4WN5A

Crystal structure of the c-terminal per-arnt-sim (pasb) of human hif-3alpha9 bound to 18:1-1-monoacylglycerol
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
109
structure length
108
Chain Sequence
b'HMGRGAFLSRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSKGQAVTGQYRFLARSGGYLWTQTQATVVSGRGPQSESIVCVHFLISQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypoxia-inducible factor 3-alpha
molecule tags Transcription
source organism Homo sapiens
publication title Unsaturated fatty acids as high-affinity ligands of the C-terminal Per-ARNT-Sim domain from the Hypoxia-inducible factor 3alpha
doi rcsb
total genus 30
structure length 108
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4wn5A00
4KUOA 5A8BA 2V0UA 2PDRA 3A0RA 5HDDA 1S1ZA 2QJ7A 2VV7A 4BBVA 2JN7A 4R3AA 1LL8A 3MXQA 3B33A 2QHKA 3C2WA 3E4OA 3E4PA 3K3DA 3LIEA 4HHDA 2CMNA 3C8CA 1N9LA 1XFNA 4L9FA 3ICYA 1D7EA 4WN5A 2W0NA 4I5SA 4DJ3A 2INWA 3HJIA 3NOPC 2Z6DA 4GCZA 4LRXC 4RQ9A 5HDSA 3UB9A 5IU1A 2EA9A 1MZUA 3NHQA 3UMEA 3GECA 4HIAA 3EEHA 3EWKA 2JHEA 1BYWA 3LYXA 1LT0A 1T1BA 2M1CA 3NOUC 5DJTA 3ZQ5A 1DP9A 4MN6A 1OTBA 3H82B 2QKPA 3LIFA 1GSXA 3H7WA 3VOLA 5HSQA 1T1CA 4K08A 1OT6A 4GS9B 1TS0A 4LRZE 1VB6A 2QJ5A 5J3WA 3RH8B 4NXGA 1Y28A 3LUQA 5I5LA 3P7NA 2PR5A 2V1BA 5EFWA 1T18A 3NJAA 4L9GA 2KX6A 5F5YA 3H82A 3VE3A 2PD7A 4GHIA 2W27A 4GHIB 2V9AA 1GSVA 3IS2A 3LICA 1UWNX 3FC7A 3MQQA 3F1OB 3MR0A 4BBTA 2I9VA 4E04A 3H9WA 4HH2A 3PYPA 4I3JA 4NXBA 3ULFA 1TS6A 5TBMB 1XJ4A 2D02A 5HDCA 3GDIA 3H7WB 1N9OA 1X0OA 3MJQA 3IS2B 3OLOA 4HI4A 4JGRA 1UGUA 4LPZA 2GJ3A 4NXEA 1S66L 1XJ3A 4EEUA 1D06A 3NOTC 3F1NA 5IS1A 5G4YA 1OTAA 1T19A 2K7SA 3F1NB 3G6OA 1LSXA 1OTDA 3CWFA 4B9OA 3A0VA 1KOUA 4HJ6A 2KDKA 2QWSA 4XT2B 2PYRA 5F68A 2D01A 4EETB 2V0WA 3F1OA 1XFQA 4PKYA 4DJ2A 4HH3A 1TS7A 1N9NA 1LSVA 2VLGA 3MFXA 5TBMA 4EERA 3SW1A 4LRYC 2VEAA 2PHYA 3HJKA 2ZOHA 4XT2A 3UB7A 4F3LA 2R78A 2V1AA 2WKQA 1TS8A 3LI8A 5HZHA 2L1MA 1P97A 1ODVA 1V9ZA 2J80A 1G28A 3E4QA 3LI9A 3LIDA 4F3LB 5KIZA 3UB6A 2PR6A 4EQ1A 1S4SA 2A24B 4HP4A 4KQDA 1F98A 2ZBBA 1V9YA 1NWZA 1WA9A 4I38A 1T1AA 2VV8A 3T50A 5J4EA 1OTEA 1S1YA 3A0SA 3CLOA 4EESA 4EXOA 4I3IA 4WL9A 4I3AA 5G4ZA 1GSWA 5HWTA 4I39A 3BY8A 1LSWA 1XJ2A 4R70A 5HD3A 3UE6A 3PHYA 1JNUA 2OWHA 5DKKA 4YWZA 3RTYA 3KX0X 1OJ5A 4R6LA 4L9EA 4HOIA 1DRMA 2PYPA 3F1PA 3LIBA 5F69A 3D72A 2WKRA 2L0WA 3K3CA 4HY8A 3LIAA 1UWPX 2H28A 2WKPA 4HJ3A 5DJUA 4MN5A 3IBRA 4EW7A 2L4RA 5F6AA 1EW0A 3CAXA 1F9IA 2BASA 5AVEA 1S67L 2Z6CA 2PD8A 2ZOIA 4JGQA 5AVFA 3MQOA 3UMDA 3BY9A 4GW9A 4R38A 5J7EA 2OOLA 2A24A 4HQAA 3UB8A 4M4XA 4NXFA 4WUJA 4HNBA 1OJGA 1OTIA 4WF0A 4WLAA 4LLOB 2HV1A 4PKYG 5HWVA 3VE4A 3F1PB 2VV6A 3BWLA 4H6JA 5HD5A 5HWWA 1S4RA 4BBUA 4JGOA 1OT9A 2YKHA 3FG8A 4GS9A 4HJ4A 4JGPA 5DKLA 1DP6A 4EEPA 2YKFA 4HP9A 2OWJA 1XJ6A 1P0ZA 2P7JA 2B02A 4KUKA 1DP8A 4H6JB
chains in the Genus database with same CATH superfamily
5EM1A 2XH9A 5HDDA 5EOOA 3ZVTA 4HHDA 5KZHA 4HH2A 1YKDA 4CLCB 4BL3A 4DE0A 4E3IA 2OLVA 1ZG6A 1MXOA 3LYXA 3O88A 4K08A 5TJJA 4GOGA 4KG5A 4CQHA 4DMZA 5F5YA 1QMFA 2GNXA 4PM6A 1BLHA 5HAQA 2J3TD 2D02A 4CLCA 4ZBEA 4HJ6A 4HBTA 1XA7A 5E43A 2D01A 1LSVA 1CI8A 1U60A 3S7NA 1YMSA 2C6WB 4CPKA 2MJ6A 3E4QA 3T4LA 5HPIA 5F83A 1W5DA 5TGFA 1TF1A 5DTTA 3MZDA 5L07A 1F98A 2DRWA 1IYOA 3ZGAB 2RL3A 2J8YA 2XF3A 3S7OA 3IWIA 1K55A 3PBQA 4DDSA 3CI6A 3K3CA 2H28A 3VMAA 5DF8A 4E6XA 1H0MA 1XP4A 3NC8A 4KZ4A 1MY8A 5EVIB 2HDSA 2OAQ1 2HP6A 2HV1A 3DWKA 3M2KA 1PWCA 2C5WB 1LI9A 2VKSA 4BD0A 4CJNA 1BULA 3N6IA 2PU2A 3HLDA 1SKOB 4P85A 2B02A 5FL3A 3T1XA 2R9WA 1EI5A 5A90A 3RFBA 4EUZA 2KOIA 1CF0A 4MLLA 3HJIA 3S7PA 4HESA 3RJUA 3EEHA 5FA7A 1K57A 3WS2A 3OCNA 3BFFA 3IF5A 5DVAA 3RH8B 3H82A 4QWOA 3LICA 2I9VA 2HGVA 1I2SA 4IJGA 5HFOA 1N9OA 5AVFA 2Q0OA 2FZ0A 4X55A 5EOEA 1HZOA 4PM5A 3SS3A 3OOVA 4IVKA 4OLDA 4DJ2A 1N9NA 2EX6A 2VEAA 3Q7VA 3KSHA 4N9LA 2DMWA 3LIDA 5M19A 2PR6A 2VK3A 3BYDA 3BQ8A 4EXOA 1H8ZA 1PFLA 1RP5A 3R4KA 2P04A 1NRJA 3PBOA 1STZA 4N1XA 4ZAMA 2O9AA 3D4FA 2PYPA 4MBKA 1MKMA 1IYQA 3LIAA 3L7HA 1NZUA 3KSFA 4R38A 4WZ5C 4M4XA 4KZ9A 1OJGA 1OTIA 3VFHA 3ZHHA 3VE4A 4KG6A 4PHTA 1ONGA 3CJMA 4KUKA 2NUPC 2Y4AA 3V39A 1RGZA 2PDRA 4JKTA 4OPRA 4GB7A 3OBFA 3E4OA 3K3DA 1ZHHB 3ICYA 4FUWA 3NOPC 2PU4A 2PBDP 3NHQA 3SS5A 1MWTA 3NOUC 5GLAA 3GR2A 3W4PA 2ZMVA 3VP4A 4GNUA 2Y2IA 3LFVA 3SH8A 3D3OA 1MWRA 3IS2A 4MNRA 3KSGA 2XEPA 3HUNA 2ZC7A 1GA0A 1TS6A 3H7WB 4IUHA 3Q1FA 4KENB 4R1GA 1S66L 1MBLA 1S6RA 4P6BA 3ITAA 1K0KA 3SZTA 5TBMA 3DTMA 3UB7A 5KSCA 4C6YA 3Q81A 4UA9A 2Y2QA 1IOUA 3FPVA 3G30A 1C3BA 3DAVA 1BUEA 4OQIA 1W63Q 3CLOA 3MZEA 5G4ZA 3BY8A 4ME4A 1CI9A 1PRQA 3UE3A 3UPOA 1G6AA 5A92A 2NUTC 2R9XA 1XXMA 2VJWA 3ZNYA 4DN0A 4D60A 4S2JA 3LEQA 2WAEA 2Q9MA 4WZ5A 1D1JA 4O01A 1F9IA 3T4OA 2BASA 2Z6CA 4IHQA 4CLCC 3M6BA 4ZRRA 3OZHA 3IH9A 1PW1A 2H0YA 3MBZA 4MBFA 4OONA 4BJPA 1S4RA 1YSPA 2H0TA 3QHYA 4OP8A 3LY3A 5DF7A 2XFSA 3A0RA 1S1ZA 1CK3A 4R3AA 2X71A 3C2WA 2QHKA 1CEFA 3P98A 4X6TA 1D7EA 5FQJA 1BT5A 1J9MA 3LO7A 1KDWA 4WMCD 5K5BA 3EGDC 4JF6A 4ID4A 1E25A 3FKWA 4GS9B 4PM7A 1K55C 2CC1A 5J3WA 2JKTM 5I5LA 2PR5A 3C30A 3VFFA 2O0YA 2PD7A 5FEFA 1ONHA 1BTLA 1I2WA 1HTZA 3S4XA 3N4IA 3BM6A 3SH7A 4OP5A 4JGRA 4EEUA 1VEUA 1G6OA 3N8SA 5AQAA 3OPRA 3UPPA 4NEED 3F1OA 2P9VB 4R23A 3AGDA 3Q7ZA 1JTDA 3HJKA 2B95A 4BD1A 4LGWA 3G2ZA 4E3LA 4JF4A 2P74A 2VGLS 4HP4A 1W7FA 4KZ5A 3BFDA 4OH0A 2XROA 4JXVA 1YLZA 4D2OA 2BTFP 1LL9A 3SS4A 4MBHA 4O8GA 2P9VA 3MS6A 3FWLA 2JKTI 2J9OA 3LR5A 4X56A 4Q0IA 2XFTA 1W63M 2Y2HA 3MQOA 4EBLA 2ZC3B 4WLAA 2HJ9C 2ZM8A 3IXBA 2B5RA 1W79A 4JGOA 5TFQA 4WELA 2OWJA 5L10A 2AVXA 4NETA 4NKPA 3V3SA 2OSUA 4IBRA 4HEFA 1BZAA 3JVUA 1YLWA 1Z09A 4GCZA 4I5SA 2WAFA 5L8MA 3ZQ5A 3ZG9B 5DJTA 1YPRA 3NJAA 4IVIA 2W27A 1YQSA 3CZDA 3MQQA 1UWNX 4Y13A 3H9WA 4FSFA 3N8LA 4RVAA 1GCEA 3VOYA 3IS2B 5A91A 3EOIA 1YM1A 2XA7S 5G4YA 2G7UA 4R3BA 3VOZA 4ARZB 4PKYA 3UN7A 3UO9A 5HL6A 2EX9A 2PHYA 2ZOHA 2XD1A 2J3WA 4UA7A 3D9YA 2XSSA 3BEBA 1V9ZA 5GLCA 5FI6A 1MKIA 5FEGA 4EQ1A 2HDRA 5CRFA 3MFDA 2OV5A 5AJGA 3GV9A 3OC2A 3K2NA 4WL9A 5GLDA 3KX0X 1OJ5A 4JBFA 5F69A 4FOFA 4Y3IA 3MKEA 4MEZA 1K25A 2W3FA 2QPNA 4B4XA 1PWDA 1RGYA 1K6SA 1GHMA 4WYYA 5FAQA 4G3KA 4HP9A 2M7VA 2ZQ9A 5CTNA 4ZDXA 1P9RA 3TG9A 4Z1WA 1KE4A 1MWUA 2WKEA 1LT0A 2QYBA 2QKPA 3H7WA 4ZJ1A 2M7UA 4LV1A 1M40A 2ZD8A 4S2IA 1GSVA 3WS0A 1BSGA 1TVFA 5HDCA 1LL5A 3HUMA 2ZQ7A 4DXBA 2XK1A 4IEDA 4M3KA 1T19A 3UDXA 2Y91A 3VP1A 1K4FA 2ZC6B 3WS1A 4EETB 3LR0A 4BLMA 1J3WA 2A2LA 5AQ7A 5HZHA 1OMEA 3LI9A 2ZMFA 4OOYA 1H3QA 5EUAA 2VV8A 3TSGA 3QP1A 5CX7A 3VV4A 3OPPA 3BQAA 1IELA 1H5XA 3FYZA 1RCJA 2PAVP 2Y2MA 4E6WA 1ES4A 1EW0A 1TDGA 4QU3A 3IT9A 2XR0A 2XDMA 4QY5A 2J7VA 1QMEA 3UB8A 2Y55A 4WF0A 1FCMA 3EQUA 2QZ6A 1PI4A 4EWFA 5HWVA 5LBRA 1NY0A 3QP6A 3BWLA 2J3TC 1NZOA 2ZQCA 1FILA 1P0ZA 3A3DA 3QNBA 3IF6C 2V0UA 3E2LA 5AQBA 1IYSA 3M2JA 3N8RA 1P9WA 3C8CA 2GX5A 4YFMA 2XD5A 4MMNA 4JPMA 5EVIC 3IF6B 4S2OA 3CG5A 1SKFA 3EWKA 3KSIA 5HSQA 1L0EA 2JBFA 1OT6A 3GTCA 5JYPA 1FSWA 4L9GA 3LR3A 4E3KA 4PM8A 3IHBA 3F1OB 4FH2A 3S7QA 3GDIA 1Q2QA 4LPZA 1SHVA 1UGUA 1HVBA 3V3RA 2PBYA 3GVBA 1PNEA 4B9OA 3S1YA 1VM1A 1KOUA 3PBRA 2KDKA 5GL9A 1XKZA 4DE3A 1FOFA 1XA1A 1Y4OA 4EERA 5FASA 4GDNA 5FSRA 3ZCZA 2GZAA 2O99A 1P97A 4R3JA 4LCMA 1EWZA 4OQ0A 4KQQA 3E0YA 3V67A 1T1AA 1I5QA 5EM0A 2K31A 4OOMA 1Q2PA 4I3IA 1GSWA 5HWTA 5HAIA 3UE6A 3VSLA 5I94A 5FQ9A 3D72A 2WKRA 4HY8A 2I72A 3IWQA 1KDSA 3CAXA 1K56D 3G34A 4HQAA 3PBNA 5EV0A 3C7VA 4WEKA 2ZMAA 5F82A 2HF6A 2OAP1 4BBUA 5CXWA 3FG8A 3IHAA 3NULA 1GHIA 3PXPA 2OLUA 2H5SA 2WUQA 3U4LP 1JWPA 2JN7A 1LL8A 4L9FA 1H8MA 4WN5A 2W0NA 4LV3A 2INWA 3PAEA 2ZQAA 1ZTUA 3FV7A 4DE1A 4RYEA 2LB9A 2UV0E 3KYQA 3WRTA 5EFWA 4CLCD 1L0GA 5BOHA 1K57C 1ESIA 1NXYA 3SH9A 4P87A 4I3JA 4WZ4A 3PYPA 4E3JA 3NCKA 4NXBA 4OOLA 1YT4A 4K0XA 1X0OA 3L9KA 2BLSA 4K91A 3NI9A 1NJ4A 3P09A 5GHZA 2JC7A 2QWSA 4N9KA 3A3FA 3WS5A 1XPBA 4XT2A 2A3UA 2R78A 5HAPA 3ZG8B 4BWIA 2L1MA 4XUZA 4ETZA 3A3JA 4UQIM 1G28A 1K4EA 4PPRA 5M18A 2EX2A 2A24B 4ZJ2A 1NWZA 2JKFA 2PT7A 4EESA 4FD8A 1PZOA 1ZC2A 5G18A 4R70A 3GRJA 1ERMA 3EGXC 4O7DA 3IXDA 4LV0A 4LCLA 3UNWA 2A24A 2W3HA 3RXWA 4Q0JA 3F1PB 4H6JA 1WE4A 1AWIA 2ZQDA 3BFCA 1H8YA 1YMXA 2HP9A 2O9BA 2ZQ8A 1G68A 2CMNA 3FZCA 3T4QA 3W2ZA 5IU1A 1CJFA 2VA0A 2ZM0A 3UMEA 4IBXA 3DTIA 4HIAA 1KE3A 4WMCA 4MN6A 3O87A 1K6RA 3IF6A 1E3UD 4JXGA 4LRZE 5DTSA 5J8XA 4BBTA 3BFEA 1W8QA 2X02A 3OLOA 5E2GA 3CHWP 3HVFA 3A0VA 4S2PA 3VP2A 2VLGA 3HLGA 3QP4A 2Y2KA 3SOIA 3LI8A 2Z2MB 2W1TB 2J80A 3IWOA 4KQRA 2HP5A 2Y2NA 4E3NA 3Q07A 5EVIA 3C4OA 4I38A 3IX8A 1IEMA 1K56A 1KGGA 2V8CA 1JWVA 5L2FA 3KYZA 4QJGA 1SKOA 4R6LA 1DRMA 5DJUA 4EW7A 4LENA 4Y17A 2PD8A 2IA2A 2EWVA 2OOLA 3BECA 3B47A 4UHUA 2E8JA 5HD5A 3QP8A 5F1GA 1KVLA 1VETA 3MXRA 4OPQA 1JWZA 5HL1A 2QJ7A 4OPZA 3OPLA 1O7EA 5FQKA 4S2NA 3W4OA 1M6KA 5CGXA 3UY6A 3GQZA 3GECA 4OQGA 3ZG0A 1L0DA 2EX8A 4GLQA 5CEDA 4Q0HA 1MC0A 5CEBA 4GD8A 1FSYA 2K2NA 3B42A 3VE3A 3FC7A 5CHUA 4YOFA 2IWDA 5DF9A 2WADA 4N92A 3T4KA 2JKRI 1L0FA 4Y0TA 3LEZA 1IKGA 3C4PA 2V8FA 3T4SA 3NOTC 3HBRA 3C5AA 5J7EA 4U3TA 1NLYA 1FCOA 4HH3A 3VP3A 4LRYC 2JE5A 2WK0A 1SCWA 4YNRA 2FFFB 4U0XA 3BW6A 4ZJ3A 4I39A 5HD3A 2OWHA 5EVID 2KLIA 4OKPA 4DDYA 3GSGA 4S2KA 4EBNA 3IBRA 4EV4A 4Y2FA 4Z9QA 3UMDA 5CHMA 3IX4A 1MWSA 3A3EA 4G3VA 3EQVA 4JGPA 4KZ3A 4PM9A 4EEPA 2VGLM 4H6JB 1EROA 3NY4A 2WGWA 1XFNA 1ES5A 4DJ3A 4LRXC 1JTGA 5IHVA 4AFIA 1FIKA 1BYWA 4MDZA 3QP5A 2ACGA 1TS0A 1IYPA 2W3GA 4YINA 2A49A 4JLFA 2XQZA 3WRZA 3M6HA 4E04A 4MCWA 3HREA 1GHPA 3ZYTA 2WZXA 3G32A 2XRNA 3ITBA 2WGWB 2JKRM 3MJQA 3NDEA 1VEUB 1XJ3A 3IQAA 1CQAA 2K7SA 5CTMA 1BLPA 3ZVWA 1N4OA 3HCYA 5L09A 1TS7A 3OCLA 4JXWA 1TS8A 5DTKA 4ESPA 2HJEA 5J4EA 2Y2PA 1S1YA 3VSKA 1PW8A 1YLJA 2DNSA 3GMWA 5F1FA 4EU0A 3FKVA 3MSHA 3F1PA 4RX3A 4WBGA 3Q82A 2L4RA 4UEYA 1YLTA 1S67L 4C75A 2LB5A 4BMWA 3T12B 5M1AA 3MMHA 2ZJ9A 4WEJA 2B18A 1ES3A 4HNBA 1TEMA 4LLOB 5KMWA 3P01A 4GS9A 2X01A 3W8KA 3RXXA 3IH8A 1LHYA 1K54A 3CUEA 4FTXA 1FCNA 4Q8IA 4KUOA 3C38A 1PWGA 2FH5A 3E4PA 3VOLA 3ZG7B 1ERQA 4S2LA 4BENA 5E2HA 3AGEA 1DP9A 1GSXA 4G3WA 3PAGA 4S2MA 1PYYA 2QJ5A 3LGOA 3LUQA 3PTEA 3CITA 3O3VA 4R0QA 3LR4A 5EVLA 5FQQA 5FATA 1IKIA 4NXEA 1KE0A 2W1TA 3DW0A 2EFXA 3TRCA 1PZPA 4GZBA 2W1RA 3AGFA 3PBSA 2PYRA 5F68A 4H8RA 4DRTA 3DTKA 2V1AA 4P0MA 1ODVA 1AXBA 5HX9A 4P6ZM 1CEGA 3G4PA 1NYYA 2HDUA 3A0SA 4I3AA 2WKHA 2IWBA 3RTYA 2ZC5B 3N7WA 3UDFA 1E4DA 4HJ3A 4K0WA 5HW3A 4JGQA 5A93A 3BLMA 3BY9A 3BLSA 1TDLA 2Q9NA 3HLFA 3HL9A 4NXFA 4WUJA 4BL2A 2YKHA 3LCEA 3WS4A 4KZBA 3UE0A 3ZG5A 2EXBA 4ETXA 2Y2LA 4X69A 3MXQA 5HDSA 2Z6DA 4QHCA 1G5UA 4IUKA 3BJNA 2M1CA 2GDNA 1OTBA 3DBAA 1T1CA 3V50A 2V1BA 2KX6A 3QP2A 1SZVA 3VP0A 4GHIA 4JXSA 3T4TA 2V9AA 3MR0A 3T4JA 3ULFA 3CPTA 1F2KA 3I7JA 4CLCE 1N9BA 3CWFA 4FCFA 5FAPA 3UDIA 3G31A 4X25A 1XFQA 4FH4A 1MPLA 4F3LA 3NIAA 2WGVA 3HUOA 2Y8HA 4UQIS 1XX2A 5KIZA 3UB6A 2JKGA 1S4SA 4E3OA 2W3DA 2WKIA 3T1SA 2ZBBA 3T50A 4B4ZA 3ZDJA 4XXRA 2WGIA 1LSWA 5GHXA 3JPUA 3PHYA 5DKKA 4ARZA 4U0TA 5TR7A 3NDGA 4X1MA 4MN7A 1L3LA 4RA7A 4DF6A 5AVEA 3JVVA 2ZOIA 4GW9A 4QB8A 5C5KA 1Z6FA 5CERA 4PKYG 3B3XA 2VV6A 4DXCA 1OT9A 3EEAA 5FDSA 1DP6A 5U47A 4X68A 2VGKA 1YSQA 2VZWA 1LLBA 3JYIA 1L2SA 1ESUA 4X53A 5FI2A 3LIEA 5D3OA 1OPXA 1N9LA 4S2NC 5HARA 2V2FF 1JVJA 1F5MA 3UB9A 3NECA 2EA9A 1MZUA 4C3QA 2EXAA 4OVDA 1T1BA 5EVEA 4LV2A 3LIFA 1NLZA 5CHJA 3PBTA 1VB6A 2H10A 4NXGA 4BBVA 2FFYA 4B93A 2W3EA 5GLBA 2Y79A 4GHIB 4KZ6A 2G2UA 1WYBA 5FQIA 4KG2A 5DFXA 5TBMB 4JF5A 1XJ4A 1KGEA 3ISGA 1YLYA 4X1LA 3F1NA 4XT2B 3A3IA 4F94A 2V0WA 3MXSA 3MFXA 1SDEA 4E3MA 2XLNA 1FR1A 2Y2GA 1ZKJA 2J9PA 3MKFA 5EECA 1OTEA 2BG1A 1K54C 3NBLA 3PR6A 4Y7PA 4OQHA 3C7UA 3G2YA 3HLCA 1UWPX 2WKPA 2UWXA 5CGSA 1WYCA 1DJCA 4L0LA 5CECA 3R7WB 3IBJA 4DKIA 3G35A 2HDQA 4R4SA 5DKLA 4QPRA 1XJ6A 1DP8A 4O0PA 4KZAA 1DY6A 3TOIA 4EUVA 3U2AA 5FQMA 5E2FA 3IXHA 3UE1A 5FAOA 1DJAA 3MQ0A 1SDNA 2JHEA 4P6ZS 5JYOA 1KVMA 2ZC4B 3S22A 3DTEA 5DFYA 5A8BA 1T18A 1ACFA 3HLWA 3QNCA 3IX3A 1GA9A 4B88A 1PIOA 2GJ3A 3E98A 5AQ9A 3CPTB 4EBPA 1DJBA 2ZLYA 1OTAA 3F1NB 3G6OA 3E2KA 1OTDA 2Z2LB 4PMAA 3T1RA 1S0WA 3LY4A 4N1HA 2QMIA 2WKQA 4QD4A 2DCFA 4QY6A 4EQIA 1BLCA 4OLGA 1XGJA 4F3LB 1TD5A 1V9YA 1WA9A 1VHMA 4R4RA 3MF0A 4ZTKA 5FI7A 2P08A 1VQQA 4PAUA 1JNUA 2O9CA 3V5MA 3UPNA 4HOIA 1W8YA 2L0WA 5CGWA 2Y59A 3FPWA 1ES2A 3R7WA 3OPHA 3W4QA 1NRFA 1VETB 5HWWA 2IWCA 3BFGA 4HJ4A 2HZ5A 3CUEC 2YKFA 2P7JA 4UA6A 4RX2A 2VV7A 4II7A 3B33A 3ZNTA 1BLSA 4RQ9A 1YAXA 1HD8A 4XUXA 5MC7A 2E8IA 1IFQA 2VX8A 4BQMA 1ZG4A 3H82B 2EFUA 3KYEA 5KSHA 3TW8A 2EWWA 2Y2OA 1Y28A 3P7NA 4Y15A 3BRMA 4NG2A 4KZ8A 2WZZA 2XGNA 2Y2JA 1FQGA 5E2EA 1LI0A 4HI4A 1D06A 5IS1A 1LSXA 3Q7VB 3UB5P 3O86A 4KZ7A 2V20A 4HBUA 3WWXA 4KQOA 3SW1A 1ALQA 3DWZA 1A0KA 4NK3A 4OPYA 1E3UA 4GDBA 5HPFA 4Y0OA 3TE8A 4KQDA 1O07A 4LFUA 2ZL1B 4GKUA 2PRFA 2V1ZA 1XJ2A 4GN2A 4Y0UA 5EPHA 2XA7M 4YWZA 5EE8A 2G2WA 4L9EA 4UAAA 4A5RA 4GD6A 5GHYA 2HPBA 3LIBA 3ZFZA 3CMZA 4Y5FA 2JCHA 4DE2A 4MN5A 3TJZC 3MZFA 1XGIA 5F6AA 1HLUP 4GJ4A 5FDHA 1KGFA 3KO6A 1PI5A 1NYMA 4WM9A 5IT5A 3IXGA 2WYXA 1FR6A 1Y54A 2ZL1A 1YLPA 2ZM2A 2VGJA 3HLBA 3HLEA 2RCXA 3O5YA 3T1QB 1K38A
chains in the Genus database with same CATH topology
5HDDA 4ETXA 2O9BA 4NKPA 3MXQA 4HHDA 4HH2A 2CMNA 1YKDA 4CLCB 3JVUA 4I5SA 4GCZA 3T4QA 5HDSA 2Z6DA 3W2ZA 5IU1A 2VA0A 4IUKA 3UMEA 4HIAA 3BJNA 3LYXA 5L8MA 3ZQ5A 2M1CA 5DJTA 4MN6A 1OTBA 3DBAA 1T1CA 4K08A 5TJJA 4CQHA 4LRZE 4DMZA 2V1BA 3NJAA 5F5YA 2KX6A 4GHIA 2W27A 2GNXA 3T4TA 2V9AA 3MQQA 1UWNX 3MR0A 3T4JA 4BBTA 3H9WA 3ULFA 4FSFA 2J3TD 2D02A 4CLCA 4CLCE 3OLOA 3IS2B 3EOIA 2XA7S 5G4YA 3CWFA 2G7UA 3A0VA 4HJ6A 4ARZB 2D01A 1XFQA 4PKYA 1LSVA 2VLGA 5HL6A 3S7NA 2PHYA 4F3LA 2ZOHA 2J3WA 2MJ6A 2XSSA 3LI8A 2Y8HA 2W1TB 4UQIS 1V9ZA 2J80A 3E4QA 3T4LA 5HPIA 5KIZA 3UB6A 1TF1A 1S4SA 4EQ1A 2W3DA 1F98A 2ZBBA 4I38A 5AJGA 3T50A 3OC2A 3K2NA 4WL9A 3S7OA 1LSWA 3PHYA 5DKKA 3KYZA 3KX0X 1OJ5A 4ARZA 4R6LA 1DRMA 3PBQA 5F69A 3CI6A 4FOFA 3K3CA 2H28A 4Y3IA 5DJUA 4MN7A 4EW7A 5AVEA 3JVVA 2ZOIA 2PD8A 2IA2A 2W3FA 2EWVA 4GW9A 2OOLA 5C5KA 3B47A 2OAQ1 2HV1A 4PKYG 2VV6A 5HD5A 1OT9A 2VKSA 3EEAA 1DP6A 4G3KA 4HP9A 1YSQA 2VZWA 2M7VA 2B02A 5FL3A 1P9RA 2QJ7A 3RFBA 3LIEA 2KOIA 1OPXA 4Z1WA 1N9LA 1F5MA 3HJIA 3UB9A 3S7PA 2EA9A 1MZUA 3GECA 3EEHA 1LT0A 1T1BA 3OCNA 4GLQA 2QYBA 2QKPA 3LIFA 1NLZA 3H7WA 4Q0HA 1MC0A 2M7UA 3PBTA 3RH8B 1VB6A 4NXGA 4BBVA 2K2NA 3B42A 3VE3A 4B93A 2W3EA 3H82A 2Y79A 4GHIB 1GSVA 3LICA 3FC7A 2I9VA 5DFXA 4YOFA 5TBMB 5DF9A 1XJ4A 5HDCA 3T4KA 2HGVA 2JKRI 4IJGA 1N9OA 5AVFA 3T4SA 2FZ0A 3NOTC 3F1NA 1T19A 5J7EA 4XT2B 3OOVA 1NLYA 4EETB 2V0WA 3LR0A 4DJ2A 4HH3A 1N9NA 3MFXA 4LRYC 2VEAA 2A2LA 3KSHA 5HZHA 4YNRA 2DMWA 3LI9A 3LIDA 2ZMFA 2PR6A 1H3QA 3BW6A 3BQ8A 2VV8A 1OTEA 5CX7A 4EXOA 4I39A 5HD3A 3R4KA 3VV4A 2P04A 2OWHA 1NRJA 3PBOA 1STZA 3BQAA 3PR6A 2KLIA 2O9AA 2PYPA 1MKMA 3LIAA 1UWPX 2WKPA 3IBRA 1EW0A 4Y2FA 4L0LA 3R7WB 3KSFA 3UMDA 4R38A 3IBJA 3UB8A 4M4XA 1OJGA 1OTIA 4WF0A 4G3VA 3EQUA 5HWVA 5LBRA 3VE4A 3BWLA 3EQVA 4JGPA 4EEPA 2J3TC 5DKLA 4PHTA 4QPRA 1XJ6A 1P0ZA 2VGLM 4KUKA 1DP8A 2NUPC 4H6JB 4O0PA 2V0UA 2PDRA 1P9WA 3OBFA 4EUVA 3E4OA 3U2AA 3K3DA 1ZHHB 3C8CA 1XFNA 2GX5A 3ICYA 4MMNA 3NOPC 4LRXC 4DJ3A 4AFIA 3NHQA 3MQ0A 3EWKA 2JHEA 1BYWA 3KSIA 4P6ZS 3NOUC 4MDZA 5HSQA 2ZMVA 1OT6A 5DFYA 1TS0A 5A8BA 2W3GA 1T18A 4L9GA 3LR3A 3LFVA 3D3OA 3IS2A 3KSGA 3F1OB 4E04A 4MCWA 1TS6A 3ZYTA 2XRNA 3S7QA 3GDIA 2JKRM 3H7WB 4IUHA 3MJQA 4LPZA 1UGUA 2GJ3A 3E98A 1S66L 1XJ3A 1OTAA 2K7SA 3F1NB 3G6OA 4B9OA 1OTDA 3PBRA 1KOUA 2KDKA 3HCYA 1TS7A 3OCLA 5TBMA 4EERA 3UB7A 2GZAA 2WKQA 1TS8A 1IOUA 3FPVA 2O99A 1P97A 4F3LB 3E0YA 3V67A 1TD5A 1V9YA 1WA9A 2HJEA 1T1AA 5J4EA 1W63Q 1VHMA 1S1YA 2K31A 3CLOA 4OOMA 4I3IA 3MF0A 5G4ZA 1GSWA 5HWTA 2P08A 3BY8A 3UE6A 4ME4A 4PAUA 4EU0A 3UE3A 1JNUA 2O9CA 2NUTC 2VJWA 4HOIA 4DN0A 3F1PA 3D72A 2WKRA 2L0WA 4HY8A 2L4RA 4UEYA 4O01A 3CAXA 1F9IA 3FPWA 2BASA 3T4OA 1S67L 2Z6CA 2LB5A 4BMWA 3R7WA 4IHQA 4CLCC 3MMHA 4WEJA 4ZRRA 4HQAA 2B18A 4HNBA 3PBNA 4WEKA 4LLOB 2HF6A 2OAP1 4BJPA 5HWWA 1S4RA 4BBUA 1YSPA 3FG8A 3P01A 4GS9A 4HJ4A 3PXPA 3CUEC 2YKFA 3CUEA 2P7JA 4KUOA 3A0RA 1S1ZA 2VV7A 4II7A 2JN7A 4R3AA 1LL8A 3C38A 3B33A 2FH5A 2QHKA 3C2WA 3E4PA 3VOLA 4L9FA 1H8MA 4WN5A 1D7EA 2W0NA 2INWA 4RQ9A 1YAXA 1ZTUA 5MC7A 5K5BA 3EGDC 1IFQA 2VX8A 1DP9A 3H82B 1GSXA 4G3WA 5KSHA 3TW8A 4GS9B 2EWWA 2QJ5A 2LB9A 5J3WA 2JKTM 1Y28A 3KYQA 3LUQA 3P7NA 2PR5A 5EFWA 5I5LA 4CLCD 3C30A 2O0YA 2PD7A 3CITA 3LR4A 4I3JA 3PYPA 4NXBA 4OOLA 1X0OA 4HI4A 4NXEA 4JGRA 4EEUA 2W1TA 1D06A 1G6OA 5IS1A 1LSXA 3TRCA 2W1RA 2QWSA 3PBSA 2PYRA 5F68A 4NEED 3F1OA 4KQOA 3SW1A 3HJKA 4XT2A 2R78A 2V1AA 4BWIA 2L1MA 4ETZA 1ODVA 4UQIM 1G28A 5HPFA 3TE8A 2A24B 2VGLS 4P6ZM 4HP4A 4KQDA 1NWZA 2PT7A 4EESA 3A0SA 4I3AA 2XROA 1XJ2A 4R70A 2XA7M 4YWZA 3RTYA 4L9EA 4O8GA 3LIBA 2JKTI 3EGXC 4Y5FA 3LR5A 4HJ3A 4MN5A 3TJZC 4Q0IA 1W63M 5F6AA 4GJ4A 4JGQA 3KO6A 3MQOA 3BY9A 5IT5A 2A24A 4NXFA 2W3HA 4WUJA 4WLAA 4Q0JA 2HJ9C 3F1PB 4H6JA 4JGOA 2YKHA 4WELA 3O5YA 2OWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KUO A;  5A8B A;  2V0U A;  2PDR A;  3A0R A;  5HDD A;  1S1Z A;  2QJ7 A;  2VV7 A;  4BBV A;  2JN7 A;  4R3A A;  1LL8 A;  3MXQ A;  3B33 A;  2QHK A;  3C2W A;  3E4O A;  3E4P A;  3K3D A;  3LIE A;  4HHD A;  2CMN A;  3C8C A;  1N9L A;  1XFN A;  4L9F A;  3ICY A;  1D7E A;  4WN5 A;  2W0N A;  4I5S A;  4DJ3 A;  2INW A;  3HJI A;  3NOP C;  2Z6D A;  4GCZ A;  4LRX C;  4RQ9 A;  5HDS A;  3UB9 A;  5IU1 A;  2EA9 A;  1MZU A;  3NHQ A;  3UME A;  3GEC A;  4HIA A;  3EEH A;  3EWK A;  2JHE A;  1BYW A;  3LYX A;  1LT0 A;  1T1B A;  2M1C A;  3NOU C;  5DJT A;  3ZQ5 A;  1DP9 A;  4MN6 A;  1OTB A;  3H82 B;  2QKP A;  3LIF A;  1GSX A;  3H7W A;  3VOL A;  5HSQ A;  1T1C A;  4K08 A;  1OT6 A;  4GS9 B;  1TS0 A;  4LRZ E;  1VB6 A;  2QJ5 A;  5J3W A;  3RH8 B;  4NXG A;  1Y28 A;  3LUQ A;  5I5L A;  3P7N A;  2PR5 A;  2V1B A;  5EFW A;  1T18 A;  3NJA A;  4L9G A;  2KX6 A;  5F5Y A;  3H82 A;  3VE3 A;  2PD7 A;  4GHI A;  2W27 A;  4GHI B;  2V9A A;  1GSV A;  3IS2 A;  3LIC A;  1UWN X;  3FC7 A;  3MQQ A;  3F1O B;  3MR0 A;  4BBT A;  2I9V A;  4E04 A;  3H9W A;  4HH2 A;  3PYP A;  4I3J A;  4NXB A;  3ULF A;  1TS6 A;  5TBM B;  1XJ4 A;  2D02 A;  5HDC A;  3GDI A;  3H7W B;  1N9O A;  1X0O A;  3MJQ A;  3IS2 B;  3OLO A;  4HI4 A;  4JGR A;  1UGU A;  4LPZ A;  2GJ3 A;  4NXE A;  1S66 L;  1XJ3 A;  4EEU A;  1D06 A;  3NOT C;  3F1N A;  5IS1 A;  5G4Y A;  1OTA A;  1T19 A;  2K7S A;  3F1N B;  3G6O A;  1LSX A;  1OTD A;  3CWF A;  4B9O A;  3A0V A;  1KOU A;  4HJ6 A;  2KDK A;  2QWS A;  4XT2 B;  2PYR A;  5F68 A;  2D01 A;  4EET B;  2V0W A;  3F1O A;  1XFQ A;  4PKY A;  4DJ2 A;  4HH3 A;  1TS7 A;  1N9N A;  1LSV A;  2VLG A;  3MFX A;  5TBM A;  4EER A;  3SW1 A;  4LRY C;  2VEA A;  2PHY A;  3HJK A;  2ZOH A;  4XT2 A;  3UB7 A;  4F3L A;  2R78 A;  2V1A A;  2WKQ A;  1TS8 A;  3LI8 A;  5HZH A;  2L1M A;  1P97 A;  1ODV A;  1V9Z A;  2J80 A;  1G28 A;  3E4Q A;  3LI9 A;  3LID A;  4F3L B;  5KIZ A;  3UB6 A;  2PR6 A;  4EQ1 A;  1S4S A;  2A24 B;  4HP4 A;  4KQD A;  1F98 A;  2ZBB A;  1V9Y A;  1NWZ A;  1WA9 A;  4I38 A;  1T1A A;  2VV8 A;  3T50 A;  5J4E A;  1OTE A;  1S1Y A;  3A0S A;  3CLO A;  4EES A;  4EXO A;  4I3I A;  4WL9 A;  4I3A A;  5G4Z A;  1GSW A;  5HWT A;  4I39 A;  3BY8 A;  1LSW A;  1XJ2 A;  4R70 A;  5HD3 A;  3UE6 A;  3PHY A;  1JNU A;  2OWH A;  5DKK A;  4YWZ A;  3RTY A;  3KX0 X;  1OJ5 A;  4R6L A;  4L9E A;  4HOI A;  1DRM A;  2PYP A;  3F1P A;  3LIB A;  5F69 A;  3D72 A;  2WKR A;  2L0W A;  3K3C A;  4HY8 A;  3LIA A;  1UWP X;  2H28 A;  2WKP A;  4HJ3 A;  5DJU A;  4MN5 A;  3IBR A;  4EW7 A;  2L4R A;  5F6A A;  1EW0 A;  3CAX A;  1F9I A;  2BAS A;  5AVE A;  1S67 L;  2Z6C A;  2PD8 A;  2ZOI A;  4JGQ A;  5AVF A;  3MQO A;  3UMD A;  3BY9 A;  4GW9 A;  4R38 A;  5J7E A;  2OOL A;  2A24 A;  4HQA A;  3UB8 A;  4M4X A;  4NXF A;  4WUJ A;  4HNB A;  1OJG A;  1OTI A;  4WF0 A;  4WLA A;  4LLO B;  2HV1 A;  4PKY G;  5HWV A;  3VE4 A;  3F1P B;  2VV6 A;  3BWL A;  4H6J A;  5HD5 A;  5HWW A;  1S4R A;  4BBU A;  4JGO A;  1OT9 A;  2YKH A;  3FG8 A;  4GS9 A;  4HJ4 A;  4JGP A;  5DKL A;  1DP6 A;  4EEP A;  2YKF A;  4HP9 A;  2OWJ A;  1XJ6 A;  1P0Z A;  2P7J A;  2B02 A;  4KUK A;  1DP8 A;  4H6J B; 
#chains in the Genus database with same CATH topology
 5EM1 A;  2XH9 A;  5HDD A;  5EOO A;  3ZVT A;  4HHD A;  5KZH A;  4HH2 A;  1YKD A;  4CLC B;  4BL3 A;  4DE0 A;  4E3I A;  2OLV A;  1ZG6 A;  1MXO A;  3LYX A;  3O88 A;  4K08 A;  5TJJ A;  4GOG A;  4KG5 A;  4CQH A;  4DMZ A;  5F5Y A;  1QMF A;  2GNX A;  4PM6 A;  1BLH A;  5HAQ A;  2J3T D;  2D02 A;  4CLC A;  4ZBE A;  4HJ6 A;  4HBT A;  1XA7 A;  5E43 A;  2D01 A;  1LSV A;  1CI8 A;  1U60 A;  3S7N A;  1YMS A;  2C6W B;  4CPK A;  2MJ6 A;  3E4Q A;  3T4L A;  5HPI A;  5F83 A;  1W5D A;  5TGF A;  1TF1 A;  5DTT A;  3MZD A;  5L07 A;  1F98 A;  2DRW A;  1IYO A;  3ZGA B;  2RL3 A;  2J8Y A;  2XF3 A;  3S7O A;  3IWI A;  1K55 A;  3PBQ A;  4DDS A;  3CI6 A;  3K3C A;  2H28 A;  3VMA A;  5DF8 A;  4E6X A;  1H0M A;  1XP4 A;  3NC8 A;  4KZ4 A;  1MY8 A;  5EVI B;  2HDS A;  2OAQ 1;  2HP6 A;  2HV1 A;  3DWK A;  3M2K A;  1PWC A;  2C5W B;  1LI9 A;  2VKS A;  4BD0 A;  4CJN A;  1BUL A;  3N6I A;  2PU2 A;  3HLD A;  1SKO B;  4P85 A;  2B02 A;  5FL3 A;  3T1X A;  2R9W A;  1EI5 A;  5A90 A;  3RFB A;  4EUZ A;  2KOI A;  1CF0 A;  4MLL A;  3HJI A;  3S7P A;  4HES A;  3RJU A;  3EEH A;  5FA7 A;  1K57 A;  3WS2 A;  3OCN A;  3BFF A;  3IF5 A;  5DVA A;  3RH8 B;  3H82 A;  4QWO A;  3LIC A;  2I9V A;  2HGV A;  1I2S A;  4IJG A;  5HFO A;  1N9O A;  5AVF A;  2Q0O A;  2FZ0 A;  4X55 A;  5EOE A;  1HZO A;  4PM5 A;  3SS3 A;  3OOV A;  4IVK A;  4OLD A;  4DJ2 A;  1N9N A;  2EX6 A;  2VEA A;  3Q7V A;  3KSH A;  4N9L A;  2DMW A;  3LID A;  5M19 A;  2PR6 A;  2VK3 A;  3BYD A;  3BQ8 A;  4EXO A;  1H8Z A;  1PFL A;  1RP5 A;  3R4K A;  2P04 A;  1NRJ A;  3PBO A;  1STZ A;  4N1X A;  4ZAM A;  2O9A A;  3D4F A;  2PYP A;  4MBK A;  1MKM A;  1IYQ A;  3LIA A;  3L7H A;  1NZU A;  3KSF A;  4R38 A;  4WZ5 C;  4M4X A;  4KZ9 A;  1OJG A;  1OTI A;  3VFH A;  3ZHH A;  3VE4 A;  4KG6 A;  4PHT A;  1ONG A;  3CJM A;  4KUK A;  2NUP C;  2Y4A A;  3V39 A;  1RGZ A;  2PDR A;  4JKT A;  4OPR A;  4GB7 A;  3OBF A;  3E4O A;  3K3D A;  1ZHH B;  3ICY A;  4FUW A;  3NOP C;  2PU4 A;  2PBD P;  3NHQ A;  3SS5 A;  1MWT A;  3NOU C;  5GLA A;  3GR2 A;  3W4P A;  2ZMV A;  3VP4 A;  4GNU A;  2Y2I A;  3LFV A;  3SH8 A;  3D3O A;  1MWR A;  3IS2 A;  4MNR A;  3KSG A;  2XEP A;  3HUN A;  2ZC7 A;  1GA0 A;  1TS6 A;  3H7W B;  4IUH A;  3Q1F A;  4KEN B;  4R1G A;  1S66 L;  1MBL A;  1S6R A;  4P6B A;  3ITA A;  1K0K A;  3SZT A;  5TBM A;  3DTM A;  3UB7 A;  5KSC A;  4C6Y A;  3Q81 A;  4UA9 A;  2Y2Q A;  1IOU A;  3FPV A;  3G30 A;  1C3B A;  3DAV A;  1BUE A;  4OQI A;  1W63 Q;  3CLO A;  3MZE A;  5G4Z A;  3BY8 A;  4ME4 A;  1CI9 A;  1PRQ A;  3UE3 A;  3UPO A;  1G6A A;  5A92 A;  2NUT C;  2R9X A;  1XXM A;  2VJW A;  3ZNY A;  4DN0 A;  4D60 A;  4S2J A;  3LEQ A;  2WAE A;  2Q9M A;  4WZ5 A;  1D1J A;  4O01 A;  1F9I A;  3T4O A;  2BAS A;  2Z6C A;  4IHQ A;  4CLC C;  3M6B A;  4ZRR A;  3OZH A;  3IH9 A;  1PW1 A;  2H0Y A;  3MBZ A;  4MBF A;  4OON A;  4BJP A;  1S4R A;  1YSP A;  2H0T A;  3QHY A;  4OP8 A;  3LY3 A;  5DF7 A;  2XFS A;  3A0R A;  1S1Z A;  1CK3 A;  4R3A A;  2X71 A;  3C2W A;  2QHK A;  1CEF A;  3P98 A;  4X6T A;  1D7E A;  5FQJ A;  1BT5 A;  1J9M A;  3LO7 A;  1KDW A;  4WMC D;  5K5B A;  3EGD C;  4JF6 A;  4ID4 A;  1E25 A;  3FKW A;  4GS9 B;  4PM7 A;  1K55 C;  2CC1 A;  5J3W A;  2JKT M;  5I5L A;  2PR5 A;  3C30 A;  3VFF A;  2O0Y A;  2PD7 A;  5FEF A;  1ONH A;  1BTL A;  1I2W A;  1HTZ A;  3S4X A;  3N4I A;  3BM6 A;  3SH7 A;  4OP5 A;  4JGR A;  4EEU A;  1VEU A;  1G6O A;  3N8S A;  5AQA A;  3OPR A;  3UPP A;  4NEE D;  3F1O A;  2P9V B;  4R23 A;  3AGD A;  3Q7Z A;  1JTD A;  3HJK A;  2B95 A;  4BD1 A;  4LGW A;  3G2Z A;  4E3L A;  4JF4 A;  2P74 A;  2VGL S;  4HP4 A;  1W7F A;  4KZ5 A;  3BFD A;  4OH0 A;  2XRO A;  4JXV A;  1YLZ A;  4D2O A;  2BTF P;  1LL9 A;  3SS4 A;  4MBH A;  4O8G A;  2P9V A;  3MS6 A;  3FWL A;  2JKT I;  2J9O A;  3LR5 A;  4X56 A;  4Q0I A;  2XFT A;  1W63 M;  2Y2H A;  3MQO A;  4EBL A;  2ZC3 B;  4WLA A;  2HJ9 C;  2ZM8 A;  3IXB A;  2B5R A;  1W79 A;  4JGO A;  5TFQ A;  4WEL A;  2OWJ A;  5L10 A;  2AVX A;  4NET A;  4NKP A;  3V3S A;  2OSU A;  4IBR A;  4HEF A;  1BZA A;  3JVU A;  1YLW A;  1Z09 A;  4GCZ A;  4I5S A;  2WAF A;  5L8M A;  3ZQ5 A;  3ZG9 B;  5DJT A;  1YPR A;  3NJA A;  4IVI A;  2W27 A;  1YQS A;  3CZD A;  3MQQ A;  1UWN X;  4Y13 A;  3H9W A;  4FSF A;  3N8L A;  4RVA A;  1GCE A;  3VOY A;  3IS2 B;  5A91 A;  3EOI A;  1YM1 A;  2XA7 S;  5G4Y A;  2G7U A;  4R3B A;  3VOZ A;  4ARZ B;  4PKY A;  3UN7 A;  3UO9 A;  5HL6 A;  2EX9 A;  2PHY A;  2ZOH A;  2XD1 A;  2J3W A;  4UA7 A;  3D9Y A;  2XSS A;  3BEB A;  1V9Z A;  5GLC A;  5FI6 A;  1MKI A;  5FEG A;  4EQ1 A;  2HDR A;  5CRF A;  3MFD A;  2OV5 A;  5AJG A;  3GV9 A;  3OC2 A;  3K2N A;  4WL9 A;  5GLD A;  3KX0 X;  1OJ5 A;  4JBF A;  5F69 A;  4FOF A;  4Y3I A;  3MKE A;  4MEZ A;  1K25 A;  2W3F A;  2QPN A;  4B4X A;  1PWD A;  1RGY A;  1K6S A;  1GHM A;  4WYY A;  5FAQ A;  4G3K A;  4HP9 A;  2M7V A;  2ZQ9 A;  5CTN A;  4ZDX A;  1P9R A;  3TG9 A;  4Z1W A;  1KE4 A;  1MWU A;  2WKE A;  1LT0 A;  2QYB A;  2QKP A;  3H7W A;  4ZJ1 A;  2M7U A;  4LV1 A;  1M40 A;  2ZD8 A;  4S2I A;  1GSV A;  3WS0 A;  1BSG A;  1TVF A;  5HDC A;  1LL5 A;  3HUM A;  2ZQ7 A;  4DXB A;  2XK1 A;  4IED A;  4M3K A;  1T19 A;  3UDX A;  2Y91 A;  3VP1 A;  1K4F A;  2ZC6 B;  3WS1 A;  4EET B;  3LR0 A;  4BLM A;  1J3W A;  2A2L A;  5AQ7 A;  5HZH A;  1OME A;  3LI9 A;  2ZMF A;  4OOY A;  1H3Q A;  5EUA A;  2VV8 A;  3TSG A;  3QP1 A;  5CX7 A;  3VV4 A;  3OPP A;  3BQA A;  1IEL A;  1H5X A;  3FYZ A;  1RCJ A;  2PAV P;  2Y2M A;  4E6W A;  1ES4 A;  1EW0 A;  1TDG A;  4QU3 A;  3IT9 A;  2XR0 A;  2XDM A;  4QY5 A;  2J7V A;  1QME A;  3UB8 A;  2Y55 A;  4WF0 A;  1FCM A;  3EQU A;  2QZ6 A;  1PI4 A;  4EWF A;  5HWV A;  5LBR A;  1NY0 A;  3QP6 A;  3BWL A;  2J3T C;  1NZO A;  2ZQC A;  1FIL A;  1P0Z A;  3A3D A;  3QNB A;  3IF6 C;  2V0U A;  3E2L A;  5AQB A;  1IYS A;  3M2J A;  3N8R A;  1P9W A;  3C8C A;  2GX5 A;  4YFM A;  2XD5 A;  4MMN A;  4JPM A;  5EVI C;  3IF6 B;  4S2O A;  3CG5 A;  1SKF A;  3EWK A;  3KSI A;  5HSQ A;  1L0E A;  2JBF A;  1OT6 A;  3GTC A;  5JYP A;  1FSW A;  4L9G A;  3LR3 A;  4E3K A;  4PM8 A;  3IHB A;  3F1O B;  4FH2 A;  3S7Q A;  3GDI A;  1Q2Q A;  4LPZ A;  1SHV A;  1UGU A;  1HVB A;  3V3R A;  2PBY A;  3GVB A;  1PNE A;  4B9O A;  3S1Y A;  1VM1 A;  1KOU A;  3PBR A;  2KDK A;  5GL9 A;  1XKZ A;  4DE3 A;  1FOF A;  1XA1 A;  1Y4O A;  4EER A;  5FAS A;  4GDN A;  5FSR A;  3ZCZ A;  2GZA A;  2O99 A;  1P97 A;  4R3J A;  4LCM A;  1EWZ A;  4OQ0 A;  4KQQ A;  3E0Y A;  3V67 A;  1T1A A;  1I5Q A;  5EM0 A;  2K31 A;  4OOM A;  1Q2P A;  4I3I A;  1GSW A;  5HWT A;  5HAI A;  3UE6 A;  3VSL A;  5I94 A;  5FQ9 A;  3D72 A;  2WKR A;  4HY8 A;  2I72 A;  3IWQ A;  1KDS A;  3CAX A;  1K56 D;  3G34 A;  4HQA A;  3PBN A;  5EV0 A;  3C7V A;  4WEK A;  2ZMA A;  5F82 A;  2HF6 A;  2OAP 1;  4BBU A;  5CXW A;  3FG8 A;  3IHA A;  3NUL A;  1GHI A;  3PXP A;  2OLU A;  2H5S A;  2WUQ A;  3U4L P;  1JWP A;  2JN7 A;  1LL8 A;  4L9F A;  1H8M A;  4WN5 A;  2W0N A;  4LV3 A;  2INW A;  3PAE A;  2ZQA A;  1ZTU A;  3FV7 A;  4DE1 A;  4RYE A;  2LB9 A;  2UV0 E;  3KYQ A;  3WRT A;  5EFW A;  4CLC D;  1L0G A;  5BOH A;  1K57 C;  1ESI A;  1NXY A;  3SH9 A;  4P87 A;  4I3J A;  4WZ4 A;  3PYP A;  4E3J A;  3NCK A;  4NXB A;  4OOL A;  1YT4 A;  4K0X A;  1X0O A;  3L9K A;  2BLS A;  4K91 A;  3NI9 A;  1NJ4 A;  3P09 A;  5GHZ A;  2JC7 A;  2QWS A;  4N9K A;  3A3F A;  3WS5 A;  1XPB A;  4XT2 A;  2A3U A;  2R78 A;  5HAP A;  3ZG8 B;  4BWI A;  2L1M A;  4XUZ A;  4ETZ A;  3A3J A;  4UQI M;  1G28 A;  1K4E A;  4PPR A;  5M18 A;  2EX2 A;  2A24 B;  4ZJ2 A;  1NWZ A;  2JKF A;  2PT7 A;  4EES A;  4FD8 A;  1PZO A;  1ZC2 A;  5G18 A;  4R70 A;  3GRJ A;  1ERM A;  3EGX C;  4O7D A;  3IXD A;  4LV0 A;  4LCL A;  3UNW A;  2A24 A;  2W3H A;  3RXW A;  4Q0J A;  3F1P B;  4H6J A;  1WE4 A;  1AWI A;  2ZQD A;  3BFC A;  1H8Y A;  1YMX A;  2HP9 A;  2O9B A;  2ZQ8 A;  1G68 A;  2CMN A;  3FZC A;  3T4Q A;  3W2Z A;  5IU1 A;  1CJF A;  2VA0 A;  2ZM0 A;  3UME A;  4IBX A;  3DTI A;  4HIA A;  1KE3 A;  4WMC A;  4MN6 A;  3O87 A;  1K6R A;  3IF6 A;  1E3U D;  4JXG A;  4LRZ E;  5DTS A;  5J8X A;  4BBT A;  3BFE A;  1W8Q A;  2X02 A;  3OLO A;  5E2G A;  3CHW P;  3HVF A;  3A0V A;  4S2P A;  3VP2 A;  2VLG A;  3HLG A;  3QP4 A;  2Y2K A;  3SOI A;  3LI8 A;  2Z2M B;  2W1T B;  2J80 A;  3IWO A;  4KQR A;  2HP5 A;  2Y2N A;  4E3N A;  3Q07 A;  5EVI A;  3C4O A;  4I38 A;  3IX8 A;  1IEM A;  1K56 A;  1KGG A;  2V8C A;  1JWV A;  5L2F A;  3KYZ A;  4QJG A;  1SKO A;  4R6L A;  1DRM A;  5DJU A;  4EW7 A;  4LEN A;  4Y17 A;  2PD8 A;  2IA2 A;  2EWV A;  2OOL A;  3BEC A;  3B47 A;  4UHU A;  2E8J A;  5HD5 A;  3QP8 A;  5F1G A;  1KVL A;  1VET A;  3MXR A;  4OPQ A;  1JWZ A;  5HL1 A;  2QJ7 A;  4OPZ A;  3OPL A;  1O7E A;  5FQK A;  4S2N A;  3W4O A;  1M6K A;  5CGX A;  3UY6 A;  3GQZ A;  3GEC A;  4OQG A;  3ZG0 A;  1L0D A;  2EX8 A;  4GLQ A;  5CED A;  4Q0H A;  1MC0 A;  5CEB A;  4GD8 A;  1FSY A;  2K2N A;  3B42 A;  3VE3 A;  3FC7 A;  5CHU A;  4YOF A;  2IWD A;  5DF9 A;  2WAD A;  4N92 A;  3T4K A;  2JKR I;  1L0F A;  4Y0T A;  3LEZ A;  1IKG A;  3C4P A;  2V8F A;  3T4S A;  3NOT C;  3HBR A;  3C5A A;  5J7E A;  4U3T A;  1NLY A;  1FCO A;  4HH3 A;  3VP3 A;  4LRY C;  2JE5 A;  2WK0 A;  1SCW A;  4YNR A;  2FFF B;  4U0X A;  3BW6 A;  4ZJ3 A;  4I39 A;  5HD3 A;  2OWH A;  5EVI D;  2KLI A;  4OKP A;  4DDY A;  3GSG A;  4S2K A;  4EBN A;  3IBR A;  4EV4 A;  4Y2F A;  4Z9Q A;  3UMD A;  5CHM A;  3IX4 A;  1MWS A;  3A3E A;  4G3V A;  3EQV A;  4JGP A;  4KZ3 A;  4PM9 A;  4EEP A;  2VGL M;  4H6J B;  1ERO A;  3NY4 A;  2WGW A;  1XFN A;  1ES5 A;  4DJ3 A;  4LRX C;  1JTG A;  5IHV A;  4AFI A;  1FIK A;  1BYW A;  4MDZ A;  3QP5 A;  2ACG A;  1TS0 A;  1IYP A;  2W3G A;  4YIN A;  2A49 A;  4JLF A;  2XQZ A;  3WRZ A;  3M6H A;  4E04 A;  4MCW A;  3HRE A;  1GHP A;  3ZYT A;  2WZX A;  3G32 A;  2XRN A;  3ITB A;  2WGW B;  2JKR M;  3MJQ A;  3NDE A;  1VEU B;  1XJ3 A;  3IQA A;  1CQA A;  2K7S A;  5CTM A;  1BLP A;  3ZVW A;  1N4O A;  3HCY A;  5L09 A;  1TS7 A;  3OCL A;  4JXW A;  1TS8 A;  5DTK A;  4ESP A;  2HJE A;  5J4E A;  2Y2P A;  1S1Y A;  3VSK A;  1PW8 A;  1YLJ A;  2DNS A;  3GMW A;  5F1F A;  4EU0 A;  3FKV A;  3MSH A;  3F1P A;  4RX3 A;  4WBG A;  3Q82 A;  2L4R A;  4UEY A;  1YLT A;  1S67 L;  4C75 A;  2LB5 A;  4BMW A;  3T12 B;  5M1A A;  3MMH A;  2ZJ9 A;  4WEJ A;  2B18 A;  1ES3 A;  4HNB A;  1TEM A;  4LLO B;  5KMW A;  3P01 A;  4GS9 A;  2X01 A;  3W8K A;  3RXX A;  3IH8 A;  1LHY A;  1K54 A;  3CUE A;  4FTX A;  1FCN A;  4Q8I A;  4KUO A;  3C38 A;  1PWG A;  2FH5 A;  3E4P A;  3VOL A;  3ZG7 B;  1ERQ A;  4S2L A;  4BEN A;  5E2H A;  3AGE A;  1DP9 A;  1GSX A;  4G3W A;  3PAG A;  4S2M A;  1PYY A;  2QJ5 A;  3LGO A;  3LUQ A;  3PTE A;  3CIT A;  3O3V A;  4R0Q A;  3LR4 A;  5EVL A;  5FQQ A;  5FAT A;  1IKI A;  4NXE A;  1KE0 A;  2W1T A;  3DW0 A;  2EFX A;  3TRC A;  1PZP A;  4GZB A;  2W1R A;  3AGF A;  3PBS A;  2PYR A;  5F68 A;  4H8R A;  4DRT A;  3DTK A;  2V1A A;  4P0M A;  1ODV A;  1AXB A;  5HX9 A;  4P6Z M;  1CEG A;  3G4P A;  1NYY A;  2HDU A;  3A0S A;  4I3A A;  2WKH A;  2IWB A;  3RTY A;  2ZC5 B;  3N7W A;  3UDF A;  1E4D A;  4HJ3 A;  4K0W A;  5HW3 A;  4JGQ A;  5A93 A;  3BLM A;  3BY9 A;  3BLS A;  1TDL A;  2Q9N A;  3HLF A;  3HL9 A;  4NXF A;  4WUJ A;  4BL2 A;  2YKH A;  3LCE A;  3WS4 A;  4KZB A;  3UE0 A;  3ZG5 A;  2EXB A;  4ETX A;  2Y2L A;  4X69 A;  3MXQ A;  5HDS A;  2Z6D A;  4QHC A;  1G5U A;  4IUK A;  3BJN A;  2M1C A;  2GDN A;  1OTB A;  3DBA A;  1T1C A;  3V50 A;  2V1B A;  2KX6 A;  3QP2 A;  1SZV A;  3VP0 A;  4GHI A;  4JXS A;  3T4T A;  2V9A A;  3MR0 A;  3T4J A;  3ULF A;  3CPT A;  1F2K A;  3I7J A;  4CLC E;  1N9B A;  3CWF A;  4FCF A;  5FAP A;  3UDI A;  3G31 A;  4X25 A;  1XFQ A;  4FH4 A;  1MPL A;  4F3L A;  3NIA A;  2WGV A;  3HUO A;  2Y8H A;  4UQI S;  1XX2 A;  5KIZ A;  3UB6 A;  2JKG A;  1S4S A;  4E3O A;  2W3D A;  2WKI A;  3T1S A;  2ZBB A;  3T50 A;  4B4Z A;  3ZDJ A;  4XXR A;  2WGI A;  1LSW A;  5GHX A;  3JPU A;  3PHY A;  5DKK A;  4ARZ A;  4U0T A;  5TR7 A;  3NDG A;  4X1M A;  4MN7 A;  1L3L A;  4RA7 A;  4DF6 A;  5AVE A;  3JVV A;  2ZOI A;  4GW9 A;  4QB8 A;  5C5K A;  1Z6F A;  5CER A;  4PKY G;  3B3X A;  2VV6 A;  4DXC A;  1OT9 A;  3EEA A;  5FDS A;  1DP6 A;  5U47 A;  4X68 A;  2VGK A;  1YSQ A;  2VZW A;  1LLB A;  3JYI A;  1L2S A;  1ESU A;  4X53 A;  5FI2 A;  3LIE A;  5D3O A;  1OPX A;  1N9L A;  4S2N C;  5HAR A;  2V2F F;  1JVJ A;  1F5M A;  3UB9 A;  3NEC A;  2EA9 A;  1MZU A;  4C3Q A;  2EXA A;  4OVD A;  1T1B A;  5EVE A;  4LV2 A;  3LIF A;  1NLZ A;  5CHJ A;  3PBT A;  1VB6 A;  2H10 A;  4NXG A;  4BBV A;  2FFY A;  4B93 A;  2W3E A;  5GLB A;  2Y79 A;  4GHI B;  4KZ6 A;  2G2U A;  1WYB A;  5FQI A;  4KG2 A;  5DFX A;  5TBM B;  4JF5 A;  1XJ4 A;  1KGE A;  3ISG A;  1YLY A;  4X1L A;  3F1N A;  4XT2 B;  3A3I A;  4F94 A;  2V0W A;  3MXS A;  3MFX A;  1SDE A;  4E3M A;  2XLN A;  1FR1 A;  2Y2G A;  1ZKJ A;  2J9P A;  3MKF A;  5EEC A;  1OTE A;  2BG1 A;  1K54 C;  3NBL A;  3PR6 A;  4Y7P A;  4OQH A;  3C7U A;  3G2Y A;  3HLC A;  1UWP X;  2WKP A;  2UWX A;  5CGS A;  1WYC A;  1DJC A;  4L0L A;  5CEC A;  3R7W B;  3IBJ A;  4DKI A;  3G35 A;  2HDQ A;  4R4S A;  5DKL A;  4QPR A;  1XJ6 A;  1DP8 A;  4O0P A;  4KZA A;  1DY6 A;  3TOI A;  4EUV A;  3U2A A;  5FQM A;  5E2F A;  3IXH A;  3UE1 A;  5FAO A;  1DJA A;  3MQ0 A;  1SDN A;  2JHE A;  4P6Z S;  5JYO A;  1KVM A;  2ZC4 B;  3S22 A;  3DTE A;  5DFY A;  5A8B A;  1T18 A;  1ACF A;  3HLW A;  3QNC A;  3IX3 A;  1GA9 A;  4B88 A;  1PIO A;  2GJ3 A;  3E98 A;  5AQ9 A;  3CPT B;  4EBP A;  1DJB A;  2ZLY A;  1OTA A;  3F1N B;  3G6O A;  3E2K A;  1OTD A;  2Z2L B;  4PMA A;  3T1R A;  1S0W A;  3LY4 A;  4N1H A;  2QMI A;  2WKQ A;  4QD4 A;  2DCF A;  4QY6 A;  4EQI A;  1BLC A;  4OLG A;  1XGJ A;  4F3L B;  1TD5 A;  1V9Y A;  1WA9 A;  1VHM A;  4R4R A;  3MF0 A;  4ZTK A;  5FI7 A;  2P08 A;  1VQQ A;  4PAU A;  1JNU A;  2O9C A;  3V5M A;  3UPN A;  4HOI A;  1W8Y A;  2L0W A;  5CGW A;  2Y59 A;  3FPW A;  1ES2 A;  3R7W A;  3OPH A;  3W4Q A;  1NRF A;  1VET B;  5HWW A;  2IWC A;  3BFG A;  4HJ4 A;  2HZ5 A;  3CUE C;  2YKF A;  2P7J A;  4UA6 A;  4RX2 A;  2VV7 A;  4II7 A;  3B33 A;  3ZNT A;  1BLS A;  4RQ9 A;  1YAX A;  1HD8 A;  4XUX A;  5MC7 A;  2E8I A;  1IFQ A;  2VX8 A;  4BQM A;  1ZG4 A;  3H82 B;  2EFU A;  3KYE A;  5KSH A;  3TW8 A;  2EWW A;  2Y2O A;  1Y28 A;  3P7N A;  4Y15 A;  3BRM A;  4NG2 A;  4KZ8 A;  2WZZ A;  2XGN A;  2Y2J A;  1FQG A;  5E2E A;  1LI0 A;  4HI4 A;  1D06 A;  5IS1 A;  1LSX A;  3Q7V B;  3UB5 P;  3O86 A;  4KZ7 A;  2V20 A;  4HBU A;  3WWX A;  4KQO A;  3SW1 A;  1ALQ A;  3DWZ A;  1A0K A;  4NK3 A;  4OPY A;  1E3U A;  4GDB A;  5HPF A;  4Y0O A;  3TE8 A;  4KQD A;  1O07 A;  4LFU A;  2ZL1 B;  4GKU A;  2PRF A;  2V1Z A;  1XJ2 A;  4GN2 A;  4Y0U A;  5EPH A;  2XA7 M;  4YWZ A;  5EE8 A;  2G2W A;  4L9E A;  4UAA A;  4A5R A;  4GD6 A;  5GHY A;  2HPB A;  3LIB A;  3ZFZ A;  3CMZ A;  4Y5F A;  2JCH A;  4DE2 A;  4MN5 A;  3TJZ C;  3MZF A;  1XGI A;  5F6A A;  1HLU P;  4GJ4 A;  5FDH A;  1KGF A;  3KO6 A;  1PI5 A;  1NYM A;  4WM9 A;  5IT5 A;  3IXG A;  2WYX A;  1FR6 A;  1Y54 A;  2ZL1 A;  1YLP A;  2ZM2 A;  2VGJ A;  3HLB A;  3HLE A;  2RCX A;  3O5Y A;  3T1Q B;  1K38 A; 
#chains in the Genus database with same CATH homology
 5HDD A;  4ETX A;  2O9B A;  4NKP A;  3MXQ A;  4HHD A;  4HH2 A;  2CMN A;  1YKD A;  4CLC B;  3JVU A;  4I5S A;  4GCZ A;  3T4Q A;  5HDS A;  2Z6D A;  3W2Z A;  5IU1 A;  2VA0 A;  4IUK A;  3UME A;  4HIA A;  3BJN A;  3LYX A;  5L8M A;  3ZQ5 A;  2M1C A;  5DJT A;  4MN6 A;  1OTB A;  3DBA A;  1T1C A;  4K08 A;  5TJJ A;  4CQH A;  4LRZ E;  4DMZ A;  2V1B A;  3NJA A;  5F5Y A;  2KX6 A;  4GHI A;  2W27 A;  2GNX A;  3T4T A;  2V9A A;  3MQQ A;  1UWN X;  3MR0 A;  3T4J A;  4BBT A;  3H9W A;  3ULF A;  4FSF A;  2J3T D;  2D02 A;  4CLC A;  4CLC E;  3OLO A;  3IS2 B;  3EOI A;  2XA7 S;  5G4Y A;  3CWF A;  2G7U A;  3A0V A;  4HJ6 A;  4ARZ B;  2D01 A;  1XFQ A;  4PKY A;  1LSV A;  2VLG A;  5HL6 A;  3S7N A;  2PHY A;  4F3L A;  2ZOH A;  2J3W A;  2MJ6 A;  2XSS A;  3LI8 A;  2Y8H A;  2W1T B;  4UQI S;  1V9Z A;  2J80 A;  3E4Q A;  3T4L A;  5HPI A;  5KIZ A;  3UB6 A;  1TF1 A;  1S4S A;  4EQ1 A;  2W3D A;  1F98 A;  2ZBB A;  4I38 A;  5AJG A;  3T50 A;  3OC2 A;  3K2N A;  4WL9 A;  3S7O A;  1LSW A;  3PHY A;  5DKK A;  3KYZ A;  3KX0 X;  1OJ5 A;  4ARZ A;  4R6L A;  1DRM A;  3PBQ A;  5F69 A;  3CI6 A;  4FOF A;  3K3C A;  2H28 A;  4Y3I A;  5DJU A;  4MN7 A;  4EW7 A;  5AVE A;  3JVV A;  2ZOI A;  2PD8 A;  2IA2 A;  2W3F A;  2EWV A;  4GW9 A;  2OOL A;  5C5K A;  3B47 A;  2OAQ 1;  2HV1 A;  4PKY G;  2VV6 A;  5HD5 A;  1OT9 A;  2VKS A;  3EEA A;  1DP6 A;  4G3K A;  4HP9 A;  1YSQ A;  2VZW A;  2M7V A;  2B02 A;  5FL3 A;  1P9R A;  2QJ7 A;  3RFB A;  3LIE A;  2KOI A;  1OPX A;  4Z1W A;  1N9L A;  1F5M A;  3HJI A;  3UB9 A;  3S7P A;  2EA9 A;  1MZU A;  3GEC A;  3EEH A;  1LT0 A;  1T1B A;  3OCN A;  4GLQ A;  2QYB A;  2QKP A;  3LIF A;  1NLZ A;  3H7W A;  4Q0H A;  1MC0 A;  2M7U A;  3PBT A;  3RH8 B;  1VB6 A;  4NXG A;  4BBV A;  2K2N A;  3B42 A;  3VE3 A;  4B93 A;  2W3E A;  3H82 A;  2Y79 A;  4GHI B;  1GSV A;  3LIC A;  3FC7 A;  2I9V A;  5DFX A;  4YOF A;  5TBM B;  5DF9 A;  1XJ4 A;  5HDC A;  3T4K A;  2HGV A;  2JKR I;  4IJG A;  1N9O A;  5AVF A;  3T4S A;  2FZ0 A;  3NOT C;  3F1N A;  1T19 A;  5J7E A;  4XT2 B;  3OOV A;  1NLY A;  4EET B;  2V0W A;  3LR0 A;  4DJ2 A;  4HH3 A;  1N9N A;  3MFX A;  4LRY C;  2VEA A;  2A2L A;  3KSH A;  5HZH A;  4YNR A;  2DMW A;  3LI9 A;  3LID A;  2ZMF A;  2PR6 A;  1H3Q A;  3BW6 A;  3BQ8 A;  2VV8 A;  1OTE A;  5CX7 A;  4EXO A;  4I39 A;  5HD3 A;  3R4K A;  3VV4 A;  2P04 A;  2OWH A;  1NRJ A;  3PBO A;  1STZ A;  3BQA A;  3PR6 A;  2KLI A;  2O9A A;  2PYP A;  1MKM A;  3LIA A;  1UWP X;  2WKP A;  3IBR A;  1EW0 A;  4Y2F A;  4L0L A;  3R7W B;  3KSF A;  3UMD A;  4R38 A;  3IBJ A;  3UB8 A;  4M4X A;  1OJG A;  1OTI A;  4WF0 A;  4G3V A;  3EQU A;  5HWV A;  5LBR A;  3VE4 A;  3BWL A;  3EQV A;  4JGP A;  4EEP A;  2J3T C;  5DKL A;  4PHT A;  4QPR A;  1XJ6 A;  1P0Z A;  2VGL M;  4KUK A;  1DP8 A;  2NUP C;  4H6J B;  4O0P A;  2V0U A;  2PDR A;  1P9W A;  3OBF A;  4EUV A;  3E4O A;  3U2A A;  3K3D A;  1ZHH B;  3C8C A;  1XFN A;  2GX5 A;  3ICY A;  4MMN A;  3NOP C;  4LRX C;  4DJ3 A;  4AFI A;  3NHQ A;  3MQ0 A;  3EWK A;  2JHE A;  1BYW A;  3KSI A;  4P6Z S;  3NOU C;  4MDZ A;  5HSQ A;  2ZMV A;  1OT6 A;  5DFY A;  1TS0 A;  5A8B A;  2W3G A;  1T18 A;  4L9G A;  3LR3 A;  3LFV A;  3D3O A;  3IS2 A;  3KSG A;  3F1O B;  4E04 A;  4MCW A;  1TS6 A;  3ZYT A;  2XRN A;  3S7Q A;  3GDI A;  2JKR M;  3H7W B;  4IUH A;  3MJQ A;  4LPZ A;  1UGU A;  2GJ3 A;  3E98 A;  1S66 L;  1XJ3 A;  1OTA A;  2K7S A;  3F1N B;  3G6O A;  4B9O A;  1OTD A;  3PBR A;  1KOU A;  2KDK A;  3HCY A;  1TS7 A;  3OCL A;  5TBM A;  4EER A;  3UB7 A;  2GZA A;  2WKQ A;  1TS8 A;  1IOU A;  3FPV A;  2O99 A;  1P97 A;  4F3L B;  3E0Y A;  3V67 A;  1TD5 A;  1V9Y A;  1WA9 A;  2HJE A;  1T1A A;  5J4E A;  1W63 Q;  1VHM A;  1S1Y A;  2K31 A;  3CLO A;  4OOM A;  4I3I A;  3MF0 A;  5G4Z A;  1GSW A;  5HWT A;  2P08 A;  3BY8 A;  3UE6 A;  4ME4 A;  4PAU A;  4EU0 A;  3UE3 A;  1JNU A;  2O9C A;  2NUT C;  2VJW A;  4HOI A;  4DN0 A;  3F1P A;  3D72 A;  2WKR A;  2L0W A;  4HY8 A;  2L4R A;  4UEY A;  4O01 A;  3CAX A;  1F9I A;  3FPW A;  2BAS A;  3T4O A;  1S67 L;  2Z6C A;  2LB5 A;  4BMW A;  3R7W A;  4IHQ A;  4CLC C;  3MMH A;  4WEJ A;  4ZRR A;  4HQA A;  2B18 A;  4HNB A;  3PBN A;  4WEK A;  4LLO B;  2HF6 A;  2OAP 1;  4BJP A;  5HWW A;  1S4R A;  4BBU A;  1YSP A;  3FG8 A;  3P01 A;  4GS9 A;  4HJ4 A;  3PXP A;  3CUE C;  2YKF A;  3CUE A;  2P7J A;  4KUO A;  3A0R A;  1S1Z A;  2VV7 A;  4II7 A;  2JN7 A;  4R3A A;  1LL8 A;  3C38 A;  3B33 A;  2FH5 A;  2QHK A;  3C2W A;  3E4P A;  3VOL A;  4L9F A;  1H8M A;  4WN5 A;  1D7E A;  2W0N A;  2INW A;  4RQ9 A;  1YAX A;  1ZTU A;  5MC7 A;  5K5B A;  3EGD C;  1IFQ A;  2VX8 A;  1DP9 A;  3H82 B;  1GSX A;  4G3W A;  5KSH A;  3TW8 A;  4GS9 B;  2EWW A;  2QJ5 A;  2LB9 A;  5J3W A;  2JKT M;  1Y28 A;  3KYQ A;  3LUQ A;  3P7N A;  2PR5 A;  5EFW A;  5I5L A;  4CLC D;  3C30 A;  2O0Y A;  2PD7 A;  3CIT A;  3LR4 A;  4I3J A;  3PYP A;  4NXB A;  4OOL A;  1X0O A;  4HI4 A;  4NXE A;  4JGR A;  4EEU A;  2W1T A;  1D06 A;  1G6O A;  5IS1 A;  1LSX A;  3TRC A;  2W1R A;  2QWS A;  3PBS A;  2PYR A;  5F68 A;  4NEE D;  3F1O A;  4KQO A;  3SW1 A;  3HJK A;  4XT2 A;  2R78 A;  2V1A A;  4BWI A;  2L1M A;  4ETZ A;  1ODV A;  4UQI M;  1G28 A;  5HPF A;  3TE8 A;  2A24 B;  2VGL S;  4P6Z M;  4HP4 A;  4KQD A;  1NWZ A;  2PT7 A;  4EES A;  3A0S A;  4I3A A;  2XRO A;  1XJ2 A;  4R70 A;  2XA7 M;  4YWZ A;  3RTY A;  4L9E A;  4O8G A;  3LIB A;  2JKT I;  3EGX C;  4Y5F A;  3LR5 A;  4HJ3 A;  4MN5 A;  3TJZ C;  4Q0I A;  1W63 M;  5F6A A;  4GJ4 A;  4JGQ A;  3KO6 A;  3MQO A;  3BY9 A;  5IT5 A;  2A24 A;  4NXF A;  2W3H A;  4WUJ A;  4WLA A;  4Q0J A;  2HJ9 C;  3F1P B;  4H6J A;  4JGO A;  2YKH A;  4WEL A;  3O5Y A;  2OWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...