4WN5A

Crystal structure of the c-terminal per-arnt-sim (pasb) of human hif-3alpha9 bound to 18:1-1-monoacylglycerol
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
108
Chain Sequence
HMGRGAFLSRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSKGQAVTGQYRFLARSGGYLWTQTQATVVSGRGPQSESIVCVHFLISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Unsaturated fatty acids as high-affinity ligands of the C-terminal Per-ARNT-Sim domain from the Hypoxia-inducible factor 3alpha
doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Hypoxia-inducible factor 3-alpha
total genus 30
structure length 108
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4wn5A00
3FC7A 2CMNA 4L9GA 3CLOA 2M1CA 5TBMB 3D72A 2H28A 3FG8A 4XT2A 5HDCA 1LSVA 3F1NA 3LIDA 2VV6A 3F1PA 3H7WB 4NXBA 2P7JA 1UWNX 1VB6A 3CAXA 3H9WA 5F5YA 1F9IA 3UB9A 2V0WA 4HP4A 4I3JA 1OTIA 4HJ3A 3UB6A 1DRMA 1UGUA 4NXEA 1LSXA 3OLOA 3VE3A 3UMEA 2WKPA 3MR0A 4LRZE 2PR5A 4PKYG 3MFXA 1T1CA 4R3AA 1UWPX 4JGOA 5I5LA 5DJTA 3RTYA 4WLAA 3E4PA 4HHDA 3UMDA 3UB7A 5EFWA 2EA9A 4H6JA 5F6AA 2OWJA 5F69A 3LIAA 2V1BA 2GJ3A 2L4RA 1S1YA 2D02A 2QWSA 4GCZA 4R38A 4RQ9A 2VV7A 5J4EA 1DP8A 1OTDA 2QJ5A 4WL9A 3T50A 2INWA 1OTEA 2J80A 1D06A 1T18A 2KX6A 2QHKA 2V9AA 2ZBBA 3LI9A 3MXQA 2PD7A 4DJ2A 5IS1A 1GSWA 3F1PB 3LIBA 1N9NA 1NWZA 3A0RA 3B33A 4I3IA 3UE6A 3IBRA 2V0UA 3HJIA 3IS2A 4F3LB 2W27A 2WKRA 5A8BA 4HY8A 4NXFA 5HWTA 4WF0A 3K3CA 3EEHA 1GSVA 3E4OA 2KDKA 4HJ6A 2D01A 4LRYC 1X0OA 4HH2A 3P7NA 3LIFA 4H6JB 1N9LA 5F68A 3NOTC 1D7EA 4KUKA 1OJ5A 1LT0A 2PD8A 2YKFA 4E04A 3G6OA 1OTBA 1JNUA 1V9YA 2K7SA 5DKLA 3K3DA 2PDRA 3NOPC 4XT2B 4DJ3A 3F1NB 1P97A 4LLOB 3H7WA 1XJ6A 2WKQA 1S4SA 4YWZA 1TS8A 5AVEA 2L0WA 1GSXA 2I9VA 4EEPA 4JGQA 4EESA 2PYRA 3E4QA 1TS0A 1XJ4A 3ICYA 5HSQA 1T1BA 5HWWA 3MQOA 5J7EA 4EETB 1S67L 1G28A 2VEAA 3LICA 4HI4A 3GDIA 4LRXC 1TS7A 3ZQ5A 4KUOA 2A24B 3CWFA 2PR6A 5J3WA 4JGRA 1LL8A 3BY8A 1T19A 3PHYA 2ZOIA 1S66L 1KOUA 4I3AA 4M4XA 4MN6A 4NXGA 4GHIB 1N9OA 2W0NA 4EXOA 4HOIA 4I38A 2HV1A 3VE4A 5KIZA 1T1AA 3H82B 2JN7A 4GS9B 5G4YA 2VV8A 4LPZA 4JGPA 4BBUA 1MZUA 2L1MA 4MN5A 5HD5A 4I5SA 4WN5A 2BASA 3RH8B 3NJAA 3GECA 1F98A 2V1AA 2ZOHA 1DP9A 1P0ZA 1BYWA 1OT9A 3LYXA 1OTAA 4I39A 4L9EA 3H82A 4R6LA 3HJKA 4B9OA 1ODVA 3A0VA 5HD3A 1XJ2A 1EW0A 3C2WA 3NHQA 4HP9A 3LUQA 5IU1A 3A0SA 3BWLA 3LIEA 2JHEA 3PYPA 1XFNA 5HZHA 4R70A 2VLGA 2PHYA 4BBVA 2R78A 3EWKA 5DJUA 5HDDA 3ULFA 1S4RA 2B02A 2Z6CA 1XFQA 2QJ7A 4HJ4A 4HH3A 2YKHA 3F1OB 3VOLA 1WA9A 1V9ZA 3KX0X 4K08A 4PKYA 3UB8A 1XJ3A 3BY9A 1DP6A 1Y28A 2QKPA 3MQQA 5G4ZA 2Z6DA 5TBMA 4EERA 4WUJA 4BBTA 2A24A 2OOLA 4HIAA 5AVFA 5HWVA 3SW1A 4EQ1A 1LSWA 3MJQA 4F3LA 1S1ZA 2PYPA 2OWHA 5DKKA 3C8CA 3NOUC 4GW9A 4HNBA 4GHIA 5HDSA 1TS6A 3LI8A 1OT6A 3F1OA 4KQDA 4L9FA 4EEUA 4EW7A 4HQAA 1OJGA 4GS9A 3IS2B
chains in the Genus database with same CATH superfamily
3FC7A 4WEKA 2H5SA 3E2KA 3UE1A 3ZGAB 3F1PA 4E3NA 4K0WA 1SDEA 4PMAA 4HJ3A 3C7UA 3FYZA 2C5WB 1K56D 2EA9A 5EUAA 1C3BA 1AWIA 3T50A 5CGSA 2J80A 4QB8A 1GCEA 3LIBA 4IHQA 3V39A 2EFXA 3T1RA 2GZAA 4HY8A 4NXFA 4OPZA 1Y54A 3K3CA 4HJ6A 4GD8A 3MZEA 2P74A 4PHTA 1FQGA 2XR0A 1HVBA 2K7SA 1JNUA 2HJ9C 5DKLA 2XLNA 1G5UA 3HLWA 2PBDP 5EVIC 1TS0A 1IKIA 5E2EA 3MQOA 4IUHA 3ZQ5A 5EE8A 5FDSA 3VFHA 3V67A 3NDEA 4KZ9A 2XQZA 4P87A 3NECA 3ZDJA 1JWVA 1ERMA 5FAQA 4WN5A 3HLFA 4R3BA 5DF7A 3O87A 5HAIA 4EU0A 4DXCA 2Y2OA 4RYEA 3IWQA 4HJ4A 4OONA 1ZTUA 4P6ZM 4PKYA 1XJ3A 1NRFA 1WYCA 1ES2A 3VOYA 4JF5A 4ZRRA 3VP2A 1NJ4A 3SS4A 5I94A 3VP0A 2G2WA 4GOGA 4L9FA 4C75A 4CQHA 4O7DA 2JKTI 2A2LA 3G34A 3TG9A 5AQAA 4CLCD 3LR0A 1CI8A 3H9WA 1LSXA 1PYYA 1UWPX 2P08A 5I5LA 1IELA 3TOIA 2R9XA 4BD0A 2PU2A 1FOFA 3B3XA 2B5RA 1D06A 1W8YA 3GQZA 4R4SA 5TJJA 1ACFA 2WYXA 2IA2A 2KOIA 4NETA 3ZCZA 3UE6A 1K6RA 3CHWP 5HWTA 1BLPA 3E4OA 4P6BA 4DXBA 3FKWA 2PD8A 5FAOA 4OPQA 3MFDA 1KVMA 1LI9A 5AQ9A 2ZLYA 1P9WA 2Y2HA 4M4XA 1S66L 4N92A 4MN6A 2ZQAA 5EVLA 1TVFA 2XD1A 2W3GA 3A3DA 1MZUA 3W8KA 2Z2LB 2PRFA 2EXBA 3KSFA 2JE5A 2V1AA 1NZUA 4I39A 1Y4OA 4O01A 4OLGA 3C2WA 4JXVA 1ES5A 3OPLA 5GLBA 2VLGA 1TF1A 4Q0JA 4DRTA 1XFQA 4X53A 1L3LA 5CTNA 4X68A 3A3JA 4BBTA 3P98A 3RFBA 3NOUC 4MNRA 3NI9A 2LB5A 3ZYTA 3PBSA 2W1TA 4IVIA 3V3RA 4IBRA 1H8MA 1FR1A 3CJMA 1J9MA 5DTSA 2JKFA 4ZAMA 2HP6A 3UB6A 4E3MA 3UY6A 4LV2A 5DJTA 4WLAA 3E4PA 3E2LA 1YMSA 2D02A 2QWSA 3IH8A 3SH8A 1DP8A 1OTDA 1SKOB 2VKSA 2XSSA 2HP9A 5DF8A 5JYPA 2HDRA 3PBQA 2O9CA 4I3IA 2V0UA 3IF6B 3OPPA 1HD8A 2NUTC 3WS5A 2WGIA 1KDSA 2RCXA 3N8SA 5CEDA 4ETZA 3RXXA 5FQIA 5GHXA 3S4XA 1FILA 3T1SA 3LICA 4HI4A 3T1QB 4Q0HA 1GHMA 3CUEC 1KGFA 4NXGA 3ZFZA 3H82B 2JN7A 3GMWA 1XP4A 4OLDA 3IT9A 2WZXA 5DFXA 4BMWA 1CQAA 2WADA 1RGYA 1MKIA 4NEED 2B95A 3G2ZA 3A0VA 3R7WA 2HDSA 2XF3A 5L07A 1U60A 3I7JA 3PYPA 3BYDA 1MXOA 2ZMFA 3BECA 4OQHA 2VK3A 4LFUA 2J9OA 1L2SA 4LV1A 3FZCA 5EM1A 3G4PA 4S2IA 3V5MA 3B47A 1IEMA 4KZBA 4BQMA 2IWDA 4NXEA 5AJGA 2VGJA 3MR0A 4ME4A 1W63M 4IVKA 2V8CA 3P09A 3GSGA 3A3EA 4RQ9A 3ZNTA 3IXDA 3LI9A 5HL1A 2QHKA 4E6WA 3HVFA 5J8XA 1NYMA 1FIKA 3UB5P 3HJIA 2W27A 4P85A 3PR6A 5GL9A 3T12B 5FL3A 3NOTC 4S2MA 1LT0A 1SCWA 2BTFP 5HFOA 3MSHA 1E3UD 2XDMA 1GHPA 3ICYA 4X6TA 5M18A 2OLVA 2VEAA 1ES3A 2Y2MA 2M7VA 5EOOA 2A24B 5CGWA 4Y3IA 2EX2A 4ID4A 3BQ8A 1K57A 2K31A 2OV5A 1ESIA 2Y2GA 1MKMA 3QP6A 3IBJA 1OTAA 2PAVP 2ZC3B 1ESUA 3NHQA 5G18A 2LB9A 4BLMA 4FTXA 3FV7A 3EWKA 2P04A 1WE4A 3IF5A 1YLJA 1H0MA 2DCFA 2EX9A 3SH7A 2MJ6A 3MQQA 1GA0A 1H3QA 2QPNA 2W3HA 4K0XA 5EVEA 3TSGA 2WZZA 4EW7A 5F1GA 3T4TA 3IS2B 1H8YA 5HDCA 1LSVA 3H7WB 3UB9A 1IKGA 1M6KA 3T4OA 4HP4A 3KYEA 1UGUA 5FQQA 2VA0A 3ITAA 4RVAA 4FOFA 1VETA 3LR4A 1XX2A 4DE1A 2XEPA 1JTDA 4GCZA 1E25A 5J4EA 4R1GA 1RP5A 2QJ5A 2Q9NA 5BOHA 2INWA 1T18A 3MF0A 4N9LA 2QZ6A 1BZAA 1TD5A 4OOLA 2WKRA 4NKPA 2Y59A 5A8BA 3V3SA 3MZDA 1ZHHB 4H6JB 3QNBA 1J3WA 2XK1A 3GRJA 3IWIA 3TRCA 2PDRA 5EVIA 1ONGA 3N7WA 3S22A 4JGQA 1XJ4A 3UDIA 1IOUA 3CWFA 2ZOIA 2HPBA 2Q0OA 4E3KA 4I38A 1MY8A 3VE4A 3OCLA 4A5RA 4B4ZA 2WGWA 4Q0IA 5DFYA 4HBUA 3NULA 2Q9MA 1K54A 2Y2IA 4KZ5A 1VEUA 1VQQA 3HLEA 4YOFA 4G3KA 4MCWA 3IHBA 1FSWA 1O7EA 1XFNA 4QU3A 4CLCC 3Q1FA 4WBGA 4MLLA 4IBXA 3VOLA 3DBAA 3OPHA 3MS6A 4WUJA 5A93A 2HGVA 2X02A 3MJQA 3OC2A 3OPRA 1BSGA 3VFFA 1PI5A 3LI8A 5GHZA 5MC7A 2Y2NA 3UMEA 2IWCA 1NLYA 3VP3A 4CLCA 2EX8A 3OLOA 4HBTA 3IX3A 1OMEA 2ZQ9A 3M2JA 1NZOA 2XA7M 1LHYA 4G3VA 1F2KA 3LIAA 3IF6A 1XPBA 4C6YA 1DJBA 3DWZA 2ZBBA 1NLZA 2O99A 3MQ0A 2G2UA 4DE3A 3G30A 2ZMVA 2Y2LA 4LRYC 3BRMA 1X0OA 3P7NA 3QP1A 5IT5A 1GSXA 3BFCA 4ARZB 1K25A 4EESA 3BLMA 2WKEA 3S7QA 3GDIA 5FATA 3MXSA 4OPYA 1KGGA 2L1MA 3D4FA 2O9AA 2VJWA 1PZPA 4FSFA 3JPUA 1MWRA 5IU1A 4HP9A 3JVUA 3A0SA 4CJNA 4JF6A 1QMFA 4S2KA 3UE3A 4DF6A 1CEFA 2X71A 3QP4A 1A0KA 4HH3A 1N9BA 2EWVA 2HDUA 2QKPA 3SW1A 1VETB 3DAVA 2JBFA 5HDSA 1EI5A 3MMHA 2Y2PA 3ZNYA 1MPLA 5TBMB 2M1CA 3NIAA 3DTIA 5CGXA 1BUEA 3CG5A 3LO7A 3EQVA 2L4RA 2VV7A 4WL9A 3W4OA 2V9AA 1K4EA 5IS1A 3G31A 5CXWA 4EV4A 1N9NA 5E43A 1PW1A 4EBPA 1W7FA 3MZFA 1JTGA 4X1LA 4YNRA 3LIFA 1JWPA 1OJ5A 3PXPA 4DJ3A 1TS8A 2FH5A 3S7NA 1YT4A 5J7EA 5M19A 5CX7A 5J3WA 3CMZA 1T19A 3E98A 3JYIA 1N9OA 2V1ZA 2C6WB 3GVBA 4BBUA 4Y0UA 1ERQA 2ZOHA 1P0ZA 3T4SA 5HPIA 1OT9A 4DMZA 4BD1A 3LR3A 1CK3A 1EW0A 5F82A 3HLCA 2VZWA 2E8JA 2ACGA 2YKHA 5FSRA 4GNUA 1V9ZA 4JF4A 4K91A 2HDQA 4JXSA 2Y2KA 4U0TA 1ZG6A 1E3UA 4EQ1A 4WELA 3T4JA 3AGEA 1JVJA 1L0GA 4NG2A 4WZ5A 4LV3A 2UV0E 4KENB 3LGOA 1VB6A 3T4KA 4DN0A 4MBFA 4R3AA 3UPPA 4B88A 5EFWA 3MKFA 4R38A 2OAQ1 2VGKA 1NY0A 2FZ0A 2J7VA 4DJ2A 1GSWA 2OSUA 5CHUA 1NWZA 4Y13A 3EOIA 3IS2A 2J3WA 2W3DA 3UPOA 2KDKA 5A92A 2NUPC 1P9RA 3DWKA 1M40A 4EEPA 3QP8A 3TJZC 5A90A 4P6ZS 4QJGA 4BL2A 1G28A 1DJAA 4I3AA 5IHVA 4ZJ1A 4EXOA 5DTTA 5KIZA 4RA7A 1XGIA 4GJ4A 4O8GA 4MN5A 4GDNA 4OVDA 2BASA 1HZOA 2EFUA 3KYQA 1ODVA 4JBFA 2XH9A 3QP2A 2AVXA 3IXBA 3N4IA 4II7A 5E2FA 5K5BA 3F1OB 3KX0X 3UB8A 3UDFA 5DTKA 2WGWB 2A24A 1RGZA 3BW6A 3LEQA 3FWLA 3LR5A 4UA6A 5DF9A 3HLGA 3D72A 2H28A 3F1NA 3G2YA 2FFYA 2Y55A 3BFFA 2V0WA 3T4LA 4GB7A 4F94A 3QP5A 3BM6A 4KG5A 4LRZE 4DDSA 3MFXA 3TW8A 4JGOA 5HW3A 3MXQA 1YSQA 4GLQA 3F1PB 1W5DA 1K55C 1TEMA 4X55A 4F3LB 1ZG4A 1Q2PA 4KZ4A 1GSVA 2XFSA 2O9BA 5F68A 2WUQA 1I2WA 3E0YA 1G68A 3EEAA 3U2AA 4XT2B 3N8LA 3H7WA 1DJCA 4YWZA 2L0WA 4ZJ3A 4D60A 2IWBA 3CITA 3MKEA 3O3VA 4JXWA 1FCOA 2GNXA 4EBNA 3BFGA 2HV1A 4U0XA 1CF0A 1PI4A 2VV8A 5HX9A 3FPWA 1YLPA 3HUOA 4GZBA 4C3QA 3GECA 4ZDXA 1L0DA 2RL3A 4WM9A 5HAQA 3U4LP 4WEJA 5HZHA 1IYOA 2PHYA 5EOEA 5EVIB 2QJ7A 3O5YA 2E8IA 2HJEA 3Q82A 4EERA 5TBMA 4WMCA 1KE0A 2Y2JA 1LSWA 2X01A 3IX8A 1OJGA 2O0YA 3A3IA 2V20A 4L9GA 3IHAA 4NXBA 2VV6A 1SHVA 1F5MA 4MDZA 2XFTA 2B18A 3RJUA 4I3JA 1OTIA 1DRMA 1BULA 1E4DA 4OOMA 2WKPA 3LY3A 1S0WA 5F1FA 3KSIA 3AGFA 4HHDA 3UB7A 4L0LA 5GLDA 1H8ZA 3PBOA 3SZTA 2ZM2A 1OTEA 5AQBA 4MEZA 1BT5A 4HH2A 2XD5A 3LCEA 1N9LA 4KZ8A 2WAEA 3DTMA 2V8FA 4E3JA 3R7WB 2ZL1A 2XGNA 5HWWA 5TR7A 1TS7A 2ZQDA 1LL8A 3PHYA 1KOUA 3EQUA 2QMIA 2J8YA 4HOIA 3VV4A 3C30A 5AQ7A 3UPNA 3HUMA 3CPTB 3V50A 1MWSA 2DNSA 1S6RA 2WK0A 4L9EA 3HJKA 4UEYA 2JKGA 4JXGA 2ZQ7A 3C7VA 3L9KA 1LLBA 4R70A 3IF6C 3UO9A 5FEGA 1IFQA 3DTKA 1S4RA 2Z6CA 5GHYA 2H0TA 3BY9A 4PAUA 3NBLA 2OOLA 1ZC2A 1PWCA 2PYPA 3HCYA 3VOZA 1SZVA 3DW0A 3LFVA 4GS9A 5EV0A 3CLOA 3FG8A 4XT2A 5D3OA 1WYBA 4MBHA 1CJFA 5F5YA 5A91A 5HAPA 4WZ5C 3WRTA 3UMDA 3R4KA 3BJNA 4LCMA 1HLUP 3SS5A 3O86A 5KZHA 4FCFA 1N4OA 3WRZA 5KSCA 2KX6A 4OQIA 4X25A 3ISGA 4GDBA 1CI9A 2EX6A 3GTCA 4DKIA 1Z09A 3S7PA 3MXRA 3G6OA 1K38A 3FKVA 3NC8A 4LV0A 2WKQA 5AVEA 2I9VA 1KGEA 2JKRI 5DVAA 4EETB 3HUNA 3PBTA 1FCMA 1PFLA 2I72A 4GHIB 4KQRA 4AFIA 4E3IA 4OOYA 3ZG7B 2VX8A 3Q7VB 1O07A 2P9VA 4HEFA 2J3TD 4N1HA 1PWDA 4Z9QA 1BYWA 4Z1WA 4R6LA 4B9OA 5GLAA 2R9WA 3N6IA 4FH4A 1PZOA 4U3TA 3TE8A 2BLSA 4DDYA 3BFEA 3IWOA 4Y17A 4UHUA 1Y28A 4OQ0A 2W1RA 1DY6A 2OWHA 4HNBA 3F1OA 1BLHA 3HREA 2VGLM 3VMAA 2KLIA 3CAXA 1IYQA 2Y79A 1NXYA 3OCNA 1Q2QA 1STZA 1YLTA 3N8RA 1T1CA 4PKYG 5CECA 3Q07A 4PM8A 4E3LA 1G6OA 2V1BA 4GKUA 4KG2A 4ESPA 1KVLA 3CPTA 4WMCD 2DRWA 3C4OA 5CERA 4BJPA 4UAAA 5FI7A 5FQKA 2JC7A 5FQ9A 4RX2A 3HLDA 4EWFA 4XUZA 2WGVA 2YKFA 1OTBA 1MWUA 1BTLA 3O88A 3K3DA 3ZG5A 1P97A 3ZG9B 3ZG0A 4S2PA 2ZM0A 5E2GA 1NYYA 4ZJ2A 1S67L 3VSLA 1YLZA 3G32A 2OAP1 3BY8A 5KMWA 3B42A 2K2NA 3WS0A 4LGWA 4JKTA 2W0NA 1T1AA 4IJGA 4GS9B 4JLFA 1AXBA 4LPZA 4KZAA 4N1XA 4PPRA 4JPMA 1GHIA 2ZQCA 2Y4AA 5C5KA 3P01A 4CPKA 2Y91A 2PU4A 3LUQA 2ZQ8A 2GX5A 3KYZA 3NDGA 3ZVWA 4CLCB 5L8MA 4Y2FA 1K6SA 2Z6DA 4G3WA 1JWZA 3PBRA 2OLUA 4Y5FA 1TS6A 2EWWA 4EEUA 3W2ZA 4QY6A 1K0KA 3M6BA 3Q7ZA 3HBRA 3KSHA 4ZTKA 3FPVA 4H6JA 3NY4A 5F69A 3VP1A 1S1YA 1K57C 5F83A 5CEBA 3ZG8B 2HF6A 3W4QA 4QY5A 4FH2A 2PD7A 4KZ6A 4S2OA 2P9VB 1K4FA 4UQIS 4EQIA 4NK3A 3LEZA 2M7UA 4YFMA 3EGXC 2WKHA 3OZHA 3EEHA 4OPRA 4R23A 1FR6A 1PRQA 1PIOA 4LCLA 1XKZA 1MWTA 3NOPC 3F1NB 3SS3A 3Q7VA 1I5QA 1YQSA 4Y7PA 2PYRA 1XA7A 4RX3A 4LRXC 2ZC4B 5LBRA 4BL3A 2UWXA 3BEBA 3K2NA 4WZ4A 3UNWA 3NCKA 1GA9A 4H8RA 4JGPA 4HESA 4OP8A 1CEGA 2W3FA 3RH8B 1MC0A 5EVID 1MBLA 4D2OA 4KQOA 4S2LA 1SDNA 5DJUA 1G6AA 1YAXA 3PBNA 1IYSA 4O0PA 5FI6A 1ZKJA 1DP6A 1K55A 1YM1A 5M1AA 4EBLA 5G4ZA 1VEUB 4HIAA 1YLWA 2H10A 5DKKA 4GW9A 4KQDA 4HQAA 1VM1A 5EPHA 4Y15A 4ZBEA 1L0EA 5TFQA 2G7UA 3LIDA 3WWXA 4UA7A 2BG1A 2PR5A 4Y0OA 1L0FA 4E3OA 1BLCA 2GJ3A 3OOVA 5E2HA 2FFFB 5FDHA 4OH0A 4OP5A 3KO6A 3WS4A 2PT7A 3B33A 4PM6A 3IBRA 3RXWA 1K56A 1XGJA 5TGFA 1XA1A 3CI6A 1H5XA 4PM7A 4WF0A 4MBKA 2D01A 3G35A 4KUKA 1ALQA 1V9YA 2GDNA 1HTZA 1FSYA 1EROA 5FQMA 5L2FA 1XJ6A 1TDGA 4GN2A 2XROA 3OBFA 2EXAA 4MMNA 2A3UA 4QPRA 2JCHA 5CTMA 3SOIA 2VGLS 3WS2A 3ZVTA 3A3FA 3IX4A 3HLBA 2V2FF 3BWLA 2JHEA 5FASA 5FEFA 1LL5A 2ZL1B 1XXMA 4IEDA 4QWOA 5EM0A 4X56A 5L09A 5CHJA 1YSPA 3C5AA 1K54C 4WYYA 4DE0A 5HWVA 1KE3A 1OPXA 4KZ3A 1S1ZA 2ZJ9A 1Z6FA 4M3KA 4S2NC 4S2NA 3Q81A 3D3OA 2CMNA 4EUZA 2P7JA 3UDXA 1F9IA 4YINA 4P0MA 1BLSA 3VE3A 2Z2MB 5HL6A 1LL9A 3D9YA 2QYBA 5U47A 3MBZA 3RTYA 3BFDA 2DMWA 2Y8HA 3AGDA 2OWJA 5FI2A 4IUKA 1YLYA 5HARA 3A0RA 3BLSA 3IXHA 4KQQA 3L7HA 1VHMA 1IYPA 4FUWA 4E04A 2ZD8A 4E6XA 5FA7A 3IXGA 4LLOB 3EGDC 1NRJA 3QHYA 4R0QA 4MN7A 3DTEA 3SH9A 5HSQA 1T1BA 3T4QA 1QMEA 3GV9A 4CLCE 4KUOA 2HZ5A 3WS1A 5HPFA 4JGRA 3HL9A 2XA7S 1D1JA 3CUEA 3PAEA 4S2JA 5G4YA 1YPRA 4UA9A 2PBYA 5KSHA 4BWIA 3S1YA 2JKTM 3NJAA 1KDWA 1DP9A 1XJ2A 4ARZA 3GR2A 1KE4A 3BQAA 2B02A 3M6HA 4KZ7A 1WA9A 4Q8IA 4K08A 1PWGA 5CRFA 4QHCA 2W1TB 4UQIM 3IH9A 5GLCA 1SKFA 2J9PA 2ZC7A 3C8CA 4GHIA 4XXRA 4B93A 4X69A 1RCJA 4QD4A 5AVFA 4F3LA 3W4PA 4KG6A 1FCNA 3VSKA 3JVVA 1UWNX 4OKPA 1LI0A 2ZC6B 1W63Q 3C4PA 1SKOA 1PW8A 4EUVA 5CHMA 2Y2QA 1TDLA 1W8QA 2JKRM 2H0YA 3T1XA 4B4XA 5EECA 3M2KA 4FD8A 2XRNA 2HP5A 4BENA 1EWZA 1YMXA 5L10A 5JYOA 3ITBA 3C38A 3LY4A 4OQGA 1D7EA 2ZM8A 2WKIA 1S4SA 4LENA 4X1MA 3E4QA 3UE0A 3CZDA 2PR6A 5F6AA 5FQJA 5FAPA 4PM9A 4DE2A 3PTEA 4Y0TA 2WAFA 5HD5A 3IQAA 4I5SA 2J3TC 1F98A 3LYXA 3H82A 1PNEA 3KSGA 5HD3A 4R3JA 2ZMAA 3LIEA 3QNCA 3UN7A 1ES4A 3S7OA 3PAGA 4ETXA 2W3EA 4BBVA 2R78A 5HDDA 2CC1A 3ULFA 2A49A 1YKDA 4GD6A 4N9KA 1W79A 4XUXA 1ONHA 3ZHHA 2ZC5B 1OT6A 3VP4A 1I2SA 4R4RA 4PM5A
chains in the Genus database with same CATH topology
3FC7A 3W2ZA 4WEKA 3D72A 2H28A 5HDCA 1LSVA 3F1NA 3H7WB 3F1PA 3UB9A 2V0WA 4HP4A 3T4OA 4HJ3A 3T4LA 1UGUA 2VA0A 4LRZE 3MFXA 4FOFA 3TW8A 4JGOA 3KSHA 3LR4A 3FPVA 2EA9A 4H6JA 5F69A 4GCZA 1S1YA 5J4EA 3T50A 2QJ5A 2HF6A 2INWA 1T18A 2J80A 3MXQA 1YSQA 3MF0A 2PD7A 4GLQA 3F1PB 3LIBA 4IHQA 1TD5A 4UQIS 4OOLA 4F3LB 2WKRA 4NKPA 2GZAA 4HY8A 4NXFA 5A8BA 2M7UA 3EGXC 3K3CA 3EEHA 1GSVA 4HJ6A 1ZHHB 4PHTA 4H6JB 2O9BA 5F68A 3E0YA 2K7SA 1JNUA 3EEAA 3U2AA 2HJ9C 5DKLA 3TRCA 2PDRA 3NOPC 4XT2B 3F1NB 3H7WA 4YWZA 2L0WA 4JGQA 2PYRA 1TS0A 1XJ4A 3MQOA 4IUHA 4LRXC 3CITA 3ZQ5A 1IOUA 3CWFA 5LBRA 2ZOIA 3V67A 2GNXA 3K2NA 4I38A 2HV1A 3VE4A 3OCLA 4Q0IA 2VV8A 4JGPA 3FPWA 5DFYA 4WN5A 2W3FA 3RH8B 3GECA 1MC0A 4YOFA 4WEJA 4G3KA 4MCWA 1XFNA 4CLCC 4EU0A 5HZHA 4KQOA 2PHYA 5DJUA 1YAXA 3PBNA 2QJ7A 3O5YA 4HJ4A 2HJEA 3DBAA 4O0PA 3VOLA 1ZTUA 4P6ZM 4PKYA 1XJ3A 1DP6A 5G4ZA 4EERA 5TBMA 4WUJA 4HIAA 2HGVA 1LSWA 3MJQA 3OC2A 4ZRRA 5DKKA 4GW9A 3LI8A 4KQDA 4L9FA 4HQAA 5MC7A 2O0YA 1OJGA 3UMEA 4CQHA 2JKTI 4L9GA 2A2LA 4NXBA 2G7UA 1NLYA 2VV6A 3LIDA 4CLCD 3LR0A 1F5MA 4MDZA 3H9WA 2B18A 4I3JA 4CLCA 1OTIA 1DRMA 4OOMA 1LSXA 3OLOA 2WKPA 2PR5A 1UWPX 2P08A 5I5LA 3KSIA 4HHDA 3UB7A 4L0LA 2XA7M 4G3VA 3LIAA 2GJ3A 3PBOA 3OOVA 1OTEA 1D06A 2ZBBA 1NLZA 3KO6A 2O99A 3MQ0A 5TJJA 2PT7A 2IA2A 2KOIA 2ZMVA 3B33A 3UE6A 3IBRA 3CI6A 5HWTA 4WF0A 3E4OA 4LRYC 2D01A 1X0OA 4HH2A 3P7NA 1N9LA 4KUKA 2PD8A 1V9YA 5IT5A 3R7WB 1XJ6A 1GSXA 4ARZB 4EESA 5HWWA 3S7QA 1P9WA 3GDIA 1TS7A 1LL8A 3PHYA 4M4XA 1S66L 1KOUA 4MN6A 2XROA 3OBFA 3EQUA 4MMNA 4HOIA 2W3GA 4QPRA 3VV4A 3C30A 2VGLS 1MZUA 2L1MA 2O9AA 3KSFA 2V1AA 2VJWA 4FSFA 4I39A 4L9EA 3HJKA 4O01A 4UEYA 5IU1A 4HP9A 3C2WA 3JVUA 3A0SA 3BWLA 2JHEA 3UE3A 4R70A 1IFQA 2VLGA 1TF1A 4Q0JA 1S4RA 2Z6CA 1XFQA 4HH3A 3BY9A 2EWVA 4PAUA 2QKPA 1YSPA 4BBTA 2OOLA 5HWVA 3SW1A 1OPXA 1S1ZA 2PYPA 5HDSA 3RFBA 3NOUC 3HCYA 3MMHA 2LB5A 3ZYTA 3LFVA 3PBSA 4GS9A 3D3OA 2W1TA 2CMNA 5TBMB 3CLOA 2M1CA 1H8MA 3FG8A 4XT2A 2P7JA 5F5YA 1F9IA 3UB6A 3VE3A 5HL6A 2QYBA 5DJTA 3RTYA 4WLAA 3E4PA 3R4KA 2DMWA 2Y8HA 3UMDA 2OWJA 3EQVA 3BJNA 2L4RA 2D02A 2QWSA 4IUKA 2VV7A 1DP8A 1OTDA 4WL9A 2VKSA 2V9AA 2XSSA 2KX6A 5IS1A 3PBQA 1N9NA 2O9CA 3A0RA 4I3IA 2V0UA 4YNRA 1VHMA 2NUTC 3LIFA 4E04A 1OJ5A 3S7PA 3G6OA 3PXPA 4DJ3A 4LLOB 2WKQA 3EGDC 1TS8A 2FH5A 5AVEA 4ETZA 1NRJA 2I9VA 4MN7A 3S7NA 5J7EA 5HSQA 2JKRI 1T1BA 4EETB 3T4QA 3LICA 4HI4A 5CX7A 4CLCE 4KUOA 5HPFA 4Q0HA 4JGRA 3PBTA 3CUEC 1T19A 3E98A 5J3WA 2XA7S 3CUEA 4NXGA 4GHIB 1N9OA 4AFIA 3H82B 2JN7A 5G4YA 4BBUA 2VX8A 5DFXA 5KSHA 4BWIA 4BMWA 2JKTM 3NJAA 2J3TD 2ZOHA 1DP9A 1P0ZA 3T4SA 5HPIA 1BYWA 1OT9A 4Z1WA 4R6LA 4NEED 4B9OA 4DMZA 3LR3A 3A0VA 3R7WA 1XJ2A 1EW0A 3PYPA 4ARZA 3TE8A 3BQAA 2VZWA 2B02A 2ZMFA 2YKHA 1WA9A 1V9ZA 4K08A 2W1TB 1Y28A 4UQIM 2W1RA 4EQ1A 4WELA 2OWHA 3C8CA 3T4JA 4HNBA 4GHIA 4B93A 3F1OA 5AVFA 3B47A 2VGLM 4F3LA 2KLIA 3JVVA 1UWNX 1VB6A 3CAXA 3T4KA 1W63Q 2Y79A 3OCNA 4DN0A 4NXEA 5AJGA 3MR0A 4ME4A 1STZA 4PKYG 1T1CA 1W63M 4R3AA 4EUVA 5EFWA 1G6OA 2V1BA 2JKRM 4R38A 2OAQ1 4RQ9A 3LI9A 2QHKA 2FZ0A 4DJ2A 1GSWA 2XRNA 1NWZA 4BJPA 3EOIA 3HJIA 3IS2A 2W27A 2J3WA 2W3DA 3C38A 2KDKA 3PR6A 1P9RA 5FL3A 2NUPC 3NOTC 1D7EA 1LT0A 2YKFA 1OTBA 3K3DA 1P97A 1S4SA 4EEPA 3ICYA 3E4QA 3TJZC 4P6ZS 1S67L 1G28A 2VEAA 2M7VA 2A24B 2PR6A 2OAP1 3BY8A 4I3AA 4Y3IA 5F6AA 3B42A 2K2NA 2W0NA 4EXOA 3BQ8A 5KIZA 1T1AA 4IJGA 4GS9B 2K31A 4LPZA 4GJ4A 4O8GA 4MN5A 5HD5A 1MKMA 4I5SA 2BASA 2J3TC 3KYQA 1F98A 3IBJA 3LYXA 1OTAA 5C5KA 3H82A 3P01A 1ODVA 3KSGA 5HD3A 3NHQA 3LUQA 2GX5A 3KYZA 3LIEA 2LB9A 4CLCB 3S7OA 4II7A 4ETXA 2W3EA 5L8MA 4BBVA 2R78A 3EWKA 5HDDA 3ULFA 2P04A 1YKDA 5K5BA 4Y2FA 3F1OB 3KX0X 3UB8A 2MJ6A 3MQQA 2Z6DA 4G3WA 2A24A 3PBRA 1H3QA 2W3HA 3BW6A 4Y5FA 1TS6A 1OT6A 3LR5A 2EWWA 4EEUA 4EW7A 5DF9A 3T4TA 3IS2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FC7 A;  2CMN A;  4L9G A;  3CLO A;  2M1C A;  5TBM B;  3D72 A;  2H28 A;  3FG8 A;  4XT2 A;  5HDC A;  1LSV A;  3F1N A;  3LID A;  2VV6 A;  3F1P A;  3H7W B;  4NXB A;  2P7J A;  1UWN X;  1VB6 A;  3CAX A;  3H9W A;  5F5Y A;  1F9I A;  3UB9 A;  2V0W A;  4HP4 A;  4I3J A;  1OTI A;  4HJ3 A;  3UB6 A;  1DRM A;  1UGU A;  4NXE A;  1LSX A;  3OLO A;  3VE3 A;  3UME A;  2WKP A;  3MR0 A;  4LRZ E;  2PR5 A;  4PKY G;  3MFX A;  1T1C A;  4R3A A;  1UWP X;  4JGO A;  5I5L A;  5DJT A;  3RTY A;  4WLA A;  3E4P A;  4HHD A;  3UMD A;  3UB7 A;  5EFW A;  2EA9 A;  4H6J A;  5F6A A;  2OWJ A;  5F69 A;  3LIA A;  2V1B A;  2GJ3 A;  2L4R A;  1S1Y A;  2D02 A;  2QWS A;  4GCZ A;  4R38 A;  4RQ9 A;  2VV7 A;  5J4E A;  1DP8 A;  1OTD A;  2QJ5 A;  4WL9 A;  3T50 A;  2INW A;  1OTE A;  2J80 A;  1D06 A;  1T18 A;  2KX6 A;  2QHK A;  2V9A A;  2ZBB A;  3LI9 A;  3MXQ A;  2PD7 A;  4DJ2 A;  5IS1 A;  1GSW A;  3F1P B;  3LIB A;  1N9N A;  1NWZ A;  3A0R A;  3B33 A;  4I3I A;  3UE6 A;  3IBR A;  2V0U A;  3HJI A;  3IS2 A;  4F3L B;  2W27 A;  2WKR A;  5A8B A;  4HY8 A;  4NXF A;  5HWT A;  4WF0 A;  3K3C A;  3EEH A;  1GSV A;  3E4O A;  2KDK A;  4HJ6 A;  2D01 A;  4LRY C;  1X0O A;  4HH2 A;  3P7N A;  3LIF A;  4H6J B;  1N9L A;  5F68 A;  3NOT C;  1D7E A;  4KUK A;  1OJ5 A;  1LT0 A;  2PD8 A;  2YKF A;  4E04 A;  3G6O A;  1OTB A;  1JNU A;  1V9Y A;  2K7S A;  5DKL A;  3K3D A;  2PDR A;  3NOP C;  4XT2 B;  4DJ3 A;  3F1N B;  1P97 A;  4LLO B;  3H7W A;  1XJ6 A;  2WKQ A;  1S4S A;  4YWZ A;  1TS8 A;  5AVE A;  2L0W A;  1GSX A;  2I9V A;  4EEP A;  4JGQ A;  4EES A;  2PYR A;  3E4Q A;  1TS0 A;  1XJ4 A;  3ICY A;  5HSQ A;  1T1B A;  5HWW A;  3MQO A;  5J7E A;  4EET B;  1S67 L;  1G28 A;  2VEA A;  3LIC A;  4HI4 A;  3GDI A;  4LRX C;  1TS7 A;  3ZQ5 A;  4KUO A;  2A24 B;  3CWF A;  2PR6 A;  5J3W A;  4JGR A;  1LL8 A;  3BY8 A;  1T19 A;  3PHY A;  2ZOI A;  1S66 L;  1KOU A;  4I3A A;  4M4X A;  4MN6 A;  4NXG A;  4GHI B;  1N9O A;  2W0N A;  4EXO A;  4HOI A;  4I38 A;  2HV1 A;  3VE4 A;  5KIZ A;  1T1A A;  3H82 B;  2JN7 A;  4GS9 B;  5G4Y A;  2VV8 A;  4LPZ A;  4JGP A;  4BBU A;  1MZU A;  2L1M A;  4MN5 A;  5HD5 A;  4I5S A;  4WN5 A;  2BAS A;  3RH8 B;  3NJA A;  3GEC A;  1F98 A;  2V1A A;  2ZOH A;  1DP9 A;  1P0Z A;  1BYW A;  1OT9 A;  3LYX A;  1OTA A;  4I39 A;  4L9E A;  3H82 A;  4R6L A;  3HJK A;  4B9O A;  1ODV A;  3A0V A;  5HD3 A;  1XJ2 A;  1EW0 A;  3C2W A;  3NHQ A;  4HP9 A;  3LUQ A;  5IU1 A;  3A0S A;  3BWL A;  3LIE A;  2JHE A;  3PYP A;  1XFN A;  5HZH A;  4R70 A;  2VLG A;  2PHY A;  4BBV A;  2R78 A;  3EWK A;  5DJU A;  5HDD A;  3ULF A;  1S4R A;  2B02 A;  2Z6C A;  1XFQ A;  2QJ7 A;  4HJ4 A;  4HH3 A;  2YKH A;  3F1O B;  3VOL A;  1WA9 A;  1V9Z A;  3KX0 X;  4K08 A;  4PKY A;  3UB8 A;  1XJ3 A;  3BY9 A;  1DP6 A;  1Y28 A;  2QKP A;  3MQQ A;  5G4Z A;  2Z6D A;  5TBM A;  4EER A;  4WUJ A;  4BBT A;  2A24 A;  2OOL A;  4HIA A;  5AVF A;  5HWV A;  3SW1 A;  4EQ1 A;  1LSW A;  3MJQ A;  4F3L A;  1S1Z A;  2PYP A;  2OWH A;  5DKK A;  3C8C A;  3NOU C;  4GW9 A;  4HNB A;  4GHI A;  5HDS A;  1TS6 A;  3LI8 A;  1OT6 A;  3F1O A;  4KQD A;  4L9F A;  4EEU A;  4EW7 A;  4HQA A;  1OJG A;  4GS9 A;  3IS2 B; 
#chains in the Genus database with same CATH topology
 3FC7 A;  4WEK A;  2H5S A;  3E2K A;  3UE1 A;  3ZGA B;  3F1P A;  4E3N A;  4K0W A;  1SDE A;  4PMA A;  4HJ3 A;  3C7U A;  3FYZ A;  2C5W B;  1K56 D;  2EA9 A;  5EUA A;  1C3B A;  1AWI A;  3T50 A;  5CGS A;  2J80 A;  4QB8 A;  1GCE A;  3LIB A;  4IHQ A;  3V39 A;  2EFX A;  3T1R A;  2GZA A;  4HY8 A;  4NXF A;  4OPZ A;  1Y54 A;  3K3C A;  4HJ6 A;  4GD8 A;  3MZE A;  2P74 A;  4PHT A;  1FQG A;  2XR0 A;  1HVB A;  2K7S A;  1JNU A;  2HJ9 C;  5DKL A;  2XLN A;  1G5U A;  3HLW A;  2PBD P;  5EVI C;  1TS0 A;  1IKI A;  5E2E A;  3MQO A;  4IUH A;  3ZQ5 A;  5EE8 A;  5FDS A;  3VFH A;  3V67 A;  3NDE A;  4KZ9 A;  2XQZ A;  4P87 A;  3NEC A;  3ZDJ A;  1JWV A;  1ERM A;  5FAQ A;  4WN5 A;  3HLF A;  4R3B A;  5DF7 A;  3O87 A;  5HAI A;  4EU0 A;  4DXC A;  2Y2O A;  4RYE A;  3IWQ A;  4HJ4 A;  4OON A;  1ZTU A;  4P6Z M;  4PKY A;  1XJ3 A;  1NRF A;  1WYC A;  1ES2 A;  3VOY A;  4JF5 A;  4ZRR A;  3VP2 A;  1NJ4 A;  3SS4 A;  5I94 A;  3VP0 A;  2G2W A;  4GOG A;  4L9F A;  4C75 A;  4CQH A;  4O7D A;  2JKT I;  2A2L A;  3G34 A;  3TG9 A;  5AQA A;  4CLC D;  3LR0 A;  1CI8 A;  3H9W A;  1LSX A;  1PYY A;  1UWP X;  2P08 A;  5I5L A;  1IEL A;  3TOI A;  2R9X A;  4BD0 A;  2PU2 A;  1FOF A;  3B3X A;  2B5R A;  1D06 A;  1W8Y A;  3GQZ A;  4R4S A;  5TJJ A;  1ACF A;  2WYX A;  2IA2 A;  2KOI A;  4NET A;  3ZCZ A;  3UE6 A;  1K6R A;  3CHW P;  5HWT A;  1BLP A;  3E4O A;  4P6B A;  4DXB A;  3FKW A;  2PD8 A;  5FAO A;  4OPQ A;  3MFD A;  1KVM A;  1LI9 A;  5AQ9 A;  2ZLY A;  1P9W A;  2Y2H A;  4M4X A;  1S66 L;  4N92 A;  4MN6 A;  2ZQA A;  5EVL A;  1TVF A;  2XD1 A;  2W3G A;  3A3D A;  1MZU A;  3W8K A;  2Z2L B;  2PRF A;  2EXB A;  3KSF A;  2JE5 A;  2V1A A;  1NZU A;  4I39 A;  1Y4O A;  4O01 A;  4OLG A;  3C2W A;  4JXV A;  1ES5 A;  3OPL A;  5GLB A;  2VLG A;  1TF1 A;  4Q0J A;  4DRT A;  1XFQ A;  4X53 A;  1L3L A;  5CTN A;  4X68 A;  3A3J A;  4BBT A;  3P98 A;  3RFB A;  3NOU C;  4MNR A;  3NI9 A;  2LB5 A;  3ZYT A;  3PBS A;  2W1T A;  4IVI A;  3V3R A;  4IBR A;  1H8M A;  1FR1 A;  3CJM A;  1J9M A;  5DTS A;  2JKF A;  4ZAM A;  2HP6 A;  3UB6 A;  4E3M A;  3UY6 A;  4LV2 A;  5DJT A;  4WLA A;  3E4P A;  3E2L A;  1YMS A;  2D02 A;  2QWS A;  3IH8 A;  3SH8 A;  1DP8 A;  1OTD A;  1SKO B;  2VKS A;  2XSS A;  2HP9 A;  5DF8 A;  5JYP A;  2HDR A;  3PBQ A;  2O9C A;  4I3I A;  2V0U A;  3IF6 B;  3OPP A;  1HD8 A;  2NUT C;  3WS5 A;  2WGI A;  1KDS A;  2RCX A;  3N8S A;  5CED A;  4ETZ A;  3RXX A;  5FQI A;  5GHX A;  3S4X A;  1FIL A;  3T1S A;  3LIC A;  4HI4 A;  3T1Q B;  4Q0H A;  1GHM A;  3CUE C;  1KGF A;  4NXG A;  3ZFZ A;  3H82 B;  2JN7 A;  3GMW A;  1XP4 A;  4OLD A;  3IT9 A;  2WZX A;  5DFX A;  4BMW A;  1CQA A;  2WAD A;  1RGY A;  1MKI A;  4NEE D;  2B95 A;  3G2Z A;  3A0V A;  3R7W A;  2HDS A;  2XF3 A;  5L07 A;  1U60 A;  3I7J A;  3PYP A;  3BYD A;  1MXO A;  2ZMF A;  3BEC A;  4OQH A;  2VK3 A;  4LFU A;  2J9O A;  1L2S A;  4LV1 A;  3FZC A;  5EM1 A;  3G4P A;  4S2I A;  3V5M A;  3B47 A;  1IEM A;  4KZB A;  4BQM A;  2IWD A;  4NXE A;  5AJG A;  2VGJ A;  3MR0 A;  4ME4 A;  1W63 M;  4IVK A;  2V8C A;  3P09 A;  3GSG A;  3A3E A;  4RQ9 A;  3ZNT A;  3IXD A;  3LI9 A;  5HL1 A;  2QHK A;  4E6W A;  3HVF A;  5J8X A;  1NYM A;  1FIK A;  3UB5 P;  3HJI A;  2W27 A;  4P85 A;  3PR6 A;  5GL9 A;  3T12 B;  5FL3 A;  3NOT C;  4S2M A;  1LT0 A;  1SCW A;  2BTF P;  5HFO A;  3MSH A;  1E3U D;  2XDM A;  1GHP A;  3ICY A;  4X6T A;  5M18 A;  2OLV A;  2VEA A;  1ES3 A;  2Y2M A;  2M7V A;  5EOO A;  2A24 B;  5CGW A;  4Y3I A;  2EX2 A;  4ID4 A;  3BQ8 A;  1K57 A;  2K31 A;  2OV5 A;  1ESI A;  2Y2G A;  1MKM A;  3QP6 A;  3IBJ A;  1OTA A;  2PAV P;  2ZC3 B;  1ESU A;  3NHQ A;  5G18 A;  2LB9 A;  4BLM A;  4FTX A;  3FV7 A;  3EWK A;  2P04 A;  1WE4 A;  3IF5 A;  1YLJ A;  1H0M A;  2DCF A;  2EX9 A;  3SH7 A;  2MJ6 A;  3MQQ A;  1GA0 A;  1H3Q A;  2QPN A;  2W3H A;  4K0X A;  5EVE A;  3TSG A;  2WZZ A;  4EW7 A;  5F1G A;  3T4T A;  3IS2 B;  1H8Y A;  5HDC A;  1LSV A;  3H7W B;  3UB9 A;  1IKG A;  1M6K A;  3T4O A;  4HP4 A;  3KYE A;  1UGU A;  5FQQ A;  2VA0 A;  3ITA A;  4RVA A;  4FOF A;  1VET A;  3LR4 A;  1XX2 A;  4DE1 A;  2XEP A;  1JTD A;  4GCZ A;  1E25 A;  5J4E A;  4R1G A;  1RP5 A;  2QJ5 A;  2Q9N A;  5BOH A;  2INW A;  1T18 A;  3MF0 A;  4N9L A;  2QZ6 A;  1BZA A;  1TD5 A;  4OOL A;  2WKR A;  4NKP A;  2Y59 A;  5A8B A;  3V3S A;  3MZD A;  1ZHH B;  4H6J B;  3QNB A;  1J3W A;  2XK1 A;  3GRJ A;  3IWI A;  3TRC A;  2PDR A;  5EVI A;  1ONG A;  3N7W A;  3S22 A;  4JGQ A;  1XJ4 A;  3UDI A;  1IOU A;  3CWF A;  2ZOI A;  2HPB A;  2Q0O A;  4E3K A;  4I38 A;  1MY8 A;  3VE4 A;  3OCL A;  4A5R A;  4B4Z A;  2WGW A;  4Q0I A;  5DFY A;  4HBU A;  3NUL A;  2Q9M A;  1K54 A;  2Y2I A;  4KZ5 A;  1VEU A;  1VQQ A;  3HLE A;  4YOF A;  4G3K A;  4MCW A;  3IHB A;  1FSW A;  1O7E A;  1XFN A;  4QU3 A;  4CLC C;  3Q1F A;  4WBG A;  4MLL A;  4IBX A;  3VOL A;  3DBA A;  3OPH A;  3MS6 A;  4WUJ A;  5A93 A;  2HGV A;  2X02 A;  3MJQ A;  3OC2 A;  3OPR A;  1BSG A;  3VFF A;  1PI5 A;  3LI8 A;  5GHZ A;  5MC7 A;  2Y2N A;  3UME A;  2IWC A;  1NLY A;  3VP3 A;  4CLC A;  2EX8 A;  3OLO A;  4HBT A;  3IX3 A;  1OME A;  2ZQ9 A;  3M2J A;  1NZO A;  2XA7 M;  1LHY A;  4G3V A;  1F2K A;  3LIA A;  3IF6 A;  1XPB A;  4C6Y A;  1DJB A;  3DWZ A;  2ZBB A;  1NLZ A;  2O99 A;  3MQ0 A;  2G2U A;  4DE3 A;  3G30 A;  2ZMV A;  2Y2L A;  4LRY C;  3BRM A;  1X0O A;  3P7N A;  3QP1 A;  5IT5 A;  1GSX A;  3BFC A;  4ARZ B;  1K25 A;  4EES A;  3BLM A;  2WKE A;  3S7Q A;  3GDI A;  5FAT A;  3MXS A;  4OPY A;  1KGG A;  2L1M A;  3D4F A;  2O9A A;  2VJW A;  1PZP A;  4FSF A;  3JPU A;  1MWR A;  5IU1 A;  4HP9 A;  3JVU A;  3A0S A;  4CJN A;  4JF6 A;  1QMF A;  4S2K A;  3UE3 A;  4DF6 A;  1CEF A;  2X71 A;  3QP4 A;  1A0K A;  4HH3 A;  1N9B A;  2EWV A;  2HDU A;  2QKP A;  3SW1 A;  1VET B;  3DAV A;  2JBF A;  5HDS A;  1EI5 A;  3MMH A;  2Y2P A;  3ZNY A;  1MPL A;  5TBM B;  2M1C A;  3NIA A;  3DTI A;  5CGX A;  1BUE A;  3CG5 A;  3LO7 A;  3EQV A;  2L4R A;  2VV7 A;  4WL9 A;  3W4O A;  2V9A A;  1K4E A;  5IS1 A;  3G31 A;  5CXW A;  4EV4 A;  1N9N A;  5E43 A;  1PW1 A;  4EBP A;  1W7F A;  3MZF A;  1JTG A;  4X1L A;  4YNR A;  3LIF A;  1JWP A;  1OJ5 A;  3PXP A;  4DJ3 A;  1TS8 A;  2FH5 A;  3S7N A;  1YT4 A;  5J7E A;  5M19 A;  5CX7 A;  5J3W A;  3CMZ A;  1T19 A;  3E98 A;  3JYI A;  1N9O A;  2V1Z A;  2C6W B;  3GVB A;  4BBU A;  4Y0U A;  1ERQ A;  2ZOH A;  1P0Z A;  3T4S A;  5HPI A;  1OT9 A;  4DMZ A;  4BD1 A;  3LR3 A;  1CK3 A;  1EW0 A;  5F82 A;  3HLC A;  2VZW A;  2E8J A;  2ACG A;  2YKH A;  5FSR A;  4GNU A;  1V9Z A;  4JF4 A;  4K91 A;  2HDQ A;  4JXS A;  2Y2K A;  4U0T A;  1ZG6 A;  1E3U A;  4EQ1 A;  4WEL A;  3T4J A;  3AGE A;  1JVJ A;  1L0G A;  4NG2 A;  4WZ5 A;  4LV3 A;  2UV0 E;  4KEN B;  3LGO A;  1VB6 A;  3T4K A;  4DN0 A;  4MBF A;  4R3A A;  3UPP A;  4B88 A;  5EFW A;  3MKF A;  4R38 A;  2OAQ 1;  2VGK A;  1NY0 A;  2FZ0 A;  2J7V A;  4DJ2 A;  1GSW A;  2OSU A;  5CHU A;  1NWZ A;  4Y13 A;  3EOI A;  3IS2 A;  2J3W A;  2W3D A;  3UPO A;  2KDK A;  5A92 A;  2NUP C;  1P9R A;  3DWK A;  1M40 A;  4EEP A;  3QP8 A;  3TJZ C;  5A90 A;  4P6Z S;  4QJG A;  4BL2 A;  1G28 A;  1DJA A;  4I3A A;  5IHV A;  4ZJ1 A;  4EXO A;  5DTT A;  5KIZ A;  4RA7 A;  1XGI A;  4GJ4 A;  4O8G A;  4MN5 A;  4GDN A;  4OVD A;  2BAS A;  1HZO A;  2EFU A;  3KYQ A;  1ODV A;  4JBF A;  2XH9 A;  3QP2 A;  2AVX A;  3IXB A;  3N4I A;  4II7 A;  5E2F A;  5K5B A;  3F1O B;  3KX0 X;  3UB8 A;  3UDF A;  5DTK A;  2WGW B;  2A24 A;  1RGZ A;  3BW6 A;  3LEQ A;  3FWL A;  3LR5 A;  4UA6 A;  5DF9 A;  3HLG A;  3D72 A;  2H28 A;  3F1N A;  3G2Y A;  2FFY A;  2Y55 A;  3BFF A;  2V0W A;  3T4L A;  4GB7 A;  4F94 A;  3QP5 A;  3BM6 A;  4KG5 A;  4LRZ E;  4DDS A;  3MFX A;  3TW8 A;  4JGO A;  5HW3 A;  3MXQ A;  1YSQ A;  4GLQ A;  3F1P B;  1W5D A;  1K55 C;  1TEM A;  4X55 A;  4F3L B;  1ZG4 A;  1Q2P A;  4KZ4 A;  1GSV A;  2XFS A;  2O9B A;  5F68 A;  2WUQ A;  1I2W A;  3E0Y A;  1G68 A;  3EEA A;  3U2A A;  4XT2 B;  3N8L A;  3H7W A;  1DJC A;  4YWZ A;  2L0W A;  4ZJ3 A;  4D60 A;  2IWB A;  3CIT A;  3MKE A;  3O3V A;  4JXW A;  1FCO A;  2GNX A;  4EBN A;  3BFG A;  2HV1 A;  4U0X A;  1CF0 A;  1PI4 A;  2VV8 A;  5HX9 A;  3FPW A;  1YLP A;  3HUO A;  4GZB A;  4C3Q A;  3GEC A;  4ZDX A;  1L0D A;  2RL3 A;  4WM9 A;  5HAQ A;  3U4L P;  4WEJ A;  5HZH A;  1IYO A;  2PHY A;  5EOE A;  5EVI B;  2QJ7 A;  3O5Y A;  2E8I A;  2HJE A;  3Q82 A;  4EER A;  5TBM A;  4WMC A;  1KE0 A;  2Y2J A;  1LSW A;  2X01 A;  3IX8 A;  1OJG A;  2O0Y A;  3A3I A;  2V20 A;  4L9G A;  3IHA A;  4NXB A;  2VV6 A;  1SHV A;  1F5M A;  4MDZ A;  2XFT A;  2B18 A;  3RJU A;  4I3J A;  1OTI A;  1DRM A;  1BUL A;  1E4D A;  4OOM A;  2WKP A;  3LY3 A;  1S0W A;  5F1F A;  3KSI A;  3AGF A;  4HHD A;  3UB7 A;  4L0L A;  5GLD A;  1H8Z A;  3PBO A;  3SZT A;  2ZM2 A;  1OTE A;  5AQB A;  4MEZ A;  1BT5 A;  4HH2 A;  2XD5 A;  3LCE A;  1N9L A;  4KZ8 A;  2WAE A;  3DTM A;  2V8F A;  4E3J A;  3R7W B;  2ZL1 A;  2XGN A;  5HWW A;  5TR7 A;  1TS7 A;  2ZQD A;  1LL8 A;  3PHY A;  1KOU A;  3EQU A;  2QMI A;  2J8Y A;  4HOI A;  3VV4 A;  3C30 A;  5AQ7 A;  3UPN A;  3HUM A;  3CPT B;  3V50 A;  1MWS A;  2DNS A;  1S6R A;  2WK0 A;  4L9E A;  3HJK A;  4UEY A;  2JKG A;  4JXG A;  2ZQ7 A;  3C7V A;  3L9K A;  1LLB A;  4R70 A;  3IF6 C;  3UO9 A;  5FEG A;  1IFQ A;  3DTK A;  1S4R A;  2Z6C A;  5GHY A;  2H0T A;  3BY9 A;  4PAU A;  3NBL A;  2OOL A;  1ZC2 A;  1PWC A;  2PYP A;  3HCY A;  3VOZ A;  1SZV A;  3DW0 A;  3LFV A;  4GS9 A;  5EV0 A;  3CLO A;  3FG8 A;  4XT2 A;  5D3O A;  1WYB A;  4MBH A;  1CJF A;  5F5Y A;  5A91 A;  5HAP A;  4WZ5 C;  3WRT A;  3UMD A;  3R4K A;  3BJN A;  4LCM A;  1HLU P;  3SS5 A;  3O86 A;  5KZH A;  4FCF A;  1N4O A;  3WRZ A;  5KSC A;  2KX6 A;  4OQI A;  4X25 A;  3ISG A;  4GDB A;  1CI9 A;  2EX6 A;  3GTC A;  4DKI A;  1Z09 A;  3S7P A;  3MXR A;  3G6O A;  1K38 A;  3FKV A;  3NC8 A;  4LV0 A;  2WKQ A;  5AVE A;  2I9V A;  1KGE A;  2JKR I;  5DVA A;  4EET B;  3HUN A;  3PBT A;  1FCM A;  1PFL A;  2I72 A;  4GHI B;  4KQR A;  4AFI A;  4E3I A;  4OOY A;  3ZG7 B;  2VX8 A;  3Q7V B;  1O07 A;  2P9V A;  4HEF A;  2J3T D;  4N1H A;  1PWD A;  4Z9Q A;  1BYW A;  4Z1W A;  4R6L A;  4B9O A;  5GLA A;  2R9W A;  3N6I A;  4FH4 A;  1PZO A;  4U3T A;  3TE8 A;  2BLS A;  4DDY A;  3BFE A;  3IWO A;  4Y17 A;  4UHU A;  1Y28 A;  4OQ0 A;  2W1R A;  1DY6 A;  2OWH A;  4HNB A;  3F1O A;  1BLH A;  3HRE A;  2VGL M;  3VMA A;  2KLI A;  3CAX A;  1IYQ A;  2Y79 A;  1NXY A;  3OCN A;  1Q2Q A;  1STZ A;  1YLT A;  3N8R A;  1T1C A;  4PKY G;  5CEC A;  3Q07 A;  4PM8 A;  4E3L A;  1G6O A;  2V1B A;  4GKU A;  4KG2 A;  4ESP A;  1KVL A;  3CPT A;  4WMC D;  2DRW A;  3C4O A;  5CER A;  4BJP A;  4UAA A;  5FI7 A;  5FQK A;  2JC7 A;  5FQ9 A;  4RX2 A;  3HLD A;  4EWF A;  4XUZ A;  2WGV A;  2YKF A;  1OTB A;  1MWU A;  1BTL A;  3O88 A;  3K3D A;  3ZG5 A;  1P97 A;  3ZG9 B;  3ZG0 A;  4S2P A;  2ZM0 A;  5E2G A;  1NYY A;  4ZJ2 A;  1S67 L;  3VSL A;  1YLZ A;  3G32 A;  2OAP 1;  3BY8 A;  5KMW A;  3B42 A;  2K2N A;  3WS0 A;  4LGW A;  4JKT A;  2W0N A;  1T1A A;  4IJG A;  4GS9 B;  4JLF A;  1AXB A;  4LPZ A;  4KZA A;  4N1X A;  4PPR A;  4JPM A;  1GHI A;  2ZQC A;  2Y4A A;  5C5K A;  3P01 A;  4CPK A;  2Y91 A;  2PU4 A;  3LUQ A;  2ZQ8 A;  2GX5 A;  3KYZ A;  3NDG A;  3ZVW A;  4CLC B;  5L8M A;  4Y2F A;  1K6S A;  2Z6D A;  4G3W A;  1JWZ A;  3PBR A;  2OLU A;  4Y5F A;  1TS6 A;  2EWW A;  4EEU A;  3W2Z A;  4QY6 A;  1K0K A;  3M6B A;  3Q7Z A;  3HBR A;  3KSH A;  4ZTK A;  3FPV A;  4H6J A;  3NY4 A;  5F69 A;  3VP1 A;  1S1Y A;  1K57 C;  5F83 A;  5CEB A;  3ZG8 B;  2HF6 A;  3W4Q A;  4QY5 A;  4FH2 A;  2PD7 A;  4KZ6 A;  4S2O A;  2P9V B;  1K4F A;  4UQI S;  4EQI A;  4NK3 A;  3LEZ A;  2M7U A;  4YFM A;  3EGX C;  2WKH A;  3OZH A;  3EEH A;  4OPR A;  4R23 A;  1FR6 A;  1PRQ A;  1PIO A;  4LCL A;  1XKZ A;  1MWT A;  3NOP C;  3F1N B;  3SS3 A;  3Q7V A;  1I5Q A;  1YQS A;  4Y7P A;  2PYR A;  1XA7 A;  4RX3 A;  4LRX C;  2ZC4 B;  5LBR A;  4BL3 A;  2UWX A;  3BEB A;  3K2N A;  4WZ4 A;  3UNW A;  3NCK A;  1GA9 A;  4H8R A;  4JGP A;  4HES A;  4OP8 A;  1CEG A;  2W3F A;  3RH8 B;  1MC0 A;  5EVI D;  1MBL A;  4D2O A;  4KQO A;  4S2L A;  1SDN A;  5DJU A;  1G6A A;  1YAX A;  3PBN A;  1IYS A;  4O0P A;  5FI6 A;  1ZKJ A;  1DP6 A;  1K55 A;  1YM1 A;  5M1A A;  4EBL A;  5G4Z A;  1VEU B;  4HIA A;  1YLW A;  2H10 A;  5DKK A;  4GW9 A;  4KQD A;  4HQA A;  1VM1 A;  5EPH A;  4Y15 A;  4ZBE A;  1L0E A;  5TFQ A;  2G7U A;  3LID A;  3WWX A;  4UA7 A;  2BG1 A;  2PR5 A;  4Y0O A;  1L0F A;  4E3O A;  1BLC A;  2GJ3 A;  3OOV A;  5E2H A;  2FFF B;  5FDH A;  4OH0 A;  4OP5 A;  3KO6 A;  3WS4 A;  2PT7 A;  3B33 A;  4PM6 A;  3IBR A;  3RXW A;  1K56 A;  1XGJ A;  5TGF A;  1XA1 A;  3CI6 A;  1H5X A;  4PM7 A;  4WF0 A;  4MBK A;  2D01 A;  3G35 A;  4KUK A;  1ALQ A;  1V9Y A;  2GDN A;  1HTZ A;  1FSY A;  1ERO A;  5FQM A;  5L2F A;  1XJ6 A;  1TDG A;  4GN2 A;  2XRO A;  3OBF A;  2EXA A;  4MMN A;  2A3U A;  4QPR A;  2JCH A;  5CTM A;  3SOI A;  2VGL S;  3WS2 A;  3ZVT A;  3A3F A;  3IX4 A;  3HLB A;  2V2F F;  3BWL A;  2JHE A;  5FAS A;  5FEF A;  1LL5 A;  2ZL1 B;  1XXM A;  4IED A;  4QWO A;  5EM0 A;  4X56 A;  5L09 A;  5CHJ A;  1YSP A;  3C5A A;  1K54 C;  4WYY A;  4DE0 A;  5HWV A;  1KE3 A;  1OPX A;  4KZ3 A;  1S1Z A;  2ZJ9 A;  1Z6F A;  4M3K A;  4S2N C;  4S2N A;  3Q81 A;  3D3O A;  2CMN A;  4EUZ A;  2P7J A;  3UDX A;  1F9I A;  4YIN A;  4P0M A;  1BLS A;  3VE3 A;  2Z2M B;  5HL6 A;  1LL9 A;  3D9Y A;  2QYB A;  5U47 A;  3MBZ A;  3RTY A;  3BFD A;  2DMW A;  2Y8H A;  3AGD A;  2OWJ A;  5FI2 A;  4IUK A;  1YLY A;  5HAR A;  3A0R A;  3BLS A;  3IXH A;  4KQQ A;  3L7H A;  1VHM A;  1IYP A;  4FUW A;  4E04 A;  2ZD8 A;  4E6X A;  5FA7 A;  3IXG A;  4LLO B;  3EGD C;  1NRJ A;  3QHY A;  4R0Q A;  4MN7 A;  3DTE A;  3SH9 A;  5HSQ A;  1T1B A;  3T4Q A;  1QME A;  3GV9 A;  4CLC E;  4KUO A;  2HZ5 A;  3WS1 A;  5HPF A;  4JGR A;  3HL9 A;  2XA7 S;  1D1J A;  3CUE A;  3PAE A;  4S2J A;  5G4Y A;  1YPR A;  4UA9 A;  2PBY A;  5KSH A;  4BWI A;  3S1Y A;  2JKT M;  3NJA A;  1KDW A;  1DP9 A;  1XJ2 A;  4ARZ A;  3GR2 A;  1KE4 A;  3BQA A;  2B02 A;  3M6H A;  4KZ7 A;  1WA9 A;  4Q8I A;  4K08 A;  1PWG A;  5CRF A;  4QHC A;  2W1T B;  4UQI M;  3IH9 A;  5GLC A;  1SKF A;  2J9P A;  2ZC7 A;  3C8C A;  4GHI A;  4XXR A;  4B93 A;  4X69 A;  1RCJ A;  4QD4 A;  5AVF A;  4F3L A;  3W4P A;  4KG6 A;  1FCN A;  3VSK A;  3JVV A;  1UWN X;  4OKP A;  1LI0 A;  2ZC6 B;  1W63 Q;  3C4P A;  1SKO A;  1PW8 A;  4EUV A;  5CHM A;  2Y2Q A;  1TDL A;  1W8Q A;  2JKR M;  2H0Y A;  3T1X A;  4B4X A;  5EEC A;  3M2K A;  4FD8 A;  2XRN A;  2HP5 A;  4BEN A;  1EWZ A;  1YMX A;  5L10 A;  5JYO A;  3ITB A;  3C38 A;  3LY4 A;  4OQG A;  1D7E A;  2ZM8 A;  2WKI A;  1S4S A;  4LEN A;  4X1M A;  3E4Q A;  3UE0 A;  3CZD A;  2PR6 A;  5F6A A;  5FQJ A;  5FAP A;  4PM9 A;  4DE2 A;  3PTE A;  4Y0T A;  2WAF A;  5HD5 A;  3IQA A;  4I5S A;  2J3T C;  1F98 A;  3LYX A;  3H82 A;  1PNE A;  3KSG A;  5HD3 A;  4R3J A;  2ZMA A;  3LIE A;  3QNC A;  3UN7 A;  1ES4 A;  3S7O A;  3PAG A;  4ETX A;  2W3E A;  4BBV A;  2R78 A;  5HDD A;  2CC1 A;  3ULF A;  2A49 A;  1YKD A;  4GD6 A;  4N9K A;  1W79 A;  4XUX A;  1ONH A;  3ZHH A;  2ZC5 B;  1OT6 A;  3VP4 A;  1I2S A;  4R4R A;  4PM5 A; 
#chains in the Genus database with same CATH homology
 3FC7 A;  3W2Z A;  4WEK A;  3D72 A;  2H28 A;  5HDC A;  1LSV A;  3F1N A;  3H7W B;  3F1P A;  3UB9 A;  2V0W A;  4HP4 A;  3T4O A;  4HJ3 A;  3T4L A;  1UGU A;  2VA0 A;  4LRZ E;  3MFX A;  4FOF A;  3TW8 A;  4JGO A;  3KSH A;  3LR4 A;  3FPV A;  2EA9 A;  4H6J A;  5F69 A;  4GCZ A;  1S1Y A;  5J4E A;  3T50 A;  2QJ5 A;  2HF6 A;  2INW A;  1T18 A;  2J80 A;  3MXQ A;  1YSQ A;  3MF0 A;  2PD7 A;  4GLQ A;  3F1P B;  3LIB A;  4IHQ A;  1TD5 A;  4UQI S;  4OOL A;  4F3L B;  2WKR A;  4NKP A;  2GZA A;  4HY8 A;  4NXF A;  5A8B A;  2M7U A;  3EGX C;  3K3C A;  3EEH A;  1GSV A;  4HJ6 A;  1ZHH B;  4PHT A;  4H6J B;  2O9B A;  5F68 A;  3E0Y A;  2K7S A;  1JNU A;  3EEA A;  3U2A A;  2HJ9 C;  5DKL A;  3TRC A;  2PDR A;  3NOP C;  4XT2 B;  3F1N B;  3H7W A;  4YWZ A;  2L0W A;  4JGQ A;  2PYR A;  1TS0 A;  1XJ4 A;  3MQO A;  4IUH A;  4LRX C;  3CIT A;  3ZQ5 A;  1IOU A;  3CWF A;  5LBR A;  2ZOI A;  3V67 A;  2GNX A;  3K2N A;  4I38 A;  2HV1 A;  3VE4 A;  3OCL A;  4Q0I A;  2VV8 A;  4JGP A;  3FPW A;  5DFY A;  4WN5 A;  2W3F A;  3RH8 B;  3GEC A;  1MC0 A;  4YOF A;  4WEJ A;  4G3K A;  4MCW A;  1XFN A;  4CLC C;  4EU0 A;  5HZH A;  4KQO A;  2PHY A;  5DJU A;  1YAX A;  3PBN A;  2QJ7 A;  3O5Y A;  4HJ4 A;  2HJE A;  3DBA A;  4O0P A;  3VOL A;  1ZTU A;  4P6Z M;  4PKY A;  1XJ3 A;  1DP6 A;  5G4Z A;  4EER A;  5TBM A;  4WUJ A;  4HIA A;  2HGV A;  1LSW A;  3MJQ A;  3OC2 A;  4ZRR A;  5DKK A;  4GW9 A;  3LI8 A;  4KQD A;  4L9F A;  4HQA A;  5MC7 A;  2O0Y A;  1OJG A;  3UME A;  4CQH A;  2JKT I;  4L9G A;  2A2L A;  4NXB A;  2G7U A;  1NLY A;  2VV6 A;  3LID A;  4CLC D;  3LR0 A;  1F5M A;  4MDZ A;  3H9W A;  2B18 A;  4I3J A;  4CLC A;  1OTI A;  1DRM A;  4OOM A;  1LSX A;  3OLO A;  2WKP A;  2PR5 A;  1UWP X;  2P08 A;  5I5L A;  3KSI A;  4HHD A;  3UB7 A;  4L0L A;  2XA7 M;  4G3V A;  3LIA A;  2GJ3 A;  3PBO A;  3OOV A;  1OTE A;  1D06 A;  2ZBB A;  1NLZ A;  3KO6 A;  2O99 A;  3MQ0 A;  5TJJ A;  2PT7 A;  2IA2 A;  2KOI A;  2ZMV A;  3B33 A;  3UE6 A;  3IBR A;  3CI6 A;  5HWT A;  4WF0 A;  3E4O A;  4LRY C;  2D01 A;  1X0O A;  4HH2 A;  3P7N A;  1N9L A;  4KUK A;  2PD8 A;  1V9Y A;  5IT5 A;  3R7W B;  1XJ6 A;  1GSX A;  4ARZ B;  4EES A;  5HWW A;  3S7Q A;  1P9W A;  3GDI A;  1TS7 A;  1LL8 A;  3PHY A;  4M4X A;  1S66 L;  1KOU A;  4MN6 A;  2XRO A;  3OBF A;  3EQU A;  4MMN A;  4HOI A;  2W3G A;  4QPR A;  3VV4 A;  3C30 A;  2VGL S;  1MZU A;  2L1M A;  2O9A A;  3KSF A;  2V1A A;  2VJW A;  4FSF A;  4I39 A;  4L9E A;  3HJK A;  4O01 A;  4UEY A;  5IU1 A;  4HP9 A;  3C2W A;  3JVU A;  3A0S A;  3BWL A;  2JHE A;  3UE3 A;  4R70 A;  1IFQ A;  2VLG A;  1TF1 A;  4Q0J A;  1S4R A;  2Z6C A;  1XFQ A;  4HH3 A;  3BY9 A;  2EWV A;  4PAU A;  2QKP A;  1YSP A;  4BBT A;  2OOL A;  5HWV A;  3SW1 A;  1OPX A;  1S1Z A;  2PYP A;  5HDS A;  3RFB A;  3NOU C;  3HCY A;  3MMH A;  2LB5 A;  3ZYT A;  3LFV A;  3PBS A;  4GS9 A;  3D3O A;  2W1T A;  2CMN A;  5TBM B;  3CLO A;  2M1C A;  1H8M A;  3FG8 A;  4XT2 A;  2P7J A;  5F5Y A;  1F9I A;  3UB6 A;  3VE3 A;  5HL6 A;  2QYB A;  5DJT A;  3RTY A;  4WLA A;  3E4P A;  3R4K A;  2DMW A;  2Y8H A;  3UMD A;  2OWJ A;  3EQV A;  3BJN A;  2L4R A;  2D02 A;  2QWS A;  4IUK A;  2VV7 A;  1DP8 A;  1OTD A;  4WL9 A;  2VKS A;  2V9A A;  2XSS A;  2KX6 A;  5IS1 A;  3PBQ A;  1N9N A;  2O9C A;  3A0R A;  4I3I A;  2V0U A;  4YNR A;  1VHM A;  2NUT C;  3LIF A;  4E04 A;  1OJ5 A;  3S7P A;  3G6O A;  3PXP A;  4DJ3 A;  4LLO B;  2WKQ A;  3EGD C;  1TS8 A;  2FH5 A;  5AVE A;  4ETZ A;  1NRJ A;  2I9V A;  4MN7 A;  3S7N A;  5J7E A;  5HSQ A;  2JKR I;  1T1B A;  4EET B;  3T4Q A;  3LIC A;  4HI4 A;  5CX7 A;  4CLC E;  4KUO A;  5HPF A;  4Q0H A;  4JGR A;  3PBT A;  3CUE C;  1T19 A;  3E98 A;  5J3W A;  2XA7 S;  3CUE A;  4NXG A;  4GHI B;  1N9O A;  4AFI A;  3H82 B;  2JN7 A;  5G4Y A;  4BBU A;  2VX8 A;  5DFX A;  5KSH A;  4BWI A;  4BMW A;  2JKT M;  3NJA A;  2J3T D;  2ZOH A;  1DP9 A;  1P0Z A;  3T4S A;  5HPI A;  1BYW A;  1OT9 A;  4Z1W A;  4R6L A;  4NEE D;  4B9O A;  4DMZ A;  3LR3 A;  3A0V A;  3R7W A;  1XJ2 A;  1EW0 A;  3PYP A;  4ARZ A;  3TE8 A;  3BQA A;  2VZW A;  2B02 A;  2ZMF A;  2YKH A;  1WA9 A;  1V9Z A;  4K08 A;  2W1T B;  1Y28 A;  4UQI M;  2W1R A;  4EQ1 A;  4WEL A;  2OWH A;  3C8C A;  3T4J A;  4HNB A;  4GHI A;  4B93 A;  3F1O A;  5AVF A;  3B47 A;  2VGL M;  4F3L A;  2KLI A;  3JVV A;  1UWN X;  1VB6 A;  3CAX A;  3T4K A;  1W63 Q;  2Y79 A;  3OCN A;  4DN0 A;  4NXE A;  5AJG A;  3MR0 A;  4ME4 A;  1STZ A;  4PKY G;  1T1C A;  1W63 M;  4R3A A;  4EUV A;  5EFW A;  1G6O A;  2V1B A;  2JKR M;  4R38 A;  2OAQ 1;  4RQ9 A;  3LI9 A;  2QHK A;  2FZ0 A;  4DJ2 A;  1GSW A;  2XRN A;  1NWZ A;  4BJP A;  3EOI A;  3HJI A;  3IS2 A;  2W27 A;  2J3W A;  2W3D A;  3C38 A;  2KDK A;  3PR6 A;  1P9R A;  5FL3 A;  2NUP C;  3NOT C;  1D7E A;  1LT0 A;  2YKF A;  1OTB A;  3K3D A;  1P97 A;  1S4S A;  4EEP A;  3ICY A;  3E4Q A;  3TJZ C;  4P6Z S;  1S67 L;  1G28 A;  2VEA A;  2M7V A;  2A24 B;  2PR6 A;  2OAP 1;  3BY8 A;  4I3A A;  4Y3I A;  5F6A A;  3B42 A;  2K2N A;  2W0N A;  4EXO A;  3BQ8 A;  5KIZ A;  1T1A A;  4IJG A;  4GS9 B;  2K31 A;  4LPZ A;  4GJ4 A;  4O8G A;  4MN5 A;  5HD5 A;  1MKM A;  4I5S A;  2BAS A;  2J3T C;  3KYQ A;  1F98 A;  3IBJ A;  3LYX A;  1OTA A;  5C5K A;  3H82 A;  3P01 A;  1ODV A;  3KSG A;  5HD3 A;  3NHQ A;  3LUQ A;  2GX5 A;  3KYZ A;  3LIE A;  2LB9 A;  4CLC B;  3S7O A;  4II7 A;  4ETX A;  2W3E A;  5L8M A;  4BBV A;  2R78 A;  3EWK A;  5HDD A;  3ULF A;  2P04 A;  1YKD A;  5K5B A;  4Y2F A;  3F1O B;  3KX0 X;  3UB8 A;  2MJ6 A;  3MQQ A;  2Z6D A;  4G3W A;  2A24 A;  3PBR A;  1H3Q A;  2W3H A;  3BW6 A;  4Y5F A;  1TS6 A;  1OT6 A;  3LR5 A;  2EWW A;  4EEU A;  4EW7 A;  5DF9 A;  3T4T A;  3IS2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...