4WN5A

Crystal structure of the c-terminal per-arnt-sim (pasb) of human hif-3alpha9 bound to 18:1-1-monoacylglycerol
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
108
Chain Sequence
HMGRGAFLSRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSKGQAVTGQYRFLARSGGYLWTQTQATVVSGRGPQSESIVCVHFLISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypoxia-inducible factor 3-alpha
publication title Unsaturated fatty acids as high-affinity ligands of the C-terminal Per-ARNT-Sim domain from the Hypoxia-inducible factor 3alpha
doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 30
structure length 108
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4wn5A00
3PYPA 4WLAA 4HJ4A 2PD7A 1EW0A 2L1MA 1T1CA 5HDDA 1XJ3A 4WUJA 1F98A 4I3IA 2QHKA 4HHDA 5HDSA 3A0RA 5IS1A 5AVEA 2P7JA 4EXOA 3ULFA 4WF0A 3KX0X 3BWLA 2ZOIA 4BBUA 2QJ5A 4MN6A 4BBVA 2GJ3A 1BYWA 2V0UA 3G6OA 2OOLA 4HH2A 3T50A 4WL9A 1DP6A 3H82A 5HWTA 1TS6A 3UB7A 5HWVA 1S4SA 4PKYA 2PR5A 2VV8A 3FG8A 3HJKA 3UMDA 2OWHA 1T1AA 3K3DA 3UB9A 3EWKA 2Z6DA 1LSVA 4KUOA 1D06A 2PD8A 1N9LA 2VLGA 5HWWA 4XT2B 3F1OB 4B9OA 2CMNA 3BY8A 5IU1A 2PYRA 1S1ZA 4GHIB 3NJAA 3CAXA 4I38A 1XFNA 3LI9A 2VV7A 4DJ3A 3LIAA 2WKPA 1X0OA 2ZOHA 3MJQA 1GSWA 5I5LA 1TS0A 2OWJA 4GW9A 3FC7A 4EW7A 1OJ5A 1LL8A 3K3CA 4L9EA 4GS9B 2KDKA 3MQOA 3IS2B 4R3AA 1UWNX 3H7WB 4JGQA 4M4XA 4WN5A 2INWA 3F1NB 2A24B 3A0VA 3UMEA 1DP8A 1GSVA 4EQ1A 4H6JB 1XJ2A 4HH3A 3B33A 3NOUC 4E04A 1NWZA 3LUQA 1OTEA 5F69A 2JN7A 3E4QA 4MN5A 1WA9A 3NHQA 4KUKA 3BY9A 1GSXA 2ZBBA 5DJUA 3GDIA 5HD5A 4L9GA 4HJ6A 1DP9A 5HSQA 2KX6A 1D7EA 5HD3A 3SW1A 5G4ZA 3ZQ5A 1OTBA 2YKFA 1UWPX 4HNBA 4LLOB 2VEAA 3HJIA 1P0ZA 2M1CA 3D72A 2V9AA 3F1PB 5DJTA 4F3LB 4XT2A 3F1OA 5DKLA 5HDCA 5F5YA 3GECA 4L9FA 3C8CA 4HI4A 1LT0A 2K7SA 1ODVA 5F6AA 3IBRA 3ICYA 2WKQA 4GHIA 1OTIA 1XJ6A 3CLOA 3MFXA 4HOIA 1OT6A 4JGPA 1V9ZA 4HP9A 3VE4A 3PHYA 4BBTA 3RTYA 4HJ3A 2PHYA 4HIAA 1LSWA 4LRXC 4NXEA 3E4PA 2V0WA 4LRYC 4YWZA 1G28A 4GS9A 2L4RA 3IS2A 3MQQA 2QKPA 3H7WA 4NXFA 1OT9A 5EFWA 3EEHA 3F1NA 3LI8A 2A24A 1S67L 3LICA 4LPZA 1KOUA 3MR0A 4H6JA 4I3JA 4EEUA 4JGOA 2QWSA 4RQ9A 3RH8B 2HV1A 5TBMB 3LIDA 3NOTC 4HQAA 5J7EA 3LIEA 5A8BA 1V9YA 1VB6A 3H9WA 1XFQA 2VV6A 3LYXA 5J4EA 2I9VA 2WKRA 4R38A 2YKHA 3MXQA 2PYPA 3NOPC 4I39A 3UE6A 3VOLA 2D01A 5J3WA 1S1YA 1S66L 1OTAA 3UB8A 2R78A 3CWFA 1T19A 1TS8A 3F1PA 4F3LA 1OJGA 2W27A 1DRMA 2H28A 3LIBA 5F68A 3H82B 4NXGA 1Y28A 2PR6A 4EESA 3E4OA 1P97A 4HY8A 4K08A 2PDRA 2V1BA 2V1AA 1TS7A 4EEPA 5HZHA 2J80A 1OTDA 5DKKA 3OLOA 4DJ2A 3P7NA 1MZUA 4I5SA 2JHEA 3VE3A 3A0SA 5G4YA 2Z6CA 5KIZA 4R6LA 1F9IA 4JGRA 1LSXA 2D02A 1T18A 1N9NA 4R70A 3C2WA 1JNUA 1S4RA 4HP4A 1XJ4A 2QJ7A 1T1BA 2W0NA 1UGUA 3UB6A 4EETB 2BASA 4NXBA 4GCZA 4EERA 2L0WA 4PKYG 4KQDA 3LIFA 2EA9A 5TBMA 1N9OA 4LRZE 4I3AA 2B02A 5AVFA
chains in the Genus database with same CATH superfamily
3IXGA 3PYPA 4BLMA 4WLAA 4Y13A 3NDGA 1EW0A 1T1CA 3CI6A 3BRMA 4WUJA 1F98A 3FPWA 2QHKA 5HFOA 3DBAA 3V5MA 2ZJ9A 1BSGA 3AGEA 3LR3A 2GZAA 5HL1A 5CGSA 1TVFA 1NZOA 3G6OA 4ZJ3A 3T50A 4C3QA 3Q7VB 4WL9A 1W63M 4JLFA 2Y2NA 3H82A 3MMHA 3CPTA 4GD6A 3UB7A 2VV8A 4U3TA 5LBRA 2I72A 2OLUA 3NI9A 2X01A 5F82A 4BQMA 2EX9A 4DXBA 2AVXA 1LSVA 1YMSA 3MQ0A 1YLYA 3ZDJA 1D06A 5DF9A 3DW0A 1D1JA 2H0YA 5HWWA 4XT2B 3UDFA 3F1OB 3UB5P 1CEGA 2EX2A 3IHBA 4ME4A 1U60A 2HJ9C 4PM7A 1ES5A 4E3LA 5GLBA 3S1YA 2V20A 1PI4A 2JC7A 4KZ3A 5EVIB 5HARA 4GHIB 4DN0A 4JKTA 2JKFA 2WYXA 4N92A 1XFNA 3LI9A 4DJ3A 4KG2A 5KZHA 3N4IA 3O87A 4E3MA 1TF1A 4ARZA 2EFXA 2BTFP 1H8YA 4EW7A 1RP5A 1OJ5A 1LL8A 3E2LA 2UV0E 4WEKA 3IS2B 4R3AA 1SDNA 5CEBA 1YLWA 3PBSA 3QP6A 1JTGA 3UPOA 1HLUP 2WAEA 1N9BA 2XA7S 4OVDA 3ZG5A 3A3FA 4WN5A 3AGFA 3IQAA 3A0VA 1MWUA 5CEDA 5FQIA 1GSVA 5E2GA 3NOUC 4LCLA 2W3GA 4WELA 1NWZA 1STZA 5F69A 1GA0A 3A3IA 4KZ7A 4YOFA 3DTMA 2VZWA 5FEFA 1F5MA 5GLAA 4ZJ1A 1XKZA 2ZBBA 4K0WA 2P74A 3GDIA 3Q7VA 1PI5A 4ZJ2A 1YLJA 3L7HA 3S7OA 3OPRA 3ZVWA 1XGJA 5FQQA 4MN7A 4Y0UA 4X1MA 3T4OA 3W2ZA 4WBGA 2KX6A 5AQ7A 2XD5A 5G4ZA 4HNBA 3U4LP 2OSUA 3NIAA 3V39A 4LLOB 1LL5A 1L0FA 4S2MA 4UHUA 2V9AA 1ACFA 3MZFA 4XT2A 3F1OA 4EQIA 3GECA 3GMWA 1XXMA 3C8CA 2HDRA 3G2YA 3G4PA 3VMAA 4O01A 1ODVA 3IBRA 5EVIA 1O07A 3OCLA 4OOMA 2WKQA 4GHIA 3O86A 3DAVA 3LEQA 4N9LA 3IX8A 4OOLA 4RX3A 3BM6A 2WKHA 3CLOA 1K55A 4IJGA 4BD0A 3CITA 2W3FA 4FUWA 4GDBA 4HJ3A 2PHYA 4LRXC 4NK3A 5EOEA 1MXOA 3M6BA 4LRYC 1P9WA 4JXGA 4YWZA 1G28A 5KMWA 3IS2A 3MQQA 2XK1A 3M6HA 3HLDA 5AQBA 4Y2FA 3LO7A 3LI8A 1K57C 4MEZA 3LICA 4LPZA 3GTCA 2VJWA 4XXRA 2G7UA 1QMFA 1BTLA 4DKIA 2QWSA 5EECA 3EOIA 1Z6FA 3DTIA 3RH8B 4Q0HA 1YAXA 3LIEA 5A8BA 2B18A 4X6TA 3SH7A 2ZQCA 1SKFA 1IYOA 3S4XA 5J4EA 1YLZA 4S2KA 4C75A 4R38A 3NECA 3ZG7B 2EX8A 2ZQAA 5FQMA 5FAQA 2D01A 5J3WA 1S1YA 2XDMA 1OTAA 1ES3A 3VP3A 2R78A 1KGFA 3QP1A 2QYBA 1BT5A 3PBRA 1PYYA 5AJGA 2WADA 5HAIA 1BLHA 2WUQA 2H28A 4RYEA 3ZG9B 1SDEA 3CJMA 2EXAA 1FCNA 3OPLA 1Y28A 2Y2GA 1JVJA 3T1RA 3BLMA 1W8QA 4EESA 3WS1A 2C5WB 3OPPA 1MWRA 1PZOA 5A93A 4EEPA 5HZHA 2W3EA 3T4LA 3T1XA 4Y15A 1NLYA 3GV9A 4OPRA 1SKOB 4EBLA 5JYOA 4GJ4A 3P7NA 1VETB 1K4FA 3MS6A 2PBYA 2X02A 2Y2QA 2ZQDA 3A0SA 4OPQA 2Y8HA 3N8RA 5E43A 2H0TA 1T18A 1N9NA 1DY6A 2WZXA 5EOOA 3SH9A 2WGWB 5FI7A 4GN2A 5DFYA 1S4RA 1DJAA 3ITBA 1ESUA 3EGDC 3IXHA 3KYQA 2W0NA 1UGUA 3BFDA 4NXBA 4LCMA 3BFCA 2WGVA 1WYBA 2NUPC 4EERA 1LI9A 4WMCA 4U0XA 3IT9A 1N9OA 4IUHA 3MF0A 1LI0A 4GZBA 2FFFB 2PD7A 3ZNYA 2EXBA 5HDDA 2VK3A 4JF4A 3N8LA 3MBZA 4I3IA 5HDSA 4MDZA 4B4ZA 5CHUA 1CI9A 3RJUA 3WS4A 4ZTKA 4WF0A 4ZRRA 3ZCZA 4MN6A 4P87A 4DF6A 3I7JA 2XSSA 2KLIA 1YLPA 2Y4AA 3QP5A 4KG5A 3G2ZA 4XUXA 4BBVA 4GB7A 3NBLA 1IKGA 5F83A 2ZMFA 3IWIA 4R4RA 3B3XA 1OPXA 4WZ5C 5HWTA 2JKRI 4LV1A 4R3JA 4E6WA 5HWVA 1ZG6A 4ETZA 3FG8A 1K54C 2OWHA 1T1AA 3N7WA 4E3IA 1ZHHB 3RXXA 4OQHA 4KUOA 2Y2MA 1YSQA 3DTKA 1NZUA 3GSGA 4N1HA 3VOZA 5HAQA 2V1ZA 3GR2A 1IELA 2PD8A 5EUAA 3LR4A 5KSCA 3PAEA 3T4TA 3DWZA 1SKOA 4P85A 2CMNA 3OZHA 1H8MA 4X56A 1VETA 4Y3IA 3BFFA 1S1ZA 1NYYA 1ZC2A 3EEAA 4NEED 4KZAA 4P6BA 1MWSA 3JPUA 2Y2IA 2WGWA 1IYQA 1BUEA 2VX8A 1E25A 3LIAA 3TSGA 1G5UA 4LFUA 4X53A 1YMXA 3MJQA 1GSWA 1TS0A 2OWJA 2JKRM 5DF7A 3FC7A 3D4FA 5HX9A 4L9EA 4MBKA 4GS9B 2KDKA 3MQOA 2H5SA 3BLSA 3UE3A 3R4KA 2ZC4B 3UY6A 3S7NA 3OPHA 2INWA 5EM1A 2QMIA 2A24B 1W7FA 4GKUA 5HPIA 3C4OA 4MLLA 1H0MA 3VOYA 4HH3A 4ZDXA 3B33A 4FH4A 3B47A 4B4XA 3MZDA 5DTKA 5FDHA 3BY9A 2ACGA 4PM5A 1YPRA 1ES4A 3ZG0A 2OAQ1 5A92A 1I2WA 2VGJA 5U47A 3HLBA 5FQKA 1DP9A 3UPPA 3IF6C 2J8YA 1D7EA 2WKIA 3SW1A 1G6OA 1OTBA 2YKFA 4BJPA 1C3BA 4E6XA 2VEAA 4DXCA 2IWCA 1TD5A 1P0ZA 3TG9A 3D72A 5FEGA 2R9XA 2Y59A 5DJTA 3UN7A 4DE3A 5HDCA 5IT5A 5FI2A 1XGIA 2GX5A 3QP2A 2K7SA 3HUOA 3VP2A 2RCXA 3SZTA 5I94A 3VFHA 2G2WA 2XFTA 3PBQA 5HAPA 1XJ6A 3IHAA 5AQAA 1E3UA 3MFXA 1BULA 5DF8A 1Q2PA 1OT6A 4FD8A 5IHVA 2Y2PA 2XGNA 3G31A 3PHYA 5TGFA 4UA9A 3LY3A 1ERQA 3JVUA 3LR0A 1XA7A 3EQUA 3SS4A 2A49A 2V0WA 3ZGAB 2V8FA 3DTEA 1DJCA 4GS9A 2L4RA 1MWTA 4DMZA 3PBNA 3QP4A 4UAAA 1FOFA 4JF5A 5EFWA 1K56A 1G6AA 4G3VA 5BOHA 4JF6A 5FAOA 4X55A 5TFQA 2A24A 1GHIA 4QHCA 1S67L 2HDQA 4HBTA 3M2KA 4FSFA 1W8YA 2ZC7A 3WRTA 5EVLA 1KE3A 1AXBA 4EEUA 1GA9A 3WRZA 4RQ9A 5CXWA 4IBRA 1CK3A 3NOTC 3T4QA 2J7VA 1VB6A 3HLCA 4P6ZM 3O5YA 1FR6A 1K38A 5F1GA 3O3VA 1HZOA 3WS0A 3OOVA 2B5RA 2PYPA 3K2NA 4I39A 3VOLA 3IXDA 3CMZA 1L0EA 4OKPA 5JYPA 3N8SA 4Q8IA 3GRJA 3S22A 3A3JA 4UA6A 1I5QA 3EQVA 1M40A 2IA2A 4D2OA 2PR6A 3PR6A 1LL9A 3O88A 3LEZA 3E4OA 4FTXA 4O7DA 4G3WA 5CERA 4JXSA 5F1FA 3UE0A 3UO9A 4K08A 2HDSA 1XPBA 5DTSA 2ZC6B 3T1QB 2J80A 4OLGA 4KQOA 1PWGA 4X25A 3RXWA 4DJ2A 1L2SA 1MBLA 4EBNA 4OQGA 2Q0OA 3W4QA 1MZUA 4I5SA 3R7WB 3VE3A 5G4YA 3KYZA 2Y2OA 4IVIA 5KIZA 4OP8A 4R6LA 1PW1A 1LSXA 3CUEC 4IEDA 1KE4A 4WZ4A 4JPMA 4HP4A 1HTZA 2HP9A 4A5RA 1XJ4A 2PU2A 3DWKA 4ID4A 3UB6A 4EETB 1ALQA 3Q81A 2EFUA 2HZ5A 2XR0A 3LFVA 4WEJA 4KQDA 3HCYA 4OOYA 2ZQ8A 2EA9A 4IBXA 2Y2KA 4LRZE 4S2NA 5HL6A 2J9OA 5AVFA 2B95A 3T4KA 4Y5FA 5GLCA 3JVVA 2P9VB 4R3BA 1FIKA 1XJ3A 4EBPA 5GL9A 3PBOA 3KO6A 3TOIA 2P7JA 2W3HA 4P6ZS 4KG6A 3BEBA 4Q0JA 5EPHA 3KX0X 4R23A 5CTNA 2ZOIA 4X69A 4BBUA 1ERMA 4GOGA 4S2IA 3GVBA 2V0UA 2OOLA 4HH2A 1QMEA 3WS2A 1K55C 1DJBA 3M2JA 3UDIA 1GCEA 1S4SA 2V8CA 2ZM8A 3UMDA 4OLDA 1YM1A 4R4SA 5L2FA 5GHYA 3EWKA 2JCHA 4JXVA 1PFLA 5L8MA 3MFDA 4MBFA 3BQAA 3C7VA 2JE5A 1N9LA 3VP0A 4OH0A 2VLGA 4EV4A 4QJGA 5CRFA 3ZVTA 1MKIA 3ITAA 4BWIA 2Y91A 3NC8A 5CGWA 2WKEA 3FYZA 1A0KA 4KZ9A 5C5KA 2MJ6A 3KSGA 5E2FA 5CHMA 4DE0A 3R7WA 3Q82A 3U2AA 1K6SA 5FAPA 2BG1A 1EI5A 4E3NA 4B88A 2OAP1 4I38A 2HJEA 4KZ4A 2VV7A 3HUNA 4QD4A 4P0MA 3LY4A 3BECA 1IEMA 4Y0TA 2ZLYA 4KZBA 2BLSA 1YQSA 4IUKA 4EUZA 3VP4A 1NRJA 3K3CA 4S2PA 1NYMA 5EVEA 4CJNA 5FQ9A 1UWNX 4CLCD 3V67A 3H7WB 2P9VA 4JGQA 4M4XA 4AFIA 4M3KA 4ZAMA 3F1NB 4QWOA 4NG2A 4R0QA 2KOIA 3FZCA 4H6JB 1XJ2A 4KENB 4YFMA 1NRFA 5FI6A 3SS3A 3NULA 2VGLM 2W1TB 2Z2LB 4WM9A 2XQZA 4WMCD 1GHPA 2M7UA 2Q9NA 4KQRA 4DRTA 3FKVA 5HD5A 4OQIA 3MKFA 2Y79A 2DCFA 5GLDA 1XP4A 5HD3A 1FSWA 1F2KA 2P04A 2ZC3B 3C38A 5M19A 3VP1A 2XF3A 4DDSA 4CLCC 2PRFA 5L09A 4NKPA 3D3OA 3F1PB 3C30A 3D9YA 1WE4A 4O8GA 4F3LB 4E3KA 5DKLA 5CX7A 1S6RA 3MXRA 4L9FA 1WYCA 2E8IA 3PAGA 3P09A 3UNWA 1MKMA 1JWPA 4JBFA 3IH9A 5AQ9A 3LR5A 1CI8A 1ZTUA 2GNXA 4Y0OA 2J9PA 1EWZA 3IXBA 1IKIA 4HOIA 4JGPA 1JWVA 1V9ZA 4II7A 4LENA 4Z1WA 3P98A 4BD1A 5MC7A 1LHYA 2M7VA 4RVAA 4BENA 4BBTA 3RTYA 1ZKJA 1RGYA 2ZL1B 1LSWA 4NXEA 3E4PA 2WGIA 1FCMA 2WAFA 1PZPA 4EWFA 4IVKA 1IFQA 2Y2HA 3Q7ZA 4KZ8A 1ESIA 2O99A 3EGXC 4QPRA 3TJZC 3C7UA 2XLNA 2QKPA 2W3DA 4U0TA 1CJFA 3H7WA 1LLBA 4NXFA 3EEHA 4QY5A 2XFSA 3F1NA 2W1RA 2ZMAA 2RL3A 1AWIA 4ARZB 1K0KA 1KOUA 3MR0A 4I3JA 4H6JA 3OCNA 3RFBA 1L0DA 3MZEA 2ZQ9A 2WZZA 5EE8A 5TBMB 5FASA 2W1TA 3ZYTA 2VKSA 5J7EA 3V50A 5M1AA 3LGOA 3H9WA 3IX3A 4PM9A 5DFXA 3B42A 2I9VA 2WKRA 4N1XA 4L0LA 2VGLS 3VSLA 4K91A 1KDSA 3MXQA 1YT4A 4R1GA 2VA0A 4FH2A 2XH9A 5A91A 1Y54A 5EM0A 4DE2A 3KSIA 3UPNA 3VV4A 1M6KA 1S66L 3BFGA 3UB8A 1FQGA 4OP5A 1T19A 3T4SA 1TS8A 1OMEA 3IWOA 3F1PA 1RGZA 1HD8A 1XX2A 4F3LA 2W27A 1DRMA 2IWBA 1L3LA 5F68A 1SZVA 1VHMA 4S2JA 3TE8A 3AGDA 5L10A 3IX4A 1ONHA 4KQQA 2FH5A 3QP8A 5K5BA 3HREA 4IHQA 2J3TD 3IWQA 4DDYA 2PDRA 4MMNA 1BZAA 5FDSA 4QB8A 1TS7A 3HUMA 3VFFA 1OTDA 1JTDA 5GHXA 3ZFZA 5DKKA 4FCFA 2V2FF 2ZL1A 3WS5A 3HLGA 1W79A 3CG5A 3TRCA 3W8KA 1SCWA 2Z2MB 2H10A 1CQAA 3NCKA 4HBUA 2JHEA 2HDUA 4Y7PA 4OPZA 1F9IA 3SH8A 3A3DA 3BYDA 4JGRA 2D02A 3W4PA 2K2NA 4R70A 3C2WA 3G30A 2WK0A 3QNBA 1JNUA 1E3UD 1O7EA 2QJ7A 3HVFA 5DVAA 4YNRA 2ZC5B 4GCZA 5HPFA 2PAVP 4GDNA 3SOIA 5CGXA 5A90A 5TBMA 1L0GA 2EX6A 2J3TC 3UDXA 4KZ6A 2X71A 3HL9A 2HPBA 4HJ4A 4BMWA 3IF5A 2L1MA 1K4EA 4LV0A 3ZHHA 3OC2A 4HHDA 1K56D 3A0RA 1J3WA 5AVEA 5CECA 5IS1A 4UEYA 4EXOA 3ULFA 3CUEA 3G34A 4OONA 1NY0A 4LV2A 2J3WA 3BWLA 3E0YA 5CHJA 2QJ5A 1ONGA 4UQIM 2Y2JA 2K31A 1SHVA 2GJ3A 1BYWA 1K57A 4Z9QA 4F94A 3QHYA 1DP6A 4LGWA 4RA7A 4D60A 2ZM2A 1TS6A 1Z09A 3FV7A 2P08A 3BJNA 4PKYA 5L07A 1S0WA 2PR5A 3HJKA 4ZBEA 2DRWA 3K3DA 4BL3A 3UB9A 4DE1A 5E2EA 2Z6DA 4HEFA 1YLTA 2A3UA 3HBRA 4B9OA 2HGVA 3MSHA 3BY8A 5IU1A 4B93A 2XRNA 2C6WB 2PYRA 3CHWP 1CEFA 1JWZA 3QNCA 4EUVA 3FWLA 1IOUA 3C4PA 3NJAA 5E2HA 2DNSA 3CAXA 1NJ4A 5EVID 4ESPA 3VSKA 2JKGA 2EWVA 4MNRA 2XEPA 3LCEA 5GHZA 4MBHA 1YKDA 2WKPA 1X0OA 2R9WA 2ZOHA 5I5LA 2JKTI 1FILA 4GNUA 2HP6A 4GW9A 1TEMA 3A3EA 3N6IA 4CLCB 1KDWA 3T4JA 4FOFA 4PHTA 5EV0A 1NXYA 4BL2A 2E8JA 1GHMA 3UMEA 4CLCE 1DP8A 1MPLA 4EQ1A 2OV5A 1HVBA 1VEUB 4E04A 3LUQA 1OTEA 2HP5A 2JN7A 3E4QA 2EWWA 4MN5A 4S2OA 1WA9A 3NHQA 2QZ6A 4KUKA 4OPYA 5G18A 1K25A 1GSXA 1TDLA 5EVIC 3IH8A 5DJUA 2CC1A 2JBFA 2XROA 4L9GA 2UWXA 2ZMVA 3E98A 2XD1A 4HJ6A 4UQIS 4E3OA 4LV3A 5HSQA 2JKTM 4KZ5A 1ZG4A 4X1LA 1P9RA 3ZQ5A 5DTTA 5D3OA 1UWPX 1XA1A 1IYPA 2O9CA 1I2SA 3HJIA 2GDNA 3V3RA 1FCOA 3S7PA 2M1CA 4X68A 5FATA 3HLEA 5F5YA 3GQZA 2Y2LA 3FPVA 1N4OA 4GD8A 2IWDA 1ES2A 4HI4A 3KYEA 5FA7A 4NETA 1LT0A 1PWCA 2G2UA 5F6AA 1H8ZA 3ICYA 1W5DA 3NDEA 1G68A 1OTIA 3V3SA 3E2KA 4WZ5A 4S2LA 3ISGA 4S2NC 4PMAA 3Q1FA 4HP9A 1KE0A 3IF6B 1RCJA 3VE4A 1CF0A 1FR1A 1BLSA 1K54A 4PM6A 4HIAA 3UE1A 4Q0IA 2OLVA 4C6YA 3KSHA 4UA7A 4CLCA 1PNEA 1PW8A 5KSHA 1KVMA 3W4OA 1OT9A 1VM1A 4YINA 4CPKA 5FL3A 1BLPA 5CTMA 2O9AA 3PXPA 1VEUA 2ZD8A 3T12B 2VGKA 4CQHA 4JGOA 1EROA 2HV1A 3T1SA 4OQ0A 1BLCA 3LIDA 4HQAA 4PAUA 1MC0A 1V9YA 1NLZA 2ZM0A 1KGGA 1XFQA 2VV6A 5FSRA 3LYXA 2HF6A 4E3JA 2NUTC 2YKHA 2ZQ7A 5TR7A 3NOPC 3UE6A 3OBFA 2A2LA 3NY4A 3PTEA 5J8XA 1VQQA 1KGEA 4RX2A 3CWFA 4EU0A 2PU4A 4O0PA 3BW6A 3WWXA 1OJGA 3MXSA 3KSFA 3LIBA 4JXWA 3C5AA 3H82B 4NXGA 3CPTB 1H5XA 3ZNTA 1Q2QA 3IBJA 5FQJA 4K0XA 2DMWA 3G35A 4HESA 3JYIA 1P97A 4HY8A 1PWDA 2LB5A 5TJJA 1MY8A 2V1BA 2V1AA 1H3QA 4MCWA 2O0YA 3ZG8B 5HW3A 4PM8A 3G32A 3IF6A 1K6RA 4QY6A 3HLWA 1W63Q 3OLOA 4WYYA 3Q07A 2PT7A 2O9BA 4XUZA 2Z6CA 3S7QA 1PIOA 2FFYA 3CZDA 4N9KA 4G3KA 5M18A 1FSYA 1YSPA 3P01A 1Y4OA 2PBDP 4PPRA 2FZ0A 1J9MA 1T1BA 4Y17A 2BASA 4H8RA 2QPNA 3BFEA 1E4DA 1PRQA 2LB9A 1TDGA 1IYSA 2L0WA 2XA7M 4PKYG 3FKWA 3TW8A 2Y55A 3LIFA 3HLFA 3PBTA 4QU3A 2Q9MA 3BQ8A 4ETXA 1KVLA 4GLQA 3SS5A 3MKEA 3L9KA 4I3AA 2B02A
chains in the Genus database with same CATH topology
3T4KA 4Y5FA 3PYPA 4WLAA 3JVVA 4HJ4A 4BMWA 2PD7A 1EW0A 2L1MA 1T1CA 3CI6A 5HDDA 1XJ3A 4WUJA 1F98A 3FPWA 4I3IA 2QHKA 3OC2A 4HHDA 3PBOA 3KO6A 5HDSA 3A0RA 5IS1A 5AVEA 3DBAA 2P7JA 4MDZA 4UEYA 2W3HA 4P6ZS 4Q0JA 4EXOA 3ULFA 3CUEA 4WF0A 3KX0X 4ZRRA 2J3WA 3BWLA 3E0YA 2ZOIA 3LR3A 4BBUA 2QJ5A 4MN6A 2XSSA 2KLIA 4UQIM 2GZAA 2K31A 4BBVA 2GJ3A 1BYWA 2V0UA 3G6OA 2ZMFA 2OOLA 4HH2A 3T50A 4WL9A 1OPXA 1DP6A 1W63M 3H82A 5HWTA 3MMHA 1TS6A 2JKRI 2P08A 3UB7A 3BJNA 5HWVA 1S4SA 4PKYA 2PR5A 2VV8A 4ETZA 3FG8A 3HJKA 5LBRA 3UMDA 2OWHA 1T1AA 3K3DA 3UB9A 1ZHHB 3EWKA 2Z6DA 1LSVA 4KUOA 1YSQA 3MQ0A 1D06A 5DF9A 5L8MA 2PD8A 3BQAA 1N9LA 3LR4A 2VLGA 5HWWA 4XT2B 3T4TA 3F1OB 4B9OA 2CMNA 1H8MA 4ME4A 4BWIA 2HGVA 2HJ9C 3BY8A 5IU1A 4Y3IA 4B93A 2XRNA 5C5KA 2MJ6A 3KSGA 2PYRA 3R7WA 1S1ZA 3EEAA 4EUVA 4GHIB 4NEED 3U2AA 1IOUA 3NJAA 4DN0A 3CAXA 2OAP1 4I38A 2HJEA 1XFNA 3LI9A 2VV7A 4DJ3A 2VX8A 2EWVA 3LIAA 1YKDA 2WKPA 1X0OA 1TF1A 2ZOHA 3MJQA 1GSWA 5I5LA 2JKTI 1TS0A 2OWJA 4ARZA 2JKRM 4GW9A 3FC7A 4EW7A 4CLCB 4IUKA 3T4JA 1OJ5A 1LL8A 4FOFA 1NRJA 4PHTA 3K3CA 4L9EA 4GS9B 2KDKA 4WEKA 3MQOA 3IS2B 4R3AA 1UWNX 3PBSA 4CLCD 3V67A 3H7WB 3UE3A 4JGQA 3R4KA 4M4XA 2XA7S 4AFIA 4WN5A 3S7NA 2INWA 3F1NB 2A24B 3A0VA 3UMEA 2KOIA 4CLCE 1DP8A 5HPIA 1GSVA 4EQ1A 4H6JB 1XJ2A 4HH3A 3B33A 3NOUC 4E04A 2W3GA 4WELA 1NWZA 3LUQA 1OTEA 1STZA 5F69A 2JN7A 3E4QA 3B47A 2EWWA 4YOFA 4MN5A 1WA9A 2VZWA 3NHQA 4KUKA 2VGLM 2W1TB 3BY9A 1F5MA 1GSXA 2ZBBA 2M7UA 5DJUA 2OAQ1 3GDIA 5HD5A 2XROA 4L9GA 2Y79A 2ZMVA 3E98A 3S7OA 4HJ6A 1DP9A 4MN7A 4UQIS 3T4OA 3W2ZA 5HSQA 2KX6A 1D7EA 5HD3A 2JKTM 3SW1A 5G4ZA 1P9RA 3ZQ5A 1G6OA 1OTBA 2YKFA 1UWPX 4HNBA 2P04A 3C38A 4BJPA 2O9CA 4LLOB 2VEAA 3HJIA 3S7PA 1TD5A 1P0ZA 2M1CA 3D72A 4CLCC 4NKPA 2V9AA 3D3OA 3F1PB 3C30A 5DJTA 4O8GA 4F3LB 4XT2A 3F1OA 5DKLA 5CX7A 5HDCA 5F5YA 5IT5A 3FPVA 3GECA 4L9FA 3C8CA 2GX5A 4HI4A 4O01A 1LT0A 2K7SA 1MKMA 1ODVA 5F6AA 3IBRA 3ICYA 3OCLA 4OOMA 2WKQA 3LR5A 4GHIA 1ZTUA 2GNXA 3PBQA 4OOLA 1OTIA 1XJ6A 3CLOA 3MFXA 4IJGA 4HOIA 3CITA 2W3FA 1OT6A 4JGPA 1V9ZA 4II7A 4HP9A 4Z1WA 3VE4A 3PHYA 5MC7A 2M7VA 4BBTA 3RTYA 4HJ3A 2PHYA 4HIAA 1LSWA 4LRXC 4NXEA 4Q0IA 3JVUA 3LR0A 3E4PA 3KSHA 3EQUA 4CLCA 2V0WA 4LRYC 1P9WA 1IFQA 5KSHA 4YWZA 1G28A 2O99A 4GS9A 3EGXC 4QPRA 2L4RA 3TJZC 3IS2A 3MQQA 4DMZA 3PBNA 2QKPA 2W3DA 3H7WA 4NXFA 1OT9A 5EFWA 4G3VA 3EEHA 4Y2FA 3F1NA 3LI8A 2A24A 5FL3A 2W1RA 1S67L 3LICA 4LPZA 4ARZB 1KOUA 3MR0A 4FSFA 2O9AA 4H6JA 4I3JA 3OCNA 3PXPA 3RFBA 2VJWA 2G7UA 4CQHA 4EEUA 4JGOA 2QWSA 3EOIA 4RQ9A 3RH8B 2HV1A 5TBMB 4Q0HA 2W1TA 3LIDA 3NOTC 2VKSA 4HQAA 3ZYTA 1YAXA 5J7EA 4PAUA 3T4QA 1MC0A 3LIEA 5A8BA 1V9YA 2B18A 1VB6A 1NLZA 3H9WA 4P6ZM 3O5YA 5DFXA 3B42A 1XFQA 2VV6A 3LYXA 5J4EA 2HF6A 2I9VA 2NUTC 2WKRA 4L0LA 2VGLS 4R38A 2YKHA 3OOVA 3MXQA 2PYPA 3K2NA 3NOPC 4I39A 2VA0A 3UE6A 3VOLA 3OBFA 2A2LA 2D01A 3KSIA 3VV4A 5J3WA 1S1YA 1S66L 1OTAA 3UB8A 2R78A 3CWFA 2QYBA 1T19A 3T4SA 4EU0A 1TS8A 3PBRA 3F1PA 4O0PA 3BW6A 5AJGA 4F3LA 1OJGA 2W27A 1DRMA 2H28A 3KSFA 3LIBA 5F68A 3H82B 4NXGA 1VHMA 3EQVA 3IBJA 2IA2A 1Y28A 2PR6A 3PR6A 3TE8A 4EESA 3E4OA 2DMWA 1P97A 2FH5A 4G3WA 4HY8A 5K5BA 4K08A 4IHQA 2J3TD 2PDRA 2LB5A 5TJJA 2V1BA 2V1AA 4MMNA 1H3QA 4MCWA 2O0YA 1TS7A 4EEPA 2W3EA 5HZHA 3T4LA 2J80A 1OTDA 1NLYA 5DKKA 4KQOA 1W63Q 4GJ4A 3OLOA 4DJ2A 3P7NA 3TRCA 1MZUA 4I5SA 2PT7A 2JHEA 2O9BA 3R7WB 3VE3A 3A0SA 5G4YA 3KYZA 2Y8HA 2Z6CA 5KIZA 3S7QA 4R6LA 1F9IA 4JGRA 4G3KA 1LSXA 2D02A 1T18A 1N9NA 2K2NA 3CUEC 4R70A 3C2WA 1YSPA 3P01A 1JNUA 5DFYA 1S4RA 2FZ0A 4HP4A 3EGDC 1XJ4A 2QJ7A 3KYQA 4YNRA 1T1BA 2W0NA 1UGUA 3UB6A 4EETB 2BASA 4NXBA 4GCZA 2NUPC 3LFVA 2LB9A 5HPFA 4WEJA 4EERA 2L0WA 2XA7M 4PKYG 4KQDA 3HCYA 3TW8A 3LIFA 3PBTA 2EA9A 5TBMA 1N9OA 3BQ8A 2J3TC 4IUHA 4ETXA 4LRZE 4GLQA 3MF0A 5HL6A 4I3AA 2B02A 5AVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PYP A;  4WLA A;  4HJ4 A;  2PD7 A;  1EW0 A;  2L1M A;  1T1C A;  5HDD A;  1XJ3 A;  4WUJ A;  1F98 A;  4I3I A;  2QHK A;  4HHD A;  5HDS A;  3A0R A;  5IS1 A;  5AVE A;  2P7J A;  4EXO A;  3ULF A;  4WF0 A;  3KX0 X;  3BWL A;  2ZOI A;  4BBU A;  2QJ5 A;  4MN6 A;  4BBV A;  2GJ3 A;  1BYW A;  2V0U A;  3G6O A;  2OOL A;  4HH2 A;  3T50 A;  4WL9 A;  1DP6 A;  3H82 A;  5HWT A;  1TS6 A;  3UB7 A;  5HWV A;  1S4S A;  4PKY A;  2PR5 A;  2VV8 A;  3FG8 A;  3HJK A;  3UMD A;  2OWH A;  1T1A A;  3K3D A;  3UB9 A;  3EWK A;  2Z6D A;  1LSV A;  4KUO A;  1D06 A;  2PD8 A;  1N9L A;  2VLG A;  5HWW A;  4XT2 B;  3F1O B;  4B9O A;  2CMN A;  3BY8 A;  5IU1 A;  2PYR A;  1S1Z A;  4GHI B;  3NJA A;  3CAX A;  4I38 A;  1XFN A;  3LI9 A;  2VV7 A;  4DJ3 A;  3LIA A;  2WKP A;  1X0O A;  2ZOH A;  3MJQ A;  1GSW A;  5I5L A;  1TS0 A;  2OWJ A;  4GW9 A;  3FC7 A;  4EW7 A;  1OJ5 A;  1LL8 A;  3K3C A;  4L9E A;  4GS9 B;  2KDK A;  3MQO A;  3IS2 B;  4R3A A;  1UWN X;  3H7W B;  4JGQ A;  4M4X A;  4WN5 A;  2INW A;  3F1N B;  2A24 B;  3A0V A;  3UME A;  1DP8 A;  1GSV A;  4EQ1 A;  4H6J B;  1XJ2 A;  4HH3 A;  3B33 A;  3NOU C;  4E04 A;  1NWZ A;  3LUQ A;  1OTE A;  5F69 A;  2JN7 A;  3E4Q A;  4MN5 A;  1WA9 A;  3NHQ A;  4KUK A;  3BY9 A;  1GSX A;  2ZBB A;  5DJU A;  3GDI A;  5HD5 A;  4L9G A;  4HJ6 A;  1DP9 A;  5HSQ A;  2KX6 A;  1D7E A;  5HD3 A;  3SW1 A;  5G4Z A;  3ZQ5 A;  1OTB A;  2YKF A;  1UWP X;  4HNB A;  4LLO B;  2VEA A;  3HJI A;  1P0Z A;  2M1C A;  3D72 A;  2V9A A;  3F1P B;  5DJT A;  4F3L B;  4XT2 A;  3F1O A;  5DKL A;  5HDC A;  5F5Y A;  3GEC A;  4L9F A;  3C8C A;  4HI4 A;  1LT0 A;  2K7S A;  1ODV A;  5F6A A;  3IBR A;  3ICY A;  2WKQ A;  4GHI A;  1OTI A;  1XJ6 A;  3CLO A;  3MFX A;  4HOI A;  1OT6 A;  4JGP A;  1V9Z A;  4HP9 A;  3VE4 A;  3PHY A;  4BBT A;  3RTY A;  4HJ3 A;  2PHY A;  4HIA A;  1LSW A;  4LRX C;  4NXE A;  3E4P A;  2V0W A;  4LRY C;  4YWZ A;  1G28 A;  4GS9 A;  2L4R A;  3IS2 A;  3MQQ A;  2QKP A;  3H7W A;  4NXF A;  1OT9 A;  5EFW A;  3EEH A;  3F1N A;  3LI8 A;  2A24 A;  1S67 L;  3LIC A;  4LPZ A;  1KOU A;  3MR0 A;  4H6J A;  4I3J A;  4EEU A;  4JGO A;  2QWS A;  4RQ9 A;  3RH8 B;  2HV1 A;  5TBM B;  3LID A;  3NOT C;  4HQA A;  5J7E A;  3LIE A;  5A8B A;  1V9Y A;  1VB6 A;  3H9W A;  1XFQ A;  2VV6 A;  3LYX A;  5J4E A;  2I9V A;  2WKR A;  4R38 A;  2YKH A;  3MXQ A;  2PYP A;  3NOP C;  4I39 A;  3UE6 A;  3VOL A;  2D01 A;  5J3W A;  1S1Y A;  1S66 L;  1OTA A;  3UB8 A;  2R78 A;  3CWF A;  1T19 A;  1TS8 A;  3F1P A;  4F3L A;  1OJG A;  2W27 A;  1DRM A;  2H28 A;  3LIB A;  5F68 A;  3H82 B;  4NXG A;  1Y28 A;  2PR6 A;  4EES A;  3E4O A;  1P97 A;  4HY8 A;  4K08 A;  2PDR A;  2V1B A;  2V1A A;  1TS7 A;  4EEP A;  5HZH A;  2J80 A;  1OTD A;  5DKK A;  3OLO A;  4DJ2 A;  3P7N A;  1MZU A;  4I5S A;  2JHE A;  3VE3 A;  3A0S A;  5G4Y A;  2Z6C A;  5KIZ A;  4R6L A;  1F9I A;  4JGR A;  1LSX A;  2D02 A;  1T18 A;  1N9N A;  4R70 A;  3C2W A;  1JNU A;  1S4R A;  4HP4 A;  1XJ4 A;  2QJ7 A;  1T1B A;  2W0N A;  1UGU A;  3UB6 A;  4EET B;  2BAS A;  4NXB A;  4GCZ A;  4EER A;  2L0W A;  4PKY G;  4KQD A;  3LIF A;  2EA9 A;  5TBM A;  1N9O A;  4LRZ E;  4I3A A;  2B02 A;  5AVF A; 
#chains in the Genus database with same CATH topology
 3IXG A;  3PYP A;  4BLM A;  4WLA A;  4Y13 A;  3NDG A;  1EW0 A;  1T1C A;  3CI6 A;  3BRM A;  4WUJ A;  1F98 A;  3FPW A;  2QHK A;  5HFO A;  3DBA A;  3V5M A;  2ZJ9 A;  1BSG A;  3AGE A;  3LR3 A;  2GZA A;  5HL1 A;  5CGS A;  1TVF A;  1NZO A;  3G6O A;  4ZJ3 A;  3T50 A;  4C3Q A;  3Q7V B;  4WL9 A;  1W63 M;  4JLF A;  2Y2N A;  3H82 A;  3MMH A;  3CPT A;  4GD6 A;  3UB7 A;  2VV8 A;  4U3T A;  5LBR A;  2I72 A;  2OLU A;  3NI9 A;  2X01 A;  5F82 A;  4BQM A;  2EX9 A;  4DXB A;  2AVX A;  1LSV A;  1YMS A;  3MQ0 A;  1YLY A;  3ZDJ A;  1D06 A;  5DF9 A;  3DW0 A;  1D1J A;  2H0Y A;  5HWW A;  4XT2 B;  3UDF A;  3F1O B;  3UB5 P;  1CEG A;  2EX2 A;  3IHB A;  4ME4 A;  1U60 A;  2HJ9 C;  4PM7 A;  1ES5 A;  4E3L A;  5GLB A;  3S1Y A;  2V20 A;  1PI4 A;  2JC7 A;  4KZ3 A;  5EVI B;  5HAR A;  4GHI B;  4DN0 A;  4JKT A;  2JKF A;  2WYX A;  4N92 A;  1XFN A;  3LI9 A;  4DJ3 A;  4KG2 A;  5KZH A;  3N4I A;  3O87 A;  4E3M A;  1TF1 A;  4ARZ A;  2EFX A;  2BTF P;  1H8Y A;  4EW7 A;  1RP5 A;  1OJ5 A;  1LL8 A;  3E2L A;  2UV0 E;  4WEK A;  3IS2 B;  4R3A A;  1SDN A;  5CEB A;  1YLW A;  3PBS A;  3QP6 A;  1JTG A;  3UPO A;  1HLU P;  2WAE A;  1N9B A;  2XA7 S;  4OVD A;  3ZG5 A;  3A3F A;  4WN5 A;  3AGF A;  3IQA A;  3A0V A;  1MWU A;  5CED A;  5FQI A;  1GSV A;  5E2G A;  3NOU C;  4LCL A;  2W3G A;  4WEL A;  1NWZ A;  1STZ A;  5F69 A;  1GA0 A;  3A3I A;  4KZ7 A;  4YOF A;  3DTM A;  2VZW A;  5FEF A;  1F5M A;  5GLA A;  4ZJ1 A;  1XKZ A;  2ZBB A;  4K0W A;  2P74 A;  3GDI A;  3Q7V A;  1PI5 A;  4ZJ2 A;  1YLJ A;  3L7H A;  3S7O A;  3OPR A;  3ZVW A;  1XGJ A;  5FQQ A;  4MN7 A;  4Y0U A;  4X1M A;  3T4O A;  3W2Z A;  4WBG A;  2KX6 A;  5AQ7 A;  2XD5 A;  5G4Z A;  4HNB A;  3U4L P;  2OSU A;  3NIA A;  3V39 A;  4LLO B;  1LL5 A;  1L0F A;  4S2M A;  4UHU A;  2V9A A;  1ACF A;  3MZF A;  4XT2 A;  3F1O A;  4EQI A;  3GEC A;  3GMW A;  1XXM A;  3C8C A;  2HDR A;  3G2Y A;  3G4P A;  3VMA A;  4O01 A;  1ODV A;  3IBR A;  5EVI A;  1O07 A;  3OCL A;  4OOM A;  2WKQ A;  4GHI A;  3O86 A;  3DAV A;  3LEQ A;  4N9L A;  3IX8 A;  4OOL A;  4RX3 A;  3BM6 A;  2WKH A;  3CLO A;  1K55 A;  4IJG A;  4BD0 A;  3CIT A;  2W3F A;  4FUW A;  4GDB A;  4HJ3 A;  2PHY A;  4LRX C;  4NK3 A;  5EOE A;  1MXO A;  3M6B A;  4LRY C;  1P9W A;  4JXG A;  4YWZ A;  1G28 A;  5KMW A;  3IS2 A;  3MQQ A;  2XK1 A;  3M6H A;  3HLD A;  5AQB A;  4Y2F A;  3LO7 A;  3LI8 A;  1K57 C;  4MEZ A;  3LIC A;  4LPZ A;  3GTC A;  2VJW A;  4XXR A;  2G7U A;  1QMF A;  1BTL A;  4DKI A;  2QWS A;  5EEC A;  3EOI A;  1Z6F A;  3DTI A;  3RH8 B;  4Q0H A;  1YAX A;  3LIE A;  5A8B A;  2B18 A;  4X6T A;  3SH7 A;  2ZQC A;  1SKF A;  1IYO A;  3S4X A;  5J4E A;  1YLZ A;  4S2K A;  4C75 A;  4R38 A;  3NEC A;  3ZG7 B;  2EX8 A;  2ZQA A;  5FQM A;  5FAQ A;  2D01 A;  5J3W A;  1S1Y A;  2XDM A;  1OTA A;  1ES3 A;  3VP3 A;  2R78 A;  1KGF A;  3QP1 A;  2QYB A;  1BT5 A;  3PBR A;  1PYY A;  5AJG A;  2WAD A;  5HAI A;  1BLH A;  2WUQ A;  2H28 A;  4RYE A;  3ZG9 B;  1SDE A;  3CJM A;  2EXA A;  1FCN A;  3OPL A;  1Y28 A;  2Y2G A;  1JVJ A;  3T1R A;  3BLM A;  1W8Q A;  4EES A;  3WS1 A;  2C5W B;  3OPP A;  1MWR A;  1PZO A;  5A93 A;  4EEP A;  5HZH A;  2W3E A;  3T4L A;  3T1X A;  4Y15 A;  1NLY A;  3GV9 A;  4OPR A;  1SKO B;  4EBL A;  5JYO A;  4GJ4 A;  3P7N A;  1VET B;  1K4F A;  3MS6 A;  2PBY A;  2X02 A;  2Y2Q A;  2ZQD A;  3A0S A;  4OPQ A;  2Y8H A;  3N8R A;  5E43 A;  2H0T A;  1T18 A;  1N9N A;  1DY6 A;  2WZX A;  5EOO A;  3SH9 A;  2WGW B;  5FI7 A;  4GN2 A;  5DFY A;  1S4R A;  1DJA A;  3ITB A;  1ESU A;  3EGD C;  3IXH A;  3KYQ A;  2W0N A;  1UGU A;  3BFD A;  4NXB A;  4LCM A;  3BFC A;  2WGV A;  1WYB A;  2NUP C;  4EER A;  1LI9 A;  4WMC A;  4U0X A;  3IT9 A;  1N9O A;  4IUH A;  3MF0 A;  1LI0 A;  4GZB A;  2FFF B;  2PD7 A;  3ZNY A;  2EXB A;  5HDD A;  2VK3 A;  4JF4 A;  3N8L A;  3MBZ A;  4I3I A;  5HDS A;  4MDZ A;  4B4Z A;  5CHU A;  1CI9 A;  3RJU A;  3WS4 A;  4ZTK A;  4WF0 A;  4ZRR A;  3ZCZ A;  4MN6 A;  4P87 A;  4DF6 A;  3I7J A;  2XSS A;  2KLI A;  1YLP A;  2Y4A A;  3QP5 A;  4KG5 A;  3G2Z A;  4XUX A;  4BBV A;  4GB7 A;  3NBL A;  1IKG A;  5F83 A;  2ZMF A;  3IWI A;  4R4R A;  3B3X A;  1OPX A;  4WZ5 C;  5HWT A;  2JKR I;  4LV1 A;  4R3J A;  4E6W A;  5HWV A;  1ZG6 A;  4ETZ A;  3FG8 A;  1K54 C;  2OWH A;  1T1A A;  3N7W A;  4E3I A;  1ZHH B;  3RXX A;  4OQH A;  4KUO A;  2Y2M A;  1YSQ A;  3DTK A;  1NZU A;  3GSG A;  4N1H A;  3VOZ A;  5HAQ A;  2V1Z A;  3GR2 A;  1IEL A;  2PD8 A;  5EUA A;  3LR4 A;  5KSC A;  3PAE A;  3T4T A;  3DWZ A;  1SKO A;  4P85 A;  2CMN A;  3OZH A;  1H8M A;  4X56 A;  1VET A;  4Y3I A;  3BFF A;  1S1Z A;  1NYY A;  1ZC2 A;  3EEA A;  4NEE D;  4KZA A;  4P6B A;  1MWS A;  3JPU A;  2Y2I A;  2WGW A;  1IYQ A;  1BUE A;  2VX8 A;  1E25 A;  3LIA A;  3TSG A;  1G5U A;  4LFU A;  4X53 A;  1YMX A;  3MJQ A;  1GSW A;  1TS0 A;  2OWJ A;  2JKR M;  5DF7 A;  3FC7 A;  3D4F A;  5HX9 A;  4L9E A;  4MBK A;  4GS9 B;  2KDK A;  3MQO A;  2H5S A;  3BLS A;  3UE3 A;  3R4K A;  2ZC4 B;  3UY6 A;  3S7N A;  3OPH A;  2INW A;  5EM1 A;  2QMI A;  2A24 B;  1W7F A;  4GKU A;  5HPI A;  3C4O A;  4MLL A;  1H0M A;  3VOY A;  4HH3 A;  4ZDX A;  3B33 A;  4FH4 A;  3B47 A;  4B4X A;  3MZD A;  5DTK A;  5FDH A;  3BY9 A;  2ACG A;  4PM5 A;  1YPR A;  1ES4 A;  3ZG0 A;  2OAQ 1;  5A92 A;  1I2W A;  2VGJ A;  5U47 A;  3HLB A;  5FQK A;  1DP9 A;  3UPP A;  3IF6 C;  2J8Y A;  1D7E A;  2WKI A;  3SW1 A;  1G6O A;  1OTB A;  2YKF A;  4BJP A;  1C3B A;  4E6X A;  2VEA A;  4DXC A;  2IWC A;  1TD5 A;  1P0Z A;  3TG9 A;  3D72 A;  5FEG A;  2R9X A;  2Y59 A;  5DJT A;  3UN7 A;  4DE3 A;  5HDC A;  5IT5 A;  5FI2 A;  1XGI A;  2GX5 A;  3QP2 A;  2K7S A;  3HUO A;  3VP2 A;  2RCX A;  3SZT A;  5I94 A;  3VFH A;  2G2W A;  2XFT A;  3PBQ A;  5HAP A;  1XJ6 A;  3IHA A;  5AQA A;  1E3U A;  3MFX A;  1BUL A;  5DF8 A;  1Q2P A;  1OT6 A;  4FD8 A;  5IHV A;  2Y2P A;  2XGN A;  3G31 A;  3PHY A;  5TGF A;  4UA9 A;  3LY3 A;  1ERQ A;  3JVU A;  3LR0 A;  1XA7 A;  3EQU A;  3SS4 A;  2A49 A;  2V0W A;  3ZGA B;  2V8F A;  3DTE A;  1DJC A;  4GS9 A;  2L4R A;  1MWT A;  4DMZ A;  3PBN A;  3QP4 A;  4UAA A;  1FOF A;  4JF5 A;  5EFW A;  1K56 A;  1G6A A;  4G3V A;  5BOH A;  4JF6 A;  5FAO A;  4X55 A;  5TFQ A;  2A24 A;  1GHI A;  4QHC A;  1S67 L;  2HDQ A;  4HBT A;  3M2K A;  4FSF A;  1W8Y A;  2ZC7 A;  3WRT A;  5EVL A;  1KE3 A;  1AXB A;  4EEU A;  1GA9 A;  3WRZ A;  4RQ9 A;  5CXW A;  4IBR A;  1CK3 A;  3NOT C;  3T4Q A;  2J7V A;  1VB6 A;  3HLC A;  4P6Z M;  3O5Y A;  1FR6 A;  1K38 A;  5F1G A;  3O3V A;  1HZO A;  3WS0 A;  3OOV A;  2B5R A;  2PYP A;  3K2N A;  4I39 A;  3VOL A;  3IXD A;  3CMZ A;  1L0E A;  4OKP A;  5JYP A;  3N8S A;  4Q8I A;  3GRJ A;  3S22 A;  3A3J A;  4UA6 A;  1I5Q A;  3EQV A;  1M40 A;  2IA2 A;  4D2O A;  2PR6 A;  3PR6 A;  1LL9 A;  3O88 A;  3LEZ A;  3E4O A;  4FTX A;  4O7D A;  4G3W A;  5CER A;  4JXS A;  5F1F A;  3UE0 A;  3UO9 A;  4K08 A;  2HDS A;  1XPB A;  5DTS A;  2ZC6 B;  3T1Q B;  2J80 A;  4OLG A;  4KQO A;  1PWG A;  4X25 A;  3RXW A;  4DJ2 A;  1L2S A;  1MBL A;  4EBN A;  4OQG A;  2Q0O A;  3W4Q A;  1MZU A;  4I5S A;  3R7W B;  3VE3 A;  5G4Y A;  3KYZ A;  2Y2O A;  4IVI A;  5KIZ A;  4OP8 A;  4R6L A;  1PW1 A;  1LSX A;  3CUE C;  4IED A;  1KE4 A;  4WZ4 A;  4JPM A;  4HP4 A;  1HTZ A;  2HP9 A;  4A5R A;  1XJ4 A;  2PU2 A;  3DWK A;  4ID4 A;  3UB6 A;  4EET B;  1ALQ A;  3Q81 A;  2EFU A;  2HZ5 A;  2XR0 A;  3LFV A;  4WEJ A;  4KQD A;  3HCY A;  4OOY A;  2ZQ8 A;  2EA9 A;  4IBX A;  2Y2K A;  4LRZ E;  4S2N A;  5HL6 A;  2J9O A;  5AVF A;  2B95 A;  3T4K A;  4Y5F A;  5GLC A;  3JVV A;  2P9V B;  4R3B A;  1FIK A;  1XJ3 A;  4EBP A;  5GL9 A;  3PBO A;  3KO6 A;  3TOI A;  2P7J A;  2W3H A;  4P6Z S;  4KG6 A;  3BEB A;  4Q0J A;  5EPH A;  3KX0 X;  4R23 A;  5CTN A;  2ZOI A;  4X69 A;  4BBU A;  1ERM A;  4GOG A;  4S2I A;  3GVB A;  2V0U A;  2OOL A;  4HH2 A;  1QME A;  3WS2 A;  1K55 C;  1DJB A;  3M2J A;  3UDI A;  1GCE A;  1S4S A;  2V8C A;  2ZM8 A;  3UMD A;  4OLD A;  1YM1 A;  4R4S A;  5L2F A;  5GHY A;  3EWK A;  2JCH A;  4JXV A;  1PFL A;  5L8M A;  3MFD A;  4MBF A;  3BQA A;  3C7V A;  2JE5 A;  1N9L A;  3VP0 A;  4OH0 A;  2VLG A;  4EV4 A;  4QJG A;  5CRF A;  3ZVT A;  1MKI A;  3ITA A;  4BWI A;  2Y91 A;  3NC8 A;  5CGW A;  2WKE A;  3FYZ A;  1A0K A;  4KZ9 A;  5C5K A;  2MJ6 A;  3KSG A;  5E2F A;  5CHM A;  4DE0 A;  3R7W A;  3Q82 A;  3U2A A;  1K6S A;  5FAP A;  2BG1 A;  1EI5 A;  4E3N A;  4B88 A;  2OAP 1;  4I38 A;  2HJE A;  4KZ4 A;  2VV7 A;  3HUN A;  4QD4 A;  4P0M A;  3LY4 A;  3BEC A;  1IEM A;  4Y0T A;  2ZLY A;  4KZB A;  2BLS A;  1YQS A;  4IUK A;  4EUZ A;  3VP4 A;  1NRJ A;  3K3C A;  4S2P A;  1NYM A;  5EVE A;  4CJN A;  5FQ9 A;  1UWN X;  4CLC D;  3V67 A;  3H7W B;  2P9V A;  4JGQ A;  4M4X A;  4AFI A;  4M3K A;  4ZAM A;  3F1N B;  4QWO A;  4NG2 A;  4R0Q A;  2KOI A;  3FZC A;  4H6J B;  1XJ2 A;  4KEN B;  4YFM A;  1NRF A;  5FI6 A;  3SS3 A;  3NUL A;  2VGL M;  2W1T B;  2Z2L B;  4WM9 A;  2XQZ A;  4WMC D;  1GHP A;  2M7U A;  2Q9N A;  4KQR A;  4DRT A;  3FKV A;  5HD5 A;  4OQI A;  3MKF A;  2Y79 A;  2DCF A;  5GLD A;  1XP4 A;  5HD3 A;  1FSW A;  1F2K A;  2P04 A;  2ZC3 B;  3C38 A;  5M19 A;  3VP1 A;  2XF3 A;  4DDS A;  4CLC C;  2PRF A;  5L09 A;  4NKP A;  3D3O A;  3F1P B;  3C30 A;  3D9Y A;  1WE4 A;  4O8G A;  4F3L B;  4E3K A;  5DKL A;  5CX7 A;  1S6R A;  3MXR A;  4L9F A;  1WYC A;  2E8I A;  3PAG A;  3P09 A;  3UNW A;  1MKM A;  1JWP A;  4JBF A;  3IH9 A;  5AQ9 A;  3LR5 A;  1CI8 A;  1ZTU A;  2GNX A;  4Y0O A;  2J9P A;  1EWZ A;  3IXB A;  1IKI A;  4HOI A;  4JGP A;  1JWV A;  1V9Z A;  4II7 A;  4LEN A;  4Z1W A;  3P98 A;  4BD1 A;  5MC7 A;  1LHY A;  2M7V A;  4RVA A;  4BEN A;  4BBT A;  3RTY A;  1ZKJ A;  1RGY A;  2ZL1 B;  1LSW A;  4NXE A;  3E4P A;  2WGI A;  1FCM A;  2WAF A;  1PZP A;  4EWF A;  4IVK A;  1IFQ A;  2Y2H A;  3Q7Z A;  4KZ8 A;  1ESI A;  2O99 A;  3EGX C;  4QPR A;  3TJZ C;  3C7U A;  2XLN A;  2QKP A;  2W3D A;  4U0T A;  1CJF A;  3H7W A;  1LLB A;  4NXF A;  3EEH A;  4QY5 A;  2XFS A;  3F1N A;  2W1R A;  2ZMA A;  2RL3 A;  1AWI A;  4ARZ B;  1K0K A;  1KOU A;  3MR0 A;  4I3J A;  4H6J A;  3OCN A;  3RFB A;  1L0D A;  3MZE A;  2ZQ9 A;  2WZZ A;  5EE8 A;  5TBM B;  5FAS A;  2W1T A;  3ZYT A;  2VKS A;  5J7E A;  3V50 A;  5M1A A;  3LGO A;  3H9W A;  3IX3 A;  4PM9 A;  5DFX A;  3B42 A;  2I9V A;  2WKR A;  4N1X A;  4L0L A;  2VGL S;  3VSL A;  4K91 A;  1KDS A;  3MXQ A;  1YT4 A;  4R1G A;  2VA0 A;  4FH2 A;  2XH9 A;  5A91 A;  1Y54 A;  5EM0 A;  4DE2 A;  3KSI A;  3UPN A;  3VV4 A;  1M6K A;  1S66 L;  3BFG A;  3UB8 A;  1FQG A;  4OP5 A;  1T19 A;  3T4S A;  1TS8 A;  1OME A;  3IWO A;  3F1P A;  1RGZ A;  1HD8 A;  1XX2 A;  4F3L A;  2W27 A;  1DRM A;  2IWB A;  1L3L A;  5F68 A;  1SZV A;  1VHM A;  4S2J A;  3TE8 A;  3AGD A;  5L10 A;  3IX4 A;  1ONH A;  4KQQ A;  2FH5 A;  3QP8 A;  5K5B A;  3HRE A;  4IHQ A;  2J3T D;  3IWQ A;  4DDY A;  2PDR A;  4MMN A;  1BZA A;  5FDS A;  4QB8 A;  1TS7 A;  3HUM A;  3VFF A;  1OTD A;  1JTD A;  5GHX A;  3ZFZ A;  5DKK A;  4FCF A;  2V2F F;  2ZL1 A;  3WS5 A;  3HLG A;  1W79 A;  3CG5 A;  3TRC A;  3W8K A;  1SCW A;  2Z2M B;  2H10 A;  1CQA A;  3NCK A;  4HBU A;  2JHE A;  2HDU A;  4Y7P A;  4OPZ A;  1F9I A;  3SH8 A;  3A3D A;  3BYD A;  4JGR A;  2D02 A;  3W4P A;  2K2N A;  4R70 A;  3C2W A;  3G30 A;  2WK0 A;  3QNB A;  1JNU A;  1E3U D;  1O7E A;  2QJ7 A;  3HVF A;  5DVA A;  4YNR A;  2ZC5 B;  4GCZ A;  5HPF A;  2PAV P;  4GDN A;  3SOI A;  5CGX A;  5A90 A;  5TBM A;  1L0G A;  2EX6 A;  2J3T C;  3UDX A;  4KZ6 A;  2X71 A;  3HL9 A;  2HPB A;  4HJ4 A;  4BMW A;  3IF5 A;  2L1M A;  1K4E A;  4LV0 A;  3ZHH A;  3OC2 A;  4HHD A;  1K56 D;  3A0R A;  1J3W A;  5AVE A;  5CEC A;  5IS1 A;  4UEY A;  4EXO A;  3ULF A;  3CUE A;  3G34 A;  4OON A;  1NY0 A;  4LV2 A;  2J3W A;  3BWL A;  3E0Y A;  5CHJ A;  2QJ5 A;  1ONG A;  4UQI M;  2Y2J A;  2K31 A;  1SHV A;  2GJ3 A;  1BYW A;  1K57 A;  4Z9Q A;  4F94 A;  3QHY A;  1DP6 A;  4LGW A;  4RA7 A;  4D60 A;  2ZM2 A;  1TS6 A;  1Z09 A;  3FV7 A;  2P08 A;  3BJN A;  4PKY A;  5L07 A;  1S0W A;  2PR5 A;  3HJK A;  4ZBE A;  2DRW A;  3K3D A;  4BL3 A;  3UB9 A;  4DE1 A;  5E2E A;  2Z6D A;  4HEF A;  1YLT A;  2A3U A;  3HBR A;  4B9O A;  2HGV A;  3MSH A;  3BY8 A;  5IU1 A;  4B93 A;  2XRN A;  2C6W B;  2PYR A;  3CHW P;  1CEF A;  1JWZ A;  3QNC A;  4EUV A;  3FWL A;  1IOU A;  3C4P A;  3NJA A;  5E2H A;  2DNS A;  3CAX A;  1NJ4 A;  5EVI D;  4ESP A;  3VSK A;  2JKG A;  2EWV A;  4MNR A;  2XEP A;  3LCE A;  5GHZ A;  4MBH A;  1YKD A;  2WKP A;  1X0O A;  2R9W A;  2ZOH A;  5I5L A;  2JKT I;  1FIL A;  4GNU A;  2HP6 A;  4GW9 A;  1TEM A;  3A3E A;  3N6I A;  4CLC B;  1KDW A;  3T4J A;  4FOF A;  4PHT A;  5EV0 A;  1NXY A;  4BL2 A;  2E8J A;  1GHM A;  3UME A;  4CLC E;  1DP8 A;  1MPL A;  4EQ1 A;  2OV5 A;  1HVB A;  1VEU B;  4E04 A;  3LUQ A;  1OTE A;  2HP5 A;  2JN7 A;  3E4Q A;  2EWW A;  4MN5 A;  4S2O A;  1WA9 A;  3NHQ A;  2QZ6 A;  4KUK A;  4OPY A;  5G18 A;  1K25 A;  1GSX A;  1TDL A;  5EVI C;  3IH8 A;  5DJU A;  2CC1 A;  2JBF A;  2XRO A;  4L9G A;  2UWX A;  2ZMV A;  3E98 A;  2XD1 A;  4HJ6 A;  4UQI S;  4E3O A;  4LV3 A;  5HSQ A;  2JKT M;  4KZ5 A;  1ZG4 A;  4X1L A;  1P9R A;  3ZQ5 A;  5DTT A;  5D3O A;  1UWP X;  1XA1 A;  1IYP A;  2O9C A;  1I2S A;  3HJI A;  2GDN A;  3V3R A;  1FCO A;  3S7P A;  2M1C A;  4X68 A;  5FAT A;  3HLE A;  5F5Y A;  3GQZ A;  2Y2L A;  3FPV A;  1N4O A;  4GD8 A;  2IWD A;  1ES2 A;  4HI4 A;  3KYE A;  5FA7 A;  4NET A;  1LT0 A;  1PWC A;  2G2U A;  5F6A A;  1H8Z A;  3ICY A;  1W5D A;  3NDE A;  1G68 A;  1OTI A;  3V3S A;  3E2K A;  4WZ5 A;  4S2L A;  3ISG A;  4S2N C;  4PMA A;  3Q1F A;  4HP9 A;  1KE0 A;  3IF6 B;  1RCJ A;  3VE4 A;  1CF0 A;  1FR1 A;  1BLS A;  1K54 A;  4PM6 A;  4HIA A;  3UE1 A;  4Q0I A;  2OLV A;  4C6Y A;  3KSH A;  4UA7 A;  4CLC A;  1PNE A;  1PW8 A;  5KSH A;  1KVM A;  3W4O A;  1OT9 A;  1VM1 A;  4YIN A;  4CPK A;  5FL3 A;  1BLP A;  5CTM A;  2O9A A;  3PXP A;  1VEU A;  2ZD8 A;  3T12 B;  2VGK A;  4CQH A;  4JGO A;  1ERO A;  2HV1 A;  3T1S A;  4OQ0 A;  1BLC A;  3LID A;  4HQA A;  4PAU A;  1MC0 A;  1V9Y A;  1NLZ A;  2ZM0 A;  1KGG A;  1XFQ A;  2VV6 A;  5FSR A;  3LYX A;  2HF6 A;  4E3J A;  2NUT C;  2YKH A;  2ZQ7 A;  5TR7 A;  3NOP C;  3UE6 A;  3OBF A;  2A2L A;  3NY4 A;  3PTE A;  5J8X A;  1VQQ A;  1KGE A;  4RX2 A;  3CWF A;  4EU0 A;  2PU4 A;  4O0P A;  3BW6 A;  3WWX A;  1OJG A;  3MXS A;  3KSF A;  3LIB A;  4JXW A;  3C5A A;  3H82 B;  4NXG A;  3CPT B;  1H5X A;  3ZNT A;  1Q2Q A;  3IBJ A;  5FQJ A;  4K0X A;  2DMW A;  3G35 A;  4HES A;  3JYI A;  1P97 A;  4HY8 A;  1PWD A;  2LB5 A;  5TJJ A;  1MY8 A;  2V1B A;  2V1A A;  1H3Q A;  4MCW A;  2O0Y A;  3ZG8 B;  5HW3 A;  4PM8 A;  3G32 A;  3IF6 A;  1K6R A;  4QY6 A;  3HLW A;  1W63 Q;  3OLO A;  4WYY A;  3Q07 A;  2PT7 A;  2O9B A;  4XUZ A;  2Z6C A;  3S7Q A;  1PIO A;  2FFY A;  3CZD A;  4N9K A;  4G3K A;  5M18 A;  1FSY A;  1YSP A;  3P01 A;  1Y4O A;  2PBD P;  4PPR A;  2FZ0 A;  1J9M A;  1T1B A;  4Y17 A;  2BAS A;  4H8R A;  2QPN A;  3BFE A;  1E4D A;  1PRQ A;  2LB9 A;  1TDG A;  1IYS A;  2L0W A;  2XA7 M;  4PKY G;  3FKW A;  3TW8 A;  2Y55 A;  3LIF A;  3HLF A;  3PBT A;  4QU3 A;  2Q9M A;  3BQ8 A;  4ETX A;  1KVL A;  4GLQ A;  3SS5 A;  3MKE A;  3L9K A;  4I3A A;  2B02 A; 
#chains in the Genus database with same CATH homology
 3T4K A;  4Y5F A;  3PYP A;  4WLA A;  3JVV A;  4HJ4 A;  4BMW A;  2PD7 A;  1EW0 A;  2L1M A;  1T1C A;  3CI6 A;  5HDD A;  1XJ3 A;  4WUJ A;  1F98 A;  3FPW A;  4I3I A;  2QHK A;  3OC2 A;  4HHD A;  3PBO A;  3KO6 A;  5HDS A;  3A0R A;  5IS1 A;  5AVE A;  3DBA A;  2P7J A;  4MDZ A;  4UEY A;  2W3H A;  4P6Z S;  4Q0J A;  4EXO A;  3ULF A;  3CUE A;  4WF0 A;  3KX0 X;  4ZRR A;  2J3W A;  3BWL A;  3E0Y A;  2ZOI A;  3LR3 A;  4BBU A;  2QJ5 A;  4MN6 A;  2XSS A;  2KLI A;  4UQI M;  2GZA A;  2K31 A;  4BBV A;  2GJ3 A;  1BYW A;  2V0U A;  3G6O A;  2ZMF A;  2OOL A;  4HH2 A;  3T50 A;  4WL9 A;  1OPX A;  1DP6 A;  1W63 M;  3H82 A;  5HWT A;  3MMH A;  1TS6 A;  2JKR I;  2P08 A;  3UB7 A;  3BJN A;  5HWV A;  1S4S A;  4PKY A;  2PR5 A;  2VV8 A;  4ETZ A;  3FG8 A;  3HJK A;  5LBR A;  3UMD A;  2OWH A;  1T1A A;  3K3D A;  3UB9 A;  1ZHH B;  3EWK A;  2Z6D A;  1LSV A;  4KUO A;  1YSQ A;  3MQ0 A;  1D06 A;  5DF9 A;  5L8M A;  2PD8 A;  3BQA A;  1N9L A;  3LR4 A;  2VLG A;  5HWW A;  4XT2 B;  3T4T A;  3F1O B;  4B9O A;  2CMN A;  1H8M A;  4ME4 A;  4BWI A;  2HGV A;  2HJ9 C;  3BY8 A;  5IU1 A;  4Y3I A;  4B93 A;  2XRN A;  5C5K A;  2MJ6 A;  3KSG A;  2PYR A;  3R7W A;  1S1Z A;  3EEA A;  4EUV A;  4GHI B;  4NEE D;  3U2A A;  1IOU A;  3NJA A;  4DN0 A;  3CAX A;  2OAP 1;  4I38 A;  2HJE A;  1XFN A;  3LI9 A;  2VV7 A;  4DJ3 A;  2VX8 A;  2EWV A;  3LIA A;  1YKD A;  2WKP A;  1X0O A;  1TF1 A;  2ZOH A;  3MJQ A;  1GSW A;  5I5L A;  2JKT I;  1TS0 A;  2OWJ A;  4ARZ A;  2JKR M;  4GW9 A;  3FC7 A;  4EW7 A;  4CLC B;  4IUK A;  3T4J A;  1OJ5 A;  1LL8 A;  4FOF A;  1NRJ A;  4PHT A;  3K3C A;  4L9E A;  4GS9 B;  2KDK A;  4WEK A;  3MQO A;  3IS2 B;  4R3A A;  1UWN X;  3PBS A;  4CLC D;  3V67 A;  3H7W B;  3UE3 A;  4JGQ A;  3R4K A;  4M4X A;  2XA7 S;  4AFI A;  4WN5 A;  3S7N A;  2INW A;  3F1N B;  2A24 B;  3A0V A;  3UME A;  2KOI A;  4CLC E;  1DP8 A;  5HPI A;  1GSV A;  4EQ1 A;  4H6J B;  1XJ2 A;  4HH3 A;  3B33 A;  3NOU C;  4E04 A;  2W3G A;  4WEL A;  1NWZ A;  3LUQ A;  1OTE A;  1STZ A;  5F69 A;  2JN7 A;  3E4Q A;  3B47 A;  2EWW A;  4YOF A;  4MN5 A;  1WA9 A;  2VZW A;  3NHQ A;  4KUK A;  2VGL M;  2W1T B;  3BY9 A;  1F5M A;  1GSX A;  2ZBB A;  2M7U A;  5DJU A;  2OAQ 1;  3GDI A;  5HD5 A;  2XRO A;  4L9G A;  2Y79 A;  2ZMV A;  3E98 A;  3S7O A;  4HJ6 A;  1DP9 A;  4MN7 A;  4UQI S;  3T4O A;  3W2Z A;  5HSQ A;  2KX6 A;  1D7E A;  5HD3 A;  2JKT M;  3SW1 A;  5G4Z A;  1P9R A;  3ZQ5 A;  1G6O A;  1OTB A;  2YKF A;  1UWP X;  4HNB A;  2P04 A;  3C38 A;  4BJP A;  2O9C A;  4LLO B;  2VEA A;  3HJI A;  3S7P A;  1TD5 A;  1P0Z A;  2M1C A;  3D72 A;  4CLC C;  4NKP A;  2V9A A;  3D3O A;  3F1P B;  3C30 A;  5DJT A;  4O8G A;  4F3L B;  4XT2 A;  3F1O A;  5DKL A;  5CX7 A;  5HDC A;  5F5Y A;  5IT5 A;  3FPV A;  3GEC A;  4L9F A;  3C8C A;  2GX5 A;  4HI4 A;  4O01 A;  1LT0 A;  2K7S A;  1MKM A;  1ODV A;  5F6A A;  3IBR A;  3ICY A;  3OCL A;  4OOM A;  2WKQ A;  3LR5 A;  4GHI A;  1ZTU A;  2GNX A;  3PBQ A;  4OOL A;  1OTI A;  1XJ6 A;  3CLO A;  3MFX A;  4IJG A;  4HOI A;  3CIT A;  2W3F A;  1OT6 A;  4JGP A;  1V9Z A;  4II7 A;  4HP9 A;  4Z1W A;  3VE4 A;  3PHY A;  5MC7 A;  2M7V A;  4BBT A;  3RTY A;  4HJ3 A;  2PHY A;  4HIA A;  1LSW A;  4LRX C;  4NXE A;  4Q0I A;  3JVU A;  3LR0 A;  3E4P A;  3KSH A;  3EQU A;  4CLC A;  2V0W A;  4LRY C;  1P9W A;  1IFQ A;  5KSH A;  4YWZ A;  1G28 A;  2O99 A;  4GS9 A;  3EGX C;  4QPR A;  2L4R A;  3TJZ C;  3IS2 A;  3MQQ A;  4DMZ A;  3PBN A;  2QKP A;  2W3D A;  3H7W A;  4NXF A;  1OT9 A;  5EFW A;  4G3V A;  3EEH A;  4Y2F A;  3F1N A;  3LI8 A;  2A24 A;  5FL3 A;  2W1R A;  1S67 L;  3LIC A;  4LPZ A;  4ARZ B;  1KOU A;  3MR0 A;  4FSF A;  2O9A A;  4H6J A;  4I3J A;  3OCN A;  3PXP A;  3RFB A;  2VJW A;  2G7U A;  4CQH A;  4EEU A;  4JGO A;  2QWS A;  3EOI A;  4RQ9 A;  3RH8 B;  2HV1 A;  5TBM B;  4Q0H A;  2W1T A;  3LID A;  3NOT C;  2VKS A;  4HQA A;  3ZYT A;  1YAX A;  5J7E A;  4PAU A;  3T4Q A;  1MC0 A;  3LIE A;  5A8B A;  1V9Y A;  2B18 A;  1VB6 A;  1NLZ A;  3H9W A;  4P6Z M;  3O5Y A;  5DFX A;  3B42 A;  1XFQ A;  2VV6 A;  3LYX A;  5J4E A;  2HF6 A;  2I9V A;  2NUT C;  2WKR A;  4L0L A;  2VGL S;  4R38 A;  2YKH A;  3OOV A;  3MXQ A;  2PYP A;  3K2N A;  3NOP C;  4I39 A;  2VA0 A;  3UE6 A;  3VOL A;  3OBF A;  2A2L A;  2D01 A;  3KSI A;  3VV4 A;  5J3W A;  1S1Y A;  1S66 L;  1OTA A;  3UB8 A;  2R78 A;  3CWF A;  2QYB A;  1T19 A;  3T4S A;  4EU0 A;  1TS8 A;  3PBR A;  3F1P A;  4O0P A;  3BW6 A;  5AJG A;  4F3L A;  1OJG A;  2W27 A;  1DRM A;  2H28 A;  3KSF A;  3LIB A;  5F68 A;  3H82 B;  4NXG A;  1VHM A;  3EQV A;  3IBJ A;  2IA2 A;  1Y28 A;  2PR6 A;  3PR6 A;  3TE8 A;  4EES A;  3E4O A;  2DMW A;  1P97 A;  2FH5 A;  4G3W A;  4HY8 A;  5K5B A;  4K08 A;  4IHQ A;  2J3T D;  2PDR A;  2LB5 A;  5TJJ A;  2V1B A;  2V1A A;  4MMN A;  1H3Q A;  4MCW A;  2O0Y A;  1TS7 A;  4EEP A;  2W3E A;  5HZH A;  3T4L A;  2J80 A;  1OTD A;  1NLY A;  5DKK A;  4KQO A;  1W63 Q;  4GJ4 A;  3OLO A;  4DJ2 A;  3P7N A;  3TRC A;  1MZU A;  4I5S A;  2PT7 A;  2JHE A;  2O9B A;  3R7W B;  3VE3 A;  3A0S A;  5G4Y A;  3KYZ A;  2Y8H A;  2Z6C A;  5KIZ A;  3S7Q A;  4R6L A;  1F9I A;  4JGR A;  4G3K A;  1LSX A;  2D02 A;  1T18 A;  1N9N A;  2K2N A;  3CUE C;  4R70 A;  3C2W A;  1YSP A;  3P01 A;  1JNU A;  5DFY A;  1S4R A;  2FZ0 A;  4HP4 A;  3EGD C;  1XJ4 A;  2QJ7 A;  3KYQ A;  4YNR A;  1T1B A;  2W0N A;  1UGU A;  3UB6 A;  4EET B;  2BAS A;  4NXB A;  4GCZ A;  2NUP C;  3LFV A;  2LB9 A;  5HPF A;  4WEJ A;  4EER A;  2L0W A;  2XA7 M;  4PKY G;  4KQD A;  3HCY A;  3TW8 A;  3LIF A;  3PBT A;  2EA9 A;  5TBM A;  1N9O A;  3BQ8 A;  2J3T C;  4IUH A;  4ETX A;  4LRZ E;  4GLQ A;  3MF0 A;  5HL6 A;  4I3A A;  2B02 A;  5AVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...