1DJBA

Structure of beta-lactamase precursor, s70a mutant, at 298k
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYAATSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and kinetics of the beta-lactamase mutants S70A and K73H from Staphylococcus aureus PC1.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
total genus 96
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1996-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1djbA00
3ZHHA 1TDGA 2Y2NA 3GVBA 3S1YA 3SS3A 4LV3A 4BLMA 2J7VA 2Y2OA 4MBKA 5JYPA 3E2LA 3ZG5A 3HLEA 3BYDA 2IWCA 3G32A 3I7JA 4PM7A 4QU3A 2OLUA 2OLVA 2R9WA 3DW0A 4WM9A 2QZ6A 3ZNYA 4U3TA 3WS2A 4S2LA 1DJAA 5F82A 5A92A 3IXDA 4BD1A 2Y2QA 5JYOA 2EX2A 5FAPA 1KE3A 3ZG8B 5E2EA 2EFUA 2WGVA 1KVMA 2H10A 2ZD8A 3VSKA 4WEKA 3W4QA 3VP0A 3G2YA 4OH0A 4OLGA 3G4PA 5HAIA 5GHXA 5HL1A 2WZZA 5U47A 4A5RA 3A3IA 5FI6A 5CERA 3WS0A 4R23A 1KGFA 4OPYA 4HBUA 1K38A 4OPRA 2Q9NA 3Q81A 3BEBA 4KG2A 3ZVWA 3M2JA 1PI5A 4S2NA 3UE1A 1ES4A 2Y2PA 5E43A 1G68A 1M40A 3IWQA 4E3OA 2Y91A 3RJUA 3HLBA 3ZNTA 2H0YA 3O3VA 1XA7A 4Q8IA 1HVBA 1KVLA 3QHYA 4P6BA 4Y0TA 4YFMA 2ZC3B 2JBFA 3PBRA 3VMAA 1FSWA 3G35A 4R1GA 1L0GA 4EUZA 3N8LA 4IBXA 5E2HA 2Y2IA 4HESA 4K0WA 4R3JA 2EXBA 5FDHA 3VP2A 4JBFA 1O7EA 2BLSA 2DRWA 5FQ9A 2V1ZA 3BFEA 2G2WA 3UDFA 5DTTA 5EVID 4GDBA 3OZHA 3TSGA 3SH8A 5F83A 1KGGA 1SKFA 3ZG7B 2WYXA 4KZ7A 2ZJ9A 4JXWA 2J8YA 3FYZA 4X6TA 5EUAA 3BLSA 2HP9A 3N7WA 5CTMA 5F1GA 4FH2A 4UA6A 1E3UA 3WRZA 1EI5A 4D2OA 2WGWA 1EWZA 2HPBA 4EBPA 1N9BA 4XUZA 1ES2A 4KZAA 3P98A 2ZQDA 3PTEA 1FCMA 2XLNA 1FCNA 1BT5A 2XDMA 4XXRA 4CPKA 2HP6A 2PBYA 1Y54A 3LCEA 5M18A 3UDIA 3B3XA 3OPLA 2QMIA 3FV7A 4DRTA 3UNWA 2PU2A 2HDSA 1W8QA 2Y55A 4DDYA 3IWOA 3NDGA 4UA9A 3M6HA 3Q7VB 4EQIA 3Q07A 2XD5A 2Y59A 1DJBA 1BULA 2Z2MB 4X55A 3AGEA 4LV0A 1MWRA 5TFQA 1TEMA 2ZQ7A 5BOHA 1L0FA 2DNSA 1JTGA 3MZDA 1YLTA 3MFDA 1IYOA 4K0XA 1OMEA 3NY4A 3E2KA 4JXVA 4YINA 1GCEA 4OQHA 2XQZA 3ISGA 4S2OA 1ZC2A 3UPPA 3A3FA 3IWIA 1JTDA 1LI9A 4LCLA 4XUXA 5CECA 4H8RA 1QMEA 1WYBA 5KSCA 4RYEA 2P9VB 2J9OA 4GN2A 5CRFA 4E3JA 1QMFA 5FQJA 1K4EA 2JE5A 1YMXA 4OOMA 4U0TA 2ZM0A 4MLLA 1K56D 5CGSA 3Q1FA 1SHVA 1BSGA 3VFHA 2QPNA 3HLCA 3PAEA 5FI7A 5CGWA 3IF6A 3UPNA 4BL2A 1XXMA 3NI9A 1IELA 1FR1A 1FCOA 4GKUA 3VP4A 3HLWA 4S2PA 3OC2A 3BECA 3FZCA 1PYYA 4GNUA 1PIOA 4R0QA 3D4FA 2XH9A 4X68A 2ZMAA 1YLYA 3LY3A 4PM6A 1SDNA 3IXBA 1NY0A 3OPRA 4WELA 3HUMA 4Y0UA 1NXYA 3ZFZA 3LEZA 1YQSA 2Y2LA 3PBQA 1YLZA 2CC1A 1CEFA 1ESUA 3ZCZA 5GLDA 1WE4A 1IYPA 1K54A 1PZPA 4E3MA 1K4FA 1HZOA 1GA9A 4KQRA 1LLBA 3HREA 5GHYA 1C3BA 1MWTA 2FFFB 4C6YA 2V20A 5EVIC 4Y0OA 2G2UA 4JPMA 3IHBA 5TGFA 4BL3A 3W4PA 4B88A 3QNCA 4N92A 4IVKA 4JLFA 5FQIA 2OV5A 4JKTA 5EVIB 5CHJA 2JCHA 3ZGAB 3HLGA 4R4SA 1KDWA 2ZM2A 1BTLA 3CZDA 5FAOA 3UE0A 1CI8A 4P87A 3OCNA 3G31A 5CEDA 3UPOA 1HTZA 4QB8A 1GA0A 1JWPA 1PWDA 5FI2A 4LV1A 1W5DA 1XA1A 1E4DA 3GRJA 3N8SA 5GHZA 2A3UA 1KE4A 2JC7A 4N9LA 5EECA 1K57C 4ZJ1A 1LL5A 4UA7A 4Y7PA 1IYSA 1PWGA 3MBZA 3DTMA 4FD8A 3BFCA 3CJMA 5AQ9A 3P09A 2EX8A 5AQAA 1YT4A 5E2FA 1DJCA 4OLDA 4OQGA 3M2KA 5TR7A 1KE0A 2Y2HA 1PI4A 5AQBA 1W79A 3Q82A 3SH7A 3HVFA 2XR0A 3GTCA 2WKHA 3HBRA 4DXCA 3W4OA 1IKGA 4BJPA 4NETA 3SOIA 4B4ZA 1YLJA 1GHMA 3ZDJA 2WAFA 5KZHA 3FKVA 4PM9A 1K55A 4ZJ2A 4Z9QA 1J9MA 4HBTA 3EQVA 2HDUA 2X01A 3UO9A 1I2WA 2ZQ9A 4GD6A 4HEFA 3G30A 2EX6A 1MWUA 4B4XA 4KZ3A 4N9KA 1PW1A 2XEPA 4LCMA 5I94A 3NCKA 3ITBA 3RXXA 4LENA 4EBLA 5M19A 1GHPA 2E8IA 4KZ4A 4JXGA 1S6RA 4E3KA 5HFOA 2XFTA 4WMCA 5DVAA 1ONGA 3BRMA 5EVLA 2EXAA 5AQ7A 4P85A 3C5AA 1ZKJA 2VGKA 2FFYA 2Y2JA 3O86A 4MEZA 4MBFA 5CGXA 4WZ5C 1XX2A 2RCXA 3MZFA 2HDQA 3Q7VA 3ITAA 1IEMA 4E3IA 2GDNA 3BFDA 1FSYA 3V3SA 4CJNA 1TVFA 3VOYA 1K6SA 3SH9A 4M3KA 2WKIA 1YLWA 4S2JA 4RX3A 4JF5A 4WEJA 5DF8A 3HLFA 5GLCA 4OP5A 2Q9MA 5FQMA 4KZBA 4E3NA 4NK3A 1ZG6A 1YM1A 3FWLA 3UE3A 2H0TA 2A49A 3PBOA 4EBNA 5HW3A 3C7UA 3O87A 4E6WA 3IF6C 4WYYA 4ZTKA 5EOOA 1M6KA 5CHUA 4OQ0A 4IVIA 4ZJ3A 1CI9A 1ES3A 5GL9A 4KZ5A 2C5WB 3N6IA 4GD8A 2WADA 2ZC7A 2P74A 3GQZA 3WS1A 1E3UD 2WUQA 4JXSA 4KENB 1I2SA 4QD4A 3RXWA 4N1HA 4OP8A 3V3RA 3BFGA 3V39A 2X02A 1XP4A 1W7FA 4PM5A 3VSLA 3NC8A 3VOZA 2HP5A 2J9PA 5CHMA 5EPHA 3CG5A 1ERMA 2WAEA 5DF9A 1VM1A 1RGZA 4RVAA 4ZAMA 5D3OA 3VP3A 1K57A 1BLHA 2WK0A 2ZQ8A 5FATA 3IXHA 1H8ZA 4JF4A 1RGYA 3IH8A 2H5SA 1BUEA 4BENA 4UAAA 1YLPA 5M1AA 1RCJA 1WYCA 3JYIA 5DF7A 2WZXA 4GDNA 3HLDA 4GZBA 1KDSA 3ZG0A 4PMAA 4IEDA 2XK1A 4MBHA 4ZBEA 4KG5A 3IXGA 3PBSA 3BLMA 4OPZA 4QHCA 1EROA 2Y2KA 2OSUA 1Q2QA 2WGWB 2ZQAA 4OONA 4DE3A 4X53A 2DCFA 4QJGA 2PU4A 3OCLA 3CMZA 3MXRA 2XGNA 5HAQA 1U60A 4PM8A 3QNBA 5EVIA 1K54C 2X71A 4KZ8A 1JWZA 3GV9A 3PAGA 4RA7A 4F94A 1S0WA 3N4IA 1L2SA 2Y2MA 5GLAA 4O7DA 5KMWA 3DWZA 1HD8A 3IF5A 4LV2A 1MKIA 1E25A 2I72A 4X69A 4L0LA 1L0DA 2V2FF 4WZ5A 3Q7ZA 1N4OA 4S2NC 3TOIA 5FQQA 2XFSA 1NYMA 4DE0A 5CTNA 4WBGA 5DTKA 3FKWA 3IT9A 1XPBA 4FSFA 4MNRA 3AGFA 5GLBA 4IBRA 3C7VA 4E3LA 2UWXA 3AGDA 1K55C 2EFXA 1IKIA 3MKEA 4KG6A 1LI0A 3SS4A 4RX2A 1ZG4A 3IF6B 3IHAA 1TDLA 2Z2LB 1IYQA 4OQIA 4R4RA 3UDXA 4DF6A 1K25A 1SCWA 2P9VA 2ZC4B 4FH4A 3WS4A 5HARA 4DDSA 1JVJA 2B5RA 3NBLA 5KSHA 1MXOA 2C6WB 1LL9A 3HL9A 1PZOA 1BLPA 3PBNA 2XD1A 4P0MA 1K56A 3M6BA 4N1XA 2RL3A 5E2GA 2Y2GA 5FQKA 3SS5A 1BZAA 4ID4A 4GB7A 5FASA 3VP1A 4C3QA 1PW8A 4ZDXA 1ALQA 1Z6FA 4OOLA 4WZ4A 1K6RA 2HDRA 2Y4AA 4OOYA 2IWBA 4U0XA 3V50A 3A3EA 3OPPA 4S2IA 3C4OA 4GOGA 4E6XA 4KZ9A 1ERQA 3UY6A 1NZUA 4S2KA 3LO7A 1BLCA 2WKEA 1MPLA 2R9XA 1NZOA 5F1FA 1CK3A 1KGEA 3PBTA 4BD0A 2ZLYA 1GHIA 4JF6A 3VFFA 3ZVTA 4EV4A 4X56A 3LY4A 4EWFA 3N8RA 2ZM8A 1Q2PA 2EX9A 1XKZA 3DWKA 5DTSA 4FCFA 1SDEA 4S2MA 5A91A 1MBLA 3ZG9B 4DXBA 5CEBA 3UN7A 4KZ6A 3NDEA 1CEGA 5FA7A 1PWCA 4UHUA 3GR2A 1NJ4A 1DY6A 1FOFA 1I5QA 5A90A 4PPRA 1JWVA 3IH9A 3NIAA 4R3BA 2IWDA 1H5XA 1NYYA 3BFFA 5IHVA 3S22A 4QY5A 3A3JA 5A93A 5J8XA 3O88A 1ES5A 1LHYA 3MKFA 1O07A 4BQMA 1H8YA 3WRTA 5FAQA 4DE2A 4QY6A 1RP5A 3BM6A 5CXWA 3W8KA 3WS5A 2ZQCA 1ESIA 1ONHA 3HUOA 5FSRA 4OVDA 3EQUA 1L0EA 4OPQA 5L2FA 3MXSA 1VQQA 1NRFA 1XGIA 4WMCD 1FR6A 3A3DA 3V5MA 4DKIA 1MWSA 4K91A 3OPHA 2ZC5B 2WGIA 3G2ZA 5EE8A 4KQQA 5EOEA 5HAPA 2VGJA 1AXBA 3GSGA 2BG1A 3GMWA 4OKPA 5HX9A 1FQGA 2ZC6B 3S4XA 1MY8A 4KQOA 1W8YA 3HUNA 3TG9A 1BLSA 3MZEA 1YMSA 3IQAA 2XF3A 1G6AA 3C4PA 3G34A 5G18A 4C75A 1XGJA 3WWXA 4DE1A
chains in the Genus database with same CATH superfamily
3PYPA 4JGRA 5JYPA 4LV3A 4MBKA 2M7UA 3G32A 3I7JA 4WM9A 3ZNYA 4S2LA 5A92A 2Y2QA 2EX2A 3ICYA 5DFXA 2WGVA 2H10A 1S4RA 4LLOB 3A0RA 4OH0A 3G4PA 5HL1A 5GHXA 3CITA 4A5RA 3S7PA 3A3IA 3WS0A 4R23A 4HBUA 4OPRA 2Q9NA 4DJ3A 2GNXA 1OTAA 3BEBA 4KG2A 2K2NA 2E8JA 3ZNTA 2H0YA 1KVLA 3KSGA 3E4QA 3VMAA 3VP2A 2Y2IA 4R3JA 2D01A 2QJ5A 2BLSA 3UDFA 1TF1A 5EVID 3OZHA 5F83A 1T1AA 5IU1A 2WYXA 2ZJ9A 3H7WB 2J8YA 5F1GA 3IX4A 3BLSA 4UA6A 3H82A 2WGWA 4FUWA 1N9BA 5TBMB 4LRZE 2ZQDA 2XLNA 4CPKA 1MZUA 1IFQA 3T1QB 2Y79A 4DRTA 2JKTM 4CLCC 3NDGA 3M6HA 3E0YA 2Y59A 1DJBA 4WL9A 1TEMA 2ZQ7A 3V67A 1NRJA 3CUEC 1YLTA 1ZTUA 2VJWA 2W3FA 4OQHA 2XQZA 2J3WA 3ISGA 4BBUA 1TS7A 4S2OA 1ZC2A 3UPPA 3IWIA 1JTDA 3TJZC 4LCLA 5FL3A 1SKOA 5CECA 2J3TD 1WYBA 3H9WA 2J9OA 4GN2A 4I3JA 4E3JA 4OOMA 4MLLA 5CGSA 1NLYA 3HLCA 5CGWA 3IF6A 3UPNA 4GKUA 1FCOA 1WA9A 1PYYA 4GNUA 3MQQA 4R0QA 1GSVA 3LY3A 1VETB 4IUHA 1ODVA 1OTDA 2A24B 4PAUA 1YLZA 5GLDA 1MC0A 5J3WA 4E3MA 1K4FA 4KQRA 1C3BA 3C8CA 4C6YA 4Y0OA 3IHBA 4BL3A 3W4PA 3QP8A 3QNCA 4IVKA 4JLFA 5FQIA 2OV5A 4JKTA 2P04A 1CI8A 3UPOA 1PWDA 2KX6A 1YPRA 1A0KA 2O9AA 1K57C 3T4KA 4CLCD 5AVFA 2W1RA 4UA7A 3SW1A 3MBZA 1PWGA 1N9LA 3BFCA 3P09A 5AQAA 1YT4A 4WN5A 4OLDA 5TR7A 2D02A 2XRNA 1PI4A 3CLOA 3HVFA 1NLZA 2HZ5A 3ULFA 3LIAA 3IS2B 5HD3A 4NETA 3R7WA 3SOIA 5IT5A 1YLJA 2VK3A 2CMNA 1J9MA 2W3GA 2HDUA 4NXFA 1MWUA 2LB9A 4KZ3A 2YKFA 2XEPA 3NCKA 4FTXA 4JXGA 4D60A 1ONGA 5EVLA 2VGKA 2Y2JA 5CGXA 3Q7VA 2RCXA 4LPZA 1IEMA 3V3SA 4S2JA 5DF8A 4R6LA 1D7EA 5GLCA 2L4RA 1Y28A 1S4SA 4NK3A 1YM1A 2H0TA 4G3KA 4LRYC 3BWLA 4EXOA 3IF6C 1OTBA 5EOOA 1H8MA 4OQ0A 3UMDA 1TS8A 4JGPA 1ACFA 3WS1A 4KENB 3RXWA 4EESA 4EW7A 4N1HA 5EM1A 3NC8A 2HP5A 3VE3A 4I3IA 5EPHA 2V1AA 3CG5A 2WAEA 2JKRM 4RVAA 1BLHA 2ZQ8A 4MN7A 4G3WA 2H5SA 5M1AA 2WZXA 2VEAA 1KDSA 3U4LP 3ZG0A 3IXGA 3LYXA 3BLMA 4OPZA 2ZQAA 2PU4A 3MXRA 2J3TC 2XGNA 4HOIA 1VEUB 3FPWA 1T1CA 4PM8A 1OTEA 4O0PA 3F1OB 1S0WA 3N4IA 3EGDC 4X25A 1HD8A 1E25A 2I72A 1W63Q 3VV4A 1N4OA 4S2NC 3TOIA 2ZOIA 1F2KA 2XFSA 1P9WA 2DMWA 1VHMA 1S1ZA 5HL6A 3IT9A 1XPBA 3NOPC 3VOLA 5GLBA 2UWXA 1K55C 4PM5A 4RX2A 4DF6A 4OQIA 3UDXA 2VV7A 2PAVP 1K25A 1SCWA 3LIEA 2EA9A 4FH4A 5HPFA 5KSHA 4EEPA 3HL9A 3P7NA 4P0MA 4Y2FA 2OWJA 2Y2GA 2W3EA 5FASA 5HZHA 1FIKA 1PW8A 1Z6FA 4WZ4A 4EU0A 3V50A 3A3EA 3RFBA 4NXGA 1ERQA 5TBMA 3UY6A 3LO7A 1MPLA 2R9XA 2ZLYA 3ZVTA 4GW9A 4X56A 5DKLA 5C5KA 2EX9A 3ZG9B 1SDEA 4DXBA 3NDEA 4F3LB 2B95A 1NJ4A 5HDCA 1I5QA 3NIAA 1H5XA 1NYYA 3BFFA 3S22A 4QY5A 3A3JA 5A93A 3EEHA 3SZTA 4DN0A 1P9RA 1ES5A 3MKFA 1O07A 2B02A 3B33A 3WRTA 3BM6A 1ESIA 2PBDP 3EQUA 3MXSA 3TRCA 1XFNA 3OPHA 3PR6A 5HAPA 2VGJA 2BG1A 5HX9A 3S4XA 2JN7A 3HUNA 3MZEA 1YMSA 4GS9A 3T4OA 1S1YA 1TS0A 1VETA 5G18A 3WWXA 4HY8A 3ZHHA 5L10A 1TDGA 1OJGA 4BLMA 4UQIM 3BYDA 1VB6A 2IWCA 4PM7A 5AVEA 3BY8A 2OLVA 2R9WA 3F1PA 4EETB 2HJ9C 1T1BA 3D9YA 2WKQA 1MKMA 4HI4A 3T1SA 4CLCA 1T19A 3G2YA 5TJJA 2W1TA 4HJ3A 3LR4A 2IA2A 3NOTC 4NEED 1LT0A 5FI6A 5CERA 3CUEA 3K2NA 4OPYA 1K38A 2KDKA 1PI5A 3T50A 2Y2PA 4E04A 1M40A 2Y91A 5MC7A 4EUVA 3QHYA 4YFMA 2JBFA 1FSWA 3IS2A 4IBXA 1N9OA 1G6OA 2DRWA 3GDIA 2B18A 2VKSA 2V1ZA 2G2WA 4GDBA 3TSGA 4KZ7A 4JXWA 3FYZA 5CTMA 1EI5A 1EWZA 1ES2A 3P98A 1FCNA 3B47A 2HP6A 2PBYA 2W0NA 4HQAA 1Y54A 4I3AA 2KLIA 3UDIA 3B3XA 3OPLA 2QMIA 4RQ9A 1W8QA 2Y55A 3IWOA 3Q7VB 2BASA 2Z2MB 3T4SA 3AGEA 1MWRA 2JKTI 1L0FA 2DNSA 1GCEA 2MJ6A 3LUQA 4XUXA 1P0ZA 3QP6A 4H8RA 1S67L 4NKPA 3L7HA 2P9VB 1T18A 2VA0A 5CRFA 1QMFA 4U0TA 2ZM0A 4GJ4A 3DTKA 3EEAA 1SHVA 4BBVA 1XXMA 5EV0A 1FR1A 3EOIA 4KQDA 3VP4A 3BECA 3BQAA 3FZCA 3DTIA 4KUKA 3UE6A 4WELA 3LEZA 4G3VA 3PBQA 1CEFA 3CAXA 2V0WA 1WE4A 1K54A 1PZPA 4II7A 1HZOA 2M7VA 3CWFA 5EVIC 5TGFA 4B88A 4F3LA 5CHJA 3HLGA 4R4SA 1KDWA 5FAOA 4P87A 3ZQ5A 5CEDA 4R38A 4QB8A 1GA0A 1JWPA 4UQIS 3LIBA 1LL5A 2M1CA 1D06A 1XJ6A 4L9EA 1W63M 3EWKA 2EX8A 4P6ZS 3M2KA 2HGVA 1H0MA 5AQBA 1W79A 2P7JA 3SH7A 3A0SA 1IKGA 4BJPA 1V9YA 1GHMA 2UV0E 2WAFA 3FKVA 1K55A 3OOVA 3CPTB 3QP2A 1I2WA 4HEFA 4N9KA 3UB5P 3H82B 4P6ZM 4EBLA 4KUOA 5DVAA 4WMCA 3C5AA 1ZKJA 2FFYA 4O01A 3UB7A 3NHQA 5DJUA 2HDQA 3T4LA 4AFIA 3BFDA 4UEYA 5CX7A 2WKIA 3IX3A 1NWZA 3HLFA 2Q9MA 1HLUP 4HJ6A 3PBOA 1YSQA 5HW3A 2PYRA 3L9KA 1G5UA 4IVIA 1CI9A 2O9CA 2WADA 2P74A 5A8BA 3BY9A 1I2SA 4IJGA 3KYQA 2XA7S 3GECA 2PDRA 3BFGA 3VSLA 4ETZA 2GJ3A 3VOZA 2J9PA 1DRMA 5DF9A 5D3OA 1K57A 1OJ5A 4BENA 2KOIA 1WYCA 4PMAA 4IEDA 2XK1A 1EROA 2OSUA 2XA7M 2G7UA 1OT9A 4OONA 5F68A 1EW0A 1UGUA 5EVIA 2V0UA 4KZ8A 3GV9A 4RA7A 4F94A 5KMWA 4LV2A 2W1TB 1MKIA 4L0LA 5L07A 4WZ5A 3Q7ZA 3TW8A 1NYMA 4WBGA 3KSIA 4MNRA 3AGFA 4IBRA 3C7VA 4E3LA 3QP5A 3SS4A 3MKEA 1IKIA 1ZG4A 2AVXA 1TDLA 4H6JA 3LFVA 4XT2A 5HSQA 3WS4A 5HARA 1JVJA 3S7OA 5L8MA 2C6WB 1PZOA 4MMNA 1CQAA 2XD1A 3O5YA 5FQKA 4GB7A 3VP1A 4ZDXA 1ALQA 4OOLA 1K6RA 2HDRA 2Y4AA 3KX0X 4DJ2A 2ZL1B 4Z1WA 1PFLA 4I39A 5FDSA 3MXQA 2WKEA 2A24A 3PBTA 2JHEA 3VFFA 4BMWA 1Q2PA 5A91A 5CEBA 2L0WA 3OLOA 4KZ6A 4NG2A 1DY6A 3QP4A 3T1XA 2NUPC 4LGWA 3MJQA 4ARZA 1LHYA 3JPUA 4QY6A 1RP5A 5DKKA 3WS5A 2VV6A 5L2FA 3LIFA 1NRFA 4DKIA 3C2WA 2WGIA 3G2ZA 3GMWA 5DFYA 1FQGA 2ZC6B 1MY8A 2EWWA 1X0OA 4C75A 4DE1A 3GVBA 4ESPA 3S1YA 3IBJA 2J7VA 4EERA 5HDDA 4QU3A 2BTFP 2Q0OA 3DW0A 2QZ6A 4U3TA 3WS2A 5F82A 4CQHA 3IX8A 2ZD8A 3F1OA 3VSKA 4WEKA 1V9ZA 4OLGA 5HAIA 2PT7A 5U47A 4MDZA 1KGFA 3C38A 4HNBA 1DP8A 3Q81A 3KSFA 3ZVWA 1YAXA 1G68A 1F5MA 1F98A 3HLBA 1XA7A 1HVBA 4P6BA 3BW6A 3G35A 1L0GA 4EUZA 3N8LA 5E2HA 4HESA 4K0WA 2EXBA 4JBFA 1O7EA 2OOLA 5FQ9A 1FILA 5DTTA 1SKFA 1OT6A 4X6TA 2QHKA 5EUAA 3N7WA 2HP9A 1E3UA 5J7EA 4KZAA 3PTEA 2VZWA 2XDMA 4XXRA 3LCEA 3S7QA 3FV7A 2PU2A 3LI9A 2R78A 4EQIA 2XD5A 1VEUA 4LV0A 3F1NA 5BOHA 1GSWA 3MZDA 1JTGA 2QJ7A 4R3AA 4YINA 3A3FA 5FEGA 3G6OA 5KSCA 4Q0HA 3K3CA 3Q1FA 1BSGA 3VFHA 5FI7A 3PAEA 4X1MA 4FOFA 2XSSA 2ZOHA 3OC2A 1OTIA 1PIOA 1YLYA 3LEQA 2ZL1A 4PM6A 4WF0A 3IXBA 1NY0A 3OPRA 2QYBA 3HUMA 2W27A 4Y0UA 1NXYA 2CC1A 3ZCZA 1GA9A 1LLBA 3HREA 4NXBA 2V20A 1N9NA 5AJGA 3HCYA 5EVIB 3FPVA 2JCHA 1H3QA 4Q0JA 1BTLA 4CLCB 3OCNA 3G31A 2PR6A 1HTZA 2WKRA 4JGQA 4LV1A 1XA1A 1W5DA 4IUKA 3N8SA 5GHZA 2A3UA 1KE4A 2PD7A 3DTMA 5KIZA 1JNUA 5AQ9A 5E2FA 3C30A 1KE0A 2GX5A 4PHTA 3Q82A 4CLCE 2XR0A 2Z6DA 2WKHA 3HBRA 3W4OA 4B4ZA 3ZDJA 5KZHA 4HBTA 2X01A 3EQVA 4B9OA 4GD6A 4GHIA 3G30A 4I5SA 2EX6A 1IOUA 1SZVA 4DMZA 2Z6CA 3ITBA 4GS9B 4NXEA 4LENA 3RXXA 5HPIA 5M19A 2E8IA 4KZ4A 1PRQA 1S6RA 4E3KA 5HFOA 3BRMA 1LSWA 2EXAA 2INWA 5AQ7A 4P85A 2O99A 3O86A 4MEZA 2OAQ1 3ITAA 3F1PB 2ZBBA 4E3IA 2GDNA 4CJNA 1TVFA 3VOYA 1K6SA 3SH9A 4M3KA 1YLWA 4JF5A 4OP5A 5FQMA 4KZBA 1ZG6A 1Y4OA 3FWLA 1UWNX 3UE3A 2A49A 2JKRI 4EBNA 1GSXA 4E6WA 5L09A 4WYYA 5CHUA 4ZJ3A 1ES3A 5GL9A 3MQOA 3N6IA 3MS6A 3GQZA 2WUQA 4JXSA 3E4PA 3W2ZA 5G4ZA 2YKHA 3V3RA 1XP4A 1W7FA 3A0VA 3JVUA 5CHMA 1ERMA 1VM1A 4ZAMA 5FATA 3IXHA 1H8ZA 2K31A 1BUEA 5F5YA 4UAAA 1YLPA 3E4OA 3JYIA 5DF7A 3U2AA 4GDNA 3HLDA 4GZBA 4PKYG 4HP4A 4KG5A 4DE3A 1Q2QA 4QJGA 5IS1A 4X53A 4O8GA 3CMZA 1PNEA 5HAQA 4EEUA 1K54C 1JWZA 4HP9A 3PAGA 5HWVA 3KO6A 4Y5FA 5GLAA 2Y2MA 3DWZA 4K08A 5HD5A 4X69A 3LGOA 4MCWA 2V2FF 2LB5A 5CTNA 3FKWA 4FSFA 1LL8A 4YNRA 1ZHHB 2EFXA 1LI0A 3IF6B 3IHAA 2Z2LB 1IYQA 2ZC4B 2P9VA 3TE8A 4DDSA 2PR5A 2B5RA 3NBLA 1LL9A 3KYEA 3M6BA 5J4EA 5E2GA 1LSXA 3SS5A 1BZAA 2L1MA 3RH8B 2QWSA 5K5BA 1YKDA 4OOYA 2Y8HA 1NZUA 2PHYA 1BLCA 1XJ3A 2VGLS 2V9AA 4EV4A 4EWFA 3N8RA 3UMEA 3HJKA 3DWKA 3NJAA 4FCFA 4S2MA 3UN7A 1DP6A 5FA7A 4Y13A 3GR2A 2JKFA 5A90A 4WUJA 2IWDA 1DP9A 2J80A 3E98A 3O88A 2HV1A 2VGLM 4DE2A 1H8YA 4QWOA 3W8KA 2ZQCA 1ONHA 1L0EA 4OPQA 5F69A 4HH3A 1VQQA 4Q0IA 3A3DA 4B93A 1MWSA 4K91A 3R7WB 2O0YA 2ZC5B 3LR3A 5EE8A 5EOEA 4GHIB 2K7SA 4KQOA 3TG9A 1BLSA 2PRFA 5HDSA 2XF3A 1G6AA 3C4PA 3G34A 1XGJA 4E3NA 2Y2NA 3SS3A 2Y2OA 3E2LA 4Y3IA 3ZG5A 3HLEA 2OLUA 5LBRA 2GZAA 1DJAA 3KYZA 3IXDA 4BD1A 5JYOA 3MMHA 4I38A 5FAPA 1KE3A 3ZG8B 5E2EA 1TD5A 2EFUA 1KVMA 4Y17A 3VP0A 3W4QA 5F6AA 1STZA 2WZZA 5EFWA 5EM0A 3MR0A 1YSPA 5I5LA 3QP1A 4L9FA 4R70A 3IBRA 3M2JA 3UE1A 4S2NA 1ES4A 5E43A 5HWTA 3IWQA 3MSHA 4E3OA 3RJUA 3O3VA 4Q8IA 4Y0TA 1J3WA 2ZC3B 4HIAA 4X1LA 2WKPA 3PBRA 2P08A 4R1GA 5FDHA 4YOFA 2V1BA 3BFEA 3NOUC 3DBAA 4M4XA 3SH8A 1KGGA 3ZG7B 3WRZA 4FH2A 2VV8A 4MN6A 4D2OA 3PHYA 3S7NA 2HPBA 4XUZA 3ZYTA 4BBTA 1FCMA 1BT5A 4ME4A 3BJNA 5M18A 3KSHA 3UNWA 2ZMFA 2HDSA 4HJ4A 4DDYA 4UA9A 3Q07A 4X55A 1BULA 1G28A 5TFQA 3OBFA 5G4YA 3FC7A 3MFDA 1IYOA 4K0XA 1OMEA 3NY4A 3E2KA 4JXVA 3PXPA 1CJFA 3UB8A 1LI9A 1QMEA 4RYEA 5FQJA 1K4EA 2JE5A 1YMXA 1K56D 1XFQA 2QPNA 4BL2A 4H6JB 3NI9A 1IELA 4XT2B 3HLWA 4S2PA 1K0KA 2NUTC 3D4FA 2XH9A 4X68A 2ZMAA 3D3OA 1OPXA 1SDNA 2FZ0A 3ZFZA 1YQSA 2Y2LA 4JGOA 1ESUA 3CHWP 1F9IA 1IYPA 2FH5A 5GHYA 1Z09A 1MWTA 2FFFB 3UB9A 2G2UA 3NECA 4JPMA 4N92A 2W3DA 3ZGAB 2ZM2A 4WLAA 3CZDA 3UE0A 1CF0A 2W3HA 4QPRA 5FI2A 1E4DA 3GRJA 2HF6A 3K3DA 4ZJ1A 2JC7A 4N9LA 5EECA 3MF0A 2OAP1 4Y7PA 1IYSA 3T1RA 2HJEA 4FD8A 3CJMA 4L9GA 1DJCA 4ARZB 3D72A 3MQ0A 4OQGA 2Y2HA 2QKPA 3GTCA 3BQ8A 4DXCA 1AWIA 4PM9A 4ZJ2A 4Z9QA 3VE4A 3UO9A 2ZQ9A 4B4XA 2A2LA 2PD8A 1PW1A 5I94A 4LCMA 3RTYA 1GHPA 2V8CA 2ACGA 2VX8A 2XFTA 2OWHA 3LR0A 4IHQA 4MBFA 3T4JA 2XROA 4WZ5C 1XX2A 3MZFA 1FSYA 2O9BA 4RX3A 4WEJA 3T4QA 3LR5A 1XJ4A 1TS6A 3C7UA 3O87A 5EVEA 2VLGA 4ZTKA 1M6KA 2I9VA 1KOUA 3DTEA 4KZ5A 1UWPX 2C5WB 4GD8A 2ZC7A 1E3UD 3B42A 4QD4A 4HHDA 3LI8A 4OP8A 3V39A 2X02A 1XJ2A 3T12B 3VP3A 1RGZA 1L3LA 2WK0A 4JF4A 1RGYA 3IH8A 1RCJA 4LFUA 3NULA 4GLQA 4GCZA 3H7WA 4HH2A 4ZBEA 4MBHA 4PKYA 3P01A 4QHCA 3PBSA 4EBPA 2Y2KA 2WGWB 2DCFA 2ZMVA 3OCLA 3LICA 1BYWA 1U60A 3QNBA 2X71A 4ZRRA 3EGXC 3DAVA 1L2SA 4O7DA 3IF5A 4BWIA 1L0DA 2JKGA 3R4KA 3F1NB 5FQQA 4MN5A 3JVVA 4DE0A 5DTKA 5FEFA 3AGDA 4KG6A 4R4RA 1SKOB 4LRXC 1MXOA 3MFXA 1P97A 1BLPA 3PBNA 1K56A 4N1XA 5HWWA 2RL3A 3FG8A 4ID4A 4C3QA 2IWBA 4U0XA 3OPPA 4S2IA 3C4OA 4GOGA 4E6XA 4KZ9A 4S2KA 1NZOA 5F1FA 1CK3A 1KGEA 4EQ1A 1S66L 4BD0A 1GHIA 4Y15A 4JF6A 3LY4A 2ZM8A 2H28A 1XKZA 5DTSA 1MBLA 3HJIA 5DJTA 1CEGA 2PYPA 1PWCA 4UHUA 3UB6A 3LIDA 1FOFA 4PPRA 1JWVA 2EWVA 1D1JA 3IH9A 4R3BA 4ETXA 5IHVA 5J8XA 4BQMA 5FAQA 5CXWA 3CI6A 3HUOA 5FSRA 4OVDA 1XGIA 4WMCD 1FR6A 3T4TA 3V5MA 2V8FA 4KQQA 1AXBA 3GSGA 3CPTA 4OKPA 1W8YA 4YWZA 3IQAA 1LSVA
chains in the Genus database with same CATH topology
3ZHHA 1TDGA 2Y2NA 3GVBA 3S1YA 3SS3A 4LV3A 4BLMA 2J7VA 2Y2OA 4MBKA 5JYPA 3E2LA 3ZG5A 3HLEA 3BYDA 2IWCA 3G32A 3I7JA 4PM7A 4QU3A 2OLUA 2OLVA 2R9WA 3DW0A 4WM9A 2QZ6A 3ZNYA 4U3TA 3WS2A 4S2LA 1DJAA 5F82A 5A92A 3IXDA 4BD1A 2Y2QA 5JYOA 2EX2A 5FAPA 1KE3A 3ZG8B 5E2EA 2EFUA 2WGVA 1KVMA 2H10A 2ZD8A 3VSKA 4WEKA 3W4QA 3VP0A 3G2YA 4OH0A 4OLGA 3G4PA 5HAIA 5GHXA 5HL1A 2WZZA 5U47A 4A5RA 3A3IA 5FI6A 5CERA 3WS0A 4R23A 1KGFA 4OPYA 4HBUA 1K38A 4OPRA 2Q9NA 3Q81A 3BEBA 4KG2A 3ZVWA 3M2JA 1PI5A 4S2NA 3UE1A 1ES4A 2Y2PA 5E43A 1G68A 1M40A 3IWQA 4E3OA 2Y91A 3RJUA 3HLBA 3ZNTA 2H0YA 3O3VA 1XA7A 4Q8IA 1HVBA 1KVLA 3QHYA 4P6BA 4Y0TA 4YFMA 2ZC3B 2JBFA 3PBRA 3VMAA 1FSWA 3G35A 4R1GA 1L0GA 4EUZA 3N8LA 4IBXA 5E2HA 2Y2IA 4HESA 4K0WA 4R3JA 2EXBA 5FDHA 3VP2A 4JBFA 1O7EA 2BLSA 2DRWA 5FQ9A 2V1ZA 3BFEA 2G2WA 3UDFA 5DTTA 5EVID 4GDBA 3OZHA 3TSGA 3SH8A 5F83A 1KGGA 1SKFA 3ZG7B 2WYXA 4KZ7A 2ZJ9A 4JXWA 2J8YA 3FYZA 4X6TA 5EUAA 3BLSA 2HP9A 3N7WA 5CTMA 5F1GA 4FH2A 4UA6A 1E3UA 3WRZA 1EI5A 4D2OA 2WGWA 1EWZA 2HPBA 4EBPA 1N9BA 4XUZA 1ES2A 4KZAA 3P98A 2ZQDA 3PTEA 1FCMA 2XLNA 1FCNA 1BT5A 2XDMA 4XXRA 4CPKA 2HP6A 2PBYA 1Y54A 3LCEA 5M18A 3UDIA 3B3XA 3OPLA 2QMIA 3FV7A 4DRTA 3UNWA 2PU2A 2HDSA 1W8QA 2Y55A 4DDYA 3IWOA 3NDGA 4UA9A 3M6HA 3Q7VB 4EQIA 3Q07A 2XD5A 2Y59A 1DJBA 1BULA 2Z2MB 4X55A 3AGEA 4LV0A 1MWRA 5TFQA 1TEMA 2ZQ7A 5BOHA 1L0FA 2DNSA 1JTGA 3MZDA 1YLTA 3MFDA 1IYOA 4K0XA 1OMEA 3NY4A 3E2KA 4JXVA 4YINA 1GCEA 4OQHA 2XQZA 3ISGA 4S2OA 1ZC2A 3UPPA 3A3FA 3IWIA 1JTDA 1LI9A 4LCLA 4XUXA 5CECA 4H8RA 1QMEA 1WYBA 5KSCA 4RYEA 2P9VB 2J9OA 4GN2A 5CRFA 4E3JA 1QMFA 5FQJA 1K4EA 2JE5A 1YMXA 4OOMA 4U0TA 2ZM0A 4MLLA 1K56D 5CGSA 3Q1FA 1SHVA 1BSGA 3VFHA 2QPNA 3HLCA 3PAEA 5FI7A 5CGWA 3IF6A 3UPNA 4BL2A 1XXMA 3NI9A 1IELA 1FR1A 1FCOA 4GKUA 3VP4A 3HLWA 4S2PA 3OC2A 3BECA 3FZCA 1PYYA 4GNUA 1PIOA 4R0QA 3D4FA 2XH9A 4X68A 2ZMAA 1YLYA 3LY3A 4PM6A 1SDNA 3IXBA 1NY0A 3OPRA 4WELA 3HUMA 4Y0UA 1NXYA 3ZFZA 3LEZA 1YQSA 2Y2LA 3PBQA 1YLZA 2CC1A 1CEFA 1ESUA 3ZCZA 5GLDA 1WE4A 1IYPA 1K54A 1PZPA 4E3MA 1K4FA 1HZOA 1GA9A 4KQRA 1LLBA 3HREA 5GHYA 1C3BA 1MWTA 2FFFB 4C6YA 2V20A 5EVIC 4Y0OA 2G2UA 4JPMA 3IHBA 5TGFA 4BL3A 3W4PA 4B88A 3QNCA 4N92A 4IVKA 4JLFA 5FQIA 2OV5A 4JKTA 5EVIB 5CHJA 2JCHA 3ZGAB 3HLGA 4R4SA 1KDWA 2ZM2A 1BTLA 3CZDA 5FAOA 3UE0A 1CI8A 4P87A 3OCNA 3G31A 5CEDA 3UPOA 1HTZA 4QB8A 1GA0A 1JWPA 1PWDA 5FI2A 4LV1A 1W5DA 1XA1A 1E4DA 3GRJA 3N8SA 5GHZA 2A3UA 1KE4A 2JC7A 4N9LA 5EECA 1K57C 4ZJ1A 1LL5A 4UA7A 4Y7PA 1IYSA 1PWGA 3MBZA 3DTMA 4FD8A 3BFCA 3CJMA 5AQ9A 3P09A 2EX8A 5AQAA 1YT4A 5E2FA 1DJCA 4OLDA 4OQGA 3M2KA 5TR7A 1KE0A 2Y2HA 1PI4A 5AQBA 1W79A 3Q82A 3SH7A 3HVFA 2XR0A 3GTCA 2WKHA 3HBRA 4DXCA 3W4OA 1IKGA 4BJPA 4NETA 3SOIA 4B4ZA 1YLJA 1GHMA 3ZDJA 2WAFA 5KZHA 3FKVA 4PM9A 1K55A 4ZJ2A 4Z9QA 1J9MA 4HBTA 3EQVA 2HDUA 2X01A 3UO9A 1I2WA 2ZQ9A 4GD6A 4HEFA 3G30A 2EX6A 1MWUA 4B4XA 4KZ3A 4N9KA 1PW1A 2XEPA 4LCMA 5I94A 3NCKA 3ITBA 3RXXA 4LENA 4EBLA 5M19A 1GHPA 2E8IA 4KZ4A 4JXGA 1S6RA 4E3KA 5HFOA 2XFTA 4WMCA 5DVAA 1ONGA 3BRMA 5EVLA 2EXAA 5AQ7A 4P85A 3C5AA 1ZKJA 2VGKA 2FFYA 2Y2JA 3O86A 4MEZA 4MBFA 5CGXA 4WZ5C 1XX2A 2RCXA 3MZFA 2HDQA 3Q7VA 3ITAA 1IEMA 4E3IA 2GDNA 3BFDA 1FSYA 3V3SA 4CJNA 1TVFA 3VOYA 1K6SA 3SH9A 4M3KA 2WKIA 1YLWA 4S2JA 4RX3A 4JF5A 4WEJA 5DF8A 3HLFA 5GLCA 4OP5A 2Q9MA 5FQMA 4KZBA 4E3NA 4NK3A 1ZG6A 1YM1A 3FWLA 3UE3A 2H0TA 2A49A 3PBOA 4EBNA 5HW3A 3C7UA 3O87A 4E6WA 3IF6C 4WYYA 4ZTKA 5EOOA 1M6KA 5CHUA 4OQ0A 4IVIA 4ZJ3A 1CI9A 1ES3A 5GL9A 4KZ5A 2C5WB 3N6IA 4GD8A 2WADA 2ZC7A 2P74A 3GQZA 3WS1A 1E3UD 2WUQA 4JXSA 4KENB 1I2SA 4QD4A 3RXWA 4N1HA 4OP8A 3V3RA 3BFGA 3V39A 2X02A 1XP4A 1W7FA 4PM5A 3VSLA 3NC8A 3VOZA 2HP5A 2J9PA 5CHMA 5EPHA 3CG5A 1ERMA 2WAEA 5DF9A 1VM1A 1RGZA 4RVAA 4ZAMA 5D3OA 3VP3A 1K57A 1BLHA 2WK0A 2ZQ8A 5FATA 3IXHA 1H8ZA 4JF4A 1RGYA 3IH8A 2H5SA 1BUEA 4BENA 4UAAA 1YLPA 5M1AA 1RCJA 1WYCA 3JYIA 5DF7A 2WZXA 4GDNA 3HLDA 4GZBA 1KDSA 3ZG0A 4PMAA 4IEDA 2XK1A 4MBHA 4ZBEA 4KG5A 3IXGA 3PBSA 3BLMA 4OPZA 4QHCA 1EROA 2Y2KA 2OSUA 1Q2QA 2WGWB 2ZQAA 4OONA 4DE3A 4X53A 2DCFA 4QJGA 2PU4A 3OCLA 3CMZA 3MXRA 2XGNA 5HAQA 1U60A 4PM8A 3QNBA 5EVIA 1K54C 2X71A 4KZ8A 1JWZA 3GV9A 3PAGA 4RA7A 4F94A 1S0WA 3N4IA 1L2SA 2Y2MA 5GLAA 4O7DA 5KMWA 3DWZA 1HD8A 3IF5A 4LV2A 1MKIA 1E25A 2I72A 4X69A 4L0LA 1L0DA 2V2FF 4WZ5A 3Q7ZA 1N4OA 4S2NC 3TOIA 5FQQA 2XFSA 1NYMA 4DE0A 5CTNA 4WBGA 5DTKA 3FKWA 3IT9A 1XPBA 4FSFA 4MNRA 3AGFA 5GLBA 4IBRA 3C7VA 4E3LA 2UWXA 3AGDA 1K55C 2EFXA 1IKIA 3MKEA 4KG6A 1LI0A 3SS4A 4RX2A 1ZG4A 3IF6B 3IHAA 1TDLA 2Z2LB 1IYQA 4OQIA 4R4RA 3UDXA 4DF6A 1K25A 1SCWA 2P9VA 2ZC4B 4FH4A 3WS4A 5HARA 4DDSA 1JVJA 2B5RA 3NBLA 5KSHA 1MXOA 2C6WB 1LL9A 3HL9A 1PZOA 1BLPA 3PBNA 2XD1A 4P0MA 1K56A 3M6BA 4N1XA 2RL3A 5E2GA 2Y2GA 5FQKA 3SS5A 1BZAA 4ID4A 4GB7A 5FASA 3VP1A 4C3QA 1PW8A 4ZDXA 1ALQA 1Z6FA 4OOLA 4WZ4A 1K6RA 2HDRA 2Y4AA 4OOYA 2IWBA 4U0XA 3V50A 3A3EA 3OPPA 4S2IA 3C4OA 4GOGA 4E6XA 4KZ9A 1ERQA 3UY6A 1NZUA 4S2KA 3LO7A 1BLCA 2WKEA 1MPLA 2R9XA 1NZOA 5F1FA 1CK3A 1KGEA 3PBTA 4BD0A 2ZLYA 1GHIA 4JF6A 3VFFA 3ZVTA 4EV4A 4X56A 3LY4A 4EWFA 3N8RA 2ZM8A 1Q2PA 2EX9A 1XKZA 3DWKA 5DTSA 4FCFA 1SDEA 4S2MA 5A91A 1MBLA 3ZG9B 4DXBA 5CEBA 3UN7A 4KZ6A 3NDEA 1CEGA 5FA7A 1PWCA 4UHUA 3GR2A 1NJ4A 1DY6A 1FOFA 1I5QA 5A90A 4PPRA 1JWVA 3IH9A 3NIAA 4R3BA 2IWDA 1H5XA 1NYYA 3BFFA 5IHVA 3S22A 4QY5A 3A3JA 5A93A 5J8XA 3O88A 1ES5A 1LHYA 3MKFA 1O07A 4BQMA 1H8YA 3WRTA 5FAQA 4DE2A 4QY6A 1RP5A 3BM6A 5CXWA 3W8KA 3WS5A 2ZQCA 1ESIA 1ONHA 3HUOA 5FSRA 4OVDA 3EQUA 1L0EA 4OPQA 5L2FA 3MXSA 1VQQA 1NRFA 1XGIA 4WMCD 1FR6A 3A3DA 3V5MA 4DKIA 1MWSA 4K91A 3OPHA 2ZC5B 2WGIA 3G2ZA 5EE8A 4KQQA 5EOEA 5HAPA 2VGJA 1AXBA 3GSGA 2BG1A 3GMWA 4OKPA 5HX9A 1FQGA 2ZC6B 3S4XA 1MY8A 4KQOA 1W8YA 3HUNA 3TG9A 1BLSA 3MZEA 1YMSA 3IQAA 2XF3A 1G6AA 3C4PA 3G34A 5G18A 4C75A 1XGJA 3WWXA 4DE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZHH A;  1TDG A;  2Y2N A;  3GVB A;  3S1Y A;  3SS3 A;  4LV3 A;  4BLM A;  2J7V A;  2Y2O A;  4MBK A;  5JYP A;  3E2L A;  3ZG5 A;  3HLE A;  3BYD A;  2IWC A;  3G32 A;  3I7J A;  4PM7 A;  4QU3 A;  2OLU A;  2OLV A;  2R9W A;  3DW0 A;  4WM9 A;  2QZ6 A;  3ZNY A;  4U3T A;  3WS2 A;  4S2L A;  1DJA A;  5F82 A;  5A92 A;  3IXD A;  4BD1 A;  2Y2Q A;  5JYO A;  2EX2 A;  5FAP A;  1KE3 A;  3ZG8 B;  5E2E A;  2EFU A;  2WGV A;  1KVM A;  2H10 A;  2ZD8 A;  3VSK A;  4WEK A;  3W4Q A;  3VP0 A;  3G2Y A;  4OH0 A;  4OLG A;  3G4P A;  5HAI A;  5GHX A;  5HL1 A;  2WZZ A;  5U47 A;  4A5R A;  3A3I A;  5FI6 A;  5CER A;  3WS0 A;  4R23 A;  1KGF A;  4OPY A;  4HBU A;  1K38 A;  4OPR A;  2Q9N A;  3Q81 A;  3BEB A;  4KG2 A;  3ZVW A;  3M2J A;  1PI5 A;  4S2N A;  3UE1 A;  1ES4 A;  2Y2P A;  5E43 A;  1G68 A;  1M40 A;  3IWQ A;  4E3O A;  2Y91 A;  3RJU A;  3HLB A;  3ZNT A;  2H0Y A;  3O3V A;  1XA7 A;  4Q8I A;  1HVB A;  1KVL A;  3QHY A;  4P6B A;  4Y0T A;  4YFM A;  2ZC3 B;  2JBF A;  3PBR A;  3VMA A;  1FSW A;  3G35 A;  4R1G A;  1L0G A;  4EUZ A;  3N8L A;  4IBX A;  5E2H A;  2Y2I A;  4HES A;  4K0W A;  4R3J A;  2EXB A;  5FDH A;  3VP2 A;  4JBF A;  1O7E A;  2BLS A;  2DRW A;  5FQ9 A;  2V1Z A;  3BFE A;  2G2W A;  3UDF A;  5DTT A;  5EVI D;  4GDB A;  3OZH A;  3TSG A;  3SH8 A;  5F83 A;  1KGG A;  1SKF A;  3ZG7 B;  2WYX A;  4KZ7 A;  2ZJ9 A;  4JXW A;  2J8Y A;  3FYZ A;  4X6T A;  5EUA A;  3BLS A;  2HP9 A;  3N7W A;  5CTM A;  5F1G A;  4FH2 A;  4UA6 A;  1E3U A;  3WRZ A;  1EI5 A;  4D2O A;  2WGW A;  1EWZ A;  2HPB A;  4EBP A;  1N9B A;  4XUZ A;  1ES2 A;  4KZA A;  3P98 A;  2ZQD A;  3PTE A;  1FCM A;  2XLN A;  1FCN A;  1BT5 A;  2XDM A;  4XXR A;  4CPK A;  2HP6 A;  2PBY A;  1Y54 A;  3LCE A;  5M18 A;  3UDI A;  3B3X A;  3OPL A;  2QMI A;  3FV7 A;  4DRT A;  3UNW A;  2PU2 A;  2HDS A;  1W8Q A;  2Y55 A;  4DDY A;  3IWO A;  3NDG A;  4UA9 A;  3M6H A;  3Q7V B;  4EQI A;  3Q07 A;  2XD5 A;  2Y59 A;  1DJB A;  1BUL A;  2Z2M B;  4X55 A;  3AGE A;  4LV0 A;  1MWR A;  5TFQ A;  1TEM A;  2ZQ7 A;  5BOH A;  1L0F A;  2DNS A;  1JTG A;  3MZD A;  1YLT A;  3MFD A;  1IYO A;  4K0X A;  1OME A;  3NY4 A;  3E2K A;  4JXV A;  4YIN A;  1GCE A;  4OQH A;  2XQZ A;  3ISG A;  4S2O A;  1ZC2 A;  3UPP A;  3A3F A;  3IWI A;  1JTD A;  1LI9 A;  4LCL A;  4XUX A;  5CEC A;  4H8R A;  1QME A;  1WYB A;  5KSC A;  4RYE A;  2P9V B;  2J9O A;  4GN2 A;  5CRF A;  4E3J A;  1QMF A;  5FQJ A;  1K4E A;  2JE5 A;  1YMX A;  4OOM A;  4U0T A;  2ZM0 A;  4MLL A;  1K56 D;  5CGS A;  3Q1F A;  1SHV A;  1BSG A;  3VFH A;  2QPN A;  3HLC A;  3PAE A;  5FI7 A;  5CGW A;  3IF6 A;  3UPN A;  4BL2 A;  1XXM A;  3NI9 A;  1IEL A;  1FR1 A;  1FCO A;  4GKU A;  3VP4 A;  3HLW A;  4S2P A;  3OC2 A;  3BEC A;  3FZC A;  1PYY A;  4GNU A;  1PIO A;  4R0Q A;  3D4F A;  2XH9 A;  4X68 A;  2ZMA A;  1YLY A;  3LY3 A;  4PM6 A;  1SDN A;  3IXB A;  1NY0 A;  3OPR A;  4WEL A;  3HUM A;  4Y0U A;  1NXY A;  3ZFZ A;  3LEZ A;  1YQS A;  2Y2L A;  3PBQ A;  1YLZ A;  2CC1 A;  1CEF A;  1ESU A;  3ZCZ A;  5GLD A;  1WE4 A;  1IYP A;  1K54 A;  1PZP A;  4E3M A;  1K4F A;  1HZO A;  1GA9 A;  4KQR A;  1LLB A;  3HRE A;  5GHY A;  1C3B A;  1MWT A;  2FFF B;  4C6Y A;  2V20 A;  5EVI C;  4Y0O A;  2G2U A;  4JPM A;  3IHB A;  5TGF A;  4BL3 A;  3W4P A;  4B88 A;  3QNC A;  4N92 A;  4IVK A;  4JLF A;  5FQI A;  2OV5 A;  4JKT A;  5EVI B;  5CHJ A;  2JCH A;  3ZGA B;  3HLG A;  4R4S A;  1KDW A;  2ZM2 A;  1BTL A;  3CZD A;  5FAO A;  3UE0 A;  1CI8 A;  4P87 A;  3OCN A;  3G31 A;  5CED A;  3UPO A;  1HTZ A;  4QB8 A;  1GA0 A;  1JWP A;  1PWD A;  5FI2 A;  4LV1 A;  1W5D A;  1XA1 A;  1E4D A;  3GRJ A;  3N8S A;  5GHZ A;  2A3U A;  1KE4 A;  2JC7 A;  4N9L A;  5EEC A;  1K57 C;  4ZJ1 A;  1LL5 A;  4UA7 A;  4Y7P A;  1IYS A;  1PWG A;  3MBZ A;  3DTM A;  4FD8 A;  3BFC A;  3CJM A;  5AQ9 A;  3P09 A;  2EX8 A;  5AQA A;  1YT4 A;  5E2F A;  1DJC A;  4OLD A;  4OQG A;  3M2K A;  5TR7 A;  1KE0 A;  2Y2H A;  1PI4 A;  5AQB A;  1W79 A;  3Q82 A;  3SH7 A;  3HVF A;  2XR0 A;  3GTC A;  2WKH A;  3HBR A;  4DXC A;  3W4O A;  1IKG A;  4BJP A;  4NET A;  3SOI A;  4B4Z A;  1YLJ A;  1GHM A;  3ZDJ A;  2WAF A;  5KZH A;  3FKV A;  4PM9 A;  1K55 A;  4ZJ2 A;  4Z9Q A;  1J9M A;  4HBT A;  3EQV A;  2HDU A;  2X01 A;  3UO9 A;  1I2W A;  2ZQ9 A;  4GD6 A;  4HEF A;  3G30 A;  2EX6 A;  1MWU A;  4B4X A;  4KZ3 A;  4N9K A;  1PW1 A;  2XEP A;  4LCM A;  5I94 A;  3NCK A;  3ITB A;  3RXX A;  4LEN A;  4EBL A;  5M19 A;  1GHP A;  2E8I A;  4KZ4 A;  4JXG A;  1S6R A;  4E3K A;  5HFO A;  2XFT A;  4WMC A;  5DVA A;  1ONG A;  3BRM A;  5EVL A;  2EXA A;  5AQ7 A;  4P85 A;  3C5A A;  1ZKJ A;  2VGK A;  2FFY A;  2Y2J A;  3O86 A;  4MEZ A;  4MBF A;  5CGX A;  4WZ5 C;  1XX2 A;  2RCX A;  3MZF A;  2HDQ A;  3Q7V A;  3ITA A;  1IEM A;  4E3I A;  2GDN A;  3BFD A;  1FSY A;  3V3S A;  4CJN A;  1TVF A;  3VOY A;  1K6S A;  3SH9 A;  4M3K A;  2WKI A;  1YLW A;  4S2J A;  4RX3 A;  4JF5 A;  4WEJ A;  5DF8 A;  3HLF A;  5GLC A;  4OP5 A;  2Q9M A;  5FQM A;  4KZB A;  4E3N A;  4NK3 A;  1ZG6 A;  1YM1 A;  3FWL A;  3UE3 A;  2H0T A;  2A49 A;  3PBO A;  4EBN A;  5HW3 A;  3C7U A;  3O87 A;  4E6W A;  3IF6 C;  4WYY A;  4ZTK A;  5EOO A;  1M6K A;  5CHU A;  4OQ0 A;  4IVI A;  4ZJ3 A;  1CI9 A;  1ES3 A;  5GL9 A;  4KZ5 A;  2C5W B;  3N6I A;  4GD8 A;  2WAD A;  2ZC7 A;  2P74 A;  3GQZ A;  3WS1 A;  1E3U D;  2WUQ A;  4JXS A;  4KEN B;  1I2S A;  4QD4 A;  3RXW A;  4N1H A;  4OP8 A;  3V3R A;  3BFG A;  3V39 A;  2X02 A;  1XP4 A;  1W7F A;  4PM5 A;  3VSL A;  3NC8 A;  3VOZ A;  2HP5 A;  2J9P A;  5CHM A;  5EPH A;  3CG5 A;  1ERM A;  2WAE A;  5DF9 A;  1VM1 A;  1RGZ A;  4RVA A;  4ZAM A;  5D3O A;  3VP3 A;  1K57 A;  1BLH A;  2WK0 A;  2ZQ8 A;  5FAT A;  3IXH A;  1H8Z A;  4JF4 A;  1RGY A;  3IH8 A;  2H5S A;  1BUE A;  4BEN A;  4UAA A;  1YLP A;  5M1A A;  1RCJ A;  1WYC A;  3JYI A;  5DF7 A;  2WZX A;  4GDN A;  3HLD A;  4GZB A;  1KDS A;  3ZG0 A;  4PMA A;  4IED A;  2XK1 A;  4MBH A;  4ZBE A;  4KG5 A;  3IXG A;  3PBS A;  3BLM A;  4OPZ A;  4QHC A;  1ERO A;  2Y2K A;  2OSU A;  1Q2Q A;  2WGW B;  2ZQA A;  4OON A;  4DE3 A;  4X53 A;  2DCF A;  4QJG A;  2PU4 A;  3OCL A;  3CMZ A;  3MXR A;  2XGN A;  5HAQ A;  1U60 A;  4PM8 A;  3QNB A;  5EVI A;  1K54 C;  2X71 A;  4KZ8 A;  1JWZ A;  3GV9 A;  3PAG A;  4RA7 A;  4F94 A;  1S0W A;  3N4I A;  1L2S A;  2Y2M A;  5GLA A;  4O7D A;  5KMW A;  3DWZ A;  1HD8 A;  3IF5 A;  4LV2 A;  1MKI A;  1E25 A;  2I72 A;  4X69 A;  4L0L A;  1L0D A;  2V2F F;  4WZ5 A;  3Q7Z A;  1N4O A;  4S2N C;  3TOI A;  5FQQ A;  2XFS A;  1NYM A;  4DE0 A;  5CTN A;  4WBG A;  5DTK A;  3FKW A;  3IT9 A;  1XPB A;  4FSF A;  4MNR A;  3AGF A;  5GLB A;  4IBR A;  3C7V A;  4E3L A;  2UWX A;  3AGD A;  1K55 C;  2EFX A;  1IKI A;  3MKE A;  4KG6 A;  1LI0 A;  3SS4 A;  4RX2 A;  1ZG4 A;  3IF6 B;  3IHA A;  1TDL A;  2Z2L B;  1IYQ A;  4OQI A;  4R4R A;  3UDX A;  4DF6 A;  1K25 A;  1SCW A;  2P9V A;  2ZC4 B;  4FH4 A;  3WS4 A;  5HAR A;  4DDS A;  1JVJ A;  2B5R A;  3NBL A;  5KSH A;  1MXO A;  2C6W B;  1LL9 A;  3HL9 A;  1PZO A;  1BLP A;  3PBN A;  2XD1 A;  4P0M A;  1K56 A;  3M6B A;  4N1X A;  2RL3 A;  5E2G A;  2Y2G A;  5FQK A;  3SS5 A;  1BZA A;  4ID4 A;  4GB7 A;  5FAS A;  3VP1 A;  4C3Q A;  1PW8 A;  4ZDX A;  1ALQ A;  1Z6F A;  4OOL A;  4WZ4 A;  1K6R A;  2HDR A;  2Y4A A;  4OOY A;  2IWB A;  4U0X A;  3V50 A;  3A3E A;  3OPP A;  4S2I A;  3C4O A;  4GOG A;  4E6X A;  4KZ9 A;  1ERQ A;  3UY6 A;  1NZU A;  4S2K A;  3LO7 A;  1BLC A;  2WKE A;  1MPL A;  2R9X A;  1NZO A;  5F1F A;  1CK3 A;  1KGE A;  3PBT A;  4BD0 A;  2ZLY A;  1GHI A;  4JF6 A;  3VFF A;  3ZVT A;  4EV4 A;  4X56 A;  3LY4 A;  4EWF A;  3N8R A;  2ZM8 A;  1Q2P A;  2EX9 A;  1XKZ A;  3DWK A;  5DTS A;  4FCF A;  1SDE A;  4S2M A;  5A91 A;  1MBL A;  3ZG9 B;  4DXB A;  5CEB A;  3UN7 A;  4KZ6 A;  3NDE A;  1CEG A;  5FA7 A;  1PWC A;  4UHU A;  3GR2 A;  1NJ4 A;  1DY6 A;  1FOF A;  1I5Q A;  5A90 A;  4PPR A;  1JWV A;  3IH9 A;  3NIA A;  4R3B A;  2IWD A;  1H5X A;  1NYY A;  3BFF A;  5IHV A;  3S22 A;  4QY5 A;  3A3J A;  5A93 A;  5J8X A;  3O88 A;  1ES5 A;  1LHY A;  3MKF A;  1O07 A;  4BQM A;  1H8Y A;  3WRT A;  5FAQ A;  4DE2 A;  4QY6 A;  1RP5 A;  3BM6 A;  5CXW A;  3W8K A;  3WS5 A;  2ZQC A;  1ESI A;  1ONH A;  3HUO A;  5FSR A;  4OVD A;  3EQU A;  1L0E A;  4OPQ A;  5L2F A;  3MXS A;  1VQQ A;  1NRF A;  1XGI A;  4WMC D;  1FR6 A;  3A3D A;  3V5M A;  4DKI A;  1MWS A;  4K91 A;  3OPH A;  2ZC5 B;  2WGI A;  3G2Z A;  5EE8 A;  4KQQ A;  5EOE A;  5HAP A;  2VGJ A;  1AXB A;  3GSG A;  2BG1 A;  3GMW A;  4OKP A;  5HX9 A;  1FQG A;  2ZC6 B;  3S4X A;  1MY8 A;  4KQO A;  1W8Y A;  3HUN A;  3TG9 A;  1BLS A;  3MZE A;  1YMS A;  3IQA A;  2XF3 A;  1G6A A;  3C4P A;  3G34 A;  5G18 A;  4C75 A;  1XGJ A;  3WWX A;  4DE1 A; 
#chains in the Genus database with same CATH topology
 3PYP A;  4JGR A;  5JYP A;  4LV3 A;  4MBK A;  2M7U A;  3G32 A;  3I7J A;  4WM9 A;  3ZNY A;  4S2L A;  5A92 A;  2Y2Q A;  2EX2 A;  3ICY A;  5DFX A;  2WGV A;  2H10 A;  1S4R A;  4LLO B;  3A0R A;  4OH0 A;  3G4P A;  5HL1 A;  5GHX A;  3CIT A;  4A5R A;  3S7P A;  3A3I A;  3WS0 A;  4R23 A;  4HBU A;  4OPR A;  2Q9N A;  4DJ3 A;  2GNX A;  1OTA A;  3BEB A;  4KG2 A;  2K2N A;  2E8J A;  3ZNT A;  2H0Y A;  1KVL A;  3KSG A;  3E4Q A;  3VMA A;  3VP2 A;  2Y2I A;  4R3J A;  2D01 A;  2QJ5 A;  2BLS A;  3UDF A;  1TF1 A;  5EVI D;  3OZH A;  5F83 A;  1T1A A;  5IU1 A;  2WYX A;  2ZJ9 A;  3H7W B;  2J8Y A;  5F1G A;  3IX4 A;  3BLS A;  4UA6 A;  3H82 A;  2WGW A;  4FUW A;  1N9B A;  5TBM B;  4LRZ E;  2ZQD A;  2XLN A;  4CPK A;  1MZU A;  1IFQ A;  3T1Q B;  2Y79 A;  4DRT A;  2JKT M;  4CLC C;  3NDG A;  3M6H A;  3E0Y A;  2Y59 A;  1DJB A;  4WL9 A;  1TEM A;  2ZQ7 A;  3V67 A;  1NRJ A;  3CUE C;  1YLT A;  1ZTU A;  2VJW A;  2W3F A;  4OQH A;  2XQZ A;  2J3W A;  3ISG A;  4BBU A;  1TS7 A;  4S2O A;  1ZC2 A;  3UPP A;  3IWI A;  1JTD A;  3TJZ C;  4LCL A;  5FL3 A;  1SKO A;  5CEC A;  2J3T D;  1WYB A;  3H9W A;  2J9O A;  4GN2 A;  4I3J A;  4E3J A;  4OOM A;  4MLL A;  5CGS A;  1NLY A;  3HLC A;  5CGW A;  3IF6 A;  3UPN A;  4GKU A;  1FCO A;  1WA9 A;  1PYY A;  4GNU A;  3MQQ A;  4R0Q A;  1GSV A;  3LY3 A;  1VET B;  4IUH A;  1ODV A;  1OTD A;  2A24 B;  4PAU A;  1YLZ A;  5GLD A;  1MC0 A;  5J3W A;  4E3M A;  1K4F A;  4KQR A;  1C3B A;  3C8C A;  4C6Y A;  4Y0O A;  3IHB A;  4BL3 A;  3W4P A;  3QP8 A;  3QNC A;  4IVK A;  4JLF A;  5FQI A;  2OV5 A;  4JKT A;  2P04 A;  1CI8 A;  3UPO A;  1PWD A;  2KX6 A;  1YPR A;  1A0K A;  2O9A A;  1K57 C;  3T4K A;  4CLC D;  5AVF A;  2W1R A;  4UA7 A;  3SW1 A;  3MBZ A;  1PWG A;  1N9L A;  3BFC A;  3P09 A;  5AQA A;  1YT4 A;  4WN5 A;  4OLD A;  5TR7 A;  2D02 A;  2XRN A;  1PI4 A;  3CLO A;  3HVF A;  1NLZ A;  2HZ5 A;  3ULF A;  3LIA A;  3IS2 B;  5HD3 A;  4NET A;  3R7W A;  3SOI A;  5IT5 A;  1YLJ A;  2VK3 A;  2CMN A;  1J9M A;  2W3G A;  2HDU A;  4NXF A;  1MWU A;  2LB9 A;  4KZ3 A;  2YKF A;  2XEP A;  3NCK A;  4FTX A;  4JXG A;  4D60 A;  1ONG A;  5EVL A;  2VGK A;  2Y2J A;  5CGX A;  3Q7V A;  2RCX A;  4LPZ A;  1IEM A;  3V3S A;  4S2J A;  5DF8 A;  4R6L A;  1D7E A;  5GLC A;  2L4R A;  1Y28 A;  1S4S A;  4NK3 A;  1YM1 A;  2H0T A;  4G3K A;  4LRY C;  3BWL A;  4EXO A;  3IF6 C;  1OTB A;  5EOO A;  1H8M A;  4OQ0 A;  3UMD A;  1TS8 A;  4JGP A;  1ACF A;  3WS1 A;  4KEN B;  3RXW A;  4EES A;  4EW7 A;  4N1H A;  5EM1 A;  3NC8 A;  2HP5 A;  3VE3 A;  4I3I A;  5EPH A;  2V1A A;  3CG5 A;  2WAE A;  2JKR M;  4RVA A;  1BLH A;  2ZQ8 A;  4MN7 A;  4G3W A;  2H5S A;  5M1A A;  2WZX A;  2VEA A;  1KDS A;  3U4L P;  3ZG0 A;  3IXG A;  3LYX A;  3BLM A;  4OPZ A;  2ZQA A;  2PU4 A;  3MXR A;  2J3T C;  2XGN A;  4HOI A;  1VEU B;  3FPW A;  1T1C A;  4PM8 A;  1OTE A;  4O0P A;  3F1O B;  1S0W A;  3N4I A;  3EGD C;  4X25 A;  1HD8 A;  1E25 A;  2I72 A;  1W63 Q;  3VV4 A;  1N4O A;  4S2N C;  3TOI A;  2ZOI A;  1F2K A;  2XFS A;  1P9W A;  2DMW A;  1VHM A;  1S1Z A;  5HL6 A;  3IT9 A;  1XPB A;  3NOP C;  3VOL A;  5GLB A;  2UWX A;  1K55 C;  4PM5 A;  4RX2 A;  4DF6 A;  4OQI A;  3UDX A;  2VV7 A;  2PAV P;  1K25 A;  1SCW A;  3LIE A;  2EA9 A;  4FH4 A;  5HPF A;  5KSH A;  4EEP A;  3HL9 A;  3P7N A;  4P0M A;  4Y2F A;  2OWJ A;  2Y2G A;  2W3E A;  5FAS A;  5HZH A;  1FIK A;  1PW8 A;  1Z6F A;  4WZ4 A;  4EU0 A;  3V50 A;  3A3E A;  3RFB A;  4NXG A;  1ERQ A;  5TBM A;  3UY6 A;  3LO7 A;  1MPL A;  2R9X A;  2ZLY A;  3ZVT A;  4GW9 A;  4X56 A;  5DKL A;  5C5K A;  2EX9 A;  3ZG9 B;  1SDE A;  4DXB A;  3NDE A;  4F3L B;  2B95 A;  1NJ4 A;  5HDC A;  1I5Q A;  3NIA A;  1H5X A;  1NYY A;  3BFF A;  3S22 A;  4QY5 A;  3A3J A;  5A93 A;  3EEH A;  3SZT A;  4DN0 A;  1P9R A;  1ES5 A;  3MKF A;  1O07 A;  2B02 A;  3B33 A;  3WRT A;  3BM6 A;  1ESI A;  2PBD P;  3EQU A;  3MXS A;  3TRC A;  1XFN A;  3OPH A;  3PR6 A;  5HAP A;  2VGJ A;  2BG1 A;  5HX9 A;  3S4X A;  2JN7 A;  3HUN A;  3MZE A;  1YMS A;  4GS9 A;  3T4O A;  1S1Y A;  1TS0 A;  1VET A;  5G18 A;  3WWX A;  4HY8 A;  3ZHH A;  5L10 A;  1TDG A;  1OJG A;  4BLM A;  4UQI M;  3BYD A;  1VB6 A;  2IWC A;  4PM7 A;  5AVE A;  3BY8 A;  2OLV A;  2R9W A;  3F1P A;  4EET B;  2HJ9 C;  1T1B A;  3D9Y A;  2WKQ A;  1MKM A;  4HI4 A;  3T1S A;  4CLC A;  1T19 A;  3G2Y A;  5TJJ A;  2W1T A;  4HJ3 A;  3LR4 A;  2IA2 A;  3NOT C;  4NEE D;  1LT0 A;  5FI6 A;  5CER A;  3CUE A;  3K2N A;  4OPY A;  1K38 A;  2KDK A;  1PI5 A;  3T50 A;  2Y2P A;  4E04 A;  1M40 A;  2Y91 A;  5MC7 A;  4EUV A;  3QHY A;  4YFM A;  2JBF A;  1FSW A;  3IS2 A;  4IBX A;  1N9O A;  1G6O A;  2DRW A;  3GDI A;  2B18 A;  2VKS A;  2V1Z A;  2G2W A;  4GDB A;  3TSG A;  4KZ7 A;  4JXW A;  3FYZ A;  5CTM A;  1EI5 A;  1EWZ A;  1ES2 A;  3P98 A;  1FCN A;  3B47 A;  2HP6 A;  2PBY A;  2W0N A;  4HQA A;  1Y54 A;  4I3A A;  2KLI A;  3UDI A;  3B3X A;  3OPL A;  2QMI A;  4RQ9 A;  1W8Q A;  2Y55 A;  3IWO A;  3Q7V B;  2BAS A;  2Z2M B;  3T4S A;  3AGE A;  1MWR A;  2JKT I;  1L0F A;  2DNS A;  1GCE A;  2MJ6 A;  3LUQ A;  4XUX A;  1P0Z A;  3QP6 A;  4H8R A;  1S67 L;  4NKP A;  3L7H A;  2P9V B;  1T18 A;  2VA0 A;  5CRF A;  1QMF A;  4U0T A;  2ZM0 A;  4GJ4 A;  3DTK A;  3EEA A;  1SHV A;  4BBV A;  1XXM A;  5EV0 A;  1FR1 A;  3EOI A;  4KQD A;  3VP4 A;  3BEC A;  3BQA A;  3FZC A;  3DTI A;  4KUK A;  3UE6 A;  4WEL A;  3LEZ A;  4G3V A;  3PBQ A;  1CEF A;  3CAX A;  2V0W A;  1WE4 A;  1K54 A;  1PZP A;  4II7 A;  1HZO A;  2M7V A;  3CWF A;  5EVI C;  5TGF A;  4B88 A;  4F3L A;  5CHJ A;  3HLG A;  4R4S A;  1KDW A;  5FAO A;  4P87 A;  3ZQ5 A;  5CED A;  4R38 A;  4QB8 A;  1GA0 A;  1JWP A;  4UQI S;  3LIB A;  1LL5 A;  2M1C A;  1D06 A;  1XJ6 A;  4L9E A;  1W63 M;  3EWK A;  2EX8 A;  4P6Z S;  3M2K A;  2HGV A;  1H0M A;  5AQB A;  1W79 A;  2P7J A;  3SH7 A;  3A0S A;  1IKG A;  4BJP A;  1V9Y A;  1GHM A;  2UV0 E;  2WAF A;  3FKV A;  1K55 A;  3OOV A;  3CPT B;  3QP2 A;  1I2W A;  4HEF A;  4N9K A;  3UB5 P;  3H82 B;  4P6Z M;  4EBL A;  4KUO A;  5DVA A;  4WMC A;  3C5A A;  1ZKJ A;  2FFY A;  4O01 A;  3UB7 A;  3NHQ A;  5DJU A;  2HDQ A;  3T4L A;  4AFI A;  3BFD A;  4UEY A;  5CX7 A;  2WKI A;  3IX3 A;  1NWZ A;  3HLF A;  2Q9M A;  1HLU P;  4HJ6 A;  3PBO A;  1YSQ A;  5HW3 A;  2PYR A;  3L9K A;  1G5U A;  4IVI A;  1CI9 A;  2O9C A;  2WAD A;  2P74 A;  5A8B A;  3BY9 A;  1I2S A;  4IJG A;  3KYQ A;  2XA7 S;  3GEC A;  2PDR A;  3BFG A;  3VSL A;  4ETZ A;  2GJ3 A;  3VOZ A;  2J9P A;  1DRM A;  5DF9 A;  5D3O A;  1K57 A;  1OJ5 A;  4BEN A;  2KOI A;  1WYC A;  4PMA A;  4IED A;  2XK1 A;  1ERO A;  2OSU A;  2XA7 M;  2G7U A;  1OT9 A;  4OON A;  5F68 A;  1EW0 A;  1UGU A;  5EVI A;  2V0U A;  4KZ8 A;  3GV9 A;  4RA7 A;  4F94 A;  5KMW A;  4LV2 A;  2W1T B;  1MKI A;  4L0L A;  5L07 A;  4WZ5 A;  3Q7Z A;  3TW8 A;  1NYM A;  4WBG A;  3KSI A;  4MNR A;  3AGF A;  4IBR A;  3C7V A;  4E3L A;  3QP5 A;  3SS4 A;  3MKE A;  1IKI A;  1ZG4 A;  2AVX A;  1TDL A;  4H6J A;  3LFV A;  4XT2 A;  5HSQ A;  3WS4 A;  5HAR A;  1JVJ A;  3S7O A;  5L8M A;  2C6W B;  1PZO A;  4MMN A;  1CQA A;  2XD1 A;  3O5Y A;  5FQK A;  4GB7 A;  3VP1 A;  4ZDX A;  1ALQ A;  4OOL A;  1K6R A;  2HDR A;  2Y4A A;  3KX0 X;  4DJ2 A;  2ZL1 B;  4Z1W A;  1PFL A;  4I39 A;  5FDS A;  3MXQ A;  2WKE A;  2A24 A;  3PBT A;  2JHE A;  3VFF A;  4BMW A;  1Q2P A;  5A91 A;  5CEB A;  2L0W A;  3OLO A;  4KZ6 A;  4NG2 A;  1DY6 A;  3QP4 A;  3T1X A;  2NUP C;  4LGW A;  3MJQ A;  4ARZ A;  1LHY A;  3JPU A;  4QY6 A;  1RP5 A;  5DKK A;  3WS5 A;  2VV6 A;  5L2F A;  3LIF A;  1NRF A;  4DKI A;  3C2W A;  2WGI A;  3G2Z A;  3GMW A;  5DFY A;  1FQG A;  2ZC6 B;  1MY8 A;  2EWW A;  1X0O A;  4C75 A;  4DE1 A;  3GVB A;  4ESP A;  3S1Y A;  3IBJ A;  2J7V A;  4EER A;  5HDD A;  4QU3 A;  2BTF P;  2Q0O A;  3DW0 A;  2QZ6 A;  4U3T A;  3WS2 A;  5F82 A;  4CQH A;  3IX8 A;  2ZD8 A;  3F1O A;  3VSK A;  4WEK A;  1V9Z A;  4OLG A;  5HAI A;  2PT7 A;  5U47 A;  4MDZ A;  1KGF A;  3C38 A;  4HNB A;  1DP8 A;  3Q81 A;  3KSF A;  3ZVW A;  1YAX A;  1G68 A;  1F5M A;  1F98 A;  3HLB A;  1XA7 A;  1HVB A;  4P6B A;  3BW6 A;  3G35 A;  1L0G A;  4EUZ A;  3N8L A;  5E2H A;  4HES A;  4K0W A;  2EXB A;  4JBF A;  1O7E A;  2OOL A;  5FQ9 A;  1FIL A;  5DTT A;  1SKF A;  1OT6 A;  4X6T A;  2QHK A;  5EUA A;  3N7W A;  2HP9 A;  1E3U A;  5J7E A;  4KZA A;  3PTE A;  2VZW A;  2XDM A;  4XXR A;  3LCE A;  3S7Q A;  3FV7 A;  2PU2 A;  3LI9 A;  2R78 A;  4EQI A;  2XD5 A;  1VEU A;  4LV0 A;  3F1N A;  5BOH A;  1GSW A;  3MZD A;  1JTG A;  2QJ7 A;  4R3A A;  4YIN A;  3A3F A;  5FEG A;  3G6O A;  5KSC A;  4Q0H A;  3K3C A;  3Q1F A;  1BSG A;  3VFH A;  5FI7 A;  3PAE A;  4X1M A;  4FOF A;  2XSS A;  2ZOH A;  3OC2 A;  1OTI A;  1PIO A;  1YLY A;  3LEQ A;  2ZL1 A;  4PM6 A;  4WF0 A;  3IXB A;  1NY0 A;  3OPR A;  2QYB A;  3HUM A;  2W27 A;  4Y0U A;  1NXY A;  2CC1 A;  3ZCZ A;  1GA9 A;  1LLB A;  3HRE A;  4NXB A;  2V20 A;  1N9N A;  5AJG A;  3HCY A;  5EVI B;  3FPV A;  2JCH A;  1H3Q A;  4Q0J A;  1BTL A;  4CLC B;  3OCN A;  3G31 A;  2PR6 A;  1HTZ A;  2WKR A;  4JGQ A;  4LV1 A;  1XA1 A;  1W5D A;  4IUK A;  3N8S A;  5GHZ A;  2A3U A;  1KE4 A;  2PD7 A;  3DTM A;  5KIZ A;  1JNU A;  5AQ9 A;  5E2F A;  3C30 A;  1KE0 A;  2GX5 A;  4PHT A;  3Q82 A;  4CLC E;  2XR0 A;  2Z6D A;  2WKH A;  3HBR A;  3W4O A;  4B4Z A;  3ZDJ A;  5KZH A;  4HBT A;  2X01 A;  3EQV A;  4B9O A;  4GD6 A;  4GHI A;  3G30 A;  4I5S A;  2EX6 A;  1IOU A;  1SZV A;  4DMZ A;  2Z6C A;  3ITB A;  4GS9 B;  4NXE A;  4LEN A;  3RXX A;  5HPI A;  5M19 A;  2E8I A;  4KZ4 A;  1PRQ A;  1S6R A;  4E3K A;  5HFO A;  3BRM A;  1LSW A;  2EXA A;  2INW A;  5AQ7 A;  4P85 A;  2O99 A;  3O86 A;  4MEZ A;  2OAQ 1;  3ITA A;  3F1P B;  2ZBB A;  4E3I A;  2GDN A;  4CJN A;  1TVF A;  3VOY A;  1K6S A;  3SH9 A;  4M3K A;  1YLW A;  4JF5 A;  4OP5 A;  5FQM A;  4KZB A;  1ZG6 A;  1Y4O A;  3FWL A;  1UWN X;  3UE3 A;  2A49 A;  2JKR I;  4EBN A;  1GSX A;  4E6W A;  5L09 A;  4WYY A;  5CHU A;  4ZJ3 A;  1ES3 A;  5GL9 A;  3MQO A;  3N6I A;  3MS6 A;  3GQZ A;  2WUQ A;  4JXS A;  3E4P A;  3W2Z A;  5G4Z A;  2YKH A;  3V3R A;  1XP4 A;  1W7F A;  3A0V A;  3JVU A;  5CHM A;  1ERM A;  1VM1 A;  4ZAM A;  5FAT A;  3IXH A;  1H8Z A;  2K31 A;  1BUE A;  5F5Y A;  4UAA A;  1YLP A;  3E4O A;  3JYI A;  5DF7 A;  3U2A A;  4GDN A;  3HLD A;  4GZB A;  4PKY G;  4HP4 A;  4KG5 A;  4DE3 A;  1Q2Q A;  4QJG A;  5IS1 A;  4X53 A;  4O8G A;  3CMZ A;  1PNE A;  5HAQ A;  4EEU A;  1K54 C;  1JWZ A;  4HP9 A;  3PAG A;  5HWV A;  3KO6 A;  4Y5F A;  5GLA A;  2Y2M A;  3DWZ A;  4K08 A;  5HD5 A;  4X69 A;  3LGO A;  4MCW A;  2V2F F;  2LB5 A;  5CTN A;  3FKW A;  4FSF A;  1LL8 A;  4YNR A;  1ZHH B;  2EFX A;  1LI0 A;  3IF6 B;  3IHA A;  2Z2L B;  1IYQ A;  2ZC4 B;  2P9V A;  3TE8 A;  4DDS A;  2PR5 A;  2B5R A;  3NBL A;  1LL9 A;  3KYE A;  3M6B A;  5J4E A;  5E2G A;  1LSX A;  3SS5 A;  1BZA A;  2L1M A;  3RH8 B;  2QWS A;  5K5B A;  1YKD A;  4OOY A;  2Y8H A;  1NZU A;  2PHY A;  1BLC A;  1XJ3 A;  2VGL S;  2V9A A;  4EV4 A;  4EWF A;  3N8R A;  3UME A;  3HJK A;  3DWK A;  3NJA A;  4FCF A;  4S2M A;  3UN7 A;  1DP6 A;  5FA7 A;  4Y13 A;  3GR2 A;  2JKF A;  5A90 A;  4WUJ A;  2IWD A;  1DP9 A;  2J80 A;  3E98 A;  3O88 A;  2HV1 A;  2VGL M;  4DE2 A;  1H8Y A;  4QWO A;  3W8K A;  2ZQC A;  1ONH A;  1L0E A;  4OPQ A;  5F69 A;  4HH3 A;  1VQQ A;  4Q0I A;  3A3D A;  4B93 A;  1MWS A;  4K91 A;  3R7W B;  2O0Y A;  2ZC5 B;  3LR3 A;  5EE8 A;  5EOE A;  4GHI B;  2K7S A;  4KQO A;  3TG9 A;  1BLS A;  2PRF A;  5HDS A;  2XF3 A;  1G6A A;  3C4P A;  3G34 A;  1XGJ A;  4E3N A;  2Y2N A;  3SS3 A;  2Y2O A;  3E2L A;  4Y3I A;  3ZG5 A;  3HLE A;  2OLU A;  5LBR A;  2GZA A;  1DJA A;  3KYZ A;  3IXD A;  4BD1 A;  5JYO A;  3MMH A;  4I38 A;  5FAP A;  1KE3 A;  3ZG8 B;  5E2E A;  1TD5 A;  2EFU A;  1KVM A;  4Y17 A;  3VP0 A;  3W4Q A;  5F6A A;  1STZ A;  2WZZ A;  5EFW A;  5EM0 A;  3MR0 A;  1YSP A;  5I5L A;  3QP1 A;  4L9F A;  4R70 A;  3IBR A;  3M2J A;  3UE1 A;  4S2N A;  1ES4 A;  5E43 A;  5HWT A;  3IWQ A;  3MSH A;  4E3O A;  3RJU A;  3O3V A;  4Q8I A;  4Y0T A;  1J3W A;  2ZC3 B;  4HIA A;  4X1L A;  2WKP A;  3PBR A;  2P08 A;  4R1G A;  5FDH A;  4YOF A;  2V1B A;  3BFE A;  3NOU C;  3DBA A;  4M4X A;  3SH8 A;  1KGG A;  3ZG7 B;  3WRZ A;  4FH2 A;  2VV8 A;  4MN6 A;  4D2O A;  3PHY A;  3S7N A;  2HPB A;  4XUZ A;  3ZYT A;  4BBT A;  1FCM A;  1BT5 A;  4ME4 A;  3BJN A;  5M18 A;  3KSH A;  3UNW A;  2ZMF A;  2HDS A;  4HJ4 A;  4DDY A;  4UA9 A;  3Q07 A;  4X55 A;  1BUL A;  1G28 A;  5TFQ A;  3OBF A;  5G4Y A;  3FC7 A;  3MFD A;  1IYO A;  4K0X A;  1OME A;  3NY4 A;  3E2K A;  4JXV A;  3PXP A;  1CJF A;  3UB8 A;  1LI9 A;  1QME A;  4RYE A;  5FQJ A;  1K4E A;  2JE5 A;  1YMX A;  1K56 D;  1XFQ A;  2QPN A;  4BL2 A;  4H6J B;  3NI9 A;  1IEL A;  4XT2 B;  3HLW A;  4S2P A;  1K0K A;  2NUT C;  3D4F A;  2XH9 A;  4X68 A;  2ZMA A;  3D3O A;  1OPX A;  1SDN A;  2FZ0 A;  3ZFZ A;  1YQS A;  2Y2L A;  4JGO A;  1ESU A;  3CHW P;  1F9I A;  1IYP A;  2FH5 A;  5GHY A;  1Z09 A;  1MWT A;  2FFF B;  3UB9 A;  2G2U A;  3NEC A;  4JPM A;  4N92 A;  2W3D A;  3ZGA B;  2ZM2 A;  4WLA A;  3CZD A;  3UE0 A;  1CF0 A;  2W3H A;  4QPR A;  5FI2 A;  1E4D A;  3GRJ A;  2HF6 A;  3K3D A;  4ZJ1 A;  2JC7 A;  4N9L A;  5EEC A;  3MF0 A;  2OAP 1;  4Y7P A;  1IYS A;  3T1R A;  2HJE A;  4FD8 A;  3CJM A;  4L9G A;  1DJC A;  4ARZ B;  3D72 A;  3MQ0 A;  4OQG A;  2Y2H A;  2QKP A;  3GTC A;  3BQ8 A;  4DXC A;  1AWI A;  4PM9 A;  4ZJ2 A;  4Z9Q A;  3VE4 A;  3UO9 A;  2ZQ9 A;  4B4X A;  2A2L A;  2PD8 A;  1PW1 A;  5I94 A;  4LCM A;  3RTY A;  1GHP A;  2V8C A;  2ACG A;  2VX8 A;  2XFT A;  2OWH A;  3LR0 A;  4IHQ A;  4MBF A;  3T4J A;  2XRO A;  4WZ5 C;  1XX2 A;  3MZF A;  1FSY A;  2O9B A;  4RX3 A;  4WEJ A;  3T4Q A;  3LR5 A;  1XJ4 A;  1TS6 A;  3C7U A;  3O87 A;  5EVE A;  2VLG A;  4ZTK A;  1M6K A;  2I9V A;  1KOU A;  3DTE A;  4KZ5 A;  1UWP X;  2C5W B;  4GD8 A;  2ZC7 A;  1E3U D;  3B42 A;  4QD4 A;  4HHD A;  3LI8 A;  4OP8 A;  3V39 A;  2X02 A;  1XJ2 A;  3T12 B;  3VP3 A;  1RGZ A;  1L3L A;  2WK0 A;  4JF4 A;  1RGY A;  3IH8 A;  1RCJ A;  4LFU A;  3NUL A;  4GLQ A;  4GCZ A;  3H7W A;  4HH2 A;  4ZBE A;  4MBH A;  4PKY A;  3P01 A;  4QHC A;  3PBS A;  4EBP A;  2Y2K A;  2WGW B;  2DCF A;  2ZMV A;  3OCL A;  3LIC A;  1BYW A;  1U60 A;  3QNB A;  2X71 A;  4ZRR A;  3EGX C;  3DAV A;  1L2S A;  4O7D A;  3IF5 A;  4BWI A;  1L0D A;  2JKG A;  3R4K A;  3F1N B;  5FQQ A;  4MN5 A;  3JVV A;  4DE0 A;  5DTK A;  5FEF A;  3AGD A;  4KG6 A;  4R4R A;  1SKO B;  4LRX C;  1MXO A;  3MFX A;  1P97 A;  1BLP A;  3PBN A;  1K56 A;  4N1X A;  5HWW A;  2RL3 A;  3FG8 A;  4ID4 A;  4C3Q A;  2IWB A;  4U0X A;  3OPP A;  4S2I A;  3C4O A;  4GOG A;  4E6X A;  4KZ9 A;  4S2K A;  1NZO A;  5F1F A;  1CK3 A;  1KGE A;  4EQ1 A;  1S66 L;  4BD0 A;  1GHI A;  4Y15 A;  4JF6 A;  3LY4 A;  2ZM8 A;  2H28 A;  1XKZ A;  5DTS A;  1MBL A;  3HJI A;  5DJT A;  1CEG A;  2PYP A;  1PWC A;  4UHU A;  3UB6 A;  3LID A;  1FOF A;  4PPR A;  1JWV A;  2EWV A;  1D1J A;  3IH9 A;  4R3B A;  4ETX A;  5IHV A;  5J8X A;  4BQM A;  5FAQ A;  5CXW A;  3CI6 A;  3HUO A;  5FSR A;  4OVD A;  1XGI A;  4WMC D;  1FR6 A;  3T4T A;  3V5M A;  2V8F A;  4KQQ A;  1AXB A;  3GSG A;  3CPT A;  4OKP A;  1W8Y A;  4YWZ A;  3IQA A;  1LSV A; 
#chains in the Genus database with same CATH homology
 3ZHH A;  1TDG A;  2Y2N A;  3GVB A;  3S1Y A;  3SS3 A;  4LV3 A;  4BLM A;  2J7V A;  2Y2O A;  4MBK A;  5JYP A;  3E2L A;  3ZG5 A;  3HLE A;  3BYD A;  2IWC A;  3G32 A;  3I7J A;  4PM7 A;  4QU3 A;  2OLU A;  2OLV A;  2R9W A;  3DW0 A;  4WM9 A;  2QZ6 A;  3ZNY A;  4U3T A;  3WS2 A;  4S2L A;  1DJA A;  5F82 A;  5A92 A;  3IXD A;  4BD1 A;  2Y2Q A;  5JYO A;  2EX2 A;  5FAP A;  1KE3 A;  3ZG8 B;  5E2E A;  2EFU A;  2WGV A;  1KVM A;  2H10 A;  2ZD8 A;  3VSK A;  4WEK A;  3W4Q A;  3VP0 A;  3G2Y A;  4OH0 A;  4OLG A;  3G4P A;  5HAI A;  5GHX A;  5HL1 A;  2WZZ A;  5U47 A;  4A5R A;  3A3I A;  5FI6 A;  5CER A;  3WS0 A;  4R23 A;  1KGF A;  4OPY A;  4HBU A;  1K38 A;  4OPR A;  2Q9N A;  3Q81 A;  3BEB A;  4KG2 A;  3ZVW A;  3M2J A;  1PI5 A;  4S2N A;  3UE1 A;  1ES4 A;  2Y2P A;  5E43 A;  1G68 A;  1M40 A;  3IWQ A;  4E3O A;  2Y91 A;  3RJU A;  3HLB A;  3ZNT A;  2H0Y A;  3O3V A;  1XA7 A;  4Q8I A;  1HVB A;  1KVL A;  3QHY A;  4P6B A;  4Y0T A;  4YFM A;  2ZC3 B;  2JBF A;  3PBR A;  3VMA A;  1FSW A;  3G35 A;  4R1G A;  1L0G A;  4EUZ A;  3N8L A;  4IBX A;  5E2H A;  2Y2I A;  4HES A;  4K0W A;  4R3J A;  2EXB A;  5FDH A;  3VP2 A;  4JBF A;  1O7E A;  2BLS A;  2DRW A;  5FQ9 A;  2V1Z A;  3BFE A;  2G2W A;  3UDF A;  5DTT A;  5EVI D;  4GDB A;  3OZH A;  3TSG A;  3SH8 A;  5F83 A;  1KGG A;  1SKF A;  3ZG7 B;  2WYX A;  4KZ7 A;  2ZJ9 A;  4JXW A;  2J8Y A;  3FYZ A;  4X6T A;  5EUA A;  3BLS A;  2HP9 A;  3N7W A;  5CTM A;  5F1G A;  4FH2 A;  4UA6 A;  1E3U A;  3WRZ A;  1EI5 A;  4D2O A;  2WGW A;  1EWZ A;  2HPB A;  4EBP A;  1N9B A;  4XUZ A;  1ES2 A;  4KZA A;  3P98 A;  2ZQD A;  3PTE A;  1FCM A;  2XLN A;  1FCN A;  1BT5 A;  2XDM A;  4XXR A;  4CPK A;  2HP6 A;  2PBY A;  1Y54 A;  3LCE A;  5M18 A;  3UDI A;  3B3X A;  3OPL A;  2QMI A;  3FV7 A;  4DRT A;  3UNW A;  2PU2 A;  2HDS A;  1W8Q A;  2Y55 A;  4DDY A;  3IWO A;  3NDG A;  4UA9 A;  3M6H A;  3Q7V B;  4EQI A;  3Q07 A;  2XD5 A;  2Y59 A;  1DJB A;  1BUL A;  2Z2M B;  4X55 A;  3AGE A;  4LV0 A;  1MWR A;  5TFQ A;  1TEM A;  2ZQ7 A;  5BOH A;  1L0F A;  2DNS A;  1JTG A;  3MZD A;  1YLT A;  3MFD A;  1IYO A;  4K0X A;  1OME A;  3NY4 A;  3E2K A;  4JXV A;  4YIN A;  1GCE A;  4OQH A;  2XQZ A;  3ISG A;  4S2O A;  1ZC2 A;  3UPP A;  3A3F A;  3IWI A;  1JTD A;  1LI9 A;  4LCL A;  4XUX A;  5CEC A;  4H8R A;  1QME A;  1WYB A;  5KSC A;  4RYE A;  2P9V B;  2J9O A;  4GN2 A;  5CRF A;  4E3J A;  1QMF A;  5FQJ A;  1K4E A;  2JE5 A;  1YMX A;  4OOM A;  4U0T A;  2ZM0 A;  4MLL A;  1K56 D;  5CGS A;  3Q1F A;  1SHV A;  1BSG A;  3VFH A;  2QPN A;  3HLC A;  3PAE A;  5FI7 A;  5CGW A;  3IF6 A;  3UPN A;  4BL2 A;  1XXM A;  3NI9 A;  1IEL A;  1FR1 A;  1FCO A;  4GKU A;  3VP4 A;  3HLW A;  4S2P A;  3OC2 A;  3BEC A;  3FZC A;  1PYY A;  4GNU A;  1PIO A;  4R0Q A;  3D4F A;  2XH9 A;  4X68 A;  2ZMA A;  1YLY A;  3LY3 A;  4PM6 A;  1SDN A;  3IXB A;  1NY0 A;  3OPR A;  4WEL A;  3HUM A;  4Y0U A;  1NXY A;  3ZFZ A;  3LEZ A;  1YQS A;  2Y2L A;  3PBQ A;  1YLZ A;  2CC1 A;  1CEF A;  1ESU A;  3ZCZ A;  5GLD A;  1WE4 A;  1IYP A;  1K54 A;  1PZP A;  4E3M A;  1K4F A;  1HZO A;  1GA9 A;  4KQR A;  1LLB A;  3HRE A;  5GHY A;  1C3B A;  1MWT A;  2FFF B;  4C6Y A;  2V20 A;  5EVI C;  4Y0O A;  2G2U A;  4JPM A;  3IHB A;  5TGF A;  4BL3 A;  3W4P A;  4B88 A;  3QNC A;  4N92 A;  4IVK A;  4JLF A;  5FQI A;  2OV5 A;  4JKT A;  5EVI B;  5CHJ A;  2JCH A;  3ZGA B;  3HLG A;  4R4S A;  1KDW A;  2ZM2 A;  1BTL A;  3CZD A;  5FAO A;  3UE0 A;  1CI8 A;  4P87 A;  3OCN A;  3G31 A;  5CED A;  3UPO A;  1HTZ A;  4QB8 A;  1GA0 A;  1JWP A;  1PWD A;  5FI2 A;  4LV1 A;  1W5D A;  1XA1 A;  1E4D A;  3GRJ A;  3N8S A;  5GHZ A;  2A3U A;  1KE4 A;  2JC7 A;  4N9L A;  5EEC A;  1K57 C;  4ZJ1 A;  1LL5 A;  4UA7 A;  4Y7P A;  1IYS A;  1PWG A;  3MBZ A;  3DTM A;  4FD8 A;  3BFC A;  3CJM A;  5AQ9 A;  3P09 A;  2EX8 A;  5AQA A;  1YT4 A;  5E2F A;  1DJC A;  4OLD A;  4OQG A;  3M2K A;  5TR7 A;  1KE0 A;  2Y2H A;  1PI4 A;  5AQB A;  1W79 A;  3Q82 A;  3SH7 A;  3HVF A;  2XR0 A;  3GTC A;  2WKH A;  3HBR A;  4DXC A;  3W4O A;  1IKG A;  4BJP A;  4NET A;  3SOI A;  4B4Z A;  1YLJ A;  1GHM A;  3ZDJ A;  2WAF A;  5KZH A;  3FKV A;  4PM9 A;  1K55 A;  4ZJ2 A;  4Z9Q A;  1J9M A;  4HBT A;  3EQV A;  2HDU A;  2X01 A;  3UO9 A;  1I2W A;  2ZQ9 A;  4GD6 A;  4HEF A;  3G30 A;  2EX6 A;  1MWU A;  4B4X A;  4KZ3 A;  4N9K A;  1PW1 A;  2XEP A;  4LCM A;  5I94 A;  3NCK A;  3ITB A;  3RXX A;  4LEN A;  4EBL A;  5M19 A;  1GHP A;  2E8I A;  4KZ4 A;  4JXG A;  1S6R A;  4E3K A;  5HFO A;  2XFT A;  4WMC A;  5DVA A;  1ONG A;  3BRM A;  5EVL A;  2EXA A;  5AQ7 A;  4P85 A;  3C5A A;  1ZKJ A;  2VGK A;  2FFY A;  2Y2J A;  3O86 A;  4MEZ A;  4MBF A;  5CGX A;  4WZ5 C;  1XX2 A;  2RCX A;  3MZF A;  2HDQ A;  3Q7V A;  3ITA A;  1IEM A;  4E3I A;  2GDN A;  3BFD A;  1FSY A;  3V3S A;  4CJN A;  1TVF A;  3VOY A;  1K6S A;  3SH9 A;  4M3K A;  2WKI A;  1YLW A;  4S2J A;  4RX3 A;  4JF5 A;  4WEJ A;  5DF8 A;  3HLF A;  5GLC A;  4OP5 A;  2Q9M A;  5FQM A;  4KZB A;  4E3N A;  4NK3 A;  1ZG6 A;  1YM1 A;  3FWL A;  3UE3 A;  2H0T A;  2A49 A;  3PBO A;  4EBN A;  5HW3 A;  3C7U A;  3O87 A;  4E6W A;  3IF6 C;  4WYY A;  4ZTK A;  5EOO A;  1M6K A;  5CHU A;  4OQ0 A;  4IVI A;  4ZJ3 A;  1CI9 A;  1ES3 A;  5GL9 A;  4KZ5 A;  2C5W B;  3N6I A;  4GD8 A;  2WAD A;  2ZC7 A;  2P74 A;  3GQZ A;  3WS1 A;  1E3U D;  2WUQ A;  4JXS A;  4KEN B;  1I2S A;  4QD4 A;  3RXW A;  4N1H A;  4OP8 A;  3V3R A;  3BFG A;  3V39 A;  2X02 A;  1XP4 A;  1W7F A;  4PM5 A;  3VSL A;  3NC8 A;  3VOZ A;  2HP5 A;  2J9P A;  5CHM A;  5EPH A;  3CG5 A;  1ERM A;  2WAE A;  5DF9 A;  1VM1 A;  1RGZ A;  4RVA A;  4ZAM A;  5D3O A;  3VP3 A;  1K57 A;  1BLH A;  2WK0 A;  2ZQ8 A;  5FAT A;  3IXH A;  1H8Z A;  4JF4 A;  1RGY A;  3IH8 A;  2H5S A;  1BUE A;  4BEN A;  4UAA A;  1YLP A;  5M1A A;  1RCJ A;  1WYC A;  3JYI A;  5DF7 A;  2WZX A;  4GDN A;  3HLD A;  4GZB A;  1KDS A;  3ZG0 A;  4PMA A;  4IED A;  2XK1 A;  4MBH A;  4ZBE A;  4KG5 A;  3IXG A;  3PBS A;  3BLM A;  4OPZ A;  4QHC A;  1ERO A;  2Y2K A;  2OSU A;  1Q2Q A;  2WGW B;  2ZQA A;  4OON A;  4DE3 A;  4X53 A;  2DCF A;  4QJG A;  2PU4 A;  3OCL A;  3CMZ A;  3MXR A;  2XGN A;  5HAQ A;  1U60 A;  4PM8 A;  3QNB A;  5EVI A;  1K54 C;  2X71 A;  4KZ8 A;  1JWZ A;  3GV9 A;  3PAG A;  4RA7 A;  4F94 A;  1S0W A;  3N4I A;  1L2S A;  2Y2M A;  5GLA A;  4O7D A;  5KMW A;  3DWZ A;  1HD8 A;  3IF5 A;  4LV2 A;  1MKI A;  1E25 A;  2I72 A;  4X69 A;  4L0L A;  1L0D A;  2V2F F;  4WZ5 A;  3Q7Z A;  1N4O A;  4S2N C;  3TOI A;  5FQQ A;  2XFS A;  1NYM A;  4DE0 A;  5CTN A;  4WBG A;  5DTK A;  3FKW A;  3IT9 A;  1XPB A;  4FSF A;  4MNR A;  3AGF A;  5GLB A;  4IBR A;  3C7V A;  4E3L A;  2UWX A;  3AGD A;  1K55 C;  2EFX A;  1IKI A;  3MKE A;  4KG6 A;  1LI0 A;  3SS4 A;  4RX2 A;  1ZG4 A;  3IF6 B;  3IHA A;  1TDL A;  2Z2L B;  1IYQ A;  4OQI A;  4R4R A;  3UDX A;  4DF6 A;  1K25 A;  1SCW A;  2P9V A;  2ZC4 B;  4FH4 A;  3WS4 A;  5HAR A;  4DDS A;  1JVJ A;  2B5R A;  3NBL A;  5KSH A;  1MXO A;  2C6W B;  1LL9 A;  3HL9 A;  1PZO A;  1BLP A;  3PBN A;  2XD1 A;  4P0M A;  1K56 A;  3M6B A;  4N1X A;  2RL3 A;  5E2G A;  2Y2G A;  5FQK A;  3SS5 A;  1BZA A;  4ID4 A;  4GB7 A;  5FAS A;  3VP1 A;  4C3Q A;  1PW8 A;  4ZDX A;  1ALQ A;  1Z6F A;  4OOL A;  4WZ4 A;  1K6R A;  2HDR A;  2Y4A A;  4OOY A;  2IWB A;  4U0X A;  3V50 A;  3A3E A;  3OPP A;  4S2I A;  3C4O A;  4GOG A;  4E6X A;  4KZ9 A;  1ERQ A;  3UY6 A;  1NZU A;  4S2K A;  3LO7 A;  1BLC A;  2WKE A;  1MPL A;  2R9X A;  1NZO A;  5F1F A;  1CK3 A;  1KGE A;  3PBT A;  4BD0 A;  2ZLY A;  1GHI A;  4JF6 A;  3VFF A;  3ZVT A;  4EV4 A;  4X56 A;  3LY4 A;  4EWF A;  3N8R A;  2ZM8 A;  1Q2P A;  2EX9 A;  1XKZ A;  3DWK A;  5DTS A;  4FCF A;  1SDE A;  4S2M A;  5A91 A;  1MBL A;  3ZG9 B;  4DXB A;  5CEB A;  3UN7 A;  4KZ6 A;  3NDE A;  1CEG A;  5FA7 A;  1PWC A;  4UHU A;  3GR2 A;  1NJ4 A;  1DY6 A;  1FOF A;  1I5Q A;  5A90 A;  4PPR A;  1JWV A;  3IH9 A;  3NIA A;  4R3B A;  2IWD A;  1H5X A;  1NYY A;  3BFF A;  5IHV A;  3S22 A;  4QY5 A;  3A3J A;  5A93 A;  5J8X A;  3O88 A;  1ES5 A;  1LHY A;  3MKF A;  1O07 A;  4BQM A;  1H8Y A;  3WRT A;  5FAQ A;  4DE2 A;  4QY6 A;  1RP5 A;  3BM6 A;  5CXW A;  3W8K A;  3WS5 A;  2ZQC A;  1ESI A;  1ONH A;  3HUO A;  5FSR A;  4OVD A;  3EQU A;  1L0E A;  4OPQ A;  5L2F A;  3MXS A;  1VQQ A;  1NRF A;  1XGI A;  4WMC D;  1FR6 A;  3A3D A;  3V5M A;  4DKI A;  1MWS A;  4K91 A;  3OPH A;  2ZC5 B;  2WGI A;  3G2Z A;  5EE8 A;  4KQQ A;  5EOE A;  5HAP A;  2VGJ A;  1AXB A;  3GSG A;  2BG1 A;  3GMW A;  4OKP A;  5HX9 A;  1FQG A;  2ZC6 B;  3S4X A;  1MY8 A;  4KQO A;  1W8Y A;  3HUN A;  3TG9 A;  1BLS A;  3MZE A;  1YMS A;  3IQA A;  2XF3 A;  1G6A A;  3C4P A;  3G34 A;  5G18 A;  4C75 A;  1XGJ A;  3WWX A;  4DE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...