4WN5A

Crystal structure of the c-terminal per-arnt-sim (pasb) of human hif-3alpha9 bound to 18:1-1-monoacylglycerol
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
108
Chain Sequence
HMGRGAFLSRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSKGQAVTGQYRFLARSGGYLWTQTQATVVSGRGPQSESIVCVHFLISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Hypoxia-inducible factor 3-alpha
publication title Unsaturated fatty acids as high-affinity ligands of the C-terminal Per-ARNT-Sim domain from the Hypoxia-inducible factor 3alpha
doi rcsb
source organism Homo sapiens
total genus 30
structure length 108
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4wn5A00
5HDCA 4JGPA 2D02A 3VE4A 1T19A 3RH8B 4NXFA 3ULFA 1S4RA 5J7EA 4GS9A 1DP8A 2EA9A 4NXGA 4HH3A 3LI8A 3UB8A 4EQ1A 3HJKA 4HJ4A 3BY9A 4R6LA 1GSVA 2Z6DA 5G4YA 5DJUA 3PHYA 2YKHA 3P7NA 5J3WA 4WF0A 2WKQA 1XJ3A 5HD5A 3CWFA 2J80A 3NOTC 5HSQA 2JN7A 5HWWA 3K3CA 4KUOA 2L1MA 1OJGA 1OTIA 4HHDA 1N9OA 2KX6A 4EEUA 4K08A 1OTAA 4GS9B 1F98A 4BBVA 1XFQA 2VV6A 3C2WA 3LYXA 4WLAA 1UWPX 2PD8A 2OOLA 5KIZA 1OTDA 4WUJA 4KUKA 2K7SA 2A24A 2OWHA 4I3JA 2GJ3A 4HY8A 1S1YA 3LIEA 3MQQA 4R38A 1XJ6A 2W27A 2PYRA 1OT6A 4GCZA 1S67L 4EEPA 4I38A 3MQOA 5EFWA 5J4EA 4EESA 3MJQA 4HJ3A 3E4QA 4BBTA 2I9VA 5F5YA 3NHQA 4I5SA 4H6JA 4MN5A 3F1PB 3ICYA 3LICA 1DP9A 3A0SA 3BY8A 4R70A 4E04A 2V1BA 1P97A 2A24B 1VB6A 4RQ9A 5TBMA 1WA9A 3EEHA 1S66L 2YKFA 4LPZA 1XFNA 3BWLA 1GSXA 2QHKA 3UB9A 3KX0X 2ZBBA 2HV1A 4HH2A 1N9LA 3NOUC 4I3IA 3OLOA 1D06A 3IS2B 5F68A 2R78A 1GSWA 4PKYA 2QJ7A 5DJTA 3GECA 5HZHA 2BASA 1D7EA 1LT0A 4LRXC 4H6JB 3A0VA 1S1ZA 1LL8A 4JGRA 3LI9A 4F3LA 2OWJA 3F1PA 1S4SA 1P0ZA 1OT9A 4I3AA 5AVFA 2VV7A 5TBMB 2V1AA 4B9OA 2D01A 3MR0A 5F6AA 3C8CA 5HWTA 2M1CA 4GHIA 4JGQA 3VE3A 5HWVA 2INWA 4GW9A 2PD7A 1F9IA 4EETB 5A8BA 1LSXA 2VLGA 3IS2A 3LIDA 3CLOA 5F69A 2CMNA 4HQAA 2WKPA 2L4RA 3FC7A 1XJ4A 5HDDA 3HJIA 2PHYA 3UB7A 4HJ6A 1UGUA 2P7JA 1JNUA 2V0WA 4F3LB 3MXQA 5DKLA 2QJ5A 1OJ5A 3F1OB 4PKYG 4NXEA 1NWZA 4L9EA 5HD3A 4MN6A 2VV8A 1DP6A 3K3DA 2QWSA 1OTEA 4JGOA 2ZOIA 1TS6A 1UWNX 4HP9A 3UB6A 1OTBA 1EW0A 1MZUA 3SW1A 4BBUA 4GHIB 4KQDA 4XT2B 3GDIA 4M4XA 3LIBA 3UE6A 5AVEA 2Z6CA 1XJ2A 2VEAA 1T18A 3H9WA 5I5LA 1T1CA 4DJ3A 2L0WA 1TS8A 2W0NA 5IU1A 4L9GA 2PR5A 3ZQ5A 4R3AA 2ZOHA 3G6OA 1TS0A 3RTYA 1Y28A 3H7WA 4DJ2A 4EW7A 4HIAA 4YWZA 3D72A 4NXBA 3FG8A 3F1NB 3CAXA 1KOUA 5DKKA 4I39A 4L9FA 1TS7A 3F1OA 5IS1A 1V9YA 3H82B 2PR6A 1DRMA 3B33A 1N9NA 2KDKA 1ODVA 4LRYC 3E4PA 3EWKA 3NJAA 3LIAA 4WN5A 2B02A 2JHEA 4HNBA 4HP4A 1T1BA 3A0RA 4XT2A 2PDRA 4EXOA 2V0UA 2H28A 2PYPA 1LSVA 4HOIA 3VOLA 2QKPA 1T1AA 1LSWA 3T50A 1V9ZA 3LIFA 1G28A 3LUQA 4LLOB 3PYPA 3UMDA 4WL9A 3NOPC 2WKRA 2V9AA 4LRZE 4HI4A 3IBRA 3H7WB 5HDSA 4EERA 1BYWA 3F1NA 1X0OA 3UMEA 3E4OA 3MFXA 3H82A 5G4ZA
chains in the Genus database with same CATH superfamily
1GA0A 2EXBA 3KSIA 2H0TA 3TOIA 4BJPA 3IF6B 3VP3A 3RH8B 5CHUA 3CHWP 3EGXC 1DP8A 3PBOA 4HH3A 4CQHA 1QMEA 3T4QA 3UB8A 4EQ1A 3TW8A 5KZHA 2ZC4B 4ZJ3A 5JYOA 2K31A 5FQQA 4EV4A 4LV1A 5HL6A 2OAQ1 5G4YA 5DJUA 2W1RA 5FQKA 3E2LA 5FQ9A 5J3WA 3M2KA 3EOIA 1JTGA 3BFEA 4WF0A 3KYQA 4OVDA 1FR1A 3HUOA 2O9BA 2GNXA 3HLGA 5E43A 3K3CA 5HPIA 1XXMA 2KX6A 3R4KA 4HHDA 5EV0A 4EEUA 1IOUA 3UE3A 3O3VA 3AGEA 2WGWA 4BBVA 1XFQA 2KOIA 4Q0JA 3VFFA 2LB9A 3IH9A 1XGJA 1UWPX 3HUNA 4Y0UA 3GVBA 3A3IA 4BD1A 1M40A 2A24A 1MKIA 1S0WA 5FAPA 3E2KA 3RXWA 1YKDA 4XUXA 3BRMA 5F1FA 3V50A 3IX3A 4EBPA 3QP4A 3T4KA 3MQOA 3IF6C 4X53A 4UHUA 1XX2A 4EUVA 2I9VA 3VSLA 4D2OA 2Y55A 4Y3IA 1ZTUA 3ZG8B 1ACFA 3VV4A 3NHQA 5HX9A 2DRWA 2JKTI 1YLZA 2WGWB 4Q0IA 4X68A 5GHYA 3ZFZA 3ICYA 3G2ZA 2V20A 5A92A 4CLCE 1K4EA 4IBRA 2A24B 4JXWA 3CI6A 2VJWA 3NCKA 2FFYA 1SKOB 2QZ6A 2O9AA 3HLBA 1BLPA 3VOZA 5K5BA 4C3QA 3UB9A 4Y15A 3T1SA 3W4QA 4UA6A 4M3KA 5CEDA 1QMFA 2HV1A 4WEJA 2J8YA 3CUEC 4X55A 4AFIA 3NECA 1KGEA 1XP4A 4BLMA 4DN0A 5CEBA 1NZOA 2JCHA 1GA9A 4E3JA 3UNWA 4N9KA 4E3LA 3GECA 1K54C 2V8FA 3BFDA 2AVXA 4KZ6A 3OC2A 4LRXC 3B42A 2EFUA 3A0VA 3IBJA 1CEFA 3S7NA 4OQIA 1LL8A 3DWKA 3FPWA 3LI9A 5KMWA 2HDUA 2GX5A 4F3LA 2G2UA 1BSGA 3F1PA 5EVLA 5DTSA 2VV7A 2PBDP 3WS5A 1E4DA 5F1GA 4CLCB 5A91A 4IUHA 4B9OA 3MR0A 3A3JA 3E98A 3DBAA 4U0XA 3DAVA 2Y2JA 3IXHA 3V3RA 4ZAMA 1RP5A 2WUQA 3OPPA 2M1CA 3G31A 1BUEA 3UB5P 1ERQA 1PI5A 4GHIA 1DJAA 3UPNA 3VE3A 5L09A 3PR6A 5HWVA 4GW9A 4GKUA 3PBNA 3KSFA 1CQAA 2VLGA 5EE8A 2O0YA 4IUKA 1FILA 2A49A 2XRNA 4DXCA 2CMNA 1IYOA 4JPMA 3FC7A 1XJ4A 4JXGA 4DE1A 3HJIA 4IVKA 2GZAA 3ZGAB 1NJ4A 3ZNTA 2Q0OA 2HP9A 4C6YA 3Q81A 4PM6A 2XF3A 2V0WA 4F3LB 1LLBA 4JF6A 1RGZA 4OONA 1NYMA 1CI9A 2B95A 3F1OB 4WZ4A 1K57A 2IWCA 2VV8A 2WZZA 1K55C 4FTXA 3TSGA 1ALQA 2P9VA 3UB6A 1OTBA 1NXYA 2JE5A 4N92A 3N8LA 3HLDA 4GHIB 1ESIA 4M4XA 3ZVTA 4LCMA 2WKHA 2VEAA 1T18A 5FA7A 4ZJ1A 3CPTB 3H9WA 2L0WA 4Y5FA 3LCEA 5M1AA 1SHVA 2PR5A 2ZC6B 3N7WA 1MKMA 2O99A 3WS0A 4JLFA 3N6IA 1G5UA 1H8YA 3RTYA 3H7WA 4QD4A 4EW7A 4YWZA 3LEZA 3CAXA 3C7UA 3Q82A 4I39A 4RA7A 3QHYA 3C5AA 3DWZA 1V9YA 1NRFA 2Y2PA 4OLGA 4LRYC 3I7JA 3VMAA 3NJAA 3LIAA 4PM9A 4S2LA 4Z9QA 2B02A 4DDSA 2PRFA 1L0FA 4EUZA 4HP4A 1T1BA 3NDEA 3A0RA 2Y2NA 3MKEA 2V0UA 4E3NA 3FKVA 4KQRA 2Y59A 3TRCA 4II7A 2ZQCA 3VOLA 2R9XA 1PZPA 3NC8A 4DRTA 2W3HA 4MBKA 3NOPC 5FL3A 4BQMA 1LHYA 1WE4A 1I5QA 4HI4A 3H7WB 5TGFA 4LENA 3R7WB 4QB8A 1FIKA 3HL9A 4WMCD 3TE8A 4Q8IA 3F1NA 3VP0A 2X02A 3IHAA 1EWZA 1SKFA 2VGLS 4JGPA 2D02A 3VE4A 4R4RA 1L0GA 4NXFA 3ZCZA 1KDWA 3HLEA 1GHMA 1MY8A 5CGSA 1NY0A 4UEYA 1BULA 4GS9A 3LY3A 3DW0A 2EA9A 2Y4AA 1MPLA 4NXGA 3LI8A 3HJKA 3PBSA 5DF8A 1G6AA 2ZMAA 5L8MA 1VETA 5I94A 1XPBA 1D1JA 4PM7A 2ZL1A 3BY9A 4DF6A 3IQAA 4R6LA 1J3WA 2OSUA 1IELA 1K6RA 4Y13A 5L10A 2YKHA 4GB7A 4GD8A 4NEED 4GZBA 5FATA 4BMWA 3M2JA 3BM6A 1SZVA 1XJ3A 5EPHA 3CWFA 4UA9A 3NOTC 2JN7A 3OPHA 5HWWA 1VEUB 4MLLA 1OPXA 1OTIA 5EOEA 1N9OA 4K08A 3HUMA 3MZDA 1OTAA 3C4PA 1MWSA 1ONGA 3IF6A 2RL3A 4HBTA 4GS9B 5GHZA 5HW3A 5DF7A 5EM0A 2BG1A 1L3LA 3C2WA 3OZHA 3CG5A 2Y2IA 4WLAA 5AQ7A 1GHIA 2V1ZA 3BYDA 1VETB 2I72A 2PT7A 4KUKA 3DTEA 3ZG5A 3FYZA 3GQZA 4I3JA 3ZG0A 3ZVWA 2ZL1B 4NG2A 3W4OA 3FPVA 1XJ6A 1YPRA 1WYBA 4BENA 1AXBA 1K25A 1S67L 3N8RA 3LEQA 1K56D 3OCNA 2ZD8A 5EFWA 3VP4A 1RGYA 4HBUA 4EESA 5EVID 4P87A 1ESUA 2ZMVA 2VGKA 1IYSA 2VGLM 2E8IA 3CUEA 4H6JA 4MN5A 3S7OA 3S4XA 5EVIC 2OV5A 4A5RA 1K54A 3OPLA 3BY8A 2WK0A 4R70A 3VOYA 5TBMA 1S66L 5FQIA 4O01A 4LPZA 3M6BA 3WS2A 3BJNA 3BWLA 1VHMA 1GSXA 3A3EA 4F94A 4L0LA 1FCMA 2VGJA 4WBGA 4QHCA 4NK3A 1PNEA 3KX0X 4N1XA 2Y91A 4B93A 4I3IA 4KZAA 1PZOA 2WGVA 3IS2B 3RJUA 2QPNA 2DMWA 3NY4A 2ZM0A 2R78A 3GRJA 4IHQA 4OP5A 2K2NA 1Y54A 5HZHA 2BASA 1D7EA 2Y79A 4H6JB 4MDZA 2W3FA 3UO9A 2ZC5B 3NBLA 4P0MA 1ZG6A 2RCXA 1OT9A 1MXOA 5TBMB 2V1AA 3C30A 1G68A 2D01A 1DY6A 4GDBA 4WZ5C 3Q7ZA 4B4ZA 3UDFA 2XFTA 2VX8A 1YLYA 2Y2GA 1J9MA 5F6AA 1SKOA 3UPPA 1YAXA 2OLUA 2WAEA 5IT5A 3VFHA 5GLBA 4N9LA 4HEFA 2XA7S 2ZLYA 3PBTA 5CX7A 2INWA 2PD7A 4JF5A 4EETB 2EWVA 4UA7A 5F69A 3CMZA 1EROA 1O7EA 4YINA 4EBNA 2WKPA 2L4RA 2HP5A 4U3TA 1XKZA 4LCLA 3UB7A 2UWXA 4OPZA 2P7JA 4DKIA 4FCFA 3MXQA 3QNCA 1ONHA 2XH9A 3JPUA 2QJ5A 1PW1A 4FH2A 3KSHA 3UY6A 4PKYG 2WAFA 1PFLA 1YMSA 4KZ3A 4MN6A 4CLCA 4OOLA 2X01A 4E3OA 2QWSA 3IH8A 1YQSA 4WYYA 1KE4A 3ZYTA 1NLYA 3EQVA 3WS1A 4MMNA 2PU4A 5DVAA 3IXDA 3IX4A 4IVIA 3GDIA 4EBLA 1W8YA 4OPQA 3RFBA 2PBYA 3UE6A 1L0DA 2Z6CA 4DDYA 2IWDA 2PU2A 3MMHA 1T1CA 2VA0A 3V3SA 3P01A 4DJ3A 2W0NA 4IJGA 5FASA 3IWQA 4L9GA 3ZQ5A 2ZQ7A 3ZDJA 2XFSA 3EEAA 4OOMA 3G2YA 3BFGA 4DJ2A 3D72A 3LR4A 5CXWA 1TDLA 5E2FA 3G4PA 4L9FA 4GLQA 3SH7A 5M18A 3F1OA 3M6HA 1DRMA 3A3FA 3W2ZA 3B33A 1N9NA 2KDKA 3IXGA 4BWIA 3UE1A 2NUTC 2IA2A 3O5YA 1SDNA 2XA7M 4HNBA 4KG5A 2XD5A 4O8GA 5M19A 4KZ4A 2EXAA 4WMCA 1TD5A 3HLWA 1K38A 2KLIA 4X6TA 3CPTA 4H8RA 5CERA 4QWOA 3MBZA 1T1AA 1Q2PA 3E0YA 1KE3A 3LUQA 4MBHA 4QY5A 3T4JA 4IEDA 5L2FA 3GR2A 1IKGA 4KQQA 1PI4A 1EI5A 4LV3A 3NDGA 5EOOA 3UDIA 1X0OA 3L7HA 3S7PA 3UMEA 3G34A 2ZQ9A 4LFUA 1YM1A 4YNRA 2QMIA 1T19A 4MCWA 5J7EA 4S2NC 3ZG9B 4ESPA 1KGFA 4CPKA 3N8SA 4ID4A 4QJGA 2J7VA 2JKRM 5EECA 2Y2MA 5U47A 3PTEA 3V39A 4C75A 4OKPA 5EUAA 1BT5A 1GSVA 1JTDA 2ZM2A 2WKQA 3R7WA 4P6BA 5HD5A 1HZOA 3O86A 1N9BA 4WEKA 5FSRA 5HSQA 2Y2KA 3C7VA 4OPYA 4X56A 4KUOA 4XXRA 3DTKA 2Y2OA 2H5SA 3JYIA 1PWCA 4MEZA 3VP2A 1F98A 5G18A 3B3XA 2VK3A 3CJMA 5EM1A 5KIZA 3SZTA 1OTDA 2K7SA 1HVBA 1FCNA 4S2KA 3AGFA 4ARZA 2OWHA 1W7FA 1H3QA 5EVIA 2GJ3A 2JBFA 4HY8A 4PHTA 3QP8A 1S1YA 3LIEA 3LY4A 4R38A 4XUZA 3P09A 2PYRA 3V67A 1OT6A 5FI2A 2PAVP 4GN2A 2W1TB 4EWFA 3HLCA 1NYYA 1ES3A 4WM9A 5J4EA 1MC0A 4BL2A 3MJQA 3HBRA 3E4QA 4GD6A 2Y2LA 4YFMA 5F5YA 1VEUA 2Z2LB 2FH5A 4OOYA 1FCOA 1K4FA 4OPRA 3IXBA 4D60A 2R9WA 2M7UA 5LBRA 5CHJA 3NIAA 2GDNA 4PAUA 2WGIA 2V1BA 1P97A 1VB6A 4S2MA 1WA9A 4ARZB 5KSCA 5EVIB 2YKFA 1LL5A 1XFNA 5FEFA 4QU3A 2QHKA 4KQOA 5J8XA 1KDSA 3VP1A 1YLPA 1MWTA 3FV7A 2ZBBA 2X71A 3G32A 4S2PA 1H0MA 4HH2A 5GL9A 1N9LA 3ZHHA 4WZ5A 1D06A 2W3DA 5HPFA 4E6XA 1BLSA 4S2IA 1JWVA 5DFYA 1N4OA 2E8JA 2QJ7A 2HJEA 3FZCA 3IX8A 5DJTA 4Y7PA 1K57C 2ZMFA 1I2SA 4O7DA 1E3UD 1G6OA 3C4OA 4JGRA 2XSSA 1GCEA 5MC7A 1F2KA 2Q9MA 1PIOA 4E3KA 2OWJA 3DTMA 1S4SA 1P0ZA 1ES2A 3K2NA 4R4SA 5FAQA 1Q2QA 3SS3A 3MSHA 2HZ5A 1A0KA 5GHXA 4EU0A 5CRFA 4EQIA 4PPRA 2XROA 3BFCA 2IWBA 3P98A 4Y0OA 4UAAA 3C8CA 4ETXA 5DFXA 4JGQA 3L9KA 5CECA 5TR7A 2ZQ8A 3HLFA 2W3EA 4Z1WA 1LSXA 3IS2A 3LIDA 1S6RA 2H10A 5HDDA 3Q07A 2PHYA 3TJZC 4HJ6A 3S22A 3ITBA 4KENB 2EWWA 2B5RA 1JNUA 2EX8A 3MZEA 3WWXA 2QYBA 1OJ5A 4JF4A 5TFQA 4NXEA 1NWZA 4L9EA 2J3WA 5D3OA 1YSPA 3S1YA 1OTEA 1PWGA 4JGOA 3T1QB 5BOHA 3MXSA 3QP2A 4HP9A 1PWDA 1EW0A 4JXSA 4PMAA 4R0QA 4R3JA 5FQMA 4FD8A 3ZG7B 3TG9A 4KQDA 4XT2B 4UQIS 4LGWA 4DMZA 3KYEA 3D3OA 1HD8A 3LIBA 1ES5A 4G3WA 1XJ2A 1NLZA 5I5LA 5F82A 1ZHHB 1TS8A 4JKTA 5HAIA 1W8QA 3MKFA 1YLTA 4R3AA 5AQAA 1TS0A 3SS5A 2G7UA 1Y28A 5FI7A 4HIAA 1CK3A 4NXBA 1KOUA 2VZWA 3BECA 2XLNA 1H5XA 3CITA 3H82B 4U0TA 2XK1A 3O88A 5F83A 1ODVA 2J3TD 4O0PA 2DNSA 3UE0A 2WKIA 3EWKA 3AGDA 2V8CA 4WN5A 3GTCA 1W63Q 2UV0E 4GJ4A 1CI8A 1K55A 5DF9A 2J3TC 4KZ7A 2PYPA 2JKFA 5GLDA 2ZJ9A 1W79A 1LSVA 5EVEA 4HOIA 2HGVA 3D4FA 2QKPA 4S2NA 4Y2FA 3PXPA 3UPOA 1G28A 4PM5A 2FFFB 2MJ6A 3UMDA 4OQGA 2WKRA 3FKWA 5KSHA 1TEMA 2JKGA 4JXVA 3BLMA 1W5DA 5AQBA 4R1GA 3V5MA 2EFXA 5HDSA 1BYWA 4QY6A 3N4IA 4OQ0A 2Y2QA 1KVLA 3E4OA 3MFXA 1O07A 1U60A 4WUJA 1P9RA 5HDCA 3ULFA 4RVAA 1S4RA 5HL1A 3QNBA 4UQIM 1TVFA 2H0YA 3PBRA 4E6WA 1NRJA 3KYZA 2P74A 4N1HA 3A3DA 4ZBEA 1WYCA 5CTNA 4HJ4A 1CEGA 4ZJ2A 5A93A 3EGDC 4OH0A 1H8MA 1YLJA 2ZQDA 1VQQA 4Y17A 3PBQA 3BLSA 3LFVA 4K0WA 2Z6DA 3T1RA 3OPRA 4NKPA 2M7VA 2XGNA 2JKRI 3PHYA 1GHPA 1YMXA 3O87A 2HPBA 4X1LA 3P7NA 1XA1A 1JVJA 4WELA 2ZC3B 3IWOA 2WADA 1VM1A 1IYPA 5E2HA 2J80A 3T4TA 4HESA 1BZAA 4RX2A 2L1MA 1H8ZA 1OJGA 2C5WB 3BQ8A 3BW6A 4S2JA 5JYPA 1IYQA 2HDRA 3PAEA 3U4LP 4MBFA 2VV6A 3LYXA 4X69A 3QP1A 2PD8A 5CGWA 2OOLA 4FOFA 4GDNA 2Q9NA 1LL9A 4G3VA 4ME4A 4LV0A 4KZBA 3T4SA 3ZNYA 2HDSA 3UN7A 3Q1FA 1OMEA 2XR0A 1Z09A 3MFDA 3MQQA 3G30A 2W27A 4Y0TA 3DTIA 4GCZA 4EEPA 4DE0A 2W3GA 2JKTM 4I38A 1ERMA 2XDMA 3JVUA 4S2OA 5FQJA 3C38A 4KG6A 5CGXA 3HCYA 4HJ3A 4BBTA 3WRTA 2ZM8A 3OBFA 4P6ZS 1DJCA 4I5SA 2EX9A 4Q0HA 2ACGA 1BTLA 3F1PB 3WS4A 2HJ9C 3QP6A 3LICA 1F5MA 1DP9A 3A0SA 5A90A 4RYEA 5HAPA 5C5KA 4E04A 2G2WA 4RQ9A 4X25A 5HARA 3BFFA 4GNUA 4KZ9A 3S7QA 3NI9A 2P04A 4R3BA 3EEHA 2WKEA 4OP8A 3QP5A 1NZUA 3OCLA 5HAQA 2HDQA 3GV9A 3BQAA 3RXXA 2HF6A 1E3UA 5L07A 4FUWA 1L0EA 4G3KA 3NOUC 1ZKJA 3OLOA 3B47A 4CLCD 1MWRA 1Y4OA 1ES4A 2Y2HA 5DTKA 2W1TA 2XEPA 5F68A 3GSGA 3MQ0A 1RCJA 5IHVA 1IFQA 3SH9A 1GSWA 4PKYA 2J9OA 2A2LA 3Q7VA 2O9CA 2B18A 2CC1A 1ZG4A 3HVFA 4FSFA 5GLAA 3T4OA 4KG2A 4CLCC 1LT0A 4ETZA 1S1ZA 1PYYA 1MBLA 2WYXA 2Y8HA 3NULA 1KGGA 1L2SA 5AQ9A 1BLHA 4I3AA 1FOFA 5AVFA 1DJBA 3LR0A 1Z6FA 4ZTKA 3W4PA 1K56A 2P9VB 3KSGA 1KVMA 1YSQA 3LR5A 2OAP1 3BEBA 4MN7A 5FDHA 3G35A 1PW8A 5HWTA 4R23A 3GMWA 3SH8A 2LB5A 1XGIA 1F9IA 5HFOA 3EQUA 1I2WA 5A8BA 3CLOA 1LI9A 5CTMA 3SS4A 1IKIA 3Q7VB 1W63M 1YT4A 4KZ8A 4HQAA 4P6ZM 5FI6A 1CJFA 3KO6A 1FR6A 1UGUA 2WZXA 2Z2MB 1SDEA 4P85A 5DKLA 2ZC7A 4E3MA 5HD3A 1CF0A 1DP6A 3K3DA 4OLDA 4BD0A 2VKSA 5GLCA 2ZOIA 1FSWA 1TS6A 1UWNX 2OLVA 3IWIA 1MZUA 3SW1A 1K6SA 2EX2A 1E25A 4BBUA 4FH4A 1SCWA 3PAGA 5AVEA 2V2FF 4YOFA 5FAOA 3CZDA 5FDSA 3T12B 5FEGA 2XQZA 5E2GA 1BLCA 4E3IA 1K0KA 5IU1A 4RX3A 2JC7A 2ZQAA 1M6KA 3LGOA 3MXRA 2ZOHA 3G6OA 3ITAA 4IBXA 2DCFA 2HP6A 4BL3A 1P9WA 4K0XA 4OQHA 3FG8A 3F1NB 4JBFA 5DKKA 1JWPA 2BLSA 1AWIA 4LV2A 1TS7A 3IHBA 4ZRRA 5IS1A 1PRQA 4GOGA 2PR6A 3U2AA 1TF1A 3E4PA 4DE3A 3LO7A 5TJJA 4KZ5A 1C3BA 3D9YA 3IF5A 4ZDXA 2JHEA 4DXBA 4XT2A 4PM8A 2PDRA 4EXOA 3HREA 3W8KA 2H28A 3IT9A 4QPRA 2EX6A 1IEMA 3JVVA 1MWUA 5AJGA 1FQGA 1ZC2A 3SOIA 3VSKA 4DE2A 4K91A 5DTTA 1LSWA 3T50A 4B4XA 1V9ZA 3LIFA 4MNRA 4LLOB 1STZA 3PYPA 1FSYA 2FZ0A 4WL9A 2V9AA 3MF0A 4LRZE 1LI0A 3T4LA 2C6WB 2P08A 3MZFA 3UDXA 3LR3A 3IBRA 3WRZA 3FWLA 2A3UA 1HLUP 4EERA 2J9PA 3ISGA 5E2EA 4B88A 3T1XA 1TDGA 4CJNA 5CHMA 2XD1A 2BTFP 4X1MA 1HTZA 1KE0A 1YLWA 3MS6A 4NETA 2NUPC 3H82A 3OOVA 1JWZA 1XA7A 5G4ZA
chains in the Genus database with same CATH topology
4YNRA 2VGLS 3KSIA 4BJPA 5HDCA 4JGPA 2D02A 3VE4A 1T19A 3RH8B 4NXFA 3ULFA 1S4RA 4MCWA 5J7EA 4UEYA 3EGXC 1DP8A 4GS9A 4UQIM 2EA9A 4NXGA 3PBOA 4HH3A 4CQHA 3LI8A 3T4QA 3UB8A 4EQ1A 3HJKA 2JKRM 3PBRA 3TW8A 1NRJA 3PBSA 3KYZA 5L8MA 2K31A 4HJ4A 3EGDC 1H8MA 3BY9A 4R6LA 3PBQA 5HL6A 1GSVA 3LFVA 2Z6DA 2OAQ1 4NKPA 2M7VA 5G4YA 5DJUA 2W1RA 2JKRI 3PHYA 2YKHA 4NEED 3P7NA 5J3WA 3EOIA 4WELA 4BMWA 4WF0A 2WKQA 3KYQA 3R7WA 1XJ3A 5HD5A 3CWFA 2J80A 3T4TA 2O9BA 2GNXA 3NOTC 4WEKA 5HSQA 2JN7A 5HWWA 3K3CA 4KUOA 2L1MA 1OJGA 1OPXA 1OTIA 5HPIA 3R4KA 1N9OA 2KX6A 4HHDA 4EEUA 1IOUA 3BQ8A 4K08A 3BW6A 1OTAA 3UE3A 4GS9B 1F98A 4BBVA 1XFQA 2VV6A 2KOIA 3C2WA 4Q0JA 3LYXA 4WLAA 2LB9A 1UWPX 2PD8A 2OOLA 4FOFA 5KIZA 1OTDA 4G3VA 2PT7A 4KUKA 2K7SA 2A24A 4ME4A 3T4SA 4ARZA 2OWHA 4I3JA 1H3QA 2GJ3A 4HY8A 4PHTA 1S1YA 1YKDA 3LIEA 3FPVA 3MQQA 4R38A 1XJ6A 2W27A 2PYRA 3V67A 1OT6A 4GCZA 1S67L 4EEPA 2W3GA 2JKTM 4I38A 2W1TB 3T4KA 3JVUA 3MQOA 3OCNA 5EFWA 3C38A 5J4EA 1MC0A 4EESA 3MJQA 3HCYA 4HJ3A 3E4QA 4EUVA 4BBTA 2I9VA 2ZMVA 3OBFA 4P6ZS 2VGLM 4Y3IA 1ZTUA 5F5YA 3VV4A 2FH5A 3NHQA 4I5SA 2JKTI 4Q0HA 3CUEA 4H6JA 4MN5A 3S7OA 4Q0IA 3F1PB 3ICYA 2M7UA 5LBRA 2HJ9C 3LICA 1F5MA 1DP9A 3A0SA 3BY8A 4PAUA 4R70A 5C5KA 4CLCE 4E04A 2V1BA 1P97A 2A24B 1VB6A 4RQ9A 5TBMA 3S7QA 2P04A 1WA9A 3EEHA 4ARZB 3CI6A 1S66L 2VJWA 2YKFA 4O01A 4LPZA 1XFNA 3BJNA 3BWLA 1VHMA 3OCLA 2O9AA 1GSXA 2QHKA 4KQOA 4L0LA 5K5BA 3UB9A 3KX0X 3BQAA 2HF6A 2ZBBA 2HV1A 4WEJA 4B93A 4G3KA 4HH2A 1N9LA 3NOUC 4I3IA 3OLOA 1D06A 3B47A 4CLCD 2W3DA 3CUEC 3IS2B 4AFIA 2W1TA 5HPFA 5F68A 4DN0A 3MQ0A 2DMWA 1IFQA 2R78A 1GSWA 4PKYA 5DFYA 2A2LA 4IHQA 2QJ7A 2HJEA 2O9CA 5DJTA 3GECA 2B18A 2K2NA 5HZHA 4FSFA 2BASA 1D7EA 2Y79A 3T4OA 2ZMFA 4CLCC 1LT0A 3OC2A 4LRXC 3B42A 4H6JB 4MDZA 4ETZA 3A0VA 3IBJA 1S1ZA 3S7NA 1G6OA 1LL8A 3FPWA 4JGRA 3LI9A 2XSSA 2W3FA 5MC7A 2GX5A 4F3LA 2Y8HA 2OWJA 3F1PA 1S4SA 1P0ZA 3K2NA 1OT9A 4EU0A 4I3AA 5AVFA 2VV7A 4CLCB 3LR0A 4IUHA 5TBMB 2V1AA 3C30A 4B9OA 2D01A 2XROA 3MR0A 3KSGA 1YSQA 3LR5A 2OAP1 4MN7A 2VX8A 3E98A 3DBAA 5F6AA 3C8CA 1YAXA 5HWTA 2M1CA 4ETXA 5DFXA 5IT5A 4GHIA 4JGQA 3VE3A 3PR6A 5HWVA 2XA7S 5CX7A 2LB5A 3PBTA 2INWA 4GW9A 2PD7A 3PBNA 1F9IA 2W3EA 3EQUA 4Z1WA 3KSFA 4EETB 2EWVA 5A8BA 1LSXA 2VLGA 2O0YA 3IS2A 3LIDA 4IUKA 3CLOA 5F69A 2XRNA 2CMNA 1W63M 4HQAA 4P6ZM 2WKPA 2L4RA 3FC7A 1XJ4A 5HDDA 3HJIA 3KO6A 2PHYA 2GZAA 3UB7A 3TJZC 4HJ6A 1UGUA 2P7JA 2EWWA 1JNUA 2V0WA 4F3LB 3MXQA 5DKLA 2QYBA 2QJ5A 1OJ5A 3KSHA 3F1OB 4PKYG 4NXEA 1NWZA 4L9EA 5HD3A 2J3WA 2VV8A 4MN6A 1DP6A 1YSPA 4CLCA 3K3DA 4OOLA 2VKSA 2QWSA 1OTEA 4JGOA 2ZOIA 1TS6A 1UWNX 4HP9A 3UB6A 1OTBA 1EW0A 1MZUA 3ZYTA 3SW1A 1NLYA 3EQVA 4MMNA 4BBUA 4GHIB 4KQDA 4XT2B 3GDIA 4UQIS 4DMZA 4M4XA 3D3OA 3RFBA 3LIBA 3UE6A 5AVEA 4G3WA 2Z6CA 1XJ2A 2VEAA 1NLZA 1T18A 4YOFA 3H9WA 5I5LA 3MMHA 1T1CA 1ZHHB 2VA0A 3P01A 4DJ3A 2L0WA 1TS8A 2W0NA 4IJGA 4Y5FA 5IU1A 4L9GA 2PR5A 3ZQ5A 1MKMA 2O99A 4R3AA 2ZOHA 3EEAA 3G6OA 1TS0A 4OOMA 2G7UA 3RTYA 1Y28A 3H7WA 1P9WA 4DJ2A 4EW7A 4HIAA 4YWZA 3D72A 3LR4A 4NXBA 3FG8A 3F1NB 3CAXA 1KOUA 2VZWA 5DKKA 4I39A 3CITA 4L9FA 4GLQA 1TS7A 4ZRRA 3F1OA 5IS1A 1V9YA 3H82B 2PR6A 1DRMA 3W2ZA 3U2AA 1TF1A 3B33A 1N9NA 2KDKA 1ODVA 4LRYC 2J3TD 4O0PA 4BWIA 3E4PA 3EWKA 2NUTC 3NJAA 2IA2A 3O5YA 5G4ZA 3LIAA 5TJJA 4WN5A 1W63Q 2B02A 2JHEA 2XA7M 4HNBA 4HP4A 1T1BA 3A0RA 4GJ4A 4XT2A 2PDRA 4O8GA 2V0UA 4EXOA 2H28A 5DF9A 2J3TC 4QPRA 2PYPA 1LSVA 3JVVA 3TRCA 1TD5A 5AJGA 4II7A 4HOIA 2KLIA 2HGVA 3VOLA 2QKPA 1T1AA 1LSWA 3T50A 4Y2FA 3PXPA 3E0YA 1V9ZA 3LIFA 1G28A 2MJ6A 3LUQA 2W3HA 4LLOB 1STZA 3T4JA 3PYPA 3UMDA 2FZ0A 3NOPC 4WL9A 2WKRA 5FL3A 2V9AA 3MF0A 4LRZE 5KSHA 3T4LA 2P08A 3LR3A 4HI4A 3IBRA 3H7WB 3R7WB 3TE8A 5HDSA 4EERA 1BYWA 3F1NA 1X0OA 3S7PA 3UMEA 3E4OA 3MFXA 2NUPC 3H82A 3OOVA 4WUJA 1P9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HDC A;  4JGP A;  2D02 A;  3VE4 A;  1T19 A;  3RH8 B;  4NXF A;  3ULF A;  1S4R A;  5J7E A;  4GS9 A;  1DP8 A;  2EA9 A;  4NXG A;  4HH3 A;  3LI8 A;  3UB8 A;  4EQ1 A;  3HJK A;  4HJ4 A;  3BY9 A;  4R6L A;  1GSV A;  2Z6D A;  5G4Y A;  5DJU A;  3PHY A;  2YKH A;  3P7N A;  5J3W A;  4WF0 A;  2WKQ A;  1XJ3 A;  5HD5 A;  3CWF A;  2J80 A;  3NOT C;  5HSQ A;  2JN7 A;  5HWW A;  3K3C A;  4KUO A;  2L1M A;  1OJG A;  1OTI A;  4HHD A;  1N9O A;  2KX6 A;  4EEU A;  4K08 A;  1OTA A;  4GS9 B;  1F98 A;  4BBV A;  1XFQ A;  2VV6 A;  3C2W A;  3LYX A;  4WLA A;  1UWP X;  2PD8 A;  2OOL A;  5KIZ A;  1OTD A;  4WUJ A;  4KUK A;  2K7S A;  2A24 A;  2OWH A;  4I3J A;  2GJ3 A;  4HY8 A;  1S1Y A;  3LIE A;  3MQQ A;  4R38 A;  1XJ6 A;  2W27 A;  2PYR A;  1OT6 A;  4GCZ A;  1S67 L;  4EEP A;  4I38 A;  3MQO A;  5EFW A;  5J4E A;  4EES A;  3MJQ A;  4HJ3 A;  3E4Q A;  4BBT A;  2I9V A;  5F5Y A;  3NHQ A;  4I5S A;  4H6J A;  4MN5 A;  3F1P B;  3ICY A;  3LIC A;  1DP9 A;  3A0S A;  3BY8 A;  4R70 A;  4E04 A;  2V1B A;  1P97 A;  2A24 B;  1VB6 A;  4RQ9 A;  5TBM A;  1WA9 A;  3EEH A;  1S66 L;  2YKF A;  4LPZ A;  1XFN A;  3BWL A;  1GSX A;  2QHK A;  3UB9 A;  3KX0 X;  2ZBB A;  2HV1 A;  4HH2 A;  1N9L A;  3NOU C;  4I3I A;  3OLO A;  1D06 A;  3IS2 B;  5F68 A;  2R78 A;  1GSW A;  4PKY A;  2QJ7 A;  5DJT A;  3GEC A;  5HZH A;  2BAS A;  1D7E A;  1LT0 A;  4LRX C;  4H6J B;  3A0V A;  1S1Z A;  1LL8 A;  4JGR A;  3LI9 A;  4F3L A;  2OWJ A;  3F1P A;  1S4S A;  1P0Z A;  1OT9 A;  4I3A A;  5AVF A;  2VV7 A;  5TBM B;  2V1A A;  4B9O A;  2D01 A;  3MR0 A;  5F6A A;  3C8C A;  5HWT A;  2M1C A;  4GHI A;  4JGQ A;  3VE3 A;  5HWV A;  2INW A;  4GW9 A;  2PD7 A;  1F9I A;  4EET B;  5A8B A;  1LSX A;  2VLG A;  3IS2 A;  3LID A;  3CLO A;  5F69 A;  2CMN A;  4HQA A;  2WKP A;  2L4R A;  3FC7 A;  1XJ4 A;  5HDD A;  3HJI A;  2PHY A;  3UB7 A;  4HJ6 A;  1UGU A;  2P7J A;  1JNU A;  2V0W A;  4F3L B;  3MXQ A;  5DKL A;  2QJ5 A;  1OJ5 A;  3F1O B;  4PKY G;  4NXE A;  1NWZ A;  4L9E A;  5HD3 A;  4MN6 A;  2VV8 A;  1DP6 A;  3K3D A;  2QWS A;  1OTE A;  4JGO A;  2ZOI A;  1TS6 A;  1UWN X;  4HP9 A;  3UB6 A;  1OTB A;  1EW0 A;  1MZU A;  3SW1 A;  4BBU A;  4GHI B;  4KQD A;  4XT2 B;  3GDI A;  4M4X A;  3LIB A;  3UE6 A;  5AVE A;  2Z6C A;  1XJ2 A;  2VEA A;  1T18 A;  3H9W A;  5I5L A;  1T1C A;  4DJ3 A;  2L0W A;  1TS8 A;  2W0N A;  5IU1 A;  4L9G A;  2PR5 A;  3ZQ5 A;  4R3A A;  2ZOH A;  3G6O A;  1TS0 A;  3RTY A;  1Y28 A;  3H7W A;  4DJ2 A;  4EW7 A;  4HIA A;  4YWZ A;  3D72 A;  4NXB A;  3FG8 A;  3F1N B;  3CAX A;  1KOU A;  5DKK A;  4I39 A;  4L9F A;  1TS7 A;  3F1O A;  5IS1 A;  1V9Y A;  3H82 B;  2PR6 A;  1DRM A;  3B33 A;  1N9N A;  2KDK A;  1ODV A;  4LRY C;  3E4P A;  3EWK A;  3NJA A;  3LIA A;  4WN5 A;  2B02 A;  2JHE A;  4HNB A;  4HP4 A;  1T1B A;  3A0R A;  4XT2 A;  2PDR A;  4EXO A;  2V0U A;  2H28 A;  2PYP A;  1LSV A;  4HOI A;  3VOL A;  2QKP A;  1T1A A;  1LSW A;  3T50 A;  1V9Z A;  3LIF A;  1G28 A;  3LUQ A;  4LLO B;  3PYP A;  3UMD A;  4WL9 A;  3NOP C;  2WKR A;  2V9A A;  4LRZ E;  4HI4 A;  3IBR A;  3H7W B;  5HDS A;  4EER A;  1BYW A;  3F1N A;  1X0O A;  3UME A;  3E4O A;  3MFX A;  3H82 A;  5G4Z A; 
#chains in the Genus database with same CATH topology
 1GA0 A;  2EXB A;  3KSI A;  2H0T A;  3TOI A;  4BJP A;  3IF6 B;  3VP3 A;  3RH8 B;  5CHU A;  3CHW P;  3EGX C;  1DP8 A;  3PBO A;  4HH3 A;  4CQH A;  1QME A;  3T4Q A;  3UB8 A;  4EQ1 A;  3TW8 A;  5KZH A;  2ZC4 B;  4ZJ3 A;  5JYO A;  2K31 A;  5FQQ A;  4EV4 A;  4LV1 A;  5HL6 A;  2OAQ 1;  5G4Y A;  5DJU A;  2W1R A;  5FQK A;  3E2L A;  5FQ9 A;  5J3W A;  3M2K A;  3EOI A;  1JTG A;  3BFE A;  4WF0 A;  3KYQ A;  4OVD A;  1FR1 A;  3HUO A;  2O9B A;  2GNX A;  3HLG A;  5E43 A;  3K3C A;  5HPI A;  1XXM A;  2KX6 A;  3R4K A;  4HHD A;  5EV0 A;  4EEU A;  1IOU A;  3UE3 A;  3O3V A;  3AGE A;  2WGW A;  4BBV A;  1XFQ A;  2KOI A;  4Q0J A;  3VFF A;  2LB9 A;  3IH9 A;  1XGJ A;  1UWP X;  3HUN A;  4Y0U A;  3GVB A;  3A3I A;  4BD1 A;  1M40 A;  2A24 A;  1MKI A;  1S0W A;  5FAP A;  3E2K A;  3RXW A;  1YKD A;  4XUX A;  3BRM A;  5F1F A;  3V50 A;  3IX3 A;  4EBP A;  3QP4 A;  3T4K A;  3MQO A;  3IF6 C;  4X53 A;  4UHU A;  1XX2 A;  4EUV A;  2I9V A;  3VSL A;  4D2O A;  2Y55 A;  4Y3I A;  1ZTU A;  3ZG8 B;  1ACF A;  3VV4 A;  3NHQ A;  5HX9 A;  2DRW A;  2JKT I;  1YLZ A;  2WGW B;  4Q0I A;  4X68 A;  5GHY A;  3ZFZ A;  3ICY A;  3G2Z A;  2V20 A;  5A92 A;  4CLC E;  1K4E A;  4IBR A;  2A24 B;  4JXW A;  3CI6 A;  2VJW A;  3NCK A;  2FFY A;  1SKO B;  2QZ6 A;  2O9A A;  3HLB A;  1BLP A;  3VOZ A;  5K5B A;  4C3Q A;  3UB9 A;  4Y15 A;  3T1S A;  3W4Q A;  4UA6 A;  4M3K A;  5CED A;  1QMF A;  2HV1 A;  4WEJ A;  2J8Y A;  3CUE C;  4X55 A;  4AFI A;  3NEC A;  1KGE A;  1XP4 A;  4BLM A;  4DN0 A;  5CEB A;  1NZO A;  2JCH A;  1GA9 A;  4E3J A;  3UNW A;  4N9K A;  4E3L A;  3GEC A;  1K54 C;  2V8F A;  3BFD A;  2AVX A;  4KZ6 A;  3OC2 A;  4LRX C;  3B42 A;  2EFU A;  3A0V A;  3IBJ A;  1CEF A;  3S7N A;  4OQI A;  1LL8 A;  3DWK A;  3FPW A;  3LI9 A;  5KMW A;  2HDU A;  2GX5 A;  4F3L A;  2G2U A;  1BSG A;  3F1P A;  5EVL A;  5DTS A;  2VV7 A;  2PBD P;  3WS5 A;  1E4D A;  5F1G A;  4CLC B;  5A91 A;  4IUH A;  4B9O A;  3MR0 A;  3A3J A;  3E98 A;  3DBA A;  4U0X A;  3DAV A;  2Y2J A;  3IXH A;  3V3R A;  4ZAM A;  1RP5 A;  2WUQ A;  3OPP A;  2M1C A;  3G31 A;  1BUE A;  3UB5 P;  1ERQ A;  1PI5 A;  4GHI A;  1DJA A;  3UPN A;  3VE3 A;  5L09 A;  3PR6 A;  5HWV A;  4GW9 A;  4GKU A;  3PBN A;  3KSF A;  1CQA A;  2VLG A;  5EE8 A;  2O0Y A;  4IUK A;  1FIL A;  2A49 A;  2XRN A;  4DXC A;  2CMN A;  1IYO A;  4JPM A;  3FC7 A;  1XJ4 A;  4JXG A;  4DE1 A;  3HJI A;  4IVK A;  2GZA A;  3ZGA B;  1NJ4 A;  3ZNT A;  2Q0O A;  2HP9 A;  4C6Y A;  3Q81 A;  4PM6 A;  2XF3 A;  2V0W A;  4F3L B;  1LLB A;  4JF6 A;  1RGZ A;  4OON A;  1NYM A;  1CI9 A;  2B95 A;  3F1O B;  4WZ4 A;  1K57 A;  2IWC A;  2VV8 A;  2WZZ A;  1K55 C;  4FTX A;  3TSG A;  1ALQ A;  2P9V A;  3UB6 A;  1OTB A;  1NXY A;  2JE5 A;  4N92 A;  3N8L A;  3HLD A;  4GHI B;  1ESI A;  4M4X A;  3ZVT A;  4LCM A;  2WKH A;  2VEA A;  1T18 A;  5FA7 A;  4ZJ1 A;  3CPT B;  3H9W A;  2L0W A;  4Y5F A;  3LCE A;  5M1A A;  1SHV A;  2PR5 A;  2ZC6 B;  3N7W A;  1MKM A;  2O99 A;  3WS0 A;  4JLF A;  3N6I A;  1G5U A;  1H8Y A;  3RTY A;  3H7W A;  4QD4 A;  4EW7 A;  4YWZ A;  3LEZ A;  3CAX A;  3C7U A;  3Q82 A;  4I39 A;  4RA7 A;  3QHY A;  3C5A A;  3DWZ A;  1V9Y A;  1NRF A;  2Y2P A;  4OLG A;  4LRY C;  3I7J A;  3VMA A;  3NJA A;  3LIA A;  4PM9 A;  4S2L A;  4Z9Q A;  2B02 A;  4DDS A;  2PRF A;  1L0F A;  4EUZ A;  4HP4 A;  1T1B A;  3NDE A;  3A0R A;  2Y2N A;  3MKE A;  2V0U A;  4E3N A;  3FKV A;  4KQR A;  2Y59 A;  3TRC A;  4II7 A;  2ZQC A;  3VOL A;  2R9X A;  1PZP A;  3NC8 A;  4DRT A;  2W3H A;  4MBK A;  3NOP C;  5FL3 A;  4BQM A;  1LHY A;  1WE4 A;  1I5Q A;  4HI4 A;  3H7W B;  5TGF A;  4LEN A;  3R7W B;  4QB8 A;  1FIK A;  3HL9 A;  4WMC D;  3TE8 A;  4Q8I A;  3F1N A;  3VP0 A;  2X02 A;  3IHA A;  1EWZ A;  1SKF A;  2VGL S;  4JGP A;  2D02 A;  3VE4 A;  4R4R A;  1L0G A;  4NXF A;  3ZCZ A;  1KDW A;  3HLE A;  1GHM A;  1MY8 A;  5CGS A;  1NY0 A;  4UEY A;  1BUL A;  4GS9 A;  3LY3 A;  3DW0 A;  2EA9 A;  2Y4A A;  1MPL A;  4NXG A;  3LI8 A;  3HJK A;  3PBS A;  5DF8 A;  1G6A A;  2ZMA A;  5L8M A;  1VET A;  5I94 A;  1XPB A;  1D1J A;  4PM7 A;  2ZL1 A;  3BY9 A;  4DF6 A;  3IQA A;  4R6L A;  1J3W A;  2OSU A;  1IEL A;  1K6R A;  4Y13 A;  5L10 A;  2YKH A;  4GB7 A;  4GD8 A;  4NEE D;  4GZB A;  5FAT A;  4BMW A;  3M2J A;  3BM6 A;  1SZV A;  1XJ3 A;  5EPH A;  3CWF A;  4UA9 A;  3NOT C;  2JN7 A;  3OPH A;  5HWW A;  1VEU B;  4MLL A;  1OPX A;  1OTI A;  5EOE A;  1N9O A;  4K08 A;  3HUM A;  3MZD A;  1OTA A;  3C4P A;  1MWS A;  1ONG A;  3IF6 A;  2RL3 A;  4HBT A;  4GS9 B;  5GHZ A;  5HW3 A;  5DF7 A;  5EM0 A;  2BG1 A;  1L3L A;  3C2W A;  3OZH A;  3CG5 A;  2Y2I A;  4WLA A;  5AQ7 A;  1GHI A;  2V1Z A;  3BYD A;  1VET B;  2I72 A;  2PT7 A;  4KUK A;  3DTE A;  3ZG5 A;  3FYZ A;  3GQZ A;  4I3J A;  3ZG0 A;  3ZVW A;  2ZL1 B;  4NG2 A;  3W4O A;  3FPV A;  1XJ6 A;  1YPR A;  1WYB A;  4BEN A;  1AXB A;  1K25 A;  1S67 L;  3N8R A;  3LEQ A;  1K56 D;  3OCN A;  2ZD8 A;  5EFW A;  3VP4 A;  1RGY A;  4HBU A;  4EES A;  5EVI D;  4P87 A;  1ESU A;  2ZMV A;  2VGK A;  1IYS A;  2VGL M;  2E8I A;  3CUE A;  4H6J A;  4MN5 A;  3S7O A;  3S4X A;  5EVI C;  2OV5 A;  4A5R A;  1K54 A;  3OPL A;  3BY8 A;  2WK0 A;  4R70 A;  3VOY A;  5TBM A;  1S66 L;  5FQI A;  4O01 A;  4LPZ A;  3M6B A;  3WS2 A;  3BJN A;  3BWL A;  1VHM A;  1GSX A;  3A3E A;  4F94 A;  4L0L A;  1FCM A;  2VGJ A;  4WBG A;  4QHC A;  4NK3 A;  1PNE A;  3KX0 X;  4N1X A;  2Y91 A;  4B93 A;  4I3I A;  4KZA A;  1PZO A;  2WGV A;  3IS2 B;  3RJU A;  2QPN A;  2DMW A;  3NY4 A;  2ZM0 A;  2R78 A;  3GRJ A;  4IHQ A;  4OP5 A;  2K2N A;  1Y54 A;  5HZH A;  2BAS A;  1D7E A;  2Y79 A;  4H6J B;  4MDZ A;  2W3F A;  3UO9 A;  2ZC5 B;  3NBL A;  4P0M A;  1ZG6 A;  2RCX A;  1OT9 A;  1MXO A;  5TBM B;  2V1A A;  3C30 A;  1G68 A;  2D01 A;  1DY6 A;  4GDB A;  4WZ5 C;  3Q7Z A;  4B4Z A;  3UDF A;  2XFT A;  2VX8 A;  1YLY A;  2Y2G A;  1J9M A;  5F6A A;  1SKO A;  3UPP A;  1YAX A;  2OLU A;  2WAE A;  5IT5 A;  3VFH A;  5GLB A;  4N9L A;  4HEF A;  2XA7 S;  2ZLY A;  3PBT A;  5CX7 A;  2INW A;  2PD7 A;  4JF5 A;  4EET B;  2EWV A;  4UA7 A;  5F69 A;  3CMZ A;  1ERO A;  1O7E A;  4YIN A;  4EBN A;  2WKP A;  2L4R A;  2HP5 A;  4U3T A;  1XKZ A;  4LCL A;  3UB7 A;  2UWX A;  4OPZ A;  2P7J A;  4DKI A;  4FCF A;  3MXQ A;  3QNC A;  1ONH A;  2XH9 A;  3JPU A;  2QJ5 A;  1PW1 A;  4FH2 A;  3KSH A;  3UY6 A;  4PKY G;  2WAF A;  1PFL A;  1YMS A;  4KZ3 A;  4MN6 A;  4CLC A;  4OOL A;  2X01 A;  4E3O A;  2QWS A;  3IH8 A;  1YQS A;  4WYY A;  1KE4 A;  3ZYT A;  1NLY A;  3EQV A;  3WS1 A;  4MMN A;  2PU4 A;  5DVA A;  3IXD A;  3IX4 A;  4IVI A;  3GDI A;  4EBL A;  1W8Y A;  4OPQ A;  3RFB A;  2PBY A;  3UE6 A;  1L0D A;  2Z6C A;  4DDY A;  2IWD A;  2PU2 A;  3MMH A;  1T1C A;  2VA0 A;  3V3S A;  3P01 A;  4DJ3 A;  2W0N A;  4IJG A;  5FAS A;  3IWQ A;  4L9G A;  3ZQ5 A;  2ZQ7 A;  3ZDJ A;  2XFS A;  3EEA A;  4OOM A;  3G2Y A;  3BFG A;  4DJ2 A;  3D72 A;  3LR4 A;  5CXW A;  1TDL A;  5E2F A;  3G4P A;  4L9F A;  4GLQ A;  3SH7 A;  5M18 A;  3F1O A;  3M6H A;  1DRM A;  3A3F A;  3W2Z A;  3B33 A;  1N9N A;  2KDK A;  3IXG A;  4BWI A;  3UE1 A;  2NUT C;  2IA2 A;  3O5Y A;  1SDN A;  2XA7 M;  4HNB A;  4KG5 A;  2XD5 A;  4O8G A;  5M19 A;  4KZ4 A;  2EXA A;  4WMC A;  1TD5 A;  3HLW A;  1K38 A;  2KLI A;  4X6T A;  3CPT A;  4H8R A;  5CER A;  4QWO A;  3MBZ A;  1T1A A;  1Q2P A;  3E0Y A;  1KE3 A;  3LUQ A;  4MBH A;  4QY5 A;  3T4J A;  4IED A;  5L2F A;  3GR2 A;  1IKG A;  4KQQ A;  1PI4 A;  1EI5 A;  4LV3 A;  3NDG A;  5EOO A;  3UDI A;  1X0O A;  3L7H A;  3S7P A;  3UME A;  3G34 A;  2ZQ9 A;  4LFU A;  1YM1 A;  4YNR A;  2QMI A;  1T19 A;  4MCW A;  5J7E A;  4S2N C;  3ZG9 B;  4ESP A;  1KGF A;  4CPK A;  3N8S A;  4ID4 A;  4QJG A;  2J7V A;  2JKR M;  5EEC A;  2Y2M A;  5U47 A;  3PTE A;  3V39 A;  4C75 A;  4OKP A;  5EUA A;  1BT5 A;  1GSV A;  1JTD A;  2ZM2 A;  2WKQ A;  3R7W A;  4P6B A;  5HD5 A;  1HZO A;  3O86 A;  1N9B A;  4WEK A;  5FSR A;  5HSQ A;  2Y2K A;  3C7V A;  4OPY A;  4X56 A;  4KUO A;  4XXR A;  3DTK A;  2Y2O A;  2H5S A;  3JYI A;  1PWC A;  4MEZ A;  3VP2 A;  1F98 A;  5G18 A;  3B3X A;  2VK3 A;  3CJM A;  5EM1 A;  5KIZ A;  3SZT A;  1OTD A;  2K7S A;  1HVB A;  1FCN A;  4S2K A;  3AGF A;  4ARZ A;  2OWH A;  1W7F A;  1H3Q A;  5EVI A;  2GJ3 A;  2JBF A;  4HY8 A;  4PHT A;  3QP8 A;  1S1Y A;  3LIE A;  3LY4 A;  4R38 A;  4XUZ A;  3P09 A;  2PYR A;  3V67 A;  1OT6 A;  5FI2 A;  2PAV P;  4GN2 A;  2W1T B;  4EWF A;  3HLC A;  1NYY A;  1ES3 A;  4WM9 A;  5J4E A;  1MC0 A;  4BL2 A;  3MJQ A;  3HBR A;  3E4Q A;  4GD6 A;  2Y2L A;  4YFM A;  5F5Y A;  1VEU A;  2Z2L B;  2FH5 A;  4OOY A;  1FCO A;  1K4F A;  4OPR A;  3IXB A;  4D60 A;  2R9W A;  2M7U A;  5LBR A;  5CHJ A;  3NIA A;  2GDN A;  4PAU A;  2WGI A;  2V1B A;  1P97 A;  1VB6 A;  4S2M A;  1WA9 A;  4ARZ B;  5KSC A;  5EVI B;  2YKF A;  1LL5 A;  1XFN A;  5FEF A;  4QU3 A;  2QHK A;  4KQO A;  5J8X A;  1KDS A;  3VP1 A;  1YLP A;  1MWT A;  3FV7 A;  2ZBB A;  2X71 A;  3G32 A;  4S2P A;  1H0M A;  4HH2 A;  5GL9 A;  1N9L A;  3ZHH A;  4WZ5 A;  1D06 A;  2W3D A;  5HPF A;  4E6X A;  1BLS A;  4S2I A;  1JWV A;  5DFY A;  1N4O A;  2E8J A;  2QJ7 A;  2HJE A;  3FZC A;  3IX8 A;  5DJT A;  4Y7P A;  1K57 C;  2ZMF A;  1I2S A;  4O7D A;  1E3U D;  1G6O A;  3C4O A;  4JGR A;  2XSS A;  1GCE A;  5MC7 A;  1F2K A;  2Q9M A;  1PIO A;  4E3K A;  2OWJ A;  3DTM A;  1S4S A;  1P0Z A;  1ES2 A;  3K2N A;  4R4S A;  5FAQ A;  1Q2Q A;  3SS3 A;  3MSH A;  2HZ5 A;  1A0K A;  5GHX A;  4EU0 A;  5CRF A;  4EQI A;  4PPR A;  2XRO A;  3BFC A;  2IWB A;  3P98 A;  4Y0O A;  4UAA A;  3C8C A;  4ETX A;  5DFX A;  4JGQ A;  3L9K A;  5CEC A;  5TR7 A;  2ZQ8 A;  3HLF A;  2W3E A;  4Z1W A;  1LSX A;  3IS2 A;  3LID A;  1S6R A;  2H10 A;  5HDD A;  3Q07 A;  2PHY A;  3TJZ C;  4HJ6 A;  3S22 A;  3ITB A;  4KEN B;  2EWW A;  2B5R A;  1JNU A;  2EX8 A;  3MZE A;  3WWX A;  2QYB A;  1OJ5 A;  4JF4 A;  5TFQ A;  4NXE A;  1NWZ A;  4L9E A;  2J3W A;  5D3O A;  1YSP A;  3S1Y A;  1OTE A;  1PWG A;  4JGO A;  3T1Q B;  5BOH A;  3MXS A;  3QP2 A;  4HP9 A;  1PWD A;  1EW0 A;  4JXS A;  4PMA A;  4R0Q A;  4R3J A;  5FQM A;  4FD8 A;  3ZG7 B;  3TG9 A;  4KQD A;  4XT2 B;  4UQI S;  4LGW A;  4DMZ A;  3KYE A;  3D3O A;  1HD8 A;  3LIB A;  1ES5 A;  4G3W A;  1XJ2 A;  1NLZ A;  5I5L A;  5F82 A;  1ZHH B;  1TS8 A;  4JKT A;  5HAI A;  1W8Q A;  3MKF A;  1YLT A;  4R3A A;  5AQA A;  1TS0 A;  3SS5 A;  2G7U A;  1Y28 A;  5FI7 A;  4HIA A;  1CK3 A;  4NXB A;  1KOU A;  2VZW A;  3BEC A;  2XLN A;  1H5X A;  3CIT A;  3H82 B;  4U0T A;  2XK1 A;  3O88 A;  5F83 A;  1ODV A;  2J3T D;  4O0P A;  2DNS A;  3UE0 A;  2WKI A;  3EWK A;  3AGD A;  2V8C A;  4WN5 A;  3GTC A;  1W63 Q;  2UV0 E;  4GJ4 A;  1CI8 A;  1K55 A;  5DF9 A;  2J3T C;  4KZ7 A;  2PYP A;  2JKF A;  5GLD A;  2ZJ9 A;  1W79 A;  1LSV A;  5EVE A;  4HOI A;  2HGV A;  3D4F A;  2QKP A;  4S2N A;  4Y2F A;  3PXP A;  3UPO A;  1G28 A;  4PM5 A;  2FFF B;  2MJ6 A;  3UMD A;  4OQG A;  2WKR A;  3FKW A;  5KSH A;  1TEM A;  2JKG A;  4JXV A;  3BLM A;  1W5D A;  5AQB A;  4R1G A;  3V5M A;  2EFX A;  5HDS A;  1BYW A;  4QY6 A;  3N4I A;  4OQ0 A;  2Y2Q A;  1KVL A;  3E4O A;  3MFX A;  1O07 A;  1U60 A;  4WUJ A;  1P9R A;  5HDC A;  3ULF A;  4RVA A;  1S4R A;  5HL1 A;  3QNB A;  4UQI M;  1TVF A;  2H0Y A;  3PBR A;  4E6W A;  1NRJ A;  3KYZ A;  2P74 A;  4N1H A;  3A3D A;  4ZBE A;  1WYC A;  5CTN A;  4HJ4 A;  1CEG A;  4ZJ2 A;  5A93 A;  3EGD C;  4OH0 A;  1H8M A;  1YLJ A;  2ZQD A;  1VQQ A;  4Y17 A;  3PBQ A;  3BLS A;  3LFV A;  4K0W A;  2Z6D A;  3T1R A;  3OPR A;  4NKP A;  2M7V A;  2XGN A;  2JKR I;  3PHY A;  1GHP A;  1YMX A;  3O87 A;  2HPB A;  4X1L A;  3P7N A;  1XA1 A;  1JVJ A;  4WEL A;  2ZC3 B;  3IWO A;  2WAD A;  1VM1 A;  1IYP A;  5E2H A;  2J80 A;  3T4T A;  4HES A;  1BZA A;  4RX2 A;  2L1M A;  1H8Z A;  1OJG A;  2C5W B;  3BQ8 A;  3BW6 A;  4S2J A;  5JYP A;  1IYQ A;  2HDR A;  3PAE A;  3U4L P;  4MBF A;  2VV6 A;  3LYX A;  4X69 A;  3QP1 A;  2PD8 A;  5CGW A;  2OOL A;  4FOF A;  4GDN A;  2Q9N A;  1LL9 A;  4G3V A;  4ME4 A;  4LV0 A;  4KZB A;  3T4S A;  3ZNY A;  2HDS A;  3UN7 A;  3Q1F A;  1OME A;  2XR0 A;  1Z09 A;  3MFD A;  3MQQ A;  3G30 A;  2W27 A;  4Y0T A;  3DTI A;  4GCZ A;  4EEP A;  4DE0 A;  2W3G A;  2JKT M;  4I38 A;  1ERM A;  2XDM A;  3JVU A;  4S2O A;  5FQJ A;  3C38 A;  4KG6 A;  5CGX A;  3HCY A;  4HJ3 A;  4BBT A;  3WRT A;  2ZM8 A;  3OBF A;  4P6Z S;  1DJC A;  4I5S A;  2EX9 A;  4Q0H A;  2ACG A;  1BTL A;  3F1P B;  3WS4 A;  2HJ9 C;  3QP6 A;  3LIC A;  1F5M A;  1DP9 A;  3A0S A;  5A90 A;  4RYE A;  5HAP A;  5C5K A;  4E04 A;  2G2W A;  4RQ9 A;  4X25 A;  5HAR A;  3BFF A;  4GNU A;  4KZ9 A;  3S7Q A;  3NI9 A;  2P04 A;  4R3B A;  3EEH A;  2WKE A;  4OP8 A;  3QP5 A;  1NZU A;  3OCL A;  5HAQ A;  2HDQ A;  3GV9 A;  3BQA A;  3RXX A;  2HF6 A;  1E3U A;  5L07 A;  4FUW A;  1L0E A;  4G3K A;  3NOU C;  1ZKJ A;  3OLO A;  3B47 A;  4CLC D;  1MWR A;  1Y4O A;  1ES4 A;  2Y2H A;  5DTK A;  2W1T A;  2XEP A;  5F68 A;  3GSG A;  3MQ0 A;  1RCJ A;  5IHV A;  1IFQ A;  3SH9 A;  1GSW A;  4PKY A;  2J9O A;  2A2L A;  3Q7V A;  2O9C A;  2B18 A;  2CC1 A;  1ZG4 A;  3HVF A;  4FSF A;  5GLA A;  3T4O A;  4KG2 A;  4CLC C;  1LT0 A;  4ETZ A;  1S1Z A;  1PYY A;  1MBL A;  2WYX A;  2Y8H A;  3NUL A;  1KGG A;  1L2S A;  5AQ9 A;  1BLH A;  4I3A A;  1FOF A;  5AVF A;  1DJB A;  3LR0 A;  1Z6F A;  4ZTK A;  3W4P A;  1K56 A;  2P9V B;  3KSG A;  1KVM A;  1YSQ A;  3LR5 A;  2OAP 1;  3BEB A;  4MN7 A;  5FDH A;  3G35 A;  1PW8 A;  5HWT A;  4R23 A;  3GMW A;  3SH8 A;  2LB5 A;  1XGI A;  1F9I A;  5HFO A;  3EQU A;  1I2W A;  5A8B A;  3CLO A;  1LI9 A;  5CTM A;  3SS4 A;  1IKI A;  3Q7V B;  1W63 M;  1YT4 A;  4KZ8 A;  4HQA A;  4P6Z M;  5FI6 A;  1CJF A;  3KO6 A;  1FR6 A;  1UGU A;  2WZX A;  2Z2M B;  1SDE A;  4P85 A;  5DKL A;  2ZC7 A;  4E3M A;  5HD3 A;  1CF0 A;  1DP6 A;  3K3D A;  4OLD A;  4BD0 A;  2VKS A;  5GLC A;  2ZOI A;  1FSW A;  1TS6 A;  1UWN X;  2OLV A;  3IWI A;  1MZU A;  3SW1 A;  1K6S A;  2EX2 A;  1E25 A;  4BBU A;  4FH4 A;  1SCW A;  3PAG A;  5AVE A;  2V2F F;  4YOF A;  5FAO A;  3CZD A;  5FDS A;  3T12 B;  5FEG A;  2XQZ A;  5E2G A;  1BLC A;  4E3I A;  1K0K A;  5IU1 A;  4RX3 A;  2JC7 A;  2ZQA A;  1M6K A;  3LGO A;  3MXR A;  2ZOH A;  3G6O A;  3ITA A;  4IBX A;  2DCF A;  2HP6 A;  4BL3 A;  1P9W A;  4K0X A;  4OQH A;  3FG8 A;  3F1N B;  4JBF A;  5DKK A;  1JWP A;  2BLS A;  1AWI A;  4LV2 A;  1TS7 A;  3IHB A;  4ZRR A;  5IS1 A;  1PRQ A;  4GOG A;  2PR6 A;  3U2A A;  1TF1 A;  3E4P A;  4DE3 A;  3LO7 A;  5TJJ A;  4KZ5 A;  1C3B A;  3D9Y A;  3IF5 A;  4ZDX A;  2JHE A;  4DXB A;  4XT2 A;  4PM8 A;  2PDR A;  4EXO A;  3HRE A;  3W8K A;  2H28 A;  3IT9 A;  4QPR A;  2EX6 A;  1IEM A;  3JVV A;  1MWU A;  5AJG A;  1FQG A;  1ZC2 A;  3SOI A;  3VSK A;  4DE2 A;  4K91 A;  5DTT A;  1LSW A;  3T50 A;  4B4X A;  1V9Z A;  3LIF A;  4MNR A;  4LLO B;  1STZ A;  3PYP A;  1FSY A;  2FZ0 A;  4WL9 A;  2V9A A;  3MF0 A;  4LRZ E;  1LI0 A;  3T4L A;  2C6W B;  2P08 A;  3MZF A;  3UDX A;  3LR3 A;  3IBR A;  3WRZ A;  3FWL A;  2A3U A;  1HLU P;  4EER A;  2J9P A;  3ISG A;  5E2E A;  4B88 A;  3T1X A;  1TDG A;  4CJN A;  5CHM A;  2XD1 A;  2BTF P;  4X1M A;  1HTZ A;  1KE0 A;  1YLW A;  3MS6 A;  4NET A;  2NUP C;  3H82 A;  3OOV A;  1JWZ A;  1XA7 A;  5G4Z A; 
#chains in the Genus database with same CATH homology
 4YNR A;  2VGL S;  3KSI A;  4BJP A;  5HDC A;  4JGP A;  2D02 A;  3VE4 A;  1T19 A;  3RH8 B;  4NXF A;  3ULF A;  1S4R A;  4MCW A;  5J7E A;  4UEY A;  3EGX C;  1DP8 A;  4GS9 A;  4UQI M;  2EA9 A;  4NXG A;  3PBO A;  4HH3 A;  4CQH A;  3LI8 A;  3T4Q A;  3UB8 A;  4EQ1 A;  3HJK A;  2JKR M;  3PBR A;  3TW8 A;  1NRJ A;  3PBS A;  3KYZ A;  5L8M A;  2K31 A;  4HJ4 A;  3EGD C;  1H8M A;  3BY9 A;  4R6L A;  3PBQ A;  5HL6 A;  1GSV A;  3LFV A;  2Z6D A;  2OAQ 1;  4NKP A;  2M7V A;  5G4Y A;  5DJU A;  2W1R A;  2JKR I;  3PHY A;  2YKH A;  4NEE D;  3P7N A;  5J3W A;  3EOI A;  4WEL A;  4BMW A;  4WF0 A;  2WKQ A;  3KYQ A;  3R7W A;  1XJ3 A;  5HD5 A;  3CWF A;  2J80 A;  3T4T A;  2O9B A;  2GNX A;  3NOT C;  4WEK A;  5HSQ A;  2JN7 A;  5HWW A;  3K3C A;  4KUO A;  2L1M A;  1OJG A;  1OPX A;  1OTI A;  5HPI A;  3R4K A;  1N9O A;  2KX6 A;  4HHD A;  4EEU A;  1IOU A;  3BQ8 A;  4K08 A;  3BW6 A;  1OTA A;  3UE3 A;  4GS9 B;  1F98 A;  4BBV A;  1XFQ A;  2VV6 A;  2KOI A;  3C2W A;  4Q0J A;  3LYX A;  4WLA A;  2LB9 A;  1UWP X;  2PD8 A;  2OOL A;  4FOF A;  5KIZ A;  1OTD A;  4G3V A;  2PT7 A;  4KUK A;  2K7S A;  2A24 A;  4ME4 A;  3T4S A;  4ARZ A;  2OWH A;  4I3J A;  1H3Q A;  2GJ3 A;  4HY8 A;  4PHT A;  1S1Y A;  1YKD A;  3LIE A;  3FPV A;  3MQQ A;  4R38 A;  1XJ6 A;  2W27 A;  2PYR A;  3V67 A;  1OT6 A;  4GCZ A;  1S67 L;  4EEP A;  2W3G A;  2JKT M;  4I38 A;  2W1T B;  3T4K A;  3JVU A;  3MQO A;  3OCN A;  5EFW A;  3C38 A;  5J4E A;  1MC0 A;  4EES A;  3MJQ A;  3HCY A;  4HJ3 A;  3E4Q A;  4EUV A;  4BBT A;  2I9V A;  2ZMV A;  3OBF A;  4P6Z S;  2VGL M;  4Y3I A;  1ZTU A;  5F5Y A;  3VV4 A;  2FH5 A;  3NHQ A;  4I5S A;  2JKT I;  4Q0H A;  3CUE A;  4H6J A;  4MN5 A;  3S7O A;  4Q0I A;  3F1P B;  3ICY A;  2M7U A;  5LBR A;  2HJ9 C;  3LIC A;  1F5M A;  1DP9 A;  3A0S A;  3BY8 A;  4PAU A;  4R70 A;  5C5K A;  4CLC E;  4E04 A;  2V1B A;  1P97 A;  2A24 B;  1VB6 A;  4RQ9 A;  5TBM A;  3S7Q A;  2P04 A;  1WA9 A;  3EEH A;  4ARZ B;  3CI6 A;  1S66 L;  2VJW A;  2YKF A;  4O01 A;  4LPZ A;  1XFN A;  3BJN A;  3BWL A;  1VHM A;  3OCL A;  2O9A A;  1GSX A;  2QHK A;  4KQO A;  4L0L A;  5K5B A;  3UB9 A;  3KX0 X;  3BQA A;  2HF6 A;  2ZBB A;  2HV1 A;  4WEJ A;  4B93 A;  4G3K A;  4HH2 A;  1N9L A;  3NOU C;  4I3I A;  3OLO A;  1D06 A;  3B47 A;  4CLC D;  2W3D A;  3CUE C;  3IS2 B;  4AFI A;  2W1T A;  5HPF A;  5F68 A;  4DN0 A;  3MQ0 A;  2DMW A;  1IFQ A;  2R78 A;  1GSW A;  4PKY A;  5DFY A;  2A2L A;  4IHQ A;  2QJ7 A;  2HJE A;  2O9C A;  5DJT A;  3GEC A;  2B18 A;  2K2N A;  5HZH A;  4FSF A;  2BAS A;  1D7E A;  2Y79 A;  3T4O A;  2ZMF A;  4CLC C;  1LT0 A;  3OC2 A;  4LRX C;  3B42 A;  4H6J B;  4MDZ A;  4ETZ A;  3A0V A;  3IBJ A;  1S1Z A;  3S7N A;  1G6O A;  1LL8 A;  3FPW A;  4JGR A;  3LI9 A;  2XSS A;  2W3F A;  5MC7 A;  2GX5 A;  4F3L A;  2Y8H A;  2OWJ A;  3F1P A;  1S4S A;  1P0Z A;  3K2N A;  1OT9 A;  4EU0 A;  4I3A A;  5AVF A;  2VV7 A;  4CLC B;  3LR0 A;  4IUH A;  5TBM B;  2V1A A;  3C30 A;  4B9O A;  2D01 A;  2XRO A;  3MR0 A;  3KSG A;  1YSQ A;  3LR5 A;  2OAP 1;  4MN7 A;  2VX8 A;  3E98 A;  3DBA A;  5F6A A;  3C8C A;  1YAX A;  5HWT A;  2M1C A;  4ETX A;  5DFX A;  5IT5 A;  4GHI A;  4JGQ A;  3VE3 A;  3PR6 A;  5HWV A;  2XA7 S;  5CX7 A;  2LB5 A;  3PBT A;  2INW A;  4GW9 A;  2PD7 A;  3PBN A;  1F9I A;  2W3E A;  3EQU A;  4Z1W A;  3KSF A;  4EET B;  2EWV A;  5A8B A;  1LSX A;  2VLG A;  2O0Y A;  3IS2 A;  3LID A;  4IUK A;  3CLO A;  5F69 A;  2XRN A;  2CMN A;  1W63 M;  4HQA A;  4P6Z M;  2WKP A;  2L4R A;  3FC7 A;  1XJ4 A;  5HDD A;  3HJI A;  3KO6 A;  2PHY A;  2GZA A;  3UB7 A;  3TJZ C;  4HJ6 A;  1UGU A;  2P7J A;  2EWW A;  1JNU A;  2V0W A;  4F3L B;  3MXQ A;  5DKL A;  2QYB A;  2QJ5 A;  1OJ5 A;  3KSH A;  3F1O B;  4PKY G;  4NXE A;  1NWZ A;  4L9E A;  5HD3 A;  2J3W A;  2VV8 A;  4MN6 A;  1DP6 A;  1YSP A;  4CLC A;  3K3D A;  4OOL A;  2VKS A;  2QWS A;  1OTE A;  4JGO A;  2ZOI A;  1TS6 A;  1UWN X;  4HP9 A;  3UB6 A;  1OTB A;  1EW0 A;  1MZU A;  3ZYT A;  3SW1 A;  1NLY A;  3EQV A;  4MMN A;  4BBU A;  4GHI B;  4KQD A;  4XT2 B;  3GDI A;  4UQI S;  4DMZ A;  4M4X A;  3D3O A;  3RFB A;  3LIB A;  3UE6 A;  5AVE A;  4G3W A;  2Z6C A;  1XJ2 A;  2VEA A;  1NLZ A;  1T18 A;  4YOF A;  3H9W A;  5I5L A;  3MMH A;  1T1C A;  1ZHH B;  2VA0 A;  3P01 A;  4DJ3 A;  2L0W A;  1TS8 A;  2W0N A;  4IJG A;  4Y5F A;  5IU1 A;  4L9G A;  2PR5 A;  3ZQ5 A;  1MKM A;  2O99 A;  4R3A A;  2ZOH A;  3EEA A;  3G6O A;  1TS0 A;  4OOM A;  2G7U A;  3RTY A;  1Y28 A;  3H7W A;  1P9W A;  4DJ2 A;  4EW7 A;  4HIA A;  4YWZ A;  3D72 A;  3LR4 A;  4NXB A;  3FG8 A;  3F1N B;  3CAX A;  1KOU A;  2VZW A;  5DKK A;  4I39 A;  3CIT A;  4L9F A;  4GLQ A;  1TS7 A;  4ZRR A;  3F1O A;  5IS1 A;  1V9Y A;  3H82 B;  2PR6 A;  1DRM A;  3W2Z A;  3U2A A;  1TF1 A;  3B33 A;  1N9N A;  2KDK A;  1ODV A;  4LRY C;  2J3T D;  4O0P A;  4BWI A;  3E4P A;  3EWK A;  2NUT C;  3NJA A;  2IA2 A;  3O5Y A;  5G4Z A;  3LIA A;  5TJJ A;  4WN5 A;  1W63 Q;  2B02 A;  2JHE A;  2XA7 M;  4HNB A;  4HP4 A;  1T1B A;  3A0R A;  4GJ4 A;  4XT2 A;  2PDR A;  4O8G A;  2V0U A;  4EXO A;  2H28 A;  5DF9 A;  2J3T C;  4QPR A;  2PYP A;  1LSV A;  3JVV A;  3TRC A;  1TD5 A;  5AJG A;  4II7 A;  4HOI A;  2KLI A;  2HGV A;  3VOL A;  2QKP A;  1T1A A;  1LSW A;  3T50 A;  4Y2F A;  3PXP A;  3E0Y A;  1V9Z A;  3LIF A;  1G28 A;  2MJ6 A;  3LUQ A;  2W3H A;  4LLO B;  1STZ A;  3T4J A;  3PYP A;  3UMD A;  2FZ0 A;  3NOP C;  4WL9 A;  2WKR A;  5FL3 A;  2V9A A;  3MF0 A;  4LRZ E;  5KSH A;  3T4L A;  2P08 A;  3LR3 A;  4HI4 A;  3IBR A;  3H7W B;  3R7W B;  3TE8 A;  5HDS A;  4EER A;  1BYW A;  3F1N A;  1X0O A;  3S7P A;  3UME A;  3E4O A;  3MFX A;  2NUP C;  3H82 A;  3OOV A;  4WUJ A;  1P9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...