1DJBA

Structure of beta-lactamase precursor, s70a mutant, at 298k
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYAATSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Structure and kinetics of the beta-lactamase mutants S70A and K73H from Staphylococcus aureus PC1.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 96
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1996-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1djbA00
1ESIA 4EV4A 1ZG4A 1HZOA 2ZM8A 4OPZA 1KGEA 2XGNA 3AGDA 1L0EA 1RCJA 1RGZA 1PI5A 2IWBA 2ZC3B 4OOYA 4P0MA 1HVBA 1IYOA 5GHXA 1CEGA 3HUMA 4KZBA 1H8YA 1FQGA 4O7DA 5F82A 3BRMA 1FSWA 1KE0A 1M6KA 1O07A 4UA9A 5IHVA 2QPNA 4JKTA 4KENB 1YQSA 3SS3A 3WS0A 2E8IA 3RXWA 1KGFA 3PBSA 2Y91A 2J9OA 1YLWA 4N9KA 5AQAA 2RCXA 2ZLYA 4UHUA 3S1YA 4KG5A 3N8SA 5DF8A 1TDLA 2Y55A 5GLAA 1YLJA 1K4FA 5DF7A 4MBFA 4ZJ1A 1QMFA 1MWRA 1KVMA 2ZM2A 3AGFA 4JLFA 1DJBA 3TSGA 2XR0A 1WYCA 3DWZA 5FQ9A 4DXBA 4XXRA 3MXRA 3A3EA 3HLEA 2A49A 3N8RA 3OC2A 3IWQA 3ZCZA 1FR1A 1W8YA 1KDWA 1KE4A 3OZHA 5G18A 1ES2A 3BFDA 5HX9A 2HPBA 3N6IA 2JCHA 3N4IA 4U3TA 2H0YA 4FH4A 4JF5A 1FSYA 5HAIA 3WS1A 4WZ5C 1W5DA 2Y2MA 3FYZA 1ZKJA 4BQMA 3BEBA 3G2ZA 5CRFA 1GHMA 5M18A 1XPBA 1FOFA 1NJ4A 3Q81A 5KSCA 4DE3A 3GV9A 2EXBA 1MXOA 3IH9A 4S2OA 2WGWB 1ONHA 1ESUA 2WUQA 3OCLA 4B88A 4GZBA 2EX6A 3A3FA 5A93A 2X71A 4RVAA 4LENA 2EXAA 3LCEA 4FCFA 3ZNYA 4RX3A 5HFOA 3WRTA 3OPRA 5M1AA 3ZG0A 1K55C 2GDNA 3GTCA 2Y2NA 5CTMA 5AQBA 1XP4A 4DXCA 1ZC2A 2Y2LA 4OOLA 1BTLA 2C6WB 5E2FA 3PBOA 3Q1FA 2HP9A 2XFSA 1JTGA 2H5SA 4QB8A 2H10A 5FAOA 4OVDA 1K4EA 1CEFA 2J7VA 2Y2KA 3WRZA 4GNUA 3IXHA 3S22A 1MKIA 4JXSA 3VP1A 4S2KA 4S2NC 1EI5A 3HLFA 3C7UA 3UE3A 4JF4A 2HP6A 1I2SA 1NYYA 4X56A 3EQVA 1KDSA 3UDFA 5FQMA 2Y4AA 3HVFA 3VMAA 1JWVA 3HLBA 4BLMA 1BULA 3MZFA 2HDRA 4GB7A 5F1GA 3C4OA 4F94A 4OQ0A 2ZQ8A 1LHYA 5FAQA 3NC8A 3OPLA 2XK1A 3P09A 4FSFA 3ZG8B 5EUAA 5FQIA 2HDUA 3ZVTA 1L0DA 1K57C 4R23A 1NRFA 5FASA 1HD8A 1N4OA 2HDQA 5AQ9A 1VM1A 5FA7A 3MKFA 1W8QA 3HLGA 4YFMA 4ZJ2A 3HLCA 3CZDA 2VGJA 4X6TA 2ZC4B 1RGYA 3M2JA 1PZOA 4Y0OA 2JBFA 1ES5A 4PPRA 4KZ6A 5CGWA 3VSLA 3BYDA 3HLWA 3B3XA 3PAGA 2Q9MA 1E4DA 4ZTKA 3A3IA 3IF6B 5EVIA 1W79A 3A3DA 2RL3A 5FATA 4R4SA 2XFTA 2XLNA 3FWLA 4HBTA 4LV3A 4BL3A 4LCLA 3IHBA 4IVKA 1LLBA 1BLHA 5GLCA 3PBNA 5D3OA 1XX2A 1TVFA 3SH7A 1DJCA 4UA6A 4WMCA 5TFQA 4U0XA 1GHPA 1IKIA 1M40A 4QJGA 3SH8A 1H8ZA 3W4QA 5CHUA 3LY4A 4MNRA 3GMWA 4UA7A 2ZD8A 2QMIA 4XUXA 2V1ZA 4PMAA 1VQQA 3RXXA 2Y2GA 2ZC7A 2ZQAA 5FI2A 4OPRA 4QU3A 1PW8A 1U60A 4KG6A 3IWOA 3ZDJA 1CK3A 2HDSA 3HLDA 3G35A 4X69A 1KGGA 2ZJ9A 5GLBA 1OMEA 1PIOA 4Y7PA 1ES3A 1YLYA 4IVIA 4IBXA 3OCNA 4UAAA 1ERQA 1O7EA 3UO9A 4E3MA 4Y0TA 4GD8A 5A91A 3IH8A 4E3KA 3IF6C 1K55A 4FD8A 3V3SA 1MY8A 3G34A 4KG2A 3ZGAB 3WS2A 1J9MA 5FQKA 3HUNA 5A92A 2JE5A 3FKVA 1N9BA 3WWXA 1JTDA 1NZOA 1BUEA 2X01A 5CEDA 4OLDA 1E25A 3N7WA 4S2NA 3BECA 3UE0A 5HAPA 4KZ7A 3C4PA 4MBHA 4OPYA 5E2EA 1YMSA 2WAEA 3G31A 3UE1A 2WGWA 3Q07A 3GVBA 1MBLA 1L0FA 3HUOA 4S2IA 3UPOA 3IXDA 3ZG5A 1PWGA 2XH9A 1GCEA 1CI9A 4BENA 1RP5A 4M3KA 3JYIA 2P9VB 5E2GA 1LI0A 4OQHA 1H5XA 3MBZA 5FDHA 4R3JA 4C75A 3DWKA 4GD6A 2DNSA 4PM7A 3UDIA 5U47A 4MLLA 3IT9A 4OH0A 5GL9A 3NDGA 1CI8A 3PAEA 2J9PA 3OPPA 2DRWA 2VGKA 3Q82A 3MZEA 5FQQA 1IEMA 4JXWA 5FAPA 4ZBEA 3TOIA 3VP4A 3FKWA 3BM6A 4X53A 4QY6A 4JPMA 1JWZA 3QNCA 1EWZA 4OOMA 5GLDA 4E3LA 5CXWA 5HARA 1SCWA 1BLCA 3G4PA 4QHCA 2C5WB 3AGEA 2R9XA 4FH2A 4B4XA 4R3BA 4P87A 4JBFA 4OONA 1XA7A 1K6SA 4OKPA 3A3JA 1SDEA 5EPHA 1IKGA 2ZC6B 4X55A 1K6RA 3VSKA 4DDYA 4E3IA 5JYOA 4EQIA 4E6XA 2Y2QA 1FCMA 4K91A 1NXYA 2Z2MB 5FI6A 3M6BA 3IXGA 3LY3A 2WAFA 4PM9A 5CEBA 4B4ZA 2PBYA 4EBNA 1PWCA 5F83A 3NCKA 3O86A 4NK3A 1BT5A 4BD0A 2P74A 3Q7VB 1DY6A 3VP2A 1SKFA 1E3UA 3BLSA 3GRJA 3V3RA 5EVID 2FFYA 3ZG9B 2V20A 4BJPA 2G2WA 4GKUA 2Y2OA 3FZCA 5F1FA 5E2HA 3ZHHA 1ES4A 3QHYA 5GHYA 2WKIA 5CHJA 2I72A 3IF6A 5A90A 2XD1A 4WMCD 5CTNA 4HBUA 4E3NA 2XEPA 1MPLA 4EBLA 1DJAA 2WZXA 4D2OA 1NYMA 1K54C 3ITAA 3VP3A 3ZFZA 4E3JA 3ZNTA 4KQOA 1I5QA 2Q9NA 3O3VA 5DVAA 4P6BA 2HP5A 3UNWA 3C5AA 1WE4A 4KZ8A 2EX9A 4OP8A 4ID4A 3IQAA 1BLPA 3LO7A 2Z2LB 4WYYA 4WZ5A 1YLTA 2QZ6A 2ZC5B 4XUZA 4N1HA 3DTMA 1G6AA 3IF5A 4A5RA 2EFUA 3HBRA 2H0TA 1KVLA 1AXBA 1Q2QA 3VOZA 1JVJA 1LL9A 2J8YA 5L2FA 1Y54A 5KSHA 2WK0A 5DTTA 3SS4A 1L2SA 2IWDA 4KZ4A 1XGIA 4OPQA 4OQIA 4DE0A 1C3BA 3MZDA 3PTEA 4YINA 2Y59A 1K25A 5AQ7A 2A3UA 1K56D 1S6RA 2IWCA 3V39A 5BOHA 2CC1A 4JXVA 2Y2IA 4R1GA 1BSGA 4WEKA 5FQJA 5FI7A 2UWXA 5DF9A 5EVIB 4DF6A 4LCMA 4K0XA 3HREA 2B5RA 1XA1A 1K38A 5CHMA 1MWSA 1YT4A 5DTSA 3S4XA 1ONGA 3UY6A 2V2FF 1LI9A 2P9VA 2XDMA 1XKZA 3SOIA 1K56A 4PM8A 4KZ5A 5CGSA 3QNBA 4ZJ3A 1YLPA 4JXGA 3C7VA 1XXMA 5CERA 4KQQA 4S2MA 4CJNA 4N1XA 1YMXA 3BLMA 3MFDA 3N8LA 1NZUA 1GHIA 4H8RA 3ZVWA 4ZDXA 1NY0A 1LL5A 1IYSA 4KZ9A 3VP0A 3ISGA 3RJUA 3GQZA 2ZM0A 1FCOA 5EVIC 3LEZA 5TGFA 1K57A 2BG1A 4HEFA 4DDSA 3G2YA 1TDGA 3M2KA 2FFFB 1EROA 1MWUA 1S0WA 1PI4A 3I7JA 4DE2A 4C3QA 3MKEA 4S2JA 3GSGA 4R0QA 4QD4A 2PU4A 1MWTA 2WADA 5EE8A 4S2LA 3NBLA 4Y0UA 3EQUA 4KZAA 1K54A 3OPHA 1JWPA 2G2UA 3GR2A 2XQZA 4RA7A 1E3UD 3BFCA 4RYEA 3SS5A 4GOGA 4E3OA 4WBGA 3MXSA 3CJMA 5KZHA 1QMEA 2OSUA 4MEZA 4N9LA 3W4PA 3Q7VA 4CPKA 5HL1A 4HESA 3WS5A 2EX2A 3D4FA 2Y2HA 1PYYA 3BFGA 1FCNA 3Q7ZA 4WZ4A 3PBRA 4EUZA 5FSRA 3IXBA 5HAQA 2EFXA 2Y2PA 4DE1A 4GDNA 3W8KA 3CG5A 1GA0A 3NIAA 4BD1A 1L0GA 4GDBA 3ITBA 3NY4A 1ZG6A 5I94A 1Q2PA 4X68A 2ZQ9A 5EECA 5JYPA 4P85A 2ZQCA 3UDXA 4WEJA 1Z6FA 2OV5A 1W7FA 3NDEA 2BLSA 3IWIA 2ZQDA 3M6HA 2ZMAA 4KZ3A 4OLGA 4PM6A 1IYPA 4WELA 4LV0A 4QY5A 2WZZA 3IHAA 1YLZA 3G32A 4GN2A 4LV1A 1G68A 5E43A 3PBQA 2OLVA 4BL2A 2PU2A 1IELA 5CGXA 4N92A 4NETA 1IYQA 1FR6A 4E6WA 2Y2JA 3DW0A 1PW1A 1KE3A 1YM1A 3V5MA 3V50A 5TR7A 4IEDA 4MBKA 4U0TA 5EOEA 3TG9A 2X02A 5EOOA 1I2WA 1PZPA 3P98A 4DKIA 4C6YA 3W4OA 3BFFA 3UN7A 2WGVA 3SH9A 4OP5A 5M19A 2JC7A 4WM9A 3UPNA 3VOYA 3O87A 4DRTA 1BLSA 4R4RA 5GHZA 2WGIA 3WS4A 2ZQ7A 2WKHA 1TEMA 2EX8A 2XD5A 4L0LA 4ZAMA 3UPPA 4S2PA 3VFFA 1GA9A 1BZAA 2WKEA 5J8XA 4JF6A 4LV2A 5EVLA 2DCFA 5HW3A 1HTZA 3CMZA 1WYBA 3FV7A 3G30A 4PM5A 4Z9QA 3E2LA 1XGJA 3HL9A 3BFEA 1ALQA 4IBRA 2R9WA 4EWFA 4K0WA 3VFHA 1SDNA 3ZG7B 2XF3A 4KQRA 4OQGA 5CECA 4EBPA 3NI9A 2OLUA 3O88A 5DTKA 3E2KA 5KMWA 2WYXA 3PBTA 1SHVA 1PWDA 4Q8IA 1ERMA 4RX2A
chains in the Genus database with same CATH superfamily
1ZG4A 4OPZA 3MQ0A 1J3WA 5GHXA 4KQDA 5F82A 3BQAA 4UA9A 4L9EA 4WF0A 2RCXA 2YKFA 3N8SA 3IS2A 1YLJA 4MBFA 2VGLM 4HH2A 3PHYA 3MXQA 2XR0A 1OTDA 2O0YA 3MXRA 3A3EA 1H3QA 2KDKA 3HLEA 1ZHHB 2A49A 4HI4A 3T4TA 3ZCZA 1FR1A 2ZL1B 1KDWA 5G18A 1F98A 2HPBA 2QHKA 3N6IA 5FDSA 3N4IA 1LT0A 3WS1A 4WZ5C 1TD5A 2Y2MA 4PAUA 1GHMA 3IH9A 3NULA 1ONHA 1YAXA 4II7A 4B88A 1H0MA 2EX6A 3LCEA 1D06A 3OPRA 3ZG0A 3P01A 3GTCA 5AQBA 4LRZE 4DXCA 2C6WB 1JTGA 2H10A 4EXOA 5FAOA 3V67A 1TS7A 4GNUA 4YNRA 3VP1A 3HLFA 3CITA 4JF4A 2CMNA 1I2SA 5FEFA 3UDFA 2Y4AA 3HVFA 2YKHA 3C4OA 2ZQ8A 3ZG8B 2HDUA 3ZVTA 1W63Q 4R23A 2HDQA 5AQ9A 1VM1A 5FA7A 3HLGA 2VGJA 2ZC4B 1A0KA 2JBFA 1ES5A 5IT5A 1Y4OA 1D7EA 3PAGA 4ZTKA 3A3IA 3A3DA 5FATA 2W3FA 4HBTA 5MC7A 1DJCA 4UA6A 1M40A 5CHUA 3LY4A 3GMWA 2ZD8A 3IX4A 4PMAA 3CHWP 2ZQAA 3E0YA 4QU3A 4KG6A 3ZDJA 2ZJ9A 1OMEA 4IVIA 4K08A 4E3KA 3IF6C 1K55A 1MY8A 4KG2A 3ZGAB 5FQKA 4I3AA 1JTDA 1BUEA 2X01A 2ZOHA 1E25A 4HNBA 2DMWA 3PXPA 5HAPA 4KZ7A 4MBHA 5E2EA 2HJ9C 2WAEA 2JKTM 3CLOA 2JKRM 1L0FA 3HUOA 4S2IA 4YOFA 2XH9A 3JPUA 3JYIA 2P9VB 5J3WA 1P9WA 5HDDA 2DNSA 5U47A 4MLLA 4G3WA 4OH0A 4FOFA 3OPPA 1YSQA 2JHEA 3T1QB 3MZEA 1IEMA 5FAPA 1JWZA 1EWZA 4OOMA 2W3GA 5GLDA 4HQAA 1BLCA 4FH2A 3AGEA 2R9XA 4JBFA 4LRXC 4OONA 3VSKA 1SDEA 4QWOA 4E6XA 1FCMA 2Z2MB 2PBYA 3NCKA 3O86A 4BD0A 1SKFA 2KX6A 3JVUA 2Y2OA 3ZHHA 1ES4A 3QHYA 5CHJA 1Z09A 1MPLA 1LL8A 4EBLA 1DJAA 3VP3A 4G3KA 4LGWA 2HP5A 5L8MA 4KZ8A 3MFXA 1H8MA 3IQAA 4NXBA 4WZ5A 1IOUA 3IF5A 3CPTA 3HBRA 5HWTA 1CQAA 1KVLA 2W3DA 3VOZA 1JVJA 1LL9A 2J8YA 4JGPA 3SS4A 3S7QA 2V8FA 1OPXA 3MZDA 5AQ7A 3EEHA 5BOHA 2CC1A 2Y2IA 1XA1A 4HY8A 1XJ3A 5DTSA 3S4XA 2OAQ1 2V2FF 2XDMA 4CLCD 3SOIA 4PM8A 4KZ5A 3GDIA 4JXGA 1ODVA 5CX7A 5CERA 3BJNA 4N1XA 4ZDXA 1LL5A 4KZ9A 3VP0A 1FCOA 5EVIC 2W1RA 4DDSA 1TDGA 1S0WA 3GSGA 1N9LA 4QD4A 5DKLA 5LBRA 3LUQA 2QKPA 1JWPA 3GR2A 3SS5A 2W3EA 5EM0A 5KZHA 1QMEA 2EWWA 1V9YA 4Q0IA 4CPKA 5HL1A 4EW7A 3HJKA 1PYYA 4EUZA 4DE1A 4GDNA 3IBRA 4IHQA 1GA0A 4BD1A 4GDBA 3ITBA 2ZQ9A 5EECA 5JYPA 4GHIB 2OV5A 1YSPA 4EERA 4LV0A 4QY5A 2WKRA 3IHAA 3G32A 5E43A 1G68A 1OTIA 5DJUA 4H6JA 3R7WA 3ICYA 5CGXA 1LSXA 4HHDA 4NETA 5TR7A 1CF0A 1PZPA 3KSHA 5F5YA 2VZWA 4I3JA 5M19A 2JC7A 1MKMA 3UPNA 3VOYA 3KSGA 3O87A 2V9AA 2ZQ7A 3UPPA 1OJGA 3U2AA 3CMZA 5HPIA 4Z9QA 1NLZA 1XGJA 3HL9A 3MQQA 2QJ5A 2XF3A 3NI9A 5C5KA 2IA2A 5KMWA 2LB5A 1MC0A 4Q8IA 4RX2A 2ZM8A 1KGEA 1L0EA 1PI5A 3OOVA 3JVVA 3ZQ5A 4GW9A 4O7DA 3BRMA 1O07A 3B33A 4GCZA 5IHVA 4JKTA 4KENB 3WS0A 3LIBA 2E8IA 5TJJA 1KGFA 3PBSA 3CPTB 4O8GA 5DF8A 5GLAA 1K4FA 5EFWA 2ZM2A 3T4KA 4JLFA 1NRJA 1DJBA 5FQ9A 4DXBA 4XXRA 2JKGA 3N8RA 1JNUA 3IWQA 1KE4A 3OZHA 3A0RA 1PRQA 1ES2A 4IJGA 2JCHA 4FH4A 4JF5A 3F1NA 3Q81A 1PFLA 1S67L 4KUOA 1ESUA 1TS8A 4RQ9A 3ZNYA 3IX8A 3EGXC 5M1AA 1K55C 1AWIA 2VEAA 3QP5A 3UB5P 1ZC2A 4OOLA 2HP9A 4CLCB 2GZAA 5J7EA 3WRZA 4S2KA 3VE4A 3RTYA 3LFVA 2HP6A 4X56A 4I3IA 3EQVA 1XJ6A 3EWKA 3MZFA 2HDRA 4GB7A 4F94A 3T12B 1LHYA 3NC8A 3OPLA 4BBTA 3L9KA 4FSFA 4ZJ2A 4JGQA 1W8QA 1OT9A 4GLQA 3M2JA 2XRNA 2INWA 4KZ6A 5CGWA 3VSLA 3HLWA 2PHYA 2Q9MA 5HD3A 1P0ZA 3IF6B 5EVIA 4M4XA 4R4SA 3FWLA 1P9RA 4LV3A 4BL3A 4LCLA 3IHBA 4IVKA 2NUPC 1BLHA 2VLGA 1XX2A 3SH7A 4ESPA 5TFQA 3F1PA 3ZYTA 4UA7A 4XUXA 1VQQA 4OPRA 1PW8A 1U60A 1XJ4A 3D72A 4X69A 3HLDA 4Y7PA 1O7EA 4E3MA 2VKSA 4Y0TA 3IH8A 4FD8A 5J4EA 3WS2A 2BTFP 3K3CA 3T4JA 5AJGA 2ZBBA 3WWXA 1NZOA 2J3TC 4GJ4A 2R78A 3C4PA 1YMSA 3UE1A 2WGWA 3Q07A 3GVBA 3IXDA 4OQHA 1H5XA 3FG8A 5FDHA 4GD6A 3UDIA 3IT9A 3LIFA 2J9PA 3K3DA 3UMDA 2VGKA 3Q82A 1S1ZA 5FQQA 4QY6A 3A0VA 1VETA 4QHCA 1GSVA 4R3BA 4OKPA 4E3IA 5EPHA 1IKGA 4EQIA 1NXYA 2M7VA 4PM9A 4IUHA 4EBNA 5F83A 2M1CA 2P74A 1DY6A 3VP2A 3NECA 1E3UA 2ZMVA 3BLSA 3ZG9B 4HH3A 3QP6A 4GKUA 3C2WA 5E2HA 2JKFA 2XD1A 2A24A 2J3WA 2XEPA 2PD8A 2K7SA 4O01A 5K5BA 1I5QA 5DVAA 4P6BA 4OP8A 2B18A 1BLPA 3TW8A 4WYYA 1G28A 1YLTA 2ZC5B 2W3HA 1G6AA 2H0TA 1DP9A 1Q2QA 3TE8A 4NXEA 2O9CA 4EETB 2KLIA 1XFNA 4KZ4A 1XGIA 4YINA 2Y59A 1K25A 2IWCA 1BSGA 4DF6A 2ACGA 2UWXA 5EVIB 5FI7A 4B93A 1D1JA 4K0XA 3HREA 1K38A 2Y8HA 1DP8A 1YT4A 2VV6A 1T1CA 3BWLA 1OT6A 1XJ2A 1YMXA 3BLMA 1NZUA 1GHIA 1NY0A 3LIDA 1IYSA 3RJUA 3GQZA 2PR6A 5TGFA 1X0OA 3NHQA 3G2YA 3IS2B 1V9ZA 1MWUA 2FZ0A 4S2JA 1T1AA 2WADA 2HV1A 4NEED 3NBLA 3EQUA 4KZAA 1K54A 3ULFA 1DP6A 4ARZA 4GOGA 3BQ8A 3GECA 4WBGA 4E3OA 4X1MA 3Q7VA 2PAVP 2A2LA 4MMNA 2XA7M 4WZ4A 5HAQA 2Y2PA 2O99A 3NIAA 1L0GA 2OAP1 2GX5A 5I94A 1Q2PA 4X68A 2KOIA 1W7FA 3NDEA 4KZ3A 4PM6A 4WELA 2D01A 4LRYC 5F68A 1TS6A 2PU2A 1IYQA 2WKPA 4E6WA 1VETB 1YM1A 3V5MA 4WLAA 4IEDA 4HIAA 3T1RA 5A8BA 5EOOA 1I2WA 1F9IA 3BY8A 4C6YA 3W4OA 3SH9A 4MN5A 4BBUA 1BLSA 5GHZA 2QWSA 2WGIA 1KOUA 2WKHA 4ZAMA 3NOTC 4S2PA 2WKEA 4LV2A 3B47A 1T18A 1WYBA 3OBFA 5HDSA 4EWFA 3BFEA 4K0WA 3ZG7B 3HJIA 5AVFA 2M7UA 2A24B 4LLOB 2PBDP 5DTKA 3DTEA 4HJ6A 3PBTA 1P97A 3LR5A 1PWDA 1ESIA 2ZOIA 1HZOA 4LFUA 1ZTUA 4BMWA 2NUTC 1RCJA 2ZC3B 4OOYA 4P0MA 1HVBA 1IYOA 1CEGA 4KZBA 1H8YA 3B42A 1FQGA 1KE0A 4JGRA 3SS3A 1YQSA 1S66L 2Y91A 2J9OA 4N9KA 4UHUA 3KSIA 2Y55A 5DF7A 2GJ3A 2B95A 3KO6A 1HLUP 3DWZA 2VGLS 1FIKA 1UWNX 3OC2A 3KYQA 1W8YA 1OTBA 4U3TA 2H0YA 3F1OA 3TRCA 5HAIA 5L09A 3FYZA 4I39A 1G5UA 2V8CA 3G2ZA 5M18A 4DE3A 2EXBA 4MCWA 1ACFA 4S2OA 2HF6A 3OCLA 1N9OA 3A3FA 5A93A 4RVAA 2EXAA 1G6OA 1W63M 5HFOA 2E8JA 1VEUA 3C30A 1S1YA 2K2NA 5HD5A 2Y2LA 1BTLA 5E2FA 3Q1FA 2XFSA 2H5SA 4QPRA 2W1TA 3SW1A 2VV8A 4BBVA 1K4EA 2J7VA 3BY9A 2Y2KA 3S22A 3IXHA 1EI5A 3KYZA 5G4ZA 1NYYA 3MSHA 3IBJA 4ARZB 2L1MA 3VMAA 5G4YA 5F1GA 4EESA 5FAQA 3S7PA 2O9BA 5EUAA 1L0DA 5HPFA 1NRFA 1HD8A 1FILA 1N4OA 3T4LA 4EEUA 3CZDA 4X6TA 1RGYA 2L4RA 1K0KA 1PZOA 4Y0OA 3RFBA 3B3XA 3QP2A 2OWJA 1PNEA 1UGUA 2XFTA 1LLBA 5GLCA 3PBNA 5D3OA 1TVFA 4WMCA 1IKIA 3SH8A 5HL6A 4PKYG 2QMIA 2V1ZA 4R70A 3RXXA 5FI2A 3LGOA 3IWOA 1CK3A 3G35A 4WN5A 1KGGA 4IBXA 4UAAA 1STZA 1SKOA 4GD8A 1LSWA 5A91A 3MS6A 3V3SA 1J9MA 1T19A 2ZL1A 3S7NA 3W2ZA 2VX8A 3HUNA 5A92A 2JE5A 4Y17A 3MJQA 3BW6A 5CEDA 4S2NA 2HZ5A 3G31A 5IU1A 2Z6DA 1PWGA 1GCEA 5DKKA 1RP5A 5E2GA 3MBZA 4MDZA 3EEAA 3SZTA 3NDGA 2B02A 2P08A 4CQHA 3VP4A 3TOIA 2V1AA 3BM6A 4X53A 4JPMA 4D60A 3QNCA 2PYRA 5HARA 3G4PA 2VK3A 5EV0A 4B4XA 1XA7A 3A3JA 1K6RA 4DDYA 3D3OA 2Y2QA 2OOLA 3KSFA 3M6BA 5DFYA 2VV7A 3IXGA 4B4ZA 4NK3A 1BT5A 4I38A 1NLYA 3GRJA 5EVID 2FFYA 2V20A 3FPVA 2PRFA 4R38A 2WKIA 3HCYA 3K2NA 5CTNA 4HBUA 3U4LP 4Q0HA 2WZXA 4D2OA 1GSXA 1TS0A 1NYMA 4UQIS 2G7UA 1K54C 3ITAA 4EU0A 4H6JB 4KQOA 3R7WB 3O3VA 3UNWA 3C5AA 4DJ3A 2EX9A 4ID4A 3E4PA 4NG2A 2Z2LB 4PKYA 3CWFA 3L7HA 3PR6A 3UB8A 4A5RA 5FEGA 1AXBA 1Y54A 5KSHA 2WK0A 1L2SA 2IWDA 5IS1A 2UV0E 2P7JA 4OPQA 4DE0A 5F6AA 3PTEA 2VA0A 2A3UA 1S6RA 4GS9A 4JXVA 4JGOA 1WA9A 2D02A 5DF9A 2B5RA 3UB9A 5CHMA 3UY6A 2P9VA 1S4RA 1XKZA 3VE3A 4HP4A 3QNBA 4ZJ3A 2V0UA 3H9WA 4S2MA 5HWWA 3ZVWA 1SKOB 2ZM0A 3KYEA 3LEZA 2BG1A 1EW0A 2FFFB 3M2KA 3I7JA 4HJ3A 1PI4A 4C3QA 3MKEA 3UB7A 2PU4A 1MWTA 4Y0UA 2G2UA 2XQZA 4RA7A 1E3UD 3BFCA 3CJMA 5HSQA 4MEZA 2J80A 3W4PA 3O5YA 2W27A 4HESA 3WS5A 2Y2HA 3F1NB 3PBRA 5FSRA 4MN7A 3MMHA 3CUEC 3NY4A 1ZG6A 3CI6A 4P85A 3UDXA 1Z6FA 2BLSA 3IWIA 4OLGA 3LI8A 4HOIA 2WZZA 1YLZA 4GN2A 4WL9A 4LV1A 3PBQA 2OLVA 4BL2A 4EQ1A 3EGDC 2Y79A 5AVEA 2HGVA 1IELA 2Y2JA 1PW1A 3V50A 4MBKA 4U0TA 5EOEA 3TG9A 4R3AA 3MR0A 2MJ6A 3P98A 3D9YA 3BFFA 4F3LA 4FTXA 4DRTA 4Y13A 3QP8A 3RH8B 2GNXA 4CLCC 3EOIA 2AVXA 3DTIA 5HDCA 3VFFA 3C8CA 5J8XA 5EVLA 3LI9A 1YPRA 5HW3A 1HTZA 3FV7A 3G30A 5L07A 1ALQA 4IBRA 2R9WA 3VV4A 3QP4A 3VFHA 1SDNA 3LICA 4KQRA 1F5MA 4Y2FA 2OLUA 1OJ5A 3LR0A 3O88A 3E2KA 1SHVA 1ERMA 4EV4A 1SZVA 1DRMA 2XGNA 3AGDA 1RGZA 4CLCE 2IWBA 3HUMA 2PD7A 3QP1A 2V1BA 4ETZA 1FSWA 1M6KA 3F1PB 2LB9A 2QYBA 2QPNA 3RXWA 1VB6A 1F2KA 1YLWA 5AQAA 2ZLYA 3S1YA 4KG5A 1TDLA 2PR5A 4P6ZS 4ZJ1A 1QMFA 1MWRA 1KVMA 3AGFA 3TSGA 5FL3A 1WYCA 5DJTA 3T1SA 4GS9B 2BASA 5DFXA 1S4SA 5L10A 3BFDA 5HX9A 4X1LA 5HWVA 1FSYA 1W5DA 1ZKJA 4BQMA 3BEBA 3E98A 5CRFA 1XPBA 1FOFA 1NJ4A 5KSCA 3GV9A 2HJEA 1MXOA 2WGWB 4GHIA 2WUQA 3H82A 4GZBA 2X71A 4LENA 4FCFA 4RX3A 3WRTA 2GDNA 2Y2NA 5CTMA 4ME4A 1XP4A 3DBAA 4Y3IA 4L9GA 3PBOA 2J3TD 4QB8A 4IUKA 4OVDA 1CEFA 4KUKA 5HZHA 1MKIA 4JXSA 4S2NC 3C7UA 3UE3A 1KDSA 2O9AA 5FQMA 3NOPC 1JWVA 3HLBA 4BLMA 1BULA 4EUVA 4OQ0A 1CJFA 2XK1A 3P09A 5FQIA 1K57C 5FASA 3MKFA 4YFMA 3HLCA 4UQIM 1Y28A 4PPRA 3R4KA 2Q0OA 3BYDA 4NXGA 4O0PA 1E4DA 1TF1A 1W79A 2RL3A 1T1BA 2XLNA 3P7NA 2JKTI 3T4QA 2JKRI 1GHPA 4MN6A 4U0XA 4QJGA 1H8ZA 3W4QA 3VOLA 4MNRA 4F3LB 2WKQA 2Y2GA 2ZC7A 2EWVA 2EA9A 3KX0X 3LEQA 4DN0A 2HDSA 5GLBA 1PIOA 1ES3A 1YLYA 3OCNA 1ERQA 3UO9A 1IFQA 3CUEA 3G34A 4FUWA 3E4QA 5EM1A 3FKVA 5I5LA 5TBMA 1N9BA 4UEYA 4OLDA 4EEPA 3N7WA 3BECA 3UE0A 4OPYA 1N9NA 1MBLA 3UPOA 3ZG5A 1CI9A 4BENA 4M3KA 3IX3A 3LIEA 1LI0A 3FC7A 2H28A 4R3JA 4C75A 3DWKA 4PHTA 4PM7A 4CLCA 5GL9A 1CI8A 3PAEA 2DRWA 3NOUC 4JXWA 4ZBEA 4BWIA 1LSVA 3FPWA 3FKWA 1BYWA 2W0NA 5KIZA 4Y5FA 4E3LA 4XT2A 5CXWA 3LIAA 3T4OA 1SCWA 4L9FA 2C5WB 3TJZC 4P87A 1K6SA 2ZC6B 4X55A 5JYOA 1L3LA 4K91A 5FI6A 3LY3A 2PYPA 2WAFA 5CEBA 2PT7A 4Y15A 4ETXA 1PWCA 2I9VA 2JN7A 3Q7VB 3MF0A 3H7WA 3H82B 3V3RA 1MZUA 4R6LA 4BJPA 2G2WA 3FZCA 4ZRRA 5F1FA 5GHYA 2I72A 3IF6A 3PYPA 5A90A 5F69A 4WMCD 2PDRA 4E3NA 2QJ7A 4G3VA 4HP9A 3ZFZA 4E3JA 3ZNTA 2Q9NA 4I5SA 1WE4A 3S7OA 3LO7A 3NJAA 3UMEA 2QZ6A 1GSWA 4XUZA 4N1HA 3DTMA 2XSSA 2EFUA 1UWPX 4NXFA 5L2FA 3DTKA 4X25A 5DTTA 1OTAA 2XROA 3A0SA 3T1XA 4OQIA 1C3BA 1VHMA 2L0WA 2FH5A 1K56D 3V39A 2OWHA 4R1GA 4WEKA 5FQJA 4Z1WA 4LCMA 4NKPA 1MWSA 1ONGA 4DMZA 1LI9A 1K56A 4P6ZM 5CGSA 1YLPA 3C7VA 3LR3A 3E4OA 1YKDA 1XXMA 4KQQA 4CJNA 3MFDA 3N8LA 4H8RA 5EVEA 3ISGA 1K57A 4HEFA 3DAVA 1EROA 4DE2A 3OLOA 3T50A 4R0QA 3CAXA 5TBMB 5EE8A 4S2LA 4B9OA 3OPHA 4RYEA 3MXSA 2OSUA 4YWZA 4N9LA 2ZMFA 3F1OB 2EX2A 3D4FA 3Q7ZA 3BFGA 1FCNA 3IXBA 2EFXA 3W8KA 3CG5A 2XA7S 4Q0JA 3C38A 2ZQCA 3UB6A 4WEJA 2ZQDA 3M6HA 2ZMAA 1IYPA 3MQOA 2P04A 4E04A 2K31A 1VEUB 3G6OA 4N92A 3LR4A 1FR6A 4DJ2A 3DW0A 1KE3A 1XFQA 4XT2B 2W1TB 2X02A 4DKIA 1NWZA 3UN7A 2WGVA 4OP5A 4WM9A 2V0WA 3T4SA 4R4RA 3LYXA 3WS4A 1TEMA 2EX8A 2XD5A 4L0LA 3H7WB 1OTEA 1GA9A 1BZAA 4JF6A 2VJWA 2DCFA 4PM5A 3E2LA 4LPZA 4AFIA 4OQGA 5CECA 4WUJA 3UE6A 4EBPA 4HJ4A 2Z6CA 2WYXA
chains in the Genus database with same CATH topology
1ESIA 4EV4A 1ZG4A 1HZOA 2ZM8A 4OPZA 1KGEA 2XGNA 3AGDA 1L0EA 1RCJA 1RGZA 1PI5A 2IWBA 2ZC3B 4OOYA 4P0MA 1HVBA 1IYOA 5GHXA 1CEGA 3HUMA 4KZBA 1H8YA 1FQGA 4O7DA 5F82A 3BRMA 1FSWA 1KE0A 1M6KA 1O07A 4UA9A 5IHVA 2QPNA 4JKTA 4KENB 1YQSA 3SS3A 3WS0A 2E8IA 3RXWA 1KGFA 3PBSA 2Y91A 2J9OA 1YLWA 4N9KA 5AQAA 2RCXA 2ZLYA 4UHUA 3S1YA 4KG5A 3N8SA 5DF8A 1TDLA 2Y55A 5GLAA 1YLJA 1K4FA 5DF7A 4MBFA 4ZJ1A 1QMFA 1MWRA 1KVMA 2ZM2A 3AGFA 4JLFA 1DJBA 3TSGA 2XR0A 1WYCA 3DWZA 5FQ9A 4DXBA 4XXRA 3MXRA 3A3EA 3HLEA 2A49A 3N8RA 3OC2A 3IWQA 3ZCZA 1FR1A 1W8YA 1KDWA 1KE4A 3OZHA 5G18A 1ES2A 3BFDA 5HX9A 2HPBA 3N6IA 2JCHA 3N4IA 4U3TA 2H0YA 4FH4A 4JF5A 1FSYA 5HAIA 3WS1A 4WZ5C 1W5DA 2Y2MA 3FYZA 1ZKJA 4BQMA 3BEBA 3G2ZA 5CRFA 1GHMA 5M18A 1XPBA 1FOFA 1NJ4A 3Q81A 5KSCA 4DE3A 3GV9A 2EXBA 1MXOA 3IH9A 4S2OA 2WGWB 1ONHA 1ESUA 2WUQA 3OCLA 4B88A 4GZBA 2EX6A 3A3FA 5A93A 2X71A 4RVAA 4LENA 2EXAA 3LCEA 4FCFA 3ZNYA 4RX3A 5HFOA 3WRTA 3OPRA 5M1AA 3ZG0A 1K55C 2GDNA 3GTCA 2Y2NA 5CTMA 5AQBA 1XP4A 4DXCA 1ZC2A 2Y2LA 4OOLA 1BTLA 2C6WB 5E2FA 3PBOA 3Q1FA 2HP9A 2XFSA 1JTGA 2H5SA 4QB8A 2H10A 5FAOA 4OVDA 1K4EA 1CEFA 2J7VA 2Y2KA 3WRZA 4GNUA 3IXHA 3S22A 1MKIA 4JXSA 3VP1A 4S2KA 4S2NC 1EI5A 3HLFA 3C7UA 3UE3A 4JF4A 2HP6A 1I2SA 1NYYA 4X56A 3EQVA 1KDSA 3UDFA 5FQMA 2Y4AA 3HVFA 3VMAA 1JWVA 3HLBA 4BLMA 1BULA 3MZFA 2HDRA 4GB7A 5F1GA 3C4OA 4F94A 4OQ0A 2ZQ8A 1LHYA 5FAQA 3NC8A 3OPLA 2XK1A 3P09A 4FSFA 3ZG8B 5EUAA 5FQIA 2HDUA 3ZVTA 1L0DA 1K57C 4R23A 1NRFA 5FASA 1HD8A 1N4OA 2HDQA 5AQ9A 1VM1A 5FA7A 3MKFA 1W8QA 3HLGA 4YFMA 4ZJ2A 3HLCA 3CZDA 2VGJA 4X6TA 2ZC4B 1RGYA 3M2JA 1PZOA 4Y0OA 2JBFA 1ES5A 4PPRA 4KZ6A 5CGWA 3VSLA 3BYDA 3HLWA 3B3XA 3PAGA 2Q9MA 1E4DA 4ZTKA 3A3IA 3IF6B 5EVIA 1W79A 3A3DA 2RL3A 5FATA 4R4SA 2XFTA 2XLNA 3FWLA 4HBTA 4LV3A 4BL3A 4LCLA 3IHBA 4IVKA 1LLBA 1BLHA 5GLCA 3PBNA 5D3OA 1XX2A 1TVFA 3SH7A 1DJCA 4UA6A 4WMCA 5TFQA 4U0XA 1GHPA 1IKIA 1M40A 4QJGA 3SH8A 1H8ZA 3W4QA 5CHUA 3LY4A 4MNRA 3GMWA 4UA7A 2ZD8A 2QMIA 4XUXA 2V1ZA 4PMAA 1VQQA 3RXXA 2Y2GA 2ZC7A 2ZQAA 5FI2A 4OPRA 4QU3A 1PW8A 1U60A 4KG6A 3IWOA 3ZDJA 1CK3A 2HDSA 3HLDA 3G35A 4X69A 1KGGA 2ZJ9A 5GLBA 1OMEA 1PIOA 4Y7PA 1ES3A 1YLYA 4IVIA 4IBXA 3OCNA 4UAAA 1ERQA 1O7EA 3UO9A 4E3MA 4Y0TA 4GD8A 5A91A 3IH8A 4E3KA 3IF6C 1K55A 4FD8A 3V3SA 1MY8A 3G34A 4KG2A 3ZGAB 3WS2A 1J9MA 5FQKA 3HUNA 5A92A 2JE5A 3FKVA 1N9BA 3WWXA 1JTDA 1NZOA 1BUEA 2X01A 5CEDA 4OLDA 1E25A 3N7WA 4S2NA 3BECA 3UE0A 5HAPA 4KZ7A 3C4PA 4MBHA 4OPYA 5E2EA 1YMSA 2WAEA 3G31A 3UE1A 2WGWA 3Q07A 3GVBA 1MBLA 1L0FA 3HUOA 4S2IA 3UPOA 3IXDA 3ZG5A 1PWGA 2XH9A 1GCEA 1CI9A 4BENA 1RP5A 4M3KA 3JYIA 2P9VB 5E2GA 1LI0A 4OQHA 1H5XA 3MBZA 5FDHA 4R3JA 4C75A 3DWKA 4GD6A 2DNSA 4PM7A 3UDIA 5U47A 4MLLA 3IT9A 4OH0A 5GL9A 3NDGA 1CI8A 3PAEA 2J9PA 3OPPA 2DRWA 2VGKA 3Q82A 3MZEA 5FQQA 1IEMA 4JXWA 5FAPA 4ZBEA 3TOIA 3VP4A 3FKWA 3BM6A 4X53A 4QY6A 4JPMA 1JWZA 3QNCA 1EWZA 4OOMA 5GLDA 4E3LA 5CXWA 5HARA 1SCWA 1BLCA 3G4PA 4QHCA 2C5WB 3AGEA 2R9XA 4FH2A 4B4XA 4R3BA 4P87A 4JBFA 4OONA 1XA7A 1K6SA 4OKPA 3A3JA 1SDEA 5EPHA 1IKGA 2ZC6B 4X55A 1K6RA 3VSKA 4DDYA 4E3IA 5JYOA 4EQIA 4E6XA 2Y2QA 1FCMA 4K91A 1NXYA 2Z2MB 5FI6A 3M6BA 3IXGA 3LY3A 2WAFA 4PM9A 5CEBA 4B4ZA 2PBYA 4EBNA 1PWCA 5F83A 3NCKA 3O86A 4NK3A 1BT5A 4BD0A 2P74A 3Q7VB 1DY6A 3VP2A 1SKFA 1E3UA 3BLSA 3GRJA 3V3RA 5EVID 2FFYA 3ZG9B 2V20A 4BJPA 2G2WA 4GKUA 2Y2OA 3FZCA 5F1FA 5E2HA 3ZHHA 1ES4A 3QHYA 5GHYA 2WKIA 5CHJA 2I72A 3IF6A 5A90A 2XD1A 4WMCD 5CTNA 4HBUA 4E3NA 2XEPA 1MPLA 4EBLA 1DJAA 2WZXA 4D2OA 1NYMA 1K54C 3ITAA 3VP3A 3ZFZA 4E3JA 3ZNTA 4KQOA 1I5QA 2Q9NA 3O3VA 5DVAA 4P6BA 2HP5A 3UNWA 3C5AA 1WE4A 4KZ8A 2EX9A 4OP8A 4ID4A 3IQAA 1BLPA 3LO7A 2Z2LB 4WYYA 4WZ5A 1YLTA 2QZ6A 2ZC5B 4XUZA 4N1HA 3DTMA 1G6AA 3IF5A 4A5RA 2EFUA 3HBRA 2H0TA 1KVLA 1AXBA 1Q2QA 3VOZA 1JVJA 1LL9A 2J8YA 5L2FA 1Y54A 5KSHA 2WK0A 5DTTA 3SS4A 1L2SA 2IWDA 4KZ4A 1XGIA 4OPQA 4OQIA 4DE0A 1C3BA 3MZDA 3PTEA 4YINA 2Y59A 1K25A 5AQ7A 2A3UA 1K56D 1S6RA 2IWCA 3V39A 5BOHA 2CC1A 4JXVA 2Y2IA 4R1GA 1BSGA 4WEKA 5FQJA 5FI7A 2UWXA 5DF9A 5EVIB 4DF6A 4LCMA 4K0XA 3HREA 2B5RA 1XA1A 1K38A 5CHMA 1MWSA 1YT4A 5DTSA 3S4XA 1ONGA 3UY6A 2V2FF 1LI9A 2P9VA 2XDMA 1XKZA 3SOIA 1K56A 4PM8A 4KZ5A 5CGSA 3QNBA 4ZJ3A 1YLPA 4JXGA 3C7VA 1XXMA 5CERA 4KQQA 4S2MA 4CJNA 4N1XA 1YMXA 3BLMA 3MFDA 3N8LA 1NZUA 1GHIA 4H8RA 3ZVWA 4ZDXA 1NY0A 1LL5A 1IYSA 4KZ9A 3VP0A 3ISGA 3RJUA 3GQZA 2ZM0A 1FCOA 5EVIC 3LEZA 5TGFA 1K57A 2BG1A 4HEFA 4DDSA 3G2YA 1TDGA 3M2KA 2FFFB 1EROA 1MWUA 1S0WA 1PI4A 3I7JA 4DE2A 4C3QA 3MKEA 4S2JA 3GSGA 4R0QA 4QD4A 2PU4A 1MWTA 2WADA 5EE8A 4S2LA 3NBLA 4Y0UA 3EQUA 4KZAA 1K54A 3OPHA 1JWPA 2G2UA 3GR2A 2XQZA 4RA7A 1E3UD 3BFCA 4RYEA 3SS5A 4GOGA 4E3OA 4WBGA 3MXSA 3CJMA 5KZHA 1QMEA 2OSUA 4MEZA 4N9LA 3W4PA 3Q7VA 4CPKA 5HL1A 4HESA 3WS5A 2EX2A 3D4FA 2Y2HA 1PYYA 3BFGA 1FCNA 3Q7ZA 4WZ4A 3PBRA 4EUZA 5FSRA 3IXBA 5HAQA 2EFXA 2Y2PA 4DE1A 4GDNA 3W8KA 3CG5A 1GA0A 3NIAA 4BD1A 1L0GA 4GDBA 3ITBA 3NY4A 1ZG6A 5I94A 1Q2PA 4X68A 2ZQ9A 5EECA 5JYPA 4P85A 2ZQCA 3UDXA 4WEJA 1Z6FA 2OV5A 1W7FA 3NDEA 2BLSA 3IWIA 2ZQDA 3M6HA 2ZMAA 4KZ3A 4OLGA 4PM6A 1IYPA 4WELA 4LV0A 4QY5A 2WZZA 3IHAA 1YLZA 3G32A 4GN2A 4LV1A 1G68A 5E43A 3PBQA 2OLVA 4BL2A 2PU2A 1IELA 5CGXA 4N92A 4NETA 1IYQA 1FR6A 4E6WA 2Y2JA 3DW0A 1PW1A 1KE3A 1YM1A 3V5MA 3V50A 5TR7A 4IEDA 4MBKA 4U0TA 5EOEA 3TG9A 2X02A 5EOOA 1I2WA 1PZPA 3P98A 4DKIA 4C6YA 3W4OA 3BFFA 3UN7A 2WGVA 3SH9A 4OP5A 5M19A 2JC7A 4WM9A 3UPNA 3VOYA 3O87A 4DRTA 1BLSA 4R4RA 5GHZA 2WGIA 3WS4A 2ZQ7A 2WKHA 1TEMA 2EX8A 2XD5A 4L0LA 4ZAMA 3UPPA 4S2PA 3VFFA 1GA9A 1BZAA 2WKEA 5J8XA 4JF6A 4LV2A 5EVLA 2DCFA 5HW3A 1HTZA 3CMZA 1WYBA 3FV7A 3G30A 4PM5A 4Z9QA 3E2LA 1XGJA 3HL9A 3BFEA 1ALQA 4IBRA 2R9WA 4EWFA 4K0WA 3VFHA 1SDNA 3ZG7B 2XF3A 4KQRA 4OQGA 5CECA 4EBPA 3NI9A 2OLUA 3O88A 5DTKA 3E2KA 5KMWA 2WYXA 3PBTA 1SHVA 1PWDA 4Q8IA 1ERMA 4RX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ESI A;  4EV4 A;  1ZG4 A;  1HZO A;  2ZM8 A;  4OPZ A;  1KGE A;  2XGN A;  3AGD A;  1L0E A;  1RCJ A;  1RGZ A;  1PI5 A;  2IWB A;  2ZC3 B;  4OOY A;  4P0M A;  1HVB A;  1IYO A;  5GHX A;  1CEG A;  3HUM A;  4KZB A;  1H8Y A;  1FQG A;  4O7D A;  5F82 A;  3BRM A;  1FSW A;  1KE0 A;  1M6K A;  1O07 A;  4UA9 A;  5IHV A;  2QPN A;  4JKT A;  4KEN B;  1YQS A;  3SS3 A;  3WS0 A;  2E8I A;  3RXW A;  1KGF A;  3PBS A;  2Y91 A;  2J9O A;  1YLW A;  4N9K A;  5AQA A;  2RCX A;  2ZLY A;  4UHU A;  3S1Y A;  4KG5 A;  3N8S A;  5DF8 A;  1TDL A;  2Y55 A;  5GLA A;  1YLJ A;  1K4F A;  5DF7 A;  4MBF A;  4ZJ1 A;  1QMF A;  1MWR A;  1KVM A;  2ZM2 A;  3AGF A;  4JLF A;  1DJB A;  3TSG A;  2XR0 A;  1WYC A;  3DWZ A;  5FQ9 A;  4DXB A;  4XXR A;  3MXR A;  3A3E A;  3HLE A;  2A49 A;  3N8R A;  3OC2 A;  3IWQ A;  3ZCZ A;  1FR1 A;  1W8Y A;  1KDW A;  1KE4 A;  3OZH A;  5G18 A;  1ES2 A;  3BFD A;  5HX9 A;  2HPB A;  3N6I A;  2JCH A;  3N4I A;  4U3T A;  2H0Y A;  4FH4 A;  4JF5 A;  1FSY A;  5HAI A;  3WS1 A;  4WZ5 C;  1W5D A;  2Y2M A;  3FYZ A;  1ZKJ A;  4BQM A;  3BEB A;  3G2Z A;  5CRF A;  1GHM A;  5M18 A;  1XPB A;  1FOF A;  1NJ4 A;  3Q81 A;  5KSC A;  4DE3 A;  3GV9 A;  2EXB A;  1MXO A;  3IH9 A;  4S2O A;  2WGW B;  1ONH A;  1ESU A;  2WUQ A;  3OCL A;  4B88 A;  4GZB A;  2EX6 A;  3A3F A;  5A93 A;  2X71 A;  4RVA A;  4LEN A;  2EXA A;  3LCE A;  4FCF A;  3ZNY A;  4RX3 A;  5HFO A;  3WRT A;  3OPR A;  5M1A A;  3ZG0 A;  1K55 C;  2GDN A;  3GTC A;  2Y2N A;  5CTM A;  5AQB A;  1XP4 A;  4DXC A;  1ZC2 A;  2Y2L A;  4OOL A;  1BTL A;  2C6W B;  5E2F A;  3PBO A;  3Q1F A;  2HP9 A;  2XFS A;  1JTG A;  2H5S A;  4QB8 A;  2H10 A;  5FAO A;  4OVD A;  1K4E A;  1CEF A;  2J7V A;  2Y2K A;  3WRZ A;  4GNU A;  3IXH A;  3S22 A;  1MKI A;  4JXS A;  3VP1 A;  4S2K A;  4S2N C;  1EI5 A;  3HLF A;  3C7U A;  3UE3 A;  4JF4 A;  2HP6 A;  1I2S A;  1NYY A;  4X56 A;  3EQV A;  1KDS A;  3UDF A;  5FQM A;  2Y4A A;  3HVF A;  3VMA A;  1JWV A;  3HLB A;  4BLM A;  1BUL A;  3MZF A;  2HDR A;  4GB7 A;  5F1G A;  3C4O A;  4F94 A;  4OQ0 A;  2ZQ8 A;  1LHY A;  5FAQ A;  3NC8 A;  3OPL A;  2XK1 A;  3P09 A;  4FSF A;  3ZG8 B;  5EUA A;  5FQI A;  2HDU A;  3ZVT A;  1L0D A;  1K57 C;  4R23 A;  1NRF A;  5FAS A;  1HD8 A;  1N4O A;  2HDQ A;  5AQ9 A;  1VM1 A;  5FA7 A;  3MKF A;  1W8Q A;  3HLG A;  4YFM A;  4ZJ2 A;  3HLC A;  3CZD A;  2VGJ A;  4X6T A;  2ZC4 B;  1RGY A;  3M2J A;  1PZO A;  4Y0O A;  2JBF A;  1ES5 A;  4PPR A;  4KZ6 A;  5CGW A;  3VSL A;  3BYD A;  3HLW A;  3B3X A;  3PAG A;  2Q9M A;  1E4D A;  4ZTK A;  3A3I A;  3IF6 B;  5EVI A;  1W79 A;  3A3D A;  2RL3 A;  5FAT A;  4R4S A;  2XFT A;  2XLN A;  3FWL A;  4HBT A;  4LV3 A;  4BL3 A;  4LCL A;  3IHB A;  4IVK A;  1LLB A;  1BLH A;  5GLC A;  3PBN A;  5D3O A;  1XX2 A;  1TVF A;  3SH7 A;  1DJC A;  4UA6 A;  4WMC A;  5TFQ A;  4U0X A;  1GHP A;  1IKI A;  1M40 A;  4QJG A;  3SH8 A;  1H8Z A;  3W4Q A;  5CHU A;  3LY4 A;  4MNR A;  3GMW A;  4UA7 A;  2ZD8 A;  2QMI A;  4XUX A;  2V1Z A;  4PMA A;  1VQQ A;  3RXX A;  2Y2G A;  2ZC7 A;  2ZQA A;  5FI2 A;  4OPR A;  4QU3 A;  1PW8 A;  1U60 A;  4KG6 A;  3IWO A;  3ZDJ A;  1CK3 A;  2HDS A;  3HLD A;  3G35 A;  4X69 A;  1KGG A;  2ZJ9 A;  5GLB A;  1OME A;  1PIO A;  4Y7P A;  1ES3 A;  1YLY A;  4IVI A;  4IBX A;  3OCN A;  4UAA A;  1ERQ A;  1O7E A;  3UO9 A;  4E3M A;  4Y0T A;  4GD8 A;  5A91 A;  3IH8 A;  4E3K A;  3IF6 C;  1K55 A;  4FD8 A;  3V3S A;  1MY8 A;  3G34 A;  4KG2 A;  3ZGA B;  3WS2 A;  1J9M A;  5FQK A;  3HUN A;  5A92 A;  2JE5 A;  3FKV A;  1N9B A;  3WWX A;  1JTD A;  1NZO A;  1BUE A;  2X01 A;  5CED A;  4OLD A;  1E25 A;  3N7W A;  4S2N A;  3BEC A;  3UE0 A;  5HAP A;  4KZ7 A;  3C4P A;  4MBH A;  4OPY A;  5E2E A;  1YMS A;  2WAE A;  3G31 A;  3UE1 A;  2WGW A;  3Q07 A;  3GVB A;  1MBL A;  1L0F A;  3HUO A;  4S2I A;  3UPO A;  3IXD A;  3ZG5 A;  1PWG A;  2XH9 A;  1GCE A;  1CI9 A;  4BEN A;  1RP5 A;  4M3K A;  3JYI A;  2P9V B;  5E2G A;  1LI0 A;  4OQH A;  1H5X A;  3MBZ A;  5FDH A;  4R3J A;  4C75 A;  3DWK A;  4GD6 A;  2DNS A;  4PM7 A;  3UDI A;  5U47 A;  4MLL A;  3IT9 A;  4OH0 A;  5GL9 A;  3NDG A;  1CI8 A;  3PAE A;  2J9P A;  3OPP A;  2DRW A;  2VGK A;  3Q82 A;  3MZE A;  5FQQ A;  1IEM A;  4JXW A;  5FAP A;  4ZBE A;  3TOI A;  3VP4 A;  3FKW A;  3BM6 A;  4X53 A;  4QY6 A;  4JPM A;  1JWZ A;  3QNC A;  1EWZ A;  4OOM A;  5GLD A;  4E3L A;  5CXW A;  5HAR A;  1SCW A;  1BLC A;  3G4P A;  4QHC A;  2C5W B;  3AGE A;  2R9X A;  4FH2 A;  4B4X A;  4R3B A;  4P87 A;  4JBF A;  4OON A;  1XA7 A;  1K6S A;  4OKP A;  3A3J A;  1SDE A;  5EPH A;  1IKG A;  2ZC6 B;  4X55 A;  1K6R A;  3VSK A;  4DDY A;  4E3I A;  5JYO A;  4EQI A;  4E6X A;  2Y2Q A;  1FCM A;  4K91 A;  1NXY A;  2Z2M B;  5FI6 A;  3M6B A;  3IXG A;  3LY3 A;  2WAF A;  4PM9 A;  5CEB A;  4B4Z A;  2PBY A;  4EBN A;  1PWC A;  5F83 A;  3NCK A;  3O86 A;  4NK3 A;  1BT5 A;  4BD0 A;  2P74 A;  3Q7V B;  1DY6 A;  3VP2 A;  1SKF A;  1E3U A;  3BLS A;  3GRJ A;  3V3R A;  5EVI D;  2FFY A;  3ZG9 B;  2V20 A;  4BJP A;  2G2W A;  4GKU A;  2Y2O A;  3FZC A;  5F1F A;  5E2H A;  3ZHH A;  1ES4 A;  3QHY A;  5GHY A;  2WKI A;  5CHJ A;  2I72 A;  3IF6 A;  5A90 A;  2XD1 A;  4WMC D;  5CTN A;  4HBU A;  4E3N A;  2XEP A;  1MPL A;  4EBL A;  1DJA A;  2WZX A;  4D2O A;  1NYM A;  1K54 C;  3ITA A;  3VP3 A;  3ZFZ A;  4E3J A;  3ZNT A;  4KQO A;  1I5Q A;  2Q9N A;  3O3V A;  5DVA A;  4P6B A;  2HP5 A;  3UNW A;  3C5A A;  1WE4 A;  4KZ8 A;  2EX9 A;  4OP8 A;  4ID4 A;  3IQA A;  1BLP A;  3LO7 A;  2Z2L B;  4WYY A;  4WZ5 A;  1YLT A;  2QZ6 A;  2ZC5 B;  4XUZ A;  4N1H A;  3DTM A;  1G6A A;  3IF5 A;  4A5R A;  2EFU A;  3HBR A;  2H0T A;  1KVL A;  1AXB A;  1Q2Q A;  3VOZ A;  1JVJ A;  1LL9 A;  2J8Y A;  5L2F A;  1Y54 A;  5KSH A;  2WK0 A;  5DTT A;  3SS4 A;  1L2S A;  2IWD A;  4KZ4 A;  1XGI A;  4OPQ A;  4OQI A;  4DE0 A;  1C3B A;  3MZD A;  3PTE A;  4YIN A;  2Y59 A;  1K25 A;  5AQ7 A;  2A3U A;  1K56 D;  1S6R A;  2IWC A;  3V39 A;  5BOH A;  2CC1 A;  4JXV A;  2Y2I A;  4R1G A;  1BSG A;  4WEK A;  5FQJ A;  5FI7 A;  2UWX A;  5DF9 A;  5EVI B;  4DF6 A;  4LCM A;  4K0X A;  3HRE A;  2B5R A;  1XA1 A;  1K38 A;  5CHM A;  1MWS A;  1YT4 A;  5DTS A;  3S4X A;  1ONG A;  3UY6 A;  2V2F F;  1LI9 A;  2P9V A;  2XDM A;  1XKZ A;  3SOI A;  1K56 A;  4PM8 A;  4KZ5 A;  5CGS A;  3QNB A;  4ZJ3 A;  1YLP A;  4JXG A;  3C7V A;  1XXM A;  5CER A;  4KQQ A;  4S2M A;  4CJN A;  4N1X A;  1YMX A;  3BLM A;  3MFD A;  3N8L A;  1NZU A;  1GHI A;  4H8R A;  3ZVW A;  4ZDX A;  1NY0 A;  1LL5 A;  1IYS A;  4KZ9 A;  3VP0 A;  3ISG A;  3RJU A;  3GQZ A;  2ZM0 A;  1FCO A;  5EVI C;  3LEZ A;  5TGF A;  1K57 A;  2BG1 A;  4HEF A;  4DDS A;  3G2Y A;  1TDG A;  3M2K A;  2FFF B;  1ERO A;  1MWU A;  1S0W A;  1PI4 A;  3I7J A;  4DE2 A;  4C3Q A;  3MKE A;  4S2J A;  3GSG A;  4R0Q A;  4QD4 A;  2PU4 A;  1MWT A;  2WAD A;  5EE8 A;  4S2L A;  3NBL A;  4Y0U A;  3EQU A;  4KZA A;  1K54 A;  3OPH A;  1JWP A;  2G2U A;  3GR2 A;  2XQZ A;  4RA7 A;  1E3U D;  3BFC A;  4RYE A;  3SS5 A;  4GOG A;  4E3O A;  4WBG A;  3MXS A;  3CJM A;  5KZH A;  1QME A;  2OSU A;  4MEZ A;  4N9L A;  3W4P A;  3Q7V A;  4CPK A;  5HL1 A;  4HES A;  3WS5 A;  2EX2 A;  3D4F A;  2Y2H A;  1PYY A;  3BFG A;  1FCN A;  3Q7Z A;  4WZ4 A;  3PBR A;  4EUZ A;  5FSR A;  3IXB A;  5HAQ A;  2EFX A;  2Y2P A;  4DE1 A;  4GDN A;  3W8K A;  3CG5 A;  1GA0 A;  3NIA A;  4BD1 A;  1L0G A;  4GDB A;  3ITB A;  3NY4 A;  1ZG6 A;  5I94 A;  1Q2P A;  4X68 A;  2ZQ9 A;  5EEC A;  5JYP A;  4P85 A;  2ZQC A;  3UDX A;  4WEJ A;  1Z6F A;  2OV5 A;  1W7F A;  3NDE A;  2BLS A;  3IWI A;  2ZQD A;  3M6H A;  2ZMA A;  4KZ3 A;  4OLG A;  4PM6 A;  1IYP A;  4WEL A;  4LV0 A;  4QY5 A;  2WZZ A;  3IHA A;  1YLZ A;  3G32 A;  4GN2 A;  4LV1 A;  1G68 A;  5E43 A;  3PBQ A;  2OLV A;  4BL2 A;  2PU2 A;  1IEL A;  5CGX A;  4N92 A;  4NET A;  1IYQ A;  1FR6 A;  4E6W A;  2Y2J A;  3DW0 A;  1PW1 A;  1KE3 A;  1YM1 A;  3V5M A;  3V50 A;  5TR7 A;  4IED A;  4MBK A;  4U0T A;  5EOE A;  3TG9 A;  2X02 A;  5EOO A;  1I2W A;  1PZP A;  3P98 A;  4DKI A;  4C6Y A;  3W4O A;  3BFF A;  3UN7 A;  2WGV A;  3SH9 A;  4OP5 A;  5M19 A;  2JC7 A;  4WM9 A;  3UPN A;  3VOY A;  3O87 A;  4DRT A;  1BLS A;  4R4R A;  5GHZ A;  2WGI A;  3WS4 A;  2ZQ7 A;  2WKH A;  1TEM A;  2EX8 A;  2XD5 A;  4L0L A;  4ZAM A;  3UPP A;  4S2P A;  3VFF A;  1GA9 A;  1BZA A;  2WKE A;  5J8X A;  4JF6 A;  4LV2 A;  5EVL A;  2DCF A;  5HW3 A;  1HTZ A;  3CMZ A;  1WYB A;  3FV7 A;  3G30 A;  4PM5 A;  4Z9Q A;  3E2L A;  1XGJ A;  3HL9 A;  3BFE A;  1ALQ A;  4IBR A;  2R9W A;  4EWF A;  4K0W A;  3VFH A;  1SDN A;  3ZG7 B;  2XF3 A;  4KQR A;  4OQG A;  5CEC A;  4EBP A;  3NI9 A;  2OLU A;  3O88 A;  5DTK A;  3E2K A;  5KMW A;  2WYX A;  3PBT A;  1SHV A;  1PWD A;  4Q8I A;  1ERM A;  4RX2 A; 
#chains in the Genus database with same CATH topology
 1ZG4 A;  4OPZ A;  3MQ0 A;  1J3W A;  5GHX A;  4KQD A;  5F82 A;  3BQA A;  4UA9 A;  4L9E A;  4WF0 A;  2RCX A;  2YKF A;  3N8S A;  3IS2 A;  1YLJ A;  4MBF A;  2VGL M;  4HH2 A;  3PHY A;  3MXQ A;  2XR0 A;  1OTD A;  2O0Y A;  3MXR A;  3A3E A;  1H3Q A;  2KDK A;  3HLE A;  1ZHH B;  2A49 A;  4HI4 A;  3T4T A;  3ZCZ A;  1FR1 A;  2ZL1 B;  1KDW A;  5G18 A;  1F98 A;  2HPB A;  2QHK A;  3N6I A;  5FDS A;  3N4I A;  1LT0 A;  3WS1 A;  4WZ5 C;  1TD5 A;  2Y2M A;  4PAU A;  1GHM A;  3IH9 A;  3NUL A;  1ONH A;  1YAX A;  4II7 A;  4B88 A;  1H0M A;  2EX6 A;  3LCE A;  1D06 A;  3OPR A;  3ZG0 A;  3P01 A;  3GTC A;  5AQB A;  4LRZ E;  4DXC A;  2C6W B;  1JTG A;  2H10 A;  4EXO A;  5FAO A;  3V67 A;  1TS7 A;  4GNU A;  4YNR A;  3VP1 A;  3HLF A;  3CIT A;  4JF4 A;  2CMN A;  1I2S A;  5FEF A;  3UDF A;  2Y4A A;  3HVF A;  2YKH A;  3C4O A;  2ZQ8 A;  3ZG8 B;  2HDU A;  3ZVT A;  1W63 Q;  4R23 A;  2HDQ A;  5AQ9 A;  1VM1 A;  5FA7 A;  3HLG A;  2VGJ A;  2ZC4 B;  1A0K A;  2JBF A;  1ES5 A;  5IT5 A;  1Y4O A;  1D7E A;  3PAG A;  4ZTK A;  3A3I A;  3A3D A;  5FAT A;  2W3F A;  4HBT A;  5MC7 A;  1DJC A;  4UA6 A;  1M40 A;  5CHU A;  3LY4 A;  3GMW A;  2ZD8 A;  3IX4 A;  4PMA A;  3CHW P;  2ZQA A;  3E0Y A;  4QU3 A;  4KG6 A;  3ZDJ A;  2ZJ9 A;  1OME A;  4IVI A;  4K08 A;  4E3K A;  3IF6 C;  1K55 A;  1MY8 A;  4KG2 A;  3ZGA B;  5FQK A;  4I3A A;  1JTD A;  1BUE A;  2X01 A;  2ZOH A;  1E25 A;  4HNB A;  2DMW A;  3PXP A;  5HAP A;  4KZ7 A;  4MBH A;  5E2E A;  2HJ9 C;  2WAE A;  2JKT M;  3CLO A;  2JKR M;  1L0F A;  3HUO A;  4S2I A;  4YOF A;  2XH9 A;  3JPU A;  3JYI A;  2P9V B;  5J3W A;  1P9W A;  5HDD A;  2DNS A;  5U47 A;  4MLL A;  4G3W A;  4OH0 A;  4FOF A;  3OPP A;  1YSQ A;  2JHE A;  3T1Q B;  3MZE A;  1IEM A;  5FAP A;  1JWZ A;  1EWZ A;  4OOM A;  2W3G A;  5GLD A;  4HQA A;  1BLC A;  4FH2 A;  3AGE A;  2R9X A;  4JBF A;  4LRX C;  4OON A;  3VSK A;  1SDE A;  4QWO A;  4E6X A;  1FCM A;  2Z2M B;  2PBY A;  3NCK A;  3O86 A;  4BD0 A;  1SKF A;  2KX6 A;  3JVU A;  2Y2O A;  3ZHH A;  1ES4 A;  3QHY A;  5CHJ A;  1Z09 A;  1MPL A;  1LL8 A;  4EBL A;  1DJA A;  3VP3 A;  4G3K A;  4LGW A;  2HP5 A;  5L8M A;  4KZ8 A;  3MFX A;  1H8M A;  3IQA A;  4NXB A;  4WZ5 A;  1IOU A;  3IF5 A;  3CPT A;  3HBR A;  5HWT A;  1CQA A;  1KVL A;  2W3D A;  3VOZ A;  1JVJ A;  1LL9 A;  2J8Y A;  4JGP A;  3SS4 A;  3S7Q A;  2V8F A;  1OPX A;  3MZD A;  5AQ7 A;  3EEH A;  5BOH A;  2CC1 A;  2Y2I A;  1XA1 A;  4HY8 A;  1XJ3 A;  5DTS A;  3S4X A;  2OAQ 1;  2V2F F;  2XDM A;  4CLC D;  3SOI A;  4PM8 A;  4KZ5 A;  3GDI A;  4JXG A;  1ODV A;  5CX7 A;  5CER A;  3BJN A;  4N1X A;  4ZDX A;  1LL5 A;  4KZ9 A;  3VP0 A;  1FCO A;  5EVI C;  2W1R A;  4DDS A;  1TDG A;  1S0W A;  3GSG A;  1N9L A;  4QD4 A;  5DKL A;  5LBR A;  3LUQ A;  2QKP A;  1JWP A;  3GR2 A;  3SS5 A;  2W3E A;  5EM0 A;  5KZH A;  1QME A;  2EWW A;  1V9Y A;  4Q0I A;  4CPK A;  5HL1 A;  4EW7 A;  3HJK A;  1PYY A;  4EUZ A;  4DE1 A;  4GDN A;  3IBR A;  4IHQ A;  1GA0 A;  4BD1 A;  4GDB A;  3ITB A;  2ZQ9 A;  5EEC A;  5JYP A;  4GHI B;  2OV5 A;  1YSP A;  4EER A;  4LV0 A;  4QY5 A;  2WKR A;  3IHA A;  3G32 A;  5E43 A;  1G68 A;  1OTI A;  5DJU A;  4H6J A;  3R7W A;  3ICY A;  5CGX A;  1LSX A;  4HHD A;  4NET A;  5TR7 A;  1CF0 A;  1PZP A;  3KSH A;  5F5Y A;  2VZW A;  4I3J A;  5M19 A;  2JC7 A;  1MKM A;  3UPN A;  3VOY A;  3KSG A;  3O87 A;  2V9A A;  2ZQ7 A;  3UPP A;  1OJG A;  3U2A A;  3CMZ A;  5HPI A;  4Z9Q A;  1NLZ A;  1XGJ A;  3HL9 A;  3MQQ A;  2QJ5 A;  2XF3 A;  3NI9 A;  5C5K A;  2IA2 A;  5KMW A;  2LB5 A;  1MC0 A;  4Q8I A;  4RX2 A;  2ZM8 A;  1KGE A;  1L0E A;  1PI5 A;  3OOV A;  3JVV A;  3ZQ5 A;  4GW9 A;  4O7D A;  3BRM A;  1O07 A;  3B33 A;  4GCZ A;  5IHV A;  4JKT A;  4KEN B;  3WS0 A;  3LIB A;  2E8I A;  5TJJ A;  1KGF A;  3PBS A;  3CPT B;  4O8G A;  5DF8 A;  5GLA A;  1K4F A;  5EFW A;  2ZM2 A;  3T4K A;  4JLF A;  1NRJ A;  1DJB A;  5FQ9 A;  4DXB A;  4XXR A;  2JKG A;  3N8R A;  1JNU A;  3IWQ A;  1KE4 A;  3OZH A;  3A0R A;  1PRQ A;  1ES2 A;  4IJG A;  2JCH A;  4FH4 A;  4JF5 A;  3F1N A;  3Q81 A;  1PFL A;  1S67 L;  4KUO A;  1ESU A;  1TS8 A;  4RQ9 A;  3ZNY A;  3IX8 A;  3EGX C;  5M1A A;  1K55 C;  1AWI A;  2VEA A;  3QP5 A;  3UB5 P;  1ZC2 A;  4OOL A;  2HP9 A;  4CLC B;  2GZA A;  5J7E A;  3WRZ A;  4S2K A;  3VE4 A;  3RTY A;  3LFV A;  2HP6 A;  4X56 A;  4I3I A;  3EQV A;  1XJ6 A;  3EWK A;  3MZF A;  2HDR A;  4GB7 A;  4F94 A;  3T12 B;  1LHY A;  3NC8 A;  3OPL A;  4BBT A;  3L9K A;  4FSF A;  4ZJ2 A;  4JGQ A;  1W8Q A;  1OT9 A;  4GLQ A;  3M2J A;  2XRN A;  2INW A;  4KZ6 A;  5CGW A;  3VSL A;  3HLW A;  2PHY A;  2Q9M A;  5HD3 A;  1P0Z A;  3IF6 B;  5EVI A;  4M4X A;  4R4S A;  3FWL A;  1P9R A;  4LV3 A;  4BL3 A;  4LCL A;  3IHB A;  4IVK A;  2NUP C;  1BLH A;  2VLG A;  1XX2 A;  3SH7 A;  4ESP A;  5TFQ A;  3F1P A;  3ZYT A;  4UA7 A;  4XUX A;  1VQQ A;  4OPR A;  1PW8 A;  1U60 A;  1XJ4 A;  3D72 A;  4X69 A;  3HLD A;  4Y7P A;  1O7E A;  4E3M A;  2VKS A;  4Y0T A;  3IH8 A;  4FD8 A;  5J4E A;  3WS2 A;  2BTF P;  3K3C A;  3T4J A;  5AJG A;  2ZBB A;  3WWX A;  1NZO A;  2J3T C;  4GJ4 A;  2R78 A;  3C4P A;  1YMS A;  3UE1 A;  2WGW A;  3Q07 A;  3GVB A;  3IXD A;  4OQH A;  1H5X A;  3FG8 A;  5FDH A;  4GD6 A;  3UDI A;  3IT9 A;  3LIF A;  2J9P A;  3K3D A;  3UMD A;  2VGK A;  3Q82 A;  1S1Z A;  5FQQ A;  4QY6 A;  3A0V A;  1VET A;  4QHC A;  1GSV A;  4R3B A;  4OKP A;  4E3I A;  5EPH A;  1IKG A;  4EQI A;  1NXY A;  2M7V A;  4PM9 A;  4IUH A;  4EBN A;  5F83 A;  2M1C A;  2P74 A;  1DY6 A;  3VP2 A;  3NEC A;  1E3U A;  2ZMV A;  3BLS A;  3ZG9 B;  4HH3 A;  3QP6 A;  4GKU A;  3C2W A;  5E2H A;  2JKF A;  2XD1 A;  2A24 A;  2J3W A;  2XEP A;  2PD8 A;  2K7S A;  4O01 A;  5K5B A;  1I5Q A;  5DVA A;  4P6B A;  4OP8 A;  2B18 A;  1BLP A;  3TW8 A;  4WYY A;  1G28 A;  1YLT A;  2ZC5 B;  2W3H A;  1G6A A;  2H0T A;  1DP9 A;  1Q2Q A;  3TE8 A;  4NXE A;  2O9C A;  4EET B;  2KLI A;  1XFN A;  4KZ4 A;  1XGI A;  4YIN A;  2Y59 A;  1K25 A;  2IWC A;  1BSG A;  4DF6 A;  2ACG A;  2UWX A;  5EVI B;  5FI7 A;  4B93 A;  1D1J A;  4K0X A;  3HRE A;  1K38 A;  2Y8H A;  1DP8 A;  1YT4 A;  2VV6 A;  1T1C A;  3BWL A;  1OT6 A;  1XJ2 A;  1YMX A;  3BLM A;  1NZU A;  1GHI A;  1NY0 A;  3LID A;  1IYS A;  3RJU A;  3GQZ A;  2PR6 A;  5TGF A;  1X0O A;  3NHQ A;  3G2Y A;  3IS2 B;  1V9Z A;  1MWU A;  2FZ0 A;  4S2J A;  1T1A A;  2WAD A;  2HV1 A;  4NEE D;  3NBL A;  3EQU A;  4KZA A;  1K54 A;  3ULF A;  1DP6 A;  4ARZ A;  4GOG A;  3BQ8 A;  3GEC A;  4WBG A;  4E3O A;  4X1M A;  3Q7V A;  2PAV P;  2A2L A;  4MMN A;  2XA7 M;  4WZ4 A;  5HAQ A;  2Y2P A;  2O99 A;  3NIA A;  1L0G A;  2OAP 1;  2GX5 A;  5I94 A;  1Q2P A;  4X68 A;  2KOI A;  1W7F A;  3NDE A;  4KZ3 A;  4PM6 A;  4WEL A;  2D01 A;  4LRY C;  5F68 A;  1TS6 A;  2PU2 A;  1IYQ A;  2WKP A;  4E6W A;  1VET B;  1YM1 A;  3V5M A;  4WLA A;  4IED A;  4HIA A;  3T1R A;  5A8B A;  5EOO A;  1I2W A;  1F9I A;  3BY8 A;  4C6Y A;  3W4O A;  3SH9 A;  4MN5 A;  4BBU A;  1BLS A;  5GHZ A;  2QWS A;  2WGI A;  1KOU A;  2WKH A;  4ZAM A;  3NOT C;  4S2P A;  2WKE A;  4LV2 A;  3B47 A;  1T18 A;  1WYB A;  3OBF A;  5HDS A;  4EWF A;  3BFE A;  4K0W A;  3ZG7 B;  3HJI A;  5AVF A;  2M7U A;  2A24 B;  4LLO B;  2PBD P;  5DTK A;  3DTE A;  4HJ6 A;  3PBT A;  1P97 A;  3LR5 A;  1PWD A;  1ESI A;  2ZOI A;  1HZO A;  4LFU A;  1ZTU A;  4BMW A;  2NUT C;  1RCJ A;  2ZC3 B;  4OOY A;  4P0M A;  1HVB A;  1IYO A;  1CEG A;  4KZB A;  1H8Y A;  3B42 A;  1FQG A;  1KE0 A;  4JGR A;  3SS3 A;  1YQS A;  1S66 L;  2Y91 A;  2J9O A;  4N9K A;  4UHU A;  3KSI A;  2Y55 A;  5DF7 A;  2GJ3 A;  2B95 A;  3KO6 A;  1HLU P;  3DWZ A;  2VGL S;  1FIK A;  1UWN X;  3OC2 A;  3KYQ A;  1W8Y A;  1OTB A;  4U3T A;  2H0Y A;  3F1O A;  3TRC A;  5HAI A;  5L09 A;  3FYZ A;  4I39 A;  1G5U A;  2V8C A;  3G2Z A;  5M18 A;  4DE3 A;  2EXB A;  4MCW A;  1ACF A;  4S2O A;  2HF6 A;  3OCL A;  1N9O A;  3A3F A;  5A93 A;  4RVA A;  2EXA A;  1G6O A;  1W63 M;  5HFO A;  2E8J A;  1VEU A;  3C30 A;  1S1Y A;  2K2N A;  5HD5 A;  2Y2L A;  1BTL A;  5E2F A;  3Q1F A;  2XFS A;  2H5S A;  4QPR A;  2W1T A;  3SW1 A;  2VV8 A;  4BBV A;  1K4E A;  2J7V A;  3BY9 A;  2Y2K A;  3S22 A;  3IXH A;  1EI5 A;  3KYZ A;  5G4Z A;  1NYY A;  3MSH A;  3IBJ A;  4ARZ B;  2L1M A;  3VMA A;  5G4Y A;  5F1G A;  4EES A;  5FAQ A;  3S7P A;  2O9B A;  5EUA A;  1L0D A;  5HPF A;  1NRF A;  1HD8 A;  1FIL A;  1N4O A;  3T4L A;  4EEU A;  3CZD A;  4X6T A;  1RGY A;  2L4R A;  1K0K A;  1PZO A;  4Y0O A;  3RFB A;  3B3X A;  3QP2 A;  2OWJ A;  1PNE A;  1UGU A;  2XFT A;  1LLB A;  5GLC A;  3PBN A;  5D3O A;  1TVF A;  4WMC A;  1IKI A;  3SH8 A;  5HL6 A;  4PKY G;  2QMI A;  2V1Z A;  4R70 A;  3RXX A;  5FI2 A;  3LGO A;  3IWO A;  1CK3 A;  3G35 A;  4WN5 A;  1KGG A;  4IBX A;  4UAA A;  1STZ A;  1SKO A;  4GD8 A;  1LSW A;  5A91 A;  3MS6 A;  3V3S A;  1J9M A;  1T19 A;  2ZL1 A;  3S7N A;  3W2Z A;  2VX8 A;  3HUN A;  5A92 A;  2JE5 A;  4Y17 A;  3MJQ A;  3BW6 A;  5CED A;  4S2N A;  2HZ5 A;  3G31 A;  5IU1 A;  2Z6D A;  1PWG A;  1GCE A;  5DKK A;  1RP5 A;  5E2G A;  3MBZ A;  4MDZ A;  3EEA A;  3SZT A;  3NDG A;  2B02 A;  2P08 A;  4CQH A;  3VP4 A;  3TOI A;  2V1A A;  3BM6 A;  4X53 A;  4JPM A;  4D60 A;  3QNC A;  2PYR A;  5HAR A;  3G4P A;  2VK3 A;  5EV0 A;  4B4X A;  1XA7 A;  3A3J A;  1K6R A;  4DDY A;  3D3O A;  2Y2Q A;  2OOL A;  3KSF A;  3M6B A;  5DFY A;  2VV7 A;  3IXG A;  4B4Z A;  4NK3 A;  1BT5 A;  4I38 A;  1NLY A;  3GRJ A;  5EVI D;  2FFY A;  2V20 A;  3FPV A;  2PRF A;  4R38 A;  2WKI A;  3HCY A;  3K2N A;  5CTN A;  4HBU A;  3U4L P;  4Q0H A;  2WZX A;  4D2O A;  1GSX A;  1TS0 A;  1NYM A;  4UQI S;  2G7U A;  1K54 C;  3ITA A;  4EU0 A;  4H6J B;  4KQO A;  3R7W B;  3O3V A;  3UNW A;  3C5A A;  4DJ3 A;  2EX9 A;  4ID4 A;  3E4P A;  4NG2 A;  2Z2L B;  4PKY A;  3CWF A;  3L7H A;  3PR6 A;  3UB8 A;  4A5R A;  5FEG A;  1AXB A;  1Y54 A;  5KSH A;  2WK0 A;  1L2S A;  2IWD A;  5IS1 A;  2UV0 E;  2P7J A;  4OPQ A;  4DE0 A;  5F6A A;  3PTE A;  2VA0 A;  2A3U A;  1S6R A;  4GS9 A;  4JXV A;  4JGO A;  1WA9 A;  2D02 A;  5DF9 A;  2B5R A;  3UB9 A;  5CHM A;  3UY6 A;  2P9V A;  1S4R A;  1XKZ A;  3VE3 A;  4HP4 A;  3QNB A;  4ZJ3 A;  2V0U A;  3H9W A;  4S2M A;  5HWW A;  3ZVW A;  1SKO B;  2ZM0 A;  3KYE A;  3LEZ A;  2BG1 A;  1EW0 A;  2FFF B;  3M2K A;  3I7J A;  4HJ3 A;  1PI4 A;  4C3Q A;  3MKE A;  3UB7 A;  2PU4 A;  1MWT A;  4Y0U A;  2G2U A;  2XQZ A;  4RA7 A;  1E3U D;  3BFC A;  3CJM A;  5HSQ A;  4MEZ A;  2J80 A;  3W4P A;  3O5Y A;  2W27 A;  4HES A;  3WS5 A;  2Y2H A;  3F1N B;  3PBR A;  5FSR A;  4MN7 A;  3MMH A;  3CUE C;  3NY4 A;  1ZG6 A;  3CI6 A;  4P85 A;  3UDX A;  1Z6F A;  2BLS A;  3IWI A;  4OLG A;  3LI8 A;  4HOI A;  2WZZ A;  1YLZ A;  4GN2 A;  4WL9 A;  4LV1 A;  3PBQ A;  2OLV A;  4BL2 A;  4EQ1 A;  3EGD C;  2Y79 A;  5AVE A;  2HGV A;  1IEL A;  2Y2J A;  1PW1 A;  3V50 A;  4MBK A;  4U0T A;  5EOE A;  3TG9 A;  4R3A A;  3MR0 A;  2MJ6 A;  3P98 A;  3D9Y A;  3BFF A;  4F3L A;  4FTX A;  4DRT A;  4Y13 A;  3QP8 A;  3RH8 B;  2GNX A;  4CLC C;  3EOI A;  2AVX A;  3DTI A;  5HDC A;  3VFF A;  3C8C A;  5J8X A;  5EVL A;  3LI9 A;  1YPR A;  5HW3 A;  1HTZ A;  3FV7 A;  3G30 A;  5L07 A;  1ALQ A;  4IBR A;  2R9W A;  3VV4 A;  3QP4 A;  3VFH A;  1SDN A;  3LIC A;  4KQR A;  1F5M A;  4Y2F A;  2OLU A;  1OJ5 A;  3LR0 A;  3O88 A;  3E2K A;  1SHV A;  1ERM A;  4EV4 A;  1SZV A;  1DRM A;  2XGN A;  3AGD A;  1RGZ A;  4CLC E;  2IWB A;  3HUM A;  2PD7 A;  3QP1 A;  2V1B A;  4ETZ A;  1FSW A;  1M6K A;  3F1P B;  2LB9 A;  2QYB A;  2QPN A;  3RXW A;  1VB6 A;  1F2K A;  1YLW A;  5AQA A;  2ZLY A;  3S1Y A;  4KG5 A;  1TDL A;  2PR5 A;  4P6Z S;  4ZJ1 A;  1QMF A;  1MWR A;  1KVM A;  3AGF A;  3TSG A;  5FL3 A;  1WYC A;  5DJT A;  3T1S A;  4GS9 B;  2BAS A;  5DFX A;  1S4S A;  5L10 A;  3BFD A;  5HX9 A;  4X1L A;  5HWV A;  1FSY A;  1W5D A;  1ZKJ A;  4BQM A;  3BEB A;  3E98 A;  5CRF A;  1XPB A;  1FOF A;  1NJ4 A;  5KSC A;  3GV9 A;  2HJE A;  1MXO A;  2WGW B;  4GHI A;  2WUQ A;  3H82 A;  4GZB A;  2X71 A;  4LEN A;  4FCF A;  4RX3 A;  3WRT A;  2GDN A;  2Y2N A;  5CTM A;  4ME4 A;  1XP4 A;  3DBA A;  4Y3I A;  4L9G A;  3PBO A;  2J3T D;  4QB8 A;  4IUK A;  4OVD A;  1CEF A;  4KUK A;  5HZH A;  1MKI A;  4JXS A;  4S2N C;  3C7U A;  3UE3 A;  1KDS A;  2O9A A;  5FQM A;  3NOP C;  1JWV A;  3HLB A;  4BLM A;  1BUL A;  4EUV A;  4OQ0 A;  1CJF A;  2XK1 A;  3P09 A;  5FQI A;  1K57 C;  5FAS A;  3MKF A;  4YFM A;  3HLC A;  4UQI M;  1Y28 A;  4PPR A;  3R4K A;  2Q0O A;  3BYD A;  4NXG A;  4O0P A;  1E4D A;  1TF1 A;  1W79 A;  2RL3 A;  1T1B A;  2XLN A;  3P7N A;  2JKT I;  3T4Q A;  2JKR I;  1GHP A;  4MN6 A;  4U0X A;  4QJG A;  1H8Z A;  3W4Q A;  3VOL A;  4MNR A;  4F3L B;  2WKQ A;  2Y2G A;  2ZC7 A;  2EWV A;  2EA9 A;  3KX0 X;  3LEQ A;  4DN0 A;  2HDS A;  5GLB A;  1PIO A;  1ES3 A;  1YLY A;  3OCN A;  1ERQ A;  3UO9 A;  1IFQ A;  3CUE A;  3G34 A;  4FUW A;  3E4Q A;  5EM1 A;  3FKV A;  5I5L A;  5TBM A;  1N9B A;  4UEY A;  4OLD A;  4EEP A;  3N7W A;  3BEC A;  3UE0 A;  4OPY A;  1N9N A;  1MBL A;  3UPO A;  3ZG5 A;  1CI9 A;  4BEN A;  4M3K A;  3IX3 A;  3LIE A;  1LI0 A;  3FC7 A;  2H28 A;  4R3J A;  4C75 A;  3DWK A;  4PHT A;  4PM7 A;  4CLC A;  5GL9 A;  1CI8 A;  3PAE A;  2DRW A;  3NOU C;  4JXW A;  4ZBE A;  4BWI A;  1LSV A;  3FPW A;  3FKW A;  1BYW A;  2W0N A;  5KIZ A;  4Y5F A;  4E3L A;  4XT2 A;  5CXW A;  3LIA A;  3T4O A;  1SCW A;  4L9F A;  2C5W B;  3TJZ C;  4P87 A;  1K6S A;  2ZC6 B;  4X55 A;  5JYO A;  1L3L A;  4K91 A;  5FI6 A;  3LY3 A;  2PYP A;  2WAF A;  5CEB A;  2PT7 A;  4Y15 A;  4ETX A;  1PWC A;  2I9V A;  2JN7 A;  3Q7V B;  3MF0 A;  3H7W A;  3H82 B;  3V3R A;  1MZU A;  4R6L A;  4BJP A;  2G2W A;  3FZC A;  4ZRR A;  5F1F A;  5GHY A;  2I72 A;  3IF6 A;  3PYP A;  5A90 A;  5F69 A;  4WMC D;  2PDR A;  4E3N A;  2QJ7 A;  4G3V A;  4HP9 A;  3ZFZ A;  4E3J A;  3ZNT A;  2Q9N A;  4I5S A;  1WE4 A;  3S7O A;  3LO7 A;  3NJA A;  3UME A;  2QZ6 A;  1GSW A;  4XUZ A;  4N1H A;  3DTM A;  2XSS A;  2EFU A;  1UWP X;  4NXF A;  5L2F A;  3DTK A;  4X25 A;  5DTT A;  1OTA A;  2XRO A;  3A0S A;  3T1X A;  4OQI A;  1C3B A;  1VHM A;  2L0W A;  2FH5 A;  1K56 D;  3V39 A;  2OWH A;  4R1G A;  4WEK A;  5FQJ A;  4Z1W A;  4LCM A;  4NKP A;  1MWS A;  1ONG A;  4DMZ A;  1LI9 A;  1K56 A;  4P6Z M;  5CGS A;  1YLP A;  3C7V A;  3LR3 A;  3E4O A;  1YKD A;  1XXM A;  4KQQ A;  4CJN A;  3MFD A;  3N8L A;  4H8R A;  5EVE A;  3ISG A;  1K57 A;  4HEF A;  3DAV A;  1ERO A;  4DE2 A;  3OLO A;  3T50 A;  4R0Q A;  3CAX A;  5TBM B;  5EE8 A;  4S2L A;  4B9O A;  3OPH A;  4RYE A;  3MXS A;  2OSU A;  4YWZ A;  4N9L A;  2ZMF A;  3F1O B;  2EX2 A;  3D4F A;  3Q7Z A;  3BFG A;  1FCN A;  3IXB A;  2EFX A;  3W8K A;  3CG5 A;  2XA7 S;  4Q0J A;  3C38 A;  2ZQC A;  3UB6 A;  4WEJ A;  2ZQD A;  3M6H A;  2ZMA A;  1IYP A;  3MQO A;  2P04 A;  4E04 A;  2K31 A;  1VEU B;  3G6O A;  4N92 A;  3LR4 A;  1FR6 A;  4DJ2 A;  3DW0 A;  1KE3 A;  1XFQ A;  4XT2 B;  2W1T B;  2X02 A;  4DKI A;  1NWZ A;  3UN7 A;  2WGV A;  4OP5 A;  4WM9 A;  2V0W A;  3T4S A;  4R4R A;  3LYX A;  3WS4 A;  1TEM A;  2EX8 A;  2XD5 A;  4L0L A;  3H7W B;  1OTE A;  1GA9 A;  1BZA A;  4JF6 A;  2VJW A;  2DCF A;  4PM5 A;  3E2L A;  4LPZ A;  4AFI A;  4OQG A;  5CEC A;  4WUJ A;  3UE6 A;  4EBP A;  4HJ4 A;  2Z6C A;  2WYX A; 
#chains in the Genus database with same CATH homology
 1ESI A;  4EV4 A;  1ZG4 A;  1HZO A;  2ZM8 A;  4OPZ A;  1KGE A;  2XGN A;  3AGD A;  1L0E A;  1RCJ A;  1RGZ A;  1PI5 A;  2IWB A;  2ZC3 B;  4OOY A;  4P0M A;  1HVB A;  1IYO A;  5GHX A;  1CEG A;  3HUM A;  4KZB A;  1H8Y A;  1FQG A;  4O7D A;  5F82 A;  3BRM A;  1FSW A;  1KE0 A;  1M6K A;  1O07 A;  4UA9 A;  5IHV A;  2QPN A;  4JKT A;  4KEN B;  1YQS A;  3SS3 A;  3WS0 A;  2E8I A;  3RXW A;  1KGF A;  3PBS A;  2Y91 A;  2J9O A;  1YLW A;  4N9K A;  5AQA A;  2RCX A;  2ZLY A;  4UHU A;  3S1Y A;  4KG5 A;  3N8S A;  5DF8 A;  1TDL A;  2Y55 A;  5GLA A;  1YLJ A;  1K4F A;  5DF7 A;  4MBF A;  4ZJ1 A;  1QMF A;  1MWR A;  1KVM A;  2ZM2 A;  3AGF A;  4JLF A;  1DJB A;  3TSG A;  2XR0 A;  1WYC A;  3DWZ A;  5FQ9 A;  4DXB A;  4XXR A;  3MXR A;  3A3E A;  3HLE A;  2A49 A;  3N8R A;  3OC2 A;  3IWQ A;  3ZCZ A;  1FR1 A;  1W8Y A;  1KDW A;  1KE4 A;  3OZH A;  5G18 A;  1ES2 A;  3BFD A;  5HX9 A;  2HPB A;  3N6I A;  2JCH A;  3N4I A;  4U3T A;  2H0Y A;  4FH4 A;  4JF5 A;  1FSY A;  5HAI A;  3WS1 A;  4WZ5 C;  1W5D A;  2Y2M A;  3FYZ A;  1ZKJ A;  4BQM A;  3BEB A;  3G2Z A;  5CRF A;  1GHM A;  5M18 A;  1XPB A;  1FOF A;  1NJ4 A;  3Q81 A;  5KSC A;  4DE3 A;  3GV9 A;  2EXB A;  1MXO A;  3IH9 A;  4S2O A;  2WGW B;  1ONH A;  1ESU A;  2WUQ A;  3OCL A;  4B88 A;  4GZB A;  2EX6 A;  3A3F A;  5A93 A;  2X71 A;  4RVA A;  4LEN A;  2EXA A;  3LCE A;  4FCF A;  3ZNY A;  4RX3 A;  5HFO A;  3WRT A;  3OPR A;  5M1A A;  3ZG0 A;  1K55 C;  2GDN A;  3GTC A;  2Y2N A;  5CTM A;  5AQB A;  1XP4 A;  4DXC A;  1ZC2 A;  2Y2L A;  4OOL A;  1BTL A;  2C6W B;  5E2F A;  3PBO A;  3Q1F A;  2HP9 A;  2XFS A;  1JTG A;  2H5S A;  4QB8 A;  2H10 A;  5FAO A;  4OVD A;  1K4E A;  1CEF A;  2J7V A;  2Y2K A;  3WRZ A;  4GNU A;  3IXH A;  3S22 A;  1MKI A;  4JXS A;  3VP1 A;  4S2K A;  4S2N C;  1EI5 A;  3HLF A;  3C7U A;  3UE3 A;  4JF4 A;  2HP6 A;  1I2S A;  1NYY A;  4X56 A;  3EQV A;  1KDS A;  3UDF A;  5FQM A;  2Y4A A;  3HVF A;  3VMA A;  1JWV A;  3HLB A;  4BLM A;  1BUL A;  3MZF A;  2HDR A;  4GB7 A;  5F1G A;  3C4O A;  4F94 A;  4OQ0 A;  2ZQ8 A;  1LHY A;  5FAQ A;  3NC8 A;  3OPL A;  2XK1 A;  3P09 A;  4FSF A;  3ZG8 B;  5EUA A;  5FQI A;  2HDU A;  3ZVT A;  1L0D A;  1K57 C;  4R23 A;  1NRF A;  5FAS A;  1HD8 A;  1N4O A;  2HDQ A;  5AQ9 A;  1VM1 A;  5FA7 A;  3MKF A;  1W8Q A;  3HLG A;  4YFM A;  4ZJ2 A;  3HLC A;  3CZD A;  2VGJ A;  4X6T A;  2ZC4 B;  1RGY A;  3M2J A;  1PZO A;  4Y0O A;  2JBF A;  1ES5 A;  4PPR A;  4KZ6 A;  5CGW A;  3VSL A;  3BYD A;  3HLW A;  3B3X A;  3PAG A;  2Q9M A;  1E4D A;  4ZTK A;  3A3I A;  3IF6 B;  5EVI A;  1W79 A;  3A3D A;  2RL3 A;  5FAT A;  4R4S A;  2XFT A;  2XLN A;  3FWL A;  4HBT A;  4LV3 A;  4BL3 A;  4LCL A;  3IHB A;  4IVK A;  1LLB A;  1BLH A;  5GLC A;  3PBN A;  5D3O A;  1XX2 A;  1TVF A;  3SH7 A;  1DJC A;  4UA6 A;  4WMC A;  5TFQ A;  4U0X A;  1GHP A;  1IKI A;  1M40 A;  4QJG A;  3SH8 A;  1H8Z A;  3W4Q A;  5CHU A;  3LY4 A;  4MNR A;  3GMW A;  4UA7 A;  2ZD8 A;  2QMI A;  4XUX A;  2V1Z A;  4PMA A;  1VQQ A;  3RXX A;  2Y2G A;  2ZC7 A;  2ZQA A;  5FI2 A;  4OPR A;  4QU3 A;  1PW8 A;  1U60 A;  4KG6 A;  3IWO A;  3ZDJ A;  1CK3 A;  2HDS A;  3HLD A;  3G35 A;  4X69 A;  1KGG A;  2ZJ9 A;  5GLB A;  1OME A;  1PIO A;  4Y7P A;  1ES3 A;  1YLY A;  4IVI A;  4IBX A;  3OCN A;  4UAA A;  1ERQ A;  1O7E A;  3UO9 A;  4E3M A;  4Y0T A;  4GD8 A;  5A91 A;  3IH8 A;  4E3K A;  3IF6 C;  1K55 A;  4FD8 A;  3V3S A;  1MY8 A;  3G34 A;  4KG2 A;  3ZGA B;  3WS2 A;  1J9M A;  5FQK A;  3HUN A;  5A92 A;  2JE5 A;  3FKV A;  1N9B A;  3WWX A;  1JTD A;  1NZO A;  1BUE A;  2X01 A;  5CED A;  4OLD A;  1E25 A;  3N7W A;  4S2N A;  3BEC A;  3UE0 A;  5HAP A;  4KZ7 A;  3C4P A;  4MBH A;  4OPY A;  5E2E A;  1YMS A;  2WAE A;  3G31 A;  3UE1 A;  2WGW A;  3Q07 A;  3GVB A;  1MBL A;  1L0F A;  3HUO A;  4S2I A;  3UPO A;  3IXD A;  3ZG5 A;  1PWG A;  2XH9 A;  1GCE A;  1CI9 A;  4BEN A;  1RP5 A;  4M3K A;  3JYI A;  2P9V B;  5E2G A;  1LI0 A;  4OQH A;  1H5X A;  3MBZ A;  5FDH A;  4R3J A;  4C75 A;  3DWK A;  4GD6 A;  2DNS A;  4PM7 A;  3UDI A;  5U47 A;  4MLL A;  3IT9 A;  4OH0 A;  5GL9 A;  3NDG A;  1CI8 A;  3PAE A;  2J9P A;  3OPP A;  2DRW A;  2VGK A;  3Q82 A;  3MZE A;  5FQQ A;  1IEM A;  4JXW A;  5FAP A;  4ZBE A;  3TOI A;  3VP4 A;  3FKW A;  3BM6 A;  4X53 A;  4QY6 A;  4JPM A;  1JWZ A;  3QNC A;  1EWZ A;  4OOM A;  5GLD A;  4E3L A;  5CXW A;  5HAR A;  1SCW A;  1BLC A;  3G4P A;  4QHC A;  2C5W B;  3AGE A;  2R9X A;  4FH2 A;  4B4X A;  4R3B A;  4P87 A;  4JBF A;  4OON A;  1XA7 A;  1K6S A;  4OKP A;  3A3J A;  1SDE A;  5EPH A;  1IKG A;  2ZC6 B;  4X55 A;  1K6R A;  3VSK A;  4DDY A;  4E3I A;  5JYO A;  4EQI A;  4E6X A;  2Y2Q A;  1FCM A;  4K91 A;  1NXY A;  2Z2M B;  5FI6 A;  3M6B A;  3IXG A;  3LY3 A;  2WAF A;  4PM9 A;  5CEB A;  4B4Z A;  2PBY A;  4EBN A;  1PWC A;  5F83 A;  3NCK A;  3O86 A;  4NK3 A;  1BT5 A;  4BD0 A;  2P74 A;  3Q7V B;  1DY6 A;  3VP2 A;  1SKF A;  1E3U A;  3BLS A;  3GRJ A;  3V3R A;  5EVI D;  2FFY A;  3ZG9 B;  2V20 A;  4BJP A;  2G2W A;  4GKU A;  2Y2O A;  3FZC A;  5F1F A;  5E2H A;  3ZHH A;  1ES4 A;  3QHY A;  5GHY A;  2WKI A;  5CHJ A;  2I72 A;  3IF6 A;  5A90 A;  2XD1 A;  4WMC D;  5CTN A;  4HBU A;  4E3N A;  2XEP A;  1MPL A;  4EBL A;  1DJA A;  2WZX A;  4D2O A;  1NYM A;  1K54 C;  3ITA A;  3VP3 A;  3ZFZ A;  4E3J A;  3ZNT A;  4KQO A;  1I5Q A;  2Q9N A;  3O3V A;  5DVA A;  4P6B A;  2HP5 A;  3UNW A;  3C5A A;  1WE4 A;  4KZ8 A;  2EX9 A;  4OP8 A;  4ID4 A;  3IQA A;  1BLP A;  3LO7 A;  2Z2L B;  4WYY A;  4WZ5 A;  1YLT A;  2QZ6 A;  2ZC5 B;  4XUZ A;  4N1H A;  3DTM A;  1G6A A;  3IF5 A;  4A5R A;  2EFU A;  3HBR A;  2H0T A;  1KVL A;  1AXB A;  1Q2Q A;  3VOZ A;  1JVJ A;  1LL9 A;  2J8Y A;  5L2F A;  1Y54 A;  5KSH A;  2WK0 A;  5DTT A;  3SS4 A;  1L2S A;  2IWD A;  4KZ4 A;  1XGI A;  4OPQ A;  4OQI A;  4DE0 A;  1C3B A;  3MZD A;  3PTE A;  4YIN A;  2Y59 A;  1K25 A;  5AQ7 A;  2A3U A;  1K56 D;  1S6R A;  2IWC A;  3V39 A;  5BOH A;  2CC1 A;  4JXV A;  2Y2I A;  4R1G A;  1BSG A;  4WEK A;  5FQJ A;  5FI7 A;  2UWX A;  5DF9 A;  5EVI B;  4DF6 A;  4LCM A;  4K0X A;  3HRE A;  2B5R A;  1XA1 A;  1K38 A;  5CHM A;  1MWS A;  1YT4 A;  5DTS A;  3S4X A;  1ONG A;  3UY6 A;  2V2F F;  1LI9 A;  2P9V A;  2XDM A;  1XKZ A;  3SOI A;  1K56 A;  4PM8 A;  4KZ5 A;  5CGS A;  3QNB A;  4ZJ3 A;  1YLP A;  4JXG A;  3C7V A;  1XXM A;  5CER A;  4KQQ A;  4S2M A;  4CJN A;  4N1X A;  1YMX A;  3BLM A;  3MFD A;  3N8L A;  1NZU A;  1GHI A;  4H8R A;  3ZVW A;  4ZDX A;  1NY0 A;  1LL5 A;  1IYS A;  4KZ9 A;  3VP0 A;  3ISG A;  3RJU A;  3GQZ A;  2ZM0 A;  1FCO A;  5EVI C;  3LEZ A;  5TGF A;  1K57 A;  2BG1 A;  4HEF A;  4DDS A;  3G2Y A;  1TDG A;  3M2K A;  2FFF B;  1ERO A;  1MWU A;  1S0W A;  1PI4 A;  3I7J A;  4DE2 A;  4C3Q A;  3MKE A;  4S2J A;  3GSG A;  4R0Q A;  4QD4 A;  2PU4 A;  1MWT A;  2WAD A;  5EE8 A;  4S2L A;  3NBL A;  4Y0U A;  3EQU A;  4KZA A;  1K54 A;  3OPH A;  1JWP A;  2G2U A;  3GR2 A;  2XQZ A;  4RA7 A;  1E3U D;  3BFC A;  4RYE A;  3SS5 A;  4GOG A;  4E3O A;  4WBG A;  3MXS A;  3CJM A;  5KZH A;  1QME A;  2OSU A;  4MEZ A;  4N9L A;  3W4P A;  3Q7V A;  4CPK A;  5HL1 A;  4HES A;  3WS5 A;  2EX2 A;  3D4F A;  2Y2H A;  1PYY A;  3BFG A;  1FCN A;  3Q7Z A;  4WZ4 A;  3PBR A;  4EUZ A;  5FSR A;  3IXB A;  5HAQ A;  2EFX A;  2Y2P A;  4DE1 A;  4GDN A;  3W8K A;  3CG5 A;  1GA0 A;  3NIA A;  4BD1 A;  1L0G A;  4GDB A;  3ITB A;  3NY4 A;  1ZG6 A;  5I94 A;  1Q2P A;  4X68 A;  2ZQ9 A;  5EEC A;  5JYP A;  4P85 A;  2ZQC A;  3UDX A;  4WEJ A;  1Z6F A;  2OV5 A;  1W7F A;  3NDE A;  2BLS A;  3IWI A;  2ZQD A;  3M6H A;  2ZMA A;  4KZ3 A;  4OLG A;  4PM6 A;  1IYP A;  4WEL A;  4LV0 A;  4QY5 A;  2WZZ A;  3IHA A;  1YLZ A;  3G32 A;  4GN2 A;  4LV1 A;  1G68 A;  5E43 A;  3PBQ A;  2OLV A;  4BL2 A;  2PU2 A;  1IEL A;  5CGX A;  4N92 A;  4NET A;  1IYQ A;  1FR6 A;  4E6W A;  2Y2J A;  3DW0 A;  1PW1 A;  1KE3 A;  1YM1 A;  3V5M A;  3V50 A;  5TR7 A;  4IED A;  4MBK A;  4U0T A;  5EOE A;  3TG9 A;  2X02 A;  5EOO A;  1I2W A;  1PZP A;  3P98 A;  4DKI A;  4C6Y A;  3W4O A;  3BFF A;  3UN7 A;  2WGV A;  3SH9 A;  4OP5 A;  5M19 A;  2JC7 A;  4WM9 A;  3UPN A;  3VOY A;  3O87 A;  4DRT A;  1BLS A;  4R4R A;  5GHZ A;  2WGI A;  3WS4 A;  2ZQ7 A;  2WKH A;  1TEM A;  2EX8 A;  2XD5 A;  4L0L A;  4ZAM A;  3UPP A;  4S2P A;  3VFF A;  1GA9 A;  1BZA A;  2WKE A;  5J8X A;  4JF6 A;  4LV2 A;  5EVL A;  2DCF A;  5HW3 A;  1HTZ A;  3CMZ A;  1WYB A;  3FV7 A;  3G30 A;  4PM5 A;  4Z9Q A;  3E2L A;  1XGJ A;  3HL9 A;  3BFE A;  1ALQ A;  4IBR A;  2R9W A;  4EWF A;  4K0W A;  3VFH A;  1SDN A;  3ZG7 B;  2XF3 A;  4KQR A;  4OQG A;  5CEC A;  4EBP A;  3NI9 A;  2OLU A;  3O88 A;  5DTK A;  3E2K A;  5KMW A;  2WYX A;  3PBT A;  1SHV A;  1PWD A;  4Q8I A;  1ERM A;  4RX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...