W3DA 1TS0A 4H8RA 3CWFA 2FZ0A 3TE8A 3Q07A 3LUQA 4OQHA 1DP6A 3AGDA 1G6OA 4EBPA 3S22A 3LIFA 2W27A 3BFFA 2EX9A 4AFIA 4KZ6A 1K6SA 4OOYA 1YLWA 4JF5A 3NDGA 1XXMA 2L0WA 2Y2PA 4R6LA 3C2WA 3IBJA 1XJ6A 3QP5A 4GNUA 4Y17A 3GRJA 2IA2A 3H82B 2QMIA 2W3HA 1SHVA 2H28A 2HPBA 2X71A 1XJ4A 4S2IA 4P85A 2HP9A 3CAXA 4IJGA 5G4ZA 3RFBA 4I3AA 5L2FA 3D3OA 2HDQA 4EU0A 3HJIA 5HFOA 4X1LA 1ES2A 2ZMAA 3H9WA 3PBQA 4UAAA 3ICYA 3CUEA 4L9FA 3PHYA 4GDNA 1BTLA 3A3FA 4ESPA 4UA7A 3Q82A 3F1NB 3O88A 4IEDA 1XA7A 5FAOA 2FFYA 4PKYA 4XT2B 2L4RA 2R9XA 1OMEA 4KG2A 4P6ZS 4KUKA 5DJUA 4FCFA 1DJCA 3Q7ZA 3V67A 4EXOA 3IX4A 4JXSA 4KZ7A 3V3RA 1H5XA 2HDSA 1Y4OA 4KZ8A 4BBVA 4GZBA 3H82A 1C3BA 2BASA 3T1RA 2EX8A 4BBUA 1FQGA 3C4OA 2P7JA 3BM6A 5FI7A 1S4SA 3MMHA 3IF6B 3CPTA 5M1AA 4Z9QA 1W5DA 1PNEA 1O7EA 3Q1FA 2L1MA 5FA7A 4XT2A 3VOYA 1ES4A 2ZQ7A 5F1GA 1LSVA 1K56D 5FI6A 3P01A 4M4XA 3MQQA 3ZNYA 2WKEA 2XA7M 1LI9A 3VE4A 3C38A 5E2GA 3ZGAB 5GLBA 3Q7VA 4ZJ1A 4LCMA 5FQQA 2EX2A 2C5WB 2Q0OA 5F6AA 2WZXA 4WN5A 4R38A 2DMWA 3H7WB 3A3JA 2HF6A 1ERQA 4OOMA 1IKIA 4ARZB 4ZDXA 3F1PB 4ETZA 2JKRM 3FV7A 1I2SA 4WYYA 5AQ7A 2RL3A 3GSGA 1MZUA 1PI5A 3WS0A 4R4RA 5A8BA 1ZG4A 5KIZA 3SS5A 3MJQA 3BECA 3CLOA 1TS8A 3MS6A 1SZVA 1BUEA 3NCKA 5CGWA 1T1BA 4YNRA 1J9MA 3NOPC 2VGLM 4B88A 4GS9B 3UE6A 2MJ6A 5C5KA 3IS2B 3IWIA 3NULA 5IU1A 2O9CA 4R0QA 3U2AA 3UE1A 3TOIA 4JGQA 1XFNA 3A3IA 1MC0A 1KVMA 1XGJA 3NDEA 3UO9A 3IF6C 3BRMA 3PAGA 2ZOIA 1TDGA 5GHZA 3T4SA 3D72A 3BEBA 4ARZA 3MQ0A 3QP4A 1BSGA 4MCWA 2XK1A 3F1PA 2OSUA 3DTEA 2PD7A 3NI9A 3PR6A 4X69A 4DJ3A 3BLSA 4WMCD 3T4QA 4G3WA 4OQIA 3KX0X 4U0TA 3TW8A 4HH2A 4K0XA 4KQQA 3I7JA 2Q9NA 4Y13A 4UA9A 4EERA 3VP0A 2WGWA 1AWIA 1MKIA 5KMWA 1P9WA 1GHMA 3E4PA 5BOHA 2M7VA 2ZQCA 1ONHA 2WUQA 5HPIA 3LR5A 1YLTA 2OV5A 5GHXA 2V20A 3DAVA 1S67L 3R7WA 4EUZA 1XGIA 3NY4A 5DTKA 3VP2A 1WYBA 1H0MA 1EWZA 2J3TC 1PW1A 3NOTC 3MFXA 1MWRA 2A49A 4E3LA 4WELA 2A24B 4CJNA 5E43A 4HOIA 2J8YA 4JXWA 4D60A 3EGXC 2WKQA 2W1RA 2P04A 1E3UD 4IUHA 2PR6A 1XJ2A 3DWZA 1DJAA 1S1ZA 1FSYA 2VKSA 1TF1A 4ZBEA 4BWIA 3W4PA 3K3CA 5FEFA 1EI5A 4EV4A 3MZEA 3MKFA 2CC1A 5E2HA 3D9YA 1PWGA 3K2NA 3KYQA 5KZHA 4R1GA 1DJBA 5HDDA 1MWSA 4KZBA 3T1SA 3G34A 2FH5A 2GNXA 3WRTA 4ETXA 1T18A 3N8SA 3FWLA 5DF8A 3BY9A 1ZC2A 2YKHA 2V1BA 4X1MA 4YOFA 4ZJ3A 5D3OA 2EXBA 5FAQA 3ZQ5A 3PBNA 3ISGA 3UNWA 5CHUA 3T1XA 4X68A 4KZAA 1NZUA 2I9VA 2R78A 3C5AA 4PM8A 2Y2LA 2IWCA 5CGXA 5EVID 5EOEA 2VLGA 1BT5A 1RGZA 2Y2MA 4IVIA 4ZJ2A 3LR0A 4OH0A 2QJ7A 4RX3A 4QJGA 1K25A 3KO6A 3W4OA 4PM7A 5A93A 1F2KA 3UB6A 1FCOA 2OAP1 4JXGA 3UDIA 2ZM0A 1YLZA 1GHIA 1SKOB 1BLCA 3PBOA 5HDSA 2WYXA 4JBFA 3EQVA 1VETB 1IEMA 1KGFA 4ZTKA 1SKFA 3ZG9B 1GA9A 5EPHA 1G5UA 4MNRA 3OPLA 5TFQA 2Z6CA 3EEHA 4NXFA 4ME4A 4BENA 3JVUA 4CLCE 3UB7A 4OVDA 3ZG7B 3BQAA 3K3DA 5G4YA 3VE3A 1K55C 2W3FA 2O9AA 1KDSA 2CMNA 4Y15A 4HESA 4FH2A 5F83A 2X01A 2ZM8A 4MBHA 4OLDA 1ODVA 5J4EA 3EWKA 1K38A 1OTAA 4LV3A 2XRNA 5EECA 2NUTC 4Y7PA 2O99A 4DRTA 5L07A 1CK3A 4GD6A 3V5MA 5EOOA 4DE3A 3A0VA 2H5SA 2D01A 4K0WA 2VJWA 4PMAA 5HSQA 4Y2FA 2PBDP 1NLZA 3ZG5A 4HH3A 2INWA 1IKGA 3N8LA 3NIAA 2XROA 4HP9A 4JF6A 1RCJA 2Z2LB 1DP9A 4KENB 2XF3A 2QHKA 3C8CA 3NHQA 5FSRA 3U4LP 4Y3IA 4WEKA 3PYPA 2P9VB 3IXGA 5TGFA 4GJ4A 2B02A 2A2LA 3KSFA 1K4FA 1N9NA 1K4EA 1P9RA 2EA9A 1GSWA 1NYYA 4BMWA 2XA7S 4NXBA 4I3IA 1OPXA 1CI8A 1EROA 1YLYA 1GCEA 1E25A 3LI9A 5EM1A 2XDMA 2PU4A 3IHAA 4U0XA 4HQAA 1BYWA 2V2FF 1G28A 1PWDA 1WYCA 1DY6A 1TEMA 4DKIA 1MPLA 1P97A 4EWFA 1IOUA 4EUVA 3G30A 5HW3A 1OJ5A 2OWHA 4R70A 2ZM2A 5LBRA 5JYOA 3CITA 3VFFA 1XKZA 2VGJA 3QNBA 2Y2KA 3MSHA 1ERMA 5FI2A 2KLIA 2HJEA 4CLCC 5HAIA 4FUWA 2P9VA 3OC2A 3C7UA 4Y0UA 2ZD8A 3CPTB 2QPNA 4F3LA 3IH9A 2OAQ1 3BQ8A 3CI6A 3MF0A 2QZ6A 4EBNA 3MKEA 1IYOA 3KSHA 1ACFA 5CX7A 2OWJA 3DTKA 1W8QA 3W8KA 5DTSA 4CLCD 2WKIA 5CEDA 2JKGA 2VGLS 1K56A 3LEZA 4I3JA 1H8MA 3IF5A 3IXBA 2WKRA 3Q7VB 5CRFA 4P87A 2EWWA 3OCLA 1JWZA 3RH8B 2V8FA 5FAPA 1YKDA 3OPPA 1MY8A 1TS6A 1L0GA 1JNUA 1PRQA 5HDCA 4Y0OA 4BJPA 4S2NA 2JKTI 5HARA 4E3IA 1LL5A 4MN5A 3CUEC 3ZG0A 1CJFA 3FYZA 3RXXA 1V9ZA 2D02A 4E3NA 3MZFA 3C4PA 1JTDA 4IVKA 3NECA 2A3UA 4HHDA 1ALQA 4QY6A 3E0YA 1T1AA 4WZ5A 2ZC7A 2J7VA 3G35A 1U60A 2W0NA 2V0WA 5HL6A 2JKRI 4K91A 2Y4AA 4ZRRA 3T4KA 1N9OA 4DE2A 2DRWA 1IFQA 3UE3A 5K5BA 3N7WA 4DMZA 3BYDA 4YINA 1LHYA 1YPRA 3LY4A 4M3KA 4OPQA 2Q9MA 1K54A 1G6AA 3N6IA 2ZC4B 3ZG8B 1Y28A 4DDSA 1ESIA 1S6RA 3R4KA 4IBXA 5IT5A 4LLOB 2Y2GA 4Q0JA 4N9LA 4S2OA 1VM1A 3LI8A 1PWCA 2Y2NA 4OLGA 2VEAA 4Y0TA 4X25A 1W8YA 1YSQA 3V50A 3UB9A 4N9KA 4LV0A 4WMCA 5EFWA 4B93A 3A3DA 1SDEA 3HREA 2PDRA 3PBRA 2LB5A 4IUKA 3MXSA 2PD8A 4E6XA 4NEED 3FKVA 3JPUA 4RA7A 2WGWB 2V9AA 5AVEA 1KGEA 2V8CA 2XD1A 3VOZA 2ZLYA 4O8GA 4HIAA 2HGVA 3MR0A 3TG9A 3DTMA 3OLOA 1Q2PA 5FDHA 3B42A 1ZHHB 3R7WB 2QWSA 1QMFA 4DDYA 2K2NA 4RQ9A 1XJ3A 4GN2A 3AGEA 1NRJA 1FR1A 4X53A 4EQIA 2JKFA 3S4XA 4QU3A 1Q2QA 5U47A 2B18A 2K31A 3UDFA 5CTNA 4N92A 3SS3A 4RX2A 4KZ9A 2ZOHA 3RTYA 4EEUA 1E3UA 2B5RA 2WAEA 4JGRA 3WS1A 2XSSA 5HZHA 3LFVA 2PRFA 3S7NA 2WK0A 3UPNA 1YQSA 5F82A 2Y2OA 3UPPA 3OOVA 4GHIB 3LY3A 2KOIA 1K6RA 1NZOA 1HLUP 3RJUA 4FOFA 3HLCA 4QD4A 3B47A 1VQQA 1YLJA 3ZVWA 3GV9A 1CEGA 4GKUA 4LFUA 5DF7A 3S7QA 1I2WA 2GDNA 4UQIM 3BY8A 4JKTA 5HD5A 1V9YA 1ZG6A 1KVLA 5CTMA 2PAVP 3T1QB 3C7VA 3E2KA 3HUNA 3MFDA 4Z1WA 4MMNA 3ZNTA 1SCWA 5HWTA 1S4RA 3EEAA 3T4JA 3VP3A 1YMSA 4E6WA 1VEUA 4H6JA 2VGKA 1HTZA 3CMZA 2B95A 2J3TD 1WA9A 4MN7A 4LRXC 4PPRA 2ZQDA 3T4TA 4UEYA 4WBGA 4GHIA 2XGNA 1STZA 1UGUA 5GHYA 3SH8A 1BULA 2VX8A 4GLQA 5DTTA 3UB5P 4F94A 3O5YA 3DW0A 1YAXA 1PZPA 1IELA 3HLBA 3DTIA 2UWXA 3T50A 2H0YA 2HDUA 1XA1A 3QNCA 1MKMA 3SH9A 4HNBA 3MXRA 1NYMA 3IQAA 1LLBA 3VSKA 3W2ZA 2J80A 4KQRA 2M7UA 3HCYA 3LO7A
chains in the Genus database with same CATH topology
1NJ4A 2Z2LB 4KENB 1YM1A 3HLFA 3V3RA 1H5XA 3IWQA 4JXVA 5HAPA 2HDSA 2XF3A 5F1FA 4EBLA 4KZ8A 1AXBA 4GZBA 5FSRA 1C3BA 1FCMA 4WEKA 5EVIB 3ZVTA 3HLWA 3M2KA 2R9WA 2EX8A 4S2PA 1FQGA 2P9VB 3C4OA 4RYEA 3N8RA 4LV1A 3BM6A 3IXGA 4FH4A 5FI7A 5TGFA 4ZAMA 4KZ7A 3G4PA 3O3VA 2Y2IA 1K4FA 3GTCA 1K4EA 2ZC3B 3IT9A 2FFFB 3IF6B 1N9BA 3M6BA 1HD8A 1E4DA 2EFXA 4HBUA 5A90A 5IHVA 5M1AA 1PIOA 4JLFA 4Z9QA 1W5DA 1NYYA 4NETA 1O7EA 2XFSA 2J9OA 4BQMA 3Q1FA 5E2FA 1CI8A 5FA7A 3G31A 1EROA 4PM6A 1YLYA 3VOYA 1GCEA 1K57C 1E25A 3OCNA 2HP6A 1LI0A 3OZHA 4OQ0A 1ES4A 2ZQ7A 2XDMA 2PU4A 2WKHA 3IHAA 5F1GA 4U0XA 3HUOA 2Y2QA 3NBLA 3ITBA 3ZCZA 1I5QA 1K56D 2G2WA 2V2FF 5GL9A 3OPHA 5FI6A 1PWDA 5FQMA 3ZNYA 2WKEA 1WYCA 3G2ZA 3CZDA 1LI9A 1DY6A 1TEMA 4DKIA 2BG1A 2WADA 4OP8A 4S2LA 4DF6A 2DCFA 5E2GA 3ZGAB 5GLBA 3VMAA 1MPLA 3Q7VA 4ZJ1A 4EWFA 1CI9A 3G30A 4LCMA 4YFMA 5FQQA 4N1XA 2EX2A 5HW3A 2C5WB 2ZJ9A 2ZM2A 5JYOA 2JE5A 4KG5A 4C75A 3WS5A 3VFFA 1XKZA 2VGJA 4UHUA 5AQ9A 5EVIA 4BLMA 1ES5A 1W7FA 5GLDA 3QNBA 2H10A 1NY0A 2WZXA 3LCEA 3NC8A 2Y2KA 1ERMA 5FI2A 5HAIA 2OLVA 2P9VA 3A3JA 3IXHA 5DVAA 3MBZA 3OC2A 3C7UA 1ERQA 3BFCA 4OOMA 2V1ZA 4PM9A 4Y0UA 4E3MA 4B4ZA 1IKIA 3PTEA 2ZD8A 2QPNA 3HUMA 2Y2JA 3IH9A 5CECA 3HLGA 4LENA 4ZDXA 5FASA 5EUAA 3WS4A 1HVBA 1M6KA 4CPKA 4OP5A 3FV7A 1GHPA 1I2SA 2QZ6A 4WYYA 3HLEA 3MKEA 4EBNA 1IYOA 2X02A 5AQ7A 2RL3A 3GSGA 1PI5A 4BD0A 1YT4A 3WS0A 1W8QA 3W8KA 2C6WB 4X6TA 5DTSA 4R4RA 5E2EA 2WKIA 1JWVA 1Y54A 5CEDA 1ZG4A 3SS5A 4BL3A 5EVLA 4QY5A 1K56A 3BECA 3LEZA 1BUEA 3NCKA 3UPOA 4OONA 4XUXA 5CGWA 4GB7A 1H8ZA 3IF5A 1MXOA 3DWKA 3IXBA 5CGSA 4O7DA 4MBFA 4LV2A 4Q8IA 5M19A 3Q7VB 5CRFA 1J9MA 1RGYA 4DXBA 4P87A 1IYPA 3OCLA 1JWZA 4B4XA 1LL9A 2WZZA 4B88A 5EVIC 3UDXA 1H8YA 5A92A 2XR0A 1IYQA 3M6HA 5FAPA 3OPPA 3HL9A 4DXCA 1MY8A 1KGGA 3BFDA 5HX9A 4WM9A 5KSCA 3IWIA 2Y55A 1FOFA 1L0GA 2ZQ9A 4R0QA 5HL1A 3UE1A 4Y0OA 4BJPA 3TOIA 4R23A 4S2NA 4X55A 4E3KA 3A3IA 3SOIA 2G2UA 1KVMA 5HARA 1XGJA 3NDEA 3UO9A 4E3IA 1GA0A 2XD5A 1LL5A 3CJMA 2BLSA 3M2JA 4GOGA 3IF6C 2XLNA 3OPRA 3ZG0A 5EE8A 3FYZA 3BRMA 3PAGA 3GMWA 1TDGA 1XPBA 3RXWA 1KE3A 5GHZA 3RXXA 3BEBA 3BFEA 1XX2A 3HLDA 1BSGA 4E3NA 3MZFA 3C4PA 1JTDA 4IVKA 2EX6A 2XK1A 2OSUA 4DE1A 4C6YA 1IYSA 3NI9A 1YLPA 4X69A 2A3UA 1HZOA 1ALQA 3BLSA 3P09A 4WMCD 5AQBA 4QY6A 4WEJA 1L0FA 4OQIA 4WZ5A 1QMEA 2ZC7A 5CHMA 2J7VA 3G35A 1U60A 4U0TA 4A5RA 1K55A 4K0XA 4K91A 4R4SA 1L0EA 4OOLA 4KQQA 2Y4AA 2Y59A 3I7JA 4N1HA 2Q9NA 4FD8A 4UA9A 3VP0A 4DE2A 2ZQ8A 3ZHHA 2DRWA 4KQOA 2WGWA 1ONGA 4RVAA 3UE3A 5CEBA 1MKIA 3N7WA 3E2LA 5KMWA 1GHMA 3BYDA 5BOHA 1FCNA 5FQ9A 1NRFA 2ZQCA 4YINA 4BD1A 1ONHA 3UN7A 2WUQA 1LHYA 3SH7A 4MLLA 3LY4A 4M3KA 3S1YA 4OPQA 1YLTA 2OV5A 5GHXA 2Q9MA 2V20A 1K54A 3VSLA 3ITAA 2DNSA 1G6AA 3Q81A 3N6IA 2ZC4B 3ZG8B 1WE4A 4EUZA 1XGIA 4DDSA 1ESIA 1ZKJA 5CERA 3NY4A 1S6RA 5DTKA 3VP2A 1WYBA 3WS2A 4IBXA 1EWZA 3VP4A 4E3JA 1PW1A 3BFGA 2Z2MB 1S0WA 2ZC6B 5A91A 3SS4A 1RP5A 3AGFA 1MWRA 2A49A 2Y2GA 4R3JA 4E3LA 4N9LA 5M18A 4WELA 4CJNA 5E43A 4S2OA 1FSWA 2J8YA 2WGVA 3CG5A 4JXWA 2RCXA 4S2MA 1VM1A 4JF4A 2JBFA 1E3UD 5JYPA 1G68A 4R3BA 1PWCA 4KG6A 2PU2A 1JWPA 2Y2NA 4OLGA 5CHJA 1KE4A 1Z6FA 4Y0TA 3ZDJA 3UY6A 3DWZA 4C3QA 1DJAA 4S2KA 3IHBA 1W8YA 3V50A 4S2JA 5GLCA 1FSYA 4LV0A 4N9KA 5FATA 4BL2A 4DE0A 4WMCA 5I94A 4NK3A 3A3DA 4ZBEA 1SDEA 3HREA 3W4PA 2IWBA 3FZCA 1M40A 1EI5A 1ESUA 3MZEA 3PBRA 4EV4A 3MKFA 2CC1A 5E2HA 5FQJA 1MWUA 1BLPA 3MXSA 4E6XA 1PWGA 1BLSA 1FR6A 3FKVA 3N4IA 4LCLA 5G18A 4RA7A 5KZHA 4R1GA 2WGWB 1DJBA 1MWSA 1TDLA 4KZBA 2P74A 2PBYA 1KGEA 3G34A 4FSFA 3WRTA 4KZ5A 2J9PA 2XD1A 3VOZA 4L0LA 3N8SA 1BZAA 2ZLYA 3FWLA 3FKWA 2HDRA 3PBSA 4JPMA 5DF8A 1ES3A 4GDBA 5FQKA 1ZC2A 3JYIA 2JCHA 3DTMA 3TG9A 1JVJA 1MWTA 1Q2PA 1CEFA 1PZOA 5FDHA 3W4QA 4ZJ3A 3A3EA 1QMFA 2XEPA 4DDYA 2EFUA 5D3OA 2EXBA 5FAQA 4KZ3A 3HVFA 2I72A 3PBNA 4GN2A 3AGEA 3ISGA 3UNWA 3B3XA 5GLAA 1SDNA 1FR1A 5CHUA 2ZQAA 4X53A 4X68A 3ZFZA 4EQIA 4KZAA 1NZUA 3MZDA 3S4XA 4OPYA 4KZ4A 4QU3A 2Y2HA 5TR7A 3TSGA 1Q2QA 2XH9A 5KSHA 5U47A 3HBRA 3UDFA 5CTNA 3C5AA 4N92A 4PM8A 3SS3A 2Y2LA 2IWCA 2OLUA 4KZ9A 4RX2A 5CGXA 3P98A 5EVID 1NXYA 2IWDA 5EOEA 3PBTA 1MBLA 1BT5A 4OKPA 1RGZA 4OQGA 1E3UA 2B5RA 2WAEA 2Y2MA 3WS1A 3PAEA 4IVIA 4ZJ2A 4QHCA 4OH0A 4WZ4A 2HP5A 4XXRA 4RX3A 2WK0A 3UPNA 3O87A 1YQSA 4QJGA 1K25A 1BLHA 3WWXA 1PYYA 5F82A 1W79A 3W4OA 1O07A 2E8IA 2Y2OA 4PM7A 5A93A 3UPPA 1PI4A 3VFHA 3V39A 3LY3A 4D2OA 1K6RA 4X56A 1FCOA 1NZOA 4JXGA 3RJUA 3UDIA 2ZM0A 1YLZA 3HLCA 4QD4A 1GHIA 2EXAA 3IH8A 4U3TA 1BLCA 3IXDA 3O86A 3PBOA 5CXWA 2ZC5B 4P6BA 1N4OA 2WYXA 1VQQA 1YLJA 2XQZA 3EQVA 4JBFA 4UA6A 4PM5A 2XFTA 2JC7A 1IEMA 1KGFA 4H8RA 4ZTKA 3ZVWA 1SKFA 3ZG9B 4IBRA 4XUZA 4MEZA 3GV9A 1CEGA 5FQIA 3VP1A 4GKUA 3Q07A 3G32A 4OQHA 5DF7A 4S2NC 1GA9A 3AGDA 5EPHA 1I2WA 2GDNA 4HBTA 3S22A 4EBPA 4MNRA 3GQZA 3OPLA 5AQAA 2WAFA 5TFQA 3BFFA 4JKTA 2EX9A 1TVFA 1ZG6A 3V3SA 4KZ6A 4QB8A 1KVLA 1K6SA 5CTMA 4OOYA 3C7VA 3E2KA 1YLWA 3HUNA 3MFDA 4JF5A 3NDGA 3ZNTA 1XXMA 1PW8A 1SCWA 2Y2PA 3QHYA 4OPRA 5J8XA 1KE0A 4BENA 3UE0A 4GNUA 3GRJA 4OVDA 4GD8A 3ZG7B 2QMIA 1SHVA 3LO7A 3VP3A 2X71A 2HPBA 3GR2A 4WZ5C 1YMSA 4S2IA 4E6WA 2HP9A 4P85A 1K55C 5L2FA 2VGKA 1HTZA 3CMZA 2HDQA 4P0MA 3WRZA 5HAQA 1KDSA 4PPRA 5HFOA 4OPZA 2ZQDA 5DF9A 1ES2A 2ZMAA 4HESA 4FH2A 4ID4A 2H0TA 5F83A 3PBQA 4UAAA 4WBGA 2X01A 2ZM8A 3IF6A 4MBHA 4OLDA 2XGNA 4GDNA 1BTLA 3A3FA 1K38A 3D4FA 3Q82A 4UA7A 5GHYA 3O88A 4IEDA 3SH8A 4LV3A 1BULA 1YMXA 1XA7A 3GVBA 5FAOA 2FFYA 3IWOA 5DTTA 5EECA 3EQUA 4Y7PA 4F94A 1K54C 1L2SA 4MBKA 2R9XA 2Y91A 4DRTA 1OMEA 3DW0A 1PZPA 1IELA 4KG2A 1XP4A 4E3OA 3HLBA 1CK3A 4GD6A 3V5MA 1K57A 2UWXA 2H0YA 5EOOA 4DE3A 4FCFA 1DJCA 2H5SA 4K0WA 1KDWA 2HDUA 1XA1A 3QNCA 4HEFA 4PMAA 3SH9A 3Q7ZA 3MXRA 1NYMA 3IQAA 1L0DA 3ZG5A 1LLBA 3VSKA 1IKGA 3N8LA 3NIAA 4KQRA 3BLMA 2WGIA 4JF6A 4JXSA 1RCJA 1JTGA 3G2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJ4 A;  2Z2L B;  4KEN B;  1YM1 A;  3HLF A;  3V3R A;  1H5X A;  3IWQ A;  4JXV A;  5HAP A;  2HDS A;  2XF3 A;  5F1F A;  4EBL A;  4KZ8 A;  1AXB A;  4GZB A;  5FSR A;  1C3B A;  1FCM A;  4WEK A;  5EVI B;  3ZVT A;  3HLW A;  3M2K A;  2R9W A;  2EX8 A;  4S2P A;  1FQG A;  2P9V B;  3C4O A;  4RYE A;  3N8R A;  4LV1 A;  3BM6 A;  3IXG A;  4FH4 A;  5FI7 A;  5TGF A;  4ZAM A;  4KZ7 A;  3G4P A;  3O3V A;  2Y2I A;  1K4F A;  3GTC A;  1K4E A;  2ZC3 B;  3IT9 A;  2FFF B;  3IF6 B;  1N9B A;  3M6B A;  1HD8 A;  1E4D A;  2EFX A;  4HBU A;  5A90 A;  5IHV A;  5M1A A;  1PIO A;  4JLF A;  4Z9Q A;  1W5D A;  1NYY A;  4NET A;  1O7E A;  2XFS A;  2J9O A;  4BQM A;  3Q1F A;  5E2F A;  1CI8 A;  5FA7 A;  3G31 A;  1ERO A;  4PM6 A;  1YLY A;  3VOY A;  1GCE A;  1K57 C;  1E25 A;  3OCN A;  2HP6 A;  1LI0 A;  3OZH A;  4OQ0 A;  1ES4 A;  2ZQ7 A;  2XDM A;  2PU4 A;  2WKH A;  3IHA A;  5F1G A;  4U0X A;  3HUO A;  2Y2Q A;  3NBL A;  3ITB A;  3ZCZ A;  1I5Q A;  1K56 D;  2G2W A;  2V2F F;  5GL9 A;  3OPH A;  5FI6 A;  1PWD A;  5FQM A;  3ZNY A;  2WKE A;  1WYC A;  3G2Z A;  3CZD A;  1LI9 A;  1DY6 A;  1TEM A;  4DKI A;  2BG1 A;  2WAD A;  4OP8 A;  4S2L A;  4DF6 A;  2DCF A;  5E2G A;  3ZGA B;  5GLB A;  3VMA A;  1MPL A;  3Q7V A;  4ZJ1 A;  4EWF A;  1CI9 A;  3G30 A;  4LCM A;  4YFM A;  5FQQ A;  4N1X A;  2EX2 A;  5HW3 A;  2C5W B;  2ZJ9 A;  2ZM2 A;  5JYO A;  2JE5 A;  4KG5 A;  4C75 A;  3WS5 A;  3VFF A;  1XKZ A;  2VGJ A;  4UHU A;  5AQ9 A;  5EVI A;  4BLM A;  1ES5 A;  1W7F A;  5GLD A;  3QNB A;  2H10 A;  1NY0 A;  2WZX A;  3LCE A;  3NC8 A;  2Y2K A;  1ERM A;  5FI2 A;  5HAI A;  2OLV A;  2P9V A;  3A3J A;  3IXH A;  5DVA A;  3MBZ A;  3OC2 A;  3C7U A;  1ERQ A;  3BFC A;  4OOM A;  2V1Z A;  4PM9 A;  4Y0U A;  4E3M A;  4B4Z A;  1IKI A;  3PTE A;  2ZD8 A;  2QPN A;  3HUM A;  2Y2J A;  3IH9 A;  5CEC A;  3HLG A;  4LEN A;  4ZDX A;  5FAS A;  5EUA A;  3WS4 A;  1HVB A;  1M6K A;  4CPK A;  4OP5 A;  3FV7 A;  1GHP A;  1I2S A;  2QZ6 A;  4WYY A;  3HLE A;  3MKE A;  4EBN A;  1IYO A;  2X02 A;  5AQ7 A;  2RL3 A;  3GSG A;  1PI5 A;  4BD0 A;  1YT4 A;  3WS0 A;  1W8Q A;  3W8K A;  2C6W B;  4X6T A;  5DTS A;  4R4R A;  5E2E A;  2WKI A;  1JWV A;  1Y54 A;  5CED A;  1ZG4 A;  3SS5 A;  4BL3 A;  5EVL A;  4QY5 A;  1K56 A;  3BEC A;  3LEZ A;  1BUE A;  3NCK A;  3UPO A;  4OON A;  4XUX A;  5CGW A;  4GB7 A;  1H8Z A;  3IF5 A;  1MXO A;  3DWK A;  3IXB A;  5CGS A;  4O7D A;  4MBF A;  4LV2 A;  4Q8I A;  5M19 A;  3Q7V B;  5CRF A;  1J9M A;  1RGY A;  4DXB A;  4P87 A;  1IYP A;  3OCL A;  1JWZ A;  4B4X A;  1LL9 A;  2WZZ A;  4B88 A;  5EVI C;  3UDX A;  1H8Y A;  5A92 A;  2XR0 A;  1IYQ A;  3M6H A;  5FAP A;  3OPP A;  3HL9 A;  4DXC A;  1MY8 A;  1KGG A;  3BFD A;  5HX9 A;  4WM9 A;  5KSC A;  3IWI A;  2Y55 A;  1FOF A;  1L0G A;  2ZQ9 A;  4R0Q A;  5HL1 A;  3UE1 A;  4Y0O A;  4BJP A;  3TOI A;  4R23 A;  4S2N A;  4X55 A;  4E3K A;  3A3I A;  3SOI A;  2G2U A;  1KVM A;  5HAR A;  1XGJ A;  3NDE A;  3UO9 A;  4E3I A;  1GA0 A;  2XD5 A;  1LL5 A;  3CJM A;  2BLS A;  3M2J A;  4GOG A;  3IF6 C;  2XLN A;  3OPR A;  3ZG0 A;  5EE8 A;  3FYZ A;  3BRM A;  3PAG A;  3GMW A;  1TDG A;  1XPB A;  3RXW A;  1KE3 A;  5GHZ A;  3RXX A;  3BEB A;  3BFE A;  1XX2 A;  3HLD A;  1BSG A;  4E3N A;  3MZF A;  3C4P A;  1JTD A;  4IVK A;  2EX6 A;  2XK1 A;  2OSU A;  4DE1 A;  4C6Y A;  1IYS A;  3NI9 A;  1YLP A;  4X69 A;  2A3U A;  1HZO A;  1ALQ A;  3BLS A;  3P09 A;  4WMC D;  5AQB A;  4QY6 A;  4WEJ A;  1L0F A;  4OQI A;  4WZ5 A;  1QME A;  2ZC7 A;  5CHM A;  2J7V A;  3G35 A;  1U60 A;  4U0T A;  4A5R A;  1K55 A;  4K0X A;  4K91 A;  4R4S A;  1L0E A;  4OOL A;  4KQQ A;  2Y4A A;  2Y59 A;  3I7J A;  4N1H A;  2Q9N A;  4FD8 A;  4UA9 A;  3VP0 A;  4DE2 A;  2ZQ8 A;  3ZHH A;  2DRW A;  4KQO A;  2WGW A;  1ONG A;  4RVA A;  3UE3 A;  5CEB A;  1MKI A;  3N7W A;  3E2L A;  5KMW A;  1GHM A;  3BYD A;  5BOH A;  1FCN A;  5FQ9 A;  1NRF A;  2ZQC A;  4YIN A;  4BD1 A;  1ONH A;  3UN7 A;  2WUQ A;  1LHY A;  3SH7 A;  4MLL A;  3LY4 A;  4M3K A;  3S1Y A;  4OPQ A;  1YLT A;  2OV5 A;  5GHX A;  2Q9M A;  2V20 A;  1K54 A;  3VSL A;  3ITA A;  2DNS A;  1G6A A;  3Q81 A;  3N6I A;  2ZC4 B;  3ZG8 B;  1WE4 A;  4EUZ A;  1XGI A;  4DDS A;  1ESI A;  1ZKJ A;  5CER A;  3NY4 A;  1S6R A;  5DTK A;  3VP2 A;  1WYB A;  3WS2 A;  4IBX A;  1EWZ A;  3VP4 A;  4E3J A;  1PW1 A;  3BFG A;  2Z2M B;  1S0W A;  2ZC6 B;  5A91 A;  3SS4 A;  1RP5 A;  3AGF A;  1MWR A;  2A49 A;  2Y2G A;  4R3J A;  4E3L A;  4N9L A;  5M18 A;  4WEL A;  4CJN A;  5E43 A;  4S2O A;  1FSW A;  2J8Y A;  2WGV A;  3CG5 A;  4JXW A;  2RCX A;  4S2M A;  1VM1 A;  4JF4 A;  2JBF A;  1E3U D;  5JYP A;  1G68 A;  4R3B A;  1PWC A;  4KG6 A;  2PU2 A;  1JWP A;  2Y2N A;  4OLG A;  5CHJ A;  1KE4 A;  1Z6F A;  4Y0T A;  3ZDJ A;  3UY6 A;  3DWZ A;  4C3Q A;  1DJA A;  4S2K A;  3IHB A;  1W8Y A;  3V50 A;  4S2J A;  5GLC A;  1FSY A;  4LV0 A;  4N9K A;  5FAT A;  4BL2 A;  4DE0 A;  4WMC A;  5I94 A;  4NK3 A;  3A3D A;  4ZBE A;  1SDE A;  3HRE A;  3W4P A;  2IWB A;  3FZC A;  1M40 A;  1EI5 A;  1ESU A;  3MZE A;  3PBR A;  4EV4 A;  3MKF A;  2CC1 A;  5E2H A;  5FQJ A;  1MWU A;  1BLP A;  3MXS A;  4E6X A;  1PWG A;  1BLS A;  1FR6 A;  3FKV A;  3N4I A;  4LCL A;  5G18 A;  4RA7 A;  5KZH A;  4R1G A;  2WGW B;  1DJB A;  1MWS A;  1TDL A;  4KZB A;  2P74 A;  2PBY A;  1KGE A;  3G34 A;  4FSF A;  3WRT A;  4KZ5 A;  2J9P A;  2XD1 A;  3VOZ A;  4L0L A;  3N8S A;  1BZA A;  2ZLY A;  3FWL A;  3FKW A;  2HDR A;  3PBS A;  4JPM A;  5DF8 A;  1ES3 A;  4GDB A;  5FQK A;  1ZC2 A;  3JYI A;  2JCH A;  3DTM A;  3TG9 A;  1JVJ A;  1MWT A;  1Q2P A;  1CEF A;  1PZO A;  5FDH A;  3W4Q A;  4ZJ3 A;  3A3E A;  1QMF A;  2XEP A;  4DDY A;  2EFU A;  5D3O A;  2EXB A;  5FAQ A;  4KZ3 A;  3HVF A;  2I72 A;  3PBN A;  4GN2 A;  3AGE A;  3ISG A;  3UNW A;  3B3X A;  5GLA A;  1SDN A;  1FR1 A;  5CHU A;  2ZQA A;  4X53 A;  4X68 A;  3ZFZ A;  4EQI A;  4KZA A;  1NZU A;  3MZD A;  3S4X A;  4OPY A;  4KZ4 A;  4QU3 A;  2Y2H A;  5TR7 A;  3TSG A;  1Q2Q A;  2XH9 A;  5KSH A;  5U47 A;  3HBR A;  3UDF A;  5CTN A;  3C5A A;  4N92 A;  4PM8 A;  3SS3 A;  2Y2L A;  2IWC A;  2OLU A;  4KZ9 A;  4RX2 A;  5CGX A;  3P98 A;  5EVI D;  1NXY A;  2IWD A;  5EOE A;  3PBT A;  1MBL A;  1BT5 A;  4OKP A;  1RGZ A;  4OQG A;  1E3U A;  2B5R A;  2WAE A;  2Y2M A;  3WS1 A;  3PAE A;  4IVI A;  4ZJ2 A;  4QHC A;  4OH0 A;  4WZ4 A;  2HP5 A;  4XXR A;  4RX3 A;  2WK0 A;  3UPN A;  3O87 A;  1YQS A;  4QJG A;  1K25 A;  1BLH A;  3WWX A;  1PYY A;  5F82 A;  1W79 A;  3W4O A;  1O07 A;  2E8I A;  2Y2O A;  4PM7 A;  5A93 A;  3UPP A;  1PI4 A;  3VFH A;  3V39 A;  3LY3 A;  4D2O A;  1K6R A;  4X56 A;  1FCO A;  1NZO A;  4JXG A;  3RJU A;  3UDI A;  2ZM0 A;  1YLZ A;  3HLC A;  4QD4 A;  1GHI A;  2EXA A;  3IH8 A;  4U3T A;  1BLC A;  3IXD A;  3O86 A;  3PBO A;  5CXW A;  2ZC5 B;  4P6B A;  1N4O A;  2WYX A;  1VQQ A;  1YLJ A;  2XQZ A;  3EQV A;  4JBF A;  4UA6 A;  4PM5 A;  2XFT A;  2JC7 A;  1IEM A;  1KGF A;  4H8R A;  4ZTK A;  3ZVW A;  1SKF A;  3ZG9 B;  4IBR A;  4XUZ A;  4MEZ A;  3GV9 A;  1CEG A;  5FQI A;  3VP1 A;  4GKU A;  3Q07 A;  3G32 A;  4OQH A;  5DF7 A;  4S2N C;  1GA9 A;  3AGD A;  5EPH A;  1I2W A;  2GDN A;  4HBT A;  3S22 A;  4EBP A;  4MNR A;  3GQZ A;  3OPL A;  5AQA A;  2WAF A;  5TFQ A;  3BFF A;  4JKT A;  2EX9 A;  1TVF A;  1ZG6 A;  3V3S A;  4KZ6 A;  4QB8 A;  1KVL A;  1K6S A;  5CTM A;  4OOY A;  3C7V A;  3E2K A;  1YLW A;  3HUN A;  3MFD A;  4JF5 A;  3NDG A;  3ZNT A;  1XXM A;  1PW8 A;  1SCW A;  2Y2P A;  3QHY A;  4OPR A;  5J8X A;  1KE0 A;  4BEN A;  3UE0 A;  4GNU A;  3GRJ A;  4OVD A;  4GD8 A;  3ZG7 B;  2QMI A;  1SHV A;  3LO7 A;  3VP3 A;  2X71 A;  2HPB A;  3GR2 A;  4WZ5 C;  1YMS A;  4S2I A;  4E6W A;  2HP9 A;  4P85 A;  1K55 C;  5L2F A;  2VGK A;  1HTZ A;  3CMZ A;  2HDQ A;  4P0M A;  3WRZ A;  5HAQ A;  1KDS A;  4PPR A;  5HFO A;  4OPZ A;  2ZQD A;  5DF9 A;  1ES2 A;  2ZMA A;  4HES A;  4FH2 A;  4ID4 A;  2H0T A;  5F83 A;  3PBQ A;  4UAA A;  4WBG A;  2X01 A;  2ZM8 A;  3IF6 A;  4MBH A;  4OLD A;  2XGN A;  4GDN A;  1BTL A;  3A3F A;  1K38 A;  3D4F A;  3Q82 A;  4UA7 A;  5GHY A;  3O88 A;  4IED A;  3SH8 A;  4LV3 A;  1BUL A;  1YMX A;  1XA7 A;  3GVB A;  5FAO A;  2FFY A;  3IWO A;  5DTT A;  5EEC A;  3EQU A;  4Y7P A;  4F94 A;  1K54 C;  1L2S A;  4MBK A;  2R9X A;  2Y91 A;  4DRT A;  1OME A;  3DW0 A;  1PZP A;  1IEL A;  4KG2 A;  1XP4 A;  4E3O A;  3HLB A;  1CK3 A;  4GD6 A;  3V5M A;  1K57 A;  2UWX A;  2H0Y A;  5EOO A;  4DE3 A;  4FCF A;  1DJC A;  2H5S A;  4K0W A;  1KDW A;  2HDU A;  1XA1 A;  3QNC A;  4HEF A;  4PMA A;  3SH9 A;  3Q7Z A;  3MXR A;  1NYM A;  3IQA A;  1L0D A;  3ZG5 A;  1LLB A;  3VSK A;  1IKG A;  3N8L A;  3NIA A;  4KQR A;  3BLM A;  2WGI A;  4JF6 A;  4JXS A;  1RCJ A;  1JTG A;  3G2Y A; 
#chains in the Genus database with same CATH topology
 3HLF A;  5HAP A;  4HJ3 A;  4EEP A;  4KUO A;  1FCM A;  2VV7 A;  5HWV A;  3HLW A;  5EV0 A;  2R9W A;  4RYE A;  4EET B;  4FH4 A;  3G4P A;  2Y2I A;  3GTC A;  1T19 A;  2ZC3 B;  4I38 A;  4Q0I A;  2FFF B;  3M6B A;  1E4D A;  1F98 A;  5A90 A;  4HBU A;  1PIO A;  1EW0 A;  4LRY C;  4NG2 A;  2XFS A;  2J9O A;  5E2F A;  3KSI A;  3G31 A;  4PM6 A;  1UWN X;  3OCN A;  2HP6 A;  3OZH A;  4EES A;  3HUO A;  3NBL A;  5TJJ A;  4GCZ A;  1I5Q A;  2G2W A;  5GL9 A;  4WUJ A;  3OPH A;  5FQM A;  1FIK A;  3IX8 A;  3C30 A;  3CZD A;  3E98 A;  2WAD A;  4OP8 A;  4DF6 A;  2WKP A;  2NUP C;  3B33 A;  3FG8 A;  4E04 A;  4YFM A;  3T12 B;  2J3W A;  3WS5 A;  3A0S A;  4UHU A;  5AQ9 A;  5GLD A;  3LCE A;  2OLV A;  1S66 L;  4GW9 A;  5DVA A;  3MBZ A;  3KSG A;  2V1Z A;  4PM9 A;  3IBR A;  4JGP A;  3QP2 A;  2ZL1 B;  5F5Y A;  5CEC A;  1XFQ A;  5FAS A;  2K7S A;  1HVB A;  1M6K A;  1D1J A;  4I5S A;  4OP5 A;  4JGO A;  5FEG A;  2JN7 A;  5AVF A;  5E2E A;  2KX6 A;  1JWV A;  3BWL A;  1TD5 A;  1DP8 A;  2VZW A;  4BL3 A;  5EVL A;  4QY5 A;  3NOU C;  1LT0 A;  3UPO A;  4OON A;  1H8Z A;  1MXO A;  4IHQ A;  5CGS A;  4O7D A;  4MBF A;  4Q8I A;  3G6O A;  3LGO A;  3E4Q A;  4I39 A;  1LL9 A;  2WZZ A;  1H8Y A;  3M6H A;  5L8M A;  3HL9 A;  2KDK A;  3BFD A;  5DJT A;  2O9B A;  5KSC A;  2ZQ9 A;  5HL1 A;  4R23 A;  4HJ4 A;  4HY8 A;  2G2U A;  1GA0 A;  2XD5 A;  5FL3 A;  3M2J A;  4HJ6 A;  3OPR A;  1LL8 A;  3GMW A;  3MQO A;  3RXW A;  1KE3 A;  3BFE A;  4F3L B;  2ZL1 A;  2ZBB A;  3LR3 A;  4C6Y A;  1IYS A;  1YLP A;  1HZO A;  3P09 A;  4WEJ A;  2GJ3 A;  1L0F A;  1A0K A;  1QME A;  2HJ9 C;  3EGD C;  5DFY A;  4R4S A;  2Y59 A;  2ACG A;  2Y8H A;  4II7 A;  2ZQ8 A;  3ZHH A;  4KQO A;  4DJ2 A;  4RVA A;  5CEB A;  3FC7 A;  4WF0 A;  3E2L A;  3S7P A;  1VHM A;  1FCN A;  5FQ9 A;  2BTF P;  4PAU A;  4G3K A;  3UN7 A;  2P08 A;  3S1Y A;  3ITA A;  1ZTU A;  1WE4 A;  2Z6D A;  5CER A;  1ZKJ A;  2UV0 E;  2ZMF A;  1FIL A;  2O0Y A;  5J7E A;  4YWZ A;  3VP4 A;  4E3J A;  2QJ5 A;  2ZC6 B;  1S0W A;  1NWZ A;  3SS4 A;  1RP5 A;  3KYE A;  1FSW A;  2WGV A;  2RCX A;  4S2M A;  4JF4 A;  2JBF A;  1W63 Q;  1X0O A;  3BW6 A;  4KG6 A;  2HZ5 A;  2PU2 A;  5EVE A;  5J3W A;  5CHJ A;  1Z6F A;  3ZDJ A;  4C3Q A;  2LB9 A;  3LIB A;  4S2J A;  5GLC A;  4DE0 A;  4BL2 A;  1N9L A;  2IWB A;  1ESU A;  2V0U A;  4LGW A;  1MWU A;  2HV1 A;  1BLS A;  1FR6 A;  4LCL A;  3SZT A;  4LPZ A;  3GDI A;  4MN6 A;  3T4O A;  4LRZ E;  2P74 A;  2PBY A;  4FSF A;  2J9P A;  4NKP A;  4L0L A;  1BZA A;  5HWW A;  2HDR A;  3PBS A;  3A0R A;  1ES3 A;  3HJK A;  5FQK A;  5AJG A;  1JVJ A;  5I5L A;  3S7O A;  1PZO A;  3A3E A;  2EFU A;  5EM0 A;  3HVF A;  3LEQ A;  3B3X A;  5GLA A;  1SDN A;  2GX5 A;  2ZQA A;  5DKL A;  4KZ4 A;  3TSG A;  2Y2H A;  5KSH A;  3DBA A;  2EWV A;  2OLU A;  3P98 A;  1NXY A;  1MBL A;  4OKP A;  2QKP A;  4L9E A;  4WL9 A;  4QHC A;  2HP5 A;  4XXR A;  3CHW P;  3O87 A;  3ULF A;  3WWX A;  1T1C A;  1W79 A;  1O07 A;  1D7E A;  3QP6 A;  1J3W A;  5TBM B;  3VFH A;  3V39 A;  3TJZ C;  1H3Q A;  4UQI S;  3F1N A;  4U3T A;  2EXA A;  5F69 A;  1N4O A;  2XQZ A;  4WLA A;  4UA6 A;  1UWP X;  4PM5 A;  4IBR A;  4XUZ A;  4MEZ A;  3UB8 A;  5DFX A;  5FQI A;  3VP1 A;  3G32 A;  4S2N C;  4HBT A;  4Y5F A;  3GQZ A;  5AQA A;  2WAF A;  3LIC A;  1TVF A;  3V3S A;  2G7U A;  2GZA A;  4QB8 A;  1PW8 A;  3QHY A;  4OPR A;  5J8X A;  1KE0 A;  2JKT M;  3E4O A;  3UE0 A;  4GD8 A;  3GR2 A;  4WZ5 C;  1F9I A;  4O01 A;  4P0M A;  3WRZ A;  5HAQ A;  4OPZ A;  5DF9 A;  4ID4 A;  2H0T A;  5TBM A;  3IF6 A;  3F1O B;  3D4F A;  3KYZ A;  1YMX A;  3GVB A;  3IWO A;  3EQU A;  1K54 C;  1L2S A;  1TS7 A;  4MBK A;  1GSX A;  2Y91 A;  5HD3 A;  1XP4 A;  4E3O A;  1K57 A;  5FDS A;  1K0K A;  4FTX A;  1KDW A;  4HEF A;  1L0D A;  3BLM A;  2WGI A;  1JTG A;  3G2Y A;  1L3L A;  1NJ4 A;  4P6Z M;  1YM1 A;  3IWQ A;  4JXV A;  5F1F A;  4EBL A;  1AXB A;  4HP4 A;  4B9O A;  5EVI B;  3ZVT A;  1VEU B;  3LYX A;  3L7H A;  3UME A;  3M2K A;  4H6J B;  4EW7 A;  1GSV A;  4S2P A;  3H7W A;  3N8R A;  4LV1 A;  1PFL A;  1VB6 A;  4ZAM A;  3O3V A;  3IT9 A;  1S1Y A;  1N9B A;  1HD8 A;  2EFX A;  3F1O A;  5IHV A;  1NLY A;  4JLF A;  4NET A;  4BQM A;  4G3V A;  1K57 C;  1LI0 A;  4OQ0 A;  2WKH A;  2Y2Q A;  3ITB A;  3ZCZ A;  3G2Z A;  2OOL A;  4L9G A;  2BG1 A;  2ZMV A;  4S2L A;  2DCF A;  4HI4 A;  5F68 A;  3VMA A;  1OTE A;  4MDZ A;  1CI9 A;  4K08 A;  4N1X A;  2VV6 A;  4GS9 A;  2ZJ9 A;  1OTD A;  2JE5 A;  5L09 A;  4KG5 A;  4C75 A;  1P0Z A;  3IS2 A;  5EVI A;  4BLM A;  1ES5 A;  1W7F A;  3NJA A;  2H10 A;  1NY0 A;  3NC8 A;  2W3E A;  2QYB A;  2E8J A;  3IXH A;  3BJN A;  2YKF A;  3BFC A;  4E3M A;  2VK3 A;  4B4Z A;  2M1C A;  3PTE A;  3HUM A;  2Y2J A;  3HLG A;  4LEN A;  4QPR A;  4PHT A;  5EUA A;  3WS4 A;  4CPK A;  1GHP A;  3HLE A;  3QP1 A;  2X02 A;  4BD0 A;  1YT4 A;  2C6W B;  4X6T A;  4QWO A;  4NXE A;  1Y54 A;  2PT7 A;  1DRM A;  4DN0 A;  4XUX A;  4GB7 A;  3JVV A;  3DWK A;  3GEC A;  4LV2 A;  5M19 A;  1RGY A;  4DXB A;  1D06 A;  1IYP A;  4B4X A;  5EVI C;  3UDX A;  5A92 A;  2XR0 A;  1IYQ A;  4BBT A;  1YSP A;  4DXC A;  1KGG A;  5HX9 A;  4WM9 A;  2Y55 A;  1FOF A;  1CQA A;  4NXG A;  4E3K A;  4X55 A;  3SOI A;  1F5M A;  3L9K A;  3CJM A;  2BLS A;  4GOG A;  5DKK A;  2XLN A;  2JHE A;  1OTI A;  1LSW A;  5EE8 A;  2A24 A;  2W1T B;  1XPB A;  3EOI A;  1LSX A;  1XX2 A;  3HLD A;  2EX6 A;  1KOU A;  4DE1 A;  3QP8 A;  5AQB A;  3IX3 A;  5CHM A;  3MXQ A;  3VOL A;  4A5R A;  1K55 A;  4Q0H A;  1L0E A;  4OOL A;  4N1H A;  4FD8 A;  3ZYT A;  1ONG A;  1OT9 A;  4KQD A;  3FPV A;  1NRF A;  3VV4 A;  1Z09 A;  3LR4 A;  4BD1 A;  3SH7 A;  4MLL A;  4O0P A;  3VSL A;  2DNS A;  3FPW A;  3Q81 A;  5MC7 A;  3WS2 A;  3BFG A;  2Z2M B;  5A91 A;  2Y79 A;  3AGF A;  4R3J A;  1W63 M;  5M18 A;  4R3A A;  5HPF A;  2W1T A;  3CG5 A;  1CF0 A;  5JYP A;  2PYR A;  1G68 A;  2VA0 A;  4R3B A;  1JWP A;  3LIA A;  1KE4 A;  3UY6 A;  4EQ1 A;  4S2K A;  3IHB A;  2PHY A;  3LIE A;  1OT6 A;  5FAT A;  5I94 A;  4NK3 A;  4CQH A;  3FZC A;  1M40 A;  4CLC B;  5FQJ A;  1BLP A;  3N4I A;  5G18 A;  1TDL A;  1SKO A;  4KZ5 A;  5IS1 A;  1VET A;  3PXP A;  3FKW A;  4JPM A;  1OJG A;  4GDB A;  3JYI A;  2JCH A;  3SW1 A;  1MWT A;  1CEF A;  3T4L A;  2V1A A;  3W4Q A;  2XEP A;  2AVX A;  4KZ3 A;  2I72 A;  2W3G A;  3ZFZ A;  3MZD A;  4OPY A;  5TR7 A;  3OBF A;  5L10 A;  2XH9 A;  3HBR A;  2IWD A;  3UMD A;  3PBT A;  4OQG A;  3PAE A;  4WZ4 A;  2PR5 A;  1BLH A;  1PYY A;  2E8I A;  3LID A;  1PI4 A;  3P7N A;  4CLC A;  3TRC A;  4D2O A;  4X56 A;  2PYP A;  3IH8 A;  3IXD A;  3O86 A;  4PKY G;  5CXW A;  2ZC5 B;  4P6B A;  1OTB A;  2VV8 A;  2XFT A;  2JC7 A;  2W3D A;  1TS0 A;  4H8R A;  3CWF A;  2FZ0 A;  3TE8 A;  3Q07 A;  3LUQ A;  4OQH A;  1DP6 A;  3AGD A;  1G6O A;  4EBP A;  3S22 A;  3LIF A;  2W27 A;  3BFF A;  2EX9 A;  4AFI A;  4KZ6 A;  1K6S A;  4OOY A;  1YLW A;  4JF5 A;  3NDG A;  1XXM A;  2L0W A;  2Y2P A;  4R6L A;  3C2W A;  3IBJ A;  1XJ6 A;  3QP5 A;  4GNU A;  4Y17 A;  3GRJ A;  2IA2 A;  3H82 B;  2QMI A;  2W3H A;  1SHV A;  2H28 A;  2HPB A;  2X71 A;  1XJ4 A;  4S2I A;  4P85 A;  2HP9 A;  3CAX A;  4IJG A;  5G4Z A;  3RFB A;  4I3A A;  5L2F A;  3D3O A;  2HDQ A;  4EU0 A;  3HJI A;  5HFO A;  4X1L A;  1ES2 A;  2ZMA A;  3H9W A;  3PBQ A;  4UAA A;  3ICY A;  3CUE A;  4L9F A;  3PHY A;  4GDN A;  1BTL A;  3A3F A;  4ESP A;  4UA7 A;  3Q82 A;  3F1N B;  3O88 A;  4IED A;  1XA7 A;  5FAO A;  2FFY A;  4PKY A;  4XT2 B;  2L4R A;  2R9X A;  1OME A;  4KG2 A;  4P6Z S;  4KUK A;  5DJU A;  4FCF A;  1DJC A;  3Q7Z A;  3V67 A;  4EXO A;  3IX4 A;  4JXS A;  4KZ7 A;  3V3R A;  1H5X A;  2HDS A;  1Y4O A;  4KZ8 A;  4BBV A;  4GZB A;  3H82 A;  1C3B A;  2BAS A;  3T1R A;  2EX8 A;  4BBU A;  1FQG A;  3C4O A;  2P7J A;  3BM6 A;  5FI7 A;  1S4S A;  3MMH A;  3IF6 B;  3CPT A;  5M1A A;  4Z9Q A;  1W5D A;  1PNE A;  1O7E A;  3Q1F A;  2L1M A;  5FA7 A;  4XT2 A;  3VOY A;  1ES4 A;  2ZQ7 A;  5F1G A;  1LSV A;  1K56 D;  5FI6 A;  3P01 A;  4M4X A;  3MQQ A;  3ZNY A;  2WKE A;  2XA7 M;  1LI9 A;  3VE4 A;  3C38 A;  5E2G A;  3ZGA B;  5GLB A;  3Q7V A;  4ZJ1 A;  4LCM A;  5FQQ A;  2EX2 A;  2C5W B;  2Q0O A;  5F6A A;  2WZX A;  4WN5 A;  4R38 A;  2DMW A;  3H7W B;  3A3J A;  2HF6 A;  1ERQ A;  4OOM A;  1IKI A;  4ARZ B;  4ZDX A;  3F1P B;  4ETZ A;  2JKR M;  3FV7 A;  1I2S A;  4WYY A;  5AQ7 A;  2RL3 A;  3GSG A;  1MZU A;  1PI5 A;  3WS0 A;  4R4R A;  5A8B A;  1ZG4 A;  5KIZ A;  3SS5 A;  3MJQ A;  3BEC A;  3CLO A;  1TS8 A;  3MS6 A;  1SZV A;  1BUE A;  3NCK A;  5CGW A;  1T1B A;  4YNR A;  1J9M A;  3NOP C;  2VGL M;  4B88 A;  4GS9 B;  3UE6 A;  2MJ6 A;  5C5K A;  3IS2 B;  3IWI A;  3NUL A;  5IU1 A;  2O9C A;  4R0Q A;  3U2A A;  3UE1 A;  3TOI A;  4JGQ A;  1XFN A;  3A3I A;  1MC0 A;  1KVM A;  1XGJ A;  3NDE A;  3UO9 A;  3IF6 C;  3BRM A;  3PAG A;  2ZOI A;  1TDG A;  5GHZ A;  3T4S A;  3D72 A;  3BEB A;  4ARZ A;  3MQ0 A;  3QP4 A;  1BSG A;  4MCW A;  2XK1 A;  3F1P A;  2OSU A;  3DTE A;  2PD7 A;  3NI9 A;  3PR6 A;  4X69 A;  4DJ3 A;  3BLS A;  4WMC D;  3T4Q A;  4G3W A;  4OQI A;  3KX0 X;  4U0T A;  3TW8 A;  4HH2 A;  4K0X A;  4KQQ A;  3I7J A;  2Q9N A;  4Y13 A;  4UA9 A;  4EER A;  3VP0 A;  2WGW A;  1AWI A;  1MKI A;  5KMW A;  1P9W A;  1GHM A;  3E4P A;  5BOH A;  2M7V A;  2ZQC A;  1ONH A;  2WUQ A;  5HPI A;  3LR5 A;  1YLT A;  2OV5 A;  5GHX A;  2V20 A;  3DAV A;  1S67 L;  3R7W A;  4EUZ A;  1XGI A;  3NY4 A;  5DTK A;  3VP2 A;  1WYB A;  1H0M A;  1EWZ A;  2J3T C;  1PW1 A;  3NOT C;  3MFX A;  1MWR A;  2A49 A;  4E3L A;  4WEL A;  2A24 B;  4CJN A;  5E43 A;  4HOI A;  2J8Y A;  4JXW A;  4D60 A;  3EGX C;  2WKQ A;  2W1R A;  2P04 A;  1E3U D;  4IUH A;  2PR6 A;  1XJ2 A;  3DWZ A;  1DJA A;  1S1Z A;  1FSY A;  2VKS A;  1TF1 A;  4ZBE A;  4BWI A;  3W4P A;  3K3C A;  5FEF A;  1EI5 A;  4EV4 A;  3MZE A;  3MKF A;  2CC1 A;  5E2H A;  3D9Y A;  1PWG A;  3K2N A;  3KYQ A;  5KZH A;  4R1G A;  1DJB A;  5HDD A;  1MWS A;  4KZB A;  3T1S A;  3G34 A;  2FH5 A;  2GNX A;  3WRT A;  4ETX A;  1T18 A;  3N8S A;  3FWL A;  5DF8 A;  3BY9 A;  1ZC2 A;  2YKH A;  2V1B A;  4X1M A;  4YOF A;  4ZJ3 A;  5D3O A;  2EXB A;  5FAQ A;  3ZQ5 A;  3PBN A;  3ISG A;  3UNW A;  5CHU A;  3T1X A;  4X68 A;  4KZA A;  1NZU A;  2I9V A;  2R78 A;  3C5A A;  4PM8 A;  2Y2L A;  2IWC A;  5CGX A;  5EVI D;  5EOE A;  2VLG A;  1BT5 A;  1RGZ A;  2Y2M A;  4IVI A;  4ZJ2 A;  3LR0 A;  4OH0 A;  2QJ7 A;  4RX3 A;  4QJG A;  1K25 A;  3KO6 A;  3W4O A;  4PM7 A;  5A93 A;  1F2K A;  3UB6 A;  1FCO A;  2OAP 1;  4JXG A;  3UDI A;  2ZM0 A;  1YLZ A;  1GHI A;  1SKO B;  1BLC A;  3PBO A;  5HDS A;  2WYX A;  4JBF A;  3EQV A;  1VET B;  1IEM A;  1KGF A;  4ZTK A;  1SKF A;  3ZG9 B;  1GA9 A;  5EPH A;  1G5U A;  4MNR A;  3OPL A;  5TFQ A;  2Z6C A;  3EEH A;  4NXF A;  4ME4 A;  4BEN A;  3JVU A;  4CLC E;  3UB7 A;  4OVD A;  3ZG7 B;  3BQA A;  3K3D A;  5G4Y A;  3VE3 A;  1K55 C;  2W3F A;  2O9A A;  1KDS A;  2CMN A;  4Y15 A;  4HES A;  4FH2 A;  5F83 A;  2X01 A;  2ZM8 A;  4MBH A;  4OLD A;  1ODV A;  5J4E A;  3EWK A;  1K38 A;  1OTA A;  4LV3 A;  2XRN A;  5EEC A;  2NUT C;  4Y7P A;  2O99 A;  4DRT A;  5L07 A;  1CK3 A;  4GD6 A;  3V5M A;  5EOO A;  4DE3 A;  3A0V A;  2H5S A;  2D01 A;  4K0W A;  2VJW A;  4PMA A;  5HSQ A;  4Y2F A;  2PBD P;  1NLZ A;  3ZG5 A;  4HH3 A;  2INW A;  1IKG A;  3N8L A;  3NIA A;  2XRO A;  4HP9 A;  4JF6 A;  1RCJ A;  2Z2L B;  1DP9 A;  4KEN B;  2XF3 A;  2QHK A;  3C8C A;  3NHQ A;  5FSR A;  3U4L P;  4Y3I A;  4WEK A;  3PYP A;  2P9V B;  3IXG A;  5TGF A;  4GJ4 A;  2B02 A;  2A2L A;  3KSF A;  1K4F A;  1N9N A;  1K4E A;  1P9R A;  2EA9 A;  1GSW A;  1NYY A;  4BMW A;  2XA7 S;  4NXB A;  4I3I A;  1OPX A;  1CI8 A;  1ERO A;  1YLY A;  1GCE A;  1E25 A;  3LI9 A;  5EM1 A;  2XDM A;  2PU4 A;  3IHA A;  4U0X A;  4HQA A;  1BYW A;  2V2F F;  1G28 A;  1PWD A;  1WYC A;  1DY6 A;  1TEM A;  4DKI A;  1MPL A;  1P97 A;  4EWF A;  1IOU A;  4EUV A;  3G30 A;  5HW3 A;  1OJ5 A;  2OWH A;  4R70 A;  2ZM2 A;  5LBR A;  5JYO A;  3CIT A;  3VFF A;  1XKZ A;  2VGJ A;  3QNB A;  2Y2K A;  3MSH A;  1ERM A;  5FI2 A;  2KLI A;  2HJE A;  4CLC C;  5HAI A;  4FUW A;  2P9V A;  3OC2 A;  3C7U A;  4Y0U A;  2ZD8 A;  3CPT B;  2QPN A;  4F3L A;  3IH9 A;  2OAQ 1;  3BQ8 A;  3CI6 A;  3MF0 A;  2QZ6 A;  4EBN A;  3MKE A;  1IYO A;  3KSH A;  1ACF A;  5CX7 A;  2OWJ A;  3DTK A;  1W8Q A;  3W8K A;  5DTS A;  4CLC D;  2WKI A;  5CED A;  2JKG A;  2VGL S;  1K56 A;  3LEZ A;  4I3J A;  1H8M A;  3IF5 A;  3IXB A;  2WKR A;  3Q7V B;  5CRF A;  4P87 A;  2EWW A;  3OCL A;  1JWZ A;  3RH8 B;  2V8F A;  5FAP A;  1YKD A;  3OPP A;  1MY8 A;  1TS6 A;  1L0G A;  1JNU A;  1PRQ A;  5HDC A;  4Y0O A;  4BJP A;  4S2N A;  2JKT I;  5HAR A;  4E3I A;  1LL5 A;  4MN5 A;  3CUE C;  3ZG0 A;  1CJF A;  3FYZ A;  3RXX A;  1V9Z A;  2D02 A;  4E3N A;  3MZF A;  3C4P A;  1JTD A;  4IVK A;  3NEC A;  2A3U A;  4HHD A;  1ALQ A;  4QY6 A;  3E0Y A;  1T1A A;  4WZ5 A;  2ZC7 A;  2J7V A;  3G35 A;  1U60 A;  2W0N A;  2V0W A;  5HL6 A;  2JKR I;  4K91 A;  2Y4A A;  4ZRR A;  3T4K A;  1N9O A;  4DE2 A;  2DRW A;  1IFQ A;  3UE3 A;  5K5B A;  3N7W A;  4DMZ A;  3BYD A;  4YIN A;  1LHY A;  1YPR A;  3LY4 A;  4M3K A;  4OPQ A;  2Q9M A;  1K54 A;  1G6A A;  3N6I A;  2ZC4 B;  3ZG8 B;  1Y28 A;  4DDS A;  1ESI A;  1S6R A;  3R4K A;  4IBX A;  5IT5 A;  4LLO B;  2Y2G A;  4Q0J A;  4N9L A;  4S2O A;  1VM1 A;  3LI8 A;  1PWC A;  2Y2N A;  4OLG A;  2VEA A;  4Y0T A;  4X25 A;  1W8Y A;  1YSQ A;  3V50 A;  3UB9 A;  4N9K A;  4LV0 A;  4WMC A;  5EFW A;  4B93 A;  3A3D A;  1SDE A;  3HRE A;  2PDR A;  3PBR A;  2LB5 A;  4IUK A;  3MXS A;  2PD8 A;  4E6X A;  4NEE D;  3FKV A;  3JPU A;  4RA7 A;  2WGW B;  2V9A A;  5AVE A;  1KGE A;  2V8C A;  2XD1 A;  3VOZ A;  2ZLY A;  4O8G A;  4HIA A;  2HGV A;  3MR0 A;  3TG9 A;  3DTM A;  3OLO A;  1Q2P A;  5FDH A;  3B42 A;  1ZHH B;  3R7W B;  2QWS A;  1QMF A;  4DDY A;  2K2N A;  4RQ9 A;  1XJ3 A;  4GN2 A;  3AGE A;  1NRJ A;  1FR1 A;  4X53 A;  4EQI A;  2JKF A;  3S4X A;  4QU3 A;  1Q2Q A;  5U47 A;  2B18 A;  2K31 A;  3UDF A;  5CTN A;  4N92 A;  3SS3 A;  4RX2 A;  4KZ9 A;  2ZOH A;  3RTY A;  4EEU A;  1E3U A;  2B5R A;  2WAE A;  4JGR A;  3WS1 A;  2XSS A;  5HZH A;  3LFV A;  2PRF A;  3S7N A;  2WK0 A;  3UPN A;  1YQS A;  5F82 A;  2Y2O A;  3UPP A;  3OOV A;  4GHI B;  3LY3 A;  2KOI A;  1K6R A;  1NZO A;  1HLU P;  3RJU A;  4FOF A;  3HLC A;  4QD4 A;  3B47 A;  1VQQ A;  1YLJ A;  3ZVW A;  3GV9 A;  1CEG A;  4GKU A;  4LFU A;  5DF7 A;  3S7Q A;  1I2W A;  2GDN A;  4UQI M;  3BY8 A;  4JKT A;  5HD5 A;  1V9Y A;  1ZG6 A;  1KVL A;  5CTM A;  2PAV P;  3T1Q B;  3C7V A;  3E2K A;  3HUN A;  3MFD A;  4Z1W A;  4MMN A;  3ZNT A;  1SCW A;  5HWT A;  1S4R A;  3EEA A;  3T4J A;  3VP3 A;  1YMS A;  4E6W A;  1VEU A;  4H6J A;  2VGK A;  1HTZ A;  3CMZ A;  2B95 A;  2J3T D;  1WA9 A;  4MN7 A;  4LRX C;  4PPR A;  2ZQD A;  3T4T A;  4UEY A;  4WBG A;  4GHI A;  2XGN A;  1STZ A;  1UGU A;  5GHY A;  3SH8 A;  1BUL A;  2VX8 A;  4GLQ A;  5DTT A;  3UB5 P;  4F94 A;  3O5Y A;  3DW0 A;  1YAX A;  1PZP A;  1IEL A;  3HLB A;  3DTI A;  2UWX A;  3T50 A;  2H0Y A;  2HDU A;  1XA1 A;  3QNC A;  1MKM A;  3SH9 A;  4HNB A;  3MXR A;  1NYM A;  3IQA A;  1LLB A;  3VSK A;  3W2Z A;  2J80 A;  4KQR A;  2M7U A;  3HCY A;  3LO7 A; 
#chains in the Genus database with same CATH homology
 1NJ4 A;  2Z2L B;  4KEN B;  1YM1 A;  3HLF A;  3V3R A;  1H5X A;  3IWQ A;  4JXV A;  5HAP A;  2HDS A;  2XF3 A;  5F1F A;  4EBL A;  4KZ8 A;  1AXB A;  4GZB A;  5FSR A;  1C3B A;  1FCM A;  4WEK A;  5EVI B;  3ZVT A;  3HLW A;  3M2K A;  2R9W A;  2EX8 A;  4S2P A;  1FQG A;  2P9V B;  3C4O A;  4RYE A;  3N8R A;  4LV1 A;  3BM6 A;  3IXG A;  4FH4 A;  5FI7 A;  5TGF A;  4ZAM A;  4KZ7 A;  3G4P A;  3O3V A;  2Y2I A;  1K4F A;  3GTC A;  1K4E A;  2ZC3 B;  3IT9 A;  2FFF B;  3IF6 B;  1N9B A;  3M6B A;  1HD8 A;  1E4D A;  2EFX A;  4HBU A;  5A90 A;  5IHV A;  5M1A A;  1PIO A;  4JLF A;  4Z9Q A;  1W5D A;  1NYY A;  4NET A;  1O7E A;  2XFS A;  2J9O A;  4BQM A;  3Q1F A;  5E2F A;  1CI8 A;  5FA7 A;  3G31 A;  1ERO A;  4PM6 A;  1YLY A;  3VOY A;  1GCE A;  1K57 C;  1E25 A;  3OCN A;  2HP6 A;  1LI0 A;  3OZH A;  4OQ0 A;  1ES4 A;  2ZQ7 A;  2XDM A;  2PU4 A;  2WKH A;  3IHA A;  5F1G A;  4U0X A;  3HUO A;  2Y2Q A;  3NBL A;  3ITB A;  3ZCZ A;  1I5Q A;  1K56 D;  2G2W A;  2V2F F;  5GL9 A;  3OPH A;  5FI6 A;  1PWD A;  5FQM A;  3ZNY A;  2WKE A;  1WYC A;  3G2Z A;  3CZD A;  1LI9 A;  1DY6 A;  1TEM A;  4DKI A;  2BG1 A;  2WAD A;  4OP8 A;  4S2L A;  4DF6 A;  2DCF A;  5E2G A;  3ZGA B;  5GLB A;  3VMA A;  1MPL A;  3Q7V A;  4ZJ1 A;  4EWF A;  1CI9 A;  3G30 A;  4LCM A;  4YFM A;  5FQQ A;  4N1X A;  2EX2 A;  5HW3 A;  2C5W B;  2ZJ9 A;  2ZM2 A;  5JYO A;  2JE5 A;  4KG5 A;  4C75 A;  3WS5 A;  3VFF A;  1XKZ A;  2VGJ A;  4UHU A;  5AQ9 A;  5EVI A;  4BLM A;  1ES5 A;  1W7F A;  5GLD A;  3QNB A;  2H10 A;  1NY0 A;  2WZX A;  3LCE A;  3NC8 A;  2Y2K A;  1ERM A;  5FI2 A;  5HAI A;  2OLV A;  2P9V A;  3A3J A;  3IXH A;  5DVA A;  3MBZ A;  3OC2 A;  3C7U A;  1ERQ A;  3BFC A;  4OOM A;  2V1Z A;  4PM9 A;  4Y0U A;  4E3M A;  4B4Z A;  1IKI A;  3PTE A;  2ZD8 A;  2QPN A;  3HUM A;  2Y2J A;  3IH9 A;  5CEC A;  3HLG A;  4LEN A;  4ZDX A;  5FAS A;  5EUA A;  3WS4 A;  1HVB A;  1M6K A;  4CPK A;  4OP5 A;  3FV7 A;  1GHP A;  1I2S A;  2QZ6 A;  4WYY A;  3HLE A;  3MKE A;  4EBN A;  1IYO A;  2X02 A;  5AQ7 A;  2RL3 A;  3GSG A;  1PI5 A;  4BD0 A;  1YT4 A;  3WS0 A;  1W8Q A;  3W8K A;  2C6W B;  4X6T A;  5DTS A;  4R4R A;  5E2E A;  2WKI A;  1JWV A;  1Y54 A;  5CED A;  1ZG4 A;  3SS5 A;  4BL3 A;  5EVL A;  4QY5 A;  1K56 A;  3BEC A;  3LEZ A;  1BUE A;  3NCK A;  3UPO A;  4OON A;  4XUX A;  5CGW A;  4GB7 A;  1H8Z A;  3IF5 A;  1MXO A;  3DWK A;  3IXB A;  5CGS A;  4O7D A;  4MBF A;  4LV2 A;  4Q8I A;  5M19 A;  3Q7V B;  5CRF A;  1J9M A;  1RGY A;  4DXB A;  4P87 A;  1IYP A;  3OCL A;  1JWZ A;  4B4X A;  1LL9 A;  2WZZ A;  4B88 A;  5EVI C;  3UDX A;  1H8Y A;  5A92 A;  2XR0 A;  1IYQ A;  3M6H A;  5FAP A;  3OPP A;  3HL9 A;  4DXC A;  1MY8 A;  1KGG A;  3BFD A;  5HX9 A;  4WM9 A;  5KSC A;  3IWI A;  2Y55 A;  1FOF A;  1L0G A;  2ZQ9 A;  4R0Q A;  5HL1 A;  3UE1 A;  4Y0O A;  4BJP A;  3TOI A;  4R23 A;  4S2N A;  4X55 A;  4E3K A;  3A3I A;  3SOI A;  2G2U A;  1KVM A;  5HAR A;  1XGJ A;  3NDE A;  3UO9 A;  4E3I A;  1GA0 A;  2XD5 A;  1LL5 A;  3CJM A;  2BLS A;  3M2J A;  4GOG A;  3IF6 C;  2XLN A;  3OPR A;  3ZG0 A;  5EE8 A;  3FYZ A;  3BRM A;  3PAG A;  3GMW A;  1TDG A;  1XPB A;  3RXW A;  1KE3 A;  5GHZ A;  3RXX A;  3BEB A;  3BFE A;  1XX2 A;  3HLD A;  1BSG A;  4E3N A;  3MZF A;  3C4P A;  1JTD A;  4IVK A;  2EX6 A;  2XK1 A;  2OSU A;  4DE1 A;  4C6Y A;  1IYS A;  3NI9 A;  1YLP A;  4X69 A;  2A3U A;  1HZO A;  1ALQ A;  3BLS A;  3P09 A;  4WMC D;  5AQB A;  4QY6 A;  4WEJ A;  1L0F A;  4OQI A;  4WZ5 A;  1QME A;  2ZC7 A;  5CHM A;  2J7V A;  3G35 A;  1U60 A;  4U0T A;  4A5R A;  1K55 A;  4K0X A;  4K91 A;  4R4S A;  1L0E A;  4OOL A;  4KQQ A;  2Y4A A;  2Y59 A;  3I7J A;  4N1H A;  2Q9N A;  4FD8 A;  4UA9 A;  3VP0 A;  4DE2 A;  2ZQ8 A;  3ZHH A;  2DRW A;  4KQO A;  2WGW A;  1ONG A;  4RVA A;  3UE3 A;  5CEB A;  1MKI A;  3N7W A;  3E2L A;  5KMW A;  1GHM A;  3BYD A;  5BOH A;  1FCN A;  5FQ9 A;  1NRF A;  2ZQC A;  4YIN A;  4BD1 A;  1ONH A;  3UN7 A;  2WUQ A;  1LHY A;  3SH7 A;  4MLL A;  3LY4 A;  4M3K A;  3S1Y A;  4OPQ A;  1YLT A;  2OV5 A;  5GHX A;  2Q9M A;  2V20 A;  1K54 A;  3VSL A;  3ITA A;  2DNS A;  1G6A A;  3Q81 A;  3N6I A;  2ZC4 B;  3ZG8 B;  1WE4 A;  4EUZ A;  1XGI A;  4DDS A;  1ESI A;  1ZKJ A;  5CER A;  3NY4 A;  1S6R A;  5DTK A;  3VP2 A;  1WYB A;  3WS2 A;  4IBX A;  1EWZ A;  3VP4 A;  4E3J A;  1PW1 A;  3BFG A;  2Z2M B;  1S0W A;  2ZC6 B;  5A91 A;  3SS4 A;  1RP5 A;  3AGF A;  1MWR A;  2A49 A;  2Y2G A;  4R3J A;  4E3L A;  4N9L A;  5M18 A;  4WEL A;  4CJN A;  5E43 A;  4S2O A;  1FSW A;  2J8Y A;  2WGV A;  3CG5 A;  4JXW A;  2RCX A;  4S2M A;  1VM1 A;  4JF4 A;  2JBF A;  1E3U D;  5JYP A;  1G68 A;  4R3B A;  1PWC A;  4KG6 A;  2PU2 A;  1JWP A;  2Y2N A;  4OLG A;  5CHJ A;  1KE4 A;  1Z6F A;  4Y0T A;  3ZDJ A;  3UY6 A;  3DWZ A;  4C3Q A;  1DJA A;  4S2K A;  3IHB A;  1W8Y A;  3V50 A;  4S2J A;  5GLC A;  1FSY A;  4LV0 A;  4N9K A;  5FAT A;  4BL2 A;  4DE0 A;  4WMC A;  5I94 A;  4NK3 A;  3A3D A;  4ZBE A;  1SDE A;  3HRE A;  3W4P A;  2IWB A;  3FZC A;  1M40 A;  1EI5 A;  1ESU A;  3MZE A;  3PBR A;  4EV4 A;  3MKF A;  2CC1 A;  5E2H A;  5FQJ A;  1MWU A;  1BLP A;  3MXS A;  4E6X A;  1PWG A;  1BLS A;  1FR6 A;  3FKV A;  3N4I A;  4LCL A;  5G18 A;  4RA7 A;  5KZH A;  4R1G A;  2WGW B;  1DJB A;  1MWS A;  1TDL A;  4KZB A;  2P74 A;  2PBY A;  1KGE A;  3G34 A;  4FSF A;  3WRT A;  4KZ5 A;  2J9P A;  2XD1 A;  3VOZ A;  4L0L A;  3N8S A;  1BZA A;  2ZLY A;  3FWL A;  3FKW A;  2HDR A;  3PBS A;  4JPM A;  5DF8 A;  1ES3 A;  4GDB A;  5FQK A;  1ZC2 A;  3JYI A;  2JCH A;  3DTM A;  3TG9 A;  1JVJ A;  1MWT A;  1Q2P A;  1CEF A;  1PZO A;  5FDH A;  3W4Q A;  4ZJ3 A;  3A3E A;  1QMF A;  2XEP A;  4DDY A;  2EFU A;  5D3O A;  2EXB A;  5FAQ A;  4KZ3 A;  3HVF A;  2I72 A;  3PBN A;  4GN2 A;  3AGE A;  3ISG A;  3UNW A;  3B3X A;  5GLA A;  1SDN A;  1FR1 A;  5CHU A;  2ZQA A;  4X53 A;  4X68 A;  3ZFZ A;  4EQI A;  4KZA A;  1NZU A;  3MZD A;  3S4X A;  4OPY A;  4KZ4 A;  4QU3 A;  2Y2H A;  5TR7 A;  3TSG A;  1Q2Q A;  2XH9 A;  5KSH A;  5U47 A;  3HBR A;  3UDF A;  5CTN A;  3C5A A;  4N92 A;  4PM8 A;  3SS3 A;  2Y2L A;  2IWC A;  2OLU A;  4KZ9 A;  4RX2 A;  5CGX A;  3P98 A;  5EVI D;  1NXY A;  2IWD A;  5EOE A;  3PBT A;  1MBL A;  1BT5 A;  4OKP A;  1RGZ A;  4OQG A;  1E3U A;  2B5R A;  2WAE A;  2Y2M A;  3WS1 A;  3PAE A;  4IVI A;  4ZJ2 A;  4QHC A;  4OH0 A;  4WZ4 A;  2HP5 A;  4XXR A;  4RX3 A;  2WK0 A;  3UPN A;  3O87 A;  1YQS A;  4QJG A;  1K25 A;  1BLH A;  3WWX A;  1PYY A;  5F82 A;  1W79 A;  3W4O A;  1O07 A;  2E8I A;  2Y2O A;  4PM7 A;  5A93 A;  3UPP A;  1PI4 A;  3VFH A;  3V39 A;  3LY3 A;  4D2O A;  1K6R A;  4X56 A;  1FCO A;  1NZO A;  4JXG A;  3RJU A;  3UDI A;  2ZM0 A;  1YLZ A;  3HLC A;  4QD4 A;  1GHI A;  2EXA A;  3IH8 A;  4U3T A;  1BLC A;  3IXD A;  3O86 A;  3PBO A;  5CXW A;  2ZC5 B;  4P6B A;  1N4O A;  2WYX A;  1VQQ A;  1YLJ A;  2XQZ A;  3EQV A;  4JBF A;  4UA6 A;  4PM5 A;  2XFT A;  2JC7 A;  1IEM A;  1KGF A;  4H8R A;  4ZTK A;  3ZVW A;  1SKF A;  3ZG9 B;  4IBR A;  4XUZ A;  4MEZ A;  3GV9 A;  1CEG A;  5FQI A;  3VP1 A;  4GKU A;  3Q07 A;  3G32 A;  4OQH A;  5DF7 A;  4S2N C;  1GA9 A;  3AGD A;  5EPH A;  1I2W A;  2GDN A;  4HBT A;  3S22 A;  4EBP A;  4MNR A;  3GQZ A;  3OPL A;  5AQA A;  2WAF A;  5TFQ A;  3BFF A;  4JKT A;  2EX9 A;  1TVF A;  1ZG6 A;  3V3S A;  4KZ6 A;  4QB8 A;  1KVL A;  1K6S A;  5CTM A;  4OOY A;  3C7V A;  3E2K A;  1YLW A;  3HUN A;  3MFD A;  4JF5 A;  3NDG A;  3ZNT A;  1XXM A;  1PW8 A;  1SCW A;  2Y2P A;  3QHY A;  4OPR A;  5J8X A;  1KE0 A;  4BEN A;  3UE0 A;  4GNU A;  3GRJ A;  4OVD A;  4GD8 A;  3ZG7 B;  2QMI A;  1SHV A;  3LO7 A;  3VP3 A;  2X71 A;  2HPB A;  3GR2 A;  4WZ5 C;  1YMS A;  4S2I A;  4E6W A;  2HP9 A;  4P85 A;  1K55 C;  5L2F A;  2VGK A;  1HTZ A;  3CMZ A;  2HDQ A;  4P0M A;  3WRZ A;  5HAQ A;  1KDS A;  4PPR A;  5HFO A;  4OPZ A;  2ZQD A;  5DF9 A;  1ES2 A;  2ZMA A;  4HES A;  4FH2 A;  4ID4 A;  2H0T A;  5F83 A;  3PBQ A;  4UAA A;  4WBG A;  2X01 A;  2ZM8 A;  3IF6 A;  4MBH A;  4OLD A;  2XGN A;  4GDN A;  1BTL A;  3A3F A;  1K38 A;  3D4F A;  3Q82 A;  4UA7 A;  5GHY A;  3O88 A;  4IED A;  3SH8 A;  4LV3 A;  1BUL A;  1YMX A;  1XA7 A;  3GVB A;  5FAO A;  2FFY A;  3IWO A;  5DTT A;  5EEC A;  3EQU A;  4Y7P A;  4F94 A;  1K54 C;  1L2S A;  4MBK A;  2R9X A;  2Y91 A;  4DRT A;  1OME A;  3DW0 A;  1PZP A;  1IEL A;  4KG2 A;  1XP4 A;  4E3O A;  3HLB A;  1CK3 A;  4GD6 A;  3V5M A;  1K57 A;  2UWX A;  2H0Y A;  5EOO A;  4DE3 A;  4FCF A;  1DJC A;  2H5S A;  4K0W A;  1KDW A;  2HDU A;  1XA1 A;  3QNC A;  4HEF A;  4PMA A;  3SH9 A;  3Q7Z A;  3MXR A;  1NYM A;  3IQA A;  1L0D A;  3ZG5 A;  1LLB A;  3VSK A;  1IKG A;  3N8L A;  3NIA A;  4KQR A;  3BLM A;  2WGI A;  4JF6 A;  4JXS A;  1RCJ A;  1JTG A;  3G2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...