4FD8A

Structure of apo s70c shv beta-lactamase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMCTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase SHV-1
publication title Crystal structure of a pre-acylation complex of the beta-lactamase inhibitor, sulbactam, bound to a sulfenamide bond containing thiol-beta-lactamase
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 99
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4fd8A00
4S2NC 5IHVA 3HUMA 2DCFA 3C4OA 3MZEA 5E2EA 2IWBA 2EXAA 3WS5A 5M1AA 5CEBA 3IXBA 4X55A 1ZC2A 1GHIA 2Z2MB 3M2KA 5E43A 5EVIA 4S2KA 4E6XA 3VP2A 1WE4A 2R9WA 1ES4A 4LV2A 4DE2A 1W79A 1YLYA 5FQIA 2WYXA 2EFUA 5GLDA 2ZC6B 4QU3A 2Y2OA 4BD1A 3C7UA 1BLCA 1IYPA 3S4XA 4PM5A 5JYOA 3E2KA 3N8RA 4LV0A 4BD0A 4DE1A 4WEKA 1NRFA 1SCWA 1DJAA 2PBYA 4JXWA 1ES5A 4L0LA 1SDEA 2OSUA 4JBFA 4K0XA 4GKUA 1LI9A 3ZHHA 2Y2GA 4QD4A 2FFYA 5CHUA 3WRZA 1HD8A 3GR2A 4OOLA 4WELA 1Y54A 2J9OA 4UA7A 1MWUA 4HBTA 4E3IA 4OVDA 1L0FA 2WGIA 2HP6A 1ZG6A 4E3JA 1BT5A 4U3TA 3IF6B 3N4IA 5FI6A 3LY4A 3V39A 5E2GA 1FQGA 2HPBA 4CJNA 3S22A 4B4XA 4XUZA 1L0EA 2Y2NA 3Q81A 2HDQA 1K55A 2X01A 5F82A 2Y55A 3ZCZA 4U0TA 5CECA 2WGWB 2P9VB 3IF6A 1Q2QA 1XPBA 3IT9A 4JXVA 1M6KA 4X6TA 4KG6A 1K57C 1LL5A 3Q07A 3VP4A 5DTSA 1YLWA 3UE3A 5FATA 2WGWA 2P9VA 4KZ8A 3AGDA 3GSGA 4PM8A 5HAIA 1J9MA 2DNSA 3UN7A 1EI5A 3G31A 4KG5A 5EOOA 1BULA 1MWTA 5HFOA 3PBSA 1XP4A 3A3FA 3TG9A 4X68A 5F83A 3VSKA 3VMAA 4S2NA 2EX9A 2QMIA 5CRFA 3IWIA 3MFDA 5BOHA 5FASA 2J7VA 4OLGA 2JBFA 1BSGA 1IYQA 4GOGA 1N9BA 1SHVA 3C5AA 3OZHA 4OQ0A 4P6BA 4WZ5C 5D3OA 4OKPA 2Y59A 4KZ6A 3ZG5A 4GN2A 1YLZA 3UDIA 1KGFA 1L0DA 3O86A 3UPOA 1HTZA 1DJBA 1PW8A 3TOIA 3VFHA 5L2FA 1I2SA 3HLEA 3OPHA 3WS4A 4ZTKA 5GHYA 1K54A 4B4ZA 5DF7A 5AQBA 2HDRA 1C3BA 4Y0OA 3C7VA 3QNBA 1CEFA 1ESUA 4KQOA 1NJ4A 3IH8A 3ITBA 3HLBA 1XGIA 4E3NA 3PAGA 5HW3A 4DKIA 4HBUA 3CMZA 2XQZA 2C5WB 4NETA 3PBNA 4M3KA 3A3DA 4N9LA 1M40A 4UA9A 4JKTA 4KZ3A 4EQIA 2Q9MA 3BEBA 3OCNA 3OCLA 4KZAA 4KZ9A 3G30A 1NZUA 1JWZA 4JF5A 4OPRA 3ZFZA 4OP8A 3ZG8B 2Z2LB 4Y0UA 4IVKA 3BLMA 1SKFA 4ZAMA 2UWXA 5A93A 5I94A 2Y91A 2WZZA 4LENA 3BRMA 4ZDXA 3NC8A 4LV3A 4MBKA 3ZG0A 1TDGA 4UAAA 4KENB 1K57A 1KGGA 4IVIA 1K25A 3NDEA 3VP3A 4Z9QA 1N4OA 3BECA 4ZJ2A 4CPKA 5CEDA 4C6YA 2GDNA 5GLAA 5AQ9A 1K56A 3FKVA 3CZDA 4RA7A 5DF9A 5E2HA 3IQAA 5FI2A 3IXDA 1MWRA 4OPQA 2BLSA 4N1XA 2H5SA 4RX2A 1BZAA 1G68A 2RCXA 1GA9A 3B3XA 4LCMA 5FQMA 3RXXA 4HEFA 1PZPA 5JYPA 4QY6A 4UHUA 1MKIA 3AGEA 4R1GA 1XX2A 4JF4A 1ERQA 5CERA 1KDWA 3MZFA 1S6RA 2BG1A 4O7DA 1ALQA 1TEMA 1XGJA 1QMEA 1NZOA 1AXBA 1BLPA 4E6WA 1O7EA 3LEZA 4JXGA 1IYOA 3G2ZA 3GRJA 2WAEA 2ZD8A 4A5RA 3CJMA 1RCJA 5A91A 2WAFA 4MEZA 1GA0A 1XXMA 1ES2A 4KQRA 4PM6A 3VOYA 4H8RA 5GLBA 1O07A 5GLCA 1VQQA 1FSWA 3PAEA 3VOZA 1LL9A 3IWOA 3NBLA 4X69A 2A49A 4R4SA 3WS0A 3M6BA 5FAPA 1BLHA 3HLCA 3LCEA 2ZQ8A 1DJCA 4IBXA 5HAPA 5DTKA 4HESA 1CI9A 3ZDJA 4R3JA 5TR7A 3BFCA 2FFFB 5TGFA 3WWXA 4MBHA 3DW0A 1KGEA 5CGWA 3MZDA 1K6SA 2JCHA 1ZG4A 1WYCA 3BYDA 4P85A 5CGSA 3NCKA 1EROA 1MBLA 3ZGAB 3MKEA 4KZBA 3FYZA 1IEMA 5F1FA 1XA1A 4GD6A 1HZOA 3V5MA 5CGXA 2V20A 2XLNA 3ZNTA 1BLSA 1PZOA 4DXCA 4S2MA 4U0XA 2VGJA 2OLVA 3MKFA 1K4FA 3NY4A 3S1YA 2OLUA 5FAOA 3OPRA 4WBGA 3P09A 1NYMA 4DRTA 4KG2A 5FDHA 1RGYA 4XUXA 4ZJ1A 3HUOA 3PBQA 3IHAA 4GB7A 3NDGA 3D4FA 4GDNA 3AGFA 4LV1A 5EECA 4DDYA 3BFFA 4FSFA 1IKGA 2J9PA 1W7FA 3CG5A 5AQAA 4BJPA 5EVIC 5DF8A 3SH9A 4EBPA 3IWQA 3OPPA 4BENA 2PU4A 4DDSA 2RL3A 4WZ4A 1ESIA 1ONGA 3HLFA 4EWFA 2HDUA 1KDSA 2ZQDA 3OC2A 3Q7VB 4N9KA 3V50A 2EXBA 4YFMA 1PWCA 3VP1A 3A3IA 4C75A 3GMWA 1JVJA 2WUQA 4NK3A 2Y2MA 5HL1A 2JE5A 4OH0A 4X53A 3TSGA 3O3VA 3Q7VA 1BTLA 2H0YA 1ZKJA 1G6AA 5EUAA 5F1GA 1KE3A 1FSYA 1FCMA 3MXRA 3SOIA 1NYYA 2WKHA 4OONA 4FH2A 5KSCA 2WKIA 1FCOA 2E8IA 1CEGA 2Y4AA 2B5RA 2EFXA 1MY8A 1XA7A 2ZQ9A 4OPYA 4MLLA 2IWCA 3UPNA 1GCEA 4Q8IA 4JPMA 3IH9A 4PPRA 4ZBEA 1L0GA 3EQVA 3ZVWA 3ZNYA 2OV5A 3G34A 4MNRA 3HL9A 5KZHA 4OPZA 4IBRA 3Q82A 1E3UD 4RYEA 5CHJA 1Z6FA 3A3EA 4FCFA 4S2OA 2Y2QA 5GHXA 2XFSA 1YLTA 4OQHA 4P0MA 3BFEA 3BFGA 3EQUA 3I7JA 1FCNA 3UDFA 3QHYA 3N6IA 4KZ5A 2ZQ7A 1ONHA 3HVFA 3SH7A 2VGKA 2EX8A 1PYYA 1K38A 2XF3A 5FA7A 1NXYA 2XD1A 1FOFA 1CI8A 2Q9NA 3VFFA 2IWDA 1PWGA 1K55C 5U47A 1PWDA 2PU2A 4XXRA 5GL9A 3V3RA 3N8LA 4S2IA 2ZM8A 4GZBA 4WMCA 1QMFA 4WMCD 2WGVA 3MXSA 4EUZA 5KMWA 2J8YA 5CTNA 3W4QA 3M2JA 1DY6A 4R3BA 1FR1A 4WZ5A 1JTGA 5EVIB 1PIOA 5EVLA 2QZ6A 1H5XA 1TDLA 2V2FF 5DVAA 5FQ9A 2XD5A 4FD8A 4OQIA 5J8XA 5M18A 3FZCA 3BM6A 5FAQA 1Q2PA 4EBLA 1I5QA 5EVID 5CTMA 4K0WA 2ZM0A 2ZLYA 5EOEA 4S2JA 1EWZA 4GD8A 3FV7A 1WYBA 2EX2A 2XEPA 3V3SA 4Y0TA 2Y2KA 2EX6A 4KZ7A 1GHMA 1PI5A 4PM9A 4EBNA 2WZXA 1W8QA 4QJGA 3DWKA 3ISGA 1E25A 1KE0A 3C4PA 3HLGA 4R23A 2XDMA 4S2LA 1IELA 5FI7A 4UA6A 4YINA 2HP9A 3GTCA 1OMEA 2XH9A 4K91A 4N1HA 4P87A 1H8ZA 4D2OA 4JF6A 1K54C 2ZQAA 3P98A 3E2LA 3HUNA 2G2UA 2X71A 4DE3A 3IXHA 2ZJ9A 3W8KA 5G18A 1PW1A 3HREA 4OLDA 1JTDA 2ZC7A 1KVLA 3SS3A 4FH4A 4Y7PA 3ZVTA 1E4DA 4MBFA 4KQQA 3A3JA 4F94A 3O87A 1MXOA 3UO9A 3DWZA 1MPLA 5CXWA 3FWLA 2XFTA 5EE8A 1YLJA 3ZG9B 4GDBA 5A90A 1LHYA 3PTEA 4WM9A 1FR6A 1YM1A 4OOMA 3O88A 3NIAA 5FQKA 1HVBA 1I2WA 2HDSA 4WEJA 3UPPA 3G35A 3WS1A 4OQGA 3Q1FA 2DRWA 4R0QA 2ZC5B 3BLSA 4RVAA 4QB8A 3W4PA 3MBZA 3QNCA 4ZJ3A 2I72A 2X02A 3WS2A 2P74A 1U60A 1JWPA 2XGNA 3GQZA 2R9XA 3HLDA 3UE0A 2JC7A 3HLWA 4WYYA 2G2WA 2ZM2A 4JLFA 3N7WA 3FKWA 1GHPA 4DXBA 2H0TA 4GNUA 3VSLA 1PI4A 5HAQA 4PMAA 3IHBA 4ID4A 3M6HA 3SS4A 4E3OA 1KE4A 3RXWA 1K4EA 1ERMA 2ZMAA 5GHZA 1TVFA 3PBOA 3IF5A 5TFQA 3VP0A 1W8YA 1LLBA 1YQSA 2C6WB 4E3LA 3PBRA 4B88A 4LCLA 2Y2JA 3NI9A 4JXSA 3N8SA 4RX3A 1YT4A 5FSRA 2QPNA 5M19A 1S0WA 4DF6A 1NY0A 1CK3A 2Y2PA 3G2YA 3UDXA 3SS5A 4C3QA 3G4PA 5CHMA 1H8YA 1K6RA 3IXGA 3Q7ZA 2V1ZA 5FQQA 1E3UA 4BLMA 5A92A 2ZQCA 4KZ4A 4EV4A 2Y2LA 5DTTA 3WRTA 4BQMA 5FQJA 5AQ7A 3SH8A 3GVBA 3JYIA 3LO7A 3GV9A 3ITAA 4QY5A 1RGZA 3G32A 1YMSA 1SDNA 3PBTA 2ZC3B 4IEDA 3RJUA 3W4OA 4DE0A 1YMXA 2Y2HA 3DTMA 1XKZA 1LI0A 1IKIA 5HARA 5EPHA 3HBRA 4X56A 3OPLA 3ZG7B 2WKEA 4N92A 2Y2IA 4OOYA 1ES3A 3UNWA 3IF6C 2WADA 3UY6A 4S2PA 4E3KA 1L2SA 2XR0A 4BL2A 2H10A 1VM1A 1BUEA 1IYSA 3BFDA 2WK0A 1W5DA 1KVMA 4BL3A 2HP5A 3UE1A 4OP5A 1RP5A 4QHCA 3LY3A 5HX9A 4PM7A 2CC1A 2ZC4B 5E2FA 5KSHA 1K56D 1YLPA 2XK1A 1MWSA 4R4RA 2A3UA 1JWVA 4E3MA
chains in the Genus database with same CATH superfamily
4S2NC 4YNRA 2IWBA 5CEBA 2JKFA 1ZC2A 2Z2MB 3M2KA 4E6XA 4S2KA 4DE2A 1W79A 3E4QA 5FQIA 1NWZA 2EFUA 2L0WA 3DBAA 1WA9A 2Y2OA 3F1PA 1IOUA 3VE3A 4PM5A 4LV0A 2INWA 4WEKA 4JXWA 1SCWA 1DJAA 3QP4A 2OSUA 1UWPX 5CHUA 3WRZA 5J3WA 1Y54A 4UQIS 4OVDA 3N4IA 3LY4A 2HPBA 4CJNA 3U4LP 1L0EA 3Q81A 1K55A 5F82A 2Y55A 4JXVA 3SW1A 4X6TA 1Y4OA 3KSHA 3VP4A 5DTSA 1YLWA 5FATA 2P9VA 4KZ8A 3GSGA 1BULA 1XP4A 4F3LB 3A3FA 3TG9A 4UQIM 2QMIA 2BTFP 3MFDA 3S7NA 1BSGA 1IYQA 4R3AA 1SHVA 4OKPA 4GN2A 3MQ0A 1HTZA 1I2SA 5GHYA 5DF7A 3C7VA 1ESUA 3ITBA 3L9KA 5HW3A 4X25A 2C5WB 5L10A 4KZ3A 2Q9MA 3OCNA 3C38A 4LFUA 1EW0A 4OP8A 3NECA 5A93A 2Y91A 4ZDXA 3NC8A 4JGOA 1TDGA 3ZG0A 2Y8HA 4Y3IA 4R70A 4Z9QA 2H28A 1OTAA 4C6YA 5GLAA 4HI4A 3FKVA 3CZDA 5E2HA 3R4KA 5CX7A 5FI2A 4OPQA 1BYWA 1G68A 1GA9A 4KQDA 3RXXA 1F98A 1PZPA 5JYPA 2JN7A 4R1GA 4JF4A 5CERA 2QJ7A 1ALQA 1TEMA 3H7WA 1BLPA 4E6WA 4Y17A 1IYOA 3R7WA 3G2ZA 4Y15A 3V67A 1XXMA 1ES2A 4FTXA 1O07A 4L9GA 4R4SA 3WS0A 1BLHA 5HAPA 3B47A 2V8CA 3BWLA 5TGFA 2K7SA 1SZVA 3FPVA 1K6SA 3BYDA 1ZG4A 4P85A 1MBLA 4KZBA 5HPIA 2PRFA 1V9ZA 3CHWP 4GLQA 5CGXA 4CLCB 4U0XA 2OLUA 5AJGA 3OPRA 4Y2FA 4I3AA 3NULA 5DKKA 1RGYA 4F3LA 4XUXA 3HUOA 2W3FA 5EECA 3AGFA 4I38A 4WUJA 2WKPA 3LYXA 1IKGA 1FIKA 1W7FA 5AQAA 1OTDA 1KDSA 4N9KA 4L9EA 4C75A 1JVJA 2Y2MA 2JE5A 5TBMB 3UB6A 3O3VA 5F1GA 1ZKJA 1FCMA 1S67L 3F1OB 1VEUB 1XA7A 5EVEA 3UPNA 4Q8IA 4PPRA 4ZBEA 3ZNYA 2OV5A 3DTKA 2P04A 2XROA 5KZHA 3T4SA 4FCFA 4S2OA 2Y2QA 3BFEA 3BFGA 5G4ZA 3MFXA 1S4RA 3HVFA 5LBRA 2VGKA 2EX8A 1K38A 1K55C 4S2IA 4WMCD 1QMFA 2WGVA 3MXSA 4EUZA 2W0NA 2J8YA 3OOVA 5CTNA 3EGDC 4R3BA 5EVIB 5EVLA 3S7PA 1VETA 4QPRA 2XD5A 1XFNA 3BM6A 5FAQA 4EBLA 4IUHA 4K0WA 4K08A 4S2JA 3ZYTA 2Y2KA 1F5MA 1GHMA 3EEHA 2W3HA 2EA9A 1TS8A 3ISGA 1KE0A 4R6LA 3HLGA 4II7A 5FI7A 4UA6A 3T12B 3EOIA 3GTCA 4K91A 1H8ZA 1W63Q 4MN7A 4JF6A 3HUNA 2G2UA 3IXHA 4JGPA 3W8KA 4DJ3A 1PW1A 4YOFA 2PBDP 1Y28A 4FH4A 1E4DA 4MBFA 4KQQA 2XRNA 3PHYA 3UO9A 1MPLA 5EE8A 1YLJA 3EWKA 3TRCA 1F2KA 2VKSA 3NIAA 1HVBA 3UPPA 4LLOB 3T1RA 1N9NA 4CLCA 3Q1FA 4R0QA 4R38A 1TS0A 2I72A 3A0SA 3GQZA 3UE6A 3HLWA 1NRJA 4BMWA 2Y79A 2ZM2A 4JLFA 3FKWA 4EERA 4DXBA 3MQQA 4ID4A 3M6HA 2ACGA 2QYBA 1KE4A 3RXWA 2OWHA 1A0KA 1TVFA 3PBOA 4E3LA 3PBRA 2EWVA 4HJ6A 3T50A 5TBMA 4Q0JA 4YWZA 1YT4A 2QPNA 4G3WA 3DTEA 3KSFA 4DF6A 1CK3A 1XJ4A 4ZRRA 2NUTC 1H8YA 3IXGA 3KSGA 1P9WA 4BLMA 2P08A 2ZQCA 3WRTA 3SH8A 3LR4A 3GVBA 3JYIA 3G32A 4HQAA 3RJUA 2Y2HA 1LI0A 3HBRA 3P01A 3OPLA 3TE8A 2WKEA 4N92A 3UNWA 2XR0A 4BL2A 2L1MA 3LGOA 5HPFA 5HDSA 1RP5A 5FDSA 5KSHA 5EVIA 2QHKA 5IHVA 3HUMA 3DAVA 5E2EA 3IXBA 4X55A 5E43A 1GHIA 2VK3A 3F1PB 1X0OA 2WYXA 5GLDA 4BD1A 3C7UA 1BLCA 4I39A 3QP2A 4BWIA 3N8RA 4Q0HA 3UB7A 4BD0A 2YKHA 4DE1A 4MN5A 1D7EA 4K0XA 4GKUA 1LI9A 3QP8A 4HY8A 3ZHHA 1IFQA 4WELA 4UA7A 1LSXA 1MWUA 4HBTA 1H0MA 4U3TA 4NEED 3V39A 3MSHA 1Z09A 3A0RA 4GCZA 4XUZA 1HLUP 2P9VB 1Q2QA 1XPBA 1M6KA 1LT0A 1K57C 3UE3A 4PM8A 1J9MA 4KG5A 4DN0A 3LR3A 4X68A 3VSKA 3VMAA 2D01A 1LL8A 2EX9A 1S1YA 3BQ8A 5CRFA 5FASA 4BBVA 4Q0IA 2J7VA 4OLGA 3T4JA 2JBFA 4P6BA 1N9BA 3C5AA 4OQ0A 3ZG5A 1G28A 3O86A 1G6OA 3UPOA 4EEUA 3IS2A 1DJBA 1PW8A 3TOIA 3VFHA 3HLEA 2W1TA 4ZTKA 5AQBA 2VV7A 1DP9A 2XA7M 3PBNA 2PR5A 3A3DA 4AFIA 4JKTA 3JPUA 5HWWA 3BEBA 3OCLA 4KZ9A 3G30A 1NZUA 4O01A 3UB8A 4LGWA 4JF5A 4OPRA 3ZFZA 3ZG8B 4Y0UA 1SKFA 5I94A 4JGRA 2WZZA 2Q0OA 4LENA 1CF0A 4LV3A 3E0YA 1OJGA 1KGGA 5HZHA 1N4OA 2VX8A 4CPKA 1K56A 3IQAA 4CLCC 2BLSA 2H5SA 2KDKA 3RH8B 3LICA 4DJ2A 3NHQA 4HEFA 3H7WB 4UHUA 1MKIA 1XX2A 3R7WB 4O7DA 1NZOA 1O7EA 3LEZA 2ZOHA 3MXQA 2B02A 1RCJA 2WAFA 4QWOA 4KQRA 4PM6A 4H8RA 4B93A 2O9AA 3IWOA 4X69A 3D72A 3HLCA 3E4PA 1DJCA 1CI9A 5TR7A 3BFCA 2FFFB 4MBHA 3DW0A 5CGWA 3MZDA 1WYCA 3NCKA 3FYZA 3SZTA 1IEMA 5AVFA 2XLNA 3ZNTA 4MDZA 4DXCA 2VGJA 5HSQA 3S1YA 5FAOA 5F5YA 2QWSA 4CLCD 4WBGA 5I5LA 4DRTA 4GW9A 3PBQA 3NDGA 4GDNA 3BFFA 3HJIA 3CG5A 4BJPA 2PR6A 3JVVA 5EVIC 3IWQA 5EV0A 2O99A 2PU4A 4DDSA 2RL3A 2XSSA 5IU1A 2LB9A 2HDUA 4LRYC 2ZQDA 1NLZA 3OC2A 3V50A 3A3IA 5HD3A 2H0YA 3MXRA 2WKHA 2GX5A 4CLCE 1FCOA 2O9BA 2B5RA 2ZQ9A 1GCEA 3G34A 3CITA 1OTEA 5FEFA 4IBRA 1MKMA 2WKQA 3CLOA 1YLTA 4OQHA 3N6IA 3CWFA 2ZQ7A 1G5UA 1PYYA 1NXYA 4EETB 1TS7A 2W1RA 1CI8A 2Q9NA 5C5KA 2IWDA 3VFFA 5U47A 3V3RA 1PWDA 3T4KA 3N8LA 4ETXA 1VETB 3W4QA 1FR1A 1P9RA 4WZ5A 1LSVA 2E8JA 2QZ6A 1H5XA 1TDLA 5M18A 1I5QA 5EVID 5CTMA 1S66L 5EOEA 1EWZA 3D3OA 2XEPA 1GSVA 4Y0TA 2WZXA 3F1NB 3DWKA 4ME4A 1CQAA 4YINA 3NJAA 1JNUA 1FILA 2X71A 5L09A 3ZVTA 4F94A 3E4OA 3DWZA 5CXWA 3FWLA 2XFTA 4WN5A 1YM1A 3O88A 1I2WA 4WEJA 4I3JA 3BY9A 3G35A 2Z6DA 4OQGA 2WKRA 3KO6A 2ZC5B 3BLSA 1YAXA 4QB8A 4RVAA 3W4PA 3MBZA 3QNCA 4ZJ3A 2GNXA 3TJZC 1S4SA 2R9XA 2G2WA 5HD5A 5HAQA 1PI4A 3SS4A 2J3TC 1ERMA 3LI8A 2KX6A 5GHZA 1NLYA 2ZL1A 3IF5A 1W8YA 3KYZA 3LR0A 1LLBA 1YQSA 4LCLA 4LRZE 3NI9A 5AVEA 4XT2A 4RX3A 1K0KA 1S0WA 1MC0A 3SS5A 3NOPC 5FQQA 5A92A 1E3UA 5FQJA 5AQ7A 3ITAA 4MCWA 1YMSA 3PBTA 2ZC3B 3W4OA 2M1CA 3DTMA 1PRQA 1XKZA 3ZG7B 1S1ZA 4GS9B 1OTBA 4E3KA 2H10A 1BUEA 2G7UA 3H9WA 1W5DA 4NXGA 4OP5A 2DMWA 4PM7A 5E2FA 1K56D 4R4RA 4E3MA 5KIZA 3C4OA 3LIEA 3T1XA 3MZEA 2EXAA 4HJ3A 2J3TD 1XJ3A 3VP2A 3JVUA 2R9WA 1ES4A 1YLYA 3CUEA 3HJKA 2HV1A 4QU3A 3F1NA 1GSXA 2HJEA 1N9LA 5JYOA 4PKYA 2J3WA 2PBYA 4O8GA 3PR6A 4L0LA 4JBFA 2Y2GA 2JKTM 2P7JA 4QD4A 3L7HA 3IX4A 1HD8A 3KYEA 3GR2A 4BBTA 4E3IA 5K5BA 4M4XA 4E3JA 1T1BA 5E2GA 1FQGA 4IUKA 5HWVA 3S22A 2Y2NA 3ZCZA 5CECA 3IT9A 3IF6A 1T19A 2WGWA 3AGDA 2DNSA 5EOOA 5HFOA 1YSPA 3NOUC 5F83A 2V1BA 2J80A 4S2NA 1T1AA 5DJUA 2HGVA 3IWIA 4WZ5C 3OZHA 5D3OA 1GSWA 3IS2B 1LSWA 1XJ2A 2W1TB 1N9OA 4H6JA 5A8BA 5L2FA 5HDDA 3OPHA 2HDRA 5IS1A 3IH8A 3KX0X 5EM1A 3VOLA 3PAGA 3CMZA 1PNEA 4NETA 4M3KA 1M40A 3ZQ5A 4KZAA 3S7QA 4EU0A 4IVKA 2PHYA 4WLAA 5TJJA 4HJ4A 2A24B 2M7UA 4UAAA 4KENB 4ARZA 4GS9A 4IVIA 2MJ6A 1K25A 1OT6A 3BECA 3IBRA 3K3CA 1ACFA 5AQ9A 2VGLS 2VEAA 4RX2A 3W2ZA 2RCXA 1YKDA 1D1JA 4QY6A 2W27A 1ERQA 1DP8A 3QP5A 1QMEA 4JXGA 3GRJA 4A5RA 5A91A 4MEZA 1GA0A 2VGLM 5GLBA 4HH3A 5GLCA 1VQQA 1FSWA 3VOZA 1AWIA 3NBLA 4I5SA 4P6ZS 5FEGA 4G3KA 3LEQA 3TW8A 3LCEA 4IBXA 3ZDJA 4R3JA 3BJNA 3WWXA 2JCHA 3ZGAB 2VA0A 5F1FA 3NOTC 4GD6A 3V5MA 2V20A 4I3IA 1BLSA 4P6ZM 1K4FA 3NY4A 3RFBA 2V9AA 2XA7S 5FDHA 2JHEA 5J4EA 4LV1A 4KUKA 5DF8A 4EBPA 3OPPA 1ONGA 3UMEA 2Z6CA 3KYQA 3GMWA 5HL1A 3TSGA 2D02A 3CUEC 1BTLA 3Q7VA 3FPWA 4OONA 1UGUA 4FH2A 2VLGA 2WKIA 2Y4AA 1H3QA 4OPYA 2IWCA 3ZVWA 3MF0A 4G3VA 1KOUA 3MMHA 5J7EA 4OPZA 2QKPA 1E3UD 5CHJA 5EM0A 1XFQA 1Z6FA 3CPTA 3GECA 1DRMA 4P0MA 3EQUA 3I7JA 1FCNA 3QHYA 2A24A 4KZ5A 1ONHA 3SH7A 1ODVA 3LR5A 5FA7A 2XD1A 4XXRA 4EW7A 2ZM8A 4GZBA 4WMCA 3M2JA 1DY6A 2OWJA 3B33A 3E98A 5DVAA 5FQ9A 4FD8A 4OQIA 3FZCA 1Q2PA 2ZM0A 1YSQA 4GD8A 3FV7A 1WYBA 2AVXA 1UWNX 2EX6A 3FG8A 4IJGA 4KZ7A 4EBNA 4QJGA 3VE4A 2I9VA 3H82A 4R23A 1VHMA 2XDMA 3CI6A 1IELA 4P87A 4N1HA 2K2NA 2ZQAA 3P98A 3E2LA 1DP6A 4DE3A 2B95A 2ZJ9A 3D9YA 1VB6A 2ZC7A 1KVLA 4Y7PA 4EUVA 3A3JA 3O87A 4GDBA 1STZA 5A90A 1LHYA 3PTEA 1FR6A 2HDSA 1SKOA 3A0VA 3C8CA 3HCYA 3WS2A 1U60A 2XGNA 2VZWA 3UE0A 2JC7A 4WYYA 3N7WA 2H0TA 4GNUA 3VSLA 2UV0E 2ZL1B 4PAUA 4E3OA 4HH2A 5L8MA 1YPRA 2V1AA 2OAP1 5TFQA 4XT2B 2PYPA 2C6WB 3VV4A 4B88A 2HZ5A 2Y2JA 2LB5A 4JXSA 2EWWA 2QJ5A 1NY0A 4C3QA 5DKLA 3G4PA 2YKFA 5DFXA 5CHMA 3Q7ZA 2V1ZA 5DTTA 2PD7A 4BQMA 4QY5A 4IEDA 4NXEA 2V0WA 5EPHA 4CQHA 4OOYA 1ES3A 3T4QA 2JKTI 1L2SA 2A2LA 1IYSA 3BFDA 2VJWA 4IHQA 4BL3A 3EEAA 3UE1A 3LY3A 2CC1A 2ZC4B 3BY8A 2KOIA 1JWPA 1MWSA 2A3UA 3T4TA 2DCFA 5F69A 1P0ZA 3WS5A 5M1AA 5HWTA 1L3LA 3LIBA 5EFWA 4BBUA 1WE4A 4MN6A 4LV2A 3FC7A 2ZC6B 1IYPA 3LI9A 3S4XA 3E2KA 1NRFA 1ES5A 1SDEA 2FFYA 3MS6A 4WL9A 4OOLA 2J9OA 1L0FA 2WGIA 2HP6A 1ZG6A 1BT5A 3C30A 3IF6B 5FI6A 4MMNA 2KLIA 4B4XA 2X01A 1ZHHB 2HDQA 4U0TA 2WGWB 4KG6A 1LL5A 3Q07A 3T1SA 2PYRA 5HAIA 3UN7A 1EI5A 3G31A 1MWTA 3ICYA 3PBSA 2L4RA 4O0PA 5FL3A 1OJ5A 4Y13A 5BOHA 4EXOA 4H6JB 4GOGA 3IX3A 3IBJA 2Y59A 4KZ6A 2NUPC 1YLZA 2HF6A 5MC7A 3MQOA 3UDIA 3B42A 1KGFA 1L0DA 4HP9A 3WS4A 2FZ0A 1K54A 4B4ZA 1C3BA 4Y0OA 3QNBA 1CEFA 4KQOA 1NJ4A 3HLBA 1XGIA 4DMZA 4E3NA 4DKIA 4HBUA 2XQZA 2VV8A 4N9LA 2ZOIA 4UA9A 4EQIA 3G6OA 2JKRI 1JWZA 4NG2A 2IA2A 3C2WA 4ARZB 2Z2LB 2ZBBA 3BLMA 4ZAMA 5IT5A 2UWXA 1H8MA 3BRMA 4X1LA 4MBKA 1K57A 5DJTA 2CMNA 3VP3A 3NDEA 3UB9A 3RTYA 2B18A 5G4YA 4ZJ2A 5CEDA 4PKYG 2GDNA 4RA7A 5DF9A 2W3GA 3IXDA 1MWRA 4N1XA 1BZAA 3B3XA 4LCMA 5FQMA 3T4OA 3AGEA 1TD5A 3P7NA 1KDWA 3MZFA 1S6RA 2PDRA 2BG1A 1XGJA 1AXBA 3IX8A 2WAEA 2ZD8A 3CJMA 3UMDA 4Z1WA 4WF0A 1TF1A 4KUOA 3VOYA 4RQ9A 2W3DA 3PAEA 1LL9A 2A49A 5HL6A 3M6BA 5FAPA 1F9IA 1D06A 2ZQ8A 3BW6A 4HHDA 5DTKA 4HESA 4LRXC 4EEPA 2M7VA 3UB5P 1KGEA 4FOFA 5CGSA 1EROA 3MKEA 1XA1A 1HZOA 1OT9A 2PT7A 1PZOA 3QP1A 4S2MA 2OLVA 2OAQ1 1CJFA 3MKFA 1ZTUA 1TS6A 3P09A 1NYMA 2GJ3A 4GHIB 4KG2A 2JKGA 2GZAA 4ZJ1A 3IHAA 4GB7A 3D4FA 2V8FA 4DDYA 5HDCA 4FSFA 2J9PA 2O9CA 3DTIA 3SH9A 1J3WA 4BENA 4WZ4A 1ESIA 3HLFA 4EWFA 3Q7VB 3OBFA 2EXBA 4YFMA 1PWCA 3VP1A 2WUQA 4NK3A 4OH0A 5DFYA 4X53A 2HJ9C 1G6AA 5EUAA 1KE3A 1FSYA 3SOIA 1NYYA 5KSCA 2E8IA 1CEGA 4Y5FA 4LPZA 2EFXA 1MY8A 4ESPA 4B9OA 3MJQA 4MLLA 4JPMA 3IH9A 1L0GA 3EQVA 1OTIA 1XJ6A 3CPTB 3F1OA 4MNRA 1VEUA 3HL9A 5F6AA 3Q82A 4RYEA 3A3EA 5GHXA 2XFSA 3UDFA 2XF3A 2OOLA 3K3DA 1FOFA 3EGXC 1PWGA 2PU2A 5GL9A 3KSIA 1P97A 5KMWA 4HIAA 4NXFA 5F68A 1T1CA 3GDIA 2VV6A 3BQAA 3LIFA 1JTGA 1PIOA 2R78A 2V0UA 2V2FF 5J8XA 4NKPA 2FH5A 3LFVA 1T18A 4EQ1A 2JKRM 2ZLYA 2EX2A 3V3SA 3H82B 1PI5A 4PM9A 1W8QA 4HP4A 1E25A 1MZUA 3C4PA 3PYPA 4S2LA 3S7OA 2HP9A 1OMEA 2XH9A 4GJ4A 4D2OA 1K54C 3LUQA 3K2NA 5G18A 3HREA 4OLDA 1JTDA 3SS3A 4D60A 3PXPA 4X1MA 1MXOA 3LIDA 3OLOA 4EESA 2W3EA 3O5YA 3ZG9B 2O0YA 1SKOB 3T4LA 3U2AA 4WM9A 4OOMA 4ETZA 5FQKA 1PFLA 2K31A 2PD8A 3WS1A 2DRWA 3QP6A 5L07A 3MR0A 2X02A 4L9FA 2P74A 3ULFA 4JGQA 4GHIA 3HLDA 2ZMFA 2PAVP 1V9YA 1GHPA 4FUWA 4PMAA 3IHBA 4UEYA 1K4EA 2ZMAA 3VP0A 4HOIA 1W63M 1OPXA 3N8SA 3CAXA 5FSRA 5M19A 3G2YA 2Y2PA 3UDXA 2BASA 1K6RA 4KZ4A 4EV4A 2Y2LA 3T1QB 3LO7A 3GV9A 1RGZA 1SDNA 4NXBA 4DE0A 4PHTA 1YMXA 1IKIA 5HARA 4X56A 2Y2IA 3IF6C 2WADA 3LIAA 3UY6A 4S2PA 2ZMVA 1VM1A 4HNBA 2WK0A 1KVMA 2HP5A 4QHCA 1YLPA 2XK1A 5HX9A 1JWVA 4E04A
chains in the Genus database with same CATH topology
4S2NC 5IHVA 3HUMA 2DCFA 3C4OA 3MZEA 5E2EA 2IWBA 2EXAA 3WS5A 5M1AA 5CEBA 3IXBA 4X55A 1ZC2A 1GHIA 2Z2MB 3M2KA 5E43A 5EVIA 4S2KA 4E6XA 3VP2A 1WE4A 2R9WA 1ES4A 4LV2A 4DE2A 1W79A 1YLYA 5FQIA 2WYXA 2EFUA 5GLDA 2ZC6B 4QU3A 2Y2OA 4BD1A 3C7UA 1BLCA 1IYPA 3S4XA 4PM5A 5JYOA 3E2KA 3N8RA 4LV0A 4BD0A 4DE1A 4WEKA 1NRFA 1SCWA 1DJAA 2PBYA 4JXWA 1ES5A 4L0LA 1SDEA 2OSUA 4JBFA 4K0XA 4GKUA 1LI9A 3ZHHA 2Y2GA 4QD4A 2FFYA 5CHUA 3WRZA 1HD8A 3GR2A 4OOLA 4WELA 1Y54A 2J9OA 4UA7A 1MWUA 4HBTA 4E3IA 4OVDA 1L0FA 2WGIA 2HP6A 1ZG6A 4E3JA 1BT5A 4U3TA 3IF6B 3N4IA 5FI6A 3LY4A 3V39A 5E2GA 1FQGA 2HPBA 4CJNA 3S22A 4B4XA 4XUZA 1L0EA 2Y2NA 3Q81A 2HDQA 1K55A 2X01A 5F82A 2Y55A 3ZCZA 4U0TA 5CECA 2WGWB 2P9VB 3IF6A 1Q2QA 1XPBA 3IT9A 4JXVA 1M6KA 4X6TA 4KG6A 1K57C 1LL5A 3Q07A 3VP4A 5DTSA 1YLWA 3UE3A 5FATA 2WGWA 2P9VA 4KZ8A 3AGDA 3GSGA 4PM8A 5HAIA 1J9MA 2DNSA 3UN7A 1EI5A 3G31A 4KG5A 5EOOA 1BULA 1MWTA 5HFOA 3PBSA 1XP4A 3A3FA 3TG9A 4X68A 5F83A 3VSKA 3VMAA 4S2NA 2EX9A 2QMIA 5CRFA 3IWIA 3MFDA 5BOHA 5FASA 2J7VA 4OLGA 2JBFA 1BSGA 1IYQA 4GOGA 1N9BA 1SHVA 3C5AA 3OZHA 4OQ0A 4P6BA 4WZ5C 5D3OA 4OKPA 2Y59A 4KZ6A 3ZG5A 4GN2A 1YLZA 3UDIA 1KGFA 1L0DA 3O86A 3UPOA 1HTZA 1DJBA 1PW8A 3TOIA 3VFHA 5L2FA 1I2SA 3HLEA 3OPHA 3WS4A 4ZTKA 5GHYA 1K54A 4B4ZA 5DF7A 5AQBA 2HDRA 1C3BA 4Y0OA 3C7VA 3QNBA 1CEFA 1ESUA 4KQOA 1NJ4A 3IH8A 3ITBA 3HLBA 1XGIA 4E3NA 3PAGA 5HW3A 4DKIA 4HBUA 3CMZA 2XQZA 2C5WB 4NETA 3PBNA 4M3KA 3A3DA 4N9LA 1M40A 4UA9A 4JKTA 4KZ3A 4EQIA 2Q9MA 3BEBA 3OCNA 3OCLA 4KZAA 4KZ9A 3G30A 1NZUA 1JWZA 4JF5A 4OPRA 3ZFZA 4OP8A 3ZG8B 2Z2LB 4Y0UA 4IVKA 3BLMA 1SKFA 4ZAMA 2UWXA 5A93A 5I94A 2Y91A 2WZZA 4LENA 3BRMA 4ZDXA 3NC8A 4LV3A 4MBKA 3ZG0A 1TDGA 4UAAA 4KENB 1K57A 1KGGA 4IVIA 1K25A 3NDEA 3VP3A 4Z9QA 1N4OA 3BECA 4ZJ2A 4CPKA 5CEDA 4C6YA 2GDNA 5GLAA 5AQ9A 1K56A 3FKVA 3CZDA 4RA7A 5DF9A 5E2HA 3IQAA 5FI2A 3IXDA 1MWRA 4OPQA 2BLSA 4N1XA 2H5SA 4RX2A 1BZAA 1G68A 2RCXA 1GA9A 3B3XA 4LCMA 5FQMA 3RXXA 4HEFA 1PZPA 5JYPA 4QY6A 4UHUA 1MKIA 3AGEA 4R1GA 1XX2A 4JF4A 1ERQA 5CERA 1KDWA 3MZFA 1S6RA 2BG1A 4O7DA 1ALQA 1TEMA 1XGJA 1QMEA 1NZOA 1AXBA 1BLPA 4E6WA 1O7EA 3LEZA 4JXGA 1IYOA 3G2ZA 3GRJA 2WAEA 2ZD8A 4A5RA 3CJMA 1RCJA 5A91A 2WAFA 4MEZA 1GA0A 1XXMA 1ES2A 4KQRA 4PM6A 3VOYA 4H8RA 5GLBA 1O07A 5GLCA 1VQQA 1FSWA 3PAEA 3VOZA 1LL9A 3IWOA 3NBLA 4X69A 2A49A 4R4SA 3WS0A 3M6BA 5FAPA 1BLHA 3HLCA 3LCEA 2ZQ8A 1DJCA 4IBXA 5HAPA 5DTKA 4HESA 1CI9A 3ZDJA 4R3JA 5TR7A 3BFCA 2FFFB 5TGFA 3WWXA 4MBHA 3DW0A 1KGEA 5CGWA 3MZDA 1K6SA 2JCHA 1ZG4A 1WYCA 3BYDA 4P85A 5CGSA 3NCKA 1EROA 1MBLA 3ZGAB 3MKEA 4KZBA 3FYZA 1IEMA 5F1FA 1XA1A 4GD6A 1HZOA 3V5MA 5CGXA 2V20A 2XLNA 3ZNTA 1BLSA 1PZOA 4DXCA 4S2MA 4U0XA 2VGJA 2OLVA 3MKFA 1K4FA 3NY4A 3S1YA 2OLUA 5FAOA 3OPRA 4WBGA 3P09A 1NYMA 4DRTA 4KG2A 5FDHA 1RGYA 4XUXA 4ZJ1A 3HUOA 3PBQA 3IHAA 4GB7A 3NDGA 3D4FA 4GDNA 3AGFA 4LV1A 5EECA 4DDYA 3BFFA 4FSFA 1IKGA 2J9PA 1W7FA 3CG5A 5AQAA 4BJPA 5EVIC 5DF8A 3SH9A 4EBPA 3IWQA 3OPPA 4BENA 2PU4A 4DDSA 2RL3A 4WZ4A 1ESIA 1ONGA 3HLFA 4EWFA 2HDUA 1KDSA 2ZQDA 3OC2A 3Q7VB 4N9KA 3V50A 2EXBA 4YFMA 1PWCA 3VP1A 3A3IA 4C75A 3GMWA 1JVJA 2WUQA 4NK3A 2Y2MA 5HL1A 2JE5A 4OH0A 4X53A 3TSGA 3O3VA 3Q7VA 1BTLA 2H0YA 1ZKJA 1G6AA 5EUAA 5F1GA 1KE3A 1FSYA 1FCMA 3MXRA 3SOIA 1NYYA 2WKHA 4OONA 4FH2A 5KSCA 2WKIA 1FCOA 2E8IA 1CEGA 2Y4AA 2B5RA 2EFXA 1MY8A 1XA7A 2ZQ9A 4OPYA 4MLLA 2IWCA 3UPNA 1GCEA 4Q8IA 4JPMA 3IH9A 4PPRA 4ZBEA 1L0GA 3EQVA 3ZVWA 3ZNYA 2OV5A 3G34A 4MNRA 3HL9A 5KZHA 4OPZA 4IBRA 3Q82A 1E3UD 4RYEA 5CHJA 1Z6FA 3A3EA 4FCFA 4S2OA 2Y2QA 5GHXA 2XFSA 1YLTA 4OQHA 4P0MA 3BFEA 3BFGA 3EQUA 3I7JA 1FCNA 3UDFA 3QHYA 3N6IA 4KZ5A 2ZQ7A 1ONHA 3HVFA 3SH7A 2VGKA 2EX8A 1PYYA 1K38A 2XF3A 5FA7A 1NXYA 2XD1A 1FOFA 1CI8A 2Q9NA 3VFFA 2IWDA 1PWGA 1K55C 5U47A 1PWDA 2PU2A 4XXRA 5GL9A 3V3RA 3N8LA 4S2IA 2ZM8A 4GZBA 4WMCA 1QMFA 4WMCD 2WGVA 3MXSA 4EUZA 5KMWA 2J8YA 5CTNA 3W4QA 3M2JA 1DY6A 4R3BA 1FR1A 4WZ5A 1JTGA 5EVIB 1PIOA 5EVLA 2QZ6A 1H5XA 1TDLA 2V2FF 5DVAA 5FQ9A 2XD5A 4FD8A 4OQIA 5J8XA 5M18A 3FZCA 3BM6A 5FAQA 1Q2PA 4EBLA 1I5QA 5EVID 5CTMA 4K0WA 2ZM0A 2ZLYA 5EOEA 4S2JA 1EWZA 4GD8A 3FV7A 1WYBA 2EX2A 2XEPA 3V3SA 4Y0TA 2Y2KA 2EX6A 4KZ7A 1GHMA 1PI5A 4PM9A 4EBNA 2WZXA 1W8QA 4QJGA 3DWKA 3ISGA 1E25A 1KE0A 3C4PA 3HLGA 4R23A 2XDMA 4S2LA 1IELA 5FI7A 4UA6A 4YINA 2HP9A 3GTCA 1OMEA 2XH9A 4K91A 4N1HA 4P87A 1H8ZA 4D2OA 4JF6A 1K54C 2ZQAA 3P98A 3E2LA 3HUNA 2G2UA 2X71A 4DE3A 3IXHA 2ZJ9A 3W8KA 5G18A 1PW1A 3HREA 4OLDA 1JTDA 2ZC7A 1KVLA 3SS3A 4FH4A 4Y7PA 3ZVTA 1E4DA 4MBFA 4KQQA 3A3JA 4F94A 3O87A 1MXOA 3UO9A 3DWZA 1MPLA 5CXWA 3FWLA 2XFTA 5EE8A 1YLJA 3ZG9B 4GDBA 5A90A 1LHYA 3PTEA 4WM9A 1FR6A 1YM1A 4OOMA 3O88A 3NIAA 5FQKA 1HVBA 1I2WA 2HDSA 4WEJA 3UPPA 3G35A 3WS1A 4OQGA 3Q1FA 2DRWA 4R0QA 2ZC5B 3BLSA 4RVAA 4QB8A 3W4PA 3MBZA 3QNCA 4ZJ3A 2I72A 2X02A 3WS2A 2P74A 1U60A 1JWPA 2XGNA 3GQZA 2R9XA 3HLDA 3UE0A 2JC7A 3HLWA 4WYYA 2G2WA 2ZM2A 4JLFA 3N7WA 3FKWA 1GHPA 4DXBA 2H0TA 4GNUA 3VSLA 1PI4A 5HAQA 4PMAA 3IHBA 4ID4A 3M6HA 3SS4A 4E3OA 1KE4A 3RXWA 1K4EA 1ERMA 2ZMAA 5GHZA 1TVFA 3PBOA 3IF5A 5TFQA 3VP0A 1W8YA 1LLBA 1YQSA 2C6WB 4E3LA 3PBRA 4B88A 4LCLA 2Y2JA 3NI9A 4JXSA 3N8SA 4RX3A 1YT4A 5FSRA 2QPNA 5M19A 1S0WA 4DF6A 1NY0A 1CK3A 2Y2PA 3G2YA 3UDXA 3SS5A 4C3QA 3G4PA 5CHMA 1H8YA 1K6RA 3IXGA 3Q7ZA 2V1ZA 5FQQA 1E3UA 4BLMA 5A92A 2ZQCA 4KZ4A 4EV4A 2Y2LA 5DTTA 3WRTA 4BQMA 5FQJA 5AQ7A 3SH8A 3GVBA 3JYIA 3LO7A 3GV9A 3ITAA 4QY5A 1RGZA 3G32A 1YMSA 1SDNA 3PBTA 2ZC3B 4IEDA 3RJUA 3W4OA 4DE0A 1YMXA 2Y2HA 3DTMA 1XKZA 1LI0A 1IKIA 5HARA 5EPHA 3HBRA 4X56A 3OPLA 3ZG7B 2WKEA 4N92A 2Y2IA 4OOYA 1ES3A 3UNWA 3IF6C 2WADA 3UY6A 4S2PA 4E3KA 1L2SA 2XR0A 4BL2A 2H10A 1VM1A 1BUEA 1IYSA 3BFDA 2WK0A 1W5DA 1KVMA 4BL3A 2HP5A 3UE1A 4OP5A 1RP5A 4QHCA 3LY3A 5HX9A 4PM7A 2CC1A 2ZC4B 5E2FA 5KSHA 1K56D 1YLPA 2XK1A 1MWSA 4R4RA 2A3UA 1JWVA 4E3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S2N C;  5IHV A;  3HUM A;  2DCF A;  3C4O A;  3MZE A;  5E2E A;  2IWB A;  2EXA A;  3WS5 A;  5M1A A;  5CEB A;  3IXB A;  4X55 A;  1ZC2 A;  1GHI A;  2Z2M B;  3M2K A;  5E43 A;  5EVI A;  4S2K A;  4E6X A;  3VP2 A;  1WE4 A;  2R9W A;  1ES4 A;  4LV2 A;  4DE2 A;  1W79 A;  1YLY A;  5FQI A;  2WYX A;  2EFU A;  5GLD A;  2ZC6 B;  4QU3 A;  2Y2O A;  4BD1 A;  3C7U A;  1BLC A;  1IYP A;  3S4X A;  4PM5 A;  5JYO A;  3E2K A;  3N8R A;  4LV0 A;  4BD0 A;  4DE1 A;  4WEK A;  1NRF A;  1SCW A;  1DJA A;  2PBY A;  4JXW A;  1ES5 A;  4L0L A;  1SDE A;  2OSU A;  4JBF A;  4K0X A;  4GKU A;  1LI9 A;  3ZHH A;  2Y2G A;  4QD4 A;  2FFY A;  5CHU A;  3WRZ A;  1HD8 A;  3GR2 A;  4OOL A;  4WEL A;  1Y54 A;  2J9O A;  4UA7 A;  1MWU A;  4HBT A;  4E3I A;  4OVD A;  1L0F A;  2WGI A;  2HP6 A;  1ZG6 A;  4E3J A;  1BT5 A;  4U3T A;  3IF6 B;  3N4I A;  5FI6 A;  3LY4 A;  3V39 A;  5E2G A;  1FQG A;  2HPB A;  4CJN A;  3S22 A;  4B4X A;  4XUZ A;  1L0E A;  2Y2N A;  3Q81 A;  2HDQ A;  1K55 A;  2X01 A;  5F82 A;  2Y55 A;  3ZCZ A;  4U0T A;  5CEC A;  2WGW B;  2P9V B;  3IF6 A;  1Q2Q A;  1XPB A;  3IT9 A;  4JXV A;  1M6K A;  4X6T A;  4KG6 A;  1K57 C;  1LL5 A;  3Q07 A;  3VP4 A;  5DTS A;  1YLW A;  3UE3 A;  5FAT A;  2WGW A;  2P9V A;  4KZ8 A;  3AGD A;  3GSG A;  4PM8 A;  5HAI A;  1J9M A;  2DNS A;  3UN7 A;  1EI5 A;  3G31 A;  4KG5 A;  5EOO A;  1BUL A;  1MWT A;  5HFO A;  3PBS A;  1XP4 A;  3A3F A;  3TG9 A;  4X68 A;  5F83 A;  3VSK A;  3VMA A;  4S2N A;  2EX9 A;  2QMI A;  5CRF A;  3IWI A;  3MFD A;  5BOH A;  5FAS A;  2J7V A;  4OLG A;  2JBF A;  1BSG A;  1IYQ A;  4GOG A;  1N9B A;  1SHV A;  3C5A A;  3OZH A;  4OQ0 A;  4P6B A;  4WZ5 C;  5D3O A;  4OKP A;  2Y59 A;  4KZ6 A;  3ZG5 A;  4GN2 A;  1YLZ A;  3UDI A;  1KGF A;  1L0D A;  3O86 A;  3UPO A;  1HTZ A;  1DJB A;  1PW8 A;  3TOI A;  3VFH A;  5L2F A;  1I2S A;  3HLE A;  3OPH A;  3WS4 A;  4ZTK A;  5GHY A;  1K54 A;  4B4Z A;  5DF7 A;  5AQB A;  2HDR A;  1C3B A;  4Y0O A;  3C7V A;  3QNB A;  1CEF A;  1ESU A;  4KQO A;  1NJ4 A;  3IH8 A;  3ITB A;  3HLB A;  1XGI A;  4E3N A;  3PAG A;  5HW3 A;  4DKI A;  4HBU A;  3CMZ A;  2XQZ A;  2C5W B;  4NET A;  3PBN A;  4M3K A;  3A3D A;  4N9L A;  1M40 A;  4UA9 A;  4JKT A;  4KZ3 A;  4EQI A;  2Q9M A;  3BEB A;  3OCN A;  3OCL A;  4KZA A;  4KZ9 A;  3G30 A;  1NZU A;  1JWZ A;  4JF5 A;  4OPR A;  3ZFZ A;  4OP8 A;  3ZG8 B;  2Z2L B;  4Y0U A;  4IVK A;  3BLM A;  1SKF A;  4ZAM A;  2UWX A;  5A93 A;  5I94 A;  2Y91 A;  2WZZ A;  4LEN A;  3BRM A;  4ZDX A;  3NC8 A;  4LV3 A;  4MBK A;  3ZG0 A;  1TDG A;  4UAA A;  4KEN B;  1K57 A;  1KGG A;  4IVI A;  1K25 A;  3NDE A;  3VP3 A;  4Z9Q A;  1N4O A;  3BEC A;  4ZJ2 A;  4CPK A;  5CED A;  4C6Y A;  2GDN A;  5GLA A;  5AQ9 A;  1K56 A;  3FKV A;  3CZD A;  4RA7 A;  5DF9 A;  5E2H A;  3IQA A;  5FI2 A;  3IXD A;  1MWR A;  4OPQ A;  2BLS A;  4N1X A;  2H5S A;  4RX2 A;  1BZA A;  1G68 A;  2RCX A;  1GA9 A;  3B3X A;  4LCM A;  5FQM A;  3RXX A;  4HEF A;  1PZP A;  5JYP A;  4QY6 A;  4UHU A;  1MKI A;  3AGE A;  4R1G A;  1XX2 A;  4JF4 A;  1ERQ A;  5CER A;  1KDW A;  3MZF A;  1S6R A;  2BG1 A;  4O7D A;  1ALQ A;  1TEM A;  1XGJ A;  1QME A;  1NZO A;  1AXB A;  1BLP A;  4E6W A;  1O7E A;  3LEZ A;  4JXG A;  1IYO A;  3G2Z A;  3GRJ A;  2WAE A;  2ZD8 A;  4A5R A;  3CJM A;  1RCJ A;  5A91 A;  2WAF A;  4MEZ A;  1GA0 A;  1XXM A;  1ES2 A;  4KQR A;  4PM6 A;  3VOY A;  4H8R A;  5GLB A;  1O07 A;  5GLC A;  1VQQ A;  1FSW A;  3PAE A;  3VOZ A;  1LL9 A;  3IWO A;  3NBL A;  4X69 A;  2A49 A;  4R4S A;  3WS0 A;  3M6B A;  5FAP A;  1BLH A;  3HLC A;  3LCE A;  2ZQ8 A;  1DJC A;  4IBX A;  5HAP A;  5DTK A;  4HES A;  1CI9 A;  3ZDJ A;  4R3J A;  5TR7 A;  3BFC A;  2FFF B;  5TGF A;  3WWX A;  4MBH A;  3DW0 A;  1KGE A;  5CGW A;  3MZD A;  1K6S A;  2JCH A;  1ZG4 A;  1WYC A;  3BYD A;  4P85 A;  5CGS A;  3NCK A;  1ERO A;  1MBL A;  3ZGA B;  3MKE A;  4KZB A;  3FYZ A;  1IEM A;  5F1F A;  1XA1 A;  4GD6 A;  1HZO A;  3V5M A;  5CGX A;  2V20 A;  2XLN A;  3ZNT A;  1BLS A;  1PZO A;  4DXC A;  4S2M A;  4U0X A;  2VGJ A;  2OLV A;  3MKF A;  1K4F A;  3NY4 A;  3S1Y A;  2OLU A;  5FAO A;  3OPR A;  4WBG A;  3P09 A;  1NYM A;  4DRT A;  4KG2 A;  5FDH A;  1RGY A;  4XUX A;  4ZJ1 A;  3HUO A;  3PBQ A;  3IHA A;  4GB7 A;  3NDG A;  3D4F A;  4GDN A;  3AGF A;  4LV1 A;  5EEC A;  4DDY A;  3BFF A;  4FSF A;  1IKG A;  2J9P A;  1W7F A;  3CG5 A;  5AQA A;  4BJP A;  5EVI C;  5DF8 A;  3SH9 A;  4EBP A;  3IWQ A;  3OPP A;  4BEN A;  2PU4 A;  4DDS A;  2RL3 A;  4WZ4 A;  1ESI A;  1ONG A;  3HLF A;  4EWF A;  2HDU A;  1KDS A;  2ZQD A;  3OC2 A;  3Q7V B;  4N9K A;  3V50 A;  2EXB A;  4YFM A;  1PWC A;  3VP1 A;  3A3I A;  4C75 A;  3GMW A;  1JVJ A;  2WUQ A;  4NK3 A;  2Y2M A;  5HL1 A;  2JE5 A;  4OH0 A;  4X53 A;  3TSG A;  3O3V A;  3Q7V A;  1BTL A;  2H0Y A;  1ZKJ A;  1G6A A;  5EUA A;  5F1G A;  1KE3 A;  1FSY A;  1FCM A;  3MXR A;  3SOI A;  1NYY A;  2WKH A;  4OON A;  4FH2 A;  5KSC A;  2WKI A;  1FCO A;  2E8I A;  1CEG A;  2Y4A A;  2B5R A;  2EFX A;  1MY8 A;  1XA7 A;  2ZQ9 A;  4OPY A;  4MLL A;  2IWC A;  3UPN A;  1GCE A;  4Q8I A;  4JPM A;  3IH9 A;  4PPR A;  4ZBE A;  1L0G A;  3EQV A;  3ZVW A;  3ZNY A;  2OV5 A;  3G34 A;  4MNR A;  3HL9 A;  5KZH A;  4OPZ A;  4IBR A;  3Q82 A;  1E3U D;  4RYE A;  5CHJ A;  1Z6F A;  3A3E A;  4FCF A;  4S2O A;  2Y2Q A;  5GHX A;  2XFS A;  1YLT A;  4OQH A;  4P0M A;  3BFE A;  3BFG A;  3EQU A;  3I7J A;  1FCN A;  3UDF A;  3QHY A;  3N6I A;  4KZ5 A;  2ZQ7 A;  1ONH A;  3HVF A;  3SH7 A;  2VGK A;  2EX8 A;  1PYY A;  1K38 A;  2XF3 A;  5FA7 A;  1NXY A;  2XD1 A;  1FOF A;  1CI8 A;  2Q9N A;  3VFF A;  2IWD A;  1PWG A;  1K55 C;  5U47 A;  1PWD A;  2PU2 A;  4XXR A;  5GL9 A;  3V3R A;  3N8L A;  4S2I A;  2ZM8 A;  4GZB A;  4WMC A;  1QMF A;  4WMC D;  2WGV A;  3MXS A;  4EUZ A;  5KMW A;  2J8Y A;  5CTN A;  3W4Q A;  3M2J A;  1DY6 A;  4R3B A;  1FR1 A;  4WZ5 A;  1JTG A;  5EVI B;  1PIO A;  5EVL A;  2QZ6 A;  1H5X A;  1TDL A;  2V2F F;  5DVA A;  5FQ9 A;  2XD5 A;  4FD8 A;  4OQI A;  5J8X A;  5M18 A;  3FZC A;  3BM6 A;  5FAQ A;  1Q2P A;  4EBL A;  1I5Q A;  5EVI D;  5CTM A;  4K0W A;  2ZM0 A;  2ZLY A;  5EOE A;  4S2J A;  1EWZ A;  4GD8 A;  3FV7 A;  1WYB A;  2EX2 A;  2XEP A;  3V3S A;  4Y0T A;  2Y2K A;  2EX6 A;  4KZ7 A;  1GHM A;  1PI5 A;  4PM9 A;  4EBN A;  2WZX A;  1W8Q A;  4QJG A;  3DWK A;  3ISG A;  1E25 A;  1KE0 A;  3C4P A;  3HLG A;  4R23 A;  2XDM A;  4S2L A;  1IEL A;  5FI7 A;  4UA6 A;  4YIN A;  2HP9 A;  3GTC A;  1OME A;  2XH9 A;  4K91 A;  4N1H A;  4P87 A;  1H8Z A;  4D2O A;  4JF6 A;  1K54 C;  2ZQA A;  3P98 A;  3E2L A;  3HUN A;  2G2U A;  2X71 A;  4DE3 A;  3IXH A;  2ZJ9 A;  3W8K A;  5G18 A;  1PW1 A;  3HRE A;  4OLD A;  1JTD A;  2ZC7 A;  1KVL A;  3SS3 A;  4FH4 A;  4Y7P A;  3ZVT A;  1E4D A;  4MBF A;  4KQQ A;  3A3J A;  4F94 A;  3O87 A;  1MXO A;  3UO9 A;  3DWZ A;  1MPL A;  5CXW A;  3FWL A;  2XFT A;  5EE8 A;  1YLJ A;  3ZG9 B;  4GDB A;  5A90 A;  1LHY A;  3PTE A;  4WM9 A;  1FR6 A;  1YM1 A;  4OOM A;  3O88 A;  3NIA A;  5FQK A;  1HVB A;  1I2W A;  2HDS A;  4WEJ A;  3UPP A;  3G35 A;  3WS1 A;  4OQG A;  3Q1F A;  2DRW A;  4R0Q A;  2ZC5 B;  3BLS A;  4RVA A;  4QB8 A;  3W4P A;  3MBZ A;  3QNC A;  4ZJ3 A;  2I72 A;  2X02 A;  3WS2 A;  2P74 A;  1U60 A;  1JWP A;  2XGN A;  3GQZ A;  2R9X A;  3HLD A;  3UE0 A;  2JC7 A;  3HLW A;  4WYY A;  2G2W A;  2ZM2 A;  4JLF A;  3N7W A;  3FKW A;  1GHP A;  4DXB A;  2H0T A;  4GNU A;  3VSL A;  1PI4 A;  5HAQ A;  4PMA A;  3IHB A;  4ID4 A;  3M6H A;  3SS4 A;  4E3O A;  1KE4 A;  3RXW A;  1K4E A;  1ERM A;  2ZMA A;  5GHZ A;  1TVF A;  3PBO A;  3IF5 A;  5TFQ A;  3VP0 A;  1W8Y A;  1LLB A;  1YQS A;  2C6W B;  4E3L A;  3PBR A;  4B88 A;  4LCL A;  2Y2J A;  3NI9 A;  4JXS A;  3N8S A;  4RX3 A;  1YT4 A;  5FSR A;  2QPN A;  5M19 A;  1S0W A;  4DF6 A;  1NY0 A;  1CK3 A;  2Y2P A;  3G2Y A;  3UDX A;  3SS5 A;  4C3Q A;  3G4P A;  5CHM A;  1H8Y A;  1K6R A;  3IXG A;  3Q7Z A;  2V1Z A;  5FQQ A;  1E3U A;  4BLM A;  5A92 A;  2ZQC A;  4KZ4 A;  4EV4 A;  2Y2L A;  5DTT A;  3WRT A;  4BQM A;  5FQJ A;  5AQ7 A;  3SH8 A;  3GVB A;  3JYI A;  3LO7 A;  3GV9 A;  3ITA A;  4QY5 A;  1RGZ A;  3G32 A;  1YMS A;  1SDN A;  3PBT A;  2ZC3 B;  4IED A;  3RJU A;  3W4O A;  4DE0 A;  1YMX A;  2Y2H A;  3DTM A;  1XKZ A;  1LI0 A;  1IKI A;  5HAR A;  5EPH A;  3HBR A;  4X56 A;  3OPL A;  3ZG7 B;  2WKE A;  4N92 A;  2Y2I A;  4OOY A;  1ES3 A;  3UNW A;  3IF6 C;  2WAD A;  3UY6 A;  4S2P A;  4E3K A;  1L2S A;  2XR0 A;  4BL2 A;  2H10 A;  1VM1 A;  1BUE A;  1IYS A;  3BFD A;  2WK0 A;  1W5D A;  1KVM A;  4BL3 A;  2HP5 A;  3UE1 A;  4OP5 A;  1RP5 A;  4QHC A;  3LY3 A;  5HX9 A;  4PM7 A;  2CC1 A;  2ZC4 B;  5E2F A;  5KSH A;  1K56 D;  1YLP A;  2XK1 A;  1MWS A;  4R4R A;  2A3U A;  1JWV A;  4E3M A; 
#chains in the Genus database with same CATH topology
 4S2N C;  4YNR A;  2IWB A;  5CEB A;  2JKF A;  1ZC2 A;  2Z2M B;  3M2K A;  4E6X A;  4S2K A;  4DE2 A;  1W79 A;  3E4Q A;  5FQI A;  1NWZ A;  2EFU A;  2L0W A;  3DBA A;  1WA9 A;  2Y2O A;  3F1P A;  1IOU A;  3VE3 A;  4PM5 A;  4LV0 A;  2INW A;  4WEK A;  4JXW A;  1SCW A;  1DJA A;  3QP4 A;  2OSU A;  1UWP X;  5CHU A;  3WRZ A;  5J3W A;  1Y54 A;  4UQI S;  4OVD A;  3N4I A;  3LY4 A;  2HPB A;  4CJN A;  3U4L P;  1L0E A;  3Q81 A;  1K55 A;  5F82 A;  2Y55 A;  4JXV A;  3SW1 A;  4X6T A;  1Y4O A;  3KSH A;  3VP4 A;  5DTS A;  1YLW A;  5FAT A;  2P9V A;  4KZ8 A;  3GSG A;  1BUL A;  1XP4 A;  4F3L B;  3A3F A;  3TG9 A;  4UQI M;  2QMI A;  2BTF P;  3MFD A;  3S7N A;  1BSG A;  1IYQ A;  4R3A A;  1SHV A;  4OKP A;  4GN2 A;  3MQ0 A;  1HTZ A;  1I2S A;  5GHY A;  5DF7 A;  3C7V A;  1ESU A;  3ITB A;  3L9K A;  5HW3 A;  4X25 A;  2C5W B;  5L10 A;  4KZ3 A;  2Q9M A;  3OCN A;  3C38 A;  4LFU A;  1EW0 A;  4OP8 A;  3NEC A;  5A93 A;  2Y91 A;  4ZDX A;  3NC8 A;  4JGO A;  1TDG A;  3ZG0 A;  2Y8H A;  4Y3I A;  4R70 A;  4Z9Q A;  2H28 A;  1OTA A;  4C6Y A;  5GLA A;  4HI4 A;  3FKV A;  3CZD A;  5E2H A;  3R4K A;  5CX7 A;  5FI2 A;  4OPQ A;  1BYW A;  1G68 A;  1GA9 A;  4KQD A;  3RXX A;  1F98 A;  1PZP A;  5JYP A;  2JN7 A;  4R1G A;  4JF4 A;  5CER A;  2QJ7 A;  1ALQ A;  1TEM A;  3H7W A;  1BLP A;  4E6W A;  4Y17 A;  1IYO A;  3R7W A;  3G2Z A;  4Y15 A;  3V67 A;  1XXM A;  1ES2 A;  4FTX A;  1O07 A;  4L9G A;  4R4S A;  3WS0 A;  1BLH A;  5HAP A;  3B47 A;  2V8C A;  3BWL A;  5TGF A;  2K7S A;  1SZV A;  3FPV A;  1K6S A;  3BYD A;  1ZG4 A;  4P85 A;  1MBL A;  4KZB A;  5HPI A;  2PRF A;  1V9Z A;  3CHW P;  4GLQ A;  5CGX A;  4CLC B;  4U0X A;  2OLU A;  5AJG A;  3OPR A;  4Y2F A;  4I3A A;  3NUL A;  5DKK A;  1RGY A;  4F3L A;  4XUX A;  3HUO A;  2W3F A;  5EEC A;  3AGF A;  4I38 A;  4WUJ A;  2WKP A;  3LYX A;  1IKG A;  1FIK A;  1W7F A;  5AQA A;  1OTD A;  1KDS A;  4N9K A;  4L9E A;  4C75 A;  1JVJ A;  2Y2M A;  2JE5 A;  5TBM B;  3UB6 A;  3O3V A;  5F1G A;  1ZKJ A;  1FCM A;  1S67 L;  3F1O B;  1VEU B;  1XA7 A;  5EVE A;  3UPN A;  4Q8I A;  4PPR A;  4ZBE A;  3ZNY A;  2OV5 A;  3DTK A;  2P04 A;  2XRO A;  5KZH A;  3T4S A;  4FCF A;  4S2O A;  2Y2Q A;  3BFE A;  3BFG A;  5G4Z A;  3MFX A;  1S4R A;  3HVF A;  5LBR A;  2VGK A;  2EX8 A;  1K38 A;  1K55 C;  4S2I A;  4WMC D;  1QMF A;  2WGV A;  3MXS A;  4EUZ A;  2W0N A;  2J8Y A;  3OOV A;  5CTN A;  3EGD C;  4R3B A;  5EVI B;  5EVL A;  3S7P A;  1VET A;  4QPR A;  2XD5 A;  1XFN A;  3BM6 A;  5FAQ A;  4EBL A;  4IUH A;  4K0W A;  4K08 A;  4S2J A;  3ZYT A;  2Y2K A;  1F5M A;  1GHM A;  3EEH A;  2W3H A;  2EA9 A;  1TS8 A;  3ISG A;  1KE0 A;  4R6L A;  3HLG A;  4II7 A;  5FI7 A;  4UA6 A;  3T12 B;  3EOI A;  3GTC A;  4K91 A;  1H8Z A;  1W63 Q;  4MN7 A;  4JF6 A;  3HUN A;  2G2U A;  3IXH A;  4JGP A;  3W8K A;  4DJ3 A;  1PW1 A;  4YOF A;  2PBD P;  1Y28 A;  4FH4 A;  1E4D A;  4MBF A;  4KQQ A;  2XRN A;  3PHY A;  3UO9 A;  1MPL A;  5EE8 A;  1YLJ A;  3EWK A;  3TRC A;  1F2K A;  2VKS A;  3NIA A;  1HVB A;  3UPP A;  4LLO B;  3T1R A;  1N9N A;  4CLC A;  3Q1F A;  4R0Q A;  4R38 A;  1TS0 A;  2I72 A;  3A0S A;  3GQZ A;  3UE6 A;  3HLW A;  1NRJ A;  4BMW A;  2Y79 A;  2ZM2 A;  4JLF A;  3FKW A;  4EER A;  4DXB A;  3MQQ A;  4ID4 A;  3M6H A;  2ACG A;  2QYB A;  1KE4 A;  3RXW A;  2OWH A;  1A0K A;  1TVF A;  3PBO A;  4E3L A;  3PBR A;  2EWV A;  4HJ6 A;  3T50 A;  5TBM A;  4Q0J A;  4YWZ A;  1YT4 A;  2QPN A;  4G3W A;  3DTE A;  3KSF A;  4DF6 A;  1CK3 A;  1XJ4 A;  4ZRR A;  2NUT C;  1H8Y A;  3IXG A;  3KSG A;  1P9W A;  4BLM A;  2P08 A;  2ZQC A;  3WRT A;  3SH8 A;  3LR4 A;  3GVB A;  3JYI A;  3G32 A;  4HQA A;  3RJU A;  2Y2H A;  1LI0 A;  3HBR A;  3P01 A;  3OPL A;  3TE8 A;  2WKE A;  4N92 A;  3UNW A;  2XR0 A;  4BL2 A;  2L1M A;  3LGO A;  5HPF A;  5HDS A;  1RP5 A;  5FDS A;  5KSH A;  5EVI A;  2QHK A;  5IHV A;  3HUM A;  3DAV A;  5E2E A;  3IXB A;  4X55 A;  5E43 A;  1GHI A;  2VK3 A;  3F1P B;  1X0O A;  2WYX A;  5GLD A;  4BD1 A;  3C7U A;  1BLC A;  4I39 A;  3QP2 A;  4BWI A;  3N8R A;  4Q0H A;  3UB7 A;  4BD0 A;  2YKH A;  4DE1 A;  4MN5 A;  1D7E A;  4K0X A;  4GKU A;  1LI9 A;  3QP8 A;  4HY8 A;  3ZHH A;  1IFQ A;  4WEL A;  4UA7 A;  1LSX A;  1MWU A;  4HBT A;  1H0M A;  4U3T A;  4NEE D;  3V39 A;  3MSH A;  1Z09 A;  3A0R A;  4GCZ A;  4XUZ A;  1HLU P;  2P9V B;  1Q2Q A;  1XPB A;  1M6K A;  1LT0 A;  1K57 C;  3UE3 A;  4PM8 A;  1J9M A;  4KG5 A;  4DN0 A;  3LR3 A;  4X68 A;  3VSK A;  3VMA A;  2D01 A;  1LL8 A;  2EX9 A;  1S1Y A;  3BQ8 A;  5CRF A;  5FAS A;  4BBV A;  4Q0I A;  2J7V A;  4OLG A;  3T4J A;  2JBF A;  4P6B A;  1N9B A;  3C5A A;  4OQ0 A;  3ZG5 A;  1G28 A;  3O86 A;  1G6O A;  3UPO A;  4EEU A;  3IS2 A;  1DJB A;  1PW8 A;  3TOI A;  3VFH A;  3HLE A;  2W1T A;  4ZTK A;  5AQB A;  2VV7 A;  1DP9 A;  2XA7 M;  3PBN A;  2PR5 A;  3A3D A;  4AFI A;  4JKT A;  3JPU A;  5HWW A;  3BEB A;  3OCL A;  4KZ9 A;  3G30 A;  1NZU A;  4O01 A;  3UB8 A;  4LGW A;  4JF5 A;  4OPR A;  3ZFZ A;  3ZG8 B;  4Y0U A;  1SKF A;  5I94 A;  4JGR A;  2WZZ A;  2Q0O A;  4LEN A;  1CF0 A;  4LV3 A;  3E0Y A;  1OJG A;  1KGG A;  5HZH A;  1N4O A;  2VX8 A;  4CPK A;  1K56 A;  3IQA A;  4CLC C;  2BLS A;  2H5S A;  2KDK A;  3RH8 B;  3LIC A;  4DJ2 A;  3NHQ A;  4HEF A;  3H7W B;  4UHU A;  1MKI A;  1XX2 A;  3R7W B;  4O7D A;  1NZO A;  1O7E A;  3LEZ A;  2ZOH A;  3MXQ A;  2B02 A;  1RCJ A;  2WAF A;  4QWO A;  4KQR A;  4PM6 A;  4H8R A;  4B93 A;  2O9A A;  3IWO A;  4X69 A;  3D72 A;  3HLC A;  3E4P A;  1DJC A;  1CI9 A;  5TR7 A;  3BFC A;  2FFF B;  4MBH A;  3DW0 A;  5CGW A;  3MZD A;  1WYC A;  3NCK A;  3FYZ A;  3SZT A;  1IEM A;  5AVF A;  2XLN A;  3ZNT A;  4MDZ A;  4DXC A;  2VGJ A;  5HSQ A;  3S1Y A;  5FAO A;  5F5Y A;  2QWS A;  4CLC D;  4WBG A;  5I5L A;  4DRT A;  4GW9 A;  3PBQ A;  3NDG A;  4GDN A;  3BFF A;  3HJI A;  3CG5 A;  4BJP A;  2PR6 A;  3JVV A;  5EVI C;  3IWQ A;  5EV0 A;  2O99 A;  2PU4 A;  4DDS A;  2RL3 A;  2XSS A;  5IU1 A;  2LB9 A;  2HDU A;  4LRY C;  2ZQD A;  1NLZ A;  3OC2 A;  3V50 A;  3A3I A;  5HD3 A;  2H0Y A;  3MXR A;  2WKH A;  2GX5 A;  4CLC E;  1FCO A;  2O9B A;  2B5R A;  2ZQ9 A;  1GCE A;  3G34 A;  3CIT A;  1OTE A;  5FEF A;  4IBR A;  1MKM A;  2WKQ A;  3CLO A;  1YLT A;  4OQH A;  3N6I A;  3CWF A;  2ZQ7 A;  1G5U A;  1PYY A;  1NXY A;  4EET B;  1TS7 A;  2W1R A;  1CI8 A;  2Q9N A;  5C5K A;  2IWD A;  3VFF A;  5U47 A;  3V3R A;  1PWD A;  3T4K A;  3N8L A;  4ETX A;  1VET B;  3W4Q A;  1FR1 A;  1P9R A;  4WZ5 A;  1LSV A;  2E8J A;  2QZ6 A;  1H5X A;  1TDL A;  5M18 A;  1I5Q A;  5EVI D;  5CTM A;  1S66 L;  5EOE A;  1EWZ A;  3D3O A;  2XEP A;  1GSV A;  4Y0T A;  2WZX A;  3F1N B;  3DWK A;  4ME4 A;  1CQA A;  4YIN A;  3NJA A;  1JNU A;  1FIL A;  2X71 A;  5L09 A;  3ZVT A;  4F94 A;  3E4O A;  3DWZ A;  5CXW A;  3FWL A;  2XFT A;  4WN5 A;  1YM1 A;  3O88 A;  1I2W A;  4WEJ A;  4I3J A;  3BY9 A;  3G35 A;  2Z6D A;  4OQG A;  2WKR A;  3KO6 A;  2ZC5 B;  3BLS A;  1YAX A;  4QB8 A;  4RVA A;  3W4P A;  3MBZ A;  3QNC A;  4ZJ3 A;  2GNX A;  3TJZ C;  1S4S A;  2R9X A;  2G2W A;  5HD5 A;  5HAQ A;  1PI4 A;  3SS4 A;  2J3T C;  1ERM A;  3LI8 A;  2KX6 A;  5GHZ A;  1NLY A;  2ZL1 A;  3IF5 A;  1W8Y A;  3KYZ A;  3LR0 A;  1LLB A;  1YQS A;  4LCL A;  4LRZ E;  3NI9 A;  5AVE A;  4XT2 A;  4RX3 A;  1K0K A;  1S0W A;  1MC0 A;  3SS5 A;  3NOP C;  5FQQ A;  5A92 A;  1E3U A;  5FQJ A;  5AQ7 A;  3ITA A;  4MCW A;  1YMS A;  3PBT A;  2ZC3 B;  3W4O A;  2M1C A;  3DTM A;  1PRQ A;  1XKZ A;  3ZG7 B;  1S1Z A;  4GS9 B;  1OTB A;  4E3K A;  2H10 A;  1BUE A;  2G7U A;  3H9W A;  1W5D A;  4NXG A;  4OP5 A;  2DMW A;  4PM7 A;  5E2F A;  1K56 D;  4R4R A;  4E3M A;  5KIZ A;  3C4O A;  3LIE A;  3T1X A;  3MZE A;  2EXA A;  4HJ3 A;  2J3T D;  1XJ3 A;  3VP2 A;  3JVU A;  2R9W A;  1ES4 A;  1YLY A;  3CUE A;  3HJK A;  2HV1 A;  4QU3 A;  3F1N A;  1GSX A;  2HJE A;  1N9L A;  5JYO A;  4PKY A;  2J3W A;  2PBY A;  4O8G A;  3PR6 A;  4L0L A;  4JBF A;  2Y2G A;  2JKT M;  2P7J A;  4QD4 A;  3L7H A;  3IX4 A;  1HD8 A;  3KYE A;  3GR2 A;  4BBT A;  4E3I A;  5K5B A;  4M4X A;  4E3J A;  1T1B A;  5E2G A;  1FQG A;  4IUK A;  5HWV A;  3S22 A;  2Y2N A;  3ZCZ A;  5CEC A;  3IT9 A;  3IF6 A;  1T19 A;  2WGW A;  3AGD A;  2DNS A;  5EOO A;  5HFO A;  1YSP A;  3NOU C;  5F83 A;  2V1B A;  2J80 A;  4S2N A;  1T1A A;  5DJU A;  2HGV A;  3IWI A;  4WZ5 C;  3OZH A;  5D3O A;  1GSW A;  3IS2 B;  1LSW A;  1XJ2 A;  2W1T B;  1N9O A;  4H6J A;  5A8B A;  5L2F A;  5HDD A;  3OPH A;  2HDR A;  5IS1 A;  3IH8 A;  3KX0 X;  5EM1 A;  3VOL A;  3PAG A;  3CMZ A;  1PNE A;  4NET A;  4M3K A;  1M40 A;  3ZQ5 A;  4KZA A;  3S7Q A;  4EU0 A;  4IVK A;  2PHY A;  4WLA A;  5TJJ A;  4HJ4 A;  2A24 B;  2M7U A;  4UAA A;  4KEN B;  4ARZ A;  4GS9 A;  4IVI A;  2MJ6 A;  1K25 A;  1OT6 A;  3BEC A;  3IBR A;  3K3C A;  1ACF A;  5AQ9 A;  2VGL S;  2VEA A;  4RX2 A;  3W2Z A;  2RCX A;  1YKD A;  1D1J A;  4QY6 A;  2W27 A;  1ERQ A;  1DP8 A;  3QP5 A;  1QME A;  4JXG A;  3GRJ A;  4A5R A;  5A91 A;  4MEZ A;  1GA0 A;  2VGL M;  5GLB A;  4HH3 A;  5GLC A;  1VQQ A;  1FSW A;  3VOZ A;  1AWI A;  3NBL A;  4I5S A;  4P6Z S;  5FEG A;  4G3K A;  3LEQ A;  3TW8 A;  3LCE A;  4IBX A;  3ZDJ A;  4R3J A;  3BJN A;  3WWX A;  2JCH A;  3ZGA B;  2VA0 A;  5F1F A;  3NOT C;  4GD6 A;  3V5M A;  2V20 A;  4I3I A;  1BLS A;  4P6Z M;  1K4F A;  3NY4 A;  3RFB A;  2V9A A;  2XA7 S;  5FDH A;  2JHE A;  5J4E A;  4LV1 A;  4KUK A;  5DF8 A;  4EBP A;  3OPP A;  1ONG A;  3UME A;  2Z6C A;  3KYQ A;  3GMW A;  5HL1 A;  3TSG A;  2D02 A;  3CUE C;  1BTL A;  3Q7V A;  3FPW A;  4OON A;  1UGU A;  4FH2 A;  2VLG A;  2WKI A;  2Y4A A;  1H3Q A;  4OPY A;  2IWC A;  3ZVW A;  3MF0 A;  4G3V A;  1KOU A;  3MMH A;  5J7E A;  4OPZ A;  2QKP A;  1E3U D;  5CHJ A;  5EM0 A;  1XFQ A;  1Z6F A;  3CPT A;  3GEC A;  1DRM A;  4P0M A;  3EQU A;  3I7J A;  1FCN A;  3QHY A;  2A24 A;  4KZ5 A;  1ONH A;  3SH7 A;  1ODV A;  3LR5 A;  5FA7 A;  2XD1 A;  4XXR A;  4EW7 A;  2ZM8 A;  4GZB A;  4WMC A;  3M2J A;  1DY6 A;  2OWJ A;  3B33 A;  3E98 A;  5DVA A;  5FQ9 A;  4FD8 A;  4OQI A;  3FZC A;  1Q2P A;  2ZM0 A;  1YSQ A;  4GD8 A;  3FV7 A;  1WYB A;  2AVX A;  1UWN X;  2EX6 A;  3FG8 A;  4IJG A;  4KZ7 A;  4EBN A;  4QJG A;  3VE4 A;  2I9V A;  3H82 A;  4R23 A;  1VHM A;  2XDM A;  3CI6 A;  1IEL A;  4P87 A;  4N1H A;  2K2N A;  2ZQA A;  3P98 A;  3E2L A;  1DP6 A;  4DE3 A;  2B95 A;  2ZJ9 A;  3D9Y A;  1VB6 A;  2ZC7 A;  1KVL A;  4Y7P A;  4EUV A;  3A3J A;  3O87 A;  4GDB A;  1STZ A;  5A90 A;  1LHY A;  3PTE A;  1FR6 A;  2HDS A;  1SKO A;  3A0V A;  3C8C A;  3HCY A;  3WS2 A;  1U60 A;  2XGN A;  2VZW A;  3UE0 A;  2JC7 A;  4WYY A;  3N7W A;  2H0T A;  4GNU A;  3VSL A;  2UV0 E;  2ZL1 B;  4PAU A;  4E3O A;  4HH2 A;  5L8M A;  1YPR A;  2V1A A;  2OAP 1;  5TFQ A;  4XT2 B;  2PYP A;  2C6W B;  3VV4 A;  4B88 A;  2HZ5 A;  2Y2J A;  2LB5 A;  4JXS A;  2EWW A;  2QJ5 A;  1NY0 A;  4C3Q A;  5DKL A;  3G4P A;  2YKF A;  5DFX A;  5CHM A;  3Q7Z A;  2V1Z A;  5DTT A;  2PD7 A;  4BQM A;  4QY5 A;  4IED A;  4NXE A;  2V0W A;  5EPH A;  4CQH A;  4OOY A;  1ES3 A;  3T4Q A;  2JKT I;  1L2S A;  2A2L A;  1IYS A;  3BFD A;  2VJW A;  4IHQ A;  4BL3 A;  3EEA A;  3UE1 A;  3LY3 A;  2CC1 A;  2ZC4 B;  3BY8 A;  2KOI A;  1JWP A;  1MWS A;  2A3U A;  3T4T A;  2DCF A;  5F69 A;  1P0Z A;  3WS5 A;  5M1A A;  5HWT A;  1L3L A;  3LIB A;  5EFW A;  4BBU A;  1WE4 A;  4MN6 A;  4LV2 A;  3FC7 A;  2ZC6 B;  1IYP A;  3LI9 A;  3S4X A;  3E2K A;  1NRF A;  1ES5 A;  1SDE A;  2FFY A;  3MS6 A;  4WL9 A;  4OOL A;  2J9O A;  1L0F A;  2WGI A;  2HP6 A;  1ZG6 A;  1BT5 A;  3C30 A;  3IF6 B;  5FI6 A;  4MMN A;  2KLI A;  4B4X A;  2X01 A;  1ZHH B;  2HDQ A;  4U0T A;  2WGW B;  4KG6 A;  1LL5 A;  3Q07 A;  3T1S A;  2PYR A;  5HAI A;  3UN7 A;  1EI5 A;  3G31 A;  1MWT A;  3ICY A;  3PBS A;  2L4R A;  4O0P A;  5FL3 A;  1OJ5 A;  4Y13 A;  5BOH A;  4EXO A;  4H6J B;  4GOG A;  3IX3 A;  3IBJ A;  2Y59 A;  4KZ6 A;  2NUP C;  1YLZ A;  2HF6 A;  5MC7 A;  3MQO A;  3UDI A;  3B42 A;  1KGF A;  1L0D A;  4HP9 A;  3WS4 A;  2FZ0 A;  1K54 A;  4B4Z A;  1C3B A;  4Y0O A;  3QNB A;  1CEF A;  4KQO A;  1NJ4 A;  3HLB A;  1XGI A;  4DMZ A;  4E3N A;  4DKI A;  4HBU A;  2XQZ A;  2VV8 A;  4N9L A;  2ZOI A;  4UA9 A;  4EQI A;  3G6O A;  2JKR I;  1JWZ A;  4NG2 A;  2IA2 A;  3C2W A;  4ARZ B;  2Z2L B;  2ZBB A;  3BLM A;  4ZAM A;  5IT5 A;  2UWX A;  1H8M A;  3BRM A;  4X1L A;  4MBK A;  1K57 A;  5DJT A;  2CMN A;  3VP3 A;  3NDE A;  3UB9 A;  3RTY A;  2B18 A;  5G4Y A;  4ZJ2 A;  5CED A;  4PKY G;  2GDN A;  4RA7 A;  5DF9 A;  2W3G A;  3IXD A;  1MWR A;  4N1X A;  1BZA A;  3B3X A;  4LCM A;  5FQM A;  3T4O A;  3AGE A;  1TD5 A;  3P7N A;  1KDW A;  3MZF A;  1S6R A;  2PDR A;  2BG1 A;  1XGJ A;  1AXB A;  3IX8 A;  2WAE A;  2ZD8 A;  3CJM A;  3UMD A;  4Z1W A;  4WF0 A;  1TF1 A;  4KUO A;  3VOY A;  4RQ9 A;  2W3D A;  3PAE A;  1LL9 A;  2A49 A;  5HL6 A;  3M6B A;  5FAP A;  1F9I A;  1D06 A;  2ZQ8 A;  3BW6 A;  4HHD A;  5DTK A;  4HES A;  4LRX C;  4EEP A;  2M7V A;  3UB5 P;  1KGE A;  4FOF A;  5CGS A;  1ERO A;  3MKE A;  1XA1 A;  1HZO A;  1OT9 A;  2PT7 A;  1PZO A;  3QP1 A;  4S2M A;  2OLV A;  2OAQ 1;  1CJF A;  3MKF A;  1ZTU A;  1TS6 A;  3P09 A;  1NYM A;  2GJ3 A;  4GHI B;  4KG2 A;  2JKG A;  2GZA A;  4ZJ1 A;  3IHA A;  4GB7 A;  3D4F A;  2V8F A;  4DDY A;  5HDC A;  4FSF A;  2J9P A;  2O9C A;  3DTI A;  3SH9 A;  1J3W A;  4BEN A;  4WZ4 A;  1ESI A;  3HLF A;  4EWF A;  3Q7V B;  3OBF A;  2EXB A;  4YFM A;  1PWC A;  3VP1 A;  2WUQ A;  4NK3 A;  4OH0 A;  5DFY A;  4X53 A;  2HJ9 C;  1G6A A;  5EUA A;  1KE3 A;  1FSY A;  3SOI A;  1NYY A;  5KSC A;  2E8I A;  1CEG A;  4Y5F A;  4LPZ A;  2EFX A;  1MY8 A;  4ESP A;  4B9O A;  3MJQ A;  4MLL A;  4JPM A;  3IH9 A;  1L0G A;  3EQV A;  1OTI A;  1XJ6 A;  3CPT B;  3F1O A;  4MNR A;  1VEU A;  3HL9 A;  5F6A A;  3Q82 A;  4RYE A;  3A3E A;  5GHX A;  2XFS A;  3UDF A;  2XF3 A;  2OOL A;  3K3D A;  1FOF A;  3EGX C;  1PWG A;  2PU2 A;  5GL9 A;  3KSI A;  1P97 A;  5KMW A;  4HIA A;  4NXF A;  5F68 A;  1T1C A;  3GDI A;  2VV6 A;  3BQA A;  3LIF A;  1JTG A;  1PIO A;  2R78 A;  2V0U A;  2V2F F;  5J8X A;  4NKP A;  2FH5 A;  3LFV A;  1T18 A;  4EQ1 A;  2JKR M;  2ZLY A;  2EX2 A;  3V3S A;  3H82 B;  1PI5 A;  4PM9 A;  1W8Q A;  4HP4 A;  1E25 A;  1MZU A;  3C4P A;  3PYP A;  4S2L A;  3S7O A;  2HP9 A;  1OME A;  2XH9 A;  4GJ4 A;  4D2O A;  1K54 C;  3LUQ A;  3K2N A;  5G18 A;  3HRE A;  4OLD A;  1JTD A;  3SS3 A;  4D60 A;  3PXP A;  4X1M A;  1MXO A;  3LID A;  3OLO A;  4EES A;  2W3E A;  3O5Y A;  3ZG9 B;  2O0Y A;  1SKO B;  3T4L A;  3U2A A;  4WM9 A;  4OOM A;  4ETZ A;  5FQK A;  1PFL A;  2K31 A;  2PD8 A;  3WS1 A;  2DRW A;  3QP6 A;  5L07 A;  3MR0 A;  2X02 A;  4L9F A;  2P74 A;  3ULF A;  4JGQ A;  4GHI A;  3HLD A;  2ZMF A;  2PAV P;  1V9Y A;  1GHP A;  4FUW A;  4PMA A;  3IHB A;  4UEY A;  1K4E A;  2ZMA A;  3VP0 A;  4HOI A;  1W63 M;  1OPX A;  3N8S A;  3CAX A;  5FSR A;  5M19 A;  3G2Y A;  2Y2P A;  3UDX A;  2BAS A;  1K6R A;  4KZ4 A;  4EV4 A;  2Y2L A;  3T1Q B;  3LO7 A;  3GV9 A;  1RGZ A;  1SDN A;  4NXB A;  4DE0 A;  4PHT A;  1YMX A;  1IKI A;  5HAR A;  4X56 A;  2Y2I A;  3IF6 C;  2WAD A;  3LIA A;  3UY6 A;  4S2P A;  2ZMV A;  1VM1 A;  4HNB A;  2WK0 A;  1KVM A;  2HP5 A;  4QHC A;  1YLP A;  2XK1 A;  5HX9 A;  1JWV A;  4E04 A; 
#chains in the Genus database with same CATH homology
 4S2N C;  5IHV A;  3HUM A;  2DCF A;  3C4O A;  3MZE A;  5E2E A;  2IWB A;  2EXA A;  3WS5 A;  5M1A A;  5CEB A;  3IXB A;  4X55 A;  1ZC2 A;  1GHI A;  2Z2M B;  3M2K A;  5E43 A;  5EVI A;  4S2K A;  4E6X A;  3VP2 A;  1WE4 A;  2R9W A;  1ES4 A;  4LV2 A;  4DE2 A;  1W79 A;  1YLY A;  5FQI A;  2WYX A;  2EFU A;  5GLD A;  2ZC6 B;  4QU3 A;  2Y2O A;  4BD1 A;  3C7U A;  1BLC A;  1IYP A;  3S4X A;  4PM5 A;  5JYO A;  3E2K A;  3N8R A;  4LV0 A;  4BD0 A;  4DE1 A;  4WEK A;  1NRF A;  1SCW A;  1DJA A;  2PBY A;  4JXW A;  1ES5 A;  4L0L A;  1SDE A;  2OSU A;  4JBF A;  4K0X A;  4GKU A;  1LI9 A;  3ZHH A;  2Y2G A;  4QD4 A;  2FFY A;  5CHU A;  3WRZ A;  1HD8 A;  3GR2 A;  4OOL A;  4WEL A;  1Y54 A;  2J9O A;  4UA7 A;  1MWU A;  4HBT A;  4E3I A;  4OVD A;  1L0F A;  2WGI A;  2HP6 A;  1ZG6 A;  4E3J A;  1BT5 A;  4U3T A;  3IF6 B;  3N4I A;  5FI6 A;  3LY4 A;  3V39 A;  5E2G A;  1FQG A;  2HPB A;  4CJN A;  3S22 A;  4B4X A;  4XUZ A;  1L0E A;  2Y2N A;  3Q81 A;  2HDQ A;  1K55 A;  2X01 A;  5F82 A;  2Y55 A;  3ZCZ A;  4U0T A;  5CEC A;  2WGW B;  2P9V B;  3IF6 A;  1Q2Q A;  1XPB A;  3IT9 A;  4JXV A;  1M6K A;  4X6T A;  4KG6 A;  1K57 C;  1LL5 A;  3Q07 A;  3VP4 A;  5DTS A;  1YLW A;  3UE3 A;  5FAT A;  2WGW A;  2P9V A;  4KZ8 A;  3AGD A;  3GSG A;  4PM8 A;  5HAI A;  1J9M A;  2DNS A;  3UN7 A;  1EI5 A;  3G31 A;  4KG5 A;  5EOO A;  1BUL A;  1MWT A;  5HFO A;  3PBS A;  1XP4 A;  3A3F A;  3TG9 A;  4X68 A;  5F83 A;  3VSK A;  3VMA A;  4S2N A;  2EX9 A;  2QMI A;  5CRF A;  3IWI A;  3MFD A;  5BOH A;  5FAS A;  2J7V A;  4OLG A;  2JBF A;  1BSG A;  1IYQ A;  4GOG A;  1N9B A;  1SHV A;  3C5A A;  3OZH A;  4OQ0 A;  4P6B A;  4WZ5 C;  5D3O A;  4OKP A;  2Y59 A;  4KZ6 A;  3ZG5 A;  4GN2 A;  1YLZ A;  3UDI A;  1KGF A;  1L0D A;  3O86 A;  3UPO A;  1HTZ A;  1DJB A;  1PW8 A;  3TOI A;  3VFH A;  5L2F A;  1I2S A;  3HLE A;  3OPH A;  3WS4 A;  4ZTK A;  5GHY A;  1K54 A;  4B4Z A;  5DF7 A;  5AQB A;  2HDR A;  1C3B A;  4Y0O A;  3C7V A;  3QNB A;  1CEF A;  1ESU A;  4KQO A;  1NJ4 A;  3IH8 A;  3ITB A;  3HLB A;  1XGI A;  4E3N A;  3PAG A;  5HW3 A;  4DKI A;  4HBU A;  3CMZ A;  2XQZ A;  2C5W B;  4NET A;  3PBN A;  4M3K A;  3A3D A;  4N9L A;  1M40 A;  4UA9 A;  4JKT A;  4KZ3 A;  4EQI A;  2Q9M A;  3BEB A;  3OCN A;  3OCL A;  4KZA A;  4KZ9 A;  3G30 A;  1NZU A;  1JWZ A;  4JF5 A;  4OPR A;  3ZFZ A;  4OP8 A;  3ZG8 B;  2Z2L B;  4Y0U A;  4IVK A;  3BLM A;  1SKF A;  4ZAM A;  2UWX A;  5A93 A;  5I94 A;  2Y91 A;  2WZZ A;  4LEN A;  3BRM A;  4ZDX A;  3NC8 A;  4LV3 A;  4MBK A;  3ZG0 A;  1TDG A;  4UAA A;  4KEN B;  1K57 A;  1KGG A;  4IVI A;  1K25 A;  3NDE A;  3VP3 A;  4Z9Q A;  1N4O A;  3BEC A;  4ZJ2 A;  4CPK A;  5CED A;  4C6Y A;  2GDN A;  5GLA A;  5AQ9 A;  1K56 A;  3FKV A;  3CZD A;  4RA7 A;  5DF9 A;  5E2H A;  3IQA A;  5FI2 A;  3IXD A;  1MWR A;  4OPQ A;  2BLS A;  4N1X A;  2H5S A;  4RX2 A;  1BZA A;  1G68 A;  2RCX A;  1GA9 A;  3B3X A;  4LCM A;  5FQM A;  3RXX A;  4HEF A;  1PZP A;  5JYP A;  4QY6 A;  4UHU A;  1MKI A;  3AGE A;  4R1G A;  1XX2 A;  4JF4 A;  1ERQ A;  5CER A;  1KDW A;  3MZF A;  1S6R A;  2BG1 A;  4O7D A;  1ALQ A;  1TEM A;  1XGJ A;  1QME A;  1NZO A;  1AXB A;  1BLP A;  4E6W A;  1O7E A;  3LEZ A;  4JXG A;  1IYO A;  3G2Z A;  3GRJ A;  2WAE A;  2ZD8 A;  4A5R A;  3CJM A;  1RCJ A;  5A91 A;  2WAF A;  4MEZ A;  1GA0 A;  1XXM A;  1ES2 A;  4KQR A;  4PM6 A;  3VOY A;  4H8R A;  5GLB A;  1O07 A;  5GLC A;  1VQQ A;  1FSW A;  3PAE A;  3VOZ A;  1LL9 A;  3IWO A;  3NBL A;  4X69 A;  2A49 A;  4R4S A;  3WS0 A;  3M6B A;  5FAP A;  1BLH A;  3HLC A;  3LCE A;  2ZQ8 A;  1DJC A;  4IBX A;  5HAP A;  5DTK A;  4HES A;  1CI9 A;  3ZDJ A;  4R3J A;  5TR7 A;  3BFC A;  2FFF B;  5TGF A;  3WWX A;  4MBH A;  3DW0 A;  1KGE A;  5CGW A;  3MZD A;  1K6S A;  2JCH A;  1ZG4 A;  1WYC A;  3BYD A;  4P85 A;  5CGS A;  3NCK A;  1ERO A;  1MBL A;  3ZGA B;  3MKE A;  4KZB A;  3FYZ A;  1IEM A;  5F1F A;  1XA1 A;  4GD6 A;  1HZO A;  3V5M A;  5CGX A;  2V20 A;  2XLN A;  3ZNT A;  1BLS A;  1PZO A;  4DXC A;  4S2M A;  4U0X A;  2VGJ A;  2OLV A;  3MKF A;  1K4F A;  3NY4 A;  3S1Y A;  2OLU A;  5FAO A;  3OPR A;  4WBG A;  3P09 A;  1NYM A;  4DRT A;  4KG2 A;  5FDH A;  1RGY A;  4XUX A;  4ZJ1 A;  3HUO A;  3PBQ A;  3IHA A;  4GB7 A;  3NDG A;  3D4F A;  4GDN A;  3AGF A;  4LV1 A;  5EEC A;  4DDY A;  3BFF A;  4FSF A;  1IKG A;  2J9P A;  1W7F A;  3CG5 A;  5AQA A;  4BJP A;  5EVI C;  5DF8 A;  3SH9 A;  4EBP A;  3IWQ A;  3OPP A;  4BEN A;  2PU4 A;  4DDS A;  2RL3 A;  4WZ4 A;  1ESI A;  1ONG A;  3HLF A;  4EWF A;  2HDU A;  1KDS A;  2ZQD A;  3OC2 A;  3Q7V B;  4N9K A;  3V50 A;  2EXB A;  4YFM A;  1PWC A;  3VP1 A;  3A3I A;  4C75 A;  3GMW A;  1JVJ A;  2WUQ A;  4NK3 A;  2Y2M A;  5HL1 A;  2JE5 A;  4OH0 A;  4X53 A;  3TSG A;  3O3V A;  3Q7V A;  1BTL A;  2H0Y A;  1ZKJ A;  1G6A A;  5EUA A;  5F1G A;  1KE3 A;  1FSY A;  1FCM A;  3MXR A;  3SOI A;  1NYY A;  2WKH A;  4OON A;  4FH2 A;  5KSC A;  2WKI A;  1FCO A;  2E8I A;  1CEG A;  2Y4A A;  2B5R A;  2EFX A;  1MY8 A;  1XA7 A;  2ZQ9 A;  4OPY A;  4MLL A;  2IWC A;  3UPN A;  1GCE A;  4Q8I A;  4JPM A;  3IH9 A;  4PPR A;  4ZBE A;  1L0G A;  3EQV A;  3ZVW A;  3ZNY A;  2OV5 A;  3G34 A;  4MNR A;  3HL9 A;  5KZH A;  4OPZ A;  4IBR A;  3Q82 A;  1E3U D;  4RYE A;  5CHJ A;  1Z6F A;  3A3E A;  4FCF A;  4S2O A;  2Y2Q A;  5GHX A;  2XFS A;  1YLT A;  4OQH A;  4P0M A;  3BFE A;  3BFG A;  3EQU A;  3I7J A;  1FCN A;  3UDF A;  3QHY A;  3N6I A;  4KZ5 A;  2ZQ7 A;  1ONH A;  3HVF A;  3SH7 A;  2VGK A;  2EX8 A;  1PYY A;  1K38 A;  2XF3 A;  5FA7 A;  1NXY A;  2XD1 A;  1FOF A;  1CI8 A;  2Q9N A;  3VFF A;  2IWD A;  1PWG A;  1K55 C;  5U47 A;  1PWD A;  2PU2 A;  4XXR A;  5GL9 A;  3V3R A;  3N8L A;  4S2I A;  2ZM8 A;  4GZB A;  4WMC A;  1QMF A;  4WMC D;  2WGV A;  3MXS A;  4EUZ A;  5KMW A;  2J8Y A;  5CTN A;  3W4Q A;  3M2J A;  1DY6 A;  4R3B A;  1FR1 A;  4WZ5 A;  1JTG A;  5EVI B;  1PIO A;  5EVL A;  2QZ6 A;  1H5X A;  1TDL A;  2V2F F;  5DVA A;  5FQ9 A;  2XD5 A;  4FD8 A;  4OQI A;  5J8X A;  5M18 A;  3FZC A;  3BM6 A;  5FAQ A;  1Q2P A;  4EBL A;  1I5Q A;  5EVI D;  5CTM A;  4K0W A;  2ZM0 A;  2ZLY A;  5EOE A;  4S2J A;  1EWZ A;  4GD8 A;  3FV7 A;  1WYB A;  2EX2 A;  2XEP A;  3V3S A;  4Y0T A;  2Y2K A;  2EX6 A;  4KZ7 A;  1GHM A;  1PI5 A;  4PM9 A;  4EBN A;  2WZX A;  1W8Q A;  4QJG A;  3DWK A;  3ISG A;  1E25 A;  1KE0 A;  3C4P A;  3HLG A;  4R23 A;  2XDM A;  4S2L A;  1IEL A;  5FI7 A;  4UA6 A;  4YIN A;  2HP9 A;  3GTC A;  1OME A;  2XH9 A;  4K91 A;  4N1H A;  4P87 A;  1H8Z A;  4D2O A;  4JF6 A;  1K54 C;  2ZQA A;  3P98 A;  3E2L A;  3HUN A;  2G2U A;  2X71 A;  4DE3 A;  3IXH A;  2ZJ9 A;  3W8K A;  5G18 A;  1PW1 A;  3HRE A;  4OLD A;  1JTD A;  2ZC7 A;  1KVL A;  3SS3 A;  4FH4 A;  4Y7P A;  3ZVT A;  1E4D A;  4MBF A;  4KQQ A;  3A3J A;  4F94 A;  3O87 A;  1MXO A;  3UO9 A;  3DWZ A;  1MPL A;  5CXW A;  3FWL A;  2XFT A;  5EE8 A;  1YLJ A;  3ZG9 B;  4GDB A;  5A90 A;  1LHY A;  3PTE A;  4WM9 A;  1FR6 A;  1YM1 A;  4OOM A;  3O88 A;  3NIA A;  5FQK A;  1HVB A;  1I2W A;  2HDS A;  4WEJ A;  3UPP A;  3G35 A;  3WS1 A;  4OQG A;  3Q1F A;  2DRW A;  4R0Q A;  2ZC5 B;  3BLS A;  4RVA A;  4QB8 A;  3W4P A;  3MBZ A;  3QNC A;  4ZJ3 A;  2I72 A;  2X02 A;  3WS2 A;  2P74 A;  1U60 A;  1JWP A;  2XGN A;  3GQZ A;  2R9X A;  3HLD A;  3UE0 A;  2JC7 A;  3HLW A;  4WYY A;  2G2W A;  2ZM2 A;  4JLF A;  3N7W A;  3FKW A;  1GHP A;  4DXB A;  2H0T A;  4GNU A;  3VSL A;  1PI4 A;  5HAQ A;  4PMA A;  3IHB A;  4ID4 A;  3M6H A;  3SS4 A;  4E3O A;  1KE4 A;  3RXW A;  1K4E A;  1ERM A;  2ZMA A;  5GHZ A;  1TVF A;  3PBO A;  3IF5 A;  5TFQ A;  3VP0 A;  1W8Y A;  1LLB A;  1YQS A;  2C6W B;  4E3L A;  3PBR A;  4B88 A;  4LCL A;  2Y2J A;  3NI9 A;  4JXS A;  3N8S A;  4RX3 A;  1YT4 A;  5FSR A;  2QPN A;  5M19 A;  1S0W A;  4DF6 A;  1NY0 A;  1CK3 A;  2Y2P A;  3G2Y A;  3UDX A;  3SS5 A;  4C3Q A;  3G4P A;  5CHM A;  1H8Y A;  1K6R A;  3IXG A;  3Q7Z A;  2V1Z A;  5FQQ A;  1E3U A;  4BLM A;  5A92 A;  2ZQC A;  4KZ4 A;  4EV4 A;  2Y2L A;  5DTT A;  3WRT A;  4BQM A;  5FQJ A;  5AQ7 A;  3SH8 A;  3GVB A;  3JYI A;  3LO7 A;  3GV9 A;  3ITA A;  4QY5 A;  1RGZ A;  3G32 A;  1YMS A;  1SDN A;  3PBT A;  2ZC3 B;  4IED A;  3RJU A;  3W4O A;  4DE0 A;  1YMX A;  2Y2H A;  3DTM A;  1XKZ A;  1LI0 A;  1IKI A;  5HAR A;  5EPH A;  3HBR A;  4X56 A;  3OPL A;  3ZG7 B;  2WKE A;  4N92 A;  2Y2I A;  4OOY A;  1ES3 A;  3UNW A;  3IF6 C;  2WAD A;  3UY6 A;  4S2P A;  4E3K A;  1L2S A;  2XR0 A;  4BL2 A;  2H10 A;  1VM1 A;  1BUE A;  1IYS A;  3BFD A;  2WK0 A;  1W5D A;  1KVM A;  4BL3 A;  2HP5 A;  3UE1 A;  4OP5 A;  1RP5 A;  4QHC A;  3LY3 A;  5HX9 A;  4PM7 A;  2CC1 A;  2ZC4 B;  5E2F A;  5KSH A;  1K56 D;  1YLP A;  2XK1 A;  1MWS A;  4R4R A;  2A3U A;  1JWV A;  4E3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...