4FD8A

Structure of apo s70c shv beta-lactamase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMCTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Crystal structure of a pre-acylation complex of the beta-lactamase inhibitor, sulbactam, bound to a sulfenamide bond containing thiol-beta-lactamase
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 99
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4fd8A00
2I72A 1KGGA 1L2SA 2ZC3B 5DTTA 1Y54A 5DF9A 1ESUA 1PW8A 4U0XA 3VP1A 4R23A 4E3KA 3V3RA 1K6RA 1CK3A 4XUXA 3IWIA 3CMZA 3AGDA 4JXGA 5FSRA 3GR2A 3C5AA 2ZJ9A 2QPNA 4OQIA 4OQ0A 4RYEA 1U60A 1TDLA 4GB7A 3D4FA 3PAEA 1E3UA 2IWBA 4WMCD 3WS4A 3WS0A 1PW1A 2WADA 3BFDA 3V5MA 2XLNA 3O3VA 5L2FA 3SS4A 3GRJA 4WBGA 3PAGA 3UPPA 3ZNTA 4N1XA 4E3OA 4U0TA 4DF6A 3A3IA 4S2IA 3BFEA 2EXAA 2E8IA 3A3JA 4Y7PA 2HDSA 2Q9NA 4Y0UA 3S22A 2Y2QA 2HDUA 3M2JA 4OKPA 5JYOA 1NYMA 1K38A 1FR1A 3UE0A 4DXBA 4ZTKA 5BOHA 1FQGA 2EFUA 2Q9MA 2Y2JA 4MBHA 1I2SA 1QMEA 4EBPA 1BZAA 1K55C 1YQSA 2Y2MA 1ES2A 2QZ6A 4HESA 4BQMA 3OPHA 4LCMA 3QHYA 4ZJ3A 3IF6C 5DF8A 5GL9A 3SS3A 5AQ7A 3VP2A 4D2OA 3O88A 2WGIA 3MZFA 3VP4A 5GLBA 3TSGA 3UO9A 1LI9A 2BG1A 3V39A 3UDIA 1YLWA 3ZDJA 2A3UA 4GD6A 1YMXA 2HDRA 4EBLA 2P9VA 4KG2A 1E3UD 3BRMA 4DKIA 2G2WA 2OV5A 5F82A 2ZQDA 4L0LA 4BENA 5TR7A 5EOEA 3HLGA 1YT4A 3HL9A 3LY4A 2Z2MB 4FH2A 3DWZA 4GD8A 4OLDA 4IVKA 4KZ7A 5HFOA 3FWLA 2Y2OA 2Y2GA 3N8SA 4PM8A 2Y2LA 3HLBA 4S2LA 3ZCZA 4JLFA 1L0FA 3NIAA 1N4OA 4E3MA 5KMWA 4MLLA 4KZ8A 4DDSA 3TG9A 4DE3A 4KZAA 3SH7A 1NYYA 3GSGA 4K91A 1ZG4A 1QMFA 4Q8IA 4S2PA 3VSLA 2CC1A 1XXMA 3IF6A 3S4XA 3LCEA 4K0WA 3MKEA 4OONA 4GDNA 4X6TA 4WEJA 1RGZA 1ZC2A 2ZM2A 4B4ZA 4BD1A 1TEMA 3A3DA 5CTMA 1JTGA 2P74A 2XFSA 4GKUA 4E3LA 4KQOA 3LO7A 2ZC7A 1EI5A 2DNSA 1ERQA 1MBLA 2UWXA 4R4RA 1N9BA 5DTKA 3NBLA 1BT5A 2RL3A 2V2FF 4YINA 5E2GA 4LV2A 1ALQA 1XKZA 1DJBA 4OLGA 3WS2A 3M6HA 3PTEA 4RVAA 3NDGA 4S2NC 1JWVA 3FV7A 1H8ZA 4B88A 3VSKA 3GV9A 5E2EA 2EX2A 1CEFA 3UE1A 3G30A 3QNCA 4GDBA 5EVIC 2JE5A 3AGEA 1JWPA 5EUAA 2X01A 4JF5A 1JTDA 4KQRA 1H8YA 2J9OA 2IWDA 2PU2A 2ZQ7A 3FKWA 4S2JA 4ZJ1A 4C6YA 2V20A 2XDMA 1IYOA 4EBNA 1HZOA 3DWKA 3G2YA 3IHBA 4JBFA 4MBKA 4WZ4A 5CHUA 1IEMA 4QB8A 5HW3A 4KZ4A 3IXBA 3UPNA 1KE4A 3AGFA 1IYPA 1I5QA 1WYBA 1ZG6A 4UAAA 2EFXA 5M18A 4HEFA 5CEDA 1K6SA 4JXWA 4JXVA 1W5DA 2XK1A 4UHUA 3BFFA 3HUOA 1FCOA 2ZQCA 3IHAA 4A5RA 3B3XA 2HPBA 1S6RA 3IWQA 4JF6A 4EQIA 3ZG7B 3IH8A 3S1YA 3IQAA 5FA7A 4RA7A 1ES3A 4E3NA 3M2KA 4S2NA 4X53A 1HD8A 1KGFA 4P87A 3BLSA 3MBZA 2HP6A 5FAQA 2Y55A 2EXBA 5DF7A 3HUMA 5HL1A 5EVIA 4N1HA 4GZBA 4KQQA 2ZMAA 4OPYA 1WE4A 3HLFA 3GMWA 3BYDA 4WM9A 5CRFA 1TVFA 2H10A 2XGNA 3E2LA 5EVLA 1NJ4A 4KG6A 2RCXA 3G4PA 4ZDXA 1SDEA 3WS1A 3MFDA 1J9MA 1MWSA 4H8RA 4N9KA 3ZG0A 4OOYA 3O87A 3HVFA 3SS5A 1MPLA 1GHPA 3HBRA 4E3IA 3IH9A 2XD1A 2XF3A 4OQHA 1KDSA 3IF5A 2H0YA 5G18A 5CGSA 3SH8A 1ES5A 4R0QA 2PU4A 1TDGA 5CTNA 1MKIA 4OPQA 2DCFA 3M6BA 1BLHA 1FOFA 3N8RA 4GN2A 1SDNA 3HLWA 2ZQ9A 3HREA 4FSFA 3G32A 3NDEA 5EVID 5GLDA 3RXXA 4BLMA 4KZ3A 2BLSA 3MZEA 3HLEA 1MWRA 1BLSA 1PWDA 3BEBA 3PBRA 3OZHA 2FFFB 2V1ZA 3N4IA 1GHMA 2GDNA 2ZLYA 1NRFA 4IVIA 4KZBA 4LV0A 1GHIA 4RX2A 1K56A 4NK3A 5AQ9A 4PM5A 1VQQA 4BJPA 3G35A 5DVAA 3Q7VA 4GNUA 3VOZA 4QY6A 2WGWA 3MKFA 1E4DA 5F1GA 5A91A 4PM6A 2WZXA 2HDQA 1PYYA 3ZFZA 5HAIA 4KG5A 1ONHA 3ZHHA 1K25A 4CJNA 5FQIA 1MXOA 1KGEA 1K55A 3UY6A 2WGVA 2HP5A 4OH0A 5EECA 5FI2A 1YM1A 2WKIA 5HAPA 2EX8A 1SKFA 2OLVA 4WEKA 3C7VA 3OCLA 2DRWA 4WYYA 2ZM0A 5CGWA 1CEGA 3CZDA 3IXHA 1RGYA 1XA7A 2Y2NA 2XEPA 4UA6A 4P85A 2P9VB 5FAOA 4QY5A 3FYZA 3Q7ZA 1SCWA 5FQ9A 2EX6A 1DJAA 1K57C 2WK0A 4C3QA 4S2OA 5GHXA 1KVMA 3LY3A 4HBUA 1O7EA 4MEZA 1FR6A 1K56D 1KE3A 4S2KA 1PI5A 1PIOA 5F83A 3VMAA 1M40A 3N8LA 4JKTA 5KSCA 1JWZA 3JYIA 3HLDA 2WUQA 3G31A 3IXGA 4MNRA 3WRZA 4DXCA 5KSHA 3PBNA 5FQQA 1RCJA 3LEZA 4DRTA 3PBOA 5F1FA 2A49A 5FI7A 5CEBA 1YLTA 1Z6FA 1YLYA 3C4PA 5DTSA 1XP4A 2R9XA 3MZDA 3A3FA 1IYQA 2WKEA 3P09A 4KZ6A 4X68A 5FASA 3IF6B 5EOOA 2EX9A 4DE2A 1W8YA 1C3BA 1XGJA 2J8YA 2ZC4B 3DW0A 4BL2A 3OPRA 2Y59A 4IBRA 4NETA 4YFMA 4ZBEA 1KDWA 4LENA 3PBQA 4QHCA 4P6BA 1RP5A 1PI4A 5TGFA 1PWGA 1YLJA 1XX2A 5CERA 2Y2IA 3UDXA 3ZG9B 1GA9A 3TOIA 1GA0A 2ZC5B 4LCLA 3UDFA 1M6KA 1L0GA 1FCNA 3FKVA 3W4PA 5CECA 3G2ZA 2JBFA 4F94A 4C75A 4OVDA 1LL9A 2H0TA 4QD4A 1DJCA 2XR0A 4KZ5A 1HVBA 4U3TA 1CI9A 1CI8A 2XFTA 3PBTA 4R4SA 1H5XA 3RJUA 3ZG5A 1DY6A 1ESIA 1YMSA 5FATA 3Q1FA 4M3KA 3QNBA 5E2HA 5FI6A 3VP0A 4ZAMA 5FQKA 3C4OA 5GLCA 3W4OA 5M19A 4O7DA 5AQAA 1XPBA 1MY8A 3Q81A 5HAQA 1S0WA 1G6AA 4FD8A 4OQGA 1NZUA 5IHVA 2J7VA 2JC7A 2ZM8A 4EWFA 3VFFA 1VM1A 5A90A 4E6XA 1SHVA 4QU3A 3W4QA 3BECA 4Y0TA 3CG5A 4X56A 3V50A 3N6IA 1NXYA 4PM9A 4PMAA 4OPRA 3WRTA 2X71A 1EWZA 3Q82A 4PPRA 2WYXA 1IKIA 1WYCA 4BD0A 3CJMA 1W8QA 1O07A 1PZPA 1Q2PA 3BLMA 3BFCA 4X69A 3UE3A 2VGJA 5CHJA 1BLCA 1BSGA 1LI0A 3SOIA 1BULA 2OLUA 1HTZA 3G34A 2ZD8A 3ITAA 3IWOA 3MXSA 3BFGA 5A92A 3I7JA 4LV3A 2WAFA 4OOMA 4OP8A 5E2FA 3UN7A 1KE0A 5M1AA 1MWTA 3EQUA 1XGIA 3GVBA 5EVIB 3ZNYA 1BTLA 5HX9A 3ISGA 3HUNA 5FQMA 5GHZA 3ITBA 1Q2QA 4Z9QA 3NI9A 3EQVA 2HP9A 2WZZA 4XXRA 1JVJA 5EE8A 3VOYA 2Y2HA 3OPPA 4DE0A 1NZOA 3HLCA 3C7UA 3P98A 1I2WA 2VGKA 2XH9A 4IBXA 4PM7A 4DDYA 2QMIA 3Q07A 2B5RA 1FCMA 1LLBA 4E3JA 3FZCA 3UPOA 1L0EA 5TFQA 2G2UA 3V3SA 4DE1A 3NY4A 1FSWA 1BLPA 1G68A 1LL5A 1PWCA 1FSYA 2J9PA 5D3OA 3VFHA 4WZ5C 1AXBA 4Y0OA 1K54C 4K0XA 1ZKJA 2IWCA 2WAEA 4RX3A 1OMEA 5EPHA 5HARA 5GHYA 5AQBA 4ZJ2A 2XD5A 5KZHA 1L0DA 4UA7A 2PBYA 1K4FA 3W8KA 1IYSA 2JCHA 2XQZA 4X55A 2Y2PA 2Z2LB 5GLAA 3E2KA 5CHMA 3WWXA 1IELA 3SH9A 1ES4A 4XUZA 3ZGAB 5J8XA 2FFYA 4KZ9A 4OOLA 5FQJA 3MXRA 3Q7VB 4EV4A 4E6WA 3PBSA 2WGWB 4N92A 3NCKA 5FAPA 4WELA 4JF4A 1KVLA 4JXSA 3A3EA 3WS5A 4N9LA 3RXWA 3N7WA 1EROA 1W79A 2H5SA 1LHYA 1PZOA 4OP5A 5E43A 1MWUA 1YLPA 3OC2A 1W7FA 4HBTA 2ZQ8A 4R3JA 5I94A 5A93A 1BUEA 4KENB 1NY0A 4WZ5A 2C6WB 1K54A 4S2MA 5JYPA 4QJGA 1GCEA 4IEDA 1XA1A 1YLZA 2Y4AA 3DTMA 4GOGA 4MBFA 2Y91A 4B4XA 1K57A 1ERMA 2OSUA 1K4EA 3ZG8B 3VP3A 4EUZA 3ZVWA 1IKGA 4BL3A 3BM6A 2ZQAA 2R9WA 4FCFA 4WMCA 1ONGA 3NC8A 2X02A 4FH4A 4LV1A 4R1GA 4P0MA 3IT9A 5CGXA 3OCNA 3OPLA 3GTCA 3GQZA 4R3BA 3UNWA 5U47A 5FDHA 4JPMA 2WKHA 1E25A 3IXDA 4UA9A 3ZVTA 2ZC6B 4CPKA 2Y2KA 2C5WB 3O86A 5CXWA 4OPZA 4ID4A
chains in the Genus database with same CATH superfamily
1KGGA 1L2SA 5DF9A 4Q0IA 3VP1A 5HD3A 4XUXA 3AGDA 3C5AA 2ZJ9A 4OQ0A 2V0WA 3D4FA 3PAEA 5L07A 4GS9A 4KUKA 5L10A 3UPPA 4Y15A 4N1XA 3LR5A 2XSSA 4S2IA 3A3JA 3S22A 2Y2QA 4ZTKA 1QMEA 1BZAA 2Y2MA 4HESA 1ES2A 3QHYA 4ZJ3A 5DF8A 5GL9A 3SS3A 3DTIA 4H6JA 3ZDJA 3VE3A 4I38A 2ACGA 2M7UA 1VHMA 1YT4A 3LY4A 2Z2MB 4GD8A 3JVUA 3K3CA 3FWLA 5FDSA 3N8SA 4PM8A 2GZAA 2W3GA 3ZCZA 4JLFA 1L0FA 1N4OA 3GSGA 4R6LA 3JVVA 3CI6A 3TW8A 4NKPA 2CC1A 3IF6A 3LCEA 3VOLA 1ZC2A 2LB9A 3RFBA 5CTMA 2XFSA 3FPVA 1EI5A 1D1JA 1ERQA 2Y8HA 3MSHA 3BY9A 5DTKA 5DJTA 4B93A 2V2FF 5E2GA 1ALQA 3KX0X 4S2NC 3VV4A 1F2KA 3B42A 5E2EA 2EX2A 1CEFA 3UE1A 3G30A 1IFQA 3CUEA 2JE5A 1JWPA 3NULA 1H8YA 1P9WA 2IWDA 3FKWA 1OJ5A 2OOLA 4GLQA 4EBNA 3DWKA 1XFNA 4QB8A 2ZL1A 1PRQA 1T18A 3AGFA 4HNBA 1I5QA 4UAAA 5HDCA 1OPXA 1S1ZA 3NHQA 4JXVA 4KUOA 2ZQCA 3IHAA 1S6RA 1CF0A 3IH8A 3S1YA 3L9KA 4X53A 1HD8A 2OWHA 3EEAA 2HP6A 2EXBA 1DRMA 4JGQA 5F69A 2PYRA 4I5SA 1CQAA 1TVFA 5EVLA 1N9OA 2XA7S 3WS1A 3MFDA 1MWSA 4H8RA 3ZG0A 5MC7A 3HVFA 1MPLA 3DTEA 3BJNA 3EGXC 1TD5A 3HJIA 2D01A 4NG2A 5G4ZA 4PHTA 4OPQA 1FOFA 3N8RA 3HLWA 5EVID 5GLDA 4KZ3A 2BLSA 1MWRA 1BLSA 2HV1A 2WKRA 3N4IA 2ZLYA 2GDNA 4RX2A 5AQ9A 3G35A 4Y5FA 3QP1A 1D06A 1OTEA 3VOZA 1E4DA 4PM6A 2KOIA 5HAIA 1K25A 3T4OA 1K55A 2K31A 1TF1A 2WGVA 5EECA 1ZTUA 2EX8A 1XFQA 4WYYA 3DAVA 5HL6A 4QPRA 3U2AA 3UB8A 4D60A 2WK0A 3LY3A 4HBUA 4MEZA 1KE3A 4GHIB 3FG8A 4PKYG 3JYIA 2ZOIA 4EW7A 1RCJA 3PBOA 1YLTA 3UE6A 2R9XA 2UV0E 2MJ6A 2WKEA 3EOIA 4KZ6A 4X68A 3UMEA 2E8JA 5EOOA 4DE2A 5FL3A 1W8YA 4MDZA 1XGJA 4Z1WA 2ZC4B 2M7VA 4YFMA 3TRCA 4QHCA 2JKGA 3UDXA 3T4KA 3TOIA 3HJKA 1FCNA 1DP9A 4C75A 4LPZA 4QD4A 2XR0A 4F3LA 2XFTA 3PBTA 4R4SA 5IS1A 2KLIA 1DY6A 1ESIA 3QNBA 3VP0A 1Y28A 4ZAMA 5GLCA 3C4OA 3W4OA 5AQAA 1GSXA 1MY8A 2V1BA 3Q81A 1T1AA 3BY8A 2J7VA 4EWFA 4QU3A 1Z09A 3CG5A 1NXYA 4PM9A 3WRTA 2G7UA 3MQ0A 1IKIA 2EWVA 1PZPA 3BFCA 3UE3A 5CHJA 1BLCA 3G34A 3IWOA 4R38A 3I7JA 2GNXA 5M1AA 3PHYA 3SW1A 4HH2A 2HP9A 1OT9A 3OPPA 4DE0A 2XH9A 3KSIA 4DDYA 3CPTA 3MJQA 2J80A 3FZCA 3W2ZA 3PXPA 3UPOA 4JGPA 2G2UA 2O99A 1NLZA 1LL5A 1PWCA 5D3OA 4EESA 2WAEA 5EPHA 5DJUA 1S4SA 3KYZA 1IYSA 1J3WA 2PHYA 3WWXA 3A0SA 2W27A 3IX4A 2FFYA 5FQJA 2P04A 2VEAA 1S66L 1N9LA 1N9NA 3F1NB 5FAPA 4MN5A 4WELA 2EWWA 4JXSA 3WS5A 3N7WA 1EROA 4EEUA 1PZOA 1YLPA 3OC2A 1W7FA 4IJGA 5A93A 4WZ5A 5JYPA 4S2MA 1GCEA 3F1OB 1XA1A 1K4EA 4HHDA 4QWOA 4CLCB 1BYWA 2ZQAA 2R9WA 3OLOA 1ONGA 3NC8A 4X25A 2X02A 2KX6A 2W1TB 3GTCA 4O8GA 3CWFA 1PFLA 5U47A 5FDHA 4JPMA 2WKHA 3IXDA 4CPKA 3O86A 5CXWA 1MKMA 2I72A 2ZC3B 5DTTA 3DBAA 3CMZA 4JXGA 1U60A 2JHEA 4GB7A 1AWIA 1LT0A 5F6AA 1E3UA 3WS4A 3BWLA 4ESPA 3O3VA 4FUWA 4YNRA 1T1BA 3GRJA 4WBGA 3SS4A 4DF6A 3A3IA 2O9CA 1X0OA 4DJ2A 2L0WA 4OKPA 5JYOA 1FR1A 5BOHA 4MBHA 1I2SA 3R7WA 3VP2A 3O88A 3MZFA 1F5MA 3VP4A 4HY8A 4Y17A 3UO9A 3V39A 1W63Q 2A3UA 2P08A 5F82A 2ZQDA 4BENA 4X1MA 3HL9A 2L4RA 4KQDA 4CLCC 3DWZA 4OLDA 4IVKA 2VJWA 3T1XA 3NJAA 2Y2LA 3MQQA 3NIAA 4KZ8A 4DDSA 4L9EA 3SH7A 4OONA 4WEJA 2YKFA 2ZM2A 4BD1A 5J7EA 3MFXA 1JTGA 1XJ2A 3TE8A 4KQOA 5HDDA 2DNSA 1MBLA 3P01A 1S67L 4YINA 3OOVA 2VGLS 4O0PA 1XKZA 4OLGA 3WS2A 4YWZA 3FV7A 1H8ZA 5EVIC 3AGEA 3F1PB 2X01A 3IS2B 1YSQA 5HWTA 2PU2A 2V20A 2V0UA 3IHBA 4MBKA 4JBFA 4KZ4A 3IXBA 3UPNA 1ZG6A 4JXWA 1W5DA 4ME4A 3BFFA 4A5RA 2OWJA 2HPBA 4EQIA 5FA7A 4E3NA 4S2NA 4NXFA 3HUMA 1UWNX 2PYPA 2FZ0A 2ZMAA 3T4LA 1MZUA 1YKDA 3GMWA 3BYDA 3E2LA 4KG6A 3G4PA 4ZDXA 4BBTA 1SKOA 4OOYA 3E0YA 4E3IA 4BWIA 2WKQA 2XD1A 4OQHA 2B18A 3IF5A 3GECA 4NXBA 3SH8A 3E4OA 2PU4A 3CAXA 1ZHHB 1SDNA 2ZQ9A 3RXXA 3G32A 2J3TC 4BLMA 4GS9B 3HLEA 3BEBA 1V9YA 3G6OA 3KYEA 3U4LP 1K56A 4NK3A 5DVAA 2NUPC 1SZVA 3MKFA 5FQIA 2OAQ1 1KGEA 3E4QA 3UY6A 2HP5A 4OH0A 3KSGA 2JKFA 5HAPA 1CEGA 3V67A 1RGYA 1XA7A 2OAP1 3FYZA 1YAXA 1SCWA 5K5BA 3A0VA 1K57C 1VEUB 2ZBBA 1HLUP 2JKRM 1PI5A 1PIOA 3VMAA 1M40A 2VKSA 3LGOA 3IXGA 5DKKA 5IU1A 3WRZA 5FQQA 4G3WA 4XT2A 2M1CA 5F1FA 5FI7A 3C4PA 1XP4A 1P9RA 5CX7A 3A3FA 3P09A 3T4SA 3H82A 3IF6B 5TBMA 2V9AA 1LSVA 1C3BA 2J8YA 4HH3A 4BL2A 4IBRA 4NETA 1KDWA 1VETA 5HSQA 4CLCD 3KYQA 4HJ6A 1M6KA 2XROA 5CECA 3G2ZA 2R78A 5J4EA 4KZ5A 1HVBA 4U3TA 1CI9A 1YSPA 1H5XA 3ZG5A 1S1YA 3TJZC 4LRZE 5E2HA 3MF0A 5FQKA 2QJ7A 2H28A 5HAQA 1G6AA 2B95A 2JC7A 2ZM8A 3VFFA 1SHVA 4CQHA 3W4QA 4Y0TA 2ZL1B 4X56A 3V50A 4OPRA 2X71A 1S4RA 2CMNA 2HGVA 4BD0A 3BLMA 1Q2PA 2O9BA 4DMZA 2PD7A 1JNUA 3SOIA 3QP5A 2OLUA 5L09A 3B33A 4OP8A 5E2FA 1XGIA 3ZNYA 1Q2QA 2D02A 4Z9QA 3FC7A 4XXRA 3VOYA 3HLCA 5F5YA 3C7UA 4PM7A 2J3WA 1L0EA 3V3SA 3JPUA 3LICA 1FSWA 1BLPA 3UB5P 1AXBA 1ZKJA 3UB7A 5HARA 5KZHA 2XD5A 3W8KA 2Z2LB 3E2KA 1ES4A 4EXOA 3LIBA 4KZ9A 4L9GA 1TS7A 3NCKA 5AJGA 4JF4A 4FOFA 3FPWA 4WF0A 3RXWA 1W79A 2H5SA 3UB6A 4OP5A 2VV8A 3C30A 3ZYTA 2INWA 3S7OA 2C6WB 2HJ9C 3LR0A 4IEDA 2PAVP 2J3TD 2Y4AA 4MBFA 4B4XA 4GW9A 4EUZA 4WUJA 1IKGA 3ZVWA 3BM6A 3RH8B 5HWWA 4LV1A 4ARZA 4R1GA 4P0MA 5CGXA 3OCNA 4R3BA 5HPFA 4ZRRA 2AVXA 3PR6A 4OPZA 3KO6A 4EQ1A 2B02A 2VK3A 1Y54A 4E3KA 4U0XA 4R23A 3D72A 4YOFA 5FEGA 3IWIA 3GR2A 2GJ3A 5HWVA 2QHKA 2IWBA 4WMCD 4ETZA 3CHWP 2WADA 3BFDA 2K2NA 2KDKA 5L2FA 3MS6A 4F3LB 1XJ6A 4U0TA 3BFEA 2EXAA 4PKYA 2E8IA 2HZ5A 2HDSA 2HDUA 1NYMA 3UE0A 4DXBA 4EUVA 2Q9MA 4EBPA 1K55C 1YQSA 4BQMA 2QZ6A 4LCMA 2Z6CA 4D2OA 5GLBA 4NEED 1LI9A 2BG1A 3K2NA 2JKRI 1YLWA 1YMXA 3S7PA 1XJ3A 2P9VA 4KG2A 3BRMA 2OV5A 5EOEA 3HLGA 1EW0A 2ZMVA 5HFOA 2Y2GA 4L9FA 4S2LA 3H9WA 2A24A 4E3MA 4MLLA 1NYYA 3C38A 1ZG4A 1QMFA 2W3HA 4Q8IA 2V8CA 3VSLA 1XXMA 3S4XA 4K0WA 3MKEA 4X6TA 1RGZA 1F9IA 1TEMA 1H3QA 4GKUA 2O0YA 3CPTB 2ZC7A 1G5UA 4CLCA 4EERA 3NBLA 4LV2A 3PTEA 4RVAA 3K3DA 3QP2A 2V1AA 2IA2A 1GSVA 3QNCA 2Y79A 5EUAA 4JF5A 4KQRA 4BMWA 4S2JA 1IYOA 1HZOA 3G2YA 3GDIA 1IEMA 1KE4A 1IYPA 4B9OA 1WYBA 3SZTA 4HEFA 5M18A 1K6SA 4CLCE 5EV0A 2XK1A 3BQ8A 3KSFA 3HUOA 1FCOA 1F98A 3IWQA 5KIZA 1KGFA 3BLSA 2GX5A 5HD5A 5HL1A 5EVIA 4N1HA 1PNEA 4GZBA 3H7WB 4KQQA 4OPYA 1WE4A 3A0RA 3HLFA 3QP6A 2BTFP 3PYPA 1NJ4A 2RCXA 3P7NA 2DMWA 3DTKA 1TS8A 2XF3A 1KDSA 1UWPX 5G18A 5CGSA 3LI8A 3HREA 4FSFA 3NDEA 3MZEA 4I3IA 1PWDA 4X55A 3OZHA 4CJNA 4KZBA 1GHMA 1GHIA 3O5YA 3Q7VA 4GJ4A 4GNUA 4QY6A 2WGWA 2WZXA 4BBUA 2HDQA 3ZFZA 3VE4A 4KG5A 3ZHHA 3R7WB 1NRJA 1YM1A 4MCWA 2OLVA 4HJ4A 1G28A 4WN5A 2ZM0A 5CGWA 4Y3IA 2PDRA 1T19A 2FH5A 2Y2NA 4P85A 5FAOA 3LYXA 2EX6A 3UB9A 4C3QA 4S2OA 5GHXA 1KVMA 1O7EA 5F83A 3N8LA 4JKTA 5KSCA 4MNRA 5KSHA 3PBNA 5CEBA 1Z6FA 1YLYA 1OTIA 3T1QB 1IYQA 5IT5A 2VX8A 3DW0A 3OPRA 2Y59A 4LENA 4AFIA 1D7EA 2HF6A 1PI4A 5TGFA 5CERA 3LR4A 1GA9A 2YKHA 2ZC5B 4EETB 4P6ZM 1L0GA 1V9ZA 3FKVA 3W4PA 3LEQA 4IUHA 4F94A 4OVDA 1LL9A 4X1LA 3C8CA 1DJCA 1VB6A 1CI8A 3RJUA 1YMSA 5FATA 4M3KA 3CITA 4O7DA 3IX3A 4HJ3A 5F68A 1S0WA 1NZUA 5IHVA 3QP4A 5A90A 1VM1A 1LSXA 1CJFA 1P97A 1KOUA 3BW6A 1H0MA 4PMAA 4PPRA 1NWZA 3CLOA 3CJMA 1W8QA 3IX8A 4Q0HA 2QKPA 3MXSA 2PR6A 1T1CA 3LIFA 5A92A 4LV3A 2WAFA 4OOMA 3UN7A 3D9YA 1KE0A 1MWTA 3GVBA 1BTLA 3C2WA 3ISGA 3HUNA 1OJGA 5FQMA 3ITBA 3NI9A 4HI4A 3EQVA 5EE8A 5EFWA 2Y2HA 5TJJA 1NZOA 3P98A 1I2WA 1SKOB 4IBXA 2JN7A 3B47A 1FCMA 4E3JA 1XJ4A 5J3WA 3D3OA 4MN6A 5TFQA 1VEUA 3MMHA 2HJEA 4DE1A 4UQIM 3NY4A 1G68A 2J9PA 4H6JB 1K54C 2IWCA 4RX3A 5GHYA 5AQBA 1L0DA 4UA7A 2PBYA 1DP8A 2JCHA 5GLAA 3ICYA 3SH9A 3MXQA 4HP4A 3NOTC 4N92A 1KVLA 1STZA 3A3EA 4UEYA 4WL9A 1LHYA 3KSHA 1TS0A 4NXEA 5L8MA 1OTDA 2ZQ8A 4R3JA 2K7SA 1NY0A 4KENB 5DKLA 4QJGA 5C5KA 3LIDA 3UMDA 1ERMA 2OSUA 3ZG8B 1OT6A 4BL3A 4FCFA 2PRFA 1TS6A 3GQZA 4XT2B 4K08A 4G3KA 1E25A 4HQAA 1ODVA 4O01A 3T1RA 3H82B 5TBMB 3NOPC 4ETXA 4II7A 4LLOB 3EWKA 1ESUA 1PW8A 3V3RA 1K6RA 1CK3A 3MR0A 5G4YA 1VETB 5FSRA 2QPNA 4OQIA 4RYEA 3EGDC 1TDLA 4DJ3A 3QP8A 3WS0A 3T50A 1PW1A 3V5MA 2XLNA 1A0KA 3PAGA 5LBRA 3T4QA 3ZNTA 4LRYC 4E3OA 4P6ZS 1OTAA 4Y7PA 2Q9NA 4Y0UA 3M2JA 1K38A 1FQGA 2EFUA 2Y2JA 2Z6DA 3OPHA 1WA9A 3IF6C 5AQ7A 2ZOHA 2WGIA 3TSGA 4IHQA 3UDIA 4GD6A 2HDRA 4EBLA 4DKIA 1E3UD 2VZWA 2G2WA 5AVEA 5HZHA 4L0LA 5TR7A 1GSWA 4LRXC 4FH2A 2A2LA 4GHIA 4KZ7A 4R3AA 2NUTC 2Y2OA 4FTXA 3HLBA 1K0KA 5KMWA 4DE3A 3TG9A 4KZAA 4BBVA 4WLAA 4K91A 2W1RA 3CUEC 4S2PA 3RTYA 5HPIA 1H8MA 2VA0A 4GDNA 4B4ZA 3A3DA 4E3LA 2P74A 3LO7A 2XRNA 2UWXA 1P0ZA 4R4RA 1N9BA 1BT5A 2RL3A 1DJBA 4NXGA 3M6HA 3NDGA 3T1SA 3LIEA 1JWVA 3BQAA 4UQIS 4HIAA 4B88A 3VSKA 3GV9A 2QJ5A 3NOUC 4I3AA 4GDBA 3LUQA 1JTDA 3T4TA 2J9OA 4C6YA 2ZQ7A 4ZJ1A 2XDMA 5CHUA 5HW3A 4WZ4A 3S7NA 4EU0A 2EFXA 3E4PA 5CEDA 1LL8A 2PD8A 4UHUA 3B3XA 4JF6A 3ZG7B 4Y13A 3IQAA 5EM1A 4RA7A 1ES3A 3M2KA 1Y4OA 4P87A 3MBZA 5FAQA 2Y55A 5DF7A 5AVFA 5DFYA 4ARZB 4LGWA 1UGUA 4WM9A 5CRFA 2XGNA 2H10A 1SDEA 4HOIA 1J9MA 4N9KA 2JKTM 3O87A 3SS5A 1GHPA 3HBRA 1L3LA 2I9VA 3IH9A 3LI9A 2H0YA 4E04A 1ES5A 3MQOA 4R0QA 1TDGA 5CTNA 1MKIA 2DCFA 3M6BA 1BLHA 3IBJA 4GN2A 2O9AA 2PBDP 3PBRA 2FFFB 2V1ZA 4LV0A 1NRFA 4IVIA 4PM5A 1VQQA 4BJPA 2BASA 4LFUA 4GCZA 5DFXA 5F1GA 3F1NA 5A91A 1PYYA 1ONHA 2P7JA 4MMNA 5HDSA 5A8BA 1MXOA 2VGLM 5FI2A 2WKIA 1SKFA 4WEKA 3C7VA 3OCLA 2DRWA 3CZDA 3IXHA 3F1OA 2XEPA 4UA6A 2P9VB 2L1MA 4QY5A 5FQ9A 3Q7ZA 1DJAA 3EEHA 2VV7A 1G6OA 1FR6A 3R4KA 1K56D 4S2KA 4HP9A 1JWZA 3HLDA 2WUQA 3G31A 4DXCA 2W1TA 3LEZA 4DRTA 4I3JA 2W3EA 2A49A 5I5LA 2A24B 5DTSA 4RQ9A 1W63M 3MZDA 5EVEA 3HCYA 5FASA 2EX9A 3L7HA 4EEPA 4PAUA 4ZBEA 3IBRA 3PBQA 4P6BA 1RP5A 4MN7A 1PWGA 1YLJA 1XX2A 3ZG9B 2Y2IA 2W3DA 1GA0A 4LCLA 1YPRA 2Q0OA 3UDFA 2JBFA 3H7WA 2H0TA 2PT7A 3Q1FA 5FI6A 5M19A 1XPBA 4IUKA 1FIKA 4FD8A 4OQGA 2PR5A 4E6XA 4Q0JA 3BECA 4M4XA 3ULFA 3N6IA 1EWZA 3Q82A 2WYXA 1WYCA 4JGOA 1O07A 4X69A 2VGJA 1BSGA 1LI0A 1BULA 3LIAA 1HTZA 2ZD8A 3ITAA 3ZQ5A 3BFGA 2VV6A 1FILA 3EQUA 3OBFA 5EVIB 3T12B 5HX9A 5GHZA 4I39A 3S7QA 2WZZA 4G3VA 1JVJA 1OTBA 2V8FA 2VGKA 2QMIA 3Q07A 2WKPA 1IOUA 2B5RA 1LLBA 3E98A 4DN0A 3NECA 1FSYA 3VFHA 4WZ5C 4Y0OA 2QYBA 4K0XA 1NLYA 2LB5A 1LSWA 1ACFA 1OMEA 4JGRA 4ZJ2A 5EM0A 1K4FA 2XQZA 2Y2PA 5CHMA 1IELA 4XUZA 3ZGAB 3F1PA 5J8XA 2ZMFA 3IS2A 4OOLA 3MXRA 3Q7VB 4EV4A 4E6WA 3PBSA 4Y2FA 2WGWB 2EA9A 2VLGA 2W3FA 4N9LA 3LFVA 5E43A 1MWUA 4HBTA 2QWSA 5I94A 4R70A 1MC0A 1BUEA 1K54A 3T4JA 1YLZA 3DTMA 3LR3A 4GOGA 2Y91A 1K57A 3VP3A 2XA7M 2JKTI 4WMCA 4FH4A 3IT9A 2W0NA 3OPLA 1DP6A 3UNWA 5FEFA 4UA9A 3ZVTA 2ZC6B 2Y2KA 2C5WB 4ID4A
chains in the Genus database with same CATH topology
2I72A 1KGGA 1L2SA 2ZC3B 5DTTA 1Y54A 5DF9A 1ESUA 1PW8A 4U0XA 3VP1A 4R23A 4E3KA 3V3RA 1K6RA 1CK3A 4XUXA 3IWIA 3CMZA 3AGDA 4JXGA 5FSRA 3GR2A 3C5AA 2ZJ9A 2QPNA 4OQIA 4OQ0A 4RYEA 1U60A 1TDLA 4GB7A 3D4FA 3PAEA 1E3UA 2IWBA 4WMCD 3WS4A 3WS0A 1PW1A 2WADA 3BFDA 3V5MA 2XLNA 3O3VA 5L2FA 3SS4A 3GRJA 4WBGA 3PAGA 3UPPA 3ZNTA 4N1XA 4E3OA 4U0TA 4DF6A 3A3IA 4S2IA 3BFEA 2EXAA 2E8IA 3A3JA 4Y7PA 2HDSA 2Q9NA 4Y0UA 3S22A 2Y2QA 2HDUA 3M2JA 4OKPA 5JYOA 1NYMA 1K38A 1FR1A 3UE0A 4DXBA 4ZTKA 5BOHA 1FQGA 2EFUA 2Q9MA 2Y2JA 4MBHA 1I2SA 1QMEA 4EBPA 1BZAA 1K55C 1YQSA 2Y2MA 1ES2A 2QZ6A 4HESA 4BQMA 3OPHA 4LCMA 3QHYA 4ZJ3A 3IF6C 5DF8A 5GL9A 3SS3A 5AQ7A 3VP2A 4D2OA 3O88A 2WGIA 3MZFA 3VP4A 5GLBA 3TSGA 3UO9A 1LI9A 2BG1A 3V39A 3UDIA 1YLWA 3ZDJA 2A3UA 4GD6A 1YMXA 2HDRA 4EBLA 2P9VA 4KG2A 1E3UD 3BRMA 4DKIA 2G2WA 2OV5A 5F82A 2ZQDA 4L0LA 4BENA 5TR7A 5EOEA 3HLGA 1YT4A 3HL9A 3LY4A 2Z2MB 4FH2A 3DWZA 4GD8A 4OLDA 4IVKA 4KZ7A 5HFOA 3FWLA 2Y2OA 2Y2GA 3N8SA 4PM8A 2Y2LA 3HLBA 4S2LA 3ZCZA 4JLFA 1L0FA 3NIAA 1N4OA 4E3MA 5KMWA 4MLLA 4KZ8A 4DDSA 3TG9A 4DE3A 4KZAA 3SH7A 1NYYA 3GSGA 4K91A 1ZG4A 1QMFA 4Q8IA 4S2PA 3VSLA 2CC1A 1XXMA 3IF6A 3S4XA 3LCEA 4K0WA 3MKEA 4OONA 4GDNA 4X6TA 4WEJA 1RGZA 1ZC2A 2ZM2A 4B4ZA 4BD1A 1TEMA 3A3DA 5CTMA 1JTGA 2P74A 2XFSA 4GKUA 4E3LA 4KQOA 3LO7A 2ZC7A 1EI5A 2DNSA 1ERQA 1MBLA 2UWXA 4R4RA 1N9BA 5DTKA 3NBLA 1BT5A 2RL3A 2V2FF 4YINA 5E2GA 4LV2A 1ALQA 1XKZA 1DJBA 4OLGA 3WS2A 3M6HA 3PTEA 4RVAA 3NDGA 4S2NC 1JWVA 3FV7A 1H8ZA 4B88A 3VSKA 3GV9A 5E2EA 2EX2A 1CEFA 3UE1A 3G30A 3QNCA 4GDBA 5EVIC 2JE5A 3AGEA 1JWPA 5EUAA 2X01A 4JF5A 1JTDA 4KQRA 1H8YA 2J9OA 2IWDA 2PU2A 2ZQ7A 3FKWA 4S2JA 4ZJ1A 4C6YA 2V20A 2XDMA 1IYOA 4EBNA 1HZOA 3DWKA 3G2YA 3IHBA 4JBFA 4MBKA 4WZ4A 5CHUA 1IEMA 4QB8A 5HW3A 4KZ4A 3IXBA 3UPNA 1KE4A 3AGFA 1IYPA 1I5QA 1WYBA 1ZG6A 4UAAA 2EFXA 5M18A 4HEFA 5CEDA 1K6SA 4JXWA 4JXVA 1W5DA 2XK1A 4UHUA 3BFFA 3HUOA 1FCOA 2ZQCA 3IHAA 4A5RA 3B3XA 2HPBA 1S6RA 3IWQA 4JF6A 4EQIA 3ZG7B 3IH8A 3S1YA 3IQAA 5FA7A 4RA7A 1ES3A 4E3NA 3M2KA 4S2NA 4X53A 1HD8A 1KGFA 4P87A 3BLSA 3MBZA 2HP6A 5FAQA 2Y55A 2EXBA 5DF7A 3HUMA 5HL1A 5EVIA 4N1HA 4GZBA 4KQQA 2ZMAA 4OPYA 1WE4A 3HLFA 3GMWA 3BYDA 4WM9A 5CRFA 1TVFA 2H10A 2XGNA 3E2LA 5EVLA 1NJ4A 4KG6A 2RCXA 3G4PA 4ZDXA 1SDEA 3WS1A 3MFDA 1J9MA 1MWSA 4H8RA 4N9KA 3ZG0A 4OOYA 3O87A 3HVFA 3SS5A 1MPLA 1GHPA 3HBRA 4E3IA 3IH9A 2XD1A 2XF3A 4OQHA 1KDSA 3IF5A 2H0YA 5G18A 5CGSA 3SH8A 1ES5A 4R0QA 2PU4A 1TDGA 5CTNA 1MKIA 4OPQA 2DCFA 3M6BA 1BLHA 1FOFA 3N8RA 4GN2A 1SDNA 3HLWA 2ZQ9A 3HREA 4FSFA 3G32A 3NDEA 5EVID 5GLDA 3RXXA 4BLMA 4KZ3A 2BLSA 3MZEA 3HLEA 1MWRA 1BLSA 1PWDA 3BEBA 3PBRA 3OZHA 2FFFB 2V1ZA 3N4IA 1GHMA 2GDNA 2ZLYA 1NRFA 4IVIA 4KZBA 4LV0A 1GHIA 4RX2A 1K56A 4NK3A 5AQ9A 4PM5A 1VQQA 4BJPA 3G35A 5DVAA 3Q7VA 4GNUA 3VOZA 4QY6A 2WGWA 3MKFA 1E4DA 5F1GA 5A91A 4PM6A 2WZXA 2HDQA 1PYYA 3ZFZA 5HAIA 4KG5A 1ONHA 3ZHHA 1K25A 4CJNA 5FQIA 1MXOA 1KGEA 1K55A 3UY6A 2WGVA 2HP5A 4OH0A 5EECA 5FI2A 1YM1A 2WKIA 5HAPA 2EX8A 1SKFA 2OLVA 4WEKA 3C7VA 3OCLA 2DRWA 4WYYA 2ZM0A 5CGWA 1CEGA 3CZDA 3IXHA 1RGYA 1XA7A 2Y2NA 2XEPA 4UA6A 4P85A 2P9VB 5FAOA 4QY5A 3FYZA 3Q7ZA 1SCWA 5FQ9A 2EX6A 1DJAA 1K57C 2WK0A 4C3QA 4S2OA 5GHXA 1KVMA 3LY3A 4HBUA 1O7EA 4MEZA 1FR6A 1K56D 1KE3A 4S2KA 1PI5A 1PIOA 5F83A 3VMAA 1M40A 3N8LA 4JKTA 5KSCA 1JWZA 3JYIA 3HLDA 2WUQA 3G31A 3IXGA 4MNRA 3WRZA 4DXCA 5KSHA 3PBNA 5FQQA 1RCJA 3LEZA 4DRTA 3PBOA 5F1FA 2A49A 5FI7A 5CEBA 1YLTA 1Z6FA 1YLYA 3C4PA 5DTSA 1XP4A 2R9XA 3MZDA 3A3FA 1IYQA 2WKEA 3P09A 4KZ6A 4X68A 5FASA 3IF6B 5EOOA 2EX9A 4DE2A 1W8YA 1C3BA 1XGJA 2J8YA 2ZC4B 3DW0A 4BL2A 3OPRA 2Y59A 4IBRA 4NETA 4YFMA 4ZBEA 1KDWA 4LENA 3PBQA 4QHCA 4P6BA 1RP5A 1PI4A 5TGFA 1PWGA 1YLJA 1XX2A 5CERA 2Y2IA 3UDXA 3ZG9B 1GA9A 3TOIA 1GA0A 2ZC5B 4LCLA 3UDFA 1M6KA 1L0GA 1FCNA 3FKVA 3W4PA 5CECA 3G2ZA 2JBFA 4F94A 4C75A 4OVDA 1LL9A 2H0TA 4QD4A 1DJCA 2XR0A 4KZ5A 1HVBA 4U3TA 1CI9A 1CI8A 2XFTA 3PBTA 4R4SA 1H5XA 3RJUA 3ZG5A 1DY6A 1ESIA 1YMSA 5FATA 3Q1FA 4M3KA 3QNBA 5E2HA 5FI6A 3VP0A 4ZAMA 5FQKA 3C4OA 5GLCA 3W4OA 5M19A 4O7DA 5AQAA 1XPBA 1MY8A 3Q81A 5HAQA 1S0WA 1G6AA 4FD8A 4OQGA 1NZUA 5IHVA 2J7VA 2JC7A 2ZM8A 4EWFA 3VFFA 1VM1A 5A90A 4E6XA 1SHVA 4QU3A 3W4QA 3BECA 4Y0TA 3CG5A 4X56A 3V50A 3N6IA 1NXYA 4PM9A 4PMAA 4OPRA 3WRTA 2X71A 1EWZA 3Q82A 4PPRA 2WYXA 1IKIA 1WYCA 4BD0A 3CJMA 1W8QA 1O07A 1PZPA 1Q2PA 3BLMA 3BFCA 4X69A 3UE3A 2VGJA 5CHJA 1BLCA 1BSGA 1LI0A 3SOIA 1BULA 2OLUA 1HTZA 3G34A 2ZD8A 3ITAA 3IWOA 3MXSA 3BFGA 5A92A 3I7JA 4LV3A 2WAFA 4OOMA 4OP8A 5E2FA 3UN7A 1KE0A 5M1AA 1MWTA 3EQUA 1XGIA 3GVBA 5EVIB 3ZNYA 1BTLA 5HX9A 3ISGA 3HUNA 5FQMA 5GHZA 3ITBA 1Q2QA 4Z9QA 3NI9A 3EQVA 2HP9A 2WZZA 4XXRA 1JVJA 5EE8A 3VOYA 2Y2HA 3OPPA 4DE0A 1NZOA 3HLCA 3C7UA 3P98A 1I2WA 2VGKA 2XH9A 4IBXA 4PM7A 4DDYA 2QMIA 3Q07A 2B5RA 1FCMA 1LLBA 4E3JA 3FZCA 3UPOA 1L0EA 5TFQA 2G2UA 3V3SA 4DE1A 3NY4A 1FSWA 1BLPA 1G68A 1LL5A 1PWCA 1FSYA 2J9PA 5D3OA 3VFHA 4WZ5C 1AXBA 4Y0OA 1K54C 4K0XA 1ZKJA 2IWCA 2WAEA 4RX3A 1OMEA 5EPHA 5HARA 5GHYA 5AQBA 4ZJ2A 2XD5A 5KZHA 1L0DA 4UA7A 2PBYA 1K4FA 3W8KA 1IYSA 2JCHA 2XQZA 4X55A 2Y2PA 2Z2LB 5GLAA 3E2KA 5CHMA 3WWXA 1IELA 3SH9A 1ES4A 4XUZA 3ZGAB 5J8XA 2FFYA 4KZ9A 4OOLA 5FQJA 3MXRA 3Q7VB 4EV4A 4E6WA 3PBSA 2WGWB 4N92A 3NCKA 5FAPA 4WELA 4JF4A 1KVLA 4JXSA 3A3EA 3WS5A 4N9LA 3RXWA 3N7WA 1EROA 1W79A 2H5SA 1LHYA 1PZOA 4OP5A 5E43A 1MWUA 1YLPA 3OC2A 1W7FA 4HBTA 2ZQ8A 4R3JA 5I94A 5A93A 1BUEA 4KENB 1NY0A 4WZ5A 2C6WB 1K54A 4S2MA 5JYPA 4QJGA 1GCEA 4IEDA 1XA1A 1YLZA 2Y4AA 3DTMA 4GOGA 4MBFA 2Y91A 4B4XA 1K57A 1ERMA 2OSUA 1K4EA 3ZG8B 3VP3A 4EUZA 3ZVWA 1IKGA 4BL3A 3BM6A 2ZQAA 2R9WA 4FCFA 4WMCA 1ONGA 3NC8A 2X02A 4FH4A 4LV1A 4R1GA 4P0MA 3IT9A 5CGXA 3OCNA 3OPLA 3GTCA 3GQZA 4R3BA 3UNWA 5U47A 5FDHA 4JPMA 2WKHA 1E25A 3IXDA 4UA9A 3ZVTA 2ZC6B 4CPKA 2Y2KA 2C5WB 3O86A 5CXWA 4OPZA 4ID4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I72 A;  1KGG A;  1L2S A;  2ZC3 B;  5DTT A;  1Y54 A;  5DF9 A;  1ESU A;  1PW8 A;  4U0X A;  3VP1 A;  4R23 A;  4E3K A;  3V3R A;  1K6R A;  1CK3 A;  4XUX A;  3IWI A;  3CMZ A;  3AGD A;  4JXG A;  5FSR A;  3GR2 A;  3C5A A;  2ZJ9 A;  2QPN A;  4OQI A;  4OQ0 A;  4RYE A;  1U60 A;  1TDL A;  4GB7 A;  3D4F A;  3PAE A;  1E3U A;  2IWB A;  4WMC D;  3WS4 A;  3WS0 A;  1PW1 A;  2WAD A;  3BFD A;  3V5M A;  2XLN A;  3O3V A;  5L2F A;  3SS4 A;  3GRJ A;  4WBG A;  3PAG A;  3UPP A;  3ZNT A;  4N1X A;  4E3O A;  4U0T A;  4DF6 A;  3A3I A;  4S2I A;  3BFE A;  2EXA A;  2E8I A;  3A3J A;  4Y7P A;  2HDS A;  2Q9N A;  4Y0U A;  3S22 A;  2Y2Q A;  2HDU A;  3M2J A;  4OKP A;  5JYO A;  1NYM A;  1K38 A;  1FR1 A;  3UE0 A;  4DXB A;  4ZTK A;  5BOH A;  1FQG A;  2EFU A;  2Q9M A;  2Y2J A;  4MBH A;  1I2S A;  1QME A;  4EBP A;  1BZA A;  1K55 C;  1YQS A;  2Y2M A;  1ES2 A;  2QZ6 A;  4HES A;  4BQM A;  3OPH A;  4LCM A;  3QHY A;  4ZJ3 A;  3IF6 C;  5DF8 A;  5GL9 A;  3SS3 A;  5AQ7 A;  3VP2 A;  4D2O A;  3O88 A;  2WGI A;  3MZF A;  3VP4 A;  5GLB A;  3TSG A;  3UO9 A;  1LI9 A;  2BG1 A;  3V39 A;  3UDI A;  1YLW A;  3ZDJ A;  2A3U A;  4GD6 A;  1YMX A;  2HDR A;  4EBL A;  2P9V A;  4KG2 A;  1E3U D;  3BRM A;  4DKI A;  2G2W A;  2OV5 A;  5F82 A;  2ZQD A;  4L0L A;  4BEN A;  5TR7 A;  5EOE A;  3HLG A;  1YT4 A;  3HL9 A;  3LY4 A;  2Z2M B;  4FH2 A;  3DWZ A;  4GD8 A;  4OLD A;  4IVK A;  4KZ7 A;  5HFO A;  3FWL A;  2Y2O A;  2Y2G A;  3N8S A;  4PM8 A;  2Y2L A;  3HLB A;  4S2L A;  3ZCZ A;  4JLF A;  1L0F A;  3NIA A;  1N4O A;  4E3M A;  5KMW A;  4MLL A;  4KZ8 A;  4DDS A;  3TG9 A;  4DE3 A;  4KZA A;  3SH7 A;  1NYY A;  3GSG A;  4K91 A;  1ZG4 A;  1QMF A;  4Q8I A;  4S2P A;  3VSL A;  2CC1 A;  1XXM A;  3IF6 A;  3S4X A;  3LCE A;  4K0W A;  3MKE A;  4OON A;  4GDN A;  4X6T A;  4WEJ A;  1RGZ A;  1ZC2 A;  2ZM2 A;  4B4Z A;  4BD1 A;  1TEM A;  3A3D A;  5CTM A;  1JTG A;  2P74 A;  2XFS A;  4GKU A;  4E3L A;  4KQO A;  3LO7 A;  2ZC7 A;  1EI5 A;  2DNS A;  1ERQ A;  1MBL A;  2UWX A;  4R4R A;  1N9B A;  5DTK A;  3NBL A;  1BT5 A;  2RL3 A;  2V2F F;  4YIN A;  5E2G A;  4LV2 A;  1ALQ A;  1XKZ A;  1DJB A;  4OLG A;  3WS2 A;  3M6H A;  3PTE A;  4RVA A;  3NDG A;  4S2N C;  1JWV A;  3FV7 A;  1H8Z A;  4B88 A;  3VSK A;  3GV9 A;  5E2E A;  2EX2 A;  1CEF A;  3UE1 A;  3G30 A;  3QNC A;  4GDB A;  5EVI C;  2JE5 A;  3AGE A;  1JWP A;  5EUA A;  2X01 A;  4JF5 A;  1JTD A;  4KQR A;  1H8Y A;  2J9O A;  2IWD A;  2PU2 A;  2ZQ7 A;  3FKW A;  4S2J A;  4ZJ1 A;  4C6Y A;  2V20 A;  2XDM A;  1IYO A;  4EBN A;  1HZO A;  3DWK A;  3G2Y A;  3IHB A;  4JBF A;  4MBK A;  4WZ4 A;  5CHU A;  1IEM A;  4QB8 A;  5HW3 A;  4KZ4 A;  3IXB A;  3UPN A;  1KE4 A;  3AGF A;  1IYP A;  1I5Q A;  1WYB A;  1ZG6 A;  4UAA A;  2EFX A;  5M18 A;  4HEF A;  5CED A;  1K6S A;  4JXW A;  4JXV A;  1W5D A;  2XK1 A;  4UHU A;  3BFF A;  3HUO A;  1FCO A;  2ZQC A;  3IHA A;  4A5R A;  3B3X A;  2HPB A;  1S6R A;  3IWQ A;  4JF6 A;  4EQI A;  3ZG7 B;  3IH8 A;  3S1Y A;  3IQA A;  5FA7 A;  4RA7 A;  1ES3 A;  4E3N A;  3M2K A;  4S2N A;  4X53 A;  1HD8 A;  1KGF A;  4P87 A;  3BLS A;  3MBZ A;  2HP6 A;  5FAQ A;  2Y55 A;  2EXB A;  5DF7 A;  3HUM A;  5HL1 A;  5EVI A;  4N1H A;  4GZB A;  4KQQ A;  2ZMA A;  4OPY A;  1WE4 A;  3HLF A;  3GMW A;  3BYD A;  4WM9 A;  5CRF A;  1TVF A;  2H10 A;  2XGN A;  3E2L A;  5EVL A;  1NJ4 A;  4KG6 A;  2RCX A;  3G4P A;  4ZDX A;  1SDE A;  3WS1 A;  3MFD A;  1J9M A;  1MWS A;  4H8R A;  4N9K A;  3ZG0 A;  4OOY A;  3O87 A;  3HVF A;  3SS5 A;  1MPL A;  1GHP A;  3HBR A;  4E3I A;  3IH9 A;  2XD1 A;  2XF3 A;  4OQH A;  1KDS A;  3IF5 A;  2H0Y A;  5G18 A;  5CGS A;  3SH8 A;  1ES5 A;  4R0Q A;  2PU4 A;  1TDG A;  5CTN A;  1MKI A;  4OPQ A;  2DCF A;  3M6B A;  1BLH A;  1FOF A;  3N8R A;  4GN2 A;  1SDN A;  3HLW A;  2ZQ9 A;  3HRE A;  4FSF A;  3G32 A;  3NDE A;  5EVI D;  5GLD A;  3RXX A;  4BLM A;  4KZ3 A;  2BLS A;  3MZE A;  3HLE A;  1MWR A;  1BLS A;  1PWD A;  3BEB A;  3PBR A;  3OZH A;  2FFF B;  2V1Z A;  3N4I A;  1GHM A;  2GDN A;  2ZLY A;  1NRF A;  4IVI A;  4KZB A;  4LV0 A;  1GHI A;  4RX2 A;  1K56 A;  4NK3 A;  5AQ9 A;  4PM5 A;  1VQQ A;  4BJP A;  3G35 A;  5DVA A;  3Q7V A;  4GNU A;  3VOZ A;  4QY6 A;  2WGW A;  3MKF A;  1E4D A;  5F1G A;  5A91 A;  4PM6 A;  2WZX A;  2HDQ A;  1PYY A;  3ZFZ A;  5HAI A;  4KG5 A;  1ONH A;  3ZHH A;  1K25 A;  4CJN A;  5FQI A;  1MXO A;  1KGE A;  1K55 A;  3UY6 A;  2WGV A;  2HP5 A;  4OH0 A;  5EEC A;  5FI2 A;  1YM1 A;  2WKI A;  5HAP A;  2EX8 A;  1SKF A;  2OLV A;  4WEK A;  3C7V A;  3OCL A;  2DRW A;  4WYY A;  2ZM0 A;  5CGW A;  1CEG A;  3CZD A;  3IXH A;  1RGY A;  1XA7 A;  2Y2N A;  2XEP A;  4UA6 A;  4P85 A;  2P9V B;  5FAO A;  4QY5 A;  3FYZ A;  3Q7Z A;  1SCW A;  5FQ9 A;  2EX6 A;  1DJA A;  1K57 C;  2WK0 A;  4C3Q A;  4S2O A;  5GHX A;  1KVM A;  3LY3 A;  4HBU A;  1O7E A;  4MEZ A;  1FR6 A;  1K56 D;  1KE3 A;  4S2K A;  1PI5 A;  1PIO A;  5F83 A;  3VMA A;  1M40 A;  3N8L A;  4JKT A;  5KSC A;  1JWZ A;  3JYI A;  3HLD A;  2WUQ A;  3G31 A;  3IXG A;  4MNR A;  3WRZ A;  4DXC A;  5KSH A;  3PBN A;  5FQQ A;  1RCJ A;  3LEZ A;  4DRT A;  3PBO A;  5F1F A;  2A49 A;  5FI7 A;  5CEB A;  1YLT A;  1Z6F A;  1YLY A;  3C4P A;  5DTS A;  1XP4 A;  2R9X A;  3MZD A;  3A3F A;  1IYQ A;  2WKE A;  3P09 A;  4KZ6 A;  4X68 A;  5FAS A;  3IF6 B;  5EOO A;  2EX9 A;  4DE2 A;  1W8Y A;  1C3B A;  1XGJ A;  2J8Y A;  2ZC4 B;  3DW0 A;  4BL2 A;  3OPR A;  2Y59 A;  4IBR A;  4NET A;  4YFM A;  4ZBE A;  1KDW A;  4LEN A;  3PBQ A;  4QHC A;  4P6B A;  1RP5 A;  1PI4 A;  5TGF A;  1PWG A;  1YLJ A;  1XX2 A;  5CER A;  2Y2I A;  3UDX A;  3ZG9 B;  1GA9 A;  3TOI A;  1GA0 A;  2ZC5 B;  4LCL A;  3UDF A;  1M6K A;  1L0G A;  1FCN A;  3FKV A;  3W4P A;  5CEC A;  3G2Z A;  2JBF A;  4F94 A;  4C75 A;  4OVD A;  1LL9 A;  2H0T A;  4QD4 A;  1DJC A;  2XR0 A;  4KZ5 A;  1HVB A;  4U3T A;  1CI9 A;  1CI8 A;  2XFT A;  3PBT A;  4R4S A;  1H5X A;  3RJU A;  3ZG5 A;  1DY6 A;  1ESI A;  1YMS A;  5FAT A;  3Q1F A;  4M3K A;  3QNB A;  5E2H A;  5FI6 A;  3VP0 A;  4ZAM A;  5FQK A;  3C4O A;  5GLC A;  3W4O A;  5M19 A;  4O7D A;  5AQA A;  1XPB A;  1MY8 A;  3Q81 A;  5HAQ A;  1S0W A;  1G6A A;  4FD8 A;  4OQG A;  1NZU A;  5IHV A;  2J7V A;  2JC7 A;  2ZM8 A;  4EWF A;  3VFF A;  1VM1 A;  5A90 A;  4E6X A;  1SHV A;  4QU3 A;  3W4Q A;  3BEC A;  4Y0T A;  3CG5 A;  4X56 A;  3V50 A;  3N6I A;  1NXY A;  4PM9 A;  4PMA A;  4OPR A;  3WRT A;  2X71 A;  1EWZ A;  3Q82 A;  4PPR A;  2WYX A;  1IKI A;  1WYC A;  4BD0 A;  3CJM A;  1W8Q A;  1O07 A;  1PZP A;  1Q2P A;  3BLM A;  3BFC A;  4X69 A;  3UE3 A;  2VGJ A;  5CHJ A;  1BLC A;  1BSG A;  1LI0 A;  3SOI A;  1BUL A;  2OLU A;  1HTZ A;  3G34 A;  2ZD8 A;  3ITA A;  3IWO A;  3MXS A;  3BFG A;  5A92 A;  3I7J A;  4LV3 A;  2WAF A;  4OOM A;  4OP8 A;  5E2F A;  3UN7 A;  1KE0 A;  5M1A A;  1MWT A;  3EQU A;  1XGI A;  3GVB A;  5EVI B;  3ZNY A;  1BTL A;  5HX9 A;  3ISG A;  3HUN A;  5FQM A;  5GHZ A;  3ITB A;  1Q2Q A;  4Z9Q A;  3NI9 A;  3EQV A;  2HP9 A;  2WZZ A;  4XXR A;  1JVJ A;  5EE8 A;  3VOY A;  2Y2H A;  3OPP A;  4DE0 A;  1NZO A;  3HLC A;  3C7U A;  3P98 A;  1I2W A;  2VGK A;  2XH9 A;  4IBX A;  4PM7 A;  4DDY A;  2QMI A;  3Q07 A;  2B5R A;  1FCM A;  1LLB A;  4E3J A;  3FZC A;  3UPO A;  1L0E A;  5TFQ A;  2G2U A;  3V3S A;  4DE1 A;  3NY4 A;  1FSW A;  1BLP A;  1G68 A;  1LL5 A;  1PWC A;  1FSY A;  2J9P A;  5D3O A;  3VFH A;  4WZ5 C;  1AXB A;  4Y0O A;  1K54 C;  4K0X A;  1ZKJ A;  2IWC A;  2WAE A;  4RX3 A;  1OME A;  5EPH A;  5HAR A;  5GHY A;  5AQB A;  4ZJ2 A;  2XD5 A;  5KZH A;  1L0D A;  4UA7 A;  2PBY A;  1K4F A;  3W8K A;  1IYS A;  2JCH A;  2XQZ A;  4X55 A;  2Y2P A;  2Z2L B;  5GLA A;  3E2K A;  5CHM A;  3WWX A;  1IEL A;  3SH9 A;  1ES4 A;  4XUZ A;  3ZGA B;  5J8X A;  2FFY A;  4KZ9 A;  4OOL A;  5FQJ A;  3MXR A;  3Q7V B;  4EV4 A;  4E6W A;  3PBS A;  2WGW B;  4N92 A;  3NCK A;  5FAP A;  4WEL A;  4JF4 A;  1KVL A;  4JXS A;  3A3E A;  3WS5 A;  4N9L A;  3RXW A;  3N7W A;  1ERO A;  1W79 A;  2H5S A;  1LHY A;  1PZO A;  4OP5 A;  5E43 A;  1MWU A;  1YLP A;  3OC2 A;  1W7F A;  4HBT A;  2ZQ8 A;  4R3J A;  5I94 A;  5A93 A;  1BUE A;  4KEN B;  1NY0 A;  4WZ5 A;  2C6W B;  1K54 A;  4S2M A;  5JYP A;  4QJG A;  1GCE A;  4IED A;  1XA1 A;  1YLZ A;  2Y4A A;  3DTM A;  4GOG A;  4MBF A;  2Y91 A;  4B4X A;  1K57 A;  1ERM A;  2OSU A;  1K4E A;  3ZG8 B;  3VP3 A;  4EUZ A;  3ZVW A;  1IKG A;  4BL3 A;  3BM6 A;  2ZQA A;  2R9W A;  4FCF A;  4WMC A;  1ONG A;  3NC8 A;  2X02 A;  4FH4 A;  4LV1 A;  4R1G A;  4P0M A;  3IT9 A;  5CGX A;  3OCN A;  3OPL A;  3GTC A;  3GQZ A;  4R3B A;  3UNW A;  5U47 A;  5FDH A;  4JPM A;  2WKH A;  1E25 A;  3IXD A;  4UA9 A;  3ZVT A;  2ZC6 B;  4CPK A;  2Y2K A;  2C5W B;  3O86 A;  5CXW A;  4OPZ A;  4ID4 A; 
#chains in the Genus database with same CATH topology
 1KGG A;  1L2S A;  5DF9 A;  4Q0I A;  3VP1 A;  5HD3 A;  4XUX A;  3AGD A;  3C5A A;  2ZJ9 A;  4OQ0 A;  2V0W A;  3D4F A;  3PAE A;  5L07 A;  4GS9 A;  4KUK A;  5L10 A;  3UPP A;  4Y15 A;  4N1X A;  3LR5 A;  2XSS A;  4S2I A;  3A3J A;  3S22 A;  2Y2Q A;  4ZTK A;  1QME A;  1BZA A;  2Y2M A;  4HES A;  1ES2 A;  3QHY A;  4ZJ3 A;  5DF8 A;  5GL9 A;  3SS3 A;  3DTI A;  4H6J A;  3ZDJ A;  3VE3 A;  4I38 A;  2ACG A;  2M7U A;  1VHM A;  1YT4 A;  3LY4 A;  2Z2M B;  4GD8 A;  3JVU A;  3K3C A;  3FWL A;  5FDS A;  3N8S A;  4PM8 A;  2GZA A;  2W3G A;  3ZCZ A;  4JLF A;  1L0F A;  1N4O A;  3GSG A;  4R6L A;  3JVV A;  3CI6 A;  3TW8 A;  4NKP A;  2CC1 A;  3IF6 A;  3LCE A;  3VOL A;  1ZC2 A;  2LB9 A;  3RFB A;  5CTM A;  2XFS A;  3FPV A;  1EI5 A;  1D1J A;  1ERQ A;  2Y8H A;  3MSH A;  3BY9 A;  5DTK A;  5DJT A;  4B93 A;  2V2F F;  5E2G A;  1ALQ A;  3KX0 X;  4S2N C;  3VV4 A;  1F2K A;  3B42 A;  5E2E A;  2EX2 A;  1CEF A;  3UE1 A;  3G30 A;  1IFQ A;  3CUE A;  2JE5 A;  1JWP A;  3NUL A;  1H8Y A;  1P9W A;  2IWD A;  3FKW A;  1OJ5 A;  2OOL A;  4GLQ A;  4EBN A;  3DWK A;  1XFN A;  4QB8 A;  2ZL1 A;  1PRQ A;  1T18 A;  3AGF A;  4HNB A;  1I5Q A;  4UAA A;  5HDC A;  1OPX A;  1S1Z A;  3NHQ A;  4JXV A;  4KUO A;  2ZQC A;  3IHA A;  1S6R A;  1CF0 A;  3IH8 A;  3S1Y A;  3L9K A;  4X53 A;  1HD8 A;  2OWH A;  3EEA A;  2HP6 A;  2EXB A;  1DRM A;  4JGQ A;  5F69 A;  2PYR A;  4I5S A;  1CQA A;  1TVF A;  5EVL A;  1N9O A;  2XA7 S;  3WS1 A;  3MFD A;  1MWS A;  4H8R A;  3ZG0 A;  5MC7 A;  3HVF A;  1MPL A;  3DTE A;  3BJN A;  3EGX C;  1TD5 A;  3HJI A;  2D01 A;  4NG2 A;  5G4Z A;  4PHT A;  4OPQ A;  1FOF A;  3N8R A;  3HLW A;  5EVI D;  5GLD A;  4KZ3 A;  2BLS A;  1MWR A;  1BLS A;  2HV1 A;  2WKR A;  3N4I A;  2ZLY A;  2GDN A;  4RX2 A;  5AQ9 A;  3G35 A;  4Y5F A;  3QP1 A;  1D06 A;  1OTE A;  3VOZ A;  1E4D A;  4PM6 A;  2KOI A;  5HAI A;  1K25 A;  3T4O A;  1K55 A;  2K31 A;  1TF1 A;  2WGV A;  5EEC A;  1ZTU A;  2EX8 A;  1XFQ A;  4WYY A;  3DAV A;  5HL6 A;  4QPR A;  3U2A A;  3UB8 A;  4D60 A;  2WK0 A;  3LY3 A;  4HBU A;  4MEZ A;  1KE3 A;  4GHI B;  3FG8 A;  4PKY G;  3JYI A;  2ZOI A;  4EW7 A;  1RCJ A;  3PBO A;  1YLT A;  3UE6 A;  2R9X A;  2UV0 E;  2MJ6 A;  2WKE A;  3EOI A;  4KZ6 A;  4X68 A;  3UME A;  2E8J A;  5EOO A;  4DE2 A;  5FL3 A;  1W8Y A;  4MDZ A;  1XGJ A;  4Z1W A;  2ZC4 B;  2M7V A;  4YFM A;  3TRC A;  4QHC A;  2JKG A;  3UDX A;  3T4K A;  3TOI A;  3HJK A;  1FCN A;  1DP9 A;  4C75 A;  4LPZ A;  4QD4 A;  2XR0 A;  4F3L A;  2XFT A;  3PBT A;  4R4S A;  5IS1 A;  2KLI A;  1DY6 A;  1ESI A;  3QNB A;  3VP0 A;  1Y28 A;  4ZAM A;  5GLC A;  3C4O A;  3W4O A;  5AQA A;  1GSX A;  1MY8 A;  2V1B A;  3Q81 A;  1T1A A;  3BY8 A;  2J7V A;  4EWF A;  4QU3 A;  1Z09 A;  3CG5 A;  1NXY A;  4PM9 A;  3WRT A;  2G7U A;  3MQ0 A;  1IKI A;  2EWV A;  1PZP A;  3BFC A;  3UE3 A;  5CHJ A;  1BLC A;  3G34 A;  3IWO A;  4R38 A;  3I7J A;  2GNX A;  5M1A A;  3PHY A;  3SW1 A;  4HH2 A;  2HP9 A;  1OT9 A;  3OPP A;  4DE0 A;  2XH9 A;  3KSI A;  4DDY A;  3CPT A;  3MJQ A;  2J80 A;  3FZC A;  3W2Z A;  3PXP A;  3UPO A;  4JGP A;  2G2U A;  2O99 A;  1NLZ A;  1LL5 A;  1PWC A;  5D3O A;  4EES A;  2WAE A;  5EPH A;  5DJU A;  1S4S A;  3KYZ A;  1IYS A;  1J3W A;  2PHY A;  3WWX A;  3A0S A;  2W27 A;  3IX4 A;  2FFY A;  5FQJ A;  2P04 A;  2VEA A;  1S66 L;  1N9L A;  1N9N A;  3F1N B;  5FAP A;  4MN5 A;  4WEL A;  2EWW A;  4JXS A;  3WS5 A;  3N7W A;  1ERO A;  4EEU A;  1PZO A;  1YLP A;  3OC2 A;  1W7F A;  4IJG A;  5A93 A;  4WZ5 A;  5JYP A;  4S2M A;  1GCE A;  3F1O B;  1XA1 A;  1K4E A;  4HHD A;  4QWO A;  4CLC B;  1BYW A;  2ZQA A;  2R9W A;  3OLO A;  1ONG A;  3NC8 A;  4X25 A;  2X02 A;  2KX6 A;  2W1T B;  3GTC A;  4O8G A;  3CWF A;  1PFL A;  5U47 A;  5FDH A;  4JPM A;  2WKH A;  3IXD A;  4CPK A;  3O86 A;  5CXW A;  1MKM A;  2I72 A;  2ZC3 B;  5DTT A;  3DBA A;  3CMZ A;  4JXG A;  1U60 A;  2JHE A;  4GB7 A;  1AWI A;  1LT0 A;  5F6A A;  1E3U A;  3WS4 A;  3BWL A;  4ESP A;  3O3V A;  4FUW A;  4YNR A;  1T1B A;  3GRJ A;  4WBG A;  3SS4 A;  4DF6 A;  3A3I A;  2O9C A;  1X0O A;  4DJ2 A;  2L0W A;  4OKP A;  5JYO A;  1FR1 A;  5BOH A;  4MBH A;  1I2S A;  3R7W A;  3VP2 A;  3O88 A;  3MZF A;  1F5M A;  3VP4 A;  4HY8 A;  4Y17 A;  3UO9 A;  3V39 A;  1W63 Q;  2A3U A;  2P08 A;  5F82 A;  2ZQD A;  4BEN A;  4X1M A;  3HL9 A;  2L4R A;  4KQD A;  4CLC C;  3DWZ A;  4OLD A;  4IVK A;  2VJW A;  3T1X A;  3NJA A;  2Y2L A;  3MQQ A;  3NIA A;  4KZ8 A;  4DDS A;  4L9E A;  3SH7 A;  4OON A;  4WEJ A;  2YKF A;  2ZM2 A;  4BD1 A;  5J7E A;  3MFX A;  1JTG A;  1XJ2 A;  3TE8 A;  4KQO A;  5HDD A;  2DNS A;  1MBL A;  3P01 A;  1S67 L;  4YIN A;  3OOV A;  2VGL S;  4O0P A;  1XKZ A;  4OLG A;  3WS2 A;  4YWZ A;  3FV7 A;  1H8Z A;  5EVI C;  3AGE A;  3F1P B;  2X01 A;  3IS2 B;  1YSQ A;  5HWT A;  2PU2 A;  2V20 A;  2V0U A;  3IHB A;  4MBK A;  4JBF A;  4KZ4 A;  3IXB A;  3UPN A;  1ZG6 A;  4JXW A;  1W5D A;  4ME4 A;  3BFF A;  4A5R A;  2OWJ A;  2HPB A;  4EQI A;  5FA7 A;  4E3N A;  4S2N A;  4NXF A;  3HUM A;  1UWN X;  2PYP A;  2FZ0 A;  2ZMA A;  3T4L A;  1MZU A;  1YKD A;  3GMW A;  3BYD A;  3E2L A;  4KG6 A;  3G4P A;  4ZDX A;  4BBT A;  1SKO A;  4OOY A;  3E0Y A;  4E3I A;  4BWI A;  2WKQ A;  2XD1 A;  4OQH A;  2B18 A;  3IF5 A;  3GEC A;  4NXB A;  3SH8 A;  3E4O A;  2PU4 A;  3CAX A;  1ZHH B;  1SDN A;  2ZQ9 A;  3RXX A;  3G32 A;  2J3T C;  4BLM A;  4GS9 B;  3HLE A;  3BEB A;  1V9Y A;  3G6O A;  3KYE A;  3U4L P;  1K56 A;  4NK3 A;  5DVA A;  2NUP C;  1SZV A;  3MKF A;  5FQI A;  2OAQ 1;  1KGE A;  3E4Q A;  3UY6 A;  2HP5 A;  4OH0 A;  3KSG A;  2JKF A;  5HAP A;  1CEG A;  3V67 A;  1RGY A;  1XA7 A;  2OAP 1;  3FYZ A;  1YAX A;  1SCW A;  5K5B A;  3A0V A;  1K57 C;  1VEU B;  2ZBB A;  1HLU P;  2JKR M;  1PI5 A;  1PIO A;  3VMA A;  1M40 A;  2VKS A;  3LGO A;  3IXG A;  5DKK A;  5IU1 A;  3WRZ A;  5FQQ A;  4G3W A;  4XT2 A;  2M1C A;  5F1F A;  5FI7 A;  3C4P A;  1XP4 A;  1P9R A;  5CX7 A;  3A3F A;  3P09 A;  3T4S A;  3H82 A;  3IF6 B;  5TBM A;  2V9A A;  1LSV A;  1C3B A;  2J8Y A;  4HH3 A;  4BL2 A;  4IBR A;  4NET A;  1KDW A;  1VET A;  5HSQ A;  4CLC D;  3KYQ A;  4HJ6 A;  1M6K A;  2XRO A;  5CEC A;  3G2Z A;  2R78 A;  5J4E A;  4KZ5 A;  1HVB A;  4U3T A;  1CI9 A;  1YSP A;  1H5X A;  3ZG5 A;  1S1Y A;  3TJZ C;  4LRZ E;  5E2H A;  3MF0 A;  5FQK A;  2QJ7 A;  2H28 A;  5HAQ A;  1G6A A;  2B95 A;  2JC7 A;  2ZM8 A;  3VFF A;  1SHV A;  4CQH A;  3W4Q A;  4Y0T A;  2ZL1 B;  4X56 A;  3V50 A;  4OPR A;  2X71 A;  1S4R A;  2CMN A;  2HGV A;  4BD0 A;  3BLM A;  1Q2P A;  2O9B A;  4DMZ A;  2PD7 A;  1JNU A;  3SOI A;  3QP5 A;  2OLU A;  5L09 A;  3B33 A;  4OP8 A;  5E2F A;  1XGI A;  3ZNY A;  1Q2Q A;  2D02 A;  4Z9Q A;  3FC7 A;  4XXR A;  3VOY A;  3HLC A;  5F5Y A;  3C7U A;  4PM7 A;  2J3W A;  1L0E A;  3V3S A;  3JPU A;  3LIC A;  1FSW A;  1BLP A;  3UB5 P;  1AXB A;  1ZKJ A;  3UB7 A;  5HAR A;  5KZH A;  2XD5 A;  3W8K A;  2Z2L B;  3E2K A;  1ES4 A;  4EXO A;  3LIB A;  4KZ9 A;  4L9G A;  1TS7 A;  3NCK A;  5AJG A;  4JF4 A;  4FOF A;  3FPW A;  4WF0 A;  3RXW A;  1W79 A;  2H5S A;  3UB6 A;  4OP5 A;  2VV8 A;  3C30 A;  3ZYT A;  2INW A;  3S7O A;  2C6W B;  2HJ9 C;  3LR0 A;  4IED A;  2PAV P;  2J3T D;  2Y4A A;  4MBF A;  4B4X A;  4GW9 A;  4EUZ A;  4WUJ A;  1IKG A;  3ZVW A;  3BM6 A;  3RH8 B;  5HWW A;  4LV1 A;  4ARZ A;  4R1G A;  4P0M A;  5CGX A;  3OCN A;  4R3B A;  5HPF A;  4ZRR A;  2AVX A;  3PR6 A;  4OPZ A;  3KO6 A;  4EQ1 A;  2B02 A;  2VK3 A;  1Y54 A;  4E3K A;  4U0X A;  4R23 A;  3D72 A;  4YOF A;  5FEG A;  3IWI A;  3GR2 A;  2GJ3 A;  5HWV A;  2QHK A;  2IWB A;  4WMC D;  4ETZ A;  3CHW P;  2WAD A;  3BFD A;  2K2N A;  2KDK A;  5L2F A;  3MS6 A;  4F3L B;  1XJ6 A;  4U0T A;  3BFE A;  2EXA A;  4PKY A;  2E8I A;  2HZ5 A;  2HDS A;  2HDU A;  1NYM A;  3UE0 A;  4DXB A;  4EUV A;  2Q9M A;  4EBP A;  1K55 C;  1YQS A;  4BQM A;  2QZ6 A;  4LCM A;  2Z6C A;  4D2O A;  5GLB A;  4NEE D;  1LI9 A;  2BG1 A;  3K2N A;  2JKR I;  1YLW A;  1YMX A;  3S7P A;  1XJ3 A;  2P9V A;  4KG2 A;  3BRM A;  2OV5 A;  5EOE A;  3HLG A;  1EW0 A;  2ZMV A;  5HFO A;  2Y2G A;  4L9F A;  4S2L A;  3H9W A;  2A24 A;  4E3M A;  4MLL A;  1NYY A;  3C38 A;  1ZG4 A;  1QMF A;  2W3H A;  4Q8I A;  2V8C A;  3VSL A;  1XXM A;  3S4X A;  4K0W A;  3MKE A;  4X6T A;  1RGZ A;  1F9I A;  1TEM A;  1H3Q A;  4GKU A;  2O0Y A;  3CPT B;  2ZC7 A;  1G5U A;  4CLC A;  4EER A;  3NBL A;  4LV2 A;  3PTE A;  4RVA A;  3K3D A;  3QP2 A;  2V1A A;  2IA2 A;  1GSV A;  3QNC A;  2Y79 A;  5EUA A;  4JF5 A;  4KQR A;  4BMW A;  4S2J A;  1IYO A;  1HZO A;  3G2Y A;  3GDI A;  1IEM A;  1KE4 A;  1IYP A;  4B9O A;  1WYB A;  3SZT A;  4HEF A;  5M18 A;  1K6S A;  4CLC E;  5EV0 A;  2XK1 A;  3BQ8 A;  3KSF A;  3HUO A;  1FCO A;  1F98 A;  3IWQ A;  5KIZ A;  1KGF A;  3BLS A;  2GX5 A;  5HD5 A;  5HL1 A;  5EVI A;  4N1H A;  1PNE A;  4GZB A;  3H7W B;  4KQQ A;  4OPY A;  1WE4 A;  3A0R A;  3HLF A;  3QP6 A;  2BTF P;  3PYP A;  1NJ4 A;  2RCX A;  3P7N A;  2DMW A;  3DTK A;  1TS8 A;  2XF3 A;  1KDS A;  1UWP X;  5G18 A;  5CGS A;  3LI8 A;  3HRE A;  4FSF A;  3NDE A;  3MZE A;  4I3I A;  1PWD A;  4X55 A;  3OZH A;  4CJN A;  4KZB A;  1GHM A;  1GHI A;  3O5Y A;  3Q7V A;  4GJ4 A;  4GNU A;  4QY6 A;  2WGW A;  2WZX A;  4BBU A;  2HDQ A;  3ZFZ A;  3VE4 A;  4KG5 A;  3ZHH A;  3R7W B;  1NRJ A;  1YM1 A;  4MCW A;  2OLV A;  4HJ4 A;  1G28 A;  4WN5 A;  2ZM0 A;  5CGW A;  4Y3I A;  2PDR A;  1T19 A;  2FH5 A;  2Y2N A;  4P85 A;  5FAO A;  3LYX A;  2EX6 A;  3UB9 A;  4C3Q A;  4S2O A;  5GHX A;  1KVM A;  1O7E A;  5F83 A;  3N8L A;  4JKT A;  5KSC A;  4MNR A;  5KSH A;  3PBN A;  5CEB A;  1Z6F A;  1YLY A;  1OTI A;  3T1Q B;  1IYQ A;  5IT5 A;  2VX8 A;  3DW0 A;  3OPR A;  2Y59 A;  4LEN A;  4AFI A;  1D7E A;  2HF6 A;  1PI4 A;  5TGF A;  5CER A;  3LR4 A;  1GA9 A;  2YKH A;  2ZC5 B;  4EET B;  4P6Z M;  1L0G A;  1V9Z A;  3FKV A;  3W4P A;  3LEQ A;  4IUH A;  4F94 A;  4OVD A;  1LL9 A;  4X1L A;  3C8C A;  1DJC A;  1VB6 A;  1CI8 A;  3RJU A;  1YMS A;  5FAT A;  4M3K A;  3CIT A;  4O7D A;  3IX3 A;  4HJ3 A;  5F68 A;  1S0W A;  1NZU A;  5IHV A;  3QP4 A;  5A90 A;  1VM1 A;  1LSX A;  1CJF A;  1P97 A;  1KOU A;  3BW6 A;  1H0M A;  4PMA A;  4PPR A;  1NWZ A;  3CLO A;  3CJM A;  1W8Q A;  3IX8 A;  4Q0H A;  2QKP A;  3MXS A;  2PR6 A;  1T1C A;  3LIF A;  5A92 A;  4LV3 A;  2WAF A;  4OOM A;  3UN7 A;  3D9Y A;  1KE0 A;  1MWT A;  3GVB A;  1BTL A;  3C2W A;  3ISG A;  3HUN A;  1OJG A;  5FQM A;  3ITB A;  3NI9 A;  4HI4 A;  3EQV A;  5EE8 A;  5EFW A;  2Y2H A;  5TJJ A;  1NZO A;  3P98 A;  1I2W A;  1SKO B;  4IBX A;  2JN7 A;  3B47 A;  1FCM A;  4E3J A;  1XJ4 A;  5J3W A;  3D3O A;  4MN6 A;  5TFQ A;  1VEU A;  3MMH A;  2HJE A;  4DE1 A;  4UQI M;  3NY4 A;  1G68 A;  2J9P A;  4H6J B;  1K54 C;  2IWC A;  4RX3 A;  5GHY A;  5AQB A;  1L0D A;  4UA7 A;  2PBY A;  1DP8 A;  2JCH A;  5GLA A;  3ICY A;  3SH9 A;  3MXQ A;  4HP4 A;  3NOT C;  4N92 A;  1KVL A;  1STZ A;  3A3E A;  4UEY A;  4WL9 A;  1LHY A;  3KSH A;  1TS0 A;  4NXE A;  5L8M A;  1OTD A;  2ZQ8 A;  4R3J A;  2K7S A;  1NY0 A;  4KEN B;  5DKL A;  4QJG A;  5C5K A;  3LID A;  3UMD A;  1ERM A;  2OSU A;  3ZG8 B;  1OT6 A;  4BL3 A;  4FCF A;  2PRF A;  1TS6 A;  3GQZ A;  4XT2 B;  4K08 A;  4G3K A;  1E25 A;  4HQA A;  1ODV A;  4O01 A;  3T1R A;  3H82 B;  5TBM B;  3NOP C;  4ETX A;  4II7 A;  4LLO B;  3EWK A;  1ESU A;  1PW8 A;  3V3R A;  1K6R A;  1CK3 A;  3MR0 A;  5G4Y A;  1VET B;  5FSR A;  2QPN A;  4OQI A;  4RYE A;  3EGD C;  1TDL A;  4DJ3 A;  3QP8 A;  3WS0 A;  3T50 A;  1PW1 A;  3V5M A;  2XLN A;  1A0K A;  3PAG A;  5LBR A;  3T4Q A;  3ZNT A;  4LRY C;  4E3O A;  4P6Z S;  1OTA A;  4Y7P A;  2Q9N A;  4Y0U A;  3M2J A;  1K38 A;  1FQG A;  2EFU A;  2Y2J A;  2Z6D A;  3OPH A;  1WA9 A;  3IF6 C;  5AQ7 A;  2ZOH A;  2WGI A;  3TSG A;  4IHQ A;  3UDI A;  4GD6 A;  2HDR A;  4EBL A;  4DKI A;  1E3U D;  2VZW A;  2G2W A;  5AVE A;  5HZH A;  4L0L A;  5TR7 A;  1GSW A;  4LRX C;  4FH2 A;  2A2L A;  4GHI A;  4KZ7 A;  4R3A A;  2NUT C;  2Y2O A;  4FTX A;  3HLB A;  1K0K A;  5KMW A;  4DE3 A;  3TG9 A;  4KZA A;  4BBV A;  4WLA A;  4K91 A;  2W1R A;  3CUE C;  4S2P A;  3RTY A;  5HPI A;  1H8M A;  2VA0 A;  4GDN A;  4B4Z A;  3A3D A;  4E3L A;  2P74 A;  3LO7 A;  2XRN A;  2UWX A;  1P0Z A;  4R4R A;  1N9B A;  1BT5 A;  2RL3 A;  1DJB A;  4NXG A;  3M6H A;  3NDG A;  3T1S A;  3LIE A;  1JWV A;  3BQA A;  4UQI S;  4HIA A;  4B88 A;  3VSK A;  3GV9 A;  2QJ5 A;  3NOU C;  4I3A A;  4GDB A;  3LUQ A;  1JTD A;  3T4T A;  2J9O A;  4C6Y A;  2ZQ7 A;  4ZJ1 A;  2XDM A;  5CHU A;  5HW3 A;  4WZ4 A;  3S7N A;  4EU0 A;  2EFX A;  3E4P A;  5CED A;  1LL8 A;  2PD8 A;  4UHU A;  3B3X A;  4JF6 A;  3ZG7 B;  4Y13 A;  3IQA A;  5EM1 A;  4RA7 A;  1ES3 A;  3M2K A;  1Y4O A;  4P87 A;  3MBZ A;  5FAQ A;  2Y55 A;  5DF7 A;  5AVF A;  5DFY A;  4ARZ B;  4LGW A;  1UGU A;  4WM9 A;  5CRF A;  2XGN A;  2H10 A;  1SDE A;  4HOI A;  1J9M A;  4N9K A;  2JKT M;  3O87 A;  3SS5 A;  1GHP A;  3HBR A;  1L3L A;  2I9V A;  3IH9 A;  3LI9 A;  2H0Y A;  4E04 A;  1ES5 A;  3MQO A;  4R0Q A;  1TDG A;  5CTN A;  1MKI A;  2DCF A;  3M6B A;  1BLH A;  3IBJ A;  4GN2 A;  2O9A A;  2PBD P;  3PBR A;  2FFF B;  2V1Z A;  4LV0 A;  1NRF A;  4IVI A;  4PM5 A;  1VQQ A;  4BJP A;  2BAS A;  4LFU A;  4GCZ A;  5DFX A;  5F1G A;  3F1N A;  5A91 A;  1PYY A;  1ONH A;  2P7J A;  4MMN A;  5HDS A;  5A8B A;  1MXO A;  2VGL M;  5FI2 A;  2WKI A;  1SKF A;  4WEK A;  3C7V A;  3OCL A;  2DRW A;  3CZD A;  3IXH A;  3F1O A;  2XEP A;  4UA6 A;  2P9V B;  2L1M A;  4QY5 A;  5FQ9 A;  3Q7Z A;  1DJA A;  3EEH A;  2VV7 A;  1G6O A;  1FR6 A;  3R4K A;  1K56 D;  4S2K A;  4HP9 A;  1JWZ A;  3HLD A;  2WUQ A;  3G31 A;  4DXC A;  2W1T A;  3LEZ A;  4DRT A;  4I3J A;  2W3E A;  2A49 A;  5I5L A;  2A24 B;  5DTS A;  4RQ9 A;  1W63 M;  3MZD A;  5EVE A;  3HCY A;  5FAS A;  2EX9 A;  3L7H A;  4EEP A;  4PAU A;  4ZBE A;  3IBR A;  3PBQ A;  4P6B A;  1RP5 A;  4MN7 A;  1PWG A;  1YLJ A;  1XX2 A;  3ZG9 B;  2Y2I A;  2W3D A;  1GA0 A;  4LCL A;  1YPR A;  2Q0O A;  3UDF A;  2JBF A;  3H7W A;  2H0T A;  2PT7 A;  3Q1F A;  5FI6 A;  5M19 A;  1XPB A;  4IUK A;  1FIK A;  4FD8 A;  4OQG A;  2PR5 A;  4E6X A;  4Q0J A;  3BEC A;  4M4X A;  3ULF A;  3N6I A;  1EWZ A;  3Q82 A;  2WYX A;  1WYC A;  4JGO A;  1O07 A;  4X69 A;  2VGJ A;  1BSG A;  1LI0 A;  1BUL A;  3LIA A;  1HTZ A;  2ZD8 A;  3ITA A;  3ZQ5 A;  3BFG A;  2VV6 A;  1FIL A;  3EQU A;  3OBF A;  5EVI B;  3T12 B;  5HX9 A;  5GHZ A;  4I39 A;  3S7Q A;  2WZZ A;  4G3V A;  1JVJ A;  1OTB A;  2V8F A;  2VGK A;  2QMI A;  3Q07 A;  2WKP A;  1IOU A;  2B5R A;  1LLB A;  3E98 A;  4DN0 A;  3NEC A;  1FSY A;  3VFH A;  4WZ5 C;  4Y0O A;  2QYB A;  4K0X A;  1NLY A;  2LB5 A;  1LSW A;  1ACF A;  1OME A;  4JGR A;  4ZJ2 A;  5EM0 A;  1K4F A;  2XQZ A;  2Y2P A;  5CHM A;  1IEL A;  4XUZ A;  3ZGA B;  3F1P A;  5J8X A;  2ZMF A;  3IS2 A;  4OOL A;  3MXR A;  3Q7V B;  4EV4 A;  4E6W A;  3PBS A;  4Y2F A;  2WGW B;  2EA9 A;  2VLG A;  2W3F A;  4N9L A;  3LFV A;  5E43 A;  1MWU A;  4HBT A;  2QWS A;  5I94 A;  4R70 A;  1MC0 A;  1BUE A;  1K54 A;  3T4J A;  1YLZ A;  3DTM A;  3LR3 A;  4GOG A;  2Y91 A;  1K57 A;  3VP3 A;  2XA7 M;  2JKT I;  4WMC A;  4FH4 A;  3IT9 A;  2W0N A;  3OPL A;  1DP6 A;  3UNW A;  5FEF A;  4UA9 A;  3ZVT A;  2ZC6 B;  2Y2K A;  2C5W B;  4ID4 A; 
#chains in the Genus database with same CATH homology
 2I72 A;  1KGG A;  1L2S A;  2ZC3 B;  5DTT A;  1Y54 A;  5DF9 A;  1ESU A;  1PW8 A;  4U0X A;  3VP1 A;  4R23 A;  4E3K A;  3V3R A;  1K6R A;  1CK3 A;  4XUX A;  3IWI A;  3CMZ A;  3AGD A;  4JXG A;  5FSR A;  3GR2 A;  3C5A A;  2ZJ9 A;  2QPN A;  4OQI A;  4OQ0 A;  4RYE A;  1U60 A;  1TDL A;  4GB7 A;  3D4F A;  3PAE A;  1E3U A;  2IWB A;  4WMC D;  3WS4 A;  3WS0 A;  1PW1 A;  2WAD A;  3BFD A;  3V5M A;  2XLN A;  3O3V A;  5L2F A;  3SS4 A;  3GRJ A;  4WBG A;  3PAG A;  3UPP A;  3ZNT A;  4N1X A;  4E3O A;  4U0T A;  4DF6 A;  3A3I A;  4S2I A;  3BFE A;  2EXA A;  2E8I A;  3A3J A;  4Y7P A;  2HDS A;  2Q9N A;  4Y0U A;  3S22 A;  2Y2Q A;  2HDU A;  3M2J A;  4OKP A;  5JYO A;  1NYM A;  1K38 A;  1FR1 A;  3UE0 A;  4DXB A;  4ZTK A;  5BOH A;  1FQG A;  2EFU A;  2Q9M A;  2Y2J A;  4MBH A;  1I2S A;  1QME A;  4EBP A;  1BZA A;  1K55 C;  1YQS A;  2Y2M A;  1ES2 A;  2QZ6 A;  4HES A;  4BQM A;  3OPH A;  4LCM A;  3QHY A;  4ZJ3 A;  3IF6 C;  5DF8 A;  5GL9 A;  3SS3 A;  5AQ7 A;  3VP2 A;  4D2O A;  3O88 A;  2WGI A;  3MZF A;  3VP4 A;  5GLB A;  3TSG A;  3UO9 A;  1LI9 A;  2BG1 A;  3V39 A;  3UDI A;  1YLW A;  3ZDJ A;  2A3U A;  4GD6 A;  1YMX A;  2HDR A;  4EBL A;  2P9V A;  4KG2 A;  1E3U D;  3BRM A;  4DKI A;  2G2W A;  2OV5 A;  5F82 A;  2ZQD A;  4L0L A;  4BEN A;  5TR7 A;  5EOE A;  3HLG A;  1YT4 A;  3HL9 A;  3LY4 A;  2Z2M B;  4FH2 A;  3DWZ A;  4GD8 A;  4OLD A;  4IVK A;  4KZ7 A;  5HFO A;  3FWL A;  2Y2O A;  2Y2G A;  3N8S A;  4PM8 A;  2Y2L A;  3HLB A;  4S2L A;  3ZCZ A;  4JLF A;  1L0F A;  3NIA A;  1N4O A;  4E3M A;  5KMW A;  4MLL A;  4KZ8 A;  4DDS A;  3TG9 A;  4DE3 A;  4KZA A;  3SH7 A;  1NYY A;  3GSG A;  4K91 A;  1ZG4 A;  1QMF A;  4Q8I A;  4S2P A;  3VSL A;  2CC1 A;  1XXM A;  3IF6 A;  3S4X A;  3LCE A;  4K0W A;  3MKE A;  4OON A;  4GDN A;  4X6T A;  4WEJ A;  1RGZ A;  1ZC2 A;  2ZM2 A;  4B4Z A;  4BD1 A;  1TEM A;  3A3D A;  5CTM A;  1JTG A;  2P74 A;  2XFS A;  4GKU A;  4E3L A;  4KQO A;  3LO7 A;  2ZC7 A;  1EI5 A;  2DNS A;  1ERQ A;  1MBL A;  2UWX A;  4R4R A;  1N9B A;  5DTK A;  3NBL A;  1BT5 A;  2RL3 A;  2V2F F;  4YIN A;  5E2G A;  4LV2 A;  1ALQ A;  1XKZ A;  1DJB A;  4OLG A;  3WS2 A;  3M6H A;  3PTE A;  4RVA A;  3NDG A;  4S2N C;  1JWV A;  3FV7 A;  1H8Z A;  4B88 A;  3VSK A;  3GV9 A;  5E2E A;  2EX2 A;  1CEF A;  3UE1 A;  3G30 A;  3QNC A;  4GDB A;  5EVI C;  2JE5 A;  3AGE A;  1JWP A;  5EUA A;  2X01 A;  4JF5 A;  1JTD A;  4KQR A;  1H8Y A;  2J9O A;  2IWD A;  2PU2 A;  2ZQ7 A;  3FKW A;  4S2J A;  4ZJ1 A;  4C6Y A;  2V20 A;  2XDM A;  1IYO A;  4EBN A;  1HZO A;  3DWK A;  3G2Y A;  3IHB A;  4JBF A;  4MBK A;  4WZ4 A;  5CHU A;  1IEM A;  4QB8 A;  5HW3 A;  4KZ4 A;  3IXB A;  3UPN A;  1KE4 A;  3AGF A;  1IYP A;  1I5Q A;  1WYB A;  1ZG6 A;  4UAA A;  2EFX A;  5M18 A;  4HEF A;  5CED A;  1K6S A;  4JXW A;  4JXV A;  1W5D A;  2XK1 A;  4UHU A;  3BFF A;  3HUO A;  1FCO A;  2ZQC A;  3IHA A;  4A5R A;  3B3X A;  2HPB A;  1S6R A;  3IWQ A;  4JF6 A;  4EQI A;  3ZG7 B;  3IH8 A;  3S1Y A;  3IQA A;  5FA7 A;  4RA7 A;  1ES3 A;  4E3N A;  3M2K A;  4S2N A;  4X53 A;  1HD8 A;  1KGF A;  4P87 A;  3BLS A;  3MBZ A;  2HP6 A;  5FAQ A;  2Y55 A;  2EXB A;  5DF7 A;  3HUM A;  5HL1 A;  5EVI A;  4N1H A;  4GZB A;  4KQQ A;  2ZMA A;  4OPY A;  1WE4 A;  3HLF A;  3GMW A;  3BYD A;  4WM9 A;  5CRF A;  1TVF A;  2H10 A;  2XGN A;  3E2L A;  5EVL A;  1NJ4 A;  4KG6 A;  2RCX A;  3G4P A;  4ZDX A;  1SDE A;  3WS1 A;  3MFD A;  1J9M A;  1MWS A;  4H8R A;  4N9K A;  3ZG0 A;  4OOY A;  3O87 A;  3HVF A;  3SS5 A;  1MPL A;  1GHP A;  3HBR A;  4E3I A;  3IH9 A;  2XD1 A;  2XF3 A;  4OQH A;  1KDS A;  3IF5 A;  2H0Y A;  5G18 A;  5CGS A;  3SH8 A;  1ES5 A;  4R0Q A;  2PU4 A;  1TDG A;  5CTN A;  1MKI A;  4OPQ A;  2DCF A;  3M6B A;  1BLH A;  1FOF A;  3N8R A;  4GN2 A;  1SDN A;  3HLW A;  2ZQ9 A;  3HRE A;  4FSF A;  3G32 A;  3NDE A;  5EVI D;  5GLD A;  3RXX A;  4BLM A;  4KZ3 A;  2BLS A;  3MZE A;  3HLE A;  1MWR A;  1BLS A;  1PWD A;  3BEB A;  3PBR A;  3OZH A;  2FFF B;  2V1Z A;  3N4I A;  1GHM A;  2GDN A;  2ZLY A;  1NRF A;  4IVI A;  4KZB A;  4LV0 A;  1GHI A;  4RX2 A;  1K56 A;  4NK3 A;  5AQ9 A;  4PM5 A;  1VQQ A;  4BJP A;  3G35 A;  5DVA A;  3Q7V A;  4GNU A;  3VOZ A;  4QY6 A;  2WGW A;  3MKF A;  1E4D A;  5F1G A;  5A91 A;  4PM6 A;  2WZX A;  2HDQ A;  1PYY A;  3ZFZ A;  5HAI A;  4KG5 A;  1ONH A;  3ZHH A;  1K25 A;  4CJN A;  5FQI A;  1MXO A;  1KGE A;  1K55 A;  3UY6 A;  2WGV A;  2HP5 A;  4OH0 A;  5EEC A;  5FI2 A;  1YM1 A;  2WKI A;  5HAP A;  2EX8 A;  1SKF A;  2OLV A;  4WEK A;  3C7V A;  3OCL A;  2DRW A;  4WYY A;  2ZM0 A;  5CGW A;  1CEG A;  3CZD A;  3IXH A;  1RGY A;  1XA7 A;  2Y2N A;  2XEP A;  4UA6 A;  4P85 A;  2P9V B;  5FAO A;  4QY5 A;  3FYZ A;  3Q7Z A;  1SCW A;  5FQ9 A;  2EX6 A;  1DJA A;  1K57 C;  2WK0 A;  4C3Q A;  4S2O A;  5GHX A;  1KVM A;  3LY3 A;  4HBU A;  1O7E A;  4MEZ A;  1FR6 A;  1K56 D;  1KE3 A;  4S2K A;  1PI5 A;  1PIO A;  5F83 A;  3VMA A;  1M40 A;  3N8L A;  4JKT A;  5KSC A;  1JWZ A;  3JYI A;  3HLD A;  2WUQ A;  3G31 A;  3IXG A;  4MNR A;  3WRZ A;  4DXC A;  5KSH A;  3PBN A;  5FQQ A;  1RCJ A;  3LEZ A;  4DRT A;  3PBO A;  5F1F A;  2A49 A;  5FI7 A;  5CEB A;  1YLT A;  1Z6F A;  1YLY A;  3C4P A;  5DTS A;  1XP4 A;  2R9X A;  3MZD A;  3A3F A;  1IYQ A;  2WKE A;  3P09 A;  4KZ6 A;  4X68 A;  5FAS A;  3IF6 B;  5EOO A;  2EX9 A;  4DE2 A;  1W8Y A;  1C3B A;  1XGJ A;  2J8Y A;  2ZC4 B;  3DW0 A;  4BL2 A;  3OPR A;  2Y59 A;  4IBR A;  4NET A;  4YFM A;  4ZBE A;  1KDW A;  4LEN A;  3PBQ A;  4QHC A;  4P6B A;  1RP5 A;  1PI4 A;  5TGF A;  1PWG A;  1YLJ A;  1XX2 A;  5CER A;  2Y2I A;  3UDX A;  3ZG9 B;  1GA9 A;  3TOI A;  1GA0 A;  2ZC5 B;  4LCL A;  3UDF A;  1M6K A;  1L0G A;  1FCN A;  3FKV A;  3W4P A;  5CEC A;  3G2Z A;  2JBF A;  4F94 A;  4C75 A;  4OVD A;  1LL9 A;  2H0T A;  4QD4 A;  1DJC A;  2XR0 A;  4KZ5 A;  1HVB A;  4U3T A;  1CI9 A;  1CI8 A;  2XFT A;  3PBT A;  4R4S A;  1H5X A;  3RJU A;  3ZG5 A;  1DY6 A;  1ESI A;  1YMS A;  5FAT A;  3Q1F A;  4M3K A;  3QNB A;  5E2H A;  5FI6 A;  3VP0 A;  4ZAM A;  5FQK A;  3C4O A;  5GLC A;  3W4O A;  5M19 A;  4O7D A;  5AQA A;  1XPB A;  1MY8 A;  3Q81 A;  5HAQ A;  1S0W A;  1G6A A;  4FD8 A;  4OQG A;  1NZU A;  5IHV A;  2J7V A;  2JC7 A;  2ZM8 A;  4EWF A;  3VFF A;  1VM1 A;  5A90 A;  4E6X A;  1SHV A;  4QU3 A;  3W4Q A;  3BEC A;  4Y0T A;  3CG5 A;  4X56 A;  3V50 A;  3N6I A;  1NXY A;  4PM9 A;  4PMA A;  4OPR A;  3WRT A;  2X71 A;  1EWZ A;  3Q82 A;  4PPR A;  2WYX A;  1IKI A;  1WYC A;  4BD0 A;  3CJM A;  1W8Q A;  1O07 A;  1PZP A;  1Q2P A;  3BLM A;  3BFC A;  4X69 A;  3UE3 A;  2VGJ A;  5CHJ A;  1BLC A;  1BSG A;  1LI0 A;  3SOI A;  1BUL A;  2OLU A;  1HTZ A;  3G34 A;  2ZD8 A;  3ITA A;  3IWO A;  3MXS A;  3BFG A;  5A92 A;  3I7J A;  4LV3 A;  2WAF A;  4OOM A;  4OP8 A;  5E2F A;  3UN7 A;  1KE0 A;  5M1A A;  1MWT A;  3EQU A;  1XGI A;  3GVB A;  5EVI B;  3ZNY A;  1BTL A;  5HX9 A;  3ISG A;  3HUN A;  5FQM A;  5GHZ A;  3ITB A;  1Q2Q A;  4Z9Q A;  3NI9 A;  3EQV A;  2HP9 A;  2WZZ A;  4XXR A;  1JVJ A;  5EE8 A;  3VOY A;  2Y2H A;  3OPP A;  4DE0 A;  1NZO A;  3HLC A;  3C7U A;  3P98 A;  1I2W A;  2VGK A;  2XH9 A;  4IBX A;  4PM7 A;  4DDY A;  2QMI A;  3Q07 A;  2B5R A;  1FCM A;  1LLB A;  4E3J A;  3FZC A;  3UPO A;  1L0E A;  5TFQ A;  2G2U A;  3V3S A;  4DE1 A;  3NY4 A;  1FSW A;  1BLP A;  1G68 A;  1LL5 A;  1PWC A;  1FSY A;  2J9P A;  5D3O A;  3VFH A;  4WZ5 C;  1AXB A;  4Y0O A;  1K54 C;  4K0X A;  1ZKJ A;  2IWC A;  2WAE A;  4RX3 A;  1OME A;  5EPH A;  5HAR A;  5GHY A;  5AQB A;  4ZJ2 A;  2XD5 A;  5KZH A;  1L0D A;  4UA7 A;  2PBY A;  1K4F A;  3W8K A;  1IYS A;  2JCH A;  2XQZ A;  4X55 A;  2Y2P A;  2Z2L B;  5GLA A;  3E2K A;  5CHM A;  3WWX A;  1IEL A;  3SH9 A;  1ES4 A;  4XUZ A;  3ZGA B;  5J8X A;  2FFY A;  4KZ9 A;  4OOL A;  5FQJ A;  3MXR A;  3Q7V B;  4EV4 A;  4E6W A;  3PBS A;  2WGW B;  4N92 A;  3NCK A;  5FAP A;  4WEL A;  4JF4 A;  1KVL A;  4JXS A;  3A3E A;  3WS5 A;  4N9L A;  3RXW A;  3N7W A;  1ERO A;  1W79 A;  2H5S A;  1LHY A;  1PZO A;  4OP5 A;  5E43 A;  1MWU A;  1YLP A;  3OC2 A;  1W7F A;  4HBT A;  2ZQ8 A;  4R3J A;  5I94 A;  5A93 A;  1BUE A;  4KEN B;  1NY0 A;  4WZ5 A;  2C6W B;  1K54 A;  4S2M A;  5JYP A;  4QJG A;  1GCE A;  4IED A;  1XA1 A;  1YLZ A;  2Y4A A;  3DTM A;  4GOG A;  4MBF A;  2Y91 A;  4B4X A;  1K57 A;  1ERM A;  2OSU A;  1K4E A;  3ZG8 B;  3VP3 A;  4EUZ A;  3ZVW A;  1IKG A;  4BL3 A;  3BM6 A;  2ZQA A;  2R9W A;  4FCF A;  4WMC A;  1ONG A;  3NC8 A;  2X02 A;  4FH4 A;  4LV1 A;  4R1G A;  4P0M A;  3IT9 A;  5CGX A;  3OCN A;  3OPL A;  3GTC A;  3GQZ A;  4R3B A;  3UNW A;  5U47 A;  5FDH A;  4JPM A;  2WKH A;  1E25 A;  3IXD A;  4UA9 A;  3ZVT A;  2ZC6 B;  4CPK A;  2Y2K A;  2C5W B;  3O86 A;  5CXW A;  4OPZ A;  4ID4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...