4WN5A

Crystal structure of the c-terminal per-arnt-sim (pasb) of human hif-3alpha9 bound to 18:1-1-monoacylglycerol
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
108
Chain Sequence
HMGRGAFLSRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSKGQAVTGQYRFLARSGGYLWTQTQATVVSGRGPQSESIVCVHFLISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Unsaturated fatty acids as high-affinity ligands of the C-terminal Per-ARNT-Sim domain from the Hypoxia-inducible factor 3alpha
doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Hypoxia-inducible factor 3-alpha
total genus 30
structure length 108
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4wn5A00
2INWA 2PD7A 2VEAA 3A0VA 3SW1A 1GSWA 1OTDA 5HWWA 1OTIA 2JN7A 2PR6A 2K7SA 1GSVA 2JHEA 3F1NA 4GHIA 5J7EA 1UWNX 4EETB 4HH3A 4NXFA 4WN5A 1N9LA 1S1YA 4JGOA 5HDDA 5TBMA 2M1CA 5HZHA 3H9WA 4I5SA 3HJIA 4NXEA 3LYXA 4HOIA 1DP8A 4HP9A 5F68A 1T1BA 2WKPA 1OJ5A 2YKFA 3RTYA 4BBTA 3VOLA 1GSXA 1TS8A 2L0WA 4JGQA 1DP6A 1D7EA 1T1CA 5I5LA 5TBMB 3ULFA 4JGPA 4EEUA 4DJ3A 4EERA 4HH2A 2V0UA 2QKPA 2PDRA 2QWSA 3A0RA 3F1OB 2OOLA 3E4QA 5EFWA 2OWJA 4L9EA 1XJ3A 4GCZA 4GHIB 4NXGA 5DJTA 3C2WA 4HI4A 1LT0A 5F5YA 1OT6A 5AVFA 1OT9A 4YWZA 5HWVA 1LSVA 3NOPC 1TS6A 3F1PB 4MN5A 2H28A 4R38A 2ZOHA 1F9IA 3PYPA 4H6JB 1S4SA 2A24B 4HIAA 3LI8A 4BBVA 2ZOIA 2D01A 2VV8A 3D72A 3K3DA 3LICA 1ODVA 3MJQA 1P0ZA 3T50A 3UMDA 2VV6A 5HD3A 3NJAA 4NXBA 3UB6A 3H82A 2L1MA 4KUKA 1G28A 3ICYA 2KDKA 2W0NA 1VB6A 1EW0A 3GDIA 1X0OA 3IBRA 1OTAA 1N9NA 4WF0A 5IU1A 3UB8A 3BWLA 3H7WB 4R6LA 4LRYC 5J3WA 2Z6CA 1WA9A 2GJ3A 2VLGA 4R3AA 3CWFA 5F6AA 1NWZA 3NHQA 4HJ6A 2B02A 5HSQA 2HV1A 3F1PA 3UMEA 1V9YA 4GW9A 3CLOA 3LIFA 3H7WA 5J4EA 1S1ZA 4HP4A 3OLOA 4F3LA 4M4XA 2PD8A 3F1OA 1TS0A 3LIDA 5HDCA 4EEPA 1S4RA 3CAXA 4HJ3A 2PYRA 2D02A 4WUJA 1LSWA 1OTEA 3A0SA 5AVEA 3LIBA 3ZQ5A 1XFQA 5KIZA 1UWPX 4WL9A 5DKLA 1V9ZA 2EA9A 2KX6A 2PYPA 2V0WA 4DJ2A 4JGRA 2R78A 2WKRA 4KQDA 2V1BA 3MQQA 5G4ZA 3RH8B 4EQ1A 5IS1A 1P97A 2YKHA 3LIEA 1T18A 4RQ9A 4KUOA 3UB9A 2P7JA 5HDSA 3LUQA 2PHYA 2QHKA 4LPZA 3FG8A 5DJUA 3MQOA 4HHDA 3IS2B 3G6OA 4LRXC 4EXOA 2V9AA 4H6JA 2QJ7A 1N9OA 3B33A 4I3AA 3MR0A 3C8CA 2Z6DA 3LIAA 3NOUC 4LLOB 2I9VA 4B9OA 5A8BA 3H82B 4MN6A 5G4YA 3VE3A 4HNBA 4LRZE 4GS9B 3NOTC 4I39A 3EWKA 1OTBA 4XT2A 2WKQA 2ZBBA 4EW7A 1DRMA 3GECA 3BY9A 2V1AA 1BYWA 4HQAA 4HY8A 4XT2B 1T19A 5DKKA 5HD5A 3IS2A 4HJ4A 2L4RA 4R70A 1XFNA 2BASA 2W27A 1T1AA 3E4PA 2PR5A 3E4OA 3MXQA 4GS9A 4PKYG 2VV7A 2OWHA 3UB7A 1JNUA 1S67L 4F3LB 3BY8A 1D06A 1S66L 2CMNA 4BBUA 3F1NB 4WLAA 4I3JA 1XJ2A 3HJKA 3P7NA 1LSXA 3K3CA 1OJGA 1F98A 2A24A 3VE4A 1KOUA 5HWTA 1MZUA 3MFXA 3EEHA 3PHYA 4L9FA 3UE6A 4I38A 3FC7A 4PKYA 3KX0X 2J80A 4I3IA 4L9GA 5F69A 1UGUA 4EESA 4K08A 1XJ4A 1LL8A 1TS7A 1Y28A 1DP9A 4E04A 1XJ6A 2QJ5A 3LI9A
chains in the Genus database with same CATH superfamily
4OPRA 3A0VA 3DAVA 1GSVA 2ZC4B 1K4FA 2Q9MA 3N8SA 5TBMA 2M1CA 3E98A 3N6IA 4DF6A 3FPWA 4UQIS 5I5LA 2HP6A 4JGPA 3OPPA 2O9CA 2EFXA 2PAVP 2XA7M 3EQUA 3NOPC 4OOLA 3IX3A 3MJQA 4XXRA 5DTTA 4WF0A 2NUPC 3PTEA 4HEFA 1NRFA 4KQRA 1H8MA 2EX2A 1S1ZA 4BWIA 4C6YA 2J7VA 1K4EA 4QU3A 4WUJA 4ETXA 2ZC5B 3MQ0A 2Y2MA 4Y5FA 5FQJA 4IHQA 5GL9A 3O5YA 2XSSA 3WS2A 2X71A 5A8BA 3QP4A 3H82B 2BG1A 1SDEA 3BY9A 3PR6A 5CHJA 4HQAA 2HGVA 5FATA 4GD6A 4PM9A 3MXQA 3UB7A 5CEBA 4DKIA 1HZOA 3BY8A 1F98A 1XGIA 3VE4A 5HL1A 2C5WB 3E0YA 3WS5A 3N8RA 4S2LA 1DP9A 5DF8A 2BTFP 3LR3A 2WGVA 1UWNX 2IA2A 1WE4A 2JKFA 2QMIA 3UDXA 2FZ0A 2ZLYA 3HUOA 5HPIA 1NY0A 3EGXC 4E6XA 1DP6A 1XPBA 1K56A 2O9AA 3W4PA 3C7UA 4Y13A 5F5YA 5F1FA 3UE0A 1Q2PA 1OMEA 4KZBA 2D01A 4LV1A 3SS5A 3GMWA 5FAOA 2FH5A 1VB6A 1SZVA 3LY3A 4EBPA 5EVIA 1YQSA 3IF6B 5TJJA 3DTKA 4B4ZA 3C4OA 1GHMA 1VM1A 1SCWA 1FCMA 1TD5A 5EOEA 3SS3A 5AVEA 3BFFA 3QNCA 1V9ZA 2EA9A 3BQ8A 3BJNA 3L7HA 2WKRA 3S22A 2V1BA 3HLGA 5KMWA 4YINA 3NCKA 2Y79A 2VGJA 5HFOA 4CLCE 2OAQ1 4XUZA 3B33A 4I3AA 1KVLA 4MDZA 5G18A 5FL3A 1S6RA 5EUAA 2J9OA 2W1RA 5CGWA 5L2FA 1PIOA 2WKEA 2P74A 4WEJA 4X68A 1KVMA 2VV7A 2ZL1A 1JNUA 1FR6A 3IXDA 2XGNA 3BEBA 4D2OA 4BBUA 4JBFA 4U0XA 4OPQA 1KOUA 4GLQA 1MWTA 1E4DA 3KX0X 1TDGA 2P9VA 1ZHHB 1YAXA 4QJGA 3UY6A 1CK3A 4GN2A 4E3IA 1IKGA 3M6HA 2VKSA 3Q07A 5HZHA 2EXAA 2ZM0A 1OJ5A 1IOUA 2UWXA 3ZG7B 1PWCA 2WKHA 4HH2A 3E4QA 3CUEC 4DE0A 5FI7A 2WUQA 5AQBA 1S4SA 5GLBA 5CGXA 3H82A 2OV5A 1N4OA 4DXBA 1W8YA 2W3FA 1JVJA 5F6AA 2RL3A 3H7WA 2PBYA 2R9XA 3CMZA 4KZ9A 3CAXA 4OQHA 3T12B 4OQIA 4ZRRA 2G2WA 2KLIA 4DJ2A 2PRFA 3G32A 4KQDA 3G4PA 4RYEA 4X53A 2K31A 4ZDXA 3AGEA 2Y4AA 3BLSA 1ONGA 1FILA 3W4OA 4I39A 3T4JA 4EW7A 2XH9A 4P6ZM 1BLSA 4HY8A 1MC0A 1BTLA 3HLCA 4MLLA 5HAIA 4OQGA 3P7NA 2ZC7A 1MZUA 3UNWA 3CZDA 3SH7A 1LL5A 2E8IA 4EESA 3V5MA 2Y2GA 3MXRA 4HESA 1KE3A 2E8JA 4E6WA 3B42A 4E3KA 5GHXA 2LB5A 2JHEA 5A91A 3TG9A 4CJNA 3OOVA 5CTNA 1O7EA 4RA7A 4IJGA 3UN7A 3FZCA 4OP8A 4WBGA 2Y91A 1Z09A 3VP4A 3EQVA 4EERA 4L9EA 3IWIA 2ZOHA 4X55A 3TRCA 1NYYA 3D72A 1ODVA 4Y15A 3NJAA 3FKWA 1MPLA 1ALQA 2G2UA 5J4EA 3M6BA 4E3MA 4S2JA 5M18A 4BLMA 3ZYTA 4OLGA 2JKRI 3KO6A 4ZJ1A 3W4QA 2PU4A 4NEED 3RH8B 4RX2A 4OVDA 2QHKA 2WZZA 4K0XA 3RXWA 1CJFA 3RFBA 3WRTA 2H5SA 2XFTA 3OC2A 1DJBA 2OLVA 4EU0A 4MN6A 3CJMA 4LCLA 5AQAA 3G31A 1XFNA 3R7WA 3CITA 4G3WA 1VQQA 4ZBEA 2CMNA 3K3CA 4QY6A 2HZ5A 1D1JA 2ZQ8A 2CC1A 3T1QB 1IYQA 4Y0TA 5L10A 2Y8HA 1BLHA 1GSWA 4NKPA 2JN7A 3TOIA 3MSHA 4EETB 4ETZA 1N9LA 1S1YA 3OPLA 4HOIA 5EVID 3RTYA 3GVBA 4S2OA 2Y2IA 3VOLA 2RCXA 2Y2PA 3KSHA 3PAEA 2VGLM 4DJ3A 3PXPA 2V0UA 2J9PA 2QWSA 1LLBA 2G7UA 4PM6A 1PFLA 4G3KA 5L09A 4KENB 4E3JA 3PBTA 3ZVWA 1H5XA 3V50A 2VX8A 3IBRA 2EWWA 4OLDA 3SH9A 4E3NA 3MF0A 3P98A 3F1PA 1Y54A 4ARZB 2XD5A 2C6WB 3F1OA 1BT5A 4JPMA 1S4RA 2EX6A 1PNEA 3A0SA 2ZJ9A 3PBOA 2VGKA 3MQQA 5CTMA 2YKHA 4KUOA 4N1HA 4P6BA 1XKZA 4BQMA 3MS6A 3NOUC 4L0LA 4ID4A 5AQ9A 3N8LA 1LL9A 4DRTA 2HP9A 2ZQ7A 2BASA 4MN7A 1H3QA 1HLUP 1NYMA 1IELA 4DDYA 4U3TA 4GKUA 3IH9A 3ZGAB 2B5RA 2P04A 1RGZA 3GQZA 1PW1A 1FCNA 1Y28A 5E2GA 2W1TB 5TGFA 2Z2MB 2VEAA 3BQAA 1BLPA 2XA7S 3QNBA 2XF3A 3Q1FA 2A49A 3NIAA 2Z2LB 4Q0HA 2Q9NA 3SOIA 4B93A 4UA9A 5F68A 2J8YA 4CLCD 2VJWA 4QB8A 1G68A 5EFWA 1XJ3A 4GCZA 4NXGA 5DJTA 4G3VA 3EEAA 4YWZA 3F1PB 4QY5A 4X1LA 2NUTC 3T50A 3P09A 3UB6A 1FOFA 4LCMA 1LHYA 2W0NA 1OTAA 1XA7A 1HD8A 1IEMA 3CG5A 1ZG4A 3FYZA 3NBLA 3ZFZA 5I94A 4MEZA 3QHYA 1YMSA 3ZG5A 3HUMA 5HDCA 4EEPA 1IFQA 4U0TA 1OTEA 4KG2A 3SH8A 3ZQ5A 5J8XA 1SKOA 2PYPA 4PM8A 2Y2HA 3FV7A 4ZAMA 3LR5A 3CI6A 5DFYA 3HL9A 1BULA 2B18A 5M19A 1K55C 3MZEA 4LV2A 2Z6DA 4B9OA 2JE5A 3NOTC 2HDRA 4AFIA 2ZBBA 1DRMA 2J3TC 5FI6A 5HD5A 4ZJ3A 1JWVA 4HJ4A 2L4RA 3O87A 3LGOA 3IWQA 4R3JA 3F1NB 5F83A 4KZ6A 5E43A 3MZDA 4FH2A 3CPTB 1JTDA 3HLBA 2B95A 3GR2A 1TS7A 3LI9A 4BENA 5E2HA 4BMWA 2ZQAA 4OOYA 4WMCA 1XX2A 3JYIA 3ZNTA 4WELA 4HP9A 2JKTI 4N1XA 1EROA 3PAGA 1VETB 1YLTA 5FDSA 3NECA 5A90A 5HWVA 4BD0A 2A24B 5HAPA 5EVEA 5EVLA 3UMDA 5DF9A 4KUKA 4BL2A 3IXHA 3LY4A 3BFCA 2ZM8A 4Y0UA 1YPRA 4KQOA 2V8CA 1WA9A 3CWFA 1NWZA 3DWZA 4HJ6A 3KYEA 4GW9A 4HP4A 1VEUB 1A0KA 5FSRA 1Q2QA 4YFMA 4N9LA 3VP2A 4QD4A 4LENA 4S2IA 2XD1A 4KG6A 1QMEA 3PBSA 1EI5A 1NZUA 2R78A 5DFXA 1PRQA 1KGEA 5DJUA 4FOFA 5HARA 3FG8A 4ARZA 1YT4A 4LRXC 2V9AA 2XLNA 4H6JA 2WAFA 1L0FA 5FDHA 2X02A 3C8CA 5TR7A 1CF0A 2I9VA 3BFDA 4N92A 3PBNA 1H8ZA 4LRZE 5IHVA 4LV0A 4YOFA 1EWZA 1BLCA 4XT2B 4EV4A 2WZXA 4BJPA 1T1AA 4K0WA 4F3LB 3B3XA 1D06A 3ZCZA 4WLAA 4S2MA 5JYPA 2LB9A 1N9BA 4QWOA 4DMZA 1E25A 2H0YA 3U4LP 4EBLA 3FC7A 4MBFA 4L9GA 2JKTM 3T4OA 3CHWP 4EQIA 3V39A 3V3SA 1OTIA 2HDQA 3HLDA 4K91A 3C4PA 3KSFA 1T1BA 2WKPA 4D60A 4BBTA 1GSXA 1W79A 1NXYA 4X6TA 4QHCA 2ZOIA 1YSQA 4EWFA 1L2SA 4MNRA 2UV0E 1F2KA 1N9NA 1MWSA 2B02A 5HSQA 2HPBA 3IX4A 1JWPA 5CX7A 3LIDA 3PBQA 2IWBA 5CXWA 3OCLA 4WL9A 3HCYA 4C75A 4JGRA 5G4ZA 4DDSA 4P0MA 3UE1A 3WRZA 4IBXA 1OPXA 4WMCD 4NETA 1IKIA 3ZG9B 3HUNA 5L8MA 3IHAA 1OTBA 3D4FA 2ZQDA 4GJ4A 4IEDA 2W27A 3E4PA 3E4OA 1L0GA 4WM9A 3HJKA 1K55A 4KZ8A 1LSXA 1MKIA 2A24A 3Q7ZA 3IH8A 4JF5A 4I38A 1G6OA 1NJ4A 4DXCA 1BSGA 1CEGA 5FA7A 4IUHA 3LR0A 1XJ4A 3FWLA 5EE8A 4JXGA 3E2KA 2DNSA 1OTDA 4DE1A 3F1NA 5J7EA 3A3FA 3VFFA 5EV0A 4JGOA 2XR0A 3A3IA 1E3UD 4FTXA 2OOLA 3MZFA 4M3KA 1GCEA 4R38A 4JXSA 1W63Q 1MWUA 3ITAA 1STZA 1PI4A 2Y59A 3LFVA 2ZMFA 3K2NA 1G28A 3NY4A 2Y2NA 3GV9A 2HJEA 5FASA 3H7WB 4LRYC 2Z6CA 2VLGA 3LR4A 3CLOA 1KGGA 4F3LA 1XP4A 2P9VB 5AQ7A 2D02A 3FPVA 3LEQA 4FD8A 3WS1A 5HW3A 2V0WA 2XQZA 4N9KA 1P97A 1FR1A 4R4SA 3UB9A 4RQ9A 2PHYA 3S7NA 3BECA 1L0EA 1Z6FA 2QJ7A 3MKEA 4UA7A 3VSLA 5G4YA 3KYQA 1MWRA 1K57A 4GS9B 3S7QA 2W3DA 3JVVA 3UDFA 2WKQA 2W3GA 4Q0JA 5KZHA 4FH4A 4RVAA 2JBFA 3WS4A 2KOIA 4XUXA 2V2FF 4UEYA 2Q0OA 4OOMA 1K6RA 2ZM2A 2J80A 3S7OA 1MKMA 5CEDA 2OAP1 3MFDA 4K08A 4PM5A 3DTMA 3T1XA 2J3TD 1KDWA 2QZ6A 4UQIM 3D9YA 4I5SA 4NXEA 4WZ4A 4EUZA 3ULFA 1JWZA 2PDRA 3A0RA 4GHIB 5AVFA 1LSVA 4BBVA 1F9IA 1I2WA 1P0ZA 5EOOA 2VV6A 5HD3A 3T4SA 5HPFA 1X0OA 4CLCC 1K6SA 1Y4OA 4E3LA 4ME4A 5L07A 2Y55A 2AVXA 3DWKA 1O07A 4Y7PA 1ESIA 5HAQA 4JXWA 1PZPA 3KSIA 1XFQA 2KX6A 3NI9A 1XXMA 3T4LA 5HX9A 3LIEA 1IYPA 4LPZA 4R4RA 1MXOA 3SS4A 3IF6A 1YLJA 4EXOA 1CQAA 5FQ9A 3VE3A 3Q7VB 3C5AA 4JLFA 3A3DA 4MBKA 4KZ4A 4O01A 3R7WB 3UDIA 4DE2A 4OH0A 1U60A 3O86A 1ES3A 1J3WA 3I7JA 3U2AA 4NG2A 4Q8IA 1ESUA 4X1MA 1ZG6A 4ZJ2A 1M6KA 1ES2A 4IVIA 5D3OA 3PHYA 5EM1A 2PBDP 4PKYA 2DCFA 4KZ3A 3MXSA 3G2YA 4O7DA 5FQKA 5EM0A 3SZTA 4RX3A 3MMHA 1YMXA 1RGYA 4WYYA 1WYBA 2PT7A 4GHIA 4NK3A 1AWIA 3HLEA 3HJIA 2JKGA 2YKFA 4KZAA 2VA0A 2K2NA 4JGQA 5TBMB 3F1OB 1TVFA 2ZL1B 4OKPA 2PU2A 3VOZA 4B4XA 4HI4A 4MN5A 2ZQ9A 2VV8A 1YLPA 3AGDA 1LI9A 3IHBA 3BLMA 1EW0A 4WEKA 4H8RA 3Q82A 3C7VA 4GDNA 4LGWA 4X25A 2EWVA 2HF6A 1NLZA 1J9MA 5M1AA 5F82A 1GHPA 4IBRA 4DN0A 4B88A 5DF7A 4IVKA 3G34A 4ZTKA 3LIBA 2V8FA 4MCWA 1FSYA 4PPRA 3P01A 2IWCA 2O9BA 5GHYA 1PWGA 5A93A 2A2LA 1NZOA 1XGJA 1N9OA 1CEFA 3MR0A 5FAQA 5TFQA 2I72A 5CRFA 3V67A 4LV3A 3EWKA 1BYWA 2WK0A 2O0YA 2PR5A 3LO7A 2OWHA 2XEPA 1PW8A 2HJ9C 4L9FA 2DMWA 3O88A 3TSGA 5CECA 4OONA 1NRJA 3G30A 2PD7A 4KG5A 4P85A 3NDGA 4OQ0A 4Z1WA 4R23A 3PBRA 5LBRA 3OZHA 3H9WA 4GDBA 3LYXA 5F1GA 5HWWA 2MJ6A 2XFSA 3UE3A 2GX5A 3ISGA 3RXXA 3RJUA 3C30A 4O0PA 3FKVA 3T4QA 4EBNA 3LI8A 1K38A 4X56A 4O8GA 2OLUA 2L1MA 3AGFA 1VETA 4EUVA 3HREA 3UB8A 5J3WA 3V3RA 5FEGA 3WWXA 5FAPA 1C3BA 3C38A 2DRWA 1YLZA 4M4XA 2WGWB 3VSKA 4WZ5C 4HJ3A 4LFUA 3T1SA 1LSWA 4WZ5A 2Y2KA 2P7JA 3MQOA 4HHDA 1W5DA 1FCOA 5FI2A 3BRMA 4S2NA 1H0MA 1WYCA 3D3OA 4JXVA 3JPUA 1ONHA 4OPYA 2WYXA 4II7A 3UE6A 3BFEA 3O3VA 3VOYA 1S66L 4PMAA 4I3JA 1G5UA 1OJGA 1YKDA 1DJAA 3IF6C 2XK1A 2JKRM 3T4TA 1XJ6A 2HP5A 1ZC2A 1I5QA 5DTSA 4MMNA 2IWDA 3QP2A 4FCFA 4S2PA 3BFGA 2EFUA 2ZD8A 5AJGA 3VMAA 2WADA 2ZC3B 2OWJA 1RP5A 1KE0A 1SHVA 3PYPA 3IF5A 5KSHA 1BUEA 2BLSA 3UB5P 2KDKA 4PM7A 1DY6A 2HDSA 3S4XA 3KSGA 1ES4A 4GNUA 3VP0A 3Q7VA 4GB7A 1PWDA 2PD8A 3LEZA 1TS0A 2FFFB 2XROA 4UAAA 4EQ1A 3HVFA 1L0DA 4QPRA 5BOHA 2V1ZA 3IWOA 3G6OA 2GZAA 4GZBA 4FUWA 3LIAA 4LLOB 4A5RA 3TE8A 4UA6A 1HTZA 5IT5A 3OPRA 3ITBA 4ESPA 3IS2A 4R70A 3ZDJA 4GS9A 4PKYG 3MBZA 3OBFA 3Q81A 4HBUA 3HLWA 2XDMA 4S2NC 3B47A 2O99A 5FQIA 3LCEA 4E3OA 1KGFA 3G35A 2K7SA 3UO9A 1YLWA 2WGWA 4R3BA 1BZAA 5JYOA 3ZG0A 3VP1A 1IYOA 1K0KA 5HL6A 1P9WA 2ZQCA 4BD1A 3R4KA 4R0QA 4EEUA 1PI5A 2QKPA 3T1RA 3C2WA 1OT9A 2H28A 4UHUA 3VP3A 5EPHA 4KQQA 3LICA 4R1GA 3NDEA 5U47A 4NXBA 4OPZA 3ICYA 3DBAA 3BWLA 4R6LA 2GJ3A 4PHTA 2HV1A 4FSFA 4S2KA 3LIFA 3UPNA 2M7UA 1YLYA 2V20A 3HLFA 1PYYA 1DJCA 2PYRA 2Y2LA 1UWPX 5DKLA 5DVAA 5KSCA 3OPHA 2ZC6B 5CGSA 3IXBA 1YSPA 3IS2B 4BL3A 4C3QA 3KYZA 2V1AA 3ZG8B 3DTEA 1JTGA 1MY8A 3G2ZA 1XA1A 2WAEA 3ZHHA 4X69A 1XJ2A 2P08A 5C5KA 5EECA 4JF4A 5HWTA 4KZ5A 1FSWA 3TJZC 4Y3IA 5F69A 1UGUA 3NULA 3GTCA 2GDNA 2H10A 2INWA 3QP6A 3IX8A 1KE4A 1CI9A 1H8YA 3NC8A 4IUKA 1G6AA 4HH3A 4NXFA 2QPNA 5HDDA 3N7WA 2JC7A 1ERQA 5FEFA 2ACGA 4Y2FA 1TS8A 1D7EA 1T1CA 3T4KA 2J3WA 2WGIA 2EX8A 3SW1A 1LT0A 2Y2OA 1OT6A 1W7FA 4H6JB 5GLDA 3S7PA 4HIAA 3UPOA 1AXBA 1TF1A 5A92A 1MBLA 4GOGA 5MC7A 3CUEA 1E3UA 1F5MA 5IU1A 3EGDC 4R3AA 3NHQA 2HDUA 1VHMA 3UMEA 1V9YA 3OLOA 4JF6A 3IT9A 4Q0IA 5K5BA 2EX9A 5CHUA 5CERA 3E2LA 1SDNA 5E2FA 3IXGA 5GLAA 5KIZA 3ZVTA 1KDSA 3HBRA 5IS1A 1T18A 2VZWA 1FQGA 1TDLA 4CLCB 2VGLS 4PAUA 1YM1A 3N4IA 2XRNA 1SKFA 3ZNYA 3BM6A 3S1YA 4HNBA 1ACFA 4CPKA 2ZMAA 1T19A 5DKKA 1FIKA 5GHZA 2Y2QA 2Y2JA 2WKIA 1VEUA 1LI0A 3W8KA 5FQMA 1ZTUA 1GHIA 1W8QA 4Z9QA 4I3IA 3IQAA 4E04A 1LL8A 1HVBA 3MFXA 3A3EA 2X01A 3JVUA 3GRJA 5CHMA 1K57C 2PR6A 2W1TA 4CQHA 4WN5A 3M2JA 1K54C 4DE3A 2A3UA 1RCJA 1DP8A 1M40A 1P9RA 2L0WA 5EVIB 3MKFA 5EVIC 3M2KA 1K54A 3EOIA 3L9KA 1NLYA 3QP8A 4MBHA 3IBJA 2QYBA 3QP1A 1TS6A 3UPPA 5DTKA 2OSUA 3K3DA 1ERMA 4OP5A 4F94A 1K56D 3GDIA 4Y17A 4KZ7A 1TEMA 2EXBA 3BW6A 2W3HA 3A3JA 2JCHA 1S0WA 5E2EA 1I2SA 2W3EA 2FFYA 5FQQA 2GNXA 3VV4A 2ZMVA 3OCNA 3W2ZA 5HDSA 1PZOA 1K25A 1SKOB 3LUQA 5GLCA 2M7VA 4CLCA 3GSGA 4P87A 3DTIA 3VFHA 4JKTA 4Y0OA 1CI8A 4P6ZS 3TW8A 3QP5A 4XT2A 3GECA 1IYSA 3DW0A 1ES5A 1S67L 1GA0A 2R9WA 3BYDA 1L3LA 4HBTA 1W63M 2H0TA 3EEHA 1ZKJA 2VK3A 4YNRA 3WS0A 1GA9A 4GD8A 1QMFA 2QJ5A 3CPTA
chains in the Genus database with same CATH topology
3A0VA 2Y8HA 1GSWA 4MMNA 4NKPA 1OTDA 2JN7A 1GSVA 3F1NA 5J7EA 4EETB 4ETZA 1N9LA 1S1YA 4JGOA 5TBMA 2M1CA 4HOIA 3RTYA 3E98A 3FPWA 3VOLA 4UQIS 3KSHA 5AJGA 5I5LA 2VGLM 4JGPA 4DJ3A 3PXPA 2V0UA 2QWSA 2OOLA 2G7UA 2O9CA 2OWJA 2XA7M 3EQUA 3NOPC 4R38A 3PYPA 4OOLA 1W63Q 4G3KA 1STZA 5KSHA 3MJQA 3PBTA 3LFVA 2ZMFA 3K2NA 1G28A 2KDKA 2VX8A 3IBRA 2EWWA 4WF0A 2NUPC 2HJEA 3H7WB 4LRYC 2Z6CA 2VLGA 3LR4A 3KSGA 3MF0A 3F1PA 1H8MA 4ARZB 3CLOA 1S1ZA 4BWIA 4F3LA 2PD8A 3F1OA 1TS0A 1S4RA 2D02A 4WUJA 3A0SA 3FPVA 2XROA 3PBOA 2V0WA 4ETXA 4EQ1A 3MQQA 1P97A 2YKHA 3UB9A 4RQ9A 4KUOA 4QPRA 2PHYA 3MQ0A 3S7NA 3G6OA 4Y5FA 2GZAA 4IHQA 3O5YA 2QJ7A 2XSSA 3NOUC 4L0LA 3LIAA 5A8BA 4LLOB 3H82B 3TE8A 5G4YA 3KYQA 5IT5A 4GS9B 3S7QA 2W3DA 3JVVA 2WKQA 3BY9A 3PR6A 2W3GA 4HQAA 2HGVA 3IS2A 4Q0JA 4R70A 3MXQA 2BASA 4GS9A 1H3QA 4MN7A 4PKYG 3UB7A 2KOIA 3BY8A 3OBFA 4UEYA 1F98A 3VE4A 4OOMA 3E0YA 2P04A 2J80A 3S7OA 1MKMA 3B47A 2OAP1 4K08A 1Y28A 1DP9A 2W1TB 2O99A 2VEAA 3BQAA 2XA7S 2J3TD 3LR3A 2K7SA 1UWNX 2IA2A 4UQIM 4B93A 4Q0HA 4I5SA 2FZ0A 4NXEA 5HL6A 5F68A 1P9WA 5HPIA 3EGXC 4CLCD 2VJWA 1DP6A 2O9AA 3ULFA 3R4KA 4EEUA 2QKPA 2PDRA 3A0RA 5EFWA 1XJ3A 4GCZA 4GHIB 4NXGA 5DJTA 3C2WA 4G3VA 5F5YA 5AVFA 1OT9A 3EEAA 4YWZA 1LSVA 3F1PB 2H28A 4BBVA 1F9IA 2NUTC 2D01A 3LICA 1P0ZA 3T50A 2VV6A 5HD3A 4NXBA 3UB6A 3ICYA 2FH5A 2W0NA 1VB6A 3T4SA 5HPFA 1X0OA 4CLCC 1OTAA 3DBAA 3BWLA 4ME4A 4R6LA 2GJ3A 4PHTA 2HV1A 4FSFA 3LIFA 5TJJA 2M7UA 5HDCA 4EEPA 1IFQA 1TD5A 2PYRA 1OTEA 5AVEA 3KSIA 3ZQ5A 1XFQA 1UWPX 5DKLA 1V9ZA 2EA9A 2KX6A 2PYPA 3BJNA 3BQ8A 2WKRA 2V1BA 3T4LA 3LIEA 3LR5A 4LPZA 3CI6A 1YSPA 2Y79A 3IS2B 5DFYA 4EXOA 4CLCE 2OAQ1 2B18A 3B33A 4I3AA 2Z6DA 4MDZA 4B9OA 3VE3A 3R7WB 5FL3A 4O01A 3NOTC 4AFIA 2ZBBA 1DRMA 2J3TC 3KYZA 2V1AA 5HD5A 2W1RA 4HJ4A 3U2AA 2L4RA 4WEJA 2VV7A 1JNUA 4BBUA 3F1NB 1XJ2A 2P08A 5C5KA 1KOUA 5HWTA 4GLQA 3TJZC 3PHYA 4Y3IA 4PKYA 3KX0X 1ZHHB 5F69A 1UGUA 1YAXA 1TS7A 3LI9A 2INWA 3MMHA 2PT7A 4BMWA 4IUKA 4GHIA 2VKSA 4HH3A 4NXFA 5HDDA 5HZHA 3HJIA 4WELA 4HP9A 2YKFA 1OJ5A 2JKTI 2VA0A 1IOUA 2K2NA 4Y2FA 1TS8A 4JGQA 1D7EA 1T1CA 5TBMB 3T4KA 2J3WA 4HH2A 3F1OB 3E4QA 3SW1A 3CUEC 4HI4A 1LT0A 1OT6A 5HWVA 4MN5A 4H6JB 3S7PA 1S4SA 2A24B 4HIAA 2VV8A 1TF1A 3UMDA 5DF9A 3H82A 5MC7A 4KUKA 3CUEA 1EW0A 1F5MA 4KQOA 4WEKA 5IU1A 3EGDC 1WA9A 4R3AA 2W3FA 2EWVA 3CWFA 2HF6A 1NWZA 5F6AA 1NLZA 3NHQA 4HJ6A 1VHMA 3UMEA 1V9YA 4GW9A 3H7WA 4HP4A 3OLOA 4Q0IA 4DN0A 5K5BA 3CAXA 3LIBA 3PBSA 5KIZA 4MCWA 4ZRRA 2KLIA 4DJ2A 2R78A 4KQDA 5DFXA 5IS1A 3P01A 1T18A 2O9BA 2VZWA 5DJUA 4FOFA 3FG8A 2K31A 2A2LA 4ARZA 4CLCB 2VGLS 4LRXC 2V9AA 4H6JA 1N9OA 4PAUA 3MR0A 3C8CA 2XRNA 2I9VA 3PBNA 4HNBA 4LRZE 3V67A 4I39A 3EWKA 4YOFA 3T4JA 4EW7A 4P6ZM 4HY8A 1BYWA 4XT2B 1T19A 1MC0A 5DKKA 4BJPA 2O0YA 1T1AA 2PR5A 2OWHA 4F3LB 1D06A 4WLAA 2LB9A 3P7NA 2HJ9C 1ZTUA 4DMZA 1MZUA 4L9FA 2DMWA 3FC7A 4I3IA 4L9GA 2JKTM 4EESA 3T4OA 1LL8A 4E04A 3MFXA 1NRJA 2PD7A 3JVUA 1OTIA 2PR6A 3B42A 2W1TA 4Z1WA 2LB5A 2JHEA 4CQHA 3PBRA 3OOVA 4WN5A 5LBRA 3H9WA 5HWWA 3LYXA 3KSFA 1DP8A 4IJGA 1T1BA 1P9RA 2MJ6A 2WKPA 3UE3A 2GX5A 4BBTA 1GSXA 2L0WA 3EOIA 1NLYA 3EQVA 4EERA 3C30A 4L9EA 3IBJA 2QYBA 4O0PA 1TS6A 2ZOHA 3T4QA 3LI8A 3TRCA 2ZOIA 1YSQA 3D72A 3K3DA 1ODVA 4O8GA 3NJAA 2L1MA 3GDIA 4EUVA 1N9NA 3UB8A 3BW6A 2W3HA 5J3WA 2B02A 5HSQA 5J4EA 3C38A 5CX7A 4M4XA 3LIDA 3PBQA 4HJ3A 3ZYTA 2W3EA 1LSWA 3OCLA 2JKRI 2GNXA 3KO6A 4WL9A 4NEED 3HCYA 3VV4A 4JGRA 2ZMVA 5G4ZA 3RH8B 3OCNA 3W2ZA 2P7JA 5HDSA 3LUQA 2QHKA 1OPXA 3MQOA 4HHDA 2M7VA 3RFBA 4CLCA 3OC2A 4EU0A 4MN6A 5L8MA 4P6ZS 3TW8A 1OTBA 4XT2A 3GECA 3D3OA 4GJ4A 4II7A 1XFNA 2W27A 3CITA 3R7WA 3E4PA 3E4OA 4G3WA 3UE6A 1S67L 2CMNA 1S66L 4I3JA 3HJKA 1W63M 1LSXA 3K3CA 1OJGA 2A24A 1YKDA 3EEHA 4I38A 1G6OA 4YNRA 2JKRM 4IUHA 3LR0A 3T4TA 1XJ4A 1XJ6A 2QJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2INW A;  2PD7 A;  2VEA A;  3A0V A;  3SW1 A;  1GSW A;  1OTD A;  5HWW A;  1OTI A;  2JN7 A;  2PR6 A;  2K7S A;  1GSV A;  2JHE A;  3F1N A;  4GHI A;  5J7E A;  1UWN X;  4EET B;  4HH3 A;  4NXF A;  4WN5 A;  1N9L A;  1S1Y A;  4JGO A;  5HDD A;  5TBM A;  2M1C A;  5HZH A;  3H9W A;  4I5S A;  3HJI A;  4NXE A;  3LYX A;  4HOI A;  1DP8 A;  4HP9 A;  5F68 A;  1T1B A;  2WKP A;  1OJ5 A;  2YKF A;  3RTY A;  4BBT A;  3VOL A;  1GSX A;  1TS8 A;  2L0W A;  4JGQ A;  1DP6 A;  1D7E A;  1T1C A;  5I5L A;  5TBM B;  3ULF A;  4JGP A;  4EEU A;  4DJ3 A;  4EER A;  4HH2 A;  2V0U A;  2QKP A;  2PDR A;  2QWS A;  3A0R A;  3F1O B;  2OOL A;  3E4Q A;  5EFW A;  2OWJ A;  4L9E A;  1XJ3 A;  4GCZ A;  4GHI B;  4NXG A;  5DJT A;  3C2W A;  4HI4 A;  1LT0 A;  5F5Y A;  1OT6 A;  5AVF A;  1OT9 A;  4YWZ A;  5HWV A;  1LSV A;  3NOP C;  1TS6 A;  3F1P B;  4MN5 A;  2H28 A;  4R38 A;  2ZOH A;  1F9I A;  3PYP A;  4H6J B;  1S4S A;  2A24 B;  4HIA A;  3LI8 A;  4BBV A;  2ZOI A;  2D01 A;  2VV8 A;  3D72 A;  3K3D A;  3LIC A;  1ODV A;  3MJQ A;  1P0Z A;  3T50 A;  3UMD A;  2VV6 A;  5HD3 A;  3NJA A;  4NXB A;  3UB6 A;  3H82 A;  2L1M A;  4KUK A;  1G28 A;  3ICY A;  2KDK A;  2W0N A;  1VB6 A;  1EW0 A;  3GDI A;  1X0O A;  3IBR A;  1OTA A;  1N9N A;  4WF0 A;  5IU1 A;  3UB8 A;  3BWL A;  3H7W B;  4R6L A;  4LRY C;  5J3W A;  2Z6C A;  1WA9 A;  2GJ3 A;  2VLG A;  4R3A A;  3CWF A;  5F6A A;  1NWZ A;  3NHQ A;  4HJ6 A;  2B02 A;  5HSQ A;  2HV1 A;  3F1P A;  3UME A;  1V9Y A;  4GW9 A;  3CLO A;  3LIF A;  3H7W A;  5J4E A;  1S1Z A;  4HP4 A;  3OLO A;  4F3L A;  4M4X A;  2PD8 A;  3F1O A;  1TS0 A;  3LID A;  5HDC A;  4EEP A;  1S4R A;  3CAX A;  4HJ3 A;  2PYR A;  2D02 A;  4WUJ A;  1LSW A;  1OTE A;  3A0S A;  5AVE A;  3LIB A;  3ZQ5 A;  1XFQ A;  5KIZ A;  1UWP X;  4WL9 A;  5DKL A;  1V9Z A;  2EA9 A;  2KX6 A;  2PYP A;  2V0W A;  4DJ2 A;  4JGR A;  2R78 A;  2WKR A;  4KQD A;  2V1B A;  3MQQ A;  5G4Z A;  3RH8 B;  4EQ1 A;  5IS1 A;  1P97 A;  2YKH A;  3LIE A;  1T18 A;  4RQ9 A;  4KUO A;  3UB9 A;  2P7J A;  5HDS A;  3LUQ A;  2PHY A;  2QHK A;  4LPZ A;  3FG8 A;  5DJU A;  3MQO A;  4HHD A;  3IS2 B;  3G6O A;  4LRX C;  4EXO A;  2V9A A;  4H6J A;  2QJ7 A;  1N9O A;  3B33 A;  4I3A A;  3MR0 A;  3C8C A;  2Z6D A;  3LIA A;  3NOU C;  4LLO B;  2I9V A;  4B9O A;  5A8B A;  3H82 B;  4MN6 A;  5G4Y A;  3VE3 A;  4HNB A;  4LRZ E;  4GS9 B;  3NOT C;  4I39 A;  3EWK A;  1OTB A;  4XT2 A;  2WKQ A;  2ZBB A;  4EW7 A;  1DRM A;  3GEC A;  3BY9 A;  2V1A A;  1BYW A;  4HQA A;  4HY8 A;  4XT2 B;  1T19 A;  5DKK A;  5HD5 A;  3IS2 A;  4HJ4 A;  2L4R A;  4R70 A;  1XFN A;  2BAS A;  2W27 A;  1T1A A;  3E4P A;  2PR5 A;  3E4O A;  3MXQ A;  4GS9 A;  4PKY G;  2VV7 A;  2OWH A;  3UB7 A;  1JNU A;  1S67 L;  4F3L B;  3BY8 A;  1D06 A;  1S66 L;  2CMN A;  4BBU A;  3F1N B;  4WLA A;  4I3J A;  1XJ2 A;  3HJK A;  3P7N A;  1LSX A;  3K3C A;  1OJG A;  1F98 A;  2A24 A;  3VE4 A;  1KOU A;  5HWT A;  1MZU A;  3MFX A;  3EEH A;  3PHY A;  4L9F A;  3UE6 A;  4I38 A;  3FC7 A;  4PKY A;  3KX0 X;  2J80 A;  4I3I A;  4L9G A;  5F69 A;  1UGU A;  4EES A;  4K08 A;  1XJ4 A;  1LL8 A;  1TS7 A;  1Y28 A;  1DP9 A;  4E04 A;  1XJ6 A;  2QJ5 A;  3LI9 A; 
#chains in the Genus database with same CATH topology
 4OPR A;  3A0V A;  3DAV A;  1GSV A;  2ZC4 B;  1K4F A;  2Q9M A;  3N8S A;  5TBM A;  2M1C A;  3E98 A;  3N6I A;  4DF6 A;  3FPW A;  4UQI S;  5I5L A;  2HP6 A;  4JGP A;  3OPP A;  2O9C A;  2EFX A;  2PAV P;  2XA7 M;  3EQU A;  3NOP C;  4OOL A;  3IX3 A;  3MJQ A;  4XXR A;  5DTT A;  4WF0 A;  2NUP C;  3PTE A;  4HEF A;  1NRF A;  4KQR A;  1H8M A;  2EX2 A;  1S1Z A;  4BWI A;  4C6Y A;  2J7V A;  1K4E A;  4QU3 A;  4WUJ A;  4ETX A;  2ZC5 B;  3MQ0 A;  2Y2M A;  4Y5F A;  5FQJ A;  4IHQ A;  5GL9 A;  3O5Y A;  2XSS A;  3WS2 A;  2X71 A;  5A8B A;  3QP4 A;  3H82 B;  2BG1 A;  1SDE A;  3BY9 A;  3PR6 A;  5CHJ A;  4HQA A;  2HGV A;  5FAT A;  4GD6 A;  4PM9 A;  3MXQ A;  3UB7 A;  5CEB A;  4DKI A;  1HZO A;  3BY8 A;  1F98 A;  1XGI A;  3VE4 A;  5HL1 A;  2C5W B;  3E0Y A;  3WS5 A;  3N8R A;  4S2L A;  1DP9 A;  5DF8 A;  2BTF P;  3LR3 A;  2WGV A;  1UWN X;  2IA2 A;  1WE4 A;  2JKF A;  2QMI A;  3UDX A;  2FZ0 A;  2ZLY A;  3HUO A;  5HPI A;  1NY0 A;  3EGX C;  4E6X A;  1DP6 A;  1XPB A;  1K56 A;  2O9A A;  3W4P A;  3C7U A;  4Y13 A;  5F5Y A;  5F1F A;  3UE0 A;  1Q2P A;  1OME A;  4KZB A;  2D01 A;  4LV1 A;  3SS5 A;  3GMW A;  5FAO A;  2FH5 A;  1VB6 A;  1SZV A;  3LY3 A;  4EBP A;  5EVI A;  1YQS A;  3IF6 B;  5TJJ A;  3DTK A;  4B4Z A;  3C4O A;  1GHM A;  1VM1 A;  1SCW A;  1FCM A;  1TD5 A;  5EOE A;  3SS3 A;  5AVE A;  3BFF A;  3QNC A;  1V9Z A;  2EA9 A;  3BQ8 A;  3BJN A;  3L7H A;  2WKR A;  3S22 A;  2V1B A;  3HLG A;  5KMW A;  4YIN A;  3NCK A;  2Y79 A;  2VGJ A;  5HFO A;  4CLC E;  2OAQ 1;  4XUZ A;  3B33 A;  4I3A A;  1KVL A;  4MDZ A;  5G18 A;  5FL3 A;  1S6R A;  5EUA A;  2J9O A;  2W1R A;  5CGW A;  5L2F A;  1PIO A;  2WKE A;  2P74 A;  4WEJ A;  4X68 A;  1KVM A;  2VV7 A;  2ZL1 A;  1JNU A;  1FR6 A;  3IXD A;  2XGN A;  3BEB A;  4D2O A;  4BBU A;  4JBF A;  4U0X A;  4OPQ A;  1KOU A;  4GLQ A;  1MWT A;  1E4D A;  3KX0 X;  1TDG A;  2P9V A;  1ZHH B;  1YAX A;  4QJG A;  3UY6 A;  1CK3 A;  4GN2 A;  4E3I A;  1IKG A;  3M6H A;  2VKS A;  3Q07 A;  5HZH A;  2EXA A;  2ZM0 A;  1OJ5 A;  1IOU A;  2UWX A;  3ZG7 B;  1PWC A;  2WKH A;  4HH2 A;  3E4Q A;  3CUE C;  4DE0 A;  5FI7 A;  2WUQ A;  5AQB A;  1S4S A;  5GLB A;  5CGX A;  3H82 A;  2OV5 A;  1N4O A;  4DXB A;  1W8Y A;  2W3F A;  1JVJ A;  5F6A A;  2RL3 A;  3H7W A;  2PBY A;  2R9X A;  3CMZ A;  4KZ9 A;  3CAX A;  4OQH A;  3T12 B;  4OQI A;  4ZRR A;  2G2W A;  2KLI A;  4DJ2 A;  2PRF A;  3G32 A;  4KQD A;  3G4P A;  4RYE A;  4X53 A;  2K31 A;  4ZDX A;  3AGE A;  2Y4A A;  3BLS A;  1ONG A;  1FIL A;  3W4O A;  4I39 A;  3T4J A;  4EW7 A;  2XH9 A;  4P6Z M;  1BLS A;  4HY8 A;  1MC0 A;  1BTL A;  3HLC A;  4MLL A;  5HAI A;  4OQG A;  3P7N A;  2ZC7 A;  1MZU A;  3UNW A;  3CZD A;  3SH7 A;  1LL5 A;  2E8I A;  4EES A;  3V5M A;  2Y2G A;  3MXR A;  4HES A;  1KE3 A;  2E8J A;  4E6W A;  3B42 A;  4E3K A;  5GHX A;  2LB5 A;  2JHE A;  5A91 A;  3TG9 A;  4CJN A;  3OOV A;  5CTN A;  1O7E A;  4RA7 A;  4IJG A;  3UN7 A;  3FZC A;  4OP8 A;  4WBG A;  2Y91 A;  1Z09 A;  3VP4 A;  3EQV A;  4EER A;  4L9E A;  3IWI A;  2ZOH A;  4X55 A;  3TRC A;  1NYY A;  3D72 A;  1ODV A;  4Y15 A;  3NJA A;  3FKW A;  1MPL A;  1ALQ A;  2G2U A;  5J4E A;  3M6B A;  4E3M A;  4S2J A;  5M18 A;  4BLM A;  3ZYT A;  4OLG A;  2JKR I;  3KO6 A;  4ZJ1 A;  3W4Q A;  2PU4 A;  4NEE D;  3RH8 B;  4RX2 A;  4OVD A;  2QHK A;  2WZZ A;  4K0X A;  3RXW A;  1CJF A;  3RFB A;  3WRT A;  2H5S A;  2XFT A;  3OC2 A;  1DJB A;  2OLV A;  4EU0 A;  4MN6 A;  3CJM A;  4LCL A;  5AQA A;  3G31 A;  1XFN A;  3R7W A;  3CIT A;  4G3W A;  1VQQ A;  4ZBE A;  2CMN A;  3K3C A;  4QY6 A;  2HZ5 A;  1D1J A;  2ZQ8 A;  2CC1 A;  3T1Q B;  1IYQ A;  4Y0T A;  5L10 A;  2Y8H A;  1BLH A;  1GSW A;  4NKP A;  2JN7 A;  3TOI A;  3MSH A;  4EET B;  4ETZ A;  1N9L A;  1S1Y A;  3OPL A;  4HOI A;  5EVI D;  3RTY A;  3GVB A;  4S2O A;  2Y2I A;  3VOL A;  2RCX A;  2Y2P A;  3KSH A;  3PAE A;  2VGL M;  4DJ3 A;  3PXP A;  2V0U A;  2J9P A;  2QWS A;  1LLB A;  2G7U A;  4PM6 A;  1PFL A;  4G3K A;  5L09 A;  4KEN B;  4E3J A;  3PBT A;  3ZVW A;  1H5X A;  3V50 A;  2VX8 A;  3IBR A;  2EWW A;  4OLD A;  3SH9 A;  4E3N A;  3MF0 A;  3P98 A;  3F1P A;  1Y54 A;  4ARZ B;  2XD5 A;  2C6W B;  3F1O A;  1BT5 A;  4JPM A;  1S4R A;  2EX6 A;  1PNE A;  3A0S A;  2ZJ9 A;  3PBO A;  2VGK A;  3MQQ A;  5CTM A;  2YKH A;  4KUO A;  4N1H A;  4P6B A;  1XKZ A;  4BQM A;  3MS6 A;  3NOU C;  4L0L A;  4ID4 A;  5AQ9 A;  3N8L A;  1LL9 A;  4DRT A;  2HP9 A;  2ZQ7 A;  2BAS A;  4MN7 A;  1H3Q A;  1HLU P;  1NYM A;  1IEL A;  4DDY A;  4U3T A;  4GKU A;  3IH9 A;  3ZGA B;  2B5R A;  2P04 A;  1RGZ A;  3GQZ A;  1PW1 A;  1FCN A;  1Y28 A;  5E2G A;  2W1T B;  5TGF A;  2Z2M B;  2VEA A;  3BQA A;  1BLP A;  2XA7 S;  3QNB A;  2XF3 A;  3Q1F A;  2A49 A;  3NIA A;  2Z2L B;  4Q0H A;  2Q9N A;  3SOI A;  4B93 A;  4UA9 A;  5F68 A;  2J8Y A;  4CLC D;  2VJW A;  4QB8 A;  1G68 A;  5EFW A;  1XJ3 A;  4GCZ A;  4NXG A;  5DJT A;  4G3V A;  3EEA A;  4YWZ A;  3F1P B;  4QY5 A;  4X1L A;  2NUT C;  3T50 A;  3P09 A;  3UB6 A;  1FOF A;  4LCM A;  1LHY A;  2W0N A;  1OTA A;  1XA7 A;  1HD8 A;  1IEM A;  3CG5 A;  1ZG4 A;  3FYZ A;  3NBL A;  3ZFZ A;  5I94 A;  4MEZ A;  3QHY A;  1YMS A;  3ZG5 A;  3HUM A;  5HDC A;  4EEP A;  1IFQ A;  4U0T A;  1OTE A;  4KG2 A;  3SH8 A;  3ZQ5 A;  5J8X A;  1SKO A;  2PYP A;  4PM8 A;  2Y2H A;  3FV7 A;  4ZAM A;  3LR5 A;  3CI6 A;  5DFY A;  3HL9 A;  1BUL A;  2B18 A;  5M19 A;  1K55 C;  3MZE A;  4LV2 A;  2Z6D A;  4B9O A;  2JE5 A;  3NOT C;  2HDR A;  4AFI A;  2ZBB A;  1DRM A;  2J3T C;  5FI6 A;  5HD5 A;  4ZJ3 A;  1JWV A;  4HJ4 A;  2L4R A;  3O87 A;  3LGO A;  3IWQ A;  4R3J A;  3F1N B;  5F83 A;  4KZ6 A;  5E43 A;  3MZD A;  4FH2 A;  3CPT B;  1JTD A;  3HLB A;  2B95 A;  3GR2 A;  1TS7 A;  3LI9 A;  4BEN A;  5E2H A;  4BMW A;  2ZQA A;  4OOY A;  4WMC A;  1XX2 A;  3JYI A;  3ZNT A;  4WEL A;  4HP9 A;  2JKT I;  4N1X A;  1ERO A;  3PAG A;  1VET B;  1YLT A;  5FDS A;  3NEC A;  5A90 A;  5HWV A;  4BD0 A;  2A24 B;  5HAP A;  5EVE A;  5EVL A;  3UMD A;  5DF9 A;  4KUK A;  4BL2 A;  3IXH A;  3LY4 A;  3BFC A;  2ZM8 A;  4Y0U A;  1YPR A;  4KQO A;  2V8C A;  1WA9 A;  3CWF A;  1NWZ A;  3DWZ A;  4HJ6 A;  3KYE A;  4GW9 A;  4HP4 A;  1VEU B;  1A0K A;  5FSR A;  1Q2Q A;  4YFM A;  4N9L A;  3VP2 A;  4QD4 A;  4LEN A;  4S2I A;  2XD1 A;  4KG6 A;  1QME A;  3PBS A;  1EI5 A;  1NZU A;  2R78 A;  5DFX A;  1PRQ A;  1KGE A;  5DJU A;  4FOF A;  5HAR A;  3FG8 A;  4ARZ A;  1YT4 A;  4LRX C;  2V9A A;  2XLN A;  4H6J A;  2WAF A;  1L0F A;  5FDH A;  2X02 A;  3C8C A;  5TR7 A;  1CF0 A;  2I9V A;  3BFD A;  4N92 A;  3PBN A;  1H8Z A;  4LRZ E;  5IHV A;  4LV0 A;  4YOF A;  1EWZ A;  1BLC A;  4XT2 B;  4EV4 A;  2WZX A;  4BJP A;  1T1A A;  4K0W A;  4F3L B;  3B3X A;  1D06 A;  3ZCZ A;  4WLA A;  4S2M A;  5JYP A;  2LB9 A;  1N9B A;  4QWO A;  4DMZ A;  1E25 A;  2H0Y A;  3U4L P;  4EBL A;  3FC7 A;  4MBF A;  4L9G A;  2JKT M;  3T4O A;  3CHW P;  4EQI A;  3V39 A;  3V3S A;  1OTI A;  2HDQ A;  3HLD A;  4K91 A;  3C4P A;  3KSF A;  1T1B A;  2WKP A;  4D60 A;  4BBT A;  1GSX A;  1W79 A;  1NXY A;  4X6T A;  4QHC A;  2ZOI A;  1YSQ A;  4EWF A;  1L2S A;  4MNR A;  2UV0 E;  1F2K A;  1N9N A;  1MWS A;  2B02 A;  5HSQ A;  2HPB A;  3IX4 A;  1JWP A;  5CX7 A;  3LID A;  3PBQ A;  2IWB A;  5CXW A;  3OCL A;  4WL9 A;  3HCY A;  4C75 A;  4JGR A;  5G4Z A;  4DDS A;  4P0M A;  3UE1 A;  3WRZ A;  4IBX A;  1OPX A;  4WMC D;  4NET A;  1IKI A;  3ZG9 B;  3HUN A;  5L8M A;  3IHA A;  1OTB A;  3D4F A;  2ZQD A;  4GJ4 A;  4IED A;  2W27 A;  3E4P A;  3E4O A;  1L0G A;  4WM9 A;  3HJK A;  1K55 A;  4KZ8 A;  1LSX A;  1MKI A;  2A24 A;  3Q7Z A;  3IH8 A;  4JF5 A;  4I38 A;  1G6O A;  1NJ4 A;  4DXC A;  1BSG A;  1CEG A;  5FA7 A;  4IUH A;  3LR0 A;  1XJ4 A;  3FWL A;  5EE8 A;  4JXG A;  3E2K A;  2DNS A;  1OTD A;  4DE1 A;  3F1N A;  5J7E A;  3A3F A;  3VFF A;  5EV0 A;  4JGO A;  2XR0 A;  3A3I A;  1E3U D;  4FTX A;  2OOL A;  3MZF A;  4M3K A;  1GCE A;  4R38 A;  4JXS A;  1W63 Q;  1MWU A;  3ITA A;  1STZ A;  1PI4 A;  2Y59 A;  3LFV A;  2ZMF A;  3K2N A;  1G28 A;  3NY4 A;  2Y2N A;  3GV9 A;  2HJE A;  5FAS A;  3H7W B;  4LRY C;  2Z6C A;  2VLG A;  3LR4 A;  3CLO A;  1KGG A;  4F3L A;  1XP4 A;  2P9V B;  5AQ7 A;  2D02 A;  3FPV A;  3LEQ A;  4FD8 A;  3WS1 A;  5HW3 A;  2V0W A;  2XQZ A;  4N9K A;  1P97 A;  1FR1 A;  4R4S A;  3UB9 A;  4RQ9 A;  2PHY A;  3S7N A;  3BEC A;  1L0E A;  1Z6F A;  2QJ7 A;  3MKE A;  4UA7 A;  3VSL A;  5G4Y A;  3KYQ A;  1MWR A;  1K57 A;  4GS9 B;  3S7Q A;  2W3D A;  3JVV A;  3UDF A;  2WKQ A;  2W3G A;  4Q0J A;  5KZH A;  4FH4 A;  4RVA A;  2JBF A;  3WS4 A;  2KOI A;  4XUX A;  2V2F F;  4UEY A;  2Q0O A;  4OOM A;  1K6R A;  2ZM2 A;  2J80 A;  3S7O A;  1MKM A;  5CED A;  2OAP 1;  3MFD A;  4K08 A;  4PM5 A;  3DTM A;  3T1X A;  2J3T D;  1KDW A;  2QZ6 A;  4UQI M;  3D9Y A;  4I5S A;  4NXE A;  4WZ4 A;  4EUZ A;  3ULF A;  1JWZ A;  2PDR A;  3A0R A;  4GHI B;  5AVF A;  1LSV A;  4BBV A;  1F9I A;  1I2W A;  1P0Z A;  5EOO A;  2VV6 A;  5HD3 A;  3T4S A;  5HPF A;  1X0O A;  4CLC C;  1K6S A;  1Y4O A;  4E3L A;  4ME4 A;  5L07 A;  2Y55 A;  2AVX A;  3DWK A;  1O07 A;  4Y7P A;  1ESI A;  5HAQ A;  4JXW A;  1PZP A;  3KSI A;  1XFQ A;  2KX6 A;  3NI9 A;  1XXM A;  3T4L A;  5HX9 A;  3LIE A;  1IYP A;  4LPZ A;  4R4R A;  1MXO A;  3SS4 A;  3IF6 A;  1YLJ A;  4EXO A;  1CQA A;  5FQ9 A;  3VE3 A;  3Q7V B;  3C5A A;  4JLF A;  3A3D A;  4MBK A;  4KZ4 A;  4O01 A;  3R7W B;  3UDI A;  4DE2 A;  4OH0 A;  1U60 A;  3O86 A;  1ES3 A;  1J3W A;  3I7J A;  3U2A A;  4NG2 A;  4Q8I A;  1ESU A;  4X1M A;  1ZG6 A;  4ZJ2 A;  1M6K A;  1ES2 A;  4IVI A;  5D3O A;  3PHY A;  5EM1 A;  2PBD P;  4PKY A;  2DCF A;  4KZ3 A;  3MXS A;  3G2Y A;  4O7D A;  5FQK A;  5EM0 A;  3SZT A;  4RX3 A;  3MMH A;  1YMX A;  1RGY A;  4WYY A;  1WYB A;  2PT7 A;  4GHI A;  4NK3 A;  1AWI A;  3HLE A;  3HJI A;  2JKG A;  2YKF A;  4KZA A;  2VA0 A;  2K2N A;  4JGQ A;  5TBM B;  3F1O B;  1TVF A;  2ZL1 B;  4OKP A;  2PU2 A;  3VOZ A;  4B4X A;  4HI4 A;  4MN5 A;  2ZQ9 A;  2VV8 A;  1YLP A;  3AGD A;  1LI9 A;  3IHB A;  3BLM A;  1EW0 A;  4WEK A;  4H8R A;  3Q82 A;  3C7V A;  4GDN A;  4LGW A;  4X25 A;  2EWV A;  2HF6 A;  1NLZ A;  1J9M A;  5M1A A;  5F82 A;  1GHP A;  4IBR A;  4DN0 A;  4B88 A;  5DF7 A;  4IVK A;  3G34 A;  4ZTK A;  3LIB A;  2V8F A;  4MCW A;  1FSY A;  4PPR A;  3P01 A;  2IWC A;  2O9B A;  5GHY A;  1PWG A;  5A93 A;  2A2L A;  1NZO A;  1XGJ A;  1N9O A;  1CEF A;  3MR0 A;  5FAQ A;  5TFQ A;  2I72 A;  5CRF A;  3V67 A;  4LV3 A;  3EWK A;  1BYW A;  2WK0 A;  2O0Y A;  2PR5 A;  3LO7 A;  2OWH A;  2XEP A;  1PW8 A;  2HJ9 C;  4L9F A;  2DMW A;  3O88 A;  3TSG A;  5CEC A;  4OON A;  1NRJ A;  3G30 A;  2PD7 A;  4KG5 A;  4P85 A;  3NDG A;  4OQ0 A;  4Z1W A;  4R23 A;  3PBR A;  5LBR A;  3OZH A;  3H9W A;  4GDB A;  3LYX A;  5F1G A;  5HWW A;  2MJ6 A;  2XFS A;  3UE3 A;  2GX5 A;  3ISG A;  3RXX A;  3RJU A;  3C30 A;  4O0P A;  3FKV A;  3T4Q A;  4EBN A;  3LI8 A;  1K38 A;  4X56 A;  4O8G A;  2OLU A;  2L1M A;  3AGF A;  1VET A;  4EUV A;  3HRE A;  3UB8 A;  5J3W A;  3V3R A;  5FEG A;  3WWX A;  5FAP A;  1C3B A;  3C38 A;  2DRW A;  1YLZ A;  4M4X A;  2WGW B;  3VSK A;  4WZ5 C;  4HJ3 A;  4LFU A;  3T1S A;  1LSW A;  4WZ5 A;  2Y2K A;  2P7J A;  3MQO A;  4HHD A;  1W5D A;  1FCO A;  5FI2 A;  3BRM A;  4S2N A;  1H0M A;  1WYC A;  3D3O A;  4JXV A;  3JPU A;  1ONH A;  4OPY A;  2WYX A;  4II7 A;  3UE6 A;  3BFE A;  3O3V A;  3VOY A;  1S66 L;  4PMA A;  4I3J A;  1G5U A;  1OJG A;  1YKD A;  1DJA A;  3IF6 C;  2XK1 A;  2JKR M;  3T4T A;  1XJ6 A;  2HP5 A;  1ZC2 A;  1I5Q A;  5DTS A;  4MMN A;  2IWD A;  3QP2 A;  4FCF A;  4S2P A;  3BFG A;  2EFU A;  2ZD8 A;  5AJG A;  3VMA A;  2WAD A;  2ZC3 B;  2OWJ A;  1RP5 A;  1KE0 A;  1SHV A;  3PYP A;  3IF5 A;  5KSH A;  1BUE A;  2BLS A;  3UB5 P;  2KDK A;  4PM7 A;  1DY6 A;  2HDS A;  3S4X A;  3KSG A;  1ES4 A;  4GNU A;  3VP0 A;  3Q7V A;  4GB7 A;  1PWD A;  2PD8 A;  3LEZ A;  1TS0 A;  2FFF B;  2XRO A;  4UAA A;  4EQ1 A;  3HVF A;  1L0D A;  4QPR A;  5BOH A;  2V1Z A;  3IWO A;  3G6O A;  2GZA A;  4GZB A;  4FUW A;  3LIA A;  4LLO B;  4A5R A;  3TE8 A;  4UA6 A;  1HTZ A;  5IT5 A;  3OPR A;  3ITB A;  4ESP A;  3IS2 A;  4R70 A;  3ZDJ A;  4GS9 A;  4PKY G;  3MBZ A;  3OBF A;  3Q81 A;  4HBU A;  3HLW A;  2XDM A;  4S2N C;  3B47 A;  2O99 A;  5FQI A;  3LCE A;  4E3O A;  1KGF A;  3G35 A;  2K7S A;  3UO9 A;  1YLW A;  2WGW A;  4R3B A;  1BZA A;  5JYO A;  3ZG0 A;  3VP1 A;  1IYO A;  1K0K A;  5HL6 A;  1P9W A;  2ZQC A;  4BD1 A;  3R4K A;  4R0Q A;  4EEU A;  1PI5 A;  2QKP A;  3T1R A;  3C2W A;  1OT9 A;  2H28 A;  4UHU A;  3VP3 A;  5EPH A;  4KQQ A;  3LIC A;  4R1G A;  3NDE A;  5U47 A;  4NXB A;  4OPZ A;  3ICY A;  3DBA A;  3BWL A;  4R6L A;  2GJ3 A;  4PHT A;  2HV1 A;  4FSF A;  4S2K A;  3LIF A;  3UPN A;  2M7U A;  1YLY A;  2V20 A;  3HLF A;  1PYY A;  1DJC A;  2PYR A;  2Y2L A;  1UWP X;  5DKL A;  5DVA A;  5KSC A;  3OPH A;  2ZC6 B;  5CGS A;  3IXB A;  1YSP A;  3IS2 B;  4BL3 A;  4C3Q A;  3KYZ A;  2V1A A;  3ZG8 B;  3DTE A;  1JTG A;  1MY8 A;  3G2Z A;  1XA1 A;  2WAE A;  3ZHH A;  4X69 A;  1XJ2 A;  2P08 A;  5C5K A;  5EEC A;  4JF4 A;  5HWT A;  4KZ5 A;  1FSW A;  3TJZ C;  4Y3I A;  5F69 A;  1UGU A;  3NUL A;  3GTC A;  2GDN A;  2H10 A;  2INW A;  3QP6 A;  3IX8 A;  1KE4 A;  1CI9 A;  1H8Y A;  3NC8 A;  4IUK A;  1G6A A;  4HH3 A;  4NXF A;  2QPN A;  5HDD A;  3N7W A;  2JC7 A;  1ERQ A;  5FEF A;  2ACG A;  4Y2F A;  1TS8 A;  1D7E A;  1T1C A;  3T4K A;  2J3W A;  2WGI A;  2EX8 A;  3SW1 A;  1LT0 A;  2Y2O A;  1OT6 A;  1W7F A;  4H6J B;  5GLD A;  3S7P A;  4HIA A;  3UPO A;  1AXB A;  1TF1 A;  5A92 A;  1MBL A;  4GOG A;  5MC7 A;  3CUE A;  1E3U A;  1F5M A;  5IU1 A;  3EGD C;  4R3A A;  3NHQ A;  2HDU A;  1VHM A;  3UME A;  1V9Y A;  3OLO A;  4JF6 A;  3IT9 A;  4Q0I A;  5K5B A;  2EX9 A;  5CHU A;  5CER A;  3E2L A;  1SDN A;  5E2F A;  3IXG A;  5GLA A;  5KIZ A;  3ZVT A;  1KDS A;  3HBR A;  5IS1 A;  1T18 A;  2VZW A;  1FQG A;  1TDL A;  4CLC B;  2VGL S;  4PAU A;  1YM1 A;  3N4I A;  2XRN A;  1SKF A;  3ZNY A;  3BM6 A;  3S1Y A;  4HNB A;  1ACF A;  4CPK A;  2ZMA A;  1T19 A;  5DKK A;  1FIK A;  5GHZ A;  2Y2Q A;  2Y2J A;  2WKI A;  1VEU A;  1LI0 A;  3W8K A;  5FQM A;  1ZTU A;  1GHI A;  1W8Q A;  4Z9Q A;  4I3I A;  3IQA A;  4E04 A;  1LL8 A;  1HVB A;  3MFX A;  3A3E A;  2X01 A;  3JVU A;  3GRJ A;  5CHM A;  1K57 C;  2PR6 A;  2W1T A;  4CQH A;  4WN5 A;  3M2J A;  1K54 C;  4DE3 A;  2A3U A;  1RCJ A;  1DP8 A;  1M40 A;  1P9R A;  2L0W A;  5EVI B;  3MKF A;  5EVI C;  3M2K A;  1K54 A;  3EOI A;  3L9K A;  1NLY A;  3QP8 A;  4MBH A;  3IBJ A;  2QYB A;  3QP1 A;  1TS6 A;  3UPP A;  5DTK A;  2OSU A;  3K3D A;  1ERM A;  4OP5 A;  4F94 A;  1K56 D;  3GDI A;  4Y17 A;  4KZ7 A;  1TEM A;  2EXB A;  3BW6 A;  2W3H A;  3A3J A;  2JCH A;  1S0W A;  5E2E A;  1I2S A;  2W3E A;  2FFY A;  5FQQ A;  2GNX A;  3VV4 A;  2ZMV A;  3OCN A;  3W2Z A;  5HDS A;  1PZO A;  1K25 A;  1SKO B;  3LUQ A;  5GLC A;  2M7V A;  4CLC A;  3GSG A;  4P87 A;  3DTI A;  3VFH A;  4JKT A;  4Y0O A;  1CI8 A;  4P6Z S;  3TW8 A;  3QP5 A;  4XT2 A;  3GEC A;  1IYS A;  3DW0 A;  1ES5 A;  1S67 L;  1GA0 A;  2R9W A;  3BYD A;  1L3L A;  4HBT A;  1W63 M;  2H0T A;  3EEH A;  1ZKJ A;  2VK3 A;  4YNR A;  3WS0 A;  1GA9 A;  4GD8 A;  1QMF A;  2QJ5 A;  3CPT A; 
#chains in the Genus database with same CATH homology
 3A0V A;  2Y8H A;  1GSW A;  4MMN A;  4NKP A;  1OTD A;  2JN7 A;  1GSV A;  3F1N A;  5J7E A;  4EET B;  4ETZ A;  1N9L A;  1S1Y A;  4JGO A;  5TBM A;  2M1C A;  4HOI A;  3RTY A;  3E98 A;  3FPW A;  3VOL A;  4UQI S;  3KSH A;  5AJG A;  5I5L A;  2VGL M;  4JGP A;  4DJ3 A;  3PXP A;  2V0U A;  2QWS A;  2OOL A;  2G7U A;  2O9C A;  2OWJ A;  2XA7 M;  3EQU A;  3NOP C;  4R38 A;  3PYP A;  4OOL A;  1W63 Q;  4G3K A;  1STZ A;  5KSH A;  3MJQ A;  3PBT A;  3LFV A;  2ZMF A;  3K2N A;  1G28 A;  2KDK A;  2VX8 A;  3IBR A;  2EWW A;  4WF0 A;  2NUP C;  2HJE A;  3H7W B;  4LRY C;  2Z6C A;  2VLG A;  3LR4 A;  3KSG A;  3MF0 A;  3F1P A;  1H8M A;  4ARZ B;  3CLO A;  1S1Z A;  4BWI A;  4F3L A;  2PD8 A;  3F1O A;  1TS0 A;  1S4R A;  2D02 A;  4WUJ A;  3A0S A;  3FPV A;  2XRO A;  3PBO A;  2V0W A;  4ETX A;  4EQ1 A;  3MQQ A;  1P97 A;  2YKH A;  3UB9 A;  4RQ9 A;  4KUO A;  4QPR A;  2PHY A;  3MQ0 A;  3S7N A;  3G6O A;  4Y5F A;  2GZA A;  4IHQ A;  3O5Y A;  2QJ7 A;  2XSS A;  3NOU C;  4L0L A;  3LIA A;  5A8B A;  4LLO B;  3H82 B;  3TE8 A;  5G4Y A;  3KYQ A;  5IT5 A;  4GS9 B;  3S7Q A;  2W3D A;  3JVV A;  2WKQ A;  3BY9 A;  3PR6 A;  2W3G A;  4HQA A;  2HGV A;  3IS2 A;  4Q0J A;  4R70 A;  3MXQ A;  2BAS A;  4GS9 A;  1H3Q A;  4MN7 A;  4PKY G;  3UB7 A;  2KOI A;  3BY8 A;  3OBF A;  4UEY A;  1F98 A;  3VE4 A;  4OOM A;  3E0Y A;  2P04 A;  2J80 A;  3S7O A;  1MKM A;  3B47 A;  2OAP 1;  4K08 A;  1Y28 A;  1DP9 A;  2W1T B;  2O99 A;  2VEA A;  3BQA A;  2XA7 S;  2J3T D;  3LR3 A;  2K7S A;  1UWN X;  2IA2 A;  4UQI M;  4B93 A;  4Q0H A;  4I5S A;  2FZ0 A;  4NXE A;  5HL6 A;  5F68 A;  1P9W A;  5HPI A;  3EGX C;  4CLC D;  2VJW A;  1DP6 A;  2O9A A;  3ULF A;  3R4K A;  4EEU A;  2QKP A;  2PDR A;  3A0R A;  5EFW A;  1XJ3 A;  4GCZ A;  4GHI B;  4NXG A;  5DJT A;  3C2W A;  4G3V A;  5F5Y A;  5AVF A;  1OT9 A;  3EEA A;  4YWZ A;  1LSV A;  3F1P B;  2H28 A;  4BBV A;  1F9I A;  2NUT C;  2D01 A;  3LIC A;  1P0Z A;  3T50 A;  2VV6 A;  5HD3 A;  4NXB A;  3UB6 A;  3ICY A;  2FH5 A;  2W0N A;  1VB6 A;  3T4S A;  5HPF A;  1X0O A;  4CLC C;  1OTA A;  3DBA A;  3BWL A;  4ME4 A;  4R6L A;  2GJ3 A;  4PHT A;  2HV1 A;  4FSF A;  3LIF A;  5TJJ A;  2M7U A;  5HDC A;  4EEP A;  1IFQ A;  1TD5 A;  2PYR A;  1OTE A;  5AVE A;  3KSI A;  3ZQ5 A;  1XFQ A;  1UWP X;  5DKL A;  1V9Z A;  2EA9 A;  2KX6 A;  2PYP A;  3BJN A;  3BQ8 A;  2WKR A;  2V1B A;  3T4L A;  3LIE A;  3LR5 A;  4LPZ A;  3CI6 A;  1YSP A;  2Y79 A;  3IS2 B;  5DFY A;  4EXO A;  4CLC E;  2OAQ 1;  2B18 A;  3B33 A;  4I3A A;  2Z6D A;  4MDZ A;  4B9O A;  3VE3 A;  3R7W B;  5FL3 A;  4O01 A;  3NOT C;  4AFI A;  2ZBB A;  1DRM A;  2J3T C;  3KYZ A;  2V1A A;  5HD5 A;  2W1R A;  4HJ4 A;  3U2A A;  2L4R A;  4WEJ A;  2VV7 A;  1JNU A;  4BBU A;  3F1N B;  1XJ2 A;  2P08 A;  5C5K A;  1KOU A;  5HWT A;  4GLQ A;  3TJZ C;  3PHY A;  4Y3I A;  4PKY A;  3KX0 X;  1ZHH B;  5F69 A;  1UGU A;  1YAX A;  1TS7 A;  3LI9 A;  2INW A;  3MMH A;  2PT7 A;  4BMW A;  4IUK A;  4GHI A;  2VKS A;  4HH3 A;  4NXF A;  5HDD A;  5HZH A;  3HJI A;  4WEL A;  4HP9 A;  2YKF A;  1OJ5 A;  2JKT I;  2VA0 A;  1IOU A;  2K2N A;  4Y2F A;  1TS8 A;  4JGQ A;  1D7E A;  1T1C A;  5TBM B;  3T4K A;  2J3W A;  4HH2 A;  3F1O B;  3E4Q A;  3SW1 A;  3CUE C;  4HI4 A;  1LT0 A;  1OT6 A;  5HWV A;  4MN5 A;  4H6J B;  3S7P A;  1S4S A;  2A24 B;  4HIA A;  2VV8 A;  1TF1 A;  3UMD A;  5DF9 A;  3H82 A;  5MC7 A;  4KUK A;  3CUE A;  1EW0 A;  1F5M A;  4KQO A;  4WEK A;  5IU1 A;  3EGD C;  1WA9 A;  4R3A A;  2W3F A;  2EWV A;  3CWF A;  2HF6 A;  1NWZ A;  5F6A A;  1NLZ A;  3NHQ A;  4HJ6 A;  1VHM A;  3UME A;  1V9Y A;  4GW9 A;  3H7W A;  4HP4 A;  3OLO A;  4Q0I A;  4DN0 A;  5K5B A;  3CAX A;  3LIB A;  3PBS A;  5KIZ A;  4MCW A;  4ZRR A;  2KLI A;  4DJ2 A;  2R78 A;  4KQD A;  5DFX A;  5IS1 A;  3P01 A;  1T18 A;  2O9B A;  2VZW A;  5DJU A;  4FOF A;  3FG8 A;  2K31 A;  2A2L A;  4ARZ A;  4CLC B;  2VGL S;  4LRX C;  2V9A A;  4H6J A;  1N9O A;  4PAU A;  3MR0 A;  3C8C A;  2XRN A;  2I9V A;  3PBN A;  4HNB A;  4LRZ E;  3V67 A;  4I39 A;  3EWK A;  4YOF A;  3T4J A;  4EW7 A;  4P6Z M;  4HY8 A;  1BYW A;  4XT2 B;  1T19 A;  1MC0 A;  5DKK A;  4BJP A;  2O0Y A;  1T1A A;  2PR5 A;  2OWH A;  4F3L B;  1D06 A;  4WLA A;  2LB9 A;  3P7N A;  2HJ9 C;  1ZTU A;  4DMZ A;  1MZU A;  4L9F A;  2DMW A;  3FC7 A;  4I3I A;  4L9G A;  2JKT M;  4EES A;  3T4O A;  1LL8 A;  4E04 A;  3MFX A;  1NRJ A;  2PD7 A;  3JVU A;  1OTI A;  2PR6 A;  3B42 A;  2W1T A;  4Z1W A;  2LB5 A;  2JHE A;  4CQH A;  3PBR A;  3OOV A;  4WN5 A;  5LBR A;  3H9W A;  5HWW A;  3LYX A;  3KSF A;  1DP8 A;  4IJG A;  1T1B A;  1P9R A;  2MJ6 A;  2WKP A;  3UE3 A;  2GX5 A;  4BBT A;  1GSX A;  2L0W A;  3EOI A;  1NLY A;  3EQV A;  4EER A;  3C30 A;  4L9E A;  3IBJ A;  2QYB A;  4O0P A;  1TS6 A;  2ZOH A;  3T4Q A;  3LI8 A;  3TRC A;  2ZOI A;  1YSQ A;  3D72 A;  3K3D A;  1ODV A;  4O8G A;  3NJA A;  2L1M A;  3GDI A;  4EUV A;  1N9N A;  3UB8 A;  3BW6 A;  2W3H A;  5J3W A;  2B02 A;  5HSQ A;  5J4E A;  3C38 A;  5CX7 A;  4M4X A;  3LID A;  3PBQ A;  4HJ3 A;  3ZYT A;  2W3E A;  1LSW A;  3OCL A;  2JKR I;  2GNX A;  3KO6 A;  4WL9 A;  4NEE D;  3HCY A;  3VV4 A;  4JGR A;  2ZMV A;  5G4Z A;  3RH8 B;  3OCN A;  3W2Z A;  2P7J A;  5HDS A;  3LUQ A;  2QHK A;  1OPX A;  3MQO A;  4HHD A;  2M7V A;  3RFB A;  4CLC A;  3OC2 A;  4EU0 A;  4MN6 A;  5L8M A;  4P6Z S;  3TW8 A;  1OTB A;  4XT2 A;  3GEC A;  3D3O A;  4GJ4 A;  4II7 A;  1XFN A;  2W27 A;  3CIT A;  3R7W A;  3E4P A;  3E4O A;  4G3W A;  3UE6 A;  1S67 L;  2CMN A;  1S66 L;  4I3J A;  3HJK A;  1W63 M;  1LSX A;  3K3C A;  1OJG A;  2A24 A;  1YKD A;  3EEH A;  4I38 A;  1G6O A;  4YNR A;  2JKR M;  4IUH A;  3LR0 A;  3T4T A;  1XJ4 A;  1XJ6 A;  2QJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...