4FD8A

Structure of apo s70c shv beta-lactamase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
265
structure length
265
Chain Sequence
b'SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMCTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWETELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Crystal structure of a pre-acylation complex of the beta-lactamase inhibitor, sulbactam, bound to a sulfenamide bond containing thiol-beta-lactamase
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 99
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4fd8A00
3UPOA 1XGIA 3HBRA 1K57A 4EBNA 2WUQA 4RX2A 4LV0A 1Z6FA 4KZ5A 3VFFA 3IXDA 4JXGA 2A3UA 2Z2LB 4UHUA 5FASA 1EI5A 2DCFA 1BTLA 1QMEA 3G35A 5DF7A 5EVID 2Y59A 1ALQA 4GZBA 2R9WA 4OQ0A 4S2NA 3WS1A 4MBHA 1PWCA 3V5MA 5GLCA 1RGZA 5A92A 4E3LA 3A3EA 2EX2A 2P9VB 3DW0A 4S2PA 5FQMA 3B3XA 5U47A 2Y2LA 1RCJA 4WM9A 2QMIA 4RA7A 3CJMA 4WMCD 4KZAA 1SCWA 2XR0A 2G2UA 5AQBA 4YFMA 5EVIA 2Y2JA 2OLVA 3IF6B 1K4FA 4N9LA 5GLDA 2P74A 3VP0A 4EWFA 2J8YA 3ITAA 3EQUA 1NXYA 4Y0OA 5EOEA 5GLBA 4WMCA 4QU3A 3HL9A 4NK3A 3HLEA 5EVLA 3M6HA 1XPBA 1JTGA 3VMAA 1HVBA 2BLSA 2J9PA 3VP4A 1CI8A 4R23A 3RXWA 3N8SA 3SS5A 2HDSA 1KE0A 1ESIA 3HLWA 4X68A 2X01A 2A49A 1PZOA 2BG1A 4C3QA 4RYEA 1MWUA 4D2OA 1J9MA 3FYZA 3WS0A 5FQQA 4JXVA 4S2JA 1EROA 2Y2QA 1EWZA 4MNRA 1CI9A 3FV7A 3AGFA 4ZJ2A 2J7VA 3MXRA 5KZHA 4KENB 4UA7A 5HX9A 1GHPA 2E8IA 3NCKA 5KSCA 3G4PA 2WGIA 2C5WB 4WEJA 3MXSA 3VP3A 3BEBA 4DE1A 3VP1A 4BQMA 4NETA 1K54C 1DJCA 2WK0A 4GDNA 4M3KA 1L0GA 1K4EA 1MXOA 4BLMA 3M2JA 4Y0UA 4JBFA 2EXAA 2EX8A 2Q9MA 2WZZA 5CTMA 3Q1FA 2ZM2A 4Z9QA 2Z2MB 3FKWA 5CERA 4IBRA 4U3TA 3WS4A 4KZ6A 4OOMA 4X56A 1WYCA 3TG9A 3IH9A 3GSGA 3PBOA 3Q82A 4CPKA 1H8YA 3E2LA 1MKIA 4KQQA 1MY8A 3QHYA 3BLMA 4LENA 3NDGA 4OONA 3OZHA 2ZD8A 2EX9A 4GN2A 3MZEA 5TFQA 4E6XA 1ESUA 1YLZA 4JPMA 4N1XA 4X53A 3NIAA 1IKGA 3S1YA 5CEBA 1N9BA 3D4FA 1E4DA 1FCMA 2ZQ8A 3PBTA 1K57C 1K55A 3IF6A 5EOOA 4UAAA 1L0EA 1JWVA 3WRTA 3IXGA 4BL2A 5AQAA 4DKIA 3FKVA 1XGJA 4OP8A 4PM5A 4OPQA 3MZFA 5E2EA 4OQHA 3BLSA 1G6AA 2XD1A 3P09A 1FR6A 1GA9A 4ZJ1A 3WRZA 5FQIA 4LCLA 3VSLA 2XLNA 1YQSA 2WYXA 2B5RA 1IYSA 2WADA 2ZQCA 1QMFA 1FSYA 1LI9A 2V1ZA 4WZ5A 1PIOA 5DTTA 5F1GA 4R4SA 2PU4A 4ID4A 4MLLA 3NC8A 4GDBA 1S0WA 1ONGA 3M2KA 3N7WA 3C5AA 4BL3A 1IYOA 2XGNA 1H5XA 3ZDJA 4X6TA 3SH8A 2XH9A 2EX6A 2XDMA 2JC7A 5HAIA 1ZKJA 3LEZA 3OCNA 3MFDA 3Q7VA 4OPYA 4ZAMA 3PBRA 2Y2PA 3HUNA 4KQOA 2WGVA 1CEFA 2WKEA 2I72A 3UDFA 5FDHA 1I2SA 1PWDA 3TOIA 3RJUA 1ERMA 3IWQA 4KZ3A 4DDSA 5E43A 4XXRA 5FAPA 2EFXA 2XQZA 3O88A 3V3SA 3V39A 4DXBA 2XF3A 4GD8A 4P0MA 3P98A 3G30A 1W79A 2R9XA 4WELA 4KG6A 2ZC3B 1WYBA 2XK1A 3TSGA 2EFUA 2QZ6A 5FAOA 4JKTA 3ZVTA 5F83A 5CXWA 4B4XA 4GNUA 3ZG5A 1LL5A 4X55A 3OC2A 4HBUA 1XP4A 5FI2A 3GQZA 1YLJA 3IQAA 4WYYA 2ZC4B 2WGWB 4LCMA 1CEGA 2GDNA 4UA9A 2FFFB 3A3DA 3W8KA 3NI9A 3EQVA 2FFYA 1IYPA 1PYYA 5E2FA 3IHBA 2ZC5B 3MKFA 1N4OA 1K25A 2HPBA 3IT9A 3BRMA 5G18A 5TR7A 2HP6A 3A3FA 3MBZA 4DE0A 3C7VA 3HLGA 4DE2A 1TDLA 3S22A 2RCXA 3NY4A 3UE3A 3ZGAB 4BENA 4B88A 3ISGA 2C6WB 1TEMA 2XFSA 4PPRA 1TVFA 3HLBA 3FZCA 4KZ7A 1MPLA 2VGJA 4E3JA 2XEPA 4E3IA 4MEZA 1BT5A 2WKIA 1RGYA 4KZBA 2ZQ9A 3PAEA 1Q2PA 4YINA 1W7FA 4ZBEA 1KGFA 5GHYA 2ZQDA 5IHVA 4XUXA 1ZG6A 4FCFA 1K6SA 1PW8A 2J9OA 4S2LA 5HW3A 4ZDXA 2H0YA 3GRJA 5FATA 4KZ4A 4DE3A 1AXBA 4P87A 2V2FF 4BD0A 4OQIA 3UDIA 5CGXA 4EQIA 3ZNYA 4S2KA 1W8YA 3CZDA 3ZVWA 2HDQA 2P9VA 3HREA 3MKEA 1HTZA 4N92A 5EUAA 4E6WA 3LY3A 3AGDA 3ZG7B 2DNSA 4L0LA 2Y2HA 3M6BA 4WEKA 1U60A 3BFFA 3ZNTA 2Y2IA 2HDUA 1H8ZA 4F94A 3W4OA 4OLGA 1SDNA 2XD5A 1KGEA 2ZJ9A 2ZLYA 5EE8A 1M6KA 3NBLA 5FSRA 3I7JA 2OLUA 4IBXA 4JF6A 4JXWA 4RX3A 1BUEA 3BYDA 4IEDA 3NDEA 4QB8A 4JF5A 3GTCA 3VOZA 3BFCA 4B4ZA 1SKFA 3ZG8B 1VM1A 3FWLA 2CC1A 1VQQA 2WZXA 5CTNA 5FAQA 5E2HA 3CMZA 2WKHA 5FA7A 4CJNA 4OP5A 1BLSA 3GMWA 3G32A 1L2SA 1ZC2A 3PBNA 4OOLA 4S2NC 5AQ9A 2WGWA 5J8XA 1HZOA 1ERQA 3G2YA 5DF9A 3VFHA 1NY0A 2WAEA 4WZ4A 1LHYA 4E3MA 3BM6A 1K54A 4R1GA 4C6YA 4OLDA 1JVJA 1YMXA 2H10A 2JCHA 4PM9A 4WBGA 3SH9A 1K38A 3G31A 1FOFA 1W5DA 1Y54A 4OOYA 3S4XA 3AGEA 4S2MA 4OH0A 4HEFA 3SS4A 3UDXA 1TDGA 3BFGA 5EVIC 1ZG4A 4OPZA 3W4QA 1MBLA 1BULA 1L0DA 3PAGA 4X69A 4ZJ3A 4OVDA 2UWXA 3C4OA 3DTMA 3Q81A 1GHMA 1YM1A 1G68A 3HLCA 1PW1A 4U0TA 1WE4A 5CHJA 4BD1A 4DDYA 3SOIA 4KZ8A 5DTSA 4DRTA 2V20A 3MZDA 1W8QA 1L0FA 4MBFA 5HFOA 1M40A 3IF5A 1KDSA 1YT4A 1PZPA 1YLPA 2DRWA 4H8RA 3WS2A 1BZAA 2H5SA 1I2WA 1YLTA 4R0QA 3BFEA 5KMWA 3Q7ZA 2H0TA 4K0WA 3UPNA 2IWDA 1C3BA 1LLBA 3DWZA 4K0XA 5HAQA 3IHAA 2HP9A 5DF8A 4Y0TA 2ZC6B 1IKIA 4BJPA 1DY6A 4MBKA 3ZG9B 2ZQ7A 4P6BA 3PTEA 5BOHA 4IVIA 4U0XA 5FQ9A 1JWZA 1XA1A 3QNBA 1PI4A 1FCOA 4LV3A 1S6RA 1ES3A 5A91A 3ZFZA 4P85A 5AQ7A 2Y2NA 3QNCA 3C4PA 1OMEA 3VP2A 3BFDA 1IELA 1JTDA 4FH2A 5DTKA 3PBSA 5FI6A 5FI7A 2OSUA 3IWIA 1FR1A 1FSWA 5D3OA 2ZMAA 5F82A 1K56D 4O7DA 2RL3A 5M1AA 2Y2GA 3UNWA 3IH8A 2PU2A 3IXHA 4QY5A 4QD4A 1KVLA 1E25A 1KE3A 4JF4A 4QY6A 4N1HA 3OPLA 4S2IA 3O87A 1SDEA 3VOYA 4OQGA 5CGWA 3ZCZA 1KDWA 1XA7A 4RVAA 3UE0A 1GHIA 4KZ9A 3HUOA 4IVKA 5TGFA 1KGGA 3A3IA 1XXMA 3BECA 2QPNA 5JYOA 1K56A 1GCEA 1GA0A 3ZHHA 5CEDA 1IYQA 3G34A 3N8RA 3OPHA 4KQRA 3G2ZA 4GD6A 3UY6A 2Y2MA 3V50A 4JXSA 1Q2QA 1BLPA 1MWTA 4HBTA 2WAFA 2EXBA 5FQKA 1RP5A 4EUZA 5A93A 1MWRA 1K55C 3HLFA 3IF6C 3IWOA 3LCEA 3ZG0A 4QJGA 4R3BA 4EBPA 3GR2A 4K91A 5EECA 1HD8A 5KSHA 4OKPA 3N8LA 4LV2A 2Y2KA 3CG5A 1ES4A 3Q07A 2ZM0A 5CHMA 1YLYA 3W4PA 3VSKA 4S2OA 5M19A 3Q7VB 5DVAA 1XKZA 4E3NA 1CK3A 5FQJA 5M18A 2HDRA 3N6IA 3OPPA 3HUMA 3C7UA 5CRFA 5HARA 2Q9NA 4DF6A 1PWGA 1YLWA 3JYIA 4UA6A 2OV5A 3A3JA 1IEMA 1JWPA 2PBYA 4PM6A 1BSGA 3SS3A 4WZ5C 5JYPA 1O7EA 4OPRA 5A90A 5EPHA 3SH7A 3PBQA 4DXCA 5EVIB 1BLHA 3LO7A 5CGSA 2XFTA 4EBLA 4PM8A 1KVMA 5CECA 2VGKA 1E3UD 4LV1A 5GHZA 2X71A 1NRFA 5GHXA 1NZOA 2ZM8A 1KE4A 4PMAA 2IWCA 4FSFA 4C75A 5GL9A 1ES2A 3UPPA 1DJAA 1NJ4A 1XX2A 4GOGA 4A5RA 3E2KA 1LL9A 1NZUA 2JBFA 1I5QA 1NYYA 1LI0A 2Y91A 4KG5A 3UE1A 1FQGA 5HAPA 3GVBA 5HL1A 3O3VA 4ZTKA 2IWBA 4EV4A 4N9KA 3O86A 4GKUA 1E3UA 4PM7A 1YMSA 4Y7PA 3RXXA 3HLDA 1DJBA 3N4IA 4R4RA 5F1FA 5GLAA 1O07A 3OCLA 1FCNA 4JLFA 4E3KA 3GV9A 1NYMA 3UN7A 3UO9A 1ES5A 2JE5A 3DWKA 1PI5A 4XUZA 2ZQAA 3IXBA 2HP5A 2G2WA 2Y2OA 4FD8A 5E2GA 5I94A 2Y4AA 1BLCA 4Q8IA 2X02A 3WS5A 4QHCA 3V3RA 3WWXA 2ZC7A 4R3JA 5L2FA 3OPRA 3HVFA 4FH4A 4KG2A 1K6RA 2Y55A 1MWSA 4HESA 3LY4A 1ONHA 4E3OA 1SHVA 3ITBA 4GB7A 5CHUA
chains in the Genus database with same CATH superfamily
3LIEA 4EBNA 4KZ5A 2A3UA 2J3TC 5DF7A 4GZBA 2R9WA 3DW0A 2P9VB 5FQMA 4S2PA 2Y2LA 3U2AA 4WMCD 4KZAA 2JKRI 2XR0A 2W1TB 5EVIA 3V67A 4HI4A 3D9YA 4MN6A 4Y0OA 5GLBA 2JKFA 2KDKA 2PD8A 2BLSA 3VP4A 4G3KA 3RXWA 3SS5A 2HDSA 1ESIA 2R78A 3HLWA 2HJ9C 4RYEA 1KOUA 5FQQA 1EWZA 2K7SA 3MXRA 2P7JA 2E8IA 5KSCA 3MXSA 1K54C 2WK0A 3F1OA 4BLMA 3M2JA 1S66L 2GX5A 2WZZA 5CTMA 2VX8A 3Q1FA 2O0YA 3T4OA 4Z9QA 5CERA 4IBRA 3WS4A 4OOMA 1WYCA 3IH9A 5DFYA 3GSGA 2O99A 3PBOA 2EWVA 3Q82A 1H8YA 3E2LA 1MKIA 1F9IA 1MY8A 2NUPC 3OZHA 3MZEA 4UEYA 5DJUA 4HJ6A 2P08A 3DTEA 1FCMA 2OOLA 3PBTA 5EOOA 2V0WA 1DP6A 1XFNA 1LL8A 2VZWA 4OPQA 3MZFA 3QP4A 4HP4A 5E2EA 3NOPC 2V8CA 1IYSA 1UWPX 2WADA 4EXOA 4WZ5A 1FSYA 2PU4A 4ID4A 2INWA 1F2KA 1ONGA 3M2KA 3N7WA 2HV1A 2EX6A 2XDMA 5HAIA 2ZL1B 3LEZA 3OCNA 2M7VA 3MFDA 3Q7VA 4OPYA 3PBRA 4KQOA 2WGVA 1CEFA 3BY9A 1G28A 2I72A 1V9ZA 5FDHA 1I2SA 1N9NA 4KZ3A 3T4KA 4DDSA 5E43A 5FAPA 3V39A 4IUHA 4DXBA 2XF3A 3P98A 2FZ0A 5TBMA 4GLQA 4R3AA 5EFWA 2QZ6A 3QP5A 2JKTI 3S7OA 1J3WA 4GNUA 3C30A 5J7EA 1LL5A 4X55A 4HBUA 5FI2A 3L9KA 2K2NA 2ZC4B 2GDNA 1N9LA 2FFFB 2B18A 2FFYA 3IT9A 4CLCA 1MKMA 1H3QA 3C7VA 3HLGA 4DJ3A 3LR3A 4DE2A 1TDLA 3T1SA 2QYBA 2RCXA 3UE3A 1NLZA 4B88A 3ISGA 2C6WB 4PPRA 3HLBA 4H6JA 4QWOA 1RGYA 2LB5A 1VEUB 1W7FA 3ZYTA 1OJ5A 5F5YA 4ETZA 5CGXA 4EQIA 1D06A 3S7QA 2HDQA 2E8JA 3AGDA 4WEKA 3M6BA 4FTXA 4F94A 5EE8A 2XD5A 2I9VA 2P04A 3NBLA 5FSRA 3NOUC 4RX3A 4JF6A 4JXWA 3NDEA 3MFXA 3ZG8B 1VQQA 2WZXA 5CTNA 5FAQA 2WKHA 4OP5A 3PBNA 4OOLA 5I5LA 4NEED 1NY0A 5IT5A 4WZ4A 4E3MA 3H9WA 4PM9A 2JCHA 2KOIA 3G31A 2WKPA 3AGEA 4DMZA 4S2MA 4OH0A 3BQAA 1MBLA 3PHYA 4ZJ3A 4X1LA 3CAXA 2UWXA 4Y13A 1YM1A 1G68A 3HLCA 4BD1A 1YSQA 4MBFA 3T4LA 3DBAA 3IF5A 3F1OB 1CJFA 3Q7ZA 2H0TA 1W63Q 4CLCC 4Y0TA 2ZC6B 4IVIA 5FQ9A 3QNBA 4LV3A 1S6RA 5A91A 3ZFZA 4G3VA 4HQAA 1OMEA 1IELA 2W0NA 3PBSA 2XROA 2VEAA 1K0KA 1FSWA 5D3OA 5F82A 2Y2GA 3IXHA 2PU2A 1STZA 2GJ3A 1HLUP 4S2IA 3O87A 5CGWA 4P6ZS 4O01A 4EETB 4HJ4A 5JYOA 1K56A 2PBDP 3G2ZA 3V50A 2Y2MA 3UB8A 5HZHA 5LBRA 2EXBA 1G5UA 4EUZA 3GECA 4WN5A 5DJTA 1HD8A 2VK3A 4HH3A 4S2OA 3Q7VB 5DVAA 1CK3A 2HDRA 1VETA 3E0YA 2Q9NA 3A3JA 4I3AA 5JYPA 2PYRA 2XFTA 4EBLA 3UB7A 1E3UD 3NHQA 1G6OA 5GHXA 3T12B 4B93A 1DP9A 3E4QA 1L3LA 2LB9A 3MSHA 1LI0A 3UE1A 4FUWA 1FQGA 5HAPA 4I38A 4ESPA 4EV4A 1YMSA 5HDSA 3RXXA 1DJBA 3H82A 1H0MA 5GLAA 2L4RA 3LIDA 4WLAA 1NYMA 4YNRA 3UO9A 2J80A 4CLCB 4QPRA 2JE5A 4XUZA 3NECA 3IXBA 5I94A 3R4KA 2ZC7A 1SKOA 3HVFA 2Y55A 4HESA 1LSWA 5CHUA 3UPOA 3ZQ5A 4JXGA 3MF0A 1EI5A 1XFQA 2DCFA 2L0WA 5J3WA 1ALQA 2B95A 4OQ0A 4S2NA 2FH5A 5GLCA 2OAP1 3CLOA 3DAVA 3E4OA 2VV6A 1RCJA 4WM9A 2QMIA 3CJMA 1DP8A 1XJ2A 4YFMA 1V9YA 4GHIA 5GLDA 4LFUA 3VP0A 4EWFA 3LEQA 5EOEA 4E04A 1A0KA 1PFLA 4QU3A 1S67L 3HL9A 4NK3A 2V9AA 1XPBA 2PAVP 1KE0A 3F1NA 1PZOA 3FPWA 1J9MA 3FYZA 5HDDA 4JXVA 4S2JA 2Y2QA 2QHKA 3FG8A 3CI6A 4UA7A 1GHPA 3G4PA 2WGIA 4WEJA 4EEUA 4BQMA 1OTIA 4NETA 1DJCA 2KLIA 3BY8A 3H7WA 3W2ZA 2VA0A 4Y0UA 2EXAA 3OBFA 1TS0A 4GCZA 1YAXA 4KZ6A 1OTDA 4X56A 3TG9A 3K2NA 2OAQ1 3QHYA 5HPFA 3MQQA 4GN2A 5TFQA 1YLZA 4X53A 4I5SA 3S1YA 3KSFA 1E4DA 3TW8A 1K55A 3IF6A 1IFQA 1L0EA 3WRTA 4BL2A 3FKVA 1XGJA 4OP8A 4PM5A 2QWSA 4NKPA 1GA9A 4LCLA 2XLNA 1YQSA 2B5RA 3JVVA 4R6LA 5DTTA 2Y79A 4MLLA 4GDBA 1S0WA 1IYOA 3ZDJA 1H5XA 2XH9A 2K31A 5J4EA 4ZAMA 3B47A 3UDFA 2M1CA 5DKKA 1VETB 1PWDA 3TOIA 5EM0A 3UE6A 4XXRA 1P0ZA 2XQZA 3LIBA 3MXQA 4XT2A 3KYZA 2D02A 2W3GA 2Z6DA 5CXWA 3JVUA 2DMWA 4JGPA 1YLJA 1CQAA 4LCMA 4UA9A 4IJGA 4F3LB 3A3DA 3EQVA 5G4YA 5E2FA 4YWZA 1ZHHB 2HPBA 3BRMA 2V1AA 3P01A 2O9CA 3ZGAB 4BENA 3QP1A 4B9OA 1TEMA 3CWFA 1SKOB 3MR0A 4HJ3A 4KZ7A 1MPLA 2PDRA 2XEPA 4MEZA 2WKIA 2ZQ9A 2BTFP 3LI9A 1YSPA 1KGFA 4FCFA 1PW8A 2J9OA 2QJ5A 4ETXA 3S7PA 2H0YA 3GRJA 4BBVA 4P87A 4LGWA 3IX8A 3A0SA 3T4TA 3ZNYA 3MKEA 4IHQA 1HTZA 3LY3A 3D72A 3RTYA 3ZNTA 5L8MA 3SW1A 2ZLYA 3T4SA 1OTAA 3I7JA 2OLUA 4IBXA 1BUEA 4IEDA 4QB8A 4JF5A 3VOZA 3C38A 3BFCA 1SKFA 1VM1A 5E2HA 3CMZA 1TS8A 1ZC2A 5AQ9A 2WGWA 5HSQA 5J8XA 4BMWA 2WAEA 1OT6A 2WKRA 4C6YA 1Y28A 4OLDA 1YMXA 2H10A 4WBGA 4D60A 1W5DA 3F1NB 3A0VA 3SS4A 5HD5A 1LSXA 5EVIC 4OPZA 1L0DA 3PAGA 3C4OA 3Q81A 4U0TA 5CHJA 1WE4A 4DDYA 3SOIA 4KZ8A 5DTSA 4LRXC 5HFOA 5F69A 1M40A 2PYPA 1YT4A 4CLCE 1PZPA 2DRWA 5AJGA 3WS2A 2WKQA 1BZAA 3ULFA 5FEFA 4R0QA 5K5BA 5KMWA 3UPNA 4GS9B 3K3CA 4ARZB 1LLBA 5HAQA 1DY6A 4MBKA 3ZG9B 4HP9A 3PTEA 3T4QA 3DTIA 1ES3A 2J3TD 4P85A 4UQIM 3VP2A 1FR1A 4Z1WA 3R7WA 2ZMAA 3UNWA 3IH8A 2B02A 3BW6A 3LR4A 4OQGA 3ZCZA 2ZMVA 4IVKA 1T19A 3A3IA 3BECA 3BJNA 1GCEA 1TS7A 1IYQA 3B33A 3G34A 2GZAA 5A93A 1MWRA 3HLFA 3IWOA 3LCEA 4HIAA 4QJGA 3GR2A 4K91A 5EECA 4OKPA 3N8LA 2H28A 1ES4A 3Q07A 1YLYA 3W4PA 1LT0A 1X0OA 5HD3A 4E3NA 5M18A 3C7UA 2W27A 1YLWA 3JYIA 4UA6A 2OV5A 4MCWA 1JWPA 4WZ5C 1O7EA 3VE4A 3KSGA 5EPHA 4AFIA 5EVIB 3LO7A 5CGSA 3CUEA 1NRFA 2ZM8A 5L10A 2XSSA 4C75A 5GL9A 1NJ4A 4A5RA 1NZUA 2JBFA 1NYYA 4KG5A 4EU0A 5HL1A 3O3VA 2ZBBA 2IWBA 4N9KA 3N4IA 1P9RA 1XJ4A 5FEGA 5F1FA 3CPTA 3OCLA 4L9EA 4ME4A 1ES5A 3DWKA 3PR6A 2ZQAA 4Y2FA 2HP5A 2Y2OA 2Y4AA 4Q8IA 3WS5A 2J3WA 2Q0OA 3OPRA 1K6RA 5HWTA 4EQ1A 3LY4A 1NRJA 4GB7A 1K57A 2WUQA 4RX2A 4LV0A 2JHEA 3UB6A 3IXDA 4EEPA 4CQHA 2Z2LB 4UHUA 3DTKA 3G35A 4O8GA 5EVID 3CITA 4KUKA 3WS1A 4MBHA 3V5MA 4I39A 4E3LA 3MMHA 5U47A 4RA7A 1GSVA 1SCWA 5AQBA 5G4ZA 2Y2JA 4K08A 3EEAA 2A2LA 4N9LA 2P74A 4BWIA 3ITAA 3EQUA 1NXYA 1PRQA 3LGOA 4WMCA 3HLEA 1DRMA 5EVLA 3M6HA 2O9AA 1JTGA 3VMAA 1D1JA 1HVBA 1CI8A 3N8SA 3LIAA 4ZRRA 2X01A 2A49A 3LR5A 3PYPA 3WS0A 3CUEC 1EROA 4MNRA 1CI9A 4ZJ2A 3G6OA 2J7VA 5KZHA 3MJQA 3BEBA 3EGDC 1L0GA 1MXOA 5HWVA 2Q9MA 2ZM2A 3LICA 4U3TA 3KYEA 5TBMB 3ICYA 3D3OA 3MQ0A 4CPKA 5F6AA 1Z09A 4KQQA 3IBJA 3BLMA 4LENA 4OONA 2ZD8A 2EX9A 5IU1A 2ZMFA 4E6XA 2W3DA 5TJJA 1ESUA 4JPMA 4N1XA 3KO6A 3FC7A 1TD5A 1K57C 4L9FA 4HNBA 1JWVA 5AQAA 3IX3A 2V1BA 4OQHA 3BLSA 1G6AA 2XD1A 4HHDA 1WA9A 5FQIA 3VSLA 4LRZE 3JPUA 2ZQCA 2ZOHA 3RH8B 4H6JB 1LI9A 4R4SA 5HL6A 2XGNA 4X6TA 2XA7M 3SH8A 2JC7A 2Y2PA 2IA2A 2WKEA 3RJUA 3IWQA 4X25A 5C5KA 3V3SA 3O88A 4P0MA 4WELA 4DJ2A 2VLGA 2XK1A 3TSGA 3ZVTA 5F83A 4CLCD 1XP4A 2EWWA 3GQZA 3IQAA 4WYYA 3UMEA 2Z6CA 3W8KA 1PYYA 2ZC5B 3T1QB 3MKFA 5G18A 3A3FA 1OT9A 2PR5A 3S22A 2PRFA 4KUOA 5L07A 1TVFA 2VGJA 3O5YA 3SZTA 4E3JA 4E3IA 4KZBA 3PAEA 3MQOA 4YINA 5GHYA 3K3DA 1ZG6A 4Q0HA 1K6SA 2ZL1A 4Y5FA 4S2LA 5HW3A 4DE3A 1AXBA 4NXBA 4BD0A 4OQIA 3UDIA 1W8YA 3CZDA 3UB9A 4N92A 5EUAA 4E6WA 3ZG7B 4L0LA 2Y2HA 3TRCA 2ZOIA 1H8ZA 3KX0X 3W4OA 4OLGA 1SDNA 2ZJ9A 4BBUA 1M6KA 4L9GA 1YPRA 4NXFA 1UGUA 3FWLA 2PT7A 4CJNA 3GMWA 4UQIS 4S2NC 1HZOA 3VFHA 3BM6A 1K54A 4R1GA 1JVJA 3SH9A 3LYXA 1K38A 4KQDA 1FOFA 1Y54A 4OOYA 3S4XA 4HEFA 1TDGA 3LR0A 4X69A 4X1MA 3DTMA 3IS2A 2MJ6A 1MC0A 4GJ4A 2JKGA 2YKHA 4JGRA 3EOIA 2G7UA 1KDSA 2A24A 1YLPA 1VEUA 1I2WA 2UV0E 1YLTA 1OJGA 2V8FA 4K0WA 5AVEA 1C3BA 3DWZA 4K0XA 2NUTC 1IKIA 2D01A 2ZQ7A 4P6BA 5BOHA 1JWZA 1XA1A 2VJWA 1PI4A 1FCOA 3B42A 5AQ7A 2Y2NA 1S1ZA 3QNCA 2VGLM 3C4PA 4EUVA 1JTDA 4WL9A 3BWLA 5DTKA 2OSUA 3IX4A 1K56D 4I3IA 2RL3A 4O7DA 5M1AA 4QY5A 3H82B 1KVLA 1E25A 1KE3A 1Y4OA 4JF4A 3MS6A 4N1HA 3VOYA 4Q0JA 4RVAA 3UE0A 4JGOA 1GHIA 4KZ9A 5TGFA 1KGGA 1XXMA 3TJZC 2QPNA 3EGXC 3ZHHA 4MN7A 4KQRA 3UY6A 4JXSA 1Q2QA 1BLPA 1MWTA 2PHYA 4RQ9A 4HBTA 4Y3IA 2WAFA 1K55C 3IF6C 4Y17A 3ZG0A 3QP6A 4R3BA 5KSHA 4LV2A 2Y2KA 1VHMA 2ZM0A 5CHMA 3VSKA 5F68A 1XKZA 5FQJA 2W3HA 3HUMA 2VV7A 2PR6A 5CRFA 5HARA 1XJ6A 4DF6A 1PWGA 2PBYA 4PM6A 1BSGA 4OPRA 5A90A 3SH7A 3PBQA 4DXCA 1BLHA 5L09A 4PM8A 1LSVA 4GHIB 4LV1A 5CX7A 1KE4A 4FSFA 1T1BA 1ES2A 3UPPA 1DJAA 3E2KA 2L1MA 3O86A 1E3UA 4PM7A 4GW9A 4Y7PA 4R4RA 1VB6A 2HGVA 1O07A 1FCNA 4JLFA 3UN7A 2OWHA 2G2WA 4FD8A 1GSXA 1BLCA 2X02A 4QHCA 3V3RA 3WWXA 4R3JA 5L2FA 4FH4A 4KG2A 1N9OA 1MWSA 1TS6A 4E3OA 3T1XA 3L7HA 1XGIA 3HBRA 2AVXA 3H7WB 1SZVA 2V0UA 1Z6FA 3VFFA 3HJKA 2JKRM 3E4PA 5FASA 1BTLA 1QMEA 4Q0IA 2Y59A 4PHTA 4MN5A 5EV0A 1PWCA 1RGZA 5A92A 3A3EA 3OOVA 2EX2A 3B3XA 3RFBA 1P9WA 1UWNX 2G2UA 2OLVA 2YKFA 5FDSA 3IF6B 1K4FA 4R38A 3LFVA 3FPVA 2J8YA 4PAUA 3NULA 5HDCA 1NWZA 2HZ5A 1CF0A 2J9PA 1T18A 4R23A 2GNXA 2VKSA 3C8CA 4X68A 4Y15A 4EW7A 2BG1A 4C3QA 1MWUA 4D2OA 4WF0A 1T1AA 3IS2B 3CHWP 3FV7A 3AGFA 3NJAA 4KENB 5HX9A 3T1RA 3NCKA 3VP3A 2C5WB 2A24B 2KX6A 4DE1A 3VP1A 3S7NA 5DFXA 4M3KA 4GDNA 5EVEA 1K4EA 1FILA 4JBFA 4NXEA 2EX8A 2XA7S 3E98A 1S1YA 2Z2MB 3FKWA 4XT2B 2OWJA 4EERA 5EM1A 3F1PA 3NDGA 2O9BA 1FIKA 3NIAA 3BQ8A 1IKGA 5CEBA 1N9BA 3D4FA 4PKYA 2ZQ8A 3KYQA 4UAAA 3IXGA 4DKIA 3PXPA 3P09A 1FR6A 4ZJ1A 3WRZA 2WYXA 1QMFA 2V1ZA 1PIOA 4R70A 5F1GA 2ACGA 3NC8A 3C5AA 4BL3A 2HF6A 1F5MA 1ZKJA 4PKYG 4IUKA 3HUNA 5IS1A 2JKTM 3KSIA 1D7EA 1NLYA 1ERMA 3QP8A 4HOIA 2W3FA 4FOFA 2EFXA 4GD8A 3G30A 1W79A 2R9XA 4KG6A 2ZC3B 2VV8A 3HJIA 1WYBA 1T1CA 4G3WA 2EFUA 5FAOA 4JKTA 4B4XA 3A0RA 3ZG5A 3OC2A 4EESA 2WGWB 1TF1A 1CEGA 2XRNA 3KSHA 3NI9A 1OPXA 1IYPA 3IHBA 1N4OA 1K25A 3OLOA 1H8MA 5TR7A 2HP6A 3MBZA 4DE0A 3NY4A 2HJEA 1F98A 4HH2A 2XFSA 3FZCA 4I3JA 1BT5A 3IBRA 3GDIA 1Q2PA 4ZBEA 5IHVA 2ZQDA 4XUXA 4NG2A 4ZDXA 4HY8A 5FATA 4KZ4A 3LUQA 2V2FF 3EEHA 3NOTC 4S2KA 1IOUA 3ZVWA 2P9VA 2W1RA 3HREA 2DNSA 1U60A 3BFFA 1OTBA 2Y2IA 3UB5P 2HDUA 1EW0A 2W1TA 3C2WA 1KGEA 2PD7A 3R7WB 3VOLA 1GSWA 1OTEA 2QJ7A 3BYDA 3GTCA 4B4ZA 1ZTUA 3QP2A 2CC1A 4M4XA 5FA7A 1W63M 1AWIA 1BLSA 3G32A 1L2SA 2VGLS 1ERQA 3G2YA 5DF9A 5HPIA 4F3LA 1LHYA 3HCYA 3VV4A 4LRYC 4II7A 3UDXA 3BFGA 1ZG4A 3W4QA 1BULA 4OVDA 1ACFA 2BASA 1GHMA 1PW1A 4DRTA 2V20A 3MZDA 1W8QA 1L0FA 3VE3A 4H8RA 2QKPA 3U4LP 2H5SA 4MDZA 1JNUA 3BFEA 2JN7A 2IWDA 3IHAA 1S4SA 2HP9A 5DF8A 4LPZA 4BJPA 4U0XA 3F1PB 1PNEA 1S4RA 3BFDA 4FH2A 5FI6A 5FI7A 3IWIA 2EA9A 4YOFA 3TE8A 1ODVA 4QD4A 4QY6A 1P97A 3OPLA 1SDEA 3CPTB 4NXGA 1KDWA 1XA7A 4BBTA 3HUOA 3T4JA 5MC7A 3LIFA 5DKLA 1GA0A 5CEDA 5KIZA 3N8RA 3OPHA 4GD6A 3T50A 4O0PA 2CMNA 4LLOB 5FQKA 1RP5A 4WUJA 4EBPA 4MMNA 3CG5A 5FL3A 4DN0A 5M19A 3N6IA 3OPPA 1XJ3A 1IEMA 3SS3A 4GS9A 4ARZA 2W3EA 1KVMA 5CECA 2VGKA 5GHZA 2X71A 5HWWA 1MZUA 1NZOA 4PMAA 2IWCA 5A8BA 1XX2A 4GOGA 4P6ZM 2M7UA 1BYWA 1LL9A 3P7NA 1I5QA 2Y91A 3GVBA 4ZTKA 4GKUA 4JGQA 3HLDA 5AVFA 3LI8A 4E3KA 3GV9A 1YKDA 1PI5A 5E2GA 2Y8HA 3EWKA 1ONHA 3UMDA 1SHVA 3ITBA
chains in the Genus database with same CATH topology
3UPOA 1XGIA 3HBRA 1K57A 4EBNA 2WUQA 4RX2A 4LV0A 1Z6FA 4KZ5A 3VFFA 3IXDA 4JXGA 2A3UA 2Z2LB 4UHUA 5FASA 1EI5A 2DCFA 1BTLA 1QMEA 3G35A 5DF7A 5EVID 2Y59A 1ALQA 4GZBA 2R9WA 4OQ0A 4S2NA 3WS1A 4MBHA 1PWCA 3V5MA 5GLCA 1RGZA 5A92A 4E3LA 3A3EA 2EX2A 2P9VB 3DW0A 4S2PA 5FQMA 3B3XA 5U47A 2Y2LA 1RCJA 4WM9A 2QMIA 4RA7A 3CJMA 4WMCD 4KZAA 1SCWA 2XR0A 2G2UA 5AQBA 4YFMA 5EVIA 2Y2JA 2OLVA 3IF6B 1K4FA 4N9LA 5GLDA 2P74A 3VP0A 4EWFA 2J8YA 3ITAA 3EQUA 1NXYA 4Y0OA 5EOEA 5GLBA 4WMCA 4QU3A 3HL9A 4NK3A 3HLEA 5EVLA 3M6HA 1XPBA 1JTGA 3VMAA 1HVBA 2BLSA 2J9PA 3VP4A 1CI8A 4R23A 3RXWA 3N8SA 3SS5A 2HDSA 1KE0A 1ESIA 3HLWA 4X68A 2X01A 2A49A 1PZOA 2BG1A 4C3QA 4RYEA 1MWUA 4D2OA 1J9MA 3FYZA 3WS0A 5FQQA 4JXVA 4S2JA 1EROA 2Y2QA 1EWZA 4MNRA 1CI9A 3FV7A 3AGFA 4ZJ2A 2J7VA 3MXRA 5KZHA 4KENB 4UA7A 5HX9A 1GHPA 2E8IA 3NCKA 5KSCA 3G4PA 2WGIA 2C5WB 4WEJA 3MXSA 3VP3A 3BEBA 4DE1A 3VP1A 4BQMA 4NETA 1K54C 1DJCA 2WK0A 4GDNA 4M3KA 1L0GA 1K4EA 1MXOA 4BLMA 3M2JA 4Y0UA 4JBFA 2EXAA 2EX8A 2Q9MA 2WZZA 5CTMA 3Q1FA 2ZM2A 4Z9QA 2Z2MB 3FKWA 5CERA 4IBRA 4U3TA 3WS4A 4KZ6A 4OOMA 4X56A 1WYCA 3TG9A 3IH9A 3GSGA 3PBOA 3Q82A 4CPKA 1H8YA 3E2LA 1MKIA 4KQQA 1MY8A 3QHYA 3BLMA 4LENA 3NDGA 4OONA 3OZHA 2ZD8A 2EX9A 4GN2A 3MZEA 5TFQA 4E6XA 1ESUA 1YLZA 4JPMA 4N1XA 4X53A 3NIAA 1IKGA 3S1YA 5CEBA 1N9BA 3D4FA 1E4DA 1FCMA 2ZQ8A 3PBTA 1K57C 1K55A 3IF6A 5EOOA 4UAAA 1L0EA 1JWVA 3WRTA 3IXGA 4BL2A 5AQAA 4DKIA 3FKVA 1XGJA 4OP8A 4PM5A 4OPQA 3MZFA 5E2EA 4OQHA 3BLSA 1G6AA 2XD1A 3P09A 1FR6A 1GA9A 4ZJ1A 3WRZA 5FQIA 4LCLA 3VSLA 2XLNA 1YQSA 2WYXA 2B5RA 1IYSA 2WADA 2ZQCA 1QMFA 1FSYA 1LI9A 2V1ZA 4WZ5A 1PIOA 5DTTA 5F1GA 4R4SA 2PU4A 4ID4A 4MLLA 3NC8A 4GDBA 1S0WA 1ONGA 3M2KA 3N7WA 3C5AA 4BL3A 1IYOA 2XGNA 1H5XA 3ZDJA 4X6TA 3SH8A 2XH9A 2EX6A 2XDMA 2JC7A 5HAIA 1ZKJA 3LEZA 3OCNA 3MFDA 3Q7VA 4OPYA 4ZAMA 3PBRA 2Y2PA 3HUNA 4KQOA 2WGVA 1CEFA 2WKEA 2I72A 3UDFA 5FDHA 1I2SA 1PWDA 3TOIA 3RJUA 1ERMA 3IWQA 4KZ3A 4DDSA 5E43A 4XXRA 5FAPA 2EFXA 2XQZA 3O88A 3V3SA 3V39A 4DXBA 2XF3A 4GD8A 4P0MA 3P98A 3G30A 1W79A 2R9XA 4WELA 4KG6A 2ZC3B 1WYBA 2XK1A 3TSGA 2EFUA 2QZ6A 5FAOA 4JKTA 3ZVTA 5F83A 5CXWA 4B4XA 4GNUA 3ZG5A 1LL5A 4X55A 3OC2A 4HBUA 1XP4A 5FI2A 3GQZA 1YLJA 3IQAA 4WYYA 2ZC4B 2WGWB 4LCMA 1CEGA 2GDNA 4UA9A 2FFFB 3A3DA 3W8KA 3NI9A 3EQVA 2FFYA 1IYPA 1PYYA 5E2FA 3IHBA 2ZC5B 3MKFA 1N4OA 1K25A 2HPBA 3IT9A 3BRMA 5G18A 5TR7A 2HP6A 3A3FA 3MBZA 4DE0A 3C7VA 3HLGA 4DE2A 1TDLA 3S22A 2RCXA 3NY4A 3UE3A 3ZGAB 4BENA 4B88A 3ISGA 2C6WB 1TEMA 2XFSA 4PPRA 1TVFA 3HLBA 3FZCA 4KZ7A 1MPLA 2VGJA 4E3JA 2XEPA 4E3IA 4MEZA 1BT5A 2WKIA 1RGYA 4KZBA 2ZQ9A 3PAEA 1Q2PA 4YINA 1W7FA 4ZBEA 1KGFA 5GHYA 2ZQDA 5IHVA 4XUXA 1ZG6A 4FCFA 1K6SA 1PW8A 2J9OA 4S2LA 5HW3A 4ZDXA 2H0YA 3GRJA 5FATA 4KZ4A 4DE3A 1AXBA 4P87A 2V2FF 4BD0A 4OQIA 3UDIA 5CGXA 4EQIA 3ZNYA 4S2KA 1W8YA 3CZDA 3ZVWA 2HDQA 2P9VA 3HREA 3MKEA 1HTZA 4N92A 5EUAA 4E6WA 3LY3A 3AGDA 3ZG7B 2DNSA 4L0LA 2Y2HA 3M6BA 4WEKA 1U60A 3BFFA 3ZNTA 2Y2IA 2HDUA 1H8ZA 4F94A 3W4OA 4OLGA 1SDNA 2XD5A 1KGEA 2ZJ9A 2ZLYA 5EE8A 1M6KA 3NBLA 5FSRA 3I7JA 2OLUA 4IBXA 4JF6A 4JXWA 4RX3A 1BUEA 3BYDA 4IEDA 3NDEA 4QB8A 4JF5A 3GTCA 3VOZA 3BFCA 4B4ZA 1SKFA 3ZG8B 1VM1A 3FWLA 2CC1A 1VQQA 2WZXA 5CTNA 5FAQA 5E2HA 3CMZA 2WKHA 5FA7A 4CJNA 4OP5A 1BLSA 3GMWA 3G32A 1L2SA 1ZC2A 3PBNA 4OOLA 4S2NC 5AQ9A 2WGWA 5J8XA 1HZOA 1ERQA 3G2YA 5DF9A 3VFHA 1NY0A 2WAEA 4WZ4A 1LHYA 4E3MA 3BM6A 1K54A 4R1GA 4C6YA 4OLDA 1JVJA 1YMXA 2H10A 2JCHA 4PM9A 4WBGA 3SH9A 1K38A 3G31A 1FOFA 1W5DA 1Y54A 4OOYA 3S4XA 3AGEA 4S2MA 4OH0A 4HEFA 3SS4A 3UDXA 1TDGA 3BFGA 5EVIC 1ZG4A 4OPZA 3W4QA 1MBLA 1BULA 1L0DA 3PAGA 4X69A 4ZJ3A 4OVDA 2UWXA 3C4OA 3DTMA 3Q81A 1GHMA 1YM1A 1G68A 3HLCA 1PW1A 4U0TA 1WE4A 5CHJA 4BD1A 4DDYA 3SOIA 4KZ8A 5DTSA 4DRTA 2V20A 3MZDA 1W8QA 1L0FA 4MBFA 5HFOA 1M40A 3IF5A 1KDSA 1YT4A 1PZPA 1YLPA 2DRWA 4H8RA 3WS2A 1BZAA 2H5SA 1I2WA 1YLTA 4R0QA 3BFEA 5KMWA 3Q7ZA 2H0TA 4K0WA 3UPNA 2IWDA 1C3BA 1LLBA 3DWZA 4K0XA 5HAQA 3IHAA 2HP9A 5DF8A 4Y0TA 2ZC6B 1IKIA 4BJPA 1DY6A 4MBKA 3ZG9B 2ZQ7A 4P6BA 3PTEA 5BOHA 4IVIA 4U0XA 5FQ9A 1JWZA 1XA1A 3QNBA 1PI4A 1FCOA 4LV3A 1S6RA 1ES3A 5A91A 3ZFZA 4P85A 5AQ7A 2Y2NA 3QNCA 3C4PA 1OMEA 3VP2A 3BFDA 1IELA 1JTDA 4FH2A 5DTKA 3PBSA 5FI6A 5FI7A 2OSUA 3IWIA 1FR1A 1FSWA 5D3OA 2ZMAA 5F82A 1K56D 4O7DA 2RL3A 5M1AA 2Y2GA 3UNWA 3IH8A 2PU2A 3IXHA 4QY5A 4QD4A 1KVLA 1E25A 1KE3A 4JF4A 4QY6A 4N1HA 3OPLA 4S2IA 3O87A 1SDEA 3VOYA 4OQGA 5CGWA 3ZCZA 1KDWA 1XA7A 4RVAA 3UE0A 1GHIA 4KZ9A 3HUOA 4IVKA 5TGFA 1KGGA 3A3IA 1XXMA 3BECA 2QPNA 5JYOA 1K56A 1GCEA 1GA0A 3ZHHA 5CEDA 1IYQA 3G34A 3N8RA 3OPHA 4KQRA 3G2ZA 4GD6A 3UY6A 2Y2MA 3V50A 4JXSA 1Q2QA 1BLPA 1MWTA 4HBTA 2WAFA 2EXBA 5FQKA 1RP5A 4EUZA 5A93A 1MWRA 1K55C 3HLFA 3IF6C 3IWOA 3LCEA 3ZG0A 4QJGA 4R3BA 4EBPA 3GR2A 4K91A 5EECA 1HD8A 5KSHA 4OKPA 3N8LA 4LV2A 2Y2KA 3CG5A 1ES4A 3Q07A 2ZM0A 5CHMA 1YLYA 3W4PA 3VSKA 4S2OA 5M19A 3Q7VB 5DVAA 1XKZA 4E3NA 1CK3A 5FQJA 5M18A 2HDRA 3N6IA 3OPPA 3HUMA 3C7UA 5CRFA 5HARA 2Q9NA 4DF6A 1PWGA 1YLWA 3JYIA 4UA6A 2OV5A 3A3JA 1IEMA 1JWPA 2PBYA 4PM6A 1BSGA 3SS3A 4WZ5C 5JYPA 1O7EA 4OPRA 5A90A 5EPHA 3SH7A 3PBQA 4DXCA 5EVIB 1BLHA 3LO7A 5CGSA 2XFTA 4EBLA 4PM8A 1KVMA 5CECA 2VGKA 1E3UD 4LV1A 5GHZA 2X71A 1NRFA 5GHXA 1NZOA 2ZM8A 1KE4A 4PMAA 2IWCA 4FSFA 4C75A 5GL9A 1ES2A 3UPPA 1DJAA 1NJ4A 1XX2A 4GOGA 4A5RA 3E2KA 1LL9A 1NZUA 2JBFA 1I5QA 1NYYA 1LI0A 2Y91A 4KG5A 3UE1A 1FQGA 5HAPA 3GVBA 5HL1A 3O3VA 4ZTKA 2IWBA 4EV4A 4N9KA 3O86A 4GKUA 1E3UA 4PM7A 1YMSA 4Y7PA 3RXXA 3HLDA 1DJBA 3N4IA 4R4RA 5F1FA 5GLAA 1O07A 3OCLA 1FCNA 4JLFA 4E3KA 3GV9A 1NYMA 3UN7A 3UO9A 1ES5A 2JE5A 3DWKA 1PI5A 4XUZA 2ZQAA 3IXBA 2HP5A 2G2WA 2Y2OA 4FD8A 5E2GA 5I94A 2Y4AA 1BLCA 4Q8IA 2X02A 3WS5A 4QHCA 3V3RA 3WWXA 2ZC7A 4R3JA 5L2FA 3OPRA 3HVFA 4FH4A 4KG2A 1K6RA 2Y55A 1MWSA 4HESA 3LY4A 1ONHA 4E3OA 1SHVA 3ITBA 4GB7A 5CHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UPO A;  1XGI A;  3HBR A;  1K57 A;  4EBN A;  2WUQ A;  4RX2 A;  4LV0 A;  1Z6F A;  4KZ5 A;  3VFF A;  3IXD A;  4JXG A;  2A3U A;  2Z2L B;  4UHU A;  5FAS A;  1EI5 A;  2DCF A;  1BTL A;  1QME A;  3G35 A;  5DF7 A;  5EVI D;  2Y59 A;  1ALQ A;  4GZB A;  2R9W A;  4OQ0 A;  4S2N A;  3WS1 A;  4MBH A;  1PWC A;  3V5M A;  5GLC A;  1RGZ A;  5A92 A;  4E3L A;  3A3E A;  2EX2 A;  2P9V B;  3DW0 A;  4S2P A;  5FQM A;  3B3X A;  5U47 A;  2Y2L A;  1RCJ A;  4WM9 A;  2QMI A;  4RA7 A;  3CJM A;  4WMC D;  4KZA A;  1SCW A;  2XR0 A;  2G2U A;  5AQB A;  4YFM A;  5EVI A;  2Y2J A;  2OLV A;  3IF6 B;  1K4F A;  4N9L A;  5GLD A;  2P74 A;  3VP0 A;  4EWF A;  2J8Y A;  3ITA A;  3EQU A;  1NXY A;  4Y0O A;  5EOE A;  5GLB A;  4WMC A;  4QU3 A;  3HL9 A;  4NK3 A;  3HLE A;  5EVL A;  3M6H A;  1XPB A;  1JTG A;  3VMA A;  1HVB A;  2BLS A;  2J9P A;  3VP4 A;  1CI8 A;  4R23 A;  3RXW A;  3N8S A;  3SS5 A;  2HDS A;  1KE0 A;  1ESI A;  3HLW A;  4X68 A;  2X01 A;  2A49 A;  1PZO A;  2BG1 A;  4C3Q A;  4RYE A;  1MWU A;  4D2O A;  1J9M A;  3FYZ A;  3WS0 A;  5FQQ A;  4JXV A;  4S2J A;  1ERO A;  2Y2Q A;  1EWZ A;  4MNR A;  1CI9 A;  3FV7 A;  3AGF A;  4ZJ2 A;  2J7V A;  3MXR A;  5KZH A;  4KEN B;  4UA7 A;  5HX9 A;  1GHP A;  2E8I A;  3NCK A;  5KSC A;  3G4P A;  2WGI A;  2C5W B;  4WEJ A;  3MXS A;  3VP3 A;  3BEB A;  4DE1 A;  3VP1 A;  4BQM A;  4NET A;  1K54 C;  1DJC A;  2WK0 A;  4GDN A;  4M3K A;  1L0G A;  1K4E A;  1MXO A;  4BLM A;  3M2J A;  4Y0U A;  4JBF A;  2EXA A;  2EX8 A;  2Q9M A;  2WZZ A;  5CTM A;  3Q1F A;  2ZM2 A;  4Z9Q A;  2Z2M B;  3FKW A;  5CER A;  4IBR A;  4U3T A;  3WS4 A;  4KZ6 A;  4OOM A;  4X56 A;  1WYC A;  3TG9 A;  3IH9 A;  3GSG A;  3PBO A;  3Q82 A;  4CPK A;  1H8Y A;  3E2L A;  1MKI A;  4KQQ A;  1MY8 A;  3QHY A;  3BLM A;  4LEN A;  3NDG A;  4OON A;  3OZH A;  2ZD8 A;  2EX9 A;  4GN2 A;  3MZE A;  5TFQ A;  4E6X A;  1ESU A;  1YLZ A;  4JPM A;  4N1X A;  4X53 A;  3NIA A;  1IKG A;  3S1Y A;  5CEB A;  1N9B A;  3D4F A;  1E4D A;  1FCM A;  2ZQ8 A;  3PBT A;  1K57 C;  1K55 A;  3IF6 A;  5EOO A;  4UAA A;  1L0E A;  1JWV A;  3WRT A;  3IXG A;  4BL2 A;  5AQA A;  4DKI A;  3FKV A;  1XGJ A;  4OP8 A;  4PM5 A;  4OPQ A;  3MZF A;  5E2E A;  4OQH A;  3BLS A;  1G6A A;  2XD1 A;  3P09 A;  1FR6 A;  1GA9 A;  4ZJ1 A;  3WRZ A;  5FQI A;  4LCL A;  3VSL A;  2XLN A;  1YQS A;  2WYX A;  2B5R A;  1IYS A;  2WAD A;  2ZQC A;  1QMF A;  1FSY A;  1LI9 A;  2V1Z A;  4WZ5 A;  1PIO A;  5DTT A;  5F1G A;  4R4S A;  2PU4 A;  4ID4 A;  4MLL A;  3NC8 A;  4GDB A;  1S0W A;  1ONG A;  3M2K A;  3N7W A;  3C5A A;  4BL3 A;  1IYO A;  2XGN A;  1H5X A;  3ZDJ A;  4X6T A;  3SH8 A;  2XH9 A;  2EX6 A;  2XDM A;  2JC7 A;  5HAI A;  1ZKJ A;  3LEZ A;  3OCN A;  3MFD A;  3Q7V A;  4OPY A;  4ZAM A;  3PBR A;  2Y2P A;  3HUN A;  4KQO A;  2WGV A;  1CEF A;  2WKE A;  2I72 A;  3UDF A;  5FDH A;  1I2S A;  1PWD A;  3TOI A;  3RJU A;  1ERM A;  3IWQ A;  4KZ3 A;  4DDS A;  5E43 A;  4XXR A;  5FAP A;  2EFX A;  2XQZ A;  3O88 A;  3V3S A;  3V39 A;  4DXB A;  2XF3 A;  4GD8 A;  4P0M A;  3P98 A;  3G30 A;  1W79 A;  2R9X A;  4WEL A;  4KG6 A;  2ZC3 B;  1WYB A;  2XK1 A;  3TSG A;  2EFU A;  2QZ6 A;  5FAO A;  4JKT A;  3ZVT A;  5F83 A;  5CXW A;  4B4X A;  4GNU A;  3ZG5 A;  1LL5 A;  4X55 A;  3OC2 A;  4HBU A;  1XP4 A;  5FI2 A;  3GQZ A;  1YLJ A;  3IQA A;  4WYY A;  2ZC4 B;  2WGW B;  4LCM A;  1CEG A;  2GDN A;  4UA9 A;  2FFF B;  3A3D A;  3W8K A;  3NI9 A;  3EQV A;  2FFY A;  1IYP A;  1PYY A;  5E2F A;  3IHB A;  2ZC5 B;  3MKF A;  1N4O A;  1K25 A;  2HPB A;  3IT9 A;  3BRM A;  5G18 A;  5TR7 A;  2HP6 A;  3A3F A;  3MBZ A;  4DE0 A;  3C7V A;  3HLG A;  4DE2 A;  1TDL A;  3S22 A;  2RCX A;  3NY4 A;  3UE3 A;  3ZGA B;  4BEN A;  4B88 A;  3ISG A;  2C6W B;  1TEM A;  2XFS A;  4PPR A;  1TVF A;  3HLB A;  3FZC A;  4KZ7 A;  1MPL A;  2VGJ A;  4E3J A;  2XEP A;  4E3I A;  4MEZ A;  1BT5 A;  2WKI A;  1RGY A;  4KZB A;  2ZQ9 A;  3PAE A;  1Q2P A;  4YIN A;  1W7F A;  4ZBE A;  1KGF A;  5GHY A;  2ZQD A;  5IHV A;  4XUX A;  1ZG6 A;  4FCF A;  1K6S A;  1PW8 A;  2J9O A;  4S2L A;  5HW3 A;  4ZDX A;  2H0Y A;  3GRJ A;  5FAT A;  4KZ4 A;  4DE3 A;  1AXB A;  4P87 A;  2V2F F;  4BD0 A;  4OQI A;  3UDI A;  5CGX A;  4EQI A;  3ZNY A;  4S2K A;  1W8Y A;  3CZD A;  3ZVW A;  2HDQ A;  2P9V A;  3HRE A;  3MKE A;  1HTZ A;  4N92 A;  5EUA A;  4E6W A;  3LY3 A;  3AGD A;  3ZG7 B;  2DNS A;  4L0L A;  2Y2H A;  3M6B A;  4WEK A;  1U60 A;  3BFF A;  3ZNT A;  2Y2I A;  2HDU A;  1H8Z A;  4F94 A;  3W4O A;  4OLG A;  1SDN A;  2XD5 A;  1KGE A;  2ZJ9 A;  2ZLY A;  5EE8 A;  1M6K A;  3NBL A;  5FSR A;  3I7J A;  2OLU A;  4IBX A;  4JF6 A;  4JXW A;  4RX3 A;  1BUE A;  3BYD A;  4IED A;  3NDE A;  4QB8 A;  4JF5 A;  3GTC A;  3VOZ A;  3BFC A;  4B4Z A;  1SKF A;  3ZG8 B;  1VM1 A;  3FWL A;  2CC1 A;  1VQQ A;  2WZX A;  5CTN A;  5FAQ A;  5E2H A;  3CMZ A;  2WKH A;  5FA7 A;  4CJN A;  4OP5 A;  1BLS A;  3GMW A;  3G32 A;  1L2S A;  1ZC2 A;  3PBN A;  4OOL A;  4S2N C;  5AQ9 A;  2WGW A;  5J8X A;  1HZO A;  1ERQ A;  3G2Y A;  5DF9 A;  3VFH A;  1NY0 A;  2WAE A;  4WZ4 A;  1LHY A;  4E3M A;  3BM6 A;  1K54 A;  4R1G A;  4C6Y A;  4OLD A;  1JVJ A;  1YMX A;  2H10 A;  2JCH A;  4PM9 A;  4WBG A;  3SH9 A;  1K38 A;  3G31 A;  1FOF A;  1W5D A;  1Y54 A;  4OOY A;  3S4X A;  3AGE A;  4S2M A;  4OH0 A;  4HEF A;  3SS4 A;  3UDX A;  1TDG A;  3BFG A;  5EVI C;  1ZG4 A;  4OPZ A;  3W4Q A;  1MBL A;  1BUL A;  1L0D A;  3PAG A;  4X69 A;  4ZJ3 A;  4OVD A;  2UWX A;  3C4O A;  3DTM A;  3Q81 A;  1GHM A;  1YM1 A;  1G68 A;  3HLC A;  1PW1 A;  4U0T A;  1WE4 A;  5CHJ A;  4BD1 A;  4DDY A;  3SOI A;  4KZ8 A;  5DTS A;  4DRT A;  2V20 A;  3MZD A;  1W8Q A;  1L0F A;  4MBF A;  5HFO A;  1M40 A;  3IF5 A;  1KDS A;  1YT4 A;  1PZP A;  1YLP A;  2DRW A;  4H8R A;  3WS2 A;  1BZA A;  2H5S A;  1I2W A;  1YLT A;  4R0Q A;  3BFE A;  5KMW A;  3Q7Z A;  2H0T A;  4K0W A;  3UPN A;  2IWD A;  1C3B A;  1LLB A;  3DWZ A;  4K0X A;  5HAQ A;  3IHA A;  2HP9 A;  5DF8 A;  4Y0T A;  2ZC6 B;  1IKI A;  4BJP A;  1DY6 A;  4MBK A;  3ZG9 B;  2ZQ7 A;  4P6B A;  3PTE A;  5BOH A;  4IVI A;  4U0X A;  5FQ9 A;  1JWZ A;  1XA1 A;  3QNB A;  1PI4 A;  1FCO A;  4LV3 A;  1S6R A;  1ES3 A;  5A91 A;  3ZFZ A;  4P85 A;  5AQ7 A;  2Y2N A;  3QNC A;  3C4P A;  1OME A;  3VP2 A;  3BFD A;  1IEL A;  1JTD A;  4FH2 A;  5DTK A;  3PBS A;  5FI6 A;  5FI7 A;  2OSU A;  3IWI A;  1FR1 A;  1FSW A;  5D3O A;  2ZMA A;  5F82 A;  1K56 D;  4O7D A;  2RL3 A;  5M1A A;  2Y2G A;  3UNW A;  3IH8 A;  2PU2 A;  3IXH A;  4QY5 A;  4QD4 A;  1KVL A;  1E25 A;  1KE3 A;  4JF4 A;  4QY6 A;  4N1H A;  3OPL A;  4S2I A;  3O87 A;  1SDE A;  3VOY A;  4OQG A;  5CGW A;  3ZCZ A;  1KDW A;  1XA7 A;  4RVA A;  3UE0 A;  1GHI A;  4KZ9 A;  3HUO A;  4IVK A;  5TGF A;  1KGG A;  3A3I A;  1XXM A;  3BEC A;  2QPN A;  5JYO A;  1K56 A;  1GCE A;  1GA0 A;  3ZHH A;  5CED A;  1IYQ A;  3G34 A;  3N8R A;  3OPH A;  4KQR A;  3G2Z A;  4GD6 A;  3UY6 A;  2Y2M A;  3V50 A;  4JXS A;  1Q2Q A;  1BLP A;  1MWT A;  4HBT A;  2WAF A;  2EXB A;  5FQK A;  1RP5 A;  4EUZ A;  5A93 A;  1MWR A;  1K55 C;  3HLF A;  3IF6 C;  3IWO A;  3LCE A;  3ZG0 A;  4QJG A;  4R3B A;  4EBP A;  3GR2 A;  4K91 A;  5EEC A;  1HD8 A;  5KSH A;  4OKP A;  3N8L A;  4LV2 A;  2Y2K A;  3CG5 A;  1ES4 A;  3Q07 A;  2ZM0 A;  5CHM A;  1YLY A;  3W4P A;  3VSK A;  4S2O A;  5M19 A;  3Q7V B;  5DVA A;  1XKZ A;  4E3N A;  1CK3 A;  5FQJ A;  5M18 A;  2HDR A;  3N6I A;  3OPP A;  3HUM A;  3C7U A;  5CRF A;  5HAR A;  2Q9N A;  4DF6 A;  1PWG A;  1YLW A;  3JYI A;  4UA6 A;  2OV5 A;  3A3J A;  1IEM A;  1JWP A;  2PBY A;  4PM6 A;  1BSG A;  3SS3 A;  4WZ5 C;  5JYP A;  1O7E A;  4OPR A;  5A90 A;  5EPH A;  3SH7 A;  3PBQ A;  4DXC A;  5EVI B;  1BLH A;  3LO7 A;  5CGS A;  2XFT A;  4EBL A;  4PM8 A;  1KVM A;  5CEC A;  2VGK A;  1E3U D;  4LV1 A;  5GHZ A;  2X71 A;  1NRF A;  5GHX A;  1NZO A;  2ZM8 A;  1KE4 A;  4PMA A;  2IWC A;  4FSF A;  4C75 A;  5GL9 A;  1ES2 A;  3UPP A;  1DJA A;  1NJ4 A;  1XX2 A;  4GOG A;  4A5R A;  3E2K A;  1LL9 A;  1NZU A;  2JBF A;  1I5Q A;  1NYY A;  1LI0 A;  2Y91 A;  4KG5 A;  3UE1 A;  1FQG A;  5HAP A;  3GVB A;  5HL1 A;  3O3V A;  4ZTK A;  2IWB A;  4EV4 A;  4N9K A;  3O86 A;  4GKU A;  1E3U A;  4PM7 A;  1YMS A;  4Y7P A;  3RXX A;  3HLD A;  1DJB A;  3N4I A;  4R4R A;  5F1F A;  5GLA A;  1O07 A;  3OCL A;  1FCN A;  4JLF A;  4E3K A;  3GV9 A;  1NYM A;  3UN7 A;  3UO9 A;  1ES5 A;  2JE5 A;  3DWK A;  1PI5 A;  4XUZ A;  2ZQA A;  3IXB A;  2HP5 A;  2G2W A;  2Y2O A;  4FD8 A;  5E2G A;  5I94 A;  2Y4A A;  1BLC A;  4Q8I A;  2X02 A;  3WS5 A;  4QHC A;  3V3R A;  3WWX A;  2ZC7 A;  4R3J A;  5L2F A;  3OPR A;  3HVF A;  4FH4 A;  4KG2 A;  1K6R A;  2Y55 A;  1MWS A;  4HES A;  3LY4 A;  1ONH A;  4E3O A;  1SHV A;  3ITB A;  4GB7 A;  5CHU A; 
#chains in the Genus database with same CATH topology
 3LIE A;  4EBN A;  4KZ5 A;  2A3U A;  2J3T C;  5DF7 A;  4GZB A;  2R9W A;  3DW0 A;  2P9V B;  5FQM A;  4S2P A;  2Y2L A;  3U2A A;  4WMC D;  4KZA A;  2JKR I;  2XR0 A;  2W1T B;  5EVI A;  3V67 A;  4HI4 A;  3D9Y A;  4MN6 A;  4Y0O A;  5GLB A;  2JKF A;  2KDK A;  2PD8 A;  2BLS A;  3VP4 A;  4G3K A;  3RXW A;  3SS5 A;  2HDS A;  1ESI A;  2R78 A;  3HLW A;  2HJ9 C;  4RYE A;  1KOU A;  5FQQ A;  1EWZ A;  2K7S A;  3MXR A;  2P7J A;  2E8I A;  5KSC A;  3MXS A;  1K54 C;  2WK0 A;  3F1O A;  4BLM A;  3M2J A;  1S66 L;  2GX5 A;  2WZZ A;  5CTM A;  2VX8 A;  3Q1F A;  2O0Y A;  3T4O A;  4Z9Q A;  5CER A;  4IBR A;  3WS4 A;  4OOM A;  1WYC A;  3IH9 A;  5DFY A;  3GSG A;  2O99 A;  3PBO A;  2EWV A;  3Q82 A;  1H8Y A;  3E2L A;  1MKI A;  1F9I A;  1MY8 A;  2NUP C;  3OZH A;  3MZE A;  4UEY A;  5DJU A;  4HJ6 A;  2P08 A;  3DTE A;  1FCM A;  2OOL A;  3PBT A;  5EOO A;  2V0W A;  1DP6 A;  1XFN A;  1LL8 A;  2VZW A;  4OPQ A;  3MZF A;  3QP4 A;  4HP4 A;  5E2E A;  3NOP C;  2V8C A;  1IYS A;  1UWP X;  2WAD A;  4EXO A;  4WZ5 A;  1FSY A;  2PU4 A;  4ID4 A;  2INW A;  1F2K A;  1ONG A;  3M2K A;  3N7W A;  2HV1 A;  2EX6 A;  2XDM A;  5HAI A;  2ZL1 B;  3LEZ A;  3OCN A;  2M7V A;  3MFD A;  3Q7V A;  4OPY A;  3PBR A;  4KQO A;  2WGV A;  1CEF A;  3BY9 A;  1G28 A;  2I72 A;  1V9Z A;  5FDH A;  1I2S A;  1N9N A;  4KZ3 A;  3T4K A;  4DDS A;  5E43 A;  5FAP A;  3V39 A;  4IUH A;  4DXB A;  2XF3 A;  3P98 A;  2FZ0 A;  5TBM A;  4GLQ A;  4R3A A;  5EFW A;  2QZ6 A;  3QP5 A;  2JKT I;  3S7O A;  1J3W A;  4GNU A;  3C30 A;  5J7E A;  1LL5 A;  4X55 A;  4HBU A;  5FI2 A;  3L9K A;  2K2N A;  2ZC4 B;  2GDN A;  1N9L A;  2FFF B;  2B18 A;  2FFY A;  3IT9 A;  4CLC A;  1MKM A;  1H3Q A;  3C7V A;  3HLG A;  4DJ3 A;  3LR3 A;  4DE2 A;  1TDL A;  3T1S A;  2QYB A;  2RCX A;  3UE3 A;  1NLZ A;  4B88 A;  3ISG A;  2C6W B;  4PPR A;  3HLB A;  4H6J A;  4QWO A;  1RGY A;  2LB5 A;  1VEU B;  1W7F A;  3ZYT A;  1OJ5 A;  5F5Y A;  4ETZ A;  5CGX A;  4EQI A;  1D06 A;  3S7Q A;  2HDQ A;  2E8J A;  3AGD A;  4WEK A;  3M6B A;  4FTX A;  4F94 A;  5EE8 A;  2XD5 A;  2I9V A;  2P04 A;  3NBL A;  5FSR A;  3NOU C;  4RX3 A;  4JF6 A;  4JXW A;  3NDE A;  3MFX A;  3ZG8 B;  1VQQ A;  2WZX A;  5CTN A;  5FAQ A;  2WKH A;  4OP5 A;  3PBN A;  4OOL A;  5I5L A;  4NEE D;  1NY0 A;  5IT5 A;  4WZ4 A;  4E3M A;  3H9W A;  4PM9 A;  2JCH A;  2KOI A;  3G31 A;  2WKP A;  3AGE A;  4DMZ A;  4S2M A;  4OH0 A;  3BQA A;  1MBL A;  3PHY A;  4ZJ3 A;  4X1L A;  3CAX A;  2UWX A;  4Y13 A;  1YM1 A;  1G68 A;  3HLC A;  4BD1 A;  1YSQ A;  4MBF A;  3T4L A;  3DBA A;  3IF5 A;  3F1O B;  1CJF A;  3Q7Z A;  2H0T A;  1W63 Q;  4CLC C;  4Y0T A;  2ZC6 B;  4IVI A;  5FQ9 A;  3QNB A;  4LV3 A;  1S6R A;  5A91 A;  3ZFZ A;  4G3V A;  4HQA A;  1OME A;  1IEL A;  2W0N A;  3PBS A;  2XRO A;  2VEA A;  1K0K A;  1FSW A;  5D3O A;  5F82 A;  2Y2G A;  3IXH A;  2PU2 A;  1STZ A;  2GJ3 A;  1HLU P;  4S2I A;  3O87 A;  5CGW A;  4P6Z S;  4O01 A;  4EET B;  4HJ4 A;  5JYO A;  1K56 A;  2PBD P;  3G2Z A;  3V50 A;  2Y2M A;  3UB8 A;  5HZH A;  5LBR A;  2EXB A;  1G5U A;  4EUZ A;  3GEC A;  4WN5 A;  5DJT A;  1HD8 A;  2VK3 A;  4HH3 A;  4S2O A;  3Q7V B;  5DVA A;  1CK3 A;  2HDR A;  1VET A;  3E0Y A;  2Q9N A;  3A3J A;  4I3A A;  5JYP A;  2PYR A;  2XFT A;  4EBL A;  3UB7 A;  1E3U D;  3NHQ A;  1G6O A;  5GHX A;  3T12 B;  4B93 A;  1DP9 A;  3E4Q A;  1L3L A;  2LB9 A;  3MSH A;  1LI0 A;  3UE1 A;  4FUW A;  1FQG A;  5HAP A;  4I38 A;  4ESP A;  4EV4 A;  1YMS A;  5HDS A;  3RXX A;  1DJB A;  3H82 A;  1H0M A;  5GLA A;  2L4R A;  3LID A;  4WLA A;  1NYM A;  4YNR A;  3UO9 A;  2J80 A;  4CLC B;  4QPR A;  2JE5 A;  4XUZ A;  3NEC A;  3IXB A;  5I94 A;  3R4K A;  2ZC7 A;  1SKO A;  3HVF A;  2Y55 A;  4HES A;  1LSW A;  5CHU A;  3UPO A;  3ZQ5 A;  4JXG A;  3MF0 A;  1EI5 A;  1XFQ A;  2DCF A;  2L0W A;  5J3W A;  1ALQ A;  2B95 A;  4OQ0 A;  4S2N A;  2FH5 A;  5GLC A;  2OAP 1;  3CLO A;  3DAV A;  3E4O A;  2VV6 A;  1RCJ A;  4WM9 A;  2QMI A;  3CJM A;  1DP8 A;  1XJ2 A;  4YFM A;  1V9Y A;  4GHI A;  5GLD A;  4LFU A;  3VP0 A;  4EWF A;  3LEQ A;  5EOE A;  4E04 A;  1A0K A;  1PFL A;  4QU3 A;  1S67 L;  3HL9 A;  4NK3 A;  2V9A A;  1XPB A;  2PAV P;  1KE0 A;  3F1N A;  1PZO A;  3FPW A;  1J9M A;  3FYZ A;  5HDD A;  4JXV A;  4S2J A;  2Y2Q A;  2QHK A;  3FG8 A;  3CI6 A;  4UA7 A;  1GHP A;  3G4P A;  2WGI A;  4WEJ A;  4EEU A;  4BQM A;  1OTI A;  4NET A;  1DJC A;  2KLI A;  3BY8 A;  3H7W A;  3W2Z A;  2VA0 A;  4Y0U A;  2EXA A;  3OBF A;  1TS0 A;  4GCZ A;  1YAX A;  4KZ6 A;  1OTD A;  4X56 A;  3TG9 A;  3K2N A;  2OAQ 1;  3QHY A;  5HPF A;  3MQQ A;  4GN2 A;  5TFQ A;  1YLZ A;  4X53 A;  4I5S A;  3S1Y A;  3KSF A;  1E4D A;  3TW8 A;  1K55 A;  3IF6 A;  1IFQ A;  1L0E A;  3WRT A;  4BL2 A;  3FKV A;  1XGJ A;  4OP8 A;  4PM5 A;  2QWS A;  4NKP A;  1GA9 A;  4LCL A;  2XLN A;  1YQS A;  2B5R A;  3JVV A;  4R6L A;  5DTT A;  2Y79 A;  4MLL A;  4GDB A;  1S0W A;  1IYO A;  3ZDJ A;  1H5X A;  2XH9 A;  2K31 A;  5J4E A;  4ZAM A;  3B47 A;  3UDF A;  2M1C A;  5DKK A;  1VET B;  1PWD A;  3TOI A;  5EM0 A;  3UE6 A;  4XXR A;  1P0Z A;  2XQZ A;  3LIB A;  3MXQ A;  4XT2 A;  3KYZ A;  2D02 A;  2W3G A;  2Z6D A;  5CXW A;  3JVU A;  2DMW A;  4JGP A;  1YLJ A;  1CQA A;  4LCM A;  4UA9 A;  4IJG A;  4F3L B;  3A3D A;  3EQV A;  5G4Y A;  5E2F A;  4YWZ A;  1ZHH B;  2HPB A;  3BRM A;  2V1A A;  3P01 A;  2O9C A;  3ZGA B;  4BEN A;  3QP1 A;  4B9O A;  1TEM A;  3CWF A;  1SKO B;  3MR0 A;  4HJ3 A;  4KZ7 A;  1MPL A;  2PDR A;  2XEP A;  4MEZ A;  2WKI A;  2ZQ9 A;  2BTF P;  3LI9 A;  1YSP A;  1KGF A;  4FCF A;  1PW8 A;  2J9O A;  2QJ5 A;  4ETX A;  3S7P A;  2H0Y A;  3GRJ A;  4BBV A;  4P87 A;  4LGW A;  3IX8 A;  3A0S A;  3T4T A;  3ZNY A;  3MKE A;  4IHQ A;  1HTZ A;  3LY3 A;  3D72 A;  3RTY A;  3ZNT A;  5L8M A;  3SW1 A;  2ZLY A;  3T4S A;  1OTA A;  3I7J A;  2OLU A;  4IBX A;  1BUE A;  4IED A;  4QB8 A;  4JF5 A;  3VOZ A;  3C38 A;  3BFC A;  1SKF A;  1VM1 A;  5E2H A;  3CMZ A;  1TS8 A;  1ZC2 A;  5AQ9 A;  2WGW A;  5HSQ A;  5J8X A;  4BMW A;  2WAE A;  1OT6 A;  2WKR A;  4C6Y A;  1Y28 A;  4OLD A;  1YMX A;  2H10 A;  4WBG A;  4D60 A;  1W5D A;  3F1N B;  3A0V A;  3SS4 A;  5HD5 A;  1LSX A;  5EVI C;  4OPZ A;  1L0D A;  3PAG A;  3C4O A;  3Q81 A;  4U0T A;  5CHJ A;  1WE4 A;  4DDY A;  3SOI A;  4KZ8 A;  5DTS A;  4LRX C;  5HFO A;  5F69 A;  1M40 A;  2PYP A;  1YT4 A;  4CLC E;  1PZP A;  2DRW A;  5AJG A;  3WS2 A;  2WKQ A;  1BZA A;  3ULF A;  5FEF A;  4R0Q A;  5K5B A;  5KMW A;  3UPN A;  4GS9 B;  3K3C A;  4ARZ B;  1LLB A;  5HAQ A;  1DY6 A;  4MBK A;  3ZG9 B;  4HP9 A;  3PTE A;  3T4Q A;  3DTI A;  1ES3 A;  2J3T D;  4P85 A;  4UQI M;  3VP2 A;  1FR1 A;  4Z1W A;  3R7W A;  2ZMA A;  3UNW A;  3IH8 A;  2B02 A;  3BW6 A;  3LR4 A;  4OQG A;  3ZCZ A;  2ZMV A;  4IVK A;  1T19 A;  3A3I A;  3BEC A;  3BJN A;  1GCE A;  1TS7 A;  1IYQ A;  3B33 A;  3G34 A;  2GZA A;  5A93 A;  1MWR A;  3HLF A;  3IWO A;  3LCE A;  4HIA A;  4QJG A;  3GR2 A;  4K91 A;  5EEC A;  4OKP A;  3N8L A;  2H28 A;  1ES4 A;  3Q07 A;  1YLY A;  3W4P A;  1LT0 A;  1X0O A;  5HD3 A;  4E3N A;  5M18 A;  3C7U A;  2W27 A;  1YLW A;  3JYI A;  4UA6 A;  2OV5 A;  4MCW A;  1JWP A;  4WZ5 C;  1O7E A;  3VE4 A;  3KSG A;  5EPH A;  4AFI A;  5EVI B;  3LO7 A;  5CGS A;  3CUE A;  1NRF A;  2ZM8 A;  5L10 A;  2XSS A;  4C75 A;  5GL9 A;  1NJ4 A;  4A5R A;  1NZU A;  2JBF A;  1NYY A;  4KG5 A;  4EU0 A;  5HL1 A;  3O3V A;  2ZBB A;  2IWB A;  4N9K A;  3N4I A;  1P9R A;  1XJ4 A;  5FEG A;  5F1F A;  3CPT A;  3OCL A;  4L9E A;  4ME4 A;  1ES5 A;  3DWK A;  3PR6 A;  2ZQA A;  4Y2F A;  2HP5 A;  2Y2O A;  2Y4A A;  4Q8I A;  3WS5 A;  2J3W A;  2Q0O A;  3OPR A;  1K6R A;  5HWT A;  4EQ1 A;  3LY4 A;  1NRJ A;  4GB7 A;  1K57 A;  2WUQ A;  4RX2 A;  4LV0 A;  2JHE A;  3UB6 A;  3IXD A;  4EEP A;  4CQH A;  2Z2L B;  4UHU A;  3DTK A;  3G35 A;  4O8G A;  5EVI D;  3CIT A;  4KUK A;  3WS1 A;  4MBH A;  3V5M A;  4I39 A;  4E3L A;  3MMH A;  5U47 A;  4RA7 A;  1GSV A;  1SCW A;  5AQB A;  5G4Z A;  2Y2J A;  4K08 A;  3EEA A;  2A2L A;  4N9L A;  2P74 A;  4BWI A;  3ITA A;  3EQU A;  1NXY A;  1PRQ A;  3LGO A;  4WMC A;  3HLE A;  1DRM A;  5EVL A;  3M6H A;  2O9A A;  1JTG A;  3VMA A;  1D1J A;  1HVB A;  1CI8 A;  3N8S A;  3LIA A;  4ZRR A;  2X01 A;  2A49 A;  3LR5 A;  3PYP A;  3WS0 A;  3CUE C;  1ERO A;  4MNR A;  1CI9 A;  4ZJ2 A;  3G6O A;  2J7V A;  5KZH A;  3MJQ A;  3BEB A;  3EGD C;  1L0G A;  1MXO A;  5HWV A;  2Q9M A;  2ZM2 A;  3LIC A;  4U3T A;  3KYE A;  5TBM B;  3ICY A;  3D3O A;  3MQ0 A;  4CPK A;  5F6A A;  1Z09 A;  4KQQ A;  3IBJ A;  3BLM A;  4LEN A;  4OON A;  2ZD8 A;  2EX9 A;  5IU1 A;  2ZMF A;  4E6X A;  2W3D A;  5TJJ A;  1ESU A;  4JPM A;  4N1X A;  3KO6 A;  3FC7 A;  1TD5 A;  1K57 C;  4L9F A;  4HNB A;  1JWV A;  5AQA A;  3IX3 A;  2V1B A;  4OQH A;  3BLS A;  1G6A A;  2XD1 A;  4HHD A;  1WA9 A;  5FQI A;  3VSL A;  4LRZ E;  3JPU A;  2ZQC A;  2ZOH A;  3RH8 B;  4H6J B;  1LI9 A;  4R4S A;  5HL6 A;  2XGN A;  4X6T A;  2XA7 M;  3SH8 A;  2JC7 A;  2Y2P A;  2IA2 A;  2WKE A;  3RJU A;  3IWQ A;  4X25 A;  5C5K A;  3V3S A;  3O88 A;  4P0M A;  4WEL A;  4DJ2 A;  2VLG A;  2XK1 A;  3TSG A;  3ZVT A;  5F83 A;  4CLC D;  1XP4 A;  2EWW A;  3GQZ A;  3IQA A;  4WYY A;  3UME A;  2Z6C A;  3W8K A;  1PYY A;  2ZC5 B;  3T1Q B;  3MKF A;  5G18 A;  3A3F A;  1OT9 A;  2PR5 A;  3S22 A;  2PRF A;  4KUO A;  5L07 A;  1TVF A;  2VGJ A;  3O5Y A;  3SZT A;  4E3J A;  4E3I A;  4KZB A;  3PAE A;  3MQO A;  4YIN A;  5GHY A;  3K3D A;  1ZG6 A;  4Q0H A;  1K6S A;  2ZL1 A;  4Y5F A;  4S2L A;  5HW3 A;  4DE3 A;  1AXB A;  4NXB A;  4BD0 A;  4OQI A;  3UDI A;  1W8Y A;  3CZD A;  3UB9 A;  4N92 A;  5EUA A;  4E6W A;  3ZG7 B;  4L0L A;  2Y2H A;  3TRC A;  2ZOI A;  1H8Z A;  3KX0 X;  3W4O A;  4OLG A;  1SDN A;  2ZJ9 A;  4BBU A;  1M6K A;  4L9G A;  1YPR A;  4NXF A;  1UGU A;  3FWL A;  2PT7 A;  4CJN A;  3GMW A;  4UQI S;  4S2N C;  1HZO A;  3VFH A;  3BM6 A;  1K54 A;  4R1G A;  1JVJ A;  3SH9 A;  3LYX A;  1K38 A;  4KQD A;  1FOF A;  1Y54 A;  4OOY A;  3S4X A;  4HEF A;  1TDG A;  3LR0 A;  4X69 A;  4X1M A;  3DTM A;  3IS2 A;  2MJ6 A;  1MC0 A;  4GJ4 A;  2JKG A;  2YKH A;  4JGR A;  3EOI A;  2G7U A;  1KDS A;  2A24 A;  1YLP A;  1VEU A;  1I2W A;  2UV0 E;  1YLT A;  1OJG A;  2V8F A;  4K0W A;  5AVE A;  1C3B A;  3DWZ A;  4K0X A;  2NUT C;  1IKI A;  2D01 A;  2ZQ7 A;  4P6B A;  5BOH A;  1JWZ A;  1XA1 A;  2VJW A;  1PI4 A;  1FCO A;  3B42 A;  5AQ7 A;  2Y2N A;  1S1Z A;  3QNC A;  2VGL M;  3C4P A;  4EUV A;  1JTD A;  4WL9 A;  3BWL A;  5DTK A;  2OSU A;  3IX4 A;  1K56 D;  4I3I A;  2RL3 A;  4O7D A;  5M1A A;  4QY5 A;  3H82 B;  1KVL A;  1E25 A;  1KE3 A;  1Y4O A;  4JF4 A;  3MS6 A;  4N1H A;  3VOY A;  4Q0J A;  4RVA A;  3UE0 A;  4JGO A;  1GHI A;  4KZ9 A;  5TGF A;  1KGG A;  1XXM A;  3TJZ C;  2QPN A;  3EGX C;  3ZHH A;  4MN7 A;  4KQR A;  3UY6 A;  4JXS A;  1Q2Q A;  1BLP A;  1MWT A;  2PHY A;  4RQ9 A;  4HBT A;  4Y3I A;  2WAF A;  1K55 C;  3IF6 C;  4Y17 A;  3ZG0 A;  3QP6 A;  4R3B A;  5KSH A;  4LV2 A;  2Y2K A;  1VHM A;  2ZM0 A;  5CHM A;  3VSK A;  5F68 A;  1XKZ A;  5FQJ A;  2W3H A;  3HUM A;  2VV7 A;  2PR6 A;  5CRF A;  5HAR A;  1XJ6 A;  4DF6 A;  1PWG A;  2PBY A;  4PM6 A;  1BSG A;  4OPR A;  5A90 A;  3SH7 A;  3PBQ A;  4DXC A;  1BLH A;  5L09 A;  4PM8 A;  1LSV A;  4GHI B;  4LV1 A;  5CX7 A;  1KE4 A;  4FSF A;  1T1B A;  1ES2 A;  3UPP A;  1DJA A;  3E2K A;  2L1M A;  3O86 A;  1E3U A;  4PM7 A;  4GW9 A;  4Y7P A;  4R4R A;  1VB6 A;  2HGV A;  1O07 A;  1FCN A;  4JLF A;  3UN7 A;  2OWH A;  2G2W A;  4FD8 A;  1GSX A;  1BLC A;  2X02 A;  4QHC A;  3V3R A;  3WWX A;  4R3J A;  5L2F A;  4FH4 A;  4KG2 A;  1N9O A;  1MWS A;  1TS6 A;  4E3O A;  3T1X A;  3L7H A;  1XGI A;  3HBR A;  2AVX A;  3H7W B;  1SZV A;  2V0U A;  1Z6F A;  3VFF A;  3HJK A;  2JKR M;  3E4P A;  5FAS A;  1BTL A;  1QME A;  4Q0I A;  2Y59 A;  4PHT A;  4MN5 A;  5EV0 A;  1PWC A;  1RGZ A;  5A92 A;  3A3E A;  3OOV A;  2EX2 A;  3B3X A;  3RFB A;  1P9W A;  1UWN X;  2G2U A;  2OLV A;  2YKF A;  5FDS A;  3IF6 B;  1K4F A;  4R38 A;  3LFV A;  3FPV A;  2J8Y A;  4PAU A;  3NUL A;  5HDC A;  1NWZ A;  2HZ5 A;  1CF0 A;  2J9P A;  1T18 A;  4R23 A;  2GNX A;  2VKS A;  3C8C A;  4X68 A;  4Y15 A;  4EW7 A;  2BG1 A;  4C3Q A;  1MWU A;  4D2O A;  4WF0 A;  1T1A A;  3IS2 B;  3CHW P;  3FV7 A;  3AGF A;  3NJA A;  4KEN B;  5HX9 A;  3T1R A;  3NCK A;  3VP3 A;  2C5W B;  2A24 B;  2KX6 A;  4DE1 A;  3VP1 A;  3S7N A;  5DFX A;  4M3K A;  4GDN A;  5EVE A;  1K4E A;  1FIL A;  4JBF A;  4NXE A;  2EX8 A;  2XA7 S;  3E98 A;  1S1Y A;  2Z2M B;  3FKW A;  4XT2 B;  2OWJ A;  4EER A;  5EM1 A;  3F1P A;  3NDG A;  2O9B A;  1FIK A;  3NIA A;  3BQ8 A;  1IKG A;  5CEB A;  1N9B A;  3D4F A;  4PKY A;  2ZQ8 A;  3KYQ A;  4UAA A;  3IXG A;  4DKI A;  3PXP A;  3P09 A;  1FR6 A;  4ZJ1 A;  3WRZ A;  2WYX A;  1QMF A;  2V1Z A;  1PIO A;  4R70 A;  5F1G A;  2ACG A;  3NC8 A;  3C5A A;  4BL3 A;  2HF6 A;  1F5M A;  1ZKJ A;  4PKY G;  4IUK A;  3HUN A;  5IS1 A;  2JKT M;  3KSI A;  1D7E A;  1NLY A;  1ERM A;  3QP8 A;  4HOI A;  2W3F A;  4FOF A;  2EFX A;  4GD8 A;  3G30 A;  1W79 A;  2R9X A;  4KG6 A;  2ZC3 B;  2VV8 A;  3HJI A;  1WYB A;  1T1C A;  4G3W A;  2EFU A;  5FAO A;  4JKT A;  4B4X A;  3A0R A;  3ZG5 A;  3OC2 A;  4EES A;  2WGW B;  1TF1 A;  1CEG A;  2XRN A;  3KSH A;  3NI9 A;  1OPX A;  1IYP A;  3IHB A;  1N4O A;  1K25 A;  3OLO A;  1H8M A;  5TR7 A;  2HP6 A;  3MBZ A;  4DE0 A;  3NY4 A;  2HJE A;  1F98 A;  4HH2 A;  2XFS A;  3FZC A;  4I3J A;  1BT5 A;  3IBR A;  3GDI A;  1Q2P A;  4ZBE A;  5IHV A;  2ZQD A;  4XUX A;  4NG2 A;  4ZDX A;  4HY8 A;  5FAT A;  4KZ4 A;  3LUQ A;  2V2F F;  3EEH A;  3NOT C;  4S2K A;  1IOU A;  3ZVW A;  2P9V A;  2W1R A;  3HRE A;  2DNS A;  1U60 A;  3BFF A;  1OTB A;  2Y2I A;  3UB5 P;  2HDU A;  1EW0 A;  2W1T A;  3C2W A;  1KGE A;  2PD7 A;  3R7W B;  3VOL A;  1GSW A;  1OTE A;  2QJ7 A;  3BYD A;  3GTC A;  4B4Z A;  1ZTU A;  3QP2 A;  2CC1 A;  4M4X A;  5FA7 A;  1W63 M;  1AWI A;  1BLS A;  3G32 A;  1L2S A;  2VGL S;  1ERQ A;  3G2Y A;  5DF9 A;  5HPI A;  4F3L A;  1LHY A;  3HCY A;  3VV4 A;  4LRY C;  4II7 A;  3UDX A;  3BFG A;  1ZG4 A;  3W4Q A;  1BUL A;  4OVD A;  1ACF A;  2BAS A;  1GHM A;  1PW1 A;  4DRT A;  2V20 A;  3MZD A;  1W8Q A;  1L0F A;  3VE3 A;  4H8R A;  2QKP A;  3U4L P;  2H5S A;  4MDZ A;  1JNU A;  3BFE A;  2JN7 A;  2IWD A;  3IHA A;  1S4S A;  2HP9 A;  5DF8 A;  4LPZ A;  4BJP A;  4U0X A;  3F1P B;  1PNE A;  1S4R A;  3BFD A;  4FH2 A;  5FI6 A;  5FI7 A;  3IWI A;  2EA9 A;  4YOF A;  3TE8 A;  1ODV A;  4QD4 A;  4QY6 A;  1P97 A;  3OPL A;  1SDE A;  3CPT B;  4NXG A;  1KDW A;  1XA7 A;  4BBT A;  3HUO A;  3T4J A;  5MC7 A;  3LIF A;  5DKL A;  1GA0 A;  5CED A;  5KIZ A;  3N8R A;  3OPH A;  4GD6 A;  3T50 A;  4O0P A;  2CMN A;  4LLO B;  5FQK A;  1RP5 A;  4WUJ A;  4EBP A;  4MMN A;  3CG5 A;  5FL3 A;  4DN0 A;  5M19 A;  3N6I A;  3OPP A;  1XJ3 A;  1IEM A;  3SS3 A;  4GS9 A;  4ARZ A;  2W3E A;  1KVM A;  5CEC A;  2VGK A;  5GHZ A;  2X71 A;  5HWW A;  1MZU A;  1NZO A;  4PMA A;  2IWC A;  5A8B A;  1XX2 A;  4GOG A;  4P6Z M;  2M7U A;  1BYW A;  1LL9 A;  3P7N A;  1I5Q A;  2Y91 A;  3GVB A;  4ZTK A;  4GKU A;  4JGQ A;  3HLD A;  5AVF A;  3LI8 A;  4E3K A;  3GV9 A;  1YKD A;  1PI5 A;  5E2G A;  2Y8H A;  3EWK A;  1ONH A;  3UMD A;  1SHV A;  3ITB A; 
#chains in the Genus database with same CATH homology
 3UPO A;  1XGI A;  3HBR A;  1K57 A;  4EBN A;  2WUQ A;  4RX2 A;  4LV0 A;  1Z6F A;  4KZ5 A;  3VFF A;  3IXD A;  4JXG A;  2A3U A;  2Z2L B;  4UHU A;  5FAS A;  1EI5 A;  2DCF A;  1BTL A;  1QME A;  3G35 A;  5DF7 A;  5EVI D;  2Y59 A;  1ALQ A;  4GZB A;  2R9W A;  4OQ0 A;  4S2N A;  3WS1 A;  4MBH A;  1PWC A;  3V5M A;  5GLC A;  1RGZ A;  5A92 A;  4E3L A;  3A3E A;  2EX2 A;  2P9V B;  3DW0 A;  4S2P A;  5FQM A;  3B3X A;  5U47 A;  2Y2L A;  1RCJ A;  4WM9 A;  2QMI A;  4RA7 A;  3CJM A;  4WMC D;  4KZA A;  1SCW A;  2XR0 A;  2G2U A;  5AQB A;  4YFM A;  5EVI A;  2Y2J A;  2OLV A;  3IF6 B;  1K4F A;  4N9L A;  5GLD A;  2P74 A;  3VP0 A;  4EWF A;  2J8Y A;  3ITA A;  3EQU A;  1NXY A;  4Y0O A;  5EOE A;  5GLB A;  4WMC A;  4QU3 A;  3HL9 A;  4NK3 A;  3HLE A;  5EVL A;  3M6H A;  1XPB A;  1JTG A;  3VMA A;  1HVB A;  2BLS A;  2J9P A;  3VP4 A;  1CI8 A;  4R23 A;  3RXW A;  3N8S A;  3SS5 A;  2HDS A;  1KE0 A;  1ESI A;  3HLW A;  4X68 A;  2X01 A;  2A49 A;  1PZO A;  2BG1 A;  4C3Q A;  4RYE A;  1MWU A;  4D2O A;  1J9M A;  3FYZ A;  3WS0 A;  5FQQ A;  4JXV A;  4S2J A;  1ERO A;  2Y2Q A;  1EWZ A;  4MNR A;  1CI9 A;  3FV7 A;  3AGF A;  4ZJ2 A;  2J7V A;  3MXR A;  5KZH A;  4KEN B;  4UA7 A;  5HX9 A;  1GHP A;  2E8I A;  3NCK A;  5KSC A;  3G4P A;  2WGI A;  2C5W B;  4WEJ A;  3MXS A;  3VP3 A;  3BEB A;  4DE1 A;  3VP1 A;  4BQM A;  4NET A;  1K54 C;  1DJC A;  2WK0 A;  4GDN A;  4M3K A;  1L0G A;  1K4E A;  1MXO A;  4BLM A;  3M2J A;  4Y0U A;  4JBF A;  2EXA A;  2EX8 A;  2Q9M A;  2WZZ A;  5CTM A;  3Q1F A;  2ZM2 A;  4Z9Q A;  2Z2M B;  3FKW A;  5CER A;  4IBR A;  4U3T A;  3WS4 A;  4KZ6 A;  4OOM A;  4X56 A;  1WYC A;  3TG9 A;  3IH9 A;  3GSG A;  3PBO A;  3Q82 A;  4CPK A;  1H8Y A;  3E2L A;  1MKI A;  4KQQ A;  1MY8 A;  3QHY A;  3BLM A;  4LEN A;  3NDG A;  4OON A;  3OZH A;  2ZD8 A;  2EX9 A;  4GN2 A;  3MZE A;  5TFQ A;  4E6X A;  1ESU A;  1YLZ A;  4JPM A;  4N1X A;  4X53 A;  3NIA A;  1IKG A;  3S1Y A;  5CEB A;  1N9B A;  3D4F A;  1E4D A;  1FCM A;  2ZQ8 A;  3PBT A;  1K57 C;  1K55 A;  3IF6 A;  5EOO A;  4UAA A;  1L0E A;  1JWV A;  3WRT A;  3IXG A;  4BL2 A;  5AQA A;  4DKI A;  3FKV A;  1XGJ A;  4OP8 A;  4PM5 A;  4OPQ A;  3MZF A;  5E2E A;  4OQH A;  3BLS A;  1G6A A;  2XD1 A;  3P09 A;  1FR6 A;  1GA9 A;  4ZJ1 A;  3WRZ A;  5FQI A;  4LCL A;  3VSL A;  2XLN A;  1YQS A;  2WYX A;  2B5R A;  1IYS A;  2WAD A;  2ZQC A;  1QMF A;  1FSY A;  1LI9 A;  2V1Z A;  4WZ5 A;  1PIO A;  5DTT A;  5F1G A;  4R4S A;  2PU4 A;  4ID4 A;  4MLL A;  3NC8 A;  4GDB A;  1S0W A;  1ONG A;  3M2K A;  3N7W A;  3C5A A;  4BL3 A;  1IYO A;  2XGN A;  1H5X A;  3ZDJ A;  4X6T A;  3SH8 A;  2XH9 A;  2EX6 A;  2XDM A;  2JC7 A;  5HAI A;  1ZKJ A;  3LEZ A;  3OCN A;  3MFD A;  3Q7V A;  4OPY A;  4ZAM A;  3PBR A;  2Y2P A;  3HUN A;  4KQO A;  2WGV A;  1CEF A;  2WKE A;  2I72 A;  3UDF A;  5FDH A;  1I2S A;  1PWD A;  3TOI A;  3RJU A;  1ERM A;  3IWQ A;  4KZ3 A;  4DDS A;  5E43 A;  4XXR A;  5FAP A;  2EFX A;  2XQZ A;  3O88 A;  3V3S A;  3V39 A;  4DXB A;  2XF3 A;  4GD8 A;  4P0M A;  3P98 A;  3G30 A;  1W79 A;  2R9X A;  4WEL A;  4KG6 A;  2ZC3 B;  1WYB A;  2XK1 A;  3TSG A;  2EFU A;  2QZ6 A;  5FAO A;  4JKT A;  3ZVT A;  5F83 A;  5CXW A;  4B4X A;  4GNU A;  3ZG5 A;  1LL5 A;  4X55 A;  3OC2 A;  4HBU A;  1XP4 A;  5FI2 A;  3GQZ A;  1YLJ A;  3IQA A;  4WYY A;  2ZC4 B;  2WGW B;  4LCM A;  1CEG A;  2GDN A;  4UA9 A;  2FFF B;  3A3D A;  3W8K A;  3NI9 A;  3EQV A;  2FFY A;  1IYP A;  1PYY A;  5E2F A;  3IHB A;  2ZC5 B;  3MKF A;  1N4O A;  1K25 A;  2HPB A;  3IT9 A;  3BRM A;  5G18 A;  5TR7 A;  2HP6 A;  3A3F A;  3MBZ A;  4DE0 A;  3C7V A;  3HLG A;  4DE2 A;  1TDL A;  3S22 A;  2RCX A;  3NY4 A;  3UE3 A;  3ZGA B;  4BEN A;  4B88 A;  3ISG A;  2C6W B;  1TEM A;  2XFS A;  4PPR A;  1TVF A;  3HLB A;  3FZC A;  4KZ7 A;  1MPL A;  2VGJ A;  4E3J A;  2XEP A;  4E3I A;  4MEZ A;  1BT5 A;  2WKI A;  1RGY A;  4KZB A;  2ZQ9 A;  3PAE A;  1Q2P A;  4YIN A;  1W7F A;  4ZBE A;  1KGF A;  5GHY A;  2ZQD A;  5IHV A;  4XUX A;  1ZG6 A;  4FCF A;  1K6S A;  1PW8 A;  2J9O A;  4S2L A;  5HW3 A;  4ZDX A;  2H0Y A;  3GRJ A;  5FAT A;  4KZ4 A;  4DE3 A;  1AXB A;  4P87 A;  2V2F F;  4BD0 A;  4OQI A;  3UDI A;  5CGX A;  4EQI A;  3ZNY A;  4S2K A;  1W8Y A;  3CZD A;  3ZVW A;  2HDQ A;  2P9V A;  3HRE A;  3MKE A;  1HTZ A;  4N92 A;  5EUA A;  4E6W A;  3LY3 A;  3AGD A;  3ZG7 B;  2DNS A;  4L0L A;  2Y2H A;  3M6B A;  4WEK A;  1U60 A;  3BFF A;  3ZNT A;  2Y2I A;  2HDU A;  1H8Z A;  4F94 A;  3W4O A;  4OLG A;  1SDN A;  2XD5 A;  1KGE A;  2ZJ9 A;  2ZLY A;  5EE8 A;  1M6K A;  3NBL A;  5FSR A;  3I7J A;  2OLU A;  4IBX A;  4JF6 A;  4JXW A;  4RX3 A;  1BUE A;  3BYD A;  4IED A;  3NDE A;  4QB8 A;  4JF5 A;  3GTC A;  3VOZ A;  3BFC A;  4B4Z A;  1SKF A;  3ZG8 B;  1VM1 A;  3FWL A;  2CC1 A;  1VQQ A;  2WZX A;  5CTN A;  5FAQ A;  5E2H A;  3CMZ A;  2WKH A;  5FA7 A;  4CJN A;  4OP5 A;  1BLS A;  3GMW A;  3G32 A;  1L2S A;  1ZC2 A;  3PBN A;  4OOL A;  4S2N C;  5AQ9 A;  2WGW A;  5J8X A;  1HZO A;  1ERQ A;  3G2Y A;  5DF9 A;  3VFH A;  1NY0 A;  2WAE A;  4WZ4 A;  1LHY A;  4E3M A;  3BM6 A;  1K54 A;  4R1G A;  4C6Y A;  4OLD A;  1JVJ A;  1YMX A;  2H10 A;  2JCH A;  4PM9 A;  4WBG A;  3SH9 A;  1K38 A;  3G31 A;  1FOF A;  1W5D A;  1Y54 A;  4OOY A;  3S4X A;  3AGE A;  4S2M A;  4OH0 A;  4HEF A;  3SS4 A;  3UDX A;  1TDG A;  3BFG A;  5EVI C;  1ZG4 A;  4OPZ A;  3W4Q A;  1MBL A;  1BUL A;  1L0D A;  3PAG A;  4X69 A;  4ZJ3 A;  4OVD A;  2UWX A;  3C4O A;  3DTM A;  3Q81 A;  1GHM A;  1YM1 A;  1G68 A;  3HLC A;  1PW1 A;  4U0T A;  1WE4 A;  5CHJ A;  4BD1 A;  4DDY A;  3SOI A;  4KZ8 A;  5DTS A;  4DRT A;  2V20 A;  3MZD A;  1W8Q A;  1L0F A;  4MBF A;  5HFO A;  1M40 A;  3IF5 A;  1KDS A;  1YT4 A;  1PZP A;  1YLP A;  2DRW A;  4H8R A;  3WS2 A;  1BZA A;  2H5S A;  1I2W A;  1YLT A;  4R0Q A;  3BFE A;  5KMW A;  3Q7Z A;  2H0T A;  4K0W A;  3UPN A;  2IWD A;  1C3B A;  1LLB A;  3DWZ A;  4K0X A;  5HAQ A;  3IHA A;  2HP9 A;  5DF8 A;  4Y0T A;  2ZC6 B;  1IKI A;  4BJP A;  1DY6 A;  4MBK A;  3ZG9 B;  2ZQ7 A;  4P6B A;  3PTE A;  5BOH A;  4IVI A;  4U0X A;  5FQ9 A;  1JWZ A;  1XA1 A;  3QNB A;  1PI4 A;  1FCO A;  4LV3 A;  1S6R A;  1ES3 A;  5A91 A;  3ZFZ A;  4P85 A;  5AQ7 A;  2Y2N A;  3QNC A;  3C4P A;  1OME A;  3VP2 A;  3BFD A;  1IEL A;  1JTD A;  4FH2 A;  5DTK A;  3PBS A;  5FI6 A;  5FI7 A;  2OSU A;  3IWI A;  1FR1 A;  1FSW A;  5D3O A;  2ZMA A;  5F82 A;  1K56 D;  4O7D A;  2RL3 A;  5M1A A;  2Y2G A;  3UNW A;  3IH8 A;  2PU2 A;  3IXH A;  4QY5 A;  4QD4 A;  1KVL A;  1E25 A;  1KE3 A;  4JF4 A;  4QY6 A;  4N1H A;  3OPL A;  4S2I A;  3O87 A;  1SDE A;  3VOY A;  4OQG A;  5CGW A;  3ZCZ A;  1KDW A;  1XA7 A;  4RVA A;  3UE0 A;  1GHI A;  4KZ9 A;  3HUO A;  4IVK A;  5TGF A;  1KGG A;  3A3I A;  1XXM A;  3BEC A;  2QPN A;  5JYO A;  1K56 A;  1GCE A;  1GA0 A;  3ZHH A;  5CED A;  1IYQ A;  3G34 A;  3N8R A;  3OPH A;  4KQR A;  3G2Z A;  4GD6 A;  3UY6 A;  2Y2M A;  3V50 A;  4JXS A;  1Q2Q A;  1BLP A;  1MWT A;  4HBT A;  2WAF A;  2EXB A;  5FQK A;  1RP5 A;  4EUZ A;  5A93 A;  1MWR A;  1K55 C;  3HLF A;  3IF6 C;  3IWO A;  3LCE A;  3ZG0 A;  4QJG A;  4R3B A;  4EBP A;  3GR2 A;  4K91 A;  5EEC A;  1HD8 A;  5KSH A;  4OKP A;  3N8L A;  4LV2 A;  2Y2K A;  3CG5 A;  1ES4 A;  3Q07 A;  2ZM0 A;  5CHM A;  1YLY A;  3W4P A;  3VSK A;  4S2O A;  5M19 A;  3Q7V B;  5DVA A;  1XKZ A;  4E3N A;  1CK3 A;  5FQJ A;  5M18 A;  2HDR A;  3N6I A;  3OPP A;  3HUM A;  3C7U A;  5CRF A;  5HAR A;  2Q9N A;  4DF6 A;  1PWG A;  1YLW A;  3JYI A;  4UA6 A;  2OV5 A;  3A3J A;  1IEM A;  1JWP A;  2PBY A;  4PM6 A;  1BSG A;  3SS3 A;  4WZ5 C;  5JYP A;  1O7E A;  4OPR A;  5A90 A;  5EPH A;  3SH7 A;  3PBQ A;  4DXC A;  5EVI B;  1BLH A;  3LO7 A;  5CGS A;  2XFT A;  4EBL A;  4PM8 A;  1KVM A;  5CEC A;  2VGK A;  1E3U D;  4LV1 A;  5GHZ A;  2X71 A;  1NRF A;  5GHX A;  1NZO A;  2ZM8 A;  1KE4 A;  4PMA A;  2IWC A;  4FSF A;  4C75 A;  5GL9 A;  1ES2 A;  3UPP A;  1DJA A;  1NJ4 A;  1XX2 A;  4GOG A;  4A5R A;  3E2K A;  1LL9 A;  1NZU A;  2JBF A;  1I5Q A;  1NYY A;  1LI0 A;  2Y91 A;  4KG5 A;  3UE1 A;  1FQG A;  5HAP A;  3GVB A;  5HL1 A;  3O3V A;  4ZTK A;  2IWB A;  4EV4 A;  4N9K A;  3O86 A;  4GKU A;  1E3U A;  4PM7 A;  1YMS A;  4Y7P A;  3RXX A;  3HLD A;  1DJB A;  3N4I A;  4R4R A;  5F1F A;  5GLA A;  1O07 A;  3OCL A;  1FCN A;  4JLF A;  4E3K A;  3GV9 A;  1NYM A;  3UN7 A;  3UO9 A;  1ES5 A;  2JE5 A;  3DWK A;  1PI5 A;  4XUZ A;  2ZQA A;  3IXB A;  2HP5 A;  2G2W A;  2Y2O A;  4FD8 A;  5E2G A;  5I94 A;  2Y4A A;  1BLC A;  4Q8I A;  2X02 A;  3WS5 A;  4QHC A;  3V3R A;  3WWX A;  2ZC7 A;  4R3J A;  5L2F A;  3OPR A;  3HVF A;  4FH4 A;  4KG2 A;  1K6R A;  2Y55 A;  1MWS A;  4HES A;  3LY4 A;  1ONH A;  4E3O A;  1SHV A;  3ITB A;  4GB7 A;  5CHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...