1DJBA

Structure of beta-lactamase precursor, s70a mutant, at 298k
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYAATSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Structure and kinetics of the beta-lactamase mutants S70A and K73H from Staphylococcus aureus PC1.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 96
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1996-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1djbA00
3WS5A 3WS0A 3OZHA 1E4DA 4JF5A 4RVAA 4MNRA 2XF3A 5CGSA 2PBYA 5JYPA 3UE1A 4BENA 3VFFA 4N1HA 1IYPA 5FAOA 1Y54A 2XGNA 3ISGA 3IHAA 2PU4A 4DDYA 4WZ4A 3BRMA 3HREA 1NZOA 4OP5A 4OPYA 4UHUA 3OCLA 4KZ8A 3WS2A 3HLFA 3ZG0A 1ES3A 4D2OA 1ZKJA 5TFQA 3M6BA 3AGFA 4DE1A 3HLDA 3VP4A 3C4PA 4PM9A 2DCFA 3VP0A 2Z2MB 4JLFA 1XGIA 1Q2PA 3GSGA 3E2LA 3PTEA 3I7JA 4QJGA 1FSWA 2VGJA 3FKWA 4X56A 3VP2A 1KE3A 4FD8A 5HAQA 5FATA 3ZVWA 1IYQA 4E3LA 2P74A 3CJMA 3HLWA 1DJAA 1G68A 4GN2A 3Q7VA 5DTTA 3WWXA 4Q8IA 3EQUA 2JC7A 4LV3A 4KZ9A 3HUOA 2JE5A 1SCWA 3GRJA 3OPRA 2A3UA 5CEBA 4YINA 4LV1A 1PW1A 3MKEA 3V3RA 5U47A 3IF6A 4NK3A 3HLCA 4UA9A 3VP3A 4MBHA 1YLZA 2WGIA 3VFHA 4KENB 1HD8A 1L2SA 1IKIA 4JXSA 4C75A 2EFUA 4RYEA 3Q7VB 2XLNA 4KZAA 5CRFA 4IBRA 5G18A 1O7EA 4QHCA 2H10A 1KVMA 3ZG5A 2Y2JA 1VM1A 1CI9A 3MBZA 4JF4A 3ZGAB 3NI9A 3VMAA 1H5XA 2EXAA 1BZAA 2PU2A 5HW3A 3PAEA 2VGKA 3G32A 5L2FA 4PM7A 3ZG7B 1RCJA 1FCNA 1YLPA 4ZJ2A 4PM5A 3IH8A 4ID4A 2BG1A 4ZTKA 1LI9A 1NY0A 2XR0A 1YMSA 2Y2HA 4KZ7A 3OPLA 4E3KA 4OP8A 3NC8A 5E2FA 4OQIA 2WZZA 3C4OA 4S2KA 4GOGA 4OQ0A 5DTSA 2WADA 2XFTA 1U60A 1ES4A 1W79A 5EPHA 2J7VA 2ZM0A 1NYMA 5HL1A 1NJ4A 1PWDA 2Y2IA 3UDIA 4S2PA 5FI7A 5EECA 1I5QA 1JWVA 1SKFA 1DJBA 3O86A 1TDLA 2XD1A 4S2JA 1O07A 3C5AA 4M3KA 1G6AA 4QB8A 4MBKA 4U3TA 4UA7A 5HAIA 3LO7A 3IF5A 4WEJA 3GVBA 3C7UA 5CHMA 5DVAA 5AQ7A 3V50A 3S4XA 4F94A 2HP6A 1KGFA 4DKIA 1KDWA 4BL3A 3RXWA 1GA0A 1KE0A 2HDRA 4S2MA 1E3UD 1XGJA 1M6KA 1TEMA 3QNBA 2ZM8A 4OKPA 5FI6A 1E3UA 3V5MA 1S0WA 3LY4A 1IEMA 1YLWA 1WYCA 2V2FF 2Y91A 3Q81A 3VP1A 5A93A 4PPRA 3SOIA 2DRWA 3Q1FA 3UO9A 3BYDA 1RP5A 4Y0TA 1PI5A 4E6XA 3ZCZA 1NZUA 4GD8A 4KZ6A 4S2NA 3MKFA 4HEFA 4OLGA 1FQGA 3BFGA 1OMEA 3BFCA 4PMAA 2Y2LA 5GLCA 3A3EA 5CHUA 5HAPA 4GZBA 4KZ3A 4XXRA 4EBPA 1K25A 2WGVA 3G30A 4WEKA 5M1AA 4BD1A 5JYOA 4DE0A 1ONGA 4HESA 4IEDA 4WM9A 5GLDA 4JXWA 4R3BA 1HVBA 3ZDJA 4XUXA 4WYYA 5M18A 4EUZA 1GHIA 4R4RA 4WBGA 5FI2A 1Z6FA 1KGGA 5FAPA 1JWZA 2XH9A 3V3SA 2IWCA 2WAEA 5E2EA 5FQKA 4OLDA 3IF6C 4B4XA 3HL9A 2OSUA 3FYZA 4KG5A 1DY6A 5GHZA 2H5SA 1ESIA 2ZC6B 2Z2LB 3MZFA 3A3FA 4JKTA 4P87A 5GL9A 2ZQAA 3JYIA 3PBTA 1FR1A 4E3IA 3IXDA 2Y2MA 3TSGA 4GKUA 2XK1A 5TGFA 5F83A 1ESUA 2EX6A 1IYOA 2XQZA 4S2LA 5EOOA 3M2JA 1CI8A 1PYYA 5CTMA 2ZC3B 3O3VA 2WUQA 5EVID 1EWZA 1NRFA 5EVIA 1I2WA 4Y0OA 4E3MA 3RXXA 3TG9A 4CJNA 4CPKA 2CC1A 5FA7A 4X69A 3SS5A 2HDQA 3GR2A 1QMFA 1XPBA 2WKEA 4ZBEA 3UPOA 3P09A 1C3BA 4BLMA 1BT5A 3S1YA 3FKVA 4S2OA 4P85A 4MLLA 5CECA 4DF6A 2X01A 4GB7A 3IXHA 4B4ZA 4R23A 1YMXA 2J9OA 2E8IA 3A3JA 3MFDA 4WMCD 4N9LA 3VOYA 3NY4A 4A5RA 4JPMA 4BJPA 4P6BA 4UA6A 5EVIB 3M6HA 5BOHA 2RCXA 2BLSA 2HDSA 4HBUA 4OOYA 3PBOA 4KZBA 1PZPA 2EXBA 3DW0A 3MZDA 1BLCA 2WZXA 1L0FA 3AGDA 4Y0UA 2V20A 4LV0A 5KZHA 4B88A 3IF6B 2QPNA 1CEGA 1GHMA 3GV9A 5CHJA 3ITAA 5A91A 2QMIA 4WZ5A 1N9BA 4E3NA 4ZDXA 5FASA 4OVDA 3S22A 4ZJ1A 1N4OA 4OONA 2WKHA 4FSFA 4S2IA 5FDHA 4C6YA 1FCOA 1WE4A 1MPLA 1NYYA 3HUMA 1JVJA 4N9KA 3G2ZA 3NIAA 3LY3A 5F1GA 2ZC4B 3DWKA 2XEPA 4OOLA 5AQBA 2XD5A 3IXBA 1BUEA 4N92A 5AQAA 4OOMA 3OCNA 5FQIA 4S2NC 4FCFA 1ERQA 1YM1A 2XFSA 1W7FA 5FQJA 1PW8A 2EX2A 5HX9A 2Y2OA 5EUAA 5FQQA 3MXSA 3FWLA 1IKGA 1ES5A 4R3JA 4EV4A 3CZDA 4U0XA 3SH8A 3GTCA 2G2UA 5F1FA 5GHYA 3UPPA 1MKIA 2ZJ9A 3UE3A 1JWPA 2DNSA 3BFEA 3MXRA 1ES2A 4IVKA 1ZC2A 4L0LA 1E25A 2XDMA 3G35A 3ZHHA 3IWQA 4RA7A 4LCLA 4KQQA 5GHXA 4KG6A 1FSYA 4YFMA 5FAQA 4KG2A 5A92A 3FZCA 3ZG8B 2HP5A 1W8YA 3WS1A 2Y2PA 4ZAMA 4EQIA 2ZLYA 3GMWA 2Y59A 4QY6A 3WRZA 1K54A 1GHPA 4X68A 1YLTA 1BLPA 4GDNA 1IELA 4R4SA 1BSGA 1XP4A 4GDBA 3UN7A 4DDSA 4IVIA 4BL2A 1K38A 1TDGA 1FOFA 3AGEA 3IWOA 3A3DA 4MBFA 5J8XA 3RJUA 4RX3A 1ZG4A 5EVIC 2ZC7A 5CGWA 3VSLA 3HLEA 3DTMA 1CEFA 3FV7A 4JBFA 4U0TA 2B5RA 3LEZA 3M2KA 5DF8A 1KDSA 2Y55A 4X55A 5A90A 4JXGA 1ERMA 2HP9A 2C6WB 1MWTA 1AXBA 1LLBA 3SH7A 1MXOA 3W8KA 1PI4A 4FH4A 5E2GA 1HTZA 3N8LA 2WAFA 3HLGA 1K4FA 1XX2A 1BULA 3OC2A 5CTNA 5GLAA 2OV5A 3W4PA 5D3OA 2X71A 1MY8A 2QZ6A 2RL3A 2ZQDA 3OPHA 2Y2QA 4KZ5A 2EX8A 2Y2KA 3EQVA 4OH0A 2Q9MA 5GLBA 1K57A 4P0MA 2ZD8A 4DE2A 3BECA 4E3OA 3G34A 4LV2A 1W5DA 1XA1A 3NCKA 3IHBA 5E2HA 4C3QA 4WZ5C 3HBRA 4X6TA 4ZJ3A 4DXCA 5EVLA 1Q2QA 3PBSA 1ALQA 5AQ9A 3O87A 3BLSA 4NETA 4PM8A 1K6RA 1L0GA 2UWXA 3N8RA 3IQAA 2OLUA 3HUNA 3P98A 2H0YA 3BEBA 4O7DA 2EX9A 1KGEA 1FR6A 1J9MA 1ONHA 5CEDA 3NDGA 4R1GA 1K55A 1HZOA 1MWSA 1QMEA 3UDXA 4Y7PA 1K4EA 5DF7A 3G2YA 5HARA 1LI0A 3VOZA 3N6IA 2H0TA 3QNCA 3PBQA 5F82A 4WMCA 1BLSA 3HLBA 3QHYA 1SDNA 3IXGA 5EOEA 4BQMA 5TR7A 3WRTA 4OQHA 1XA7A 5I94A 3Q82A 3IWIA 4EBLA 4XUZA 2WK0A 1L0EA 3ZNTA 4DRTA 1PWGA 1W8QA 4E3JA 3W4QA 3GQZA 3ZG9B 2ZQCA 1LHYA 5CGXA 4MEZA 3ZNYA 3N8SA 4UAAA 1BLHA 5IHVA 5DTKA 5FQMA 2ZQ7A 3ZFZA 3PBRA 4R0QA 3D4FA 1NXYA 1YLJA 1BTLA 3UPNA 2ZQ8A 1YQSA 4KQOA 5M19A 2WKIA 1PZOA 3Q07A 4FH2A 3PAGA 2HPBA 1K54C 1GCEA 3NBLA 2Y4AA 3WS4A 5KSCA 3ITBA 2R9XA 3SS3A 5E43A 4DE3A 3UNWA 2ZC5B 2ZM2A 3B3XA 1ZG6A 1RGZA 1K6SA 1S6RA 4DXBA 3CG5A 1L0DA 2FFYA 3ZVTA 3BM6A 1JTDA 1MBLA 4LCMA 4EBNA 2G2WA 4PM6A 4X53A 3UDFA 1LL9A 1PWCA 4KZ4A 1YT4A 1EI5A 4WELA 1GA9A 3SH9A 3E2KA 4K0WA 3G31A 3V39A 2WYXA 2JCHA 4QY5A 2Q9NA 1EROA 1XKZA 2GDNA 3W4OA 4QU3A 3VSKA 5CXWA 5HFOA 3SS4A 2P9VA 3G4PA 1JTGA 2ZMAA 3CMZA 4KQRA 3HVFA 4E6WA 4JF6A 2V1ZA 4JXVA 2IWDA 3IH9A 4BD0A 4H8RA 1M40A 2IWBA 5FSRA 4K91A 3BFFA 3UE0A 1H8YA 2A49A 2Y2NA 3NDEA 4OPRA 4Z9QA 1LL5A 3PBNA 1WYBA 1K57C 2OLVA 5KSHA 1VQQA 1TVFA 1H8ZA 2WGWA 1DJCA 1XXMA 3BLMA 1YLYA 5CERA 1IYSA 4K0XA 4HBTA 1MWUA 1KE4A 2EFXA 3BFDA 1FCMA 1MWRA 2P9VB 3N4IA 3Q7ZA 2X02A 1CK3A 3OPPA 2R9WA 3MZEA 2Y2GA 5KMWA 5DF9A 4IBXA 2HDUA 3C7VA 5FQ9A 3UY6A 1K56D 1RGYA 3N7WA 2I72A 2JBFA 4N1XA 3LCEA 1I2SA 4RX2A 1K56A 1PIOA 2C5WB 3A3IA 1SDEA 5EE8A 1K55C 4OPQA 1KVLA 3IT9A 2WGWB 2ZQ9A 4GD6A 4OPZA 4QD4A 4EWFA 4OQGA 4GNUA 3TOIA 2J8YA 2J9PA 4LENA 3DWZA 3O88A 2FFFB 1SHVA
chains in the Genus database with same CATH superfamily
1E4DA 4JF5A 4MNRA 3JVVA 3IHAA 5DJUA 1D1JA 2PU4A 2W1RA 3LIEA 4DDYA 3BQ8A 3EWKA 4ETZA 3HREA 2PD7A 3LIAA 3E4PA 4UQIM 2ZL1B 1ZKJA 5TFQA 3VP4A 4PM9A 1XGIA 1Q2PA 3GSGA 3PTEA 1FSWA 4FD8A 2ZMFA 4DN0A 3HLWA 3WWXA 4KZ9A 3PXPA 5FL3A 1SCWA 4HJ3A 1T18A 2OWJA 5AVFA 2B18A 3V3RA 5U47A 1SZVA 4NK3A 3HLCA 1H8MA 3VP3A 2WGIA 3VFHA 4KENB 1HD8A 1IKIA 4JXSA 1H3QA 5DFXA 4GS9A 4GLQA 4IBRA 1O7EA 1CI9A 3NI9A 3A0SA 2L0WA 1YSPA 4I38A 4EW7A 4WUJA 2W3DA 4BBTA 1YLPA 4ZJ2A 3IH8A 4ZTKA 1LI9A 1NY0A 2Y2HA 3NC8A 3BJNA 4X1LA 4GOGA 1PNEA 2ZBBA 3RTYA 1N9LA 1NYMA 1PWDA 4S2PA 1SKOA 3O86A 4LRYC 4MDZA 4O0PA 1G6AA 5HAIA 4P6ZS 4WEJA 3V50A 3C7UA 2HP6A 4BL3A 4Y13A 1GA0A 1M6KA 3LR3A 4OKPA 3KYQA 4H6JB 2DRWA 3UO9A 2VA0A 4GD8A 4HEFA 4Q0HA 5GLCA 3G30A 3TRCA 5M1AA 4IEDA 2EWVA 4WM9A 5HWWA 2J3WA 5M18A 4M4XA 1OPXA 4Z1WA 3MF0A 3MS6A 4OLDA 1PFLA 4B4XA 2OSUA 3FYZA 3BW6A 4GJ4A 4JKTA 3T1QB 5C5KA 4E3IA 3IXDA 2Y2MA 4GKUA 1YAXA 4S2LA 1PYYA 2PD8A 2G7UA 3O3VA 4IUKA 5HD3A 3MQQA 1OTEA 1I2WA 4Y0OA 1LSXA 3RXXA 5FA7A 1VETB 1OT6A 2HDQA 3UMDA 1C3BA 3BY9A 4BLMA 1BT5A 3S1YA 1JNUA 4S2OA 4MLLA 2EA9A 3IXHA 4R23A 1CF0A 2E8IA 2XSSA 2YKHA 1LSWA 2RCXA 2JKRM 3PBOA 3DW0A 3MZDA 4FOFA 3AGDA 4ME4A 2V20A 4AFIA 3IF6B 3GV9A 3T1RA 4KUOA 4ZDXA 3S22A 4I3JA 1JVJA 3G2ZA 1Z09A 4NKPA 3DWKA 4Y3IA 5AQBA 2XD5A 4F3LB 2PYRA 5FDSA 3MXQA 3CUEC 1YM1A 2XFSA 1AWIA 1ODVA 1IKGA 4R3JA 5EFWA 3T4TA 5EM0A 3UPPA 5MC7A 2ZJ9A 1XJ6A 1JWPA 3BFEA 1ZC2A 3CI6A 2M7UA 3DTEA 3ZHHA 2V0UA 4KQQA 4KG6A 3R7WA 3ZG8B 2HP5A 1TD5A 1K54A 1W63Q 3IX3A 1BLPA 3UN7A 4IVIA 4YNRA 3AGEA 2V8FA 4EUVA 1MC0A 5J8XA 3F1OA 3LR0A 3KYEA 1DP6A 4I39A 3HLEA 3DTMA 2B5RA 3LEZA 3M2KA 2Y55A 3LEQA 1ERMA 3QP2A 2HP9A 2A2LA 1MWTA 2O9CA 3FPVA 2WAFA 2OV5A 3W4PA 2X71A 1MY8A 3CAXA 4IUHA 5GLBA 4JGRA 1XA1A 4CLCE 5E2HA 3T12B 4X6TA 1Q2QA 1OJGA 1T1CA 2P08A 5HWVA 5F68A 1L0GA 3IQAA 3UB5P 3C38A 2OLUA 3HUNA 3BEBA 1K55A 1QMEA 3UDXA 1V9YA 4Y7PA 3G2YA 2Y79A 3LUQA 5K5BA 3QHYA 4CLCD 5TR7A 4OQHA 1XA7A 3Q82A 1W8QA 3W4QA 3GQZA 5TJJA 2ZQCA 3ZNYA 5TBMB 2CMNA 3KSIA 3PBRA 4Y2FA 4CLCB 5DFYA 4Q0JA 3SS3A 4DE3A 3UNWA 4DJ3A 1ZG6A 2HJ9C 3CG5A 1MBLA 1OTDA 4EBNA 4Y17A 4HP4A 3SH9A 3H7WB 3LIFA 3OBFA 3EGDC 4HQAA 2KDKA 3EEHA 3K3DA 3HVFA 4JF6A 2V1ZA 2IWBA 5FSRA 3LI9A 4X1MA 5CX7A 4Z9QA 3NDEA 1LL5A 4HJ6A 1KOUA 1G28A 1H8ZA 1DJCA 1FCMA 3Q7ZA 3LIBA 3ULFA 3OPPA 1NLZA 2R9WA 2Y2GA 4IBXA 3UY6A 3N7WA 4N1XA 4OPQA 3KX0X 4DJ2A 3IT9A 3C8CA 4OPZA 2ZQ9A 4GNUA 2J8YA 5A8BA 2J9PA 2K2NA 4LENA 3O88A 4KQRA 3QP1A 2XROA 4EQ1A 3T4LA 4RVAA 4CLCC 2XF3A 2PBYA 2ACGA 3UE1A 1Y28A 4BENA 2XGNA 4OP5A 4UHUA 2EWWA 3TE8A 3GDIA 1EW0A 1DRMA 3AGFA 3HLDA 2Z2MB 4HJ4A 4JLFA 4QJGA 4X56A 1KE3A 5DTTA 1G68A 2QYBA 2JC7A 4LV3A 3HUOA 4O8GA 2A3UA 3A0RA 3SW1A 5KIZA 3MKEA 1TS6A 3F1NA 2WKQA 1YLZA 4RYEA 5CRFA 2XLNA 3C30A 1S66L 4P6ZM 1VM1A 3MBZA 3DAVA 3VMAA 4L9GA 3FPWA 2PU2A 2XRNA 3PAEA 3A0VA 2LB9A 3BWLA 4PM7A 1RCJA 3O5YA 4PM5A 5HPIA 4WF0A 4GS9B 2XR0A 1TS8A 1YMSA 4OP8A 3QP8A 5E2FA 5HWTA 2QWSA 2QJ5A 1W79A 3MQOA 3T4QA 3T4SA 3UDIA 5EECA 1I5QA 2Z6CA 1DJBA 2XD1A 1O07A 3C5AA 3LIDA 4QB8A 4UA7A 5AQ7A 5CHMA 4F94A 2M1CA 1KDWA 3PYPA 5EV0A 1XGJA 4PHTA 1S0WA 1IEMA 5L07A 4R3AA 3B47A 1SKOB 5A93A 4PPRA 4G3VA 1PI5A 4E6XA 4QPRA 4S2NA 3BFGA 1OMEA 2Y2LA 2PAVP 4BD1A 1ONGA 4HESA 2JKGA 2VGLS 4JXWA 1HVBA 5DKLA 1F9IA 1XJ3A 5FAPA 1JWZA 1XFNA 4HOIA 3LR5A 5E2EA 1J3WA 4LRXC 4KG5A 3E0YA 1DY6A 1X0OA 2VK3A 5GHZA 1ESIA 4P87A 2W0NA 1UWPX 2XA7S 3OOVA 1FR1A 3PR6A 2A24A 3TSGA 2XK1A 5F83A 1ESUA 1IYOA 5EOOA 5AJGA 1CI8A 5CTMA 2ZC3B 4LFUA 2FH5A 5EVIA 4CJNA 2CC1A 3GR2A 2BTFP 5FEGA 2PT7A 1G5UA 5HDDA 2O0YA 4GB7A 4B4ZA 2IA2A 4N9LA 1CQAA 1WA9A 3CITA 2HV1A 4UA6A 3M6HA 5BOHA 2HDSA 4OOYA 2VEAA 2GNXA 3K3CA 4B88A 5CHJA 2QPNA 5A91A 2QMIA 1N9BA 4ZJ1A 1N4OA 4C6YA 1T19A 3RFBA 3NIAA 2ZC4B 1BUEA 3NECA 3S7NA 1W7FA 5FQJA 4K08A 3MXSA 3FWLA 3CPTA 1D06A 3SH8A 3GTCA 2G2UA 3MJQA 3MXRA 4L0LA 2VX8A 1E25A 2XDMA 5IU1A 1Y4OA 4LCLA 5GHXA 3JVUA 2V8CA 4HH3A 2L1MA 5A92A 2GZAA 4ZAMA 4EQIA 4X68A 4WN5A 3F1PA 4R4SA 4DDSA 1H0MA 3CLOA 1FOFA 4MBFA 3R7WB 3RJUA 2ZC7A 2PRFA 4JBFA 2M7VA 2VJWA 1KDSA 4X55A 3LICA 2C6WB 3W8KA 4FH4A 4ZRRA 1GSVA 2PBDP 4IHQA 1K4FA 1BULA 3OC2A 5F5YA 3F1OB 5CTNA 5GLAA 3T4OA 2Y2KA 3EQVA 1K57A 4P0MA 2ZD8A 4DE2A 3BECA 3T4KA 4E3OA 3IHBA 2Y8HA 3HBRA 5EVEA 1P9WA 4ZJ3A 5EVLA 3NULA 4ARZA 3BLSA 1K6RA 2I9VA 3N8RA 4EERA 2H0YA 1KGEA 2EX9A 1J9MA 3NDGA 4R1GA 1HZOA 4MCWA 5DF7A 3VV4A 3PBQA 3MMHA 1BLSA 1SDNA 3IXGA 3HCYA 3WRTA 5I94A 3IWIA 2KOIA 3VE4A 4XUZA 1L0EA 4HP9A 3ZNTA 1PWGA 3U4LP 1STZA 1LHYA 4MEZA 2KLIA 4UAAA 5IHVA 4L9EA 2UV0E 3IS2B 4R0QA 3D4FA 1YLJA 2QHKA 1BTLA 2ZQ8A 4E04A 1A0KA 2WKIA 3BQAA 5M19A 3Q07A 4FH2A 3PAGA 1G6OA 2HPBA 1K54C 2P7JA 2ZM2A 1RGZA 1L0DA 4NXBA 2G2WA 4I3AA 4PM6A 4X53A 4WELA 3E2KA 3G6OA 3G31A 3V39A 2Q9NA 1EROA 1XKZA 4JGQA 4QU3A 3EGXC 5CXWA 3G4PA 2VZWA 1JTGA 4E6WA 2J80A 3E4QA 1M40A 2PR5A 3UB8A 2A49A 3BY8A 3IBJA 1PRQA 1VQQA 1TVFA 4WLAA 1XXMA 1NWZA 3MFXA 2EFXA 3N4IA 2P04A 4XT2A 1UGUA 5KMWA 1T1BA 5DJTA 2HDUA 4LGWA 1K56A 1PIOA 2C5WB 5EE8A 1SDEA 1K55C 4QD4A 4EWFA 3DTIA 1F98A 2FFFB 4ESPA 3WS5A 3MSHA 3OZHA 1P97A 5JYPA 3DBAA 1ZTUA 2W3GA 5FAOA 3ZYTA 3ISGA 2W27A 4NXFA 4WZ4A 1NZOA 4OPYA 3OCLA 2AVXA 4KZ8A 3WS2A 1LSVA 3HLFA 4D2OA 4LLOB 4LRZE 3M6BA 4DE1A 2WKPA 3C4PA 2DCFA 3VP0A 3SZTA 3E2LA 3I7JA 3VP2A 3P7NA 2MJ6A 5HAQA 5FATA 3ZVWA 4E3LA 3CJMA 4GN2A 3Q7VA 4EESA 2K31A 1BYWA 2JE5A 4YINA 4JGPA 4LV1A 3IF6A 4UA9A 4MBHA 2HZ5A 3JPUA 1L2SA 5G4ZA 2PR6A 4B93A 5G18A 4QHCA 4F3LA 3ZG5A 2Y2JA 5IS1A 1MZUA 2EXAA 1BZAA 3RH8B 1CJFA 1XJ2A 2VV8A 2VGKA 2O9BA 3F1NB 3G32A 3ZG7B 5L10A 1FCNA 4EXOA 4ID4A 2BG1A 4PAUA 4E3KA 1S1YA 5FEFA 5HD5A 4S2KA 4OQ0A 5DTSA 4I3IA 1ES4A 4HIAA 2J7VA 2ZM0A 5HDCA 4NXEA 1NJ4A 1JWVA 4S2JA 4M3KA 4MBKA 3LO7A 5DVAA 3UB9A 3GVBA 2VGLM 3S4XA 4UEYA 4D60A 1KE0A 2HDRA 3H82A 1E3UA 3V5MA 1YLWA 1FILA 3SOIA 4GHIA 3BYDA 1RP5A 4Y0TA 2XA7M 2NUPC 2JN7A 1NZUA 3P01A 4KZ6A 3ZCZA 4EEUA 3BFCA 4PMAA 1V9ZA 3A3EA 3T4JA 3UMEA 4GZBA 4KZ3A 4XXRA 4EBPA 4WEKA 1F5MA 2GX5A 4R3BA 4GW9A 1GHIA 4NEED 4WBGA 2ZMVA 1KGGA 2XH9A 3UE6A 2IWCA 2WAEA 2JKTI 3NOTC 2Q0OA 2ZC6B 2Z2LB 3MZFA 3U2AA 1VEUA 5TGFA 3T50A 1DP9A 1N9NA 2WUQA 5EVID 1NRFA 1OTIA 3TG9A 4CPKA 4X69A 1XPBA 2A24B 3P09A 3FKVA 1T1AA 5CECA 4DF6A 2X01A 1YMXA 2J9OA 3MFDA 4WMCD 3NY4A 4BJPA 5EVIB 4HBUA 3L7HA 2EXBA 4II7A 1L0FA 4Y0UA 3LYXA 4LV0A 3VOLA 5KZHA 1D7EA 1CEGA 1GHMA 4WZ5A 4E3NA 5FASA 2WKHA 4FSFA 4S2IA 3VE3A 1FCOA 1MPLA 1NYYA 5F1GA 2XEPA 3S7QA 3IXBA 4N92A 3OCNA 3ZQ5A 5FQIA 4S2NC 2ZOIA 4FCFA 2K7SA 1PW8A 2EX2A 5EUAA 4NG2A 4EV4A 2W3EA 1K0KA 3KSHA 3QP4A 5F1FA 2KX6A 5GHYA 1VB6A 3QP6A 5HDSA 3UE3A 4IVKA 1UWNX 3G35A 2V1BA 3IWQA 2QJ7A 1FSYA 4YFMA 4MMNA 4KG2A 4BBUA 3CPTB 1W8YA 2J3TD 2Y2PA 3KSFA 3WRZA 1GHPA 2H28A 1YLTA 1OTAA 2W1TA 3T1SA 4BL2A 3A3DA 5EVIC 5CGWA 3FV7A 1CEFA 5HPFA 5DF8A 3F1PB 5A90A 2V0WA 1AXBA 2R78A 3SH7A 1MXOA 4I5SA 5E2GA 3PHYA 1HTZA 3N8LA 3HLGA 1XX2A 5D3OA 2ZQDA 2RL3A 1OT9A 4R70A 2Y2QA 5EM1A 1TS0A 3IBRA 1YSQA 5J4EA 1W5DA 3B42A 1XFQA 3PBSA 4PM8A 4KQDA 1FR6A 5CEDA 4X25A 1MWSA 1P0ZA 1LI0A 4HNBA 3VOZA 4WMCA 4ARZB 3MR0A 5EOEA 4BQMA 1YPRA 2WK0A 1OTBA 4DRTA 4BBVA 4E3JA 3ZG9B 1ACFA 1TF1A 3R4KA 3N8SA 1BLHA 5FQMA 2OOLA 3ZFZA 1NXYA 3UPNA 1PZOA 1GCEA 3NBLA 2J3TC 3WS4A 1L3LA 3B3XA 2FFYA 3ZVTA 3BM6A 4LCMA 1LL9A 1PWCA 4KZ4A 3D3OA 1EI5A 1GA9A 5F6AA 4K0WA 2WYXA 2JCHA 4QY5A 3LFVA 3W4OA 2B02A 4G3KA 3SS4A 2P9VA 3OLOA 3CMZA 2ZMAA 4JXVA 2IWDA 3IH9A 4BD0A 4H8RA 2V1AA 2YKFA 4K91A 3UE0A 2QKPA 2LB5A 4R6LA 3PBNA 1WYBA 1K57C 2OLVA 5KSHA 1XJ4A 1YKDA 2WGWA 3BLMA 5CERA 1IYSA 1CK3A 3MZEA 5DF9A 5G4YA 3NJAA 1K56D 2I72A 2JBFA 4RX2A 3A3IA 4MN7A 2DMWA 4GD6A 4DMZA 3IX4A 3TOIA 3IX8A 5L8MA 3DWZA 1SHVA 3WS0A 2ZL1A 4XT2B 1IFQA 2JKTM 3L9KA 5CGSA 5I5LA 3VFFA 4N1HA 1IYPA 1Y54A 2PHYA 2V9AA 3BRMA 3KYZA 3ZG0A 1ES3A 4NXGA 3ICYA 3KO6A 2VGJA 3FKWA 1S1ZA 2W3FA 1IYQA 2P74A 1DJAA 4Q8IA 3EQUA 5IT5A 3GRJA 3OPRA 4Y5FA 5CEBA 1PW1A 3EEAA 3TW8A 2INWA 2VV7A 2VLGA 3KSGA 4C75A 2EFUA 3Q7VB 4KZAA 4UQIS 4YOFA 1S4SA 3B33A 2H10A 1KVMA 1P9RA 3GECA 4JF4A 3ZGAB 4HH2A 1H5XA 5HW3A 2B95A 2D01A 5L2FA 5J3WA 3HJIA 4HHDA 3D72A 4KZ7A 3HJKA 3OPLA 4OQIA 2WZZA 3C4OA 4FTXA 2WADA 2XFTA 1U60A 5EPHA 5HL1A 5HSQA 2Y2IA 5FI7A 1SKFA 1TDLA 4H6JA 4U3TA 3IF5A 1KGFA 4DKIA 1ZHHB 3RXWA 4S2MA 1E3UD 3NOUC 4KUKA 4BMWA 1TEMA 3QNBA 2ZM8A 5FI6A 3LY4A 2V2FF 1WYCA 2Y91A 3Q81A 3VP1A 2Z6DA 3Q1FA 3LR4A 3MKFA 2OWHA 3CUEA 4OLGA 1FQGA 3DTKA 5J7EA 3H82B 5CHUA 5HAPA 1K25A 2WGVA 5JYOA 4DE0A 5GLDA 4PKYA 3ZDJA 4GHIB 4MN5A 4WYYA 4XUXA 4EUZA 4R4RA 1OJ5A 5FI2A 1Z6FA 1F2KA 3V3SA 2D02A 5FQKA 3IF6C 3HL9A 3CHWP 2H5SA 2OAQ1 3A3FA 1VETA 5GL9A 2ZQAA 3JYIA 3PBTA 2GJ3A 3T1XA 2BASA 2EX6A 2XQZA 1S4RA 3LGOA 3M2JA 1EWZA 1LL8A 4E3MA 3SS5A 1QMFA 4ZBEA 2WKEA 3UPOA 2JKFA 3QP5A 1VEUB 4P85A 4R38A 3A3JA 5HL6A 3VOYA 4A5RA 4JPMA 4P6BA 2BLSA 4JGOA 3IS2A 4KZBA 1PZPA 1BLCA 2WZXA 3C2WA 4GCZA 3ITAA 2OAP1 4OVDA 2L4RA 2PDRA 3UB7A 4OONA 5DKKA 5FDHA 1WE4A 3HUMA 4N9KA 3LY3A 3H9WA 4OOLA 5AQAA 4OOMA 3E98A 2NUTC 3MQ0A 1ERQA 4EETB 4PKYG 2Y2OA 5FQQA 5HX9A 1ES5A 3CZDA 4U0XA 1MKIA 5AVEA 2FZ0A 3NHQA 2DNSA 1ES2A 2HF6A 4RA7A 4QWOA 1NRJA 5FAQA 4EEPA 3CWFA 3FZCA 4ETXA 3WS1A 1GSWA 2ZLYA 3GMWA 2Y59A 4QY6A 3FC7A 4Q0IA 4GDNA 1IELA 1BSGA 1XP4A 4GDBA 2E8JA 1K38A 1TDGA 3IWOA 3NOPC 4RX3A 1ZG4A 3TJZC 3VSLA 4U0TA 3S7PA 4YWZA 2W1TB 4JXGA 2ZOHA 1LLBA 1NLYA 1PI4A 2QZ6A 4RQ9A 3OPHA 4KZ5A 2EX8A 4OH0A 2Q9MA 1N9OA 1IOUA 2O9AA 3G34A 4LV2A 1TS7A 3D9YA 3NCKA 3E4OA 4C3QA 4WZ5C 4DXCA 1ALQA 5AQ9A 3O87A 4NETA 1FIKA 2UWXA 1W63M 3P98A 2VV6A 4O7DA 1ONHA 4HY8A 1K4EA 1LT0A 5HARA 2JHEA 3N6IA 2H0TA 3EOIA 3QNCA 2PYPA 5F82A 3HLBA 5TBMA 3K2NA 3W2ZA 1GSXA 3LI8A 4CLCA 1DP8A 4EBLA 4FUWA 2JKRI 4L9FA 5CGXA 5DTKA 5HZHA 5L09A 2ZQ7A 1YQSA 4KQOA 4Y15A 3H7WA 5KSCA 2Y4AA 3ITBA 2WKRA 2R9XA 4O01A 5E43A 2ZC5B 1K6SA 2HJEA 1S6RA 4DXBA 1JTDA 3UDFA 1YT4A 2VKSA 3FG8A 5LBRA 2GDNA 4LPZA 3VSKA 5F69A 5HFOA 4IJGA 1MKMA 4HI4A 4CQHA 3BFFA 4BWIA 1H8YA 2Y2NA 4OPRA 4B9OA 3UB6A 4EU0A 1YLYA 4K0XA 4HBTA 1MWUA 1S67L 1KE4A 3BFDA 1MWRA 2P9VB 2X02A 2HGVA 2O99A 4WL9A 2W3HA 3C7VA 4G3WA 5FQ9A 3S7OA 1RGYA 3LCEA 1I2SA 4MN6A 1KVLA 1VHMA 2WGWB 4OQGA 1HLUP 3V67A
chains in the Genus database with same CATH topology
3WS5A 3WS0A 3OZHA 1E4DA 4JF5A 4RVAA 4MNRA 2XF3A 5CGSA 2PBYA 5JYPA 3UE1A 4BENA 3VFFA 4N1HA 1IYPA 5FAOA 1Y54A 2XGNA 3ISGA 3IHAA 2PU4A 4DDYA 4WZ4A 3BRMA 3HREA 1NZOA 4OP5A 4OPYA 4UHUA 3OCLA 4KZ8A 3WS2A 3HLFA 3ZG0A 1ES3A 4D2OA 1ZKJA 5TFQA 3M6BA 3AGFA 4DE1A 3HLDA 3VP4A 3C4PA 4PM9A 2DCFA 3VP0A 2Z2MB 4JLFA 1XGIA 1Q2PA 3GSGA 3E2LA 3PTEA 3I7JA 4QJGA 1FSWA 2VGJA 3FKWA 4X56A 3VP2A 1KE3A 4FD8A 5HAQA 5FATA 3ZVWA 1IYQA 4E3LA 2P74A 3CJMA 3HLWA 1DJAA 1G68A 4GN2A 3Q7VA 5DTTA 3WWXA 4Q8IA 3EQUA 2JC7A 4LV3A 4KZ9A 3HUOA 2JE5A 1SCWA 3GRJA 3OPRA 2A3UA 5CEBA 4YINA 4LV1A 1PW1A 3MKEA 3V3RA 5U47A 3IF6A 4NK3A 3HLCA 4UA9A 3VP3A 4MBHA 1YLZA 2WGIA 3VFHA 4KENB 1HD8A 1L2SA 1IKIA 4JXSA 4C75A 2EFUA 4RYEA 3Q7VB 2XLNA 4KZAA 5CRFA 4IBRA 5G18A 1O7EA 4QHCA 2H10A 1KVMA 3ZG5A 2Y2JA 1VM1A 1CI9A 3MBZA 4JF4A 3ZGAB 3NI9A 3VMAA 1H5XA 2EXAA 1BZAA 2PU2A 5HW3A 3PAEA 2VGKA 3G32A 5L2FA 4PM7A 3ZG7B 1RCJA 1FCNA 1YLPA 4ZJ2A 4PM5A 3IH8A 4ID4A 2BG1A 4ZTKA 1LI9A 1NY0A 2XR0A 1YMSA 2Y2HA 4KZ7A 3OPLA 4E3KA 4OP8A 3NC8A 5E2FA 4OQIA 2WZZA 3C4OA 4S2KA 4GOGA 4OQ0A 5DTSA 2WADA 2XFTA 1U60A 1ES4A 1W79A 5EPHA 2J7VA 2ZM0A 1NYMA 5HL1A 1NJ4A 1PWDA 2Y2IA 3UDIA 4S2PA 5FI7A 5EECA 1I5QA 1JWVA 1SKFA 1DJBA 3O86A 1TDLA 2XD1A 4S2JA 1O07A 3C5AA 4M3KA 1G6AA 4QB8A 4MBKA 4U3TA 4UA7A 5HAIA 3LO7A 3IF5A 4WEJA 3GVBA 3C7UA 5CHMA 5DVAA 5AQ7A 3V50A 3S4XA 4F94A 2HP6A 1KGFA 4DKIA 1KDWA 4BL3A 3RXWA 1GA0A 1KE0A 2HDRA 4S2MA 1E3UD 1XGJA 1M6KA 1TEMA 3QNBA 2ZM8A 4OKPA 5FI6A 1E3UA 3V5MA 1S0WA 3LY4A 1IEMA 1YLWA 1WYCA 2V2FF 2Y91A 3Q81A 3VP1A 5A93A 4PPRA 3SOIA 2DRWA 3Q1FA 3UO9A 3BYDA 1RP5A 4Y0TA 1PI5A 4E6XA 3ZCZA 1NZUA 4GD8A 4KZ6A 4S2NA 3MKFA 4HEFA 4OLGA 1FQGA 3BFGA 1OMEA 3BFCA 4PMAA 2Y2LA 5GLCA 3A3EA 5CHUA 5HAPA 4GZBA 4KZ3A 4XXRA 4EBPA 1K25A 2WGVA 3G30A 4WEKA 5M1AA 4BD1A 5JYOA 4DE0A 1ONGA 4HESA 4IEDA 4WM9A 5GLDA 4JXWA 4R3BA 1HVBA 3ZDJA 4XUXA 4WYYA 5M18A 4EUZA 1GHIA 4R4RA 4WBGA 5FI2A 1Z6FA 1KGGA 5FAPA 1JWZA 2XH9A 3V3SA 2IWCA 2WAEA 5E2EA 5FQKA 4OLDA 3IF6C 4B4XA 3HL9A 2OSUA 3FYZA 4KG5A 1DY6A 5GHZA 2H5SA 1ESIA 2ZC6B 2Z2LB 3MZFA 3A3FA 4JKTA 4P87A 5GL9A 2ZQAA 3JYIA 3PBTA 1FR1A 4E3IA 3IXDA 2Y2MA 3TSGA 4GKUA 2XK1A 5TGFA 5F83A 1ESUA 2EX6A 1IYOA 2XQZA 4S2LA 5EOOA 3M2JA 1CI8A 1PYYA 5CTMA 2ZC3B 3O3VA 2WUQA 5EVID 1EWZA 1NRFA 5EVIA 1I2WA 4Y0OA 4E3MA 3RXXA 3TG9A 4CJNA 4CPKA 2CC1A 5FA7A 4X69A 3SS5A 2HDQA 3GR2A 1QMFA 1XPBA 2WKEA 4ZBEA 3UPOA 3P09A 1C3BA 4BLMA 1BT5A 3S1YA 3FKVA 4S2OA 4P85A 4MLLA 5CECA 4DF6A 2X01A 4GB7A 3IXHA 4B4ZA 4R23A 1YMXA 2J9OA 2E8IA 3A3JA 3MFDA 4WMCD 4N9LA 3VOYA 3NY4A 4A5RA 4JPMA 4BJPA 4P6BA 4UA6A 5EVIB 3M6HA 5BOHA 2RCXA 2BLSA 2HDSA 4HBUA 4OOYA 3PBOA 4KZBA 1PZPA 2EXBA 3DW0A 3MZDA 1BLCA 2WZXA 1L0FA 3AGDA 4Y0UA 2V20A 4LV0A 5KZHA 4B88A 3IF6B 2QPNA 1CEGA 1GHMA 3GV9A 5CHJA 3ITAA 5A91A 2QMIA 4WZ5A 1N9BA 4E3NA 4ZDXA 5FASA 4OVDA 3S22A 4ZJ1A 1N4OA 4OONA 2WKHA 4FSFA 4S2IA 5FDHA 4C6YA 1FCOA 1WE4A 1MPLA 1NYYA 3HUMA 1JVJA 4N9KA 3G2ZA 3NIAA 3LY3A 5F1GA 2ZC4B 3DWKA 2XEPA 4OOLA 5AQBA 2XD5A 3IXBA 1BUEA 4N92A 5AQAA 4OOMA 3OCNA 5FQIA 4S2NC 4FCFA 1ERQA 1YM1A 2XFSA 1W7FA 5FQJA 1PW8A 2EX2A 5HX9A 2Y2OA 5EUAA 5FQQA 3MXSA 3FWLA 1IKGA 1ES5A 4R3JA 4EV4A 3CZDA 4U0XA 3SH8A 3GTCA 2G2UA 5F1FA 5GHYA 3UPPA 1MKIA 2ZJ9A 3UE3A 1JWPA 2DNSA 3BFEA 3MXRA 1ES2A 4IVKA 1ZC2A 4L0LA 1E25A 2XDMA 3G35A 3ZHHA 3IWQA 4RA7A 4LCLA 4KQQA 5GHXA 4KG6A 1FSYA 4YFMA 5FAQA 4KG2A 5A92A 3FZCA 3ZG8B 2HP5A 1W8YA 3WS1A 2Y2PA 4ZAMA 4EQIA 2ZLYA 3GMWA 2Y59A 4QY6A 3WRZA 1K54A 1GHPA 4X68A 1YLTA 1BLPA 4GDNA 1IELA 4R4SA 1BSGA 1XP4A 4GDBA 3UN7A 4DDSA 4IVIA 4BL2A 1K38A 1TDGA 1FOFA 3AGEA 3IWOA 3A3DA 4MBFA 5J8XA 3RJUA 4RX3A 1ZG4A 5EVIC 2ZC7A 5CGWA 3VSLA 3HLEA 3DTMA 1CEFA 3FV7A 4JBFA 4U0TA 2B5RA 3LEZA 3M2KA 5DF8A 1KDSA 2Y55A 4X55A 5A90A 4JXGA 1ERMA 2HP9A 2C6WB 1MWTA 1AXBA 1LLBA 3SH7A 1MXOA 3W8KA 1PI4A 4FH4A 5E2GA 1HTZA 3N8LA 2WAFA 3HLGA 1K4FA 1XX2A 1BULA 3OC2A 5CTNA 5GLAA 2OV5A 3W4PA 5D3OA 2X71A 1MY8A 2QZ6A 2RL3A 2ZQDA 3OPHA 2Y2QA 4KZ5A 2EX8A 2Y2KA 3EQVA 4OH0A 2Q9MA 5GLBA 1K57A 4P0MA 2ZD8A 4DE2A 3BECA 4E3OA 3G34A 4LV2A 1W5DA 1XA1A 3NCKA 3IHBA 5E2HA 4C3QA 4WZ5C 3HBRA 4X6TA 4ZJ3A 4DXCA 5EVLA 1Q2QA 3PBSA 1ALQA 5AQ9A 3O87A 3BLSA 4NETA 4PM8A 1K6RA 1L0GA 2UWXA 3N8RA 3IQAA 2OLUA 3HUNA 3P98A 2H0YA 3BEBA 4O7DA 2EX9A 1KGEA 1FR6A 1J9MA 1ONHA 5CEDA 3NDGA 4R1GA 1K55A 1HZOA 1MWSA 1QMEA 3UDXA 4Y7PA 1K4EA 5DF7A 3G2YA 5HARA 1LI0A 3VOZA 3N6IA 2H0TA 3QNCA 3PBQA 5F82A 4WMCA 1BLSA 3HLBA 3QHYA 1SDNA 3IXGA 5EOEA 4BQMA 5TR7A 3WRTA 4OQHA 1XA7A 5I94A 3Q82A 3IWIA 4EBLA 4XUZA 2WK0A 1L0EA 3ZNTA 4DRTA 1PWGA 1W8QA 4E3JA 3W4QA 3GQZA 3ZG9B 2ZQCA 1LHYA 5CGXA 4MEZA 3ZNYA 3N8SA 4UAAA 1BLHA 5IHVA 5DTKA 5FQMA 2ZQ7A 3ZFZA 3PBRA 4R0QA 3D4FA 1NXYA 1YLJA 1BTLA 3UPNA 2ZQ8A 1YQSA 4KQOA 5M19A 2WKIA 1PZOA 3Q07A 4FH2A 3PAGA 2HPBA 1K54C 1GCEA 3NBLA 2Y4AA 3WS4A 5KSCA 3ITBA 2R9XA 3SS3A 5E43A 4DE3A 3UNWA 2ZC5B 2ZM2A 3B3XA 1ZG6A 1RGZA 1K6SA 1S6RA 4DXBA 3CG5A 1L0DA 2FFYA 3ZVTA 3BM6A 1JTDA 1MBLA 4LCMA 4EBNA 2G2WA 4PM6A 4X53A 3UDFA 1LL9A 1PWCA 4KZ4A 1YT4A 1EI5A 4WELA 1GA9A 3SH9A 3E2KA 4K0WA 3G31A 3V39A 2WYXA 2JCHA 4QY5A 2Q9NA 1EROA 1XKZA 2GDNA 3W4OA 4QU3A 3VSKA 5CXWA 5HFOA 3SS4A 2P9VA 3G4PA 1JTGA 2ZMAA 3CMZA 4KQRA 3HVFA 4E6WA 4JF6A 2V1ZA 4JXVA 2IWDA 3IH9A 4BD0A 4H8RA 1M40A 2IWBA 5FSRA 4K91A 3BFFA 3UE0A 1H8YA 2A49A 2Y2NA 3NDEA 4OPRA 4Z9QA 1LL5A 3PBNA 1WYBA 1K57C 2OLVA 5KSHA 1VQQA 1TVFA 1H8ZA 2WGWA 1DJCA 1XXMA 3BLMA 1YLYA 5CERA 1IYSA 4K0XA 4HBTA 1MWUA 1KE4A 2EFXA 3BFDA 1FCMA 1MWRA 2P9VB 3N4IA 3Q7ZA 2X02A 1CK3A 3OPPA 2R9WA 3MZEA 2Y2GA 5KMWA 5DF9A 4IBXA 2HDUA 3C7VA 5FQ9A 3UY6A 1K56D 1RGYA 3N7WA 2I72A 2JBFA 4N1XA 3LCEA 1I2SA 4RX2A 1K56A 1PIOA 2C5WB 3A3IA 1SDEA 5EE8A 1K55C 4OPQA 1KVLA 3IT9A 2WGWB 2ZQ9A 4GD6A 4OPZA 4QD4A 4EWFA 4OQGA 4GNUA 3TOIA 2J8YA 2J9PA 4LENA 3DWZA 3O88A 2FFFB 1SHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WS5 A;  3WS0 A;  3OZH A;  1E4D A;  4JF5 A;  4RVA A;  4MNR A;  2XF3 A;  5CGS A;  2PBY A;  5JYP A;  3UE1 A;  4BEN A;  3VFF A;  4N1H A;  1IYP A;  5FAO A;  1Y54 A;  2XGN A;  3ISG A;  3IHA A;  2PU4 A;  4DDY A;  4WZ4 A;  3BRM A;  3HRE A;  1NZO A;  4OP5 A;  4OPY A;  4UHU A;  3OCL A;  4KZ8 A;  3WS2 A;  3HLF A;  3ZG0 A;  1ES3 A;  4D2O A;  1ZKJ A;  5TFQ A;  3M6B A;  3AGF A;  4DE1 A;  3HLD A;  3VP4 A;  3C4P A;  4PM9 A;  2DCF A;  3VP0 A;  2Z2M B;  4JLF A;  1XGI A;  1Q2P A;  3GSG A;  3E2L A;  3PTE A;  3I7J A;  4QJG A;  1FSW A;  2VGJ A;  3FKW A;  4X56 A;  3VP2 A;  1KE3 A;  4FD8 A;  5HAQ A;  5FAT A;  3ZVW A;  1IYQ A;  4E3L A;  2P74 A;  3CJM A;  3HLW A;  1DJA A;  1G68 A;  4GN2 A;  3Q7V A;  5DTT A;  3WWX A;  4Q8I A;  3EQU A;  2JC7 A;  4LV3 A;  4KZ9 A;  3HUO A;  2JE5 A;  1SCW A;  3GRJ A;  3OPR A;  2A3U A;  5CEB A;  4YIN A;  4LV1 A;  1PW1 A;  3MKE A;  3V3R A;  5U47 A;  3IF6 A;  4NK3 A;  3HLC A;  4UA9 A;  3VP3 A;  4MBH A;  1YLZ A;  2WGI A;  3VFH A;  4KEN B;  1HD8 A;  1L2S A;  1IKI A;  4JXS A;  4C75 A;  2EFU A;  4RYE A;  3Q7V B;  2XLN A;  4KZA A;  5CRF A;  4IBR A;  5G18 A;  1O7E A;  4QHC A;  2H10 A;  1KVM A;  3ZG5 A;  2Y2J A;  1VM1 A;  1CI9 A;  3MBZ A;  4JF4 A;  3ZGA B;  3NI9 A;  3VMA A;  1H5X A;  2EXA A;  1BZA A;  2PU2 A;  5HW3 A;  3PAE A;  2VGK A;  3G32 A;  5L2F A;  4PM7 A;  3ZG7 B;  1RCJ A;  1FCN A;  1YLP A;  4ZJ2 A;  4PM5 A;  3IH8 A;  4ID4 A;  2BG1 A;  4ZTK A;  1LI9 A;  1NY0 A;  2XR0 A;  1YMS A;  2Y2H A;  4KZ7 A;  3OPL A;  4E3K A;  4OP8 A;  3NC8 A;  5E2F A;  4OQI A;  2WZZ A;  3C4O A;  4S2K A;  4GOG A;  4OQ0 A;  5DTS A;  2WAD A;  2XFT A;  1U60 A;  1ES4 A;  1W79 A;  5EPH A;  2J7V A;  2ZM0 A;  1NYM A;  5HL1 A;  1NJ4 A;  1PWD A;  2Y2I A;  3UDI A;  4S2P A;  5FI7 A;  5EEC A;  1I5Q A;  1JWV A;  1SKF A;  1DJB A;  3O86 A;  1TDL A;  2XD1 A;  4S2J A;  1O07 A;  3C5A A;  4M3K A;  1G6A A;  4QB8 A;  4MBK A;  4U3T A;  4UA7 A;  5HAI A;  3LO7 A;  3IF5 A;  4WEJ A;  3GVB A;  3C7U A;  5CHM A;  5DVA A;  5AQ7 A;  3V50 A;  3S4X A;  4F94 A;  2HP6 A;  1KGF A;  4DKI A;  1KDW A;  4BL3 A;  3RXW A;  1GA0 A;  1KE0 A;  2HDR A;  4S2M A;  1E3U D;  1XGJ A;  1M6K A;  1TEM A;  3QNB A;  2ZM8 A;  4OKP A;  5FI6 A;  1E3U A;  3V5M A;  1S0W A;  3LY4 A;  1IEM A;  1YLW A;  1WYC A;  2V2F F;  2Y91 A;  3Q81 A;  3VP1 A;  5A93 A;  4PPR A;  3SOI A;  2DRW A;  3Q1F A;  3UO9 A;  3BYD A;  1RP5 A;  4Y0T A;  1PI5 A;  4E6X A;  3ZCZ A;  1NZU A;  4GD8 A;  4KZ6 A;  4S2N A;  3MKF A;  4HEF A;  4OLG A;  1FQG A;  3BFG A;  1OME A;  3BFC A;  4PMA A;  2Y2L A;  5GLC A;  3A3E A;  5CHU A;  5HAP A;  4GZB A;  4KZ3 A;  4XXR A;  4EBP A;  1K25 A;  2WGV A;  3G30 A;  4WEK A;  5M1A A;  4BD1 A;  5JYO A;  4DE0 A;  1ONG A;  4HES A;  4IED A;  4WM9 A;  5GLD A;  4JXW A;  4R3B A;  1HVB A;  3ZDJ A;  4XUX A;  4WYY A;  5M18 A;  4EUZ A;  1GHI A;  4R4R A;  4WBG A;  5FI2 A;  1Z6F A;  1KGG A;  5FAP A;  1JWZ A;  2XH9 A;  3V3S A;  2IWC A;  2WAE A;  5E2E A;  5FQK A;  4OLD A;  3IF6 C;  4B4X A;  3HL9 A;  2OSU A;  3FYZ A;  4KG5 A;  1DY6 A;  5GHZ A;  2H5S A;  1ESI A;  2ZC6 B;  2Z2L B;  3MZF A;  3A3F A;  4JKT A;  4P87 A;  5GL9 A;  2ZQA A;  3JYI A;  3PBT A;  1FR1 A;  4E3I A;  3IXD A;  2Y2M A;  3TSG A;  4GKU A;  2XK1 A;  5TGF A;  5F83 A;  1ESU A;  2EX6 A;  1IYO A;  2XQZ A;  4S2L A;  5EOO A;  3M2J A;  1CI8 A;  1PYY A;  5CTM A;  2ZC3 B;  3O3V A;  2WUQ A;  5EVI D;  1EWZ A;  1NRF A;  5EVI A;  1I2W A;  4Y0O A;  4E3M A;  3RXX A;  3TG9 A;  4CJN A;  4CPK A;  2CC1 A;  5FA7 A;  4X69 A;  3SS5 A;  2HDQ A;  3GR2 A;  1QMF A;  1XPB A;  2WKE A;  4ZBE A;  3UPO A;  3P09 A;  1C3B A;  4BLM A;  1BT5 A;  3S1Y A;  3FKV A;  4S2O A;  4P85 A;  4MLL A;  5CEC A;  4DF6 A;  2X01 A;  4GB7 A;  3IXH A;  4B4Z A;  4R23 A;  1YMX A;  2J9O A;  2E8I A;  3A3J A;  3MFD A;  4WMC D;  4N9L A;  3VOY A;  3NY4 A;  4A5R A;  4JPM A;  4BJP A;  4P6B A;  4UA6 A;  5EVI B;  3M6H A;  5BOH A;  2RCX A;  2BLS A;  2HDS A;  4HBU A;  4OOY A;  3PBO A;  4KZB A;  1PZP A;  2EXB A;  3DW0 A;  3MZD A;  1BLC A;  2WZX A;  1L0F A;  3AGD A;  4Y0U A;  2V20 A;  4LV0 A;  5KZH A;  4B88 A;  3IF6 B;  2QPN A;  1CEG A;  1GHM A;  3GV9 A;  5CHJ A;  3ITA A;  5A91 A;  2QMI A;  4WZ5 A;  1N9B A;  4E3N A;  4ZDX A;  5FAS A;  4OVD A;  3S22 A;  4ZJ1 A;  1N4O A;  4OON A;  2WKH A;  4FSF A;  4S2I A;  5FDH A;  4C6Y A;  1FCO A;  1WE4 A;  1MPL A;  1NYY A;  3HUM A;  1JVJ A;  4N9K A;  3G2Z A;  3NIA A;  3LY3 A;  5F1G A;  2ZC4 B;  3DWK A;  2XEP A;  4OOL A;  5AQB A;  2XD5 A;  3IXB A;  1BUE A;  4N92 A;  5AQA A;  4OOM A;  3OCN A;  5FQI A;  4S2N C;  4FCF A;  1ERQ A;  1YM1 A;  2XFS A;  1W7F A;  5FQJ A;  1PW8 A;  2EX2 A;  5HX9 A;  2Y2O A;  5EUA A;  5FQQ A;  3MXS A;  3FWL A;  1IKG A;  1ES5 A;  4R3J A;  4EV4 A;  3CZD A;  4U0X A;  3SH8 A;  3GTC A;  2G2U A;  5F1F A;  5GHY A;  3UPP A;  1MKI A;  2ZJ9 A;  3UE3 A;  1JWP A;  2DNS A;  3BFE A;  3MXR A;  1ES2 A;  4IVK A;  1ZC2 A;  4L0L A;  1E25 A;  2XDM A;  3G35 A;  3ZHH A;  3IWQ A;  4RA7 A;  4LCL A;  4KQQ A;  5GHX A;  4KG6 A;  1FSY A;  4YFM A;  5FAQ A;  4KG2 A;  5A92 A;  3FZC A;  3ZG8 B;  2HP5 A;  1W8Y A;  3WS1 A;  2Y2P A;  4ZAM A;  4EQI A;  2ZLY A;  3GMW A;  2Y59 A;  4QY6 A;  3WRZ A;  1K54 A;  1GHP A;  4X68 A;  1YLT A;  1BLP A;  4GDN A;  1IEL A;  4R4S A;  1BSG A;  1XP4 A;  4GDB A;  3UN7 A;  4DDS A;  4IVI A;  4BL2 A;  1K38 A;  1TDG A;  1FOF A;  3AGE A;  3IWO A;  3A3D A;  4MBF A;  5J8X A;  3RJU A;  4RX3 A;  1ZG4 A;  5EVI C;  2ZC7 A;  5CGW A;  3VSL A;  3HLE A;  3DTM A;  1CEF A;  3FV7 A;  4JBF A;  4U0T A;  2B5R A;  3LEZ A;  3M2K A;  5DF8 A;  1KDS A;  2Y55 A;  4X55 A;  5A90 A;  4JXG A;  1ERM A;  2HP9 A;  2C6W B;  1MWT A;  1AXB A;  1LLB A;  3SH7 A;  1MXO A;  3W8K A;  1PI4 A;  4FH4 A;  5E2G A;  1HTZ A;  3N8L A;  2WAF A;  3HLG A;  1K4F A;  1XX2 A;  1BUL A;  3OC2 A;  5CTN A;  5GLA A;  2OV5 A;  3W4P A;  5D3O A;  2X71 A;  1MY8 A;  2QZ6 A;  2RL3 A;  2ZQD A;  3OPH A;  2Y2Q A;  4KZ5 A;  2EX8 A;  2Y2K A;  3EQV A;  4OH0 A;  2Q9M A;  5GLB A;  1K57 A;  4P0M A;  2ZD8 A;  4DE2 A;  3BEC A;  4E3O A;  3G34 A;  4LV2 A;  1W5D A;  1XA1 A;  3NCK A;  3IHB A;  5E2H A;  4C3Q A;  4WZ5 C;  3HBR A;  4X6T A;  4ZJ3 A;  4DXC A;  5EVL A;  1Q2Q A;  3PBS A;  1ALQ A;  5AQ9 A;  3O87 A;  3BLS A;  4NET A;  4PM8 A;  1K6R A;  1L0G A;  2UWX A;  3N8R A;  3IQA A;  2OLU A;  3HUN A;  3P98 A;  2H0Y A;  3BEB A;  4O7D A;  2EX9 A;  1KGE A;  1FR6 A;  1J9M A;  1ONH A;  5CED A;  3NDG A;  4R1G A;  1K55 A;  1HZO A;  1MWS A;  1QME A;  3UDX A;  4Y7P A;  1K4E A;  5DF7 A;  3G2Y A;  5HAR A;  1LI0 A;  3VOZ A;  3N6I A;  2H0T A;  3QNC A;  3PBQ A;  5F82 A;  4WMC A;  1BLS A;  3HLB A;  3QHY A;  1SDN A;  3IXG A;  5EOE A;  4BQM A;  5TR7 A;  3WRT A;  4OQH A;  1XA7 A;  5I94 A;  3Q82 A;  3IWI A;  4EBL A;  4XUZ A;  2WK0 A;  1L0E A;  3ZNT A;  4DRT A;  1PWG A;  1W8Q A;  4E3J A;  3W4Q A;  3GQZ A;  3ZG9 B;  2ZQC A;  1LHY A;  5CGX A;  4MEZ A;  3ZNY A;  3N8S A;  4UAA A;  1BLH A;  5IHV A;  5DTK A;  5FQM A;  2ZQ7 A;  3ZFZ A;  3PBR A;  4R0Q A;  3D4F A;  1NXY A;  1YLJ A;  1BTL A;  3UPN A;  2ZQ8 A;  1YQS A;  4KQO A;  5M19 A;  2WKI A;  1PZO A;  3Q07 A;  4FH2 A;  3PAG A;  2HPB A;  1K54 C;  1GCE A;  3NBL A;  2Y4A A;  3WS4 A;  5KSC A;  3ITB A;  2R9X A;  3SS3 A;  5E43 A;  4DE3 A;  3UNW A;  2ZC5 B;  2ZM2 A;  3B3X A;  1ZG6 A;  1RGZ A;  1K6S A;  1S6R A;  4DXB A;  3CG5 A;  1L0D A;  2FFY A;  3ZVT A;  3BM6 A;  1JTD A;  1MBL A;  4LCM A;  4EBN A;  2G2W A;  4PM6 A;  4X53 A;  3UDF A;  1LL9 A;  1PWC A;  4KZ4 A;  1YT4 A;  1EI5 A;  4WEL A;  1GA9 A;  3SH9 A;  3E2K A;  4K0W A;  3G31 A;  3V39 A;  2WYX A;  2JCH A;  4QY5 A;  2Q9N A;  1ERO A;  1XKZ A;  2GDN A;  3W4O A;  4QU3 A;  3VSK A;  5CXW A;  5HFO A;  3SS4 A;  2P9V A;  3G4P A;  1JTG A;  2ZMA A;  3CMZ A;  4KQR A;  3HVF A;  4E6W A;  4JF6 A;  2V1Z A;  4JXV A;  2IWD A;  3IH9 A;  4BD0 A;  4H8R A;  1M40 A;  2IWB A;  5FSR A;  4K91 A;  3BFF A;  3UE0 A;  1H8Y A;  2A49 A;  2Y2N A;  3NDE A;  4OPR A;  4Z9Q A;  1LL5 A;  3PBN A;  1WYB A;  1K57 C;  2OLV A;  5KSH A;  1VQQ A;  1TVF A;  1H8Z A;  2WGW A;  1DJC A;  1XXM A;  3BLM A;  1YLY A;  5CER A;  1IYS A;  4K0X A;  4HBT A;  1MWU A;  1KE4 A;  2EFX A;  3BFD A;  1FCM A;  1MWR A;  2P9V B;  3N4I A;  3Q7Z A;  2X02 A;  1CK3 A;  3OPP A;  2R9W A;  3MZE A;  2Y2G A;  5KMW A;  5DF9 A;  4IBX A;  2HDU A;  3C7V A;  5FQ9 A;  3UY6 A;  1K56 D;  1RGY A;  3N7W A;  2I72 A;  2JBF A;  4N1X A;  3LCE A;  1I2S A;  4RX2 A;  1K56 A;  1PIO A;  2C5W B;  3A3I A;  1SDE A;  5EE8 A;  1K55 C;  4OPQ A;  1KVL A;  3IT9 A;  2WGW B;  2ZQ9 A;  4GD6 A;  4OPZ A;  4QD4 A;  4EWF A;  4OQG A;  4GNU A;  3TOI A;  2J8Y A;  2J9P A;  4LEN A;  3DWZ A;  3O88 A;  2FFF B;  1SHV A; 
#chains in the Genus database with same CATH topology
 1E4D A;  4JF5 A;  4MNR A;  3JVV A;  3IHA A;  5DJU A;  1D1J A;  2PU4 A;  2W1R A;  3LIE A;  4DDY A;  3BQ8 A;  3EWK A;  4ETZ A;  3HRE A;  2PD7 A;  3LIA A;  3E4P A;  4UQI M;  2ZL1 B;  1ZKJ A;  5TFQ A;  3VP4 A;  4PM9 A;  1XGI A;  1Q2P A;  3GSG A;  3PTE A;  1FSW A;  4FD8 A;  2ZMF A;  4DN0 A;  3HLW A;  3WWX A;  4KZ9 A;  3PXP A;  5FL3 A;  1SCW A;  4HJ3 A;  1T18 A;  2OWJ A;  5AVF A;  2B18 A;  3V3R A;  5U47 A;  1SZV A;  4NK3 A;  3HLC A;  1H8M A;  3VP3 A;  2WGI A;  3VFH A;  4KEN B;  1HD8 A;  1IKI A;  4JXS A;  1H3Q A;  5DFX A;  4GS9 A;  4GLQ A;  4IBR A;  1O7E A;  1CI9 A;  3NI9 A;  3A0S A;  2L0W A;  1YSP A;  4I38 A;  4EW7 A;  4WUJ A;  2W3D A;  4BBT A;  1YLP A;  4ZJ2 A;  3IH8 A;  4ZTK A;  1LI9 A;  1NY0 A;  2Y2H A;  3NC8 A;  3BJN A;  4X1L A;  4GOG A;  1PNE A;  2ZBB A;  3RTY A;  1N9L A;  1NYM A;  1PWD A;  4S2P A;  1SKO A;  3O86 A;  4LRY C;  4MDZ A;  4O0P A;  1G6A A;  5HAI A;  4P6Z S;  4WEJ A;  3V50 A;  3C7U A;  2HP6 A;  4BL3 A;  4Y13 A;  1GA0 A;  1M6K A;  3LR3 A;  4OKP A;  3KYQ A;  4H6J B;  2DRW A;  3UO9 A;  2VA0 A;  4GD8 A;  4HEF A;  4Q0H A;  5GLC A;  3G30 A;  3TRC A;  5M1A A;  4IED A;  2EWV A;  4WM9 A;  5HWW A;  2J3W A;  5M18 A;  4M4X A;  1OPX A;  4Z1W A;  3MF0 A;  3MS6 A;  4OLD A;  1PFL A;  4B4X A;  2OSU A;  3FYZ A;  3BW6 A;  4GJ4 A;  4JKT A;  3T1Q B;  5C5K A;  4E3I A;  3IXD A;  2Y2M A;  4GKU A;  1YAX A;  4S2L A;  1PYY A;  2PD8 A;  2G7U A;  3O3V A;  4IUK A;  5HD3 A;  3MQQ A;  1OTE A;  1I2W A;  4Y0O A;  1LSX A;  3RXX A;  5FA7 A;  1VET B;  1OT6 A;  2HDQ A;  3UMD A;  1C3B A;  3BY9 A;  4BLM A;  1BT5 A;  3S1Y A;  1JNU A;  4S2O A;  4MLL A;  2EA9 A;  3IXH A;  4R23 A;  1CF0 A;  2E8I A;  2XSS A;  2YKH A;  1LSW A;  2RCX A;  2JKR M;  3PBO A;  3DW0 A;  3MZD A;  4FOF A;  3AGD A;  4ME4 A;  2V20 A;  4AFI A;  3IF6 B;  3GV9 A;  3T1R A;  4KUO A;  4ZDX A;  3S22 A;  4I3J A;  1JVJ A;  3G2Z A;  1Z09 A;  4NKP A;  3DWK A;  4Y3I A;  5AQB A;  2XD5 A;  4F3L B;  2PYR A;  5FDS A;  3MXQ A;  3CUE C;  1YM1 A;  2XFS A;  1AWI A;  1ODV A;  1IKG A;  4R3J A;  5EFW A;  3T4T A;  5EM0 A;  3UPP A;  5MC7 A;  2ZJ9 A;  1XJ6 A;  1JWP A;  3BFE A;  1ZC2 A;  3CI6 A;  2M7U A;  3DTE A;  3ZHH A;  2V0U A;  4KQQ A;  4KG6 A;  3R7W A;  3ZG8 B;  2HP5 A;  1TD5 A;  1K54 A;  1W63 Q;  3IX3 A;  1BLP A;  3UN7 A;  4IVI A;  4YNR A;  3AGE A;  2V8F A;  4EUV A;  1MC0 A;  5J8X A;  3F1O A;  3LR0 A;  3KYE A;  1DP6 A;  4I39 A;  3HLE A;  3DTM A;  2B5R A;  3LEZ A;  3M2K A;  2Y55 A;  3LEQ A;  1ERM A;  3QP2 A;  2HP9 A;  2A2L A;  1MWT A;  2O9C A;  3FPV A;  2WAF A;  2OV5 A;  3W4P A;  2X71 A;  1MY8 A;  3CAX A;  4IUH A;  5GLB A;  4JGR A;  1XA1 A;  4CLC E;  5E2H A;  3T12 B;  4X6T A;  1Q2Q A;  1OJG A;  1T1C A;  2P08 A;  5HWV A;  5F68 A;  1L0G A;  3IQA A;  3UB5 P;  3C38 A;  2OLU A;  3HUN A;  3BEB A;  1K55 A;  1QME A;  3UDX A;  1V9Y A;  4Y7P A;  3G2Y A;  2Y79 A;  3LUQ A;  5K5B A;  3QHY A;  4CLC D;  5TR7 A;  4OQH A;  1XA7 A;  3Q82 A;  1W8Q A;  3W4Q A;  3GQZ A;  5TJJ A;  2ZQC A;  3ZNY A;  5TBM B;  2CMN A;  3KSI A;  3PBR A;  4Y2F A;  4CLC B;  5DFY A;  4Q0J A;  3SS3 A;  4DE3 A;  3UNW A;  4DJ3 A;  1ZG6 A;  2HJ9 C;  3CG5 A;  1MBL A;  1OTD A;  4EBN A;  4Y17 A;  4HP4 A;  3SH9 A;  3H7W B;  3LIF A;  3OBF A;  3EGD C;  4HQA A;  2KDK A;  3EEH A;  3K3D A;  3HVF A;  4JF6 A;  2V1Z A;  2IWB A;  5FSR A;  3LI9 A;  4X1M A;  5CX7 A;  4Z9Q A;  3NDE A;  1LL5 A;  4HJ6 A;  1KOU A;  1G28 A;  1H8Z A;  1DJC A;  1FCM A;  3Q7Z A;  3LIB A;  3ULF A;  3OPP A;  1NLZ A;  2R9W A;  2Y2G A;  4IBX A;  3UY6 A;  3N7W A;  4N1X A;  4OPQ A;  3KX0 X;  4DJ2 A;  3IT9 A;  3C8C A;  4OPZ A;  2ZQ9 A;  4GNU A;  2J8Y A;  5A8B A;  2J9P A;  2K2N A;  4LEN A;  3O88 A;  4KQR A;  3QP1 A;  2XRO A;  4EQ1 A;  3T4L A;  4RVA A;  4CLC C;  2XF3 A;  2PBY A;  2ACG A;  3UE1 A;  1Y28 A;  4BEN A;  2XGN A;  4OP5 A;  4UHU A;  2EWW A;  3TE8 A;  3GDI A;  1EW0 A;  1DRM A;  3AGF A;  3HLD A;  2Z2M B;  4HJ4 A;  4JLF A;  4QJG A;  4X56 A;  1KE3 A;  5DTT A;  1G68 A;  2QYB A;  2JC7 A;  4LV3 A;  3HUO A;  4O8G A;  2A3U A;  3A0R A;  3SW1 A;  5KIZ A;  3MKE A;  1TS6 A;  3F1N A;  2WKQ A;  1YLZ A;  4RYE A;  5CRF A;  2XLN A;  3C30 A;  1S66 L;  4P6Z M;  1VM1 A;  3MBZ A;  3DAV A;  3VMA A;  4L9G A;  3FPW A;  2PU2 A;  2XRN A;  3PAE A;  3A0V A;  2LB9 A;  3BWL A;  4PM7 A;  1RCJ A;  3O5Y A;  4PM5 A;  5HPI A;  4WF0 A;  4GS9 B;  2XR0 A;  1TS8 A;  1YMS A;  4OP8 A;  3QP8 A;  5E2F A;  5HWT A;  2QWS A;  2QJ5 A;  1W79 A;  3MQO A;  3T4Q A;  3T4S A;  3UDI A;  5EEC A;  1I5Q A;  2Z6C A;  1DJB A;  2XD1 A;  1O07 A;  3C5A A;  3LID A;  4QB8 A;  4UA7 A;  5AQ7 A;  5CHM A;  4F94 A;  2M1C A;  1KDW A;  3PYP A;  5EV0 A;  1XGJ A;  4PHT A;  1S0W A;  1IEM A;  5L07 A;  4R3A A;  3B47 A;  1SKO B;  5A93 A;  4PPR A;  4G3V A;  1PI5 A;  4E6X A;  4QPR A;  4S2N A;  3BFG A;  1OME A;  2Y2L A;  2PAV P;  4BD1 A;  1ONG A;  4HES A;  2JKG A;  2VGL S;  4JXW A;  1HVB A;  5DKL A;  1F9I A;  1XJ3 A;  5FAP A;  1JWZ A;  1XFN A;  4HOI A;  3LR5 A;  5E2E A;  1J3W A;  4LRX C;  4KG5 A;  3E0Y A;  1DY6 A;  1X0O A;  2VK3 A;  5GHZ A;  1ESI A;  4P87 A;  2W0N A;  1UWP X;  2XA7 S;  3OOV A;  1FR1 A;  3PR6 A;  2A24 A;  3TSG A;  2XK1 A;  5F83 A;  1ESU A;  1IYO A;  5EOO A;  5AJG A;  1CI8 A;  5CTM A;  2ZC3 B;  4LFU A;  2FH5 A;  5EVI A;  4CJN A;  2CC1 A;  3GR2 A;  2BTF P;  5FEG A;  2PT7 A;  1G5U A;  5HDD A;  2O0Y A;  4GB7 A;  4B4Z A;  2IA2 A;  4N9L A;  1CQA A;  1WA9 A;  3CIT A;  2HV1 A;  4UA6 A;  3M6H A;  5BOH A;  2HDS A;  4OOY A;  2VEA A;  2GNX A;  3K3C A;  4B88 A;  5CHJ A;  2QPN A;  5A91 A;  2QMI A;  1N9B A;  4ZJ1 A;  1N4O A;  4C6Y A;  1T19 A;  3RFB A;  3NIA A;  2ZC4 B;  1BUE A;  3NEC A;  3S7N A;  1W7F A;  5FQJ A;  4K08 A;  3MXS A;  3FWL A;  3CPT A;  1D06 A;  3SH8 A;  3GTC A;  2G2U A;  3MJQ A;  3MXR A;  4L0L A;  2VX8 A;  1E25 A;  2XDM A;  5IU1 A;  1Y4O A;  4LCL A;  5GHX A;  3JVU A;  2V8C A;  4HH3 A;  2L1M A;  5A92 A;  2GZA A;  4ZAM A;  4EQI A;  4X68 A;  4WN5 A;  3F1P A;  4R4S A;  4DDS A;  1H0M A;  3CLO A;  1FOF A;  4MBF A;  3R7W B;  3RJU A;  2ZC7 A;  2PRF A;  4JBF A;  2M7V A;  2VJW A;  1KDS A;  4X55 A;  3LIC A;  2C6W B;  3W8K A;  4FH4 A;  4ZRR A;  1GSV A;  2PBD P;  4IHQ A;  1K4F A;  1BUL A;  3OC2 A;  5F5Y A;  3F1O B;  5CTN A;  5GLA A;  3T4O A;  2Y2K A;  3EQV A;  1K57 A;  4P0M A;  2ZD8 A;  4DE2 A;  3BEC A;  3T4K A;  4E3O A;  3IHB A;  2Y8H A;  3HBR A;  5EVE A;  1P9W A;  4ZJ3 A;  5EVL A;  3NUL A;  4ARZ A;  3BLS A;  1K6R A;  2I9V A;  3N8R A;  4EER A;  2H0Y A;  1KGE A;  2EX9 A;  1J9M A;  3NDG A;  4R1G A;  1HZO A;  4MCW A;  5DF7 A;  3VV4 A;  3PBQ A;  3MMH A;  1BLS A;  1SDN A;  3IXG A;  3HCY A;  3WRT A;  5I94 A;  3IWI A;  2KOI A;  3VE4 A;  4XUZ A;  1L0E A;  4HP9 A;  3ZNT A;  1PWG A;  3U4L P;  1STZ A;  1LHY A;  4MEZ A;  2KLI A;  4UAA A;  5IHV A;  4L9E A;  2UV0 E;  3IS2 B;  4R0Q A;  3D4F A;  1YLJ A;  2QHK A;  1BTL A;  2ZQ8 A;  4E04 A;  1A0K A;  2WKI A;  3BQA A;  5M19 A;  3Q07 A;  4FH2 A;  3PAG A;  1G6O A;  2HPB A;  1K54 C;  2P7J A;  2ZM2 A;  1RGZ A;  1L0D A;  4NXB A;  2G2W A;  4I3A A;  4PM6 A;  4X53 A;  4WEL A;  3E2K A;  3G6O A;  3G31 A;  3V39 A;  2Q9N A;  1ERO A;  1XKZ A;  4JGQ A;  4QU3 A;  3EGX C;  5CXW A;  3G4P A;  2VZW A;  1JTG A;  4E6W A;  2J80 A;  3E4Q A;  1M40 A;  2PR5 A;  3UB8 A;  2A49 A;  3BY8 A;  3IBJ A;  1PRQ A;  1VQQ A;  1TVF A;  4WLA A;  1XXM A;  1NWZ A;  3MFX A;  2EFX A;  3N4I A;  2P04 A;  4XT2 A;  1UGU A;  5KMW A;  1T1B A;  5DJT A;  2HDU A;  4LGW A;  1K56 A;  1PIO A;  2C5W B;  5EE8 A;  1SDE A;  1K55 C;  4QD4 A;  4EWF A;  3DTI A;  1F98 A;  2FFF B;  4ESP A;  3WS5 A;  3MSH A;  3OZH A;  1P97 A;  5JYP A;  3DBA A;  1ZTU A;  2W3G A;  5FAO A;  3ZYT A;  3ISG A;  2W27 A;  4NXF A;  4WZ4 A;  1NZO A;  4OPY A;  3OCL A;  2AVX A;  4KZ8 A;  3WS2 A;  1LSV A;  3HLF A;  4D2O A;  4LLO B;  4LRZ E;  3M6B A;  4DE1 A;  2WKP A;  3C4P A;  2DCF A;  3VP0 A;  3SZT A;  3E2L A;  3I7J A;  3VP2 A;  3P7N A;  2MJ6 A;  5HAQ A;  5FAT A;  3ZVW A;  4E3L A;  3CJM A;  4GN2 A;  3Q7V A;  4EES A;  2K31 A;  1BYW A;  2JE5 A;  4YIN A;  4JGP A;  4LV1 A;  3IF6 A;  4UA9 A;  4MBH A;  2HZ5 A;  3JPU A;  1L2S A;  5G4Z A;  2PR6 A;  4B93 A;  5G18 A;  4QHC A;  4F3L A;  3ZG5 A;  2Y2J A;  5IS1 A;  1MZU A;  2EXA A;  1BZA A;  3RH8 B;  1CJF A;  1XJ2 A;  2VV8 A;  2VGK A;  2O9B A;  3F1N B;  3G32 A;  3ZG7 B;  5L10 A;  1FCN A;  4EXO A;  4ID4 A;  2BG1 A;  4PAU A;  4E3K A;  1S1Y A;  5FEF A;  5HD5 A;  4S2K A;  4OQ0 A;  5DTS A;  4I3I A;  1ES4 A;  4HIA A;  2J7V A;  2ZM0 A;  5HDC A;  4NXE A;  1NJ4 A;  1JWV A;  4S2J A;  4M3K A;  4MBK A;  3LO7 A;  5DVA A;  3UB9 A;  3GVB A;  2VGL M;  3S4X A;  4UEY A;  4D60 A;  1KE0 A;  2HDR A;  3H82 A;  1E3U A;  3V5M A;  1YLW A;  1FIL A;  3SOI A;  4GHI A;  3BYD A;  1RP5 A;  4Y0T A;  2XA7 M;  2NUP C;  2JN7 A;  1NZU A;  3P01 A;  4KZ6 A;  3ZCZ A;  4EEU A;  3BFC A;  4PMA A;  1V9Z A;  3A3E A;  3T4J A;  3UME A;  4GZB A;  4KZ3 A;  4XXR A;  4EBP A;  4WEK A;  1F5M A;  2GX5 A;  4R3B A;  4GW9 A;  1GHI A;  4NEE D;  4WBG A;  2ZMV A;  1KGG A;  2XH9 A;  3UE6 A;  2IWC A;  2WAE A;  2JKT I;  3NOT C;  2Q0O A;  2ZC6 B;  2Z2L B;  3MZF A;  3U2A A;  1VEU A;  5TGF A;  3T50 A;  1DP9 A;  1N9N A;  2WUQ A;  5EVI D;  1NRF A;  1OTI A;  3TG9 A;  4CPK A;  4X69 A;  1XPB A;  2A24 B;  3P09 A;  3FKV A;  1T1A A;  5CEC A;  4DF6 A;  2X01 A;  1YMX A;  2J9O A;  3MFD A;  4WMC D;  3NY4 A;  4BJP A;  5EVI B;  4HBU A;  3L7H A;  2EXB A;  4II7 A;  1L0F A;  4Y0U A;  3LYX A;  4LV0 A;  3VOL A;  5KZH A;  1D7E A;  1CEG A;  1GHM A;  4WZ5 A;  4E3N A;  5FAS A;  2WKH A;  4FSF A;  4S2I A;  3VE3 A;  1FCO A;  1MPL A;  1NYY A;  5F1G A;  2XEP A;  3S7Q A;  3IXB A;  4N92 A;  3OCN A;  3ZQ5 A;  5FQI A;  4S2N C;  2ZOI A;  4FCF A;  2K7S A;  1PW8 A;  2EX2 A;  5EUA A;  4NG2 A;  4EV4 A;  2W3E A;  1K0K A;  3KSH A;  3QP4 A;  5F1F A;  2KX6 A;  5GHY A;  1VB6 A;  3QP6 A;  5HDS A;  3UE3 A;  4IVK A;  1UWN X;  3G35 A;  2V1B A;  3IWQ A;  2QJ7 A;  1FSY A;  4YFM A;  4MMN A;  4KG2 A;  4BBU A;  3CPT B;  1W8Y A;  2J3T D;  2Y2P A;  3KSF A;  3WRZ A;  1GHP A;  2H28 A;  1YLT A;  1OTA A;  2W1T A;  3T1S A;  4BL2 A;  3A3D A;  5EVI C;  5CGW A;  3FV7 A;  1CEF A;  5HPF A;  5DF8 A;  3F1P B;  5A90 A;  2V0W A;  1AXB A;  2R78 A;  3SH7 A;  1MXO A;  4I5S A;  5E2G A;  3PHY A;  1HTZ A;  3N8L A;  3HLG A;  1XX2 A;  5D3O A;  2ZQD A;  2RL3 A;  1OT9 A;  4R70 A;  2Y2Q A;  5EM1 A;  1TS0 A;  3IBR A;  1YSQ A;  5J4E A;  1W5D A;  3B42 A;  1XFQ A;  3PBS A;  4PM8 A;  4KQD A;  1FR6 A;  5CED A;  4X25 A;  1MWS A;  1P0Z A;  1LI0 A;  4HNB A;  3VOZ A;  4WMC A;  4ARZ B;  3MR0 A;  5EOE A;  4BQM A;  1YPR A;  2WK0 A;  1OTB A;  4DRT A;  4BBV A;  4E3J A;  3ZG9 B;  1ACF A;  1TF1 A;  3R4K A;  3N8S A;  1BLH A;  5FQM A;  2OOL A;  3ZFZ A;  1NXY A;  3UPN A;  1PZO A;  1GCE A;  3NBL A;  2J3T C;  3WS4 A;  1L3L A;  3B3X A;  2FFY A;  3ZVT A;  3BM6 A;  4LCM A;  1LL9 A;  1PWC A;  4KZ4 A;  3D3O A;  1EI5 A;  1GA9 A;  5F6A A;  4K0W A;  2WYX A;  2JCH A;  4QY5 A;  3LFV A;  3W4O A;  2B02 A;  4G3K A;  3SS4 A;  2P9V A;  3OLO A;  3CMZ A;  2ZMA A;  4JXV A;  2IWD A;  3IH9 A;  4BD0 A;  4H8R A;  2V1A A;  2YKF A;  4K91 A;  3UE0 A;  2QKP A;  2LB5 A;  4R6L A;  3PBN A;  1WYB A;  1K57 C;  2OLV A;  5KSH A;  1XJ4 A;  1YKD A;  2WGW A;  3BLM A;  5CER A;  1IYS A;  1CK3 A;  3MZE A;  5DF9 A;  5G4Y A;  3NJA A;  1K56 D;  2I72 A;  2JBF A;  4RX2 A;  3A3I A;  4MN7 A;  2DMW A;  4GD6 A;  4DMZ A;  3IX4 A;  3TOI A;  3IX8 A;  5L8M A;  3DWZ A;  1SHV A;  3WS0 A;  2ZL1 A;  4XT2 B;  1IFQ A;  2JKT M;  3L9K A;  5CGS A;  5I5L A;  3VFF A;  4N1H A;  1IYP A;  1Y54 A;  2PHY A;  2V9A A;  3BRM A;  3KYZ A;  3ZG0 A;  1ES3 A;  4NXG A;  3ICY A;  3KO6 A;  2VGJ A;  3FKW A;  1S1Z A;  2W3F A;  1IYQ A;  2P74 A;  1DJA A;  4Q8I A;  3EQU A;  5IT5 A;  3GRJ A;  3OPR A;  4Y5F A;  5CEB A;  1PW1 A;  3EEA A;  3TW8 A;  2INW A;  2VV7 A;  2VLG A;  3KSG A;  4C75 A;  2EFU A;  3Q7V B;  4KZA A;  4UQI S;  4YOF A;  1S4S A;  3B33 A;  2H10 A;  1KVM A;  1P9R A;  3GEC A;  4JF4 A;  3ZGA B;  4HH2 A;  1H5X A;  5HW3 A;  2B95 A;  2D01 A;  5L2F A;  5J3W A;  3HJI A;  4HHD A;  3D72 A;  4KZ7 A;  3HJK A;  3OPL A;  4OQI A;  2WZZ A;  3C4O A;  4FTX A;  2WAD A;  2XFT A;  1U60 A;  5EPH A;  5HL1 A;  5HSQ A;  2Y2I A;  5FI7 A;  1SKF A;  1TDL A;  4H6J A;  4U3T A;  3IF5 A;  1KGF A;  4DKI A;  1ZHH B;  3RXW A;  4S2M A;  1E3U D;  3NOU C;  4KUK A;  4BMW A;  1TEM A;  3QNB A;  2ZM8 A;  5FI6 A;  3LY4 A;  2V2F F;  1WYC A;  2Y91 A;  3Q81 A;  3VP1 A;  2Z6D A;  3Q1F A;  3LR4 A;  3MKF A;  2OWH A;  3CUE A;  4OLG A;  1FQG A;  3DTK A;  5J7E A;  3H82 B;  5CHU A;  5HAP A;  1K25 A;  2WGV A;  5JYO A;  4DE0 A;  5GLD A;  4PKY A;  3ZDJ A;  4GHI B;  4MN5 A;  4WYY A;  4XUX A;  4EUZ A;  4R4R A;  1OJ5 A;  5FI2 A;  1Z6F A;  1F2K A;  3V3S A;  2D02 A;  5FQK A;  3IF6 C;  3HL9 A;  3CHW P;  2H5S A;  2OAQ 1;  3A3F A;  1VET A;  5GL9 A;  2ZQA A;  3JYI A;  3PBT A;  2GJ3 A;  3T1X A;  2BAS A;  2EX6 A;  2XQZ A;  1S4R A;  3LGO A;  3M2J A;  1EWZ A;  1LL8 A;  4E3M A;  3SS5 A;  1QMF A;  4ZBE A;  2WKE A;  3UPO A;  2JKF A;  3QP5 A;  1VEU B;  4P85 A;  4R38 A;  3A3J A;  5HL6 A;  3VOY A;  4A5R A;  4JPM A;  4P6B A;  2BLS A;  4JGO A;  3IS2 A;  4KZB A;  1PZP A;  1BLC A;  2WZX A;  3C2W A;  4GCZ A;  3ITA A;  2OAP 1;  4OVD A;  2L4R A;  2PDR A;  3UB7 A;  4OON A;  5DKK A;  5FDH A;  1WE4 A;  3HUM A;  4N9K A;  3LY3 A;  3H9W A;  4OOL A;  5AQA A;  4OOM A;  3E98 A;  2NUT C;  3MQ0 A;  1ERQ A;  4EET B;  4PKY G;  2Y2O A;  5FQQ A;  5HX9 A;  1ES5 A;  3CZD A;  4U0X A;  1MKI A;  5AVE A;  2FZ0 A;  3NHQ A;  2DNS A;  1ES2 A;  2HF6 A;  4RA7 A;  4QWO A;  1NRJ A;  5FAQ A;  4EEP A;  3CWF A;  3FZC A;  4ETX A;  3WS1 A;  1GSW A;  2ZLY A;  3GMW A;  2Y59 A;  4QY6 A;  3FC7 A;  4Q0I A;  4GDN A;  1IEL A;  1BSG A;  1XP4 A;  4GDB A;  2E8J A;  1K38 A;  1TDG A;  3IWO A;  3NOP C;  4RX3 A;  1ZG4 A;  3TJZ C;  3VSL A;  4U0T A;  3S7P A;  4YWZ A;  2W1T B;  4JXG A;  2ZOH A;  1LLB A;  1NLY A;  1PI4 A;  2QZ6 A;  4RQ9 A;  3OPH A;  4KZ5 A;  2EX8 A;  4OH0 A;  2Q9M A;  1N9O A;  1IOU A;  2O9A A;  3G34 A;  4LV2 A;  1TS7 A;  3D9Y A;  3NCK A;  3E4O A;  4C3Q A;  4WZ5 C;  4DXC A;  1ALQ A;  5AQ9 A;  3O87 A;  4NET A;  1FIK A;  2UWX A;  1W63 M;  3P98 A;  2VV6 A;  4O7D A;  1ONH A;  4HY8 A;  1K4E A;  1LT0 A;  5HAR A;  2JHE A;  3N6I A;  2H0T A;  3EOI A;  3QNC A;  2PYP A;  5F82 A;  3HLB A;  5TBM A;  3K2N A;  3W2Z A;  1GSX A;  3LI8 A;  4CLC A;  1DP8 A;  4EBL A;  4FUW A;  2JKR I;  4L9F A;  5CGX A;  5DTK A;  5HZH A;  5L09 A;  2ZQ7 A;  1YQS A;  4KQO A;  4Y15 A;  3H7W A;  5KSC A;  2Y4A A;  3ITB A;  2WKR A;  2R9X A;  4O01 A;  5E43 A;  2ZC5 B;  1K6S A;  2HJE A;  1S6R A;  4DXB A;  1JTD A;  3UDF A;  1YT4 A;  2VKS A;  3FG8 A;  5LBR A;  2GDN A;  4LPZ A;  3VSK A;  5F69 A;  5HFO A;  4IJG A;  1MKM A;  4HI4 A;  4CQH A;  3BFF A;  4BWI A;  1H8Y A;  2Y2N A;  4OPR A;  4B9O A;  3UB6 A;  4EU0 A;  1YLY A;  4K0X A;  4HBT A;  1MWU A;  1S67 L;  1KE4 A;  3BFD A;  1MWR A;  2P9V B;  2X02 A;  2HGV A;  2O99 A;  4WL9 A;  2W3H A;  3C7V A;  4G3W A;  5FQ9 A;  3S7O A;  1RGY A;  3LCE A;  1I2S A;  4MN6 A;  1KVL A;  1VHM A;  2WGW B;  4OQG A;  1HLU P;  3V67 A; 
#chains in the Genus database with same CATH homology
 3WS5 A;  3WS0 A;  3OZH A;  1E4D A;  4JF5 A;  4RVA A;  4MNR A;  2XF3 A;  5CGS A;  2PBY A;  5JYP A;  3UE1 A;  4BEN A;  3VFF A;  4N1H A;  1IYP A;  5FAO A;  1Y54 A;  2XGN A;  3ISG A;  3IHA A;  2PU4 A;  4DDY A;  4WZ4 A;  3BRM A;  3HRE A;  1NZO A;  4OP5 A;  4OPY A;  4UHU A;  3OCL A;  4KZ8 A;  3WS2 A;  3HLF A;  3ZG0 A;  1ES3 A;  4D2O A;  1ZKJ A;  5TFQ A;  3M6B A;  3AGF A;  4DE1 A;  3HLD A;  3VP4 A;  3C4P A;  4PM9 A;  2DCF A;  3VP0 A;  2Z2M B;  4JLF A;  1XGI A;  1Q2P A;  3GSG A;  3E2L A;  3PTE A;  3I7J A;  4QJG A;  1FSW A;  2VGJ A;  3FKW A;  4X56 A;  3VP2 A;  1KE3 A;  4FD8 A;  5HAQ A;  5FAT A;  3ZVW A;  1IYQ A;  4E3L A;  2P74 A;  3CJM A;  3HLW A;  1DJA A;  1G68 A;  4GN2 A;  3Q7V A;  5DTT A;  3WWX A;  4Q8I A;  3EQU A;  2JC7 A;  4LV3 A;  4KZ9 A;  3HUO A;  2JE5 A;  1SCW A;  3GRJ A;  3OPR A;  2A3U A;  5CEB A;  4YIN A;  4LV1 A;  1PW1 A;  3MKE A;  3V3R A;  5U47 A;  3IF6 A;  4NK3 A;  3HLC A;  4UA9 A;  3VP3 A;  4MBH A;  1YLZ A;  2WGI A;  3VFH A;  4KEN B;  1HD8 A;  1L2S A;  1IKI A;  4JXS A;  4C75 A;  2EFU A;  4RYE A;  3Q7V B;  2XLN A;  4KZA A;  5CRF A;  4IBR A;  5G18 A;  1O7E A;  4QHC A;  2H10 A;  1KVM A;  3ZG5 A;  2Y2J A;  1VM1 A;  1CI9 A;  3MBZ A;  4JF4 A;  3ZGA B;  3NI9 A;  3VMA A;  1H5X A;  2EXA A;  1BZA A;  2PU2 A;  5HW3 A;  3PAE A;  2VGK A;  3G32 A;  5L2F A;  4PM7 A;  3ZG7 B;  1RCJ A;  1FCN A;  1YLP A;  4ZJ2 A;  4PM5 A;  3IH8 A;  4ID4 A;  2BG1 A;  4ZTK A;  1LI9 A;  1NY0 A;  2XR0 A;  1YMS A;  2Y2H A;  4KZ7 A;  3OPL A;  4E3K A;  4OP8 A;  3NC8 A;  5E2F A;  4OQI A;  2WZZ A;  3C4O A;  4S2K A;  4GOG A;  4OQ0 A;  5DTS A;  2WAD A;  2XFT A;  1U60 A;  1ES4 A;  1W79 A;  5EPH A;  2J7V A;  2ZM0 A;  1NYM A;  5HL1 A;  1NJ4 A;  1PWD A;  2Y2I A;  3UDI A;  4S2P A;  5FI7 A;  5EEC A;  1I5Q A;  1JWV A;  1SKF A;  1DJB A;  3O86 A;  1TDL A;  2XD1 A;  4S2J A;  1O07 A;  3C5A A;  4M3K A;  1G6A A;  4QB8 A;  4MBK A;  4U3T A;  4UA7 A;  5HAI A;  3LO7 A;  3IF5 A;  4WEJ A;  3GVB A;  3C7U A;  5CHM A;  5DVA A;  5AQ7 A;  3V50 A;  3S4X A;  4F94 A;  2HP6 A;  1KGF A;  4DKI A;  1KDW A;  4BL3 A;  3RXW A;  1GA0 A;  1KE0 A;  2HDR A;  4S2M A;  1E3U D;  1XGJ A;  1M6K A;  1TEM A;  3QNB A;  2ZM8 A;  4OKP A;  5FI6 A;  1E3U A;  3V5M A;  1S0W A;  3LY4 A;  1IEM A;  1YLW A;  1WYC A;  2V2F F;  2Y91 A;  3Q81 A;  3VP1 A;  5A93 A;  4PPR A;  3SOI A;  2DRW A;  3Q1F A;  3UO9 A;  3BYD A;  1RP5 A;  4Y0T A;  1PI5 A;  4E6X A;  3ZCZ A;  1NZU A;  4GD8 A;  4KZ6 A;  4S2N A;  3MKF A;  4HEF A;  4OLG A;  1FQG A;  3BFG A;  1OME A;  3BFC A;  4PMA A;  2Y2L A;  5GLC A;  3A3E A;  5CHU A;  5HAP A;  4GZB A;  4KZ3 A;  4XXR A;  4EBP A;  1K25 A;  2WGV A;  3G30 A;  4WEK A;  5M1A A;  4BD1 A;  5JYO A;  4DE0 A;  1ONG A;  4HES A;  4IED A;  4WM9 A;  5GLD A;  4JXW A;  4R3B A;  1HVB A;  3ZDJ A;  4XUX A;  4WYY A;  5M18 A;  4EUZ A;  1GHI A;  4R4R A;  4WBG A;  5FI2 A;  1Z6F A;  1KGG A;  5FAP A;  1JWZ A;  2XH9 A;  3V3S A;  2IWC A;  2WAE A;  5E2E A;  5FQK A;  4OLD A;  3IF6 C;  4B4X A;  3HL9 A;  2OSU A;  3FYZ A;  4KG5 A;  1DY6 A;  5GHZ A;  2H5S A;  1ESI A;  2ZC6 B;  2Z2L B;  3MZF A;  3A3F A;  4JKT A;  4P87 A;  5GL9 A;  2ZQA A;  3JYI A;  3PBT A;  1FR1 A;  4E3I A;  3IXD A;  2Y2M A;  3TSG A;  4GKU A;  2XK1 A;  5TGF A;  5F83 A;  1ESU A;  2EX6 A;  1IYO A;  2XQZ A;  4S2L A;  5EOO A;  3M2J A;  1CI8 A;  1PYY A;  5CTM A;  2ZC3 B;  3O3V A;  2WUQ A;  5EVI D;  1EWZ A;  1NRF A;  5EVI A;  1I2W A;  4Y0O A;  4E3M A;  3RXX A;  3TG9 A;  4CJN A;  4CPK A;  2CC1 A;  5FA7 A;  4X69 A;  3SS5 A;  2HDQ A;  3GR2 A;  1QMF A;  1XPB A;  2WKE A;  4ZBE A;  3UPO A;  3P09 A;  1C3B A;  4BLM A;  1BT5 A;  3S1Y A;  3FKV A;  4S2O A;  4P85 A;  4MLL A;  5CEC A;  4DF6 A;  2X01 A;  4GB7 A;  3IXH A;  4B4Z A;  4R23 A;  1YMX A;  2J9O A;  2E8I A;  3A3J A;  3MFD A;  4WMC D;  4N9L A;  3VOY A;  3NY4 A;  4A5R A;  4JPM A;  4BJP A;  4P6B A;  4UA6 A;  5EVI B;  3M6H A;  5BOH A;  2RCX A;  2BLS A;  2HDS A;  4HBU A;  4OOY A;  3PBO A;  4KZB A;  1PZP A;  2EXB A;  3DW0 A;  3MZD A;  1BLC A;  2WZX A;  1L0F A;  3AGD A;  4Y0U A;  2V20 A;  4LV0 A;  5KZH A;  4B88 A;  3IF6 B;  2QPN A;  1CEG A;  1GHM A;  3GV9 A;  5CHJ A;  3ITA A;  5A91 A;  2QMI A;  4WZ5 A;  1N9B A;  4E3N A;  4ZDX A;  5FAS A;  4OVD A;  3S22 A;  4ZJ1 A;  1N4O A;  4OON A;  2WKH A;  4FSF A;  4S2I A;  5FDH A;  4C6Y A;  1FCO A;  1WE4 A;  1MPL A;  1NYY A;  3HUM A;  1JVJ A;  4N9K A;  3G2Z A;  3NIA A;  3LY3 A;  5F1G A;  2ZC4 B;  3DWK A;  2XEP A;  4OOL A;  5AQB A;  2XD5 A;  3IXB A;  1BUE A;  4N92 A;  5AQA A;  4OOM A;  3OCN A;  5FQI A;  4S2N C;  4FCF A;  1ERQ A;  1YM1 A;  2XFS A;  1W7F A;  5FQJ A;  1PW8 A;  2EX2 A;  5HX9 A;  2Y2O A;  5EUA A;  5FQQ A;  3MXS A;  3FWL A;  1IKG A;  1ES5 A;  4R3J A;  4EV4 A;  3CZD A;  4U0X A;  3SH8 A;  3GTC A;  2G2U A;  5F1F A;  5GHY A;  3UPP A;  1MKI A;  2ZJ9 A;  3UE3 A;  1JWP A;  2DNS A;  3BFE A;  3MXR A;  1ES2 A;  4IVK A;  1ZC2 A;  4L0L A;  1E25 A;  2XDM A;  3G35 A;  3ZHH A;  3IWQ A;  4RA7 A;  4LCL A;  4KQQ A;  5GHX A;  4KG6 A;  1FSY A;  4YFM A;  5FAQ A;  4KG2 A;  5A92 A;  3FZC A;  3ZG8 B;  2HP5 A;  1W8Y A;  3WS1 A;  2Y2P A;  4ZAM A;  4EQI A;  2ZLY A;  3GMW A;  2Y59 A;  4QY6 A;  3WRZ A;  1K54 A;  1GHP A;  4X68 A;  1YLT A;  1BLP A;  4GDN A;  1IEL A;  4R4S A;  1BSG A;  1XP4 A;  4GDB A;  3UN7 A;  4DDS A;  4IVI A;  4BL2 A;  1K38 A;  1TDG A;  1FOF A;  3AGE A;  3IWO A;  3A3D A;  4MBF A;  5J8X A;  3RJU A;  4RX3 A;  1ZG4 A;  5EVI C;  2ZC7 A;  5CGW A;  3VSL A;  3HLE A;  3DTM A;  1CEF A;  3FV7 A;  4JBF A;  4U0T A;  2B5R A;  3LEZ A;  3M2K A;  5DF8 A;  1KDS A;  2Y55 A;  4X55 A;  5A90 A;  4JXG A;  1ERM A;  2HP9 A;  2C6W B;  1MWT A;  1AXB A;  1LLB A;  3SH7 A;  1MXO A;  3W8K A;  1PI4 A;  4FH4 A;  5E2G A;  1HTZ A;  3N8L A;  2WAF A;  3HLG A;  1K4F A;  1XX2 A;  1BUL A;  3OC2 A;  5CTN A;  5GLA A;  2OV5 A;  3W4P A;  5D3O A;  2X71 A;  1MY8 A;  2QZ6 A;  2RL3 A;  2ZQD A;  3OPH A;  2Y2Q A;  4KZ5 A;  2EX8 A;  2Y2K A;  3EQV A;  4OH0 A;  2Q9M A;  5GLB A;  1K57 A;  4P0M A;  2ZD8 A;  4DE2 A;  3BEC A;  4E3O A;  3G34 A;  4LV2 A;  1W5D A;  1XA1 A;  3NCK A;  3IHB A;  5E2H A;  4C3Q A;  4WZ5 C;  3HBR A;  4X6T A;  4ZJ3 A;  4DXC A;  5EVL A;  1Q2Q A;  3PBS A;  1ALQ A;  5AQ9 A;  3O87 A;  3BLS A;  4NET A;  4PM8 A;  1K6R A;  1L0G A;  2UWX A;  3N8R A;  3IQA A;  2OLU A;  3HUN A;  3P98 A;  2H0Y A;  3BEB A;  4O7D A;  2EX9 A;  1KGE A;  1FR6 A;  1J9M A;  1ONH A;  5CED A;  3NDG A;  4R1G A;  1K55 A;  1HZO A;  1MWS A;  1QME A;  3UDX A;  4Y7P A;  1K4E A;  5DF7 A;  3G2Y A;  5HAR A;  1LI0 A;  3VOZ A;  3N6I A;  2H0T A;  3QNC A;  3PBQ A;  5F82 A;  4WMC A;  1BLS A;  3HLB A;  3QHY A;  1SDN A;  3IXG A;  5EOE A;  4BQM A;  5TR7 A;  3WRT A;  4OQH A;  1XA7 A;  5I94 A;  3Q82 A;  3IWI A;  4EBL A;  4XUZ A;  2WK0 A;  1L0E A;  3ZNT A;  4DRT A;  1PWG A;  1W8Q A;  4E3J A;  3W4Q A;  3GQZ A;  3ZG9 B;  2ZQC A;  1LHY A;  5CGX A;  4MEZ A;  3ZNY A;  3N8S A;  4UAA A;  1BLH A;  5IHV A;  5DTK A;  5FQM A;  2ZQ7 A;  3ZFZ A;  3PBR A;  4R0Q A;  3D4F A;  1NXY A;  1YLJ A;  1BTL A;  3UPN A;  2ZQ8 A;  1YQS A;  4KQO A;  5M19 A;  2WKI A;  1PZO A;  3Q07 A;  4FH2 A;  3PAG A;  2HPB A;  1K54 C;  1GCE A;  3NBL A;  2Y4A A;  3WS4 A;  5KSC A;  3ITB A;  2R9X A;  3SS3 A;  5E43 A;  4DE3 A;  3UNW A;  2ZC5 B;  2ZM2 A;  3B3X A;  1ZG6 A;  1RGZ A;  1K6S A;  1S6R A;  4DXB A;  3CG5 A;  1L0D A;  2FFY A;  3ZVT A;  3BM6 A;  1JTD A;  1MBL A;  4LCM A;  4EBN A;  2G2W A;  4PM6 A;  4X53 A;  3UDF A;  1LL9 A;  1PWC A;  4KZ4 A;  1YT4 A;  1EI5 A;  4WEL A;  1GA9 A;  3SH9 A;  3E2K A;  4K0W A;  3G31 A;  3V39 A;  2WYX A;  2JCH A;  4QY5 A;  2Q9N A;  1ERO A;  1XKZ A;  2GDN A;  3W4O A;  4QU3 A;  3VSK A;  5CXW A;  5HFO A;  3SS4 A;  2P9V A;  3G4P A;  1JTG A;  2ZMA A;  3CMZ A;  4KQR A;  3HVF A;  4E6W A;  4JF6 A;  2V1Z A;  4JXV A;  2IWD A;  3IH9 A;  4BD0 A;  4H8R A;  1M40 A;  2IWB A;  5FSR A;  4K91 A;  3BFF A;  3UE0 A;  1H8Y A;  2A49 A;  2Y2N A;  3NDE A;  4OPR A;  4Z9Q A;  1LL5 A;  3PBN A;  1WYB A;  1K57 C;  2OLV A;  5KSH A;  1VQQ A;  1TVF A;  1H8Z A;  2WGW A;  1DJC A;  1XXM A;  3BLM A;  1YLY A;  5CER A;  1IYS A;  4K0X A;  4HBT A;  1MWU A;  1KE4 A;  2EFX A;  3BFD A;  1FCM A;  1MWR A;  2P9V B;  3N4I A;  3Q7Z A;  2X02 A;  1CK3 A;  3OPP A;  2R9W A;  3MZE A;  2Y2G A;  5KMW A;  5DF9 A;  4IBX A;  2HDU A;  3C7V A;  5FQ9 A;  3UY6 A;  1K56 D;  1RGY A;  3N7W A;  2I72 A;  2JBF A;  4N1X A;  3LCE A;  1I2S A;  4RX2 A;  1K56 A;  1PIO A;  2C5W B;  3A3I A;  1SDE A;  5EE8 A;  1K55 C;  4OPQ A;  1KVL A;  3IT9 A;  2WGW B;  2ZQ9 A;  4GD6 A;  4OPZ A;  4QD4 A;  4EWF A;  4OQG A;  4GNU A;  3TOI A;  2J8Y A;  2J9P A;  4LEN A;  3DWZ A;  3O88 A;  2FFF B;  1SHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...