4WN5A

Crystal structure of the c-terminal per-arnt-sim (pasb) of human hif-3alpha9 bound to 18:1-1-monoacylglycerol
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
108
Chain Sequence
HMGRGAFLSRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSKGQAVTGQYRFLARSGGYLWTQTQATVVSGRGPQSESIVCVHFLISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypoxia-inducible factor 3-alpha
publication title Unsaturated fatty acids as high-affinity ligands of the C-terminal Per-ARNT-Sim domain from the Hypoxia-inducible factor 3alpha
doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 30
structure length 108
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4wn5A00
4WLAA 4DJ3A 3G6OA 2Z6DA 4I38A 3A0VA 4H6JB 3LUQA 4PKYA 4DJ2A 3IS2A 1D06A 3NOUC 4HH2A 1TS6A 1TS0A 3MJQA 4LPZA 2VV7A 4EW7A 2A24B 2QJ7A 1LSWA 4L9EA 5HDDA 4KUKA 3H82A 4F3LA 3H7WA 2KX6A 5G4YA 1V9YA 3EEHA 1NWZA 4I5SA 5A8BA 1WA9A 3NOTC 3BY8A 3LYXA 2PHYA 3LI9A 2GJ3A 1S67L 3ULFA 2VV6A 1ODVA 4EEUA 1S66L 5J7EA 1XJ3A 1LSXA 1D7EA 1EW0A 3HJKA 1XJ2A 3LICA 2V9AA 2PD8A 2QKPA 3GDIA 1P97A 1XJ6A 1N9LA 1GSVA 3UMDA 3LIDA 4WN5A 3T50A 4WUJA 3RH8B 3BWLA 2OWJA 2V1AA 1LL8A 2V0WA 5I5LA 5DKKA 2V1BA 3RTYA 1BYWA 4HP4A 5HWTA 2PYRA 4R3AA 4H6JA 4EESA 1OT9A 1T1CA 3BY9A 2L4RA 3HJIA 4HQAA 2L1MA 2W0NA 4XT2A 2EA9A 4I39A 4KQDA 2V0UA 5F69A 4M4XA 4HI4A 1UWPX 3IBRA 2JN7A 5AVFA 4GS9A 3F1NB 2YKFA 2H28A 4LRXC 1TS7A 1S4RA 2OOLA 1OTAA 3EWKA 4NXEA 2BASA 2Z6CA 3H9WA 1DP9A 3F1PA 3UB6A 4EERA 4I3JA 4R6LA 4JGRA 2WKPA 4RQ9A 3A0RA 5DJUA 2WKQA 3LIFA 3P7NA 5HD5A 3MQQA 3VE4A 1TS8A 3C2WA 2VEAA 5TBMB 4KUOA 4R38A 3SW1A 1LSVA 3CAXA 5G4ZA 3UB9A 4LRYC 1MZUA 1OTIA 3ICYA 3MXQA 1XFQA 2PR5A 1JNUA 2B02A 1GSWA 5DKLA 1F9IA 2ZOHA 5DJTA 3E4PA 2QHKA 5IS1A 1P0ZA 4L9GA 4NXBA 3VE3A 3B33A 3PYPA 4JGPA 5HD3A 3FG8A 1OTBA 1Y28A 4HJ6A 3NOPC 5HWVA 1OTDA 4MN5A 3F1OB 1OJ5A 3MQOA 4GHIA 5HZHA 4BBVA 3D72A 1VB6A 3IS2B 3GECA 2W27A 5F6AA 4WF0A 2PYPA 4JGOA 3OLOA 1T1AA 4NXGA 4HY8A 4LRZE 3LIBA 3H82B 4F3LB 3LIAA 4R70A 3H7WB 5F5YA 4HP9A 3UE6A 2VV8A 2M1CA 1UGUA 2A24A 5J4EA 1T1BA 1XFNA 2ZBBA 4HNBA 1S4SA 3PHYA 3CWFA 4EEPA 1N9NA 1OJGA 2J80A 1V9ZA 2HV1A 2P7JA 1N9OA 3CLOA 2I9VA 4NXFA 3LI8A 3E4OA 4YWZA 3NJAA 2PD7A 3K3CA 1DP8A 2OWHA 4E04A 1OT6A 1GSXA 5KIZA 4I3AA 2D01A 4HH3A 4B9OA 4HJ4A 2KDKA 3F1OA 4BBUA 4HHDA 1X0OA 5HSQA 2QWSA 4GCZA 4JGQA 5IU1A 3VOLA 2PDRA 4HOIA 2R78A 4XT2B 2L0WA 3K3DA 4I3IA 3LIEA 4GW9A 1OTEA 4PKYG 4GS9B 3FC7A 3KX0X 4EQ1A 4K08A 4EETB 1T19A 1XJ4A 2VLGA 3F1NA 4BBTA 5AVEA 3F1PB 1S1ZA 2ZOIA 1UWNX 3UB7A 5HWWA 3A0SA 2JHEA 5J3WA 1DP6A 2QJ5A 4MN6A 1DRMA 5TBMA 3UMEA 1G28A 4HJ3A 1T18A 3C8CA 5F68A 4L9FA 5HDSA 4WL9A 2D02A 4HIAA 3MFXA 2PR6A 2CMNA 4LLOB 1S1YA 2YKHA 3UB8A 2K7SA 5EFWA 3E4QA 3NHQA 3ZQ5A 5HDCA 1LT0A 2WKRA 3MR0A 1F98A 4GHIB 4EXOA 1KOUA 2INWA
chains in the Genus database with same CATH superfamily
3RXXA 3ZCZA 1GHIA 3IH9A 1L0FA 4F94A 2Q9MA 3A0VA 4PKYA 2W3HA 3D4FA 3FV7A 3IXDA 3CZDA 2PAVP 4MEZA 5HAPA 2QMIA 3HVFA 3MJQA 5GHZA 2VV7A 4EUVA 2QJ7A 3BQAA 5CECA 2X71A 2KX6A 3EEHA 1NWZA 1W63Q 5A8BA 1WA9A 3O87A 3T1RA 3GV9A 1M40A 2ZL1B 3NC8A 5TJJA 3B3XA 3NECA 1LLBA 1S67L 4WZ5C 2VV6A 5DFXA 3D3OA 4FUWA 5CGXA 5A90A 1XA7A 1S66L 1YPRA 3JVUA 1XJ3A 3JPUA 3HJKA 1XJ2A 5DF7A 3LICA 2V9AA 1MKMA 1NZOA 5CTMA 4OKPA 3S7OA 3VFHA 3PXPA 3BW6A 5U47A 3IH8A 2HJEA 1PI5A 2V2FF 3GR2A 3W8KA 1VQQA 3HL9A 3EQVA 2JBFA 5FAOA 1SDEA 3RH8B 5KSCA 5KMWA 2OWJA 5A92A 3NDGA 4MLLA 3MMHA 2V0WA 5I5LA 1K56A 4IBXA 2H0YA 2A3UA 1PRQA 5HWTA 3DTIA 1D1JA 3ISGA 1OT9A 3N8SA 4DMZA 2L4RA 3FZCA 4OLGA 5F1FA 1WE4A 2Y2PA 2L1MA 4XT2A 1MPLA 4JF5A 3UE0A 3A3FA 3QP5A 2V0UA 3UE1A 4Z9QA 2M7UA 3QP6A 3MQ0A 4JXWA 2OOLA 3WS5A 3EWKA 2XGNA 3FWLA 3VMAA 1BLPA 1TDLA 3T1XA 3UB6A 4EERA 4E3IA 4DE1A 2C6WB 3IXBA 1IEMA 3KYEA 1YLJA 1MWRA 3KSIA 2HDRA 3P7NA 2K2NA 3MQQA 3VE4A 5JYPA 1ONGA 3A3EA 1TS8A 4DKIA 2R9WA 5TBMB 3E98A 1VEUA 2BLSA 3NCKA 4R38A 1JWVA 2WAEA 1H0MA 3CPTB 2GDNA 3CAXA 1H8YA 4MNRA 3UB9A 4M3KA 1FILA 5GLDA 4D60A 1EROA 3LR3A 2WKEA 3UO9A 1XFQA 3D9YA 2O9BA 4B4XA 4E3MA 2B18A 3U4LP 1TDGA 1ZKJA 4JF6A 5CGSA 4L9GA 4N1XA 4NXBA 2I72A 2Y91A 3PYPA 4OP8A 4KZ8A 3LGOA 3PTEA 1K38A 3TOIA 1BULA 4HJ6A 1OTDA 2V8FA 5EVEA 1K25A 3DBAA 3F1OB 3TJZC 4AFIA 3MQOA 1W63M 1ACFA 1K4EA 2WADA 3G35A 3HLDA 5HZHA 4Y3IA 3WS2A 2V8CA 4WM9A 3NIAA 3UPPA 3HLWA 5FASA 2ZC6B 5F6AA 3OPPA 1XKZA 4JGOA 1G6OA 1T1AA 2JKRM 3VOZA 4D2OA 5L09A 3T12B 4P6ZM 4R70A 2VKSA 3H7WB 3UE6A 2A24A 5J4EA 1T1BA 4Y0TA 5HPIA 1H5XA 4HNBA 2Y79A 3QHYA 2Z2MB 1OJGA 5L2FA 3IXHA 3IX8A 4R4SA 2HV1A 3CUEA 3FYZA 1CEFA 1ERQA 3ZG7B 3V39A 3NJAA 4MBKA 3LEZA 5CXWA 3K3CA 2J3TD 3S22A 1IFQA 3MSHA 2OWHA 5F1GA 5HARA 3IHBA 2D01A 3M6BA 3FPVA 4K0XA 4B9OA 4E3JA 3VP2A 3CJMA 4B88A 1SDNA 2OAP1 5HSQA 3QP2A 4LV2A 1Q2QA 3LEQA 3KSGA 1PWGA 1XXMA 4WMCA 3WS0A 2R78A 1MWUA 4P87A 2W1TB 3K3DA 1TF1A 1F5MA 3HLBA 1NXYA 1ES3A 2Q9NA 4Y7PA 2VGLM 2ZD8A 4FCFA 3VP4A 3F1NA 4WELA 4BLMA 2WUQA 5A91A 1PZOA 4RYEA 3UPNA 1K54C 4G3VA 3C7UA 3UB7A 3N6IA 1CI8A 4OQ0A 3DWZA 4LV3A 3ZHHA 2WGIA 1FCOA 3C7VA 1XP4A 5CGWA 3QP8A 4PM9A 1DRMA 1NLYA 4GDNA 1PWCA 4EV4A 3R7WA 3HLFA 4ARZA 5FSRA 3UMEA 3O88A 1IELA 3CMZA 5F68A 4QU3A 1MC0A 5HDSA 3MZFA 4WL9A 4ZBEA 4UQIS 2NUTC 3MFXA 2XK1A 5EVIC 3T4SA 1EWZA 5DTKA 3OCLA 3BFCA 1ZHHB 4ID4A 2X02A 3UB8A 1KE0A 5GHYA 5EFWA 3E4QA 1CK3A 4CQHA 4ME4A 3MR0A 2H5SA 2XR0A 1HLUP 4PM6A 2INWA 4MN7A 3SH8A 4ZTKA 5DF8A 5M1AA 2RCXA 4JF4A 4DJ3A 3S7QA 4N9LA 1NYYA 4I38A 3LUQA 1PI4A 3NOUC 3VSKA 1L0DA 4HH2A 3G30A 1P9WA 2JCHA 1FOFA 1TS0A 3BJNA 1LSWA 4JKTA 5EV0A 4OLDA 3H82A 2WGVA 2FFFB 1G6AA 5G4YA 1V9YA 5FQKA 2OLVA 1YSPA 3EOIA 3P98A 5CX7A 3ZG5A 2FZ0A 3BFDA 3IBJA 2ZM8A 5FEGA 3DTEA 3LI9A 3ZG8B 3BLMA 3ZG9B 4CLCA 3Q7VB 4R1GA 1ODVA 4EEUA 4KZ7A 2JKTM 3T1QB 1SKOA 1EW0A 3CG5A 4UAAA 4HEFA 2WGWA 4NEED 3E0YA 1K55C 4IVKA 1LI9A 2G7UA 3PR6A 3BWLA 4EBLA 3HBRA 2XA7M 1LL8A 5DKKA 3IF5A 3DWKA 1IOUA 1BYWA 1L0GA 4OPRA 4HESA 5EVIB 1MKIA 5FA7A 1BSGA 4EESA 5IHVA 3BFEA 1K4FA 2JKGA 3HJIA 3IWIA 2W0NA 3UDIA 3W4PA 4LGWA 5GL9A 1EI5A 3IF6B 4R23A 1I2WA 4X56A 2RL3A 2PRFA 4GS9A 1BT5A 2H28A 4LRXC 1G5UA 2P04A 5F83A 2HP9A 3BEBA 5CEBA 3H9WA 3F1PA 3FKWA 1NJ4A 4YINA 2XDMA 1FR1A 1KE4A 5FATA 3Q82A 2G2WA 5HD5A 1K6SA 4BD1A 3UE3A 1I2SA 4UA9A 4NK3A 3BLSA 3OBFA 5FI6A 2KLIA 4K0WA 2W3GA 1LSVA 1FSYA 5HW3A 1DJCA 3ICYA 1VETA 4RX3A 1JNUA 2HZ5A 3KO6A 5DKLA 5HFOA 3OOVA 3E4PA 5TFQA 1P0ZA 3MBZA 2X01A 3T4JA 1NRFA 3VE3A 1N4OA 4EBPA 3B33A 3L9KA 5HD3A 4Y0OA 5KSHA 1JWPA 1Y28A 1BLCA 3NOPC 5HWVA 4GD6A 4GHIA 4WBGA 1NLZA 1RGYA 3IQAA 1QMEA 1H8ZA 3D72A 2HJ9C 2XFTA 1ZG6A 1XPBA 3QP4A 3CI6A 3V5MA 5EM0A 1FSWA 3PBOA 1IKGA 2PT7A 5AQBA 3GECA 3WWXA 3WRZA 4S2KA 3OLOA 4NXGA 3S1YA 2LB9A 3LIBA 3G32A 3N4IA 5F5YA 5KZHA 2VV8A 2M1CA 2Z2LB 1UGUA 1XGIA 3C38A 1E4DA 4IBRA 1K57A 1XFNA 2M7VA 3ZFZA 4C75A 4OH0A 5TGFA 2VGJA 2XEPA 5DVAA 4EEPA 1H3QA 2J80A 1V9ZA 3MKFA 5GLBA 2OAQ1 4NXFA 3OC2A 4PM7A 1CF0A 1ES4A 3N8RA 1U60A 1DP8A 3UPOA 3LO7A 2ZMAA 5DTTA 2GX5A 1GSXA 5AQ9A 3PBSA 4ZRRA 3UDFA 4CLCD 3IHAA 2Y2GA 1O07A 2PBYA 5FEFA 4HJ4A 4B93A 3F1OA 1YSQA 3PBTA 4Q8IA 3CITA 2XFSA 2GNXA 3HLEA 2BG1A 3HUMA 2HDUA 4S2MA 2Y2LA 5CHJA 5IU1A 1IYSA 3VOLA 4KZ3A 2PDRA 4XT2B 5AQ7A 2IWBA 1S0WA 3DW0A 4UHUA 3ZGAB 1TD5A 1YLWA 1IYPA 4GW9A 1SKFA 4S2LA 3BRMA 4EQ1A 2IWCA 1XJ4A 2VLGA 1ZTUA 5L07A 2ZOIA 1FCNA 3VFFA 1M6KA 2DMWA 2ZM0A 1JTDA 3JYIA 3MZDA 4EBNA 3W4OA 4Y0UA 3NY4A 4X55A 3WS1A 1VEUB 4LCLA 1SZVA 1DP6A 2EX6A 4MN6A 3VOYA 3HUOA 4S2OA 4KZ6A 4HJ3A 1T18A 3C8CA 2J9OA 3GSGA 1GA0A 4H8RA 2W3EA 4OVDA 3B42A 3T4QA 2PR6A 4P6ZS 5FAPA 4S2NC 4LLOB 2ZC4B 2DCFA 3SH9A 4KQQA 3PBRA 4E3KA 4PAUA 2K7SA 5DTSA 2O0YA 4KZAA 2XQZA 3ZQ5A 1IYQA 1DJBA 4PPRA 3A3DA 5HDCA 4GDBA 5K5BA 2P9VA 4GB7A 2WKRA 1KVLA 1F98A 1GHPA 5D3OA 4EXOA 2WYXA 2Y2QA 4WLAA 1TEMA 4X1MA 4N92A 5FI7A 4H6JB 1JWZA 4DJ2A 3IS2A 1D06A 4CJNA 3HLCA 2V20A 2A24B 5EPHA 3O3VA 4OQIA 4F3LA 3C4OA 4I5SA 3LCEA 1O7EA 3U2AA 2FFYA 2JKFA 1CJFA 4R3JA 3BY8A 1L0EA 4R4RA 3UY6A 2VGLS 2PU4A 3ULFA 3LR4A 5L8MA 1Q2PA 4WYYA 1J3WA 3DTMA 5HL6A 5JYOA 1ONHA 1LSXA 4MBHA 1GCEA 1IYOA 1JVJA 4QB8A 3DTKA 3GDIA 1P97A 2W3DA 2ZQCA 4KQOA 1GSVA 3HUNA 3T50A 3NDEA 4UEYA 2KOIA 1RCJA 2UV0E 2V1AA 5GHXA 4CLCE 1HZOA 3RTYA 2Y55A 2VK3A 3VV4A 1FR6A 2PYRA 1YMXA 4P6BA 3O86A 4QY6A 4PMAA 4R3AA 1T1CA 4KQRA 1C3BA 1ESUA 1TVFA 4HQAA 2IA2A 5FL3A 2EA9A 4I39A 2EWVA 1PWDA 2JE5A 4EUZA 3IBRA 2JN7A 3F1NB 2EXAA 2YKFA 3AGDA 3RJUA 3IF6C 3BYDA 1TS7A 4MBFA 2OLUA 3SZTA 3MS6A 3MF0A 1K54A 3MKEA 1MY8A 1DP9A 4RA7A 2VX8A 4KZ9A 1PW8A 4R6LA 3TE8A 3ITAA 2J3WA 4EU0A 4RQ9A 2A49A 2WKQA 3G2YA 2EX2A 3C2WA 3UDXA 3R7WB 3BQ8A 4ARZB 1PYYA 4S2PA 4DDSA 1JTGA 4OOYA 4KUOA 4R0QA 5F82A 4E6WA 1NYMA 1PNEA 5G4ZA 4JXSA 2V1ZA 1MZUA 4X25A 1OTIA 3MXQA 2PR5A 4WZ4A 4ZDXA 2B02A 1GSWA 3LY4A 3VP0A 1F9IA 4FOFA 4IUHA 4P0MA 4E3LA 2B5RA 2QHKA 4Y17A 5IS1A 1S6RA 3L7HA 5IT5A 3GTCA 4OP5A 4ETXA 2C5WB 4ETZA 1AXBA 4E3OA 1OTBA 2HDSA 1PIOA 3M2JA 3IX3A 3T4OA 1ERMA 1OJ5A 4JXGA 2ZMVA 3GQZA 1KGFA 5G18A 2Q0OA 3KSHA 3O5YA 3R4KA 1MBLA 2OSUA 4U3TA 3UB5P 4C6YA 1VB6A 5EUAA 4FD8A 4ESPA 5J8XA 1YLZA 3V3RA 3CHWP 2Y59A 5CEDA 4HY8A 4LRZE 4YNRA 2XA7S 4LV0A 3H82B 3LIAA 4X1LA 2Y4AA 1NZUA 5AJGA 2ZJ9A 1E3UD 1MWTA 1BTLA 3ZDJA 1VHMA 5E2FA 1KDWA 2QYBA 3CWFA 5HL1A 1N9NA 2ZMFA 2P7JA 3K2NA 4BQMA 4CLCB 3E4OA 3MXSA 2ZL1A 4LV1A 5FQIA 4CPKA 2EFXA 1BLHA 5EVLA 1RGZA 4E04A 5EE8A 4XUXA 3UNWA 2XH9A 4OQHA 4I3AA 2WGWB 2BTFP 5M19A 3AGEA 3PBNA 3IWQA 4HH3A 1W7FA 2JC7A 1YT4A 2HP6A 2KDKA 4WEKA 4BBUA 1BLSA 4GJ4A 2ZQ8A 4RVAA 2QWSA 3OPHA 3G4PA 4GCZA 4Y2FA 2LB5A 4JGQA 3QNCA 4LCMA 1YMSA 3BFGA 4G3KA 5I94A 3WRTA 4HOIA 2L0WA 1STZA 5CHUA 3IWOA 4GZBA 2O99A 4Y15A 3V3SA 3LIEA 2GZAA 1OTEA 4GS9B 1K6RA 3OPRA 1K57C 3NI9A 4BWIA 2K31A 4K08A 1T19A 4FH2A 4IVIA 1FQGA 4WEJA 1BZAA 3PAGA 4U0XA 4BBTA 4UA6A 3F1PB 3IX4A 1A0KA 4FH4A 2DNSA 3AGFA 3TRCA 3ZG0A 5J3WA 4S2IA 4YFMA 4MMNA 3OPLA 4DN0A 3HLGA 3OZHA 5FAQA 5TBMA 4YOFA 1G28A 2ZLYA 3S4XA 4NG2A 3A3JA 3S7PA 1I5QA 4BMWA 2EX9A 3CPTA 4L9FA 4IHQA 1VETB 3UN7A 5BOHA 1KGEA 1YLYA 4RX2A 4HBUA 4Q0JA 3C30A 4MCWA 1ZG4A 4Z1WA 1CQAA 2J8YA 3LFVA 4L0LA 5L10A 2CMNA 1Z6FA 1KDSA 3TG9A 4UA7A 4WZ5A 1S1YA 2WAFA 2FH5A 4OQGA 5CERA 4EWFA 3QP1A 5EVID 3Q07A 3SS5A 3TW8A 3HCYA 3SS4A 2ZQ7A 1NY0A 3LY3A 1LT0A 4GHIB 3PBQA 4QJGA 5DFYA 3KYQA 1K0KA 1KOUA 4S2JA 3I7JA 5DF9A 3EEAA 3G6OA 4II7A 1OMEA 2HF6A 2Z6DA 4X53A 4XUZA 3ZYTA 2O9AA 4O7DA 2XD1A 5TR7A 4KG5A 1TS6A 2WK0A 4QPRA 3IT9A 1OPXA 4LPZA 2H0TA 4EW7A 2EFUA 4L9EA 5HDDA 4BD0A 4KUKA 2WZXA 3H7WA 2VGKA 4N1HA 4X68A 1QMFA 2R9XA 5EOEA 2Y2OA 3NOTC 3LYXA 3CUEC 2PHYA 3VP3A 4NKPA 2GJ3A 3SH7A 2VZWA 5HX9A 2EX8A 5FQ9A 1HD8A 1LL5A 4JLFA 3JVVA 3W4QA 5FQJA 5J7EA 3MZEA 3FKVA 1D7EA 1PFLA 1WYCA 2HPBA 5M18A 2PD8A 1YQSA 4PM5A 2EWWA 2QKPA 2P74A 1XJ6A 1N9LA 3UMDA 3LIDA 4X6TA 2JKRI 4WN5A 4WUJA 4GLQA 2VA0A 3LR5A 3ZVWA 1W79A 2V1BA 2XROA 3NBLA 1LL9A 1Y54A 4HP4A 3IXGA 4FSFA 4H6JA 3BY9A 4G3WA 1J9MA 3M6HA 4IJGA 4E3NA 3N7WA 2W1TA 4GD8A 4KQDA 2Y2IA 5F69A 4DF6A 3MXRA 4M4XA 3T4KA 4HI4A 1UWPX 5AVFA 3FPWA 3BFFA 4NETA 1XX2A 4PHTA 4ZJ1A 1S4RA 4BJPA 1OTAA 4BL3A 4DXCA 4NXEA 2WZZA 2BASA 2Z6CA 4OONA 4Y5FA 5E2EA 1FIKA 4I3JA 3SS3A 3GRJA 3VP1A 1SCWA 3A3IA 4JGRA 2WKPA 3N8LA 1KE3A 3A0RA 2Y8HA 5DJUA 3LIFA 4OOMA 2XF3A 4FTXA 3B47A 2VEAA 1E3UA 2Y2HA 4C3QA 3VSLA 5CHMA 3SW1A 1Z09A 4IUKA 4LRYC 3W2ZA 2ZM2A 5E2HA 5FQMA 3EGXC 2XRNA 2DRWA 4OOLA 1N9BA 4BENA 4IEDA 3S7NA 1P9RA 2ZOHA 4N9KA 5DJTA 4B4ZA 4S2NA 3Q7ZA 4XXRA 1YLTA 1K56D 4X69A 1KGGA 3ZNYA 1NRJA 5E2GA 4LENA 3P09A 3G34A 4JGPA 3FG8A 4LFUA 4QD4A 4GN2A 2P9VB 3EGDC 5A93A 3HREA 3BM6A 1L2SA 3C4PA 3G2ZA 3ZNTA 4KZ5A 2XD5A 4GNUA 1YM1A 4MN5A 2NUPC 3SOIA 5C5KA 1CI9A 3GMWA 3T1SA 1SHVA 4HBTA 2AVXA 4JBFA 4BBVA 2ZC7A 3T4LA 1YLPA 3V67A 2IWDA 2EXBA 4K91A 4Q0HA 1ESIA 4DRTA 1H8MA 5EECA 5HAQA 3IS2B 3C5AA 4DDYA 2W27A 4WF0A 2PYPA 3V50A 4UQIM 4QWOA 1MXOA 2E8JA 1MWSA 3TSGA 1KVMA 2J9PA 4P85A 4QY5A 4F3LB 1L3LA 4KZ4A 4HP9A 1Y4OA 2PBDP 1CEGA 3PAEA 1IKIA 1WYBA 1XGJA 4JXVA 4JPMA 3M2KA 4OPQA 4PM8A 1PZPA 4ZAMA 1BUEA 2ZBBA 4BL2A 1S4SA 1FCMA 3PHYA 4KG6A 3QNBA 2XLNA 3CLOA 1N9OA 2I9VA 4GKUA 3LI8A 4YWZA 1LHYA 2PD7A 3MFDA 5HPFA 3Q81A 2Y2MA 4CLCC 2ACGA 3Q7VA 1OT6A 5FI2A 5KIZA 1RP5A 1YKDA 1GHMA 5GLCA 4ZJ3A 1DJAA 3NULA 2QPNA 3WS4A 1W5DA 4HHDA 3RXWA 2XSSA 1X0OA 4A5RA 3ITBA 4DE2A 5GLAA 3EQUA 2P08A 5EOOA 4DE3A 1ES2A 1GA9A 5EVIA 1PW1A 3RFBA 1E25A 3DAVA 3LR0A 2G2UA 4I3IA 1W8QA 4PKYG 3FC7A 3KX0X 4O8GA 4EETB 2ZC3B 3IF6A 2JKTI 1LI0A 4DXBA 2ZQDA 2ZQ9A 3GVBA 5FDSA 1ES5A 3Q1FA 5AVEA 3ZVTA 3G31A 2HGVA 1DY6A 4KG2A 5AQAA 1S1ZA 1VM1A 1UWNX 2WKHA 5HWWA 3A0SA 5EM1A 2UWXA 2JHEA 4U0TA 2E8IA 4KENB 4QHCA 2O9CA 4MDZA 3E2LA 1F2KA 2HP5A 5FDHA 1HTZA 4OPYA 2QJ5A 2Y2JA 3P01A 2Y2KA 4GOGA 2ZC5B 4R3BA 5E43A 5FQQA 2CC1A 2B95A 2QZ6A 1HVBA 5HAIA 2Y2NA 5CRFA 3T4TA 1ALQA 2W1RA 4O0PA 2D02A 4HIAA 3E2KA 4O01A 2J3TC 4ZJ2A 2W3FA 4EQIA 4DE0A 2VJWA 2YKHA 3BECA 2PU2A 1SKOB 1YAXA 4WMCD 2A2LA 1G68A 3OCNA 4Y13A 2ZQAA 3NHQA 1W8YA 5LBRA 4Q0IA 2J7VA 2WKIA 3KYZA 4KZBA 5MC7A 1K55A 1ZC2A 1AWIA 2HDQA 1XA1A 3KSFA 2OV5A 5CTNA 2H10A 4E6XA 2MJ6A 4OPZA
chains in the Genus database with same CATH topology
4WLAA 5DF9A 3EEAA 4DJ3A 3G6OA 3S7QA 4II7A 2HF6A 2Z6DA 4I38A 3ZYTA 3A0VA 4H6JB 3LUQA 2O9AA 4PKYA 4DJ2A 3IS2A 1D06A 3NOUC 2W3HA 4HH2A 1TS6A 1P9WA 4QPRA 1OPXA 1TS0A 3MJQA 4LPZA 2VV7A 4EW7A 4EUVA 2A24B 2QJ7A 3BJNA 1LSWA 3BQAA 4L9EA 5HDDA 4KUKA 3H82A 4F3LA 3H7WA 2KX6A 5G4YA 1V9YA 3EEHA 1YSPA 1NWZA 3EOIA 1W63Q 4I5SA 5A8BA 1WA9A 5CX7A 3U2AA 2FZ0A 3NOTC 3BY8A 3IBJA 3LYXA 5TJJA 3CUEC 2PHYA 3LI9A 4NKPA 2GJ3A 2VGLS 1S67L 3ULFA 2VZWA 4CLCA 3LR4A 5L8MA 2VV6A 5DFXA 3D3OA 1ODVA 4EEUA 2JKTM 5HL6A 1S66L 3JVVA 3JVUA 5J7EA 1XJ3A 1LSXA 1D7EA 1EW0A 3HJKA 1XJ2A 3LICA 2V9AA 2PD8A 1MKMA 3S7OA 3PXPA 3BW6A 2EWWA 2QKPA 2HJEA 4NEED 3E0YA 3GDIA 3EQVA 1P97A 1XJ6A 1N9LA 2W3DA 4KQOA 1GSVA 3UMDA 3LIDA 2G7UA 2JKRI 4WN5A 3PR6A 3T50A 4UEYA 4WUJA 3BWLA 3RH8B 2KOIA 2OWJA 2VA0A 4GLQA 3LR5A 2V1AA 2XA7M 1LL8A 2V0WA 3MMHA 5DKKA 5I5LA 4CLCE 2V1BA 3RTYA 2XROA 3VV4A 1IOUA 1BYWA 4HP4A 5HWTA 2PYRA 4R3AA 4FSFA 4H6JA 4EESA 1OT9A 1T1CA 4DMZA 3BY9A 2L4RA 4G3WA 3HJIA 4HQAA 2IA2A 2L1MA 5FL3A 4IJGA 2W0NA 4XT2A 2EA9A 4I39A 2W1TA 2EWVA 4KQDA 2V0UA 5F69A 4M4XA 3T4KA 2M7UA 4HI4A 1UWPX 3IBRA 2JN7A 3MQ0A 3FPWA 5AVFA 4GS9A 3F1NB 2YKFA 2H28A 4LRXC 1TS7A 4PHTA 1S4RA 2OOLA 1OTAA 4BJPA 2P04A 3EWKA 4NXEA 2BASA 2Z6CA 3MF0A 3H9WA 4Y5FA 1DP9A 3F1PA 2VX8A 3UB6A 4I3JA 4EERA 4R6LA 3TE8A 4JGRA 2J3WA 2WKPA 4EU0A 4RQ9A 3A0RA 2Y8HA 3KSIA 5DJUA 2WKQA 3LIFA 4OOMA 3P7NA 2K2NA 5HD5A 3MQQA 3VE4A 3B47A 1TS8A 3C2WA 3R7WB 2VEAA 3BQ8A 4ARZB 5TBMB 3E98A 3UE3A 4KUOA 3OBFA 4R38A 2KLIA 2W3GA 3SW1A 1LSVA 3CAXA 5G4ZA 3UB9A 4IUKA 4LRYC 3W2ZA 1MZUA 3LR3A 3EGXC 2XRNA 1OTIA 3ICYA 3MXQA 1XFQA 2PR5A 4OOLA 1JNUA 2B02A 1GSWA 2O9BA 3KO6A 5DKLA 1F9IA 4FOFA 4IUHA 3OOVA 3S7NA 1P9RA 2ZOHA 5DJTA 2B18A 3E4PA 2QHKA 5IS1A 1P0ZA 4L9GA 5IT5A 4NXBA 1NRJA 3T4JA 3VE3A 4ETXA 3B33A 3PYPA 4ETZA 4JGPA 5HD3A 3FG8A 3EGDC 5KSHA 1OTBA 1Y28A 4HJ6A 3NOPC 5HWVA 1OTDA 4MN5A 2NUPC 3DBAA 3F1OB 3T4OA 1OJ5A 3TJZC 4AFIA 3MQOA 4GHIA 5C5KA 1W63M 2ZMVA 5HZHA 1NLZA 4BBVA 3D72A 4Y3IA 2HJ9C 3KSHA 3T4LA 3O5YA 3R4KA 3V67A 3CI6A 4Q0HA 1VB6A 1H8MA 3IS2B 3PBOA 2PT7A 3GECA 2W27A 5F6AA 4WF0A 2PYPA 4JGOA 4UQIM 3OLOA 1G6OA 1T1AA 4NXGA 2JKRM 4HY8A 4LRZE 2LB9A 3LIBA 4YNRA 2XA7S 3H82B 4P6ZM 4F3LB 3LIAA 4R70A 2VKSA 3H7WB 5F5YA 4HP9A 3UE6A 2VV8A 2M1CA 1UGUA 2A24A 3C38A 5AJGA 5J4EA 1T1BA 1XFNA 2M7VA 5HPIA 2ZBBA 1VHMA 4HNBA 1S4SA 2Y79A 3PHYA 2QYBA 3CWFA 1H3QA 4EEPA 1N9NA 1OJGA 2J80A 1V9ZA 2ZMFA 2HV1A 3CUEA 2P7JA 1N9OA 3CLOA 3K2NA 4CLCB 2OAQ1 2I9VA 4NXFA 3LI8A 3E4OA 4YWZA 3OC2A 3NJAA 2PD7A 5HPFA 4CLCC 3K3CA 2J3TD 1DP8A 1IFQA 2OWHA 4E04A 1OT6A 2GX5A 1GSXA 3PBSA 5KIZA 4I3AA 4ZRRA 4CLCD 2D01A 3PBNA 4HH3A 1YKDA 3FPVA 4B9OA 4HJ4A 2KDKA 4B93A 4WEKA 3F1OA 1YSQA 4BBUA 4HHDA 3PBTA 2XSSA 2OAP1 1X0OA 3CITA 4GJ4A 5HSQA 2GNXA 2QWSA 3KSGA 3EQUA 2P08A 4GCZA 4Y2FA 2LB5A 4JGQA 5IU1A 3VOLA 2PDRA 4G3KA 4HOIA 2R78A 4XT2B 2L0WA 2W1TB 3RFBA 3K3DA 1STZA 1TF1A 1F5MA 3LR0A 2O99A 1TD5A 3LIEA 2GZAA 4I3IA 4GW9A 1OTEA 4PKYG 4GS9B 3FC7A 2VGLM 3KX0X 4O8GA 4BWIA 4EQ1A 2K31A 4K08A 4EETB 1T19A 2JKTI 1XJ4A 2VLGA 4WEJA 3F1NA 4WELA 4BBTA 1ZTUA 5AVEA 3F1PB 2HGVA 1S1ZA 4G3VA 2ZOIA 1UWNX 3UB7A 5HWWA 3A0SA 3TRCA 2JHEA 2DMWA 5J3WA 2O9CA 4MDZA 4MMNA 1DP6A 2QJ5A 3P01A 1DRMA 1NLYA 4MN6A 4DN0A 3R7WA 4ARZA 5TBMA 4YOFA 3UMEA 1G28A 4HJ3A 1T18A 3C8CA 3S7PA 5F68A 4BMWA 4L9FA 4IHQA 5HDSA 1MC0A 4WL9A 4Q0JA 3T4TA 3C30A 2W3EA 2W1RA 2D02A 4HIAA 4O0PA 4MCWA 4UQIS 2NUTC 3B42A 4Z1WA 4O01A 3T4QA 2J3TC 3LFVA 2PR6A 3MFXA 4L0LA 4P6ZS 3T4SA 2CMNA 2W3FA 4LLOB 3OCLA 3PBRA 2VJWA 1S1YA 1ZHHB 2YKHA 2FH5A 3UB8A 1YAXA 2A2LA 4PAUA 2K7SA 2O0YA 3OCNA 3TW8A 3HCYA 5EFWA 3E4QA 3NHQA 3ZQ5A 5LBRA 4Q0IA 5HDCA 4CQHA 5K5BA 4ME4A 3KYZA 5MC7A 1LT0A 2WKRA 3MR0A 1F98A 4GHIB 3PBQA 4EXOA 3KSFA 5DFYA 3KYQA 1KOUA 2MJ6A 2INWA 4MN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WLA A;  4DJ3 A;  3G6O A;  2Z6D A;  4I38 A;  3A0V A;  4H6J B;  3LUQ A;  4PKY A;  4DJ2 A;  3IS2 A;  1D06 A;  3NOU C;  4HH2 A;  1TS6 A;  1TS0 A;  3MJQ A;  4LPZ A;  2VV7 A;  4EW7 A;  2A24 B;  2QJ7 A;  1LSW A;  4L9E A;  5HDD A;  4KUK A;  3H82 A;  4F3L A;  3H7W A;  2KX6 A;  5G4Y A;  1V9Y A;  3EEH A;  1NWZ A;  4I5S A;  5A8B A;  1WA9 A;  3NOT C;  3BY8 A;  3LYX A;  2PHY A;  3LI9 A;  2GJ3 A;  1S67 L;  3ULF A;  2VV6 A;  1ODV A;  4EEU A;  1S66 L;  5J7E A;  1XJ3 A;  1LSX A;  1D7E A;  1EW0 A;  3HJK A;  1XJ2 A;  3LIC A;  2V9A A;  2PD8 A;  2QKP A;  3GDI A;  1P97 A;  1XJ6 A;  1N9L A;  1GSV A;  3UMD A;  3LID A;  4WN5 A;  3T50 A;  4WUJ A;  3RH8 B;  3BWL A;  2OWJ A;  2V1A A;  1LL8 A;  2V0W A;  5I5L A;  5DKK A;  2V1B A;  3RTY A;  1BYW A;  4HP4 A;  5HWT A;  2PYR A;  4R3A A;  4H6J A;  4EES A;  1OT9 A;  1T1C A;  3BY9 A;  2L4R A;  3HJI A;  4HQA A;  2L1M A;  2W0N A;  4XT2 A;  2EA9 A;  4I39 A;  4KQD A;  2V0U A;  5F69 A;  4M4X A;  4HI4 A;  1UWP X;  3IBR A;  2JN7 A;  5AVF A;  4GS9 A;  3F1N B;  2YKF A;  2H28 A;  4LRX C;  1TS7 A;  1S4R A;  2OOL A;  1OTA A;  3EWK A;  4NXE A;  2BAS A;  2Z6C A;  3H9W A;  1DP9 A;  3F1P A;  3UB6 A;  4EER A;  4I3J A;  4R6L A;  4JGR A;  2WKP A;  4RQ9 A;  3A0R A;  5DJU A;  2WKQ A;  3LIF A;  3P7N A;  5HD5 A;  3MQQ A;  3VE4 A;  1TS8 A;  3C2W A;  2VEA A;  5TBM B;  4KUO A;  4R38 A;  3SW1 A;  1LSV A;  3CAX A;  5G4Z A;  3UB9 A;  4LRY C;  1MZU A;  1OTI A;  3ICY A;  3MXQ A;  1XFQ A;  2PR5 A;  1JNU A;  2B02 A;  1GSW A;  5DKL A;  1F9I A;  2ZOH A;  5DJT A;  3E4P A;  2QHK A;  5IS1 A;  1P0Z A;  4L9G A;  4NXB A;  3VE3 A;  3B33 A;  3PYP A;  4JGP A;  5HD3 A;  3FG8 A;  1OTB A;  1Y28 A;  4HJ6 A;  3NOP C;  5HWV A;  1OTD A;  4MN5 A;  3F1O B;  1OJ5 A;  3MQO A;  4GHI A;  5HZH A;  4BBV A;  3D72 A;  1VB6 A;  3IS2 B;  3GEC A;  2W27 A;  5F6A A;  4WF0 A;  2PYP A;  4JGO A;  3OLO A;  1T1A A;  4NXG A;  4HY8 A;  4LRZ E;  3LIB A;  3H82 B;  4F3L B;  3LIA A;  4R70 A;  3H7W B;  5F5Y A;  4HP9 A;  3UE6 A;  2VV8 A;  2M1C A;  1UGU A;  2A24 A;  5J4E A;  1T1B A;  1XFN A;  2ZBB A;  4HNB A;  1S4S A;  3PHY A;  3CWF A;  4EEP A;  1N9N A;  1OJG A;  2J80 A;  1V9Z A;  2HV1 A;  2P7J A;  1N9O A;  3CLO A;  2I9V A;  4NXF A;  3LI8 A;  3E4O A;  4YWZ A;  3NJA A;  2PD7 A;  3K3C A;  1DP8 A;  2OWH A;  4E04 A;  1OT6 A;  1GSX A;  5KIZ A;  4I3A A;  2D01 A;  4HH3 A;  4B9O A;  4HJ4 A;  2KDK A;  3F1O A;  4BBU A;  4HHD A;  1X0O A;  5HSQ A;  2QWS A;  4GCZ A;  4JGQ A;  5IU1 A;  3VOL A;  2PDR A;  4HOI A;  2R78 A;  4XT2 B;  2L0W A;  3K3D A;  4I3I A;  3LIE A;  4GW9 A;  1OTE A;  4PKY G;  4GS9 B;  3FC7 A;  3KX0 X;  4EQ1 A;  4K08 A;  4EET B;  1T19 A;  1XJ4 A;  2VLG A;  3F1N A;  4BBT A;  5AVE A;  3F1P B;  1S1Z A;  2ZOI A;  1UWN X;  3UB7 A;  5HWW A;  3A0S A;  2JHE A;  5J3W A;  1DP6 A;  2QJ5 A;  4MN6 A;  1DRM A;  5TBM A;  3UME A;  1G28 A;  4HJ3 A;  1T18 A;  3C8C A;  5F68 A;  4L9F A;  5HDS A;  4WL9 A;  2D02 A;  4HIA A;  3MFX A;  2PR6 A;  2CMN A;  4LLO B;  1S1Y A;  2YKH A;  3UB8 A;  2K7S A;  5EFW A;  3E4Q A;  3NHQ A;  3ZQ5 A;  5HDC A;  1LT0 A;  2WKR A;  3MR0 A;  1F98 A;  4GHI B;  4EXO A;  1KOU A;  2INW A; 
#chains in the Genus database with same CATH topology
 3RXX A;  3ZCZ A;  1GHI A;  3IH9 A;  1L0F A;  4F94 A;  2Q9M A;  3A0V A;  4PKY A;  2W3H A;  3D4F A;  3FV7 A;  3IXD A;  3CZD A;  2PAV P;  4MEZ A;  5HAP A;  2QMI A;  3HVF A;  3MJQ A;  5GHZ A;  2VV7 A;  4EUV A;  2QJ7 A;  3BQA A;  5CEC A;  2X71 A;  2KX6 A;  3EEH A;  1NWZ A;  1W63 Q;  5A8B A;  1WA9 A;  3O87 A;  3T1R A;  3GV9 A;  1M40 A;  2ZL1 B;  3NC8 A;  5TJJ A;  3B3X A;  3NEC A;  1LLB A;  1S67 L;  4WZ5 C;  2VV6 A;  5DFX A;  3D3O A;  4FUW A;  5CGX A;  5A90 A;  1XA7 A;  1S66 L;  1YPR A;  3JVU A;  1XJ3 A;  3JPU A;  3HJK A;  1XJ2 A;  5DF7 A;  3LIC A;  2V9A A;  1MKM A;  1NZO A;  5CTM A;  4OKP A;  3S7O A;  3VFH A;  3PXP A;  3BW6 A;  5U47 A;  3IH8 A;  2HJE A;  1PI5 A;  2V2F F;  3GR2 A;  3W8K A;  1VQQ A;  3HL9 A;  3EQV A;  2JBF A;  5FAO A;  1SDE A;  3RH8 B;  5KSC A;  5KMW A;  2OWJ A;  5A92 A;  3NDG A;  4MLL A;  3MMH A;  2V0W A;  5I5L A;  1K56 A;  4IBX A;  2H0Y A;  2A3U A;  1PRQ A;  5HWT A;  3DTI A;  1D1J A;  3ISG A;  1OT9 A;  3N8S A;  4DMZ A;  2L4R A;  3FZC A;  4OLG A;  5F1F A;  1WE4 A;  2Y2P A;  2L1M A;  4XT2 A;  1MPL A;  4JF5 A;  3UE0 A;  3A3F A;  3QP5 A;  2V0U A;  3UE1 A;  4Z9Q A;  2M7U A;  3QP6 A;  3MQ0 A;  4JXW A;  2OOL A;  3WS5 A;  3EWK A;  2XGN A;  3FWL A;  3VMA A;  1BLP A;  1TDL A;  3T1X A;  3UB6 A;  4EER A;  4E3I A;  4DE1 A;  2C6W B;  3IXB A;  1IEM A;  3KYE A;  1YLJ A;  1MWR A;  3KSI A;  2HDR A;  3P7N A;  2K2N A;  3MQQ A;  3VE4 A;  5JYP A;  1ONG A;  3A3E A;  1TS8 A;  4DKI A;  2R9W A;  5TBM B;  3E98 A;  1VEU A;  2BLS A;  3NCK A;  4R38 A;  1JWV A;  2WAE A;  1H0M A;  3CPT B;  2GDN A;  3CAX A;  1H8Y A;  4MNR A;  3UB9 A;  4M3K A;  1FIL A;  5GLD A;  4D60 A;  1ERO A;  3LR3 A;  2WKE A;  3UO9 A;  1XFQ A;  3D9Y A;  2O9B A;  4B4X A;  4E3M A;  2B18 A;  3U4L P;  1TDG A;  1ZKJ A;  4JF6 A;  5CGS A;  4L9G A;  4N1X A;  4NXB A;  2I72 A;  2Y91 A;  3PYP A;  4OP8 A;  4KZ8 A;  3LGO A;  3PTE A;  1K38 A;  3TOI A;  1BUL A;  4HJ6 A;  1OTD A;  2V8F A;  5EVE A;  1K25 A;  3DBA A;  3F1O B;  3TJZ C;  4AFI A;  3MQO A;  1W63 M;  1ACF A;  1K4E A;  2WAD A;  3G35 A;  3HLD A;  5HZH A;  4Y3I A;  3WS2 A;  2V8C A;  4WM9 A;  3NIA A;  3UPP A;  3HLW A;  5FAS A;  2ZC6 B;  5F6A A;  3OPP A;  1XKZ A;  4JGO A;  1G6O A;  1T1A A;  2JKR M;  3VOZ A;  4D2O A;  5L09 A;  3T12 B;  4P6Z M;  4R70 A;  2VKS A;  3H7W B;  3UE6 A;  2A24 A;  5J4E A;  1T1B A;  4Y0T A;  5HPI A;  1H5X A;  4HNB A;  2Y79 A;  3QHY A;  2Z2M B;  1OJG A;  5L2F A;  3IXH A;  3IX8 A;  4R4S A;  2HV1 A;  3CUE A;  3FYZ A;  1CEF A;  1ERQ A;  3ZG7 B;  3V39 A;  3NJA A;  4MBK A;  3LEZ A;  5CXW A;  3K3C A;  2J3T D;  3S22 A;  1IFQ A;  3MSH A;  2OWH A;  5F1G A;  5HAR A;  3IHB A;  2D01 A;  3M6B A;  3FPV A;  4K0X A;  4B9O A;  4E3J A;  3VP2 A;  3CJM A;  4B88 A;  1SDN A;  2OAP 1;  5HSQ A;  3QP2 A;  4LV2 A;  1Q2Q A;  3LEQ A;  3KSG A;  1PWG A;  1XXM A;  4WMC A;  3WS0 A;  2R78 A;  1MWU A;  4P87 A;  2W1T B;  3K3D A;  1TF1 A;  1F5M A;  3HLB A;  1NXY A;  1ES3 A;  2Q9N A;  4Y7P A;  2VGL M;  2ZD8 A;  4FCF A;  3VP4 A;  3F1N A;  4WEL A;  4BLM A;  2WUQ A;  5A91 A;  1PZO A;  4RYE A;  3UPN A;  1K54 C;  4G3V A;  3C7U A;  3UB7 A;  3N6I A;  1CI8 A;  4OQ0 A;  3DWZ A;  4LV3 A;  3ZHH A;  2WGI A;  1FCO A;  3C7V A;  1XP4 A;  5CGW A;  3QP8 A;  4PM9 A;  1DRM A;  1NLY A;  4GDN A;  1PWC A;  4EV4 A;  3R7W A;  3HLF A;  4ARZ A;  5FSR A;  3UME A;  3O88 A;  1IEL A;  3CMZ A;  5F68 A;  4QU3 A;  1MC0 A;  5HDS A;  3MZF A;  4WL9 A;  4ZBE A;  4UQI S;  2NUT C;  3MFX A;  2XK1 A;  5EVI C;  3T4S A;  1EWZ A;  5DTK A;  3OCL A;  3BFC A;  1ZHH B;  4ID4 A;  2X02 A;  3UB8 A;  1KE0 A;  5GHY A;  5EFW A;  3E4Q A;  1CK3 A;  4CQH A;  4ME4 A;  3MR0 A;  2H5S A;  2XR0 A;  1HLU P;  4PM6 A;  2INW A;  4MN7 A;  3SH8 A;  4ZTK A;  5DF8 A;  5M1A A;  2RCX A;  4JF4 A;  4DJ3 A;  3S7Q A;  4N9L A;  1NYY A;  4I38 A;  3LUQ A;  1PI4 A;  3NOU C;  3VSK A;  1L0D A;  4HH2 A;  3G30 A;  1P9W A;  2JCH A;  1FOF A;  1TS0 A;  3BJN A;  1LSW A;  4JKT A;  5EV0 A;  4OLD A;  3H82 A;  2WGV A;  2FFF B;  1G6A A;  5G4Y A;  1V9Y A;  5FQK A;  2OLV A;  1YSP A;  3EOI A;  3P98 A;  5CX7 A;  3ZG5 A;  2FZ0 A;  3BFD A;  3IBJ A;  2ZM8 A;  5FEG A;  3DTE A;  3LI9 A;  3ZG8 B;  3BLM A;  3ZG9 B;  4CLC A;  3Q7V B;  4R1G A;  1ODV A;  4EEU A;  4KZ7 A;  2JKT M;  3T1Q B;  1SKO A;  1EW0 A;  3CG5 A;  4UAA A;  4HEF A;  2WGW A;  4NEE D;  3E0Y A;  1K55 C;  4IVK A;  1LI9 A;  2G7U A;  3PR6 A;  3BWL A;  4EBL A;  3HBR A;  2XA7 M;  1LL8 A;  5DKK A;  3IF5 A;  3DWK A;  1IOU A;  1BYW A;  1L0G A;  4OPR A;  4HES A;  5EVI B;  1MKI A;  5FA7 A;  1BSG A;  4EES A;  5IHV A;  3BFE A;  1K4F A;  2JKG A;  3HJI A;  3IWI A;  2W0N A;  3UDI A;  3W4P A;  4LGW A;  5GL9 A;  1EI5 A;  3IF6 B;  4R23 A;  1I2W A;  4X56 A;  2RL3 A;  2PRF A;  4GS9 A;  1BT5 A;  2H28 A;  4LRX C;  1G5U A;  2P04 A;  5F83 A;  2HP9 A;  3BEB A;  5CEB A;  3H9W A;  3F1P A;  3FKW A;  1NJ4 A;  4YIN A;  2XDM A;  1FR1 A;  1KE4 A;  5FAT A;  3Q82 A;  2G2W A;  5HD5 A;  1K6S A;  4BD1 A;  3UE3 A;  1I2S A;  4UA9 A;  4NK3 A;  3BLS A;  3OBF A;  5FI6 A;  2KLI A;  4K0W A;  2W3G A;  1LSV A;  1FSY A;  5HW3 A;  1DJC A;  3ICY A;  1VET A;  4RX3 A;  1JNU A;  2HZ5 A;  3KO6 A;  5DKL A;  5HFO A;  3OOV A;  3E4P A;  5TFQ A;  1P0Z A;  3MBZ A;  2X01 A;  3T4J A;  1NRF A;  3VE3 A;  1N4O A;  4EBP A;  3B33 A;  3L9K A;  5HD3 A;  4Y0O A;  5KSH A;  1JWP A;  1Y28 A;  1BLC A;  3NOP C;  5HWV A;  4GD6 A;  4GHI A;  4WBG A;  1NLZ A;  1RGY A;  3IQA A;  1QME A;  1H8Z A;  3D72 A;  2HJ9 C;  2XFT A;  1ZG6 A;  1XPB A;  3QP4 A;  3CI6 A;  3V5M A;  5EM0 A;  1FSW A;  3PBO A;  1IKG A;  2PT7 A;  5AQB A;  3GEC A;  3WWX A;  3WRZ A;  4S2K A;  3OLO A;  4NXG A;  3S1Y A;  2LB9 A;  3LIB A;  3G32 A;  3N4I A;  5F5Y A;  5KZH A;  2VV8 A;  2M1C A;  2Z2L B;  1UGU A;  1XGI A;  3C38 A;  1E4D A;  4IBR A;  1K57 A;  1XFN A;  2M7V A;  3ZFZ A;  4C75 A;  4OH0 A;  5TGF A;  2VGJ A;  2XEP A;  5DVA A;  4EEP A;  1H3Q A;  2J80 A;  1V9Z A;  3MKF A;  5GLB A;  2OAQ 1;  4NXF A;  3OC2 A;  4PM7 A;  1CF0 A;  1ES4 A;  3N8R A;  1U60 A;  1DP8 A;  3UPO A;  3LO7 A;  2ZMA A;  5DTT A;  2GX5 A;  1GSX A;  5AQ9 A;  3PBS A;  4ZRR A;  3UDF A;  4CLC D;  3IHA A;  2Y2G A;  1O07 A;  2PBY A;  5FEF A;  4HJ4 A;  4B93 A;  3F1O A;  1YSQ A;  3PBT A;  4Q8I A;  3CIT A;  2XFS A;  2GNX A;  3HLE A;  2BG1 A;  3HUM A;  2HDU A;  4S2M A;  2Y2L A;  5CHJ A;  5IU1 A;  1IYS A;  3VOL A;  4KZ3 A;  2PDR A;  4XT2 B;  5AQ7 A;  2IWB A;  1S0W A;  3DW0 A;  4UHU A;  3ZGA B;  1TD5 A;  1YLW A;  1IYP A;  4GW9 A;  1SKF A;  4S2L A;  3BRM A;  4EQ1 A;  2IWC A;  1XJ4 A;  2VLG A;  1ZTU A;  5L07 A;  2ZOI A;  1FCN A;  3VFF A;  1M6K A;  2DMW A;  2ZM0 A;  1JTD A;  3JYI A;  3MZD A;  4EBN A;  3W4O A;  4Y0U A;  3NY4 A;  4X55 A;  3WS1 A;  1VEU B;  4LCL A;  1SZV A;  1DP6 A;  2EX6 A;  4MN6 A;  3VOY A;  3HUO A;  4S2O A;  4KZ6 A;  4HJ3 A;  1T18 A;  3C8C A;  2J9O A;  3GSG A;  1GA0 A;  4H8R A;  2W3E A;  4OVD A;  3B42 A;  3T4Q A;  2PR6 A;  4P6Z S;  5FAP A;  4S2N C;  4LLO B;  2ZC4 B;  2DCF A;  3SH9 A;  4KQQ A;  3PBR A;  4E3K A;  4PAU A;  2K7S A;  5DTS A;  2O0Y A;  4KZA A;  2XQZ A;  3ZQ5 A;  1IYQ A;  1DJB A;  4PPR A;  3A3D A;  5HDC A;  4GDB A;  5K5B A;  2P9V A;  4GB7 A;  2WKR A;  1KVL A;  1F98 A;  1GHP A;  5D3O A;  4EXO A;  2WYX A;  2Y2Q A;  4WLA A;  1TEM A;  4X1M A;  4N92 A;  5FI7 A;  4H6J B;  1JWZ A;  4DJ2 A;  3IS2 A;  1D06 A;  4CJN A;  3HLC A;  2V20 A;  2A24 B;  5EPH A;  3O3V A;  4OQI A;  4F3L A;  3C4O A;  4I5S A;  3LCE A;  1O7E A;  3U2A A;  2FFY A;  2JKF A;  1CJF A;  4R3J A;  3BY8 A;  1L0E A;  4R4R A;  3UY6 A;  2VGL S;  2PU4 A;  3ULF A;  3LR4 A;  5L8M A;  1Q2P A;  4WYY A;  1J3W A;  3DTM A;  5HL6 A;  5JYO A;  1ONH A;  1LSX A;  4MBH A;  1GCE A;  1IYO A;  1JVJ A;  4QB8 A;  3DTK A;  3GDI A;  1P97 A;  2W3D A;  2ZQC A;  4KQO A;  1GSV A;  3HUN A;  3T50 A;  3NDE A;  4UEY A;  2KOI A;  1RCJ A;  2UV0 E;  2V1A A;  5GHX A;  4CLC E;  1HZO A;  3RTY A;  2Y55 A;  2VK3 A;  3VV4 A;  1FR6 A;  2PYR A;  1YMX A;  4P6B A;  3O86 A;  4QY6 A;  4PMA A;  4R3A A;  1T1C A;  4KQR A;  1C3B A;  1ESU A;  1TVF A;  4HQA A;  2IA2 A;  5FL3 A;  2EA9 A;  4I39 A;  2EWV A;  1PWD A;  2JE5 A;  4EUZ A;  3IBR A;  2JN7 A;  3F1N B;  2EXA A;  2YKF A;  3AGD A;  3RJU A;  3IF6 C;  3BYD A;  1TS7 A;  4MBF A;  2OLU A;  3SZT A;  3MS6 A;  3MF0 A;  1K54 A;  3MKE A;  1MY8 A;  1DP9 A;  4RA7 A;  2VX8 A;  4KZ9 A;  1PW8 A;  4R6L A;  3TE8 A;  3ITA A;  2J3W A;  4EU0 A;  4RQ9 A;  2A49 A;  2WKQ A;  3G2Y A;  2EX2 A;  3C2W A;  3UDX A;  3R7W B;  3BQ8 A;  4ARZ B;  1PYY A;  4S2P A;  4DDS A;  1JTG A;  4OOY A;  4KUO A;  4R0Q A;  5F82 A;  4E6W A;  1NYM A;  1PNE A;  5G4Z A;  4JXS A;  2V1Z A;  1MZU A;  4X25 A;  1OTI A;  3MXQ A;  2PR5 A;  4WZ4 A;  4ZDX A;  2B02 A;  1GSW A;  3LY4 A;  3VP0 A;  1F9I A;  4FOF A;  4IUH A;  4P0M A;  4E3L A;  2B5R A;  2QHK A;  4Y17 A;  5IS1 A;  1S6R A;  3L7H A;  5IT5 A;  3GTC A;  4OP5 A;  4ETX A;  2C5W B;  4ETZ A;  1AXB A;  4E3O A;  1OTB A;  2HDS A;  1PIO A;  3M2J A;  3IX3 A;  3T4O A;  1ERM A;  1OJ5 A;  4JXG A;  2ZMV A;  3GQZ A;  1KGF A;  5G18 A;  2Q0O A;  3KSH A;  3O5Y A;  3R4K A;  1MBL A;  2OSU A;  4U3T A;  3UB5 P;  4C6Y A;  1VB6 A;  5EUA A;  4FD8 A;  4ESP A;  5J8X A;  1YLZ A;  3V3R A;  3CHW P;  2Y59 A;  5CED A;  4HY8 A;  4LRZ E;  4YNR A;  2XA7 S;  4LV0 A;  3H82 B;  3LIA A;  4X1L A;  2Y4A A;  1NZU A;  5AJG A;  2ZJ9 A;  1E3U D;  1MWT A;  1BTL A;  3ZDJ A;  1VHM A;  5E2F A;  1KDW A;  2QYB A;  3CWF A;  5HL1 A;  1N9N A;  2ZMF A;  2P7J A;  3K2N A;  4BQM A;  4CLC B;  3E4O A;  3MXS A;  2ZL1 A;  4LV1 A;  5FQI A;  4CPK A;  2EFX A;  1BLH A;  5EVL A;  1RGZ A;  4E04 A;  5EE8 A;  4XUX A;  3UNW A;  2XH9 A;  4OQH A;  4I3A A;  2WGW B;  2BTF P;  5M19 A;  3AGE A;  3PBN A;  3IWQ A;  4HH3 A;  1W7F A;  2JC7 A;  1YT4 A;  2HP6 A;  2KDK A;  4WEK A;  4BBU A;  1BLS A;  4GJ4 A;  2ZQ8 A;  4RVA A;  2QWS A;  3OPH A;  3G4P A;  4GCZ A;  4Y2F A;  2LB5 A;  4JGQ A;  3QNC A;  4LCM A;  1YMS A;  3BFG A;  4G3K A;  5I94 A;  3WRT A;  4HOI A;  2L0W A;  1STZ A;  5CHU A;  3IWO A;  4GZB A;  2O99 A;  4Y15 A;  3V3S A;  3LIE A;  2GZA A;  1OTE A;  4GS9 B;  1K6R A;  3OPR A;  1K57 C;  3NI9 A;  4BWI A;  2K31 A;  4K08 A;  1T19 A;  4FH2 A;  4IVI A;  1FQG A;  4WEJ A;  1BZA A;  3PAG A;  4U0X A;  4BBT A;  4UA6 A;  3F1P B;  3IX4 A;  1A0K A;  4FH4 A;  2DNS A;  3AGF A;  3TRC A;  3ZG0 A;  5J3W A;  4S2I A;  4YFM A;  4MMN A;  3OPL A;  4DN0 A;  3HLG A;  3OZH A;  5FAQ A;  5TBM A;  4YOF A;  1G28 A;  2ZLY A;  3S4X A;  4NG2 A;  3A3J A;  3S7P A;  1I5Q A;  4BMW A;  2EX9 A;  3CPT A;  4L9F A;  4IHQ A;  1VET B;  3UN7 A;  5BOH A;  1KGE A;  1YLY A;  4RX2 A;  4HBU A;  4Q0J A;  3C30 A;  4MCW A;  1ZG4 A;  4Z1W A;  1CQA A;  2J8Y A;  3LFV A;  4L0L A;  5L10 A;  2CMN A;  1Z6F A;  1KDS A;  3TG9 A;  4UA7 A;  4WZ5 A;  1S1Y A;  2WAF A;  2FH5 A;  4OQG A;  5CER A;  4EWF A;  3QP1 A;  5EVI D;  3Q07 A;  3SS5 A;  3TW8 A;  3HCY A;  3SS4 A;  2ZQ7 A;  1NY0 A;  3LY3 A;  1LT0 A;  4GHI B;  3PBQ A;  4QJG A;  5DFY A;  3KYQ A;  1K0K A;  1KOU A;  4S2J A;  3I7J A;  5DF9 A;  3EEA A;  3G6O A;  4II7 A;  1OME A;  2HF6 A;  2Z6D A;  4X53 A;  4XUZ A;  3ZYT A;  2O9A A;  4O7D A;  2XD1 A;  5TR7 A;  4KG5 A;  1TS6 A;  2WK0 A;  4QPR A;  3IT9 A;  1OPX A;  4LPZ A;  2H0T A;  4EW7 A;  2EFU A;  4L9E A;  5HDD A;  4BD0 A;  4KUK A;  2WZX A;  3H7W A;  2VGK A;  4N1H A;  4X68 A;  1QMF A;  2R9X A;  5EOE A;  2Y2O A;  3NOT C;  3LYX A;  3CUE C;  2PHY A;  3VP3 A;  4NKP A;  2GJ3 A;  3SH7 A;  2VZW A;  5HX9 A;  2EX8 A;  5FQ9 A;  1HD8 A;  1LL5 A;  4JLF A;  3JVV A;  3W4Q A;  5FQJ A;  5J7E A;  3MZE A;  3FKV A;  1D7E A;  1PFL A;  1WYC A;  2HPB A;  5M18 A;  2PD8 A;  1YQS A;  4PM5 A;  2EWW A;  2QKP A;  2P74 A;  1XJ6 A;  1N9L A;  3UMD A;  3LID A;  4X6T A;  2JKR I;  4WN5 A;  4WUJ A;  4GLQ A;  2VA0 A;  3LR5 A;  3ZVW A;  1W79 A;  2V1B A;  2XRO A;  3NBL A;  1LL9 A;  1Y54 A;  4HP4 A;  3IXG A;  4FSF A;  4H6J A;  3BY9 A;  4G3W A;  1J9M A;  3M6H A;  4IJG A;  4E3N A;  3N7W A;  2W1T A;  4GD8 A;  4KQD A;  2Y2I A;  5F69 A;  4DF6 A;  3MXR A;  4M4X A;  3T4K A;  4HI4 A;  1UWP X;  5AVF A;  3FPW A;  3BFF A;  4NET A;  1XX2 A;  4PHT A;  4ZJ1 A;  1S4R A;  4BJP A;  1OTA A;  4BL3 A;  4DXC A;  4NXE A;  2WZZ A;  2BAS A;  2Z6C A;  4OON A;  4Y5F A;  5E2E A;  1FIK A;  4I3J A;  3SS3 A;  3GRJ A;  3VP1 A;  1SCW A;  3A3I A;  4JGR A;  2WKP A;  3N8L A;  1KE3 A;  3A0R A;  2Y8H A;  5DJU A;  3LIF A;  4OOM A;  2XF3 A;  4FTX A;  3B47 A;  2VEA A;  1E3U A;  2Y2H A;  4C3Q A;  3VSL A;  5CHM A;  3SW1 A;  1Z09 A;  4IUK A;  4LRY C;  3W2Z A;  2ZM2 A;  5E2H A;  5FQM A;  3EGX C;  2XRN A;  2DRW A;  4OOL A;  1N9B A;  4BEN A;  4IED A;  3S7N A;  1P9R A;  2ZOH A;  4N9K A;  5DJT A;  4B4Z A;  4S2N A;  3Q7Z A;  4XXR A;  1YLT A;  1K56 D;  4X69 A;  1KGG A;  3ZNY A;  1NRJ A;  5E2G A;  4LEN A;  3P09 A;  3G34 A;  4JGP A;  3FG8 A;  4LFU A;  4QD4 A;  4GN2 A;  2P9V B;  3EGD C;  5A93 A;  3HRE A;  3BM6 A;  1L2S A;  3C4P A;  3G2Z A;  3ZNT A;  4KZ5 A;  2XD5 A;  4GNU A;  1YM1 A;  4MN5 A;  2NUP C;  3SOI A;  5C5K A;  1CI9 A;  3GMW A;  3T1S A;  1SHV A;  4HBT A;  2AVX A;  4JBF A;  4BBV A;  2ZC7 A;  3T4L A;  1YLP A;  3V67 A;  2IWD A;  2EXB A;  4K91 A;  4Q0H A;  1ESI A;  4DRT A;  1H8M A;  5EEC A;  5HAQ A;  3IS2 B;  3C5A A;  4DDY A;  2W27 A;  4WF0 A;  2PYP A;  3V50 A;  4UQI M;  4QWO A;  1MXO A;  2E8J A;  1MWS A;  3TSG A;  1KVM A;  2J9P A;  4P85 A;  4QY5 A;  4F3L B;  1L3L A;  4KZ4 A;  4HP9 A;  1Y4O A;  2PBD P;  1CEG A;  3PAE A;  1IKI A;  1WYB A;  1XGJ A;  4JXV A;  4JPM A;  3M2K A;  4OPQ A;  4PM8 A;  1PZP A;  4ZAM A;  1BUE A;  2ZBB A;  4BL2 A;  1S4S A;  1FCM A;  3PHY A;  4KG6 A;  3QNB A;  2XLN A;  3CLO A;  1N9O A;  2I9V A;  4GKU A;  3LI8 A;  4YWZ A;  1LHY A;  2PD7 A;  3MFD A;  5HPF A;  3Q81 A;  2Y2M A;  4CLC C;  2ACG A;  3Q7V A;  1OT6 A;  5FI2 A;  5KIZ A;  1RP5 A;  1YKD A;  1GHM A;  5GLC A;  4ZJ3 A;  1DJA A;  3NUL A;  2QPN A;  3WS4 A;  1W5D A;  4HHD A;  3RXW A;  2XSS A;  1X0O A;  4A5R A;  3ITB A;  4DE2 A;  5GLA A;  3EQU A;  2P08 A;  5EOO A;  4DE3 A;  1ES2 A;  1GA9 A;  5EVI A;  1PW1 A;  3RFB A;  1E25 A;  3DAV A;  3LR0 A;  2G2U A;  4I3I A;  1W8Q A;  4PKY G;  3FC7 A;  3KX0 X;  4O8G A;  4EET B;  2ZC3 B;  3IF6 A;  2JKT I;  1LI0 A;  4DXB A;  2ZQD A;  2ZQ9 A;  3GVB A;  5FDS A;  1ES5 A;  3Q1F A;  5AVE A;  3ZVT A;  3G31 A;  2HGV A;  1DY6 A;  4KG2 A;  5AQA A;  1S1Z A;  1VM1 A;  1UWN X;  2WKH A;  5HWW A;  3A0S A;  5EM1 A;  2UWX A;  2JHE A;  4U0T A;  2E8I A;  4KEN B;  4QHC A;  2O9C A;  4MDZ A;  3E2L A;  1F2K A;  2HP5 A;  5FDH A;  1HTZ A;  4OPY A;  2QJ5 A;  2Y2J A;  3P01 A;  2Y2K A;  4GOG A;  2ZC5 B;  4R3B A;  5E43 A;  5FQQ A;  2CC1 A;  2B95 A;  2QZ6 A;  1HVB A;  5HAI A;  2Y2N A;  5CRF A;  3T4T A;  1ALQ A;  2W1R A;  4O0P A;  2D02 A;  4HIA A;  3E2K A;  4O01 A;  2J3T C;  4ZJ2 A;  2W3F A;  4EQI A;  4DE0 A;  2VJW A;  2YKH A;  3BEC A;  2PU2 A;  1SKO B;  1YAX A;  4WMC D;  2A2L A;  1G68 A;  3OCN A;  4Y13 A;  2ZQA A;  3NHQ A;  1W8Y A;  5LBR A;  4Q0I A;  2J7V A;  2WKI A;  3KYZ A;  4KZB A;  5MC7 A;  1K55 A;  1ZC2 A;  1AWI A;  2HDQ A;  1XA1 A;  3KSF A;  2OV5 A;  5CTN A;  2H10 A;  4E6X A;  2MJ6 A;  4OPZ A; 
#chains in the Genus database with same CATH homology
 4WLA A;  5DF9 A;  3EEA A;  4DJ3 A;  3G6O A;  3S7Q A;  4II7 A;  2HF6 A;  2Z6D A;  4I38 A;  3ZYT A;  3A0V A;  4H6J B;  3LUQ A;  2O9A A;  4PKY A;  4DJ2 A;  3IS2 A;  1D06 A;  3NOU C;  2W3H A;  4HH2 A;  1TS6 A;  1P9W A;  4QPR A;  1OPX A;  1TS0 A;  3MJQ A;  4LPZ A;  2VV7 A;  4EW7 A;  4EUV A;  2A24 B;  2QJ7 A;  3BJN A;  1LSW A;  3BQA A;  4L9E A;  5HDD A;  4KUK A;  3H82 A;  4F3L A;  3H7W A;  2KX6 A;  5G4Y A;  1V9Y A;  3EEH A;  1YSP A;  1NWZ A;  3EOI A;  1W63 Q;  4I5S A;  5A8B A;  1WA9 A;  5CX7 A;  3U2A A;  2FZ0 A;  3NOT C;  3BY8 A;  3IBJ A;  3LYX A;  5TJJ A;  3CUE C;  2PHY A;  3LI9 A;  4NKP A;  2GJ3 A;  2VGL S;  1S67 L;  3ULF A;  2VZW A;  4CLC A;  3LR4 A;  5L8M A;  2VV6 A;  5DFX A;  3D3O A;  1ODV A;  4EEU A;  2JKT M;  5HL6 A;  1S66 L;  3JVV A;  3JVU A;  5J7E A;  1XJ3 A;  1LSX A;  1D7E A;  1EW0 A;  3HJK A;  1XJ2 A;  3LIC A;  2V9A A;  2PD8 A;  1MKM A;  3S7O A;  3PXP A;  3BW6 A;  2EWW A;  2QKP A;  2HJE A;  4NEE D;  3E0Y A;  3GDI A;  3EQV A;  1P97 A;  1XJ6 A;  1N9L A;  2W3D A;  4KQO A;  1GSV A;  3UMD A;  3LID A;  2G7U A;  2JKR I;  4WN5 A;  3PR6 A;  3T50 A;  4UEY A;  4WUJ A;  3BWL A;  3RH8 B;  2KOI A;  2OWJ A;  2VA0 A;  4GLQ A;  3LR5 A;  2V1A A;  2XA7 M;  1LL8 A;  2V0W A;  3MMH A;  5DKK A;  5I5L A;  4CLC E;  2V1B A;  3RTY A;  2XRO A;  3VV4 A;  1IOU A;  1BYW A;  4HP4 A;  5HWT A;  2PYR A;  4R3A A;  4FSF A;  4H6J A;  4EES A;  1OT9 A;  1T1C A;  4DMZ A;  3BY9 A;  2L4R A;  4G3W A;  3HJI A;  4HQA A;  2IA2 A;  2L1M A;  5FL3 A;  4IJG A;  2W0N A;  4XT2 A;  2EA9 A;  4I39 A;  2W1T A;  2EWV A;  4KQD A;  2V0U A;  5F69 A;  4M4X A;  3T4K A;  2M7U A;  4HI4 A;  1UWP X;  3IBR A;  2JN7 A;  3MQ0 A;  3FPW A;  5AVF A;  4GS9 A;  3F1N B;  2YKF A;  2H28 A;  4LRX C;  1TS7 A;  4PHT A;  1S4R A;  2OOL A;  1OTA A;  4BJP A;  2P04 A;  3EWK A;  4NXE A;  2BAS A;  2Z6C A;  3MF0 A;  3H9W A;  4Y5F A;  1DP9 A;  3F1P A;  2VX8 A;  3UB6 A;  4I3J A;  4EER A;  4R6L A;  3TE8 A;  4JGR A;  2J3W A;  2WKP A;  4EU0 A;  4RQ9 A;  3A0R A;  2Y8H A;  3KSI A;  5DJU A;  2WKQ A;  3LIF A;  4OOM A;  3P7N A;  2K2N A;  5HD5 A;  3MQQ A;  3VE4 A;  3B47 A;  1TS8 A;  3C2W A;  3R7W B;  2VEA A;  3BQ8 A;  4ARZ B;  5TBM B;  3E98 A;  3UE3 A;  4KUO A;  3OBF A;  4R38 A;  2KLI A;  2W3G A;  3SW1 A;  1LSV A;  3CAX A;  5G4Z A;  3UB9 A;  4IUK A;  4LRY C;  3W2Z A;  1MZU A;  3LR3 A;  3EGX C;  2XRN A;  1OTI A;  3ICY A;  3MXQ A;  1XFQ A;  2PR5 A;  4OOL A;  1JNU A;  2B02 A;  1GSW A;  2O9B A;  3KO6 A;  5DKL A;  1F9I A;  4FOF A;  4IUH A;  3OOV A;  3S7N A;  1P9R A;  2ZOH A;  5DJT A;  2B18 A;  3E4P A;  2QHK A;  5IS1 A;  1P0Z A;  4L9G A;  5IT5 A;  4NXB A;  1NRJ A;  3T4J A;  3VE3 A;  4ETX A;  3B33 A;  3PYP A;  4ETZ A;  4JGP A;  5HD3 A;  3FG8 A;  3EGD C;  5KSH A;  1OTB A;  1Y28 A;  4HJ6 A;  3NOP C;  5HWV A;  1OTD A;  4MN5 A;  2NUP C;  3DBA A;  3F1O B;  3T4O A;  1OJ5 A;  3TJZ C;  4AFI A;  3MQO A;  4GHI A;  5C5K A;  1W63 M;  2ZMV A;  5HZH A;  1NLZ A;  4BBV A;  3D72 A;  4Y3I A;  2HJ9 C;  3KSH A;  3T4L A;  3O5Y A;  3R4K A;  3V67 A;  3CI6 A;  4Q0H A;  1VB6 A;  1H8M A;  3IS2 B;  3PBO A;  2PT7 A;  3GEC A;  2W27 A;  5F6A A;  4WF0 A;  2PYP A;  4JGO A;  4UQI M;  3OLO A;  1G6O A;  1T1A A;  4NXG A;  2JKR M;  4HY8 A;  4LRZ E;  2LB9 A;  3LIB A;  4YNR A;  2XA7 S;  3H82 B;  4P6Z M;  4F3L B;  3LIA A;  4R70 A;  2VKS A;  3H7W B;  5F5Y A;  4HP9 A;  3UE6 A;  2VV8 A;  2M1C A;  1UGU A;  2A24 A;  3C38 A;  5AJG A;  5J4E A;  1T1B A;  1XFN A;  2M7V A;  5HPI A;  2ZBB A;  1VHM A;  4HNB A;  1S4S A;  2Y79 A;  3PHY A;  2QYB A;  3CWF A;  1H3Q A;  4EEP A;  1N9N A;  1OJG A;  2J80 A;  1V9Z A;  2ZMF A;  2HV1 A;  3CUE A;  2P7J A;  1N9O A;  3CLO A;  3K2N A;  4CLC B;  2OAQ 1;  2I9V A;  4NXF A;  3LI8 A;  3E4O A;  4YWZ A;  3OC2 A;  3NJA A;  2PD7 A;  5HPF A;  4CLC C;  3K3C A;  2J3T D;  1DP8 A;  1IFQ A;  2OWH A;  4E04 A;  1OT6 A;  2GX5 A;  1GSX A;  3PBS A;  5KIZ A;  4I3A A;  4ZRR A;  4CLC D;  2D01 A;  3PBN A;  4HH3 A;  1YKD A;  3FPV A;  4B9O A;  4HJ4 A;  2KDK A;  4B93 A;  4WEK A;  3F1O A;  1YSQ A;  4BBU A;  4HHD A;  3PBT A;  2XSS A;  2OAP 1;  1X0O A;  3CIT A;  4GJ4 A;  5HSQ A;  2GNX A;  2QWS A;  3KSG A;  3EQU A;  2P08 A;  4GCZ A;  4Y2F A;  2LB5 A;  4JGQ A;  5IU1 A;  3VOL A;  2PDR A;  4G3K A;  4HOI A;  2R78 A;  4XT2 B;  2L0W A;  2W1T B;  3RFB A;  3K3D A;  1STZ A;  1TF1 A;  1F5M A;  3LR0 A;  2O99 A;  1TD5 A;  3LIE A;  2GZA A;  4I3I A;  4GW9 A;  1OTE A;  4PKY G;  4GS9 B;  3FC7 A;  2VGL M;  3KX0 X;  4O8G A;  4BWI A;  4EQ1 A;  2K31 A;  4K08 A;  4EET B;  1T19 A;  2JKT I;  1XJ4 A;  2VLG A;  4WEJ A;  3F1N A;  4WEL A;  4BBT A;  1ZTU A;  5AVE A;  3F1P B;  2HGV A;  1S1Z A;  4G3V A;  2ZOI A;  1UWN X;  3UB7 A;  5HWW A;  3A0S A;  3TRC A;  2JHE A;  2DMW A;  5J3W A;  2O9C A;  4MDZ A;  4MMN A;  1DP6 A;  2QJ5 A;  3P01 A;  1DRM A;  1NLY A;  4MN6 A;  4DN0 A;  3R7W A;  4ARZ A;  5TBM A;  4YOF A;  3UME A;  1G28 A;  4HJ3 A;  1T18 A;  3C8C A;  3S7P A;  5F68 A;  4BMW A;  4L9F A;  4IHQ A;  5HDS A;  1MC0 A;  4WL9 A;  4Q0J A;  3T4T A;  3C30 A;  2W3E A;  2W1R A;  2D02 A;  4HIA A;  4O0P A;  4MCW A;  4UQI S;  2NUT C;  3B42 A;  4Z1W A;  4O01 A;  3T4Q A;  2J3T C;  3LFV A;  2PR6 A;  3MFX A;  4L0L A;  4P6Z S;  3T4S A;  2CMN A;  2W3F A;  4LLO B;  3OCL A;  3PBR A;  2VJW A;  1S1Y A;  1ZHH B;  2YKH A;  2FH5 A;  3UB8 A;  1YAX A;  2A2L A;  4PAU A;  2K7S A;  2O0Y A;  3OCN A;  3TW8 A;  3HCY A;  5EFW A;  3E4Q A;  3NHQ A;  3ZQ5 A;  5LBR A;  4Q0I A;  5HDC A;  4CQH A;  5K5B A;  4ME4 A;  3KYZ A;  5MC7 A;  1LT0 A;  2WKR A;  3MR0 A;  1F98 A;  4GHI B;  3PBQ A;  4EXO A;  3KSF A;  5DFY A;  3KYQ A;  1KOU A;  2MJ6 A;  2INW A;  4MN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...