3KSGA

Structure of frmsr of staphylococcus aureus (complex with substrate)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
153
structure length
153
Chain Sequence
TTINPTNYTLLKKQAASLIEDEHHMIAILSNMSALLNDNLDQINWVGFYLLEQNELILGPFQGHPASVHIPIGKGVCGTAVSERRTQVVADVHQFKGHIACDANSKSEIVVPIFKDDKIIGVLDIDAPITDRFDDNDKEHLEAIVKIIEKQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structure of fRMsr of Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
total genus 43
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2009-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ksgA00
3MQ0A 3BJNA 2VEAA 4Z1WA 2W3DA 3E98A 4Q0HA 4Y5FA 5C5KA 2VJWA 4IJGA 2W1TA 3TRCA 1TF1A 2O0YA 2O9AA 4Q0IA 4R70A 4O0PA 2LB5A 4DMZA 2KOIA 3VV4A 3HCYA 4MCWA 4ETZA 3G6OA 2OOLA 4YOFA 1MKMA 2B18A 3KSIA 3CI6A 4IUKA 1YSPA 4IUHA 5HPFA 5DFYA 4MDZA 4PAUA 4YNRA 4GW9A 2G7UA 3KSHA 5K5BA 4E04A 1YSQA 5HL6A 3S7NA 3C2WA 2QYBA 2ZMFA 3NOPC 3DBAA 1F5MA 2Y79A 4Y3IA 3W2ZA 3O5YA 2VZWA 3NOTC 4LRYC 2W1RA 4EUVA 2M7UA 2W3FA 3KSFA 1STZA 2W1TB 3E0YA 4GLQA 4DN0A 3NHQA 2W3HA 4R6LA 2K31A 3S7QA 2M7VA 5LBRA 5L8MA 4G3WA 2Y8HA 3S7PA 5AJGA 4MN7A 2XRNA 2W3EA 2O9CA 4O8GA 3OOVA 4EU0A 4G3VA 3ZQ5A 2K2NA 2LB9A 3IBJA 3K2NA 2O9BA 3IBRA 3RFBA 3OBFA 1VHMA 2HGVA 2KLIA 2IA2A 5I5LA 3KO6A 1MC0A 4G3KA 4BWIA 2GX5A 4Y2FA 4CQHA 4QPRA 3KSGA 3NOUC 2VKSA 3MMHA 2O99A 3R4KA 4ME4A 1TD5A 3S7OA 2XSSA 2W3GA 4ZRRA 1ZTUA 1YKDA 3D3OA 5HPIA 4MMNA 2XROA 4Q0JA 5DFXA 3EEAA 3MF0A 5TJJA 4LRXC 4RQ9A 3CITA 5HSQA 3LFVA 4O01A 4ETXA 4FOFA 4LRZE
chains in the Genus database with same CATH superfamily
5CHMA 3UMDA 3VSLA 1ZC2A 4OPZA 4HESA 3EGDC 2OSUA 5TR7A 5AQ7A 3UPOA 5DF8A 4HJ4A 4JF4A 1IELA 5FQJA 1MKMA 2QPNA 1SKOB 2Y4AA 5AQBA 4BENA 1GSXA 3SZTA 4Y17A 4B93A 1H8YA 4S2NA 1IYSA 4LV3A 5J8XA 4LRYC 3V39A 1STZA 3G2YA 4C3QA 4DJ2A 1F9IA 2PU4A 3RTYA 2PD7A 3G4PA 4E3JA 2JHEA 3MFXA 1XKZA 2PYRA 3UB6A 2L4RA 5EVIA 2EX9A 3K2NA 1PW8A 3H7WA 1MZUA 4U3TA 1K4FA 3T4JA 2KLIA 1XXMA 4KQRA 2JKTI 1XJ2A 2EX8A 1YMXA 5DJUA 3HUMA 1SKFA 1D7EA 5FQIA 4S2PA 5HAIA 4Z9QA 4HY8A 2W3GA 1GA0A 4RA7A 2V2FF 1XGJA 2W0NA 1KE3A 3RH8B 5HSQA 5J7EA 5HDDA 5FA7A 4KZ5A 2X71A 2A3UA 3LR3A 1OT6A 3JVVA 5FASA 4KZ9A 4QWOA 3SW1A 1YLZA 4DDYA 1IYQA 1GHMA 1ZKJA 2Y2NA 5FEGA 1G6OA 2OWHA 1BSGA 1VB6A 5HW3A 4P85A 3E2KA 2R78A 2OV5A 4OOYA 1OJ5A 4N1XA 4X55A 3G2ZA 4N9KA 5TGFA 1EWZA 1N9LA 2JKTM 4GHIB 3O5YA 2V0UA 4OP8A 4WBGA 3BFCA 3KX0X 4DN0A 3P01A 1TS6A 4R6LA 2OAQ1 3T4OA 1K55C 1ZHHB 3L9KA 5L2FA 5L8MA 2EX2A 5J3WA 4XT2B 1E3UD 3NIAA 3CMZA 1L0GA 2PT7A 1I5QA 3FWLA 4OQIA 3LIBA 4QY5A 3ZG0A 4Y7PA 5G18A 1MWTA 3FC7A 3BFGA 2O99A 2IWBA 5CGSA 4OQGA 2BLSA 1PYYA 1GCEA 1ZTUA 3N6IA 3PBTA 4JXVA 4MMNA 1HTZA 3C4OA 2XROA 3MQQA 4RQ9A 4LV0A 2EX6A 2HP9A 4FOFA 2ZL1B 1FOFA 4U0XA 1ERMA 4CLCE 4I3IA 3TJZC 3BW6A 4HP9A 3UB7A 1XPBA 2JN7A 1L3LA 2P9VB 4PM9A 5GLDA 4OPYA 2ZQ7A 4JF5A 2JKRI 4EUZA 1KE4A 4JGQA 4DMZA 4LLOB 5AVFA 3ZG8B 3BLMA 4MBHA 3QHYA 4MCWA 5TBMB 4X6TA 4X1LA 5HPFA 3EEHA 4N9LA 2QZ6A 2WGIA 1FSWA 4WL9A 2EWWA 5F1FA 3FG8A 4RYEA 3MR0A 4ID4A 2EXAA 4KUOA 1F2KA 1VETB 2W1TB 4JLFA 5DKLA 1XA1A 3CAXA 4IHQA 4GD8A 3IHBA 3UO9A 5KMWA 1L2SA 4PM7A 5DVAA 4ZTKA 4B9OA 2GJ3A 3BY9A 3BYDA 3Q7ZA 3QNCA 5FI7A 2CC1A 2BASA 3UNWA 3G34A 2VGKA 1PI5A 3MZEA 3Q82A 4R4SA 5HL1A 1FILA 3MJQA 2V1BA 3F1OA 2Z2MB 4S2KA 4L9GA 2JKRM 4ME4A 2VV6A 4HH3A 4UQIM 3SS5A 3S7OA 1BUEA 3F1OB 1P97A 1YKDA 2VGLM 3DWZA 3LUQA 4DE2A 4R4RA 2XA7M 1P9WA 1DP8A 1V9YA 1OTEA 1AWIA 4M4XA 5F5YA 3ZNYA 1XP4A 2WK0A 3TRCA 1FR6A 4K0XA 4LGWA 4Q0IA 5DTKA 2Q0OA 3UE1A 3C8CA 3GV9A 2KOIA 2J3WA 4F3LB 4ZJ1A 2WKIA 4KZ7A 1TEMA 2ZC3B 5CGWA 2Y2GA 4BL2A 2GNXA 3RXXA 1ONGA 3N8SA 1EW0A 2Y2KA 4NXBA 4OQ0A 1K38A 3GQZA 3PBNA 3JPUA 4ZJ2A 1MWUA 3P98A 2W1RA 3UY6A 3HJKA 3ZFZA 3LR0A 1GHPA 3ISGA 1XFQA 3A0SA 2B02A 4FH2A 4E3LA 5EVID 1N9OA 2WAFA 1K6SA 2Y8HA 3UE0A 4YWZA 4NEED 1HZOA 2ZM2A 3H82A 4KZAA 1W7FA 5G4ZA 2I72A 4E3KA 5EM0A 4BJPA 3PHYA 4WF0A 3U4LP 3A0RA 2MJ6A 4D60A 5J4EA 4OQHA 4EW7A 1JTDA 3R4KA 5GL9A 5CHUA 3ZNTA 1SDEA 2VV8A 3LEZA 4KUKA 1YLPA 5HWTA 3OPPA 5HZHA 3LI8A 1UWPX 5MC7A 4JGPA 5EM1A 3D4FA 1PZPA 3VFHA 2JE5A 5C5KA 2C6WB 4OOLA 1GSVA 4WMCA 3WS2A 3C38A 3N4IA 5GHYA 3LIAA 4NXFA 3MKEA 3NCKA 2P7JA 1S66L 3W8KA 3DTMA 3ZHHA 5EFWA 3IS2A 3IWQA 2OOLA 3LY3A 5CHJA 1ERQA 4FSFA 4GW9A 5FQMA 2UWXA 2PBYA 3BQAA 2QJ5A 5M18A 2Y2JA 1DP9A 3EWKA 4RX2A 1MWSA 1DP6A 5E2FA 3SS4A 1NLYA 1W63M 1TDLA 3CG5A 3KSFA 3MXSA 4H6JA 2HJ9C 3LEQA 4HHDA 3T4QA 2B5RA 2Q9MA 3DAVA 3IXGA 3MFDA 2WGVA 1FQGA 2FZ0A 1XFNA 1WA9A 3UMEA 4D2OA 4EU0A 3T4TA 2V1AA 4MNRA 5DTTA 1YMSA 1K0KA 2FFYA 2WKEA 2ACGA 3OLOA 4DRTA 4HI4A 3VFFA 2GX5A 4BLMA 1DJCA 4UEYA 4F94A 1WYCA 3OCNA 2IWDA 2Y2PA 2HDQA 3M2KA 4K0WA 1LL8A 4MN5A 1IOUA 4WZ4A 3HLFA 4MLLA 3BLSA 4ZBEA 2BG1A 2VEAA 4P6BA 3N8RA 3CHWP 1N4OA 1BLPA 2GZAA 1CI9A 2KDKA 3E4PA 2L1MA 3QP2A 1ZG4A 2J7VA 4B4XA 4EEPA 2L0WA 4OPRA 3JYIA 4AFIA 4S2MA 3O86A 1PWCA 1K55A 1NXYA 5E2EA 1H8ZA 1ACFA 1GHIA 1NYYA 3IF6C 3T4KA 3GMWA 5HL6A 3RJUA 3LI9A 3OPLA 2ZLYA 4GZBA 4BD1A 4E3MA 3NBLA 3BFFA 3ZG7B 1A0KA 1I2SA 5E2GA 1FCMA 4DE3A 2WGWA 1O7EA 4GCZA 2O9CA 4KG6A 5IS1A 1OPXA 2E8JA 3P09A 4G3VA 1RGYA 2ZC4B 3LYXA 4R3JA 3DWKA 3SH9A 1J9MA 1K56A 4L9EA 1NZUA 4JGOA 2A24A 4II7A 2Y91A 2G2UA 3MMHA 3VP4A 3LICA 4XUXA 1NJ4A 3IF5A 3T12B 1PRQA 1O07A 1U60A 1HD8A 3JVUA 3PXPA 1P0ZA 5F1GA 3CWFA 1K54A 1LI0A 3LIDA 4X56A 4I5SA 5EVIB 3HLGA 4LRZE 3GTCA 3H7WB 2ZC5B 5EV0A 2W3DA 4PKYG 1MXOA 1CK3A 4Y5FA 2XFSA 2OLUA 3VP1A 5F69A 3VOZA 3QP4A 3MS6A 2O9AA 4HIAA 5HAQA 4Y0OA 5EE8A 2D02A 4HP4A 1LL5A 1T18A 2WYXA 4YOFA 3T1SA 3CI6A 3DTEA 1ONHA 4IUHA 1W5DA 3MZDA 4E3OA 3PTEA 3FV7A 5GLBA 4C75A 1EROA 3NOPC 4FUWA 2NUTC 2XGNA 2IWCA 4I38A 4LV1A 2V9AA 1K57C 1FIKA 2M7VA 5LBRA 3IH9A 5FAQA 4KG5A 1XGIA 4UA9A 4HJ3A 3OOVA 4WZ5C 4N1HA 2HV1A 2WAEA 4KZ8A 4UA6A 5CTMA 4DXCA 4G3KA 4EBLA 2XD5A 3G31A 4LV2A 5F82A 1RP5A 1YT4A 5AQAA 2GDNA 1H5XA 1K4EA 3CUEC 3PR6A 3VP2A 4WEKA 4E6WA 3HLEA 1D1JA 3MQ0A 3OPHA 4WMCD 1IYOA 3LO7A 1ES2A 5E43A 4Y0UA 3HUOA 4IJGA 4HEFA 1XJ3A 4KQDA 3M2JA 1D06A 1YAXA 5HAPA 3T1XA 3S22A 1SZVA 4FD8A 4DXBA 1DJAA 3KSIA 2PD8A 3MQOA 3B3XA 4PAUA 1FR1A 2JC7A 2XF3A 3KSHA 4S2IA 4EV4A 2EFXA 3K3CA 1CEGA 2ZMFA 1FSYA 2VX8A 3KYQA 3W2ZA 2Y2HA 4LPZA 2DNSA 3E0YA 4GLQA 3IXHA 2Y59A 2QJ7A 2HJEA 5FI2A 5EOOA 1CEFA 2W3EA 3VMAA 1Z09A 5IT5A 3UE3A 2M1CA 3RFBA 4KZ3A 4PM8A 1L0DA 5FAPA 1H0MA 1Y28A 5KIZA 2ZOIA 4CLCA 5JYOA 5M1AA 4WEJA 3VP0A 2PHYA 1G68A 4NETA 5KSCA 3FZCA 1ESIA 5TFQA 2J80A 2X02A 4ZRRA 2DRWA 3IWIA 5GHXA 3MSHA 1H8MA 5A8BA 4NK3A 4GOGA 4R0QA 1PI4A 3WS4A 4UQIS 2WZZA 3LR5A 4HBUA 5FQKA 1BLCA 4P0MA 5FL3A 2VJWA 3ITBA 4E6XA 5KSHA 3WS5A 3BWLA 2HP6A 1T1AA 3NY4A 2XA7S 1YM1A 4R70A 4QHCA 5I94A 1PIOA 3HLWA 3BRMA 1ESUA 1NLZA 5F83A 3ZVWA 2PAVP 3ZGAB 1KGGA 4NKPA 3W4PA 5L10A 2AVXA 4BQMA 2ZJ9A 2V1ZA 4N92A 1JVJA 5HWVA 1LSWA 3R7WA 2PDRA 5HX9A 3M6HA 3C7VA 2A49A 4O7DA 1G28A 3FYZA 4ESPA 5HFOA 1KDWA 3TG9A 1JNUA 3S7QA 1T19A 3U2AA 1K56D 4KG2A 1XJ4A 2UV0E 1Y54A 4OH0A 3FKVA 1LHYA 3AGEA 5GHZA 2NUPC 1SHVA 4ARZA 1TVFA 3UB9A 5A91A 4OONA 2Q9NA 4Y15A 3UDXA 3VE4A 5M19A 5FI6A 2XFTA 3S4XA 2Z6CA 1W79A 2J3TD 4X68A 3CITA 2HDSA 1GA9A 1BULA 4ETXA 3H82B 3ITAA 4GS9A 5HWWA 3V3SA 3BJNA 4S2LA 1LSVA 4P6ZM 4PM5A 3QP6A 2WUQA 2WADA 1V9ZA 1PFLA 4OLGA 2HZ5A 3NDGA 4GS9B 1H3QA 2WKHA 1TF1A 4I3AA 4HH2A 4LCMA 3UB5P 4NXGA 4ETZA 1OTDA 4GN2A 2WZXA 1LLBA 1Y4OA 2PR5A 1CF0A 2Z2LB 4KZ6A 4XXRA 2VA0A 1MY8A 5K5BA 4EBPA 1DJBA 3NC8A 4LFUA 2QYBA 2XEPA 5FAOA 4RVAA 2Y2LA 3AGFA 4K08A 1AXBA 5EVLA 3C5AA 2VK3A 1MKIA 4L0LA 4RX3A 4DE0A 1PNEA 1S1ZA 3DW0A 4L9FA 3VP3A 3CLOA 4QB8A 3V5MA 4NXEA 4G3WA 3IS2B 4JGRA 1C3BA 3O3VA 3HVFA 5FQQA 2ZM8A 1KGEA 2QWSA 1S67L 4IVKA 1ODVA 4QD4A 3VOLA 1BTLA 2IA2A 3IX8A 5HARA 3FPVA 1MC0A 2ZOHA 1OT9A 2P04A 3KSGA 3NOUC 5DTSA 4R38A 2VKSA 4GB7A 3UDFA 2XDMA 3ULFA 1TS7A 4EEUA 4H6JB 3A3EA 1NRFA 2EWVA 4R1GA 3W4QA 3MF0A 5CXWA 4GKUA 2YKFA 1FCNA 3T1QB 4XUZA 4GDNA 3EQUA 2INWA 1BZAA 3DTIA 3G30A 2Y2QA 4X53A 4JF6A 2V8CA 3ICYA 4CJNA 3MBZA 2LB5A 3UE6A 2JCHA 2B95A 3Q1FA 3NECA 3BECA 3ZVTA 3G6OA 1WYBA 4BBUA 1IYPA 3SS3A 1K57A 3PAGA 4MDZA 3F1PA 1Q2QA 1KGFA 1RCJA 4R23A 3BM6A 3S7NA 1CI8A 1N9NA 2XQZA 2FH5A 3DBAA 3F1PB 5U47A 5DF9A 1LI9A 5L07A 1LL9A 2ZQCA 3WRTA 4P87A 4WYYA 2W3HA 5CERA 4DJ3A 1OTBA 1X0OA 2ZM0A 1JWVA 3HLDA 4HNBA 3FPWA 2VLGA 3W4OA 5AJGA 3UB8A 4O8GA 2O9BA 4IVIA 3IBRA 4CLCD 2EXBA 3B33A 3OBFA 3IT9A 1TS0A 3C4PA 2RL3A 3KO6A 3WS0A 1BLSA 2V20A 2J9PA 3A3JA 3EQVA 1T1BA 1YLYA 2V8FA 2XSSA 3OCLA 4KZBA 4JKTA 4S2OA 2HDRA 3GRJA 1SKOA 2WGWB 3MZFA 4GD6A 5KZHA 3T4LA 4EESA 2ZQDA 5EECA 4HBTA 4WN5A 1SDNA 3HBRA 2RCXA 2ZQ8A 2I9VA 3A3FA 3Q7VA 2A24B 4OLDA 5EVEA 1NZOA 3ZYTA 2OLVA 3LIFA 5AVEA 4YFMA 4IBXA 5HDSA 3EOIA 3ZG9B 3Q7VB 4E3NA 2ZMVA 4R3BA 4JXSA 1YLTA 3HCYA 3HUNA 3PBQA 2H0YA 3P7NA 2B18A 1W63Q 5JYPA 3IXDA 3G32A 3SOIA 1YSQA 4B4ZA 2R9WA 1OJGA 4BBTA 4PMAA 3E4QA 3IH8A 1HLUP 2E8IA 3TW8A 3PBOA 1KDSA 2J8YA 3PBRA 3MXQA 3QP5A 2BTFP 3GVBA 3L7HA 4Q8IA 5I5LA 1KE0A 3GDIA 5HDCA 5IHVA 2EA9A 4QJGA 1S4SA 2H5SA 1F98A 1TD5A 3GSGA 2HP5A 3HL9A 3EEAA 3NULA 5E2HA 3B47A 4FH4A 4X69A 2H10A 1N9BA 5EPHA 4EQ1A 4JPMA 3O87A 1QMFA 1XA7A 5AQ9A 3E98A 2XH9A 5F68A 3TSGA 4GHIA 4WUJA 2JKGA 4H8RA 1OMEA 1NYMA 2VV7A 3MXRA 1VEUA 3WRZA 3NI9A 2EFUA 1VEUB 3LR4A 1PWGA 4XT2A 3LY4A 3GECA 3QP1A 4OKPA 3NJAA 2XD1A 4KQOA 1W8YA 3N7WA 2QHKA 2ZC7A 1TS8A 4UAAA 3KYEA 2XLNA 3IHAA 4EQIA 1FCOA 4ZDXA 3WWXA 2VZWA 3RXWA 3UN7A 1S6RA 4MBFA 1NRJA 1YQSA 4PHTA 3QNBA 4PPRA 3S7PA 4JXGA 5GLAA 5EUAA 3KYZA 2ZL1A 4S2NC 4C6YA 3IBJA 3CZDA 3D72A 1VHMA 2P9VA 1K25A 3N8LA 2Y2OA 4GDBA 2Y55A 4BWIA 4WM9A 1T1CA 4CQHA 4Y13A 3I7JA 1SCWA 4DF6A 5TBMA 5EVIC 4DE1A 1YLJA 4IEDA 1K54C 5D3OA 3T50A 2J9OA 5A92A 3BEBA 4Y0TA 4ZJ3A 1MWRA 4I39A 1K6RA 2HPBA 2J3TC 2ZBBA 4Z1WA 4DDSA 3E4OA 4HQAA 1M6KA 3K3DA 4FTXA 1J3WA 1E4DA 4UA7A 1VETA 2W1TA 3E2LA 3DTKA 4CLCB 2V0WA 4S2JA 2OWJA 2H0TA 5EOEA 4M3KA 2OAP1 3UDIA 1P9RA 5DFYA 1ES5A 1PWDA 2ZQ9A 3VSKA 4QU3A 5FDHA 3C2WA 2VGLS 4E3IA 3LIEA 5CECA 4EUVA 2PR6A 2W3FA 5DKKA 1S0WA 3MKFA 2QMIA 1IKIA 1IEMA 3OZHA 2C5WB 4U0TA 1UWNX 4IBRA 5CTNA 3SH8A 4JBFA 1LSXA 2XR0A 3OC2A 4MBKA 3ZQ5A 2K2NA 2LB9A 5HD3A 1EI5A 1BT5A 3T1RA 1CQAA 3R7WB 4FCFA 2HGVA 3IX4A 3CPTA 5FQ9A 3IXBA 4Y2FA 3VE3A 1S1YA 4LCLA 3V3RA 3CPTB 1XX2A 5A93A 5CRFA 4F3LA 1Z6FA 1PW1A 1JWZA 4NG2A 3FKWA 2PRFA 5DFXA 2X01A 5TJJA 2QKPA 4EETB 1OTIA 2PYPA 2JBFA 2HDUA 1HVBA 1RGZA 4WLAA 3A3DA 1GSWA 5FSRA 3D9YA 1VM1A 2A2LA 3UPNA 5G4YA 1S4RA 3TOIA 4BMWA 4HJ6A 5FEFA 3HLBA 4CPKA 4ARZB 4ZAMA 3VV4A 4PM6A 4P6ZS 5FDSA 1ALQA 2VGJA 2P08A 4KZ4A 1Q2PA 1YSPA 3C7UA 3Q07A 3BFEA 3WS1A 5DF7A 4PKYA 4E04A 3IF6A 3Q81A 3PAEA 1DY6A 1F5MA 2Y79A 2HF6A 3IF6B 3H9WA 2FFFB 2M7UA 3BFDA 1XJ6A 5IU1A 2D01A 1MPLA 1UGUA 1DRMA 5F6AA 2K31A 4KQQA 3CJMA 1L0EA 1OTAA 3IX3A 4MN7A 1BLHA 3V67A 3T4SA 2WKQA 5CEBA 1L0FA 1NY0A 3G35A 3HJIA 4B88A 3QP8A 3AGDA 3GR2A 1E3UA 1YLWA 5A90A 4GNUA 2Y2IA 3LGOA 4CLCC 4GJ4A 3A0VA 3S1YA 3NDEA 4I3JA 4KENB 2PBDP 2XK1A 2H28A 1M40A 4WELA 2G2WA 2Z6DA 4Q0JA 5FATA 3IQAA 4LRXC 3O88A 3LFVA 3F1NA 4K91A 3PBSA 4O01A 5BOHA 3TE8A 4X25A 3PYPA 2ZMAA 3F1NB 1G6AA 4Q0HA 1KOUA 3OPRA 4EXOA 3BY8A 4BL3A 3BQ8A 4EWFA 2O0YA 3LCEA 2WKPA 4O0PA 2WKRA 4EERA 3ZG5A 1ES3A 1KVLA 1NWZA 1TDGA 1PZOA 4BBVA 4MN6A 4IUKA 1E25A 2YKHA 3HREA 4OPQA 4YNRA 3IWOA 1KVMA 2G7UA 3EGXC 2R9XA 1ZG6A 2JKFA 1G5UA 1W8QA 4UHUA 1IKGA 1I2WA 4X1MA 1CJFA 4OP5A 1IFQA 1BYWA 5CEDA 1QMEA 4Y3IA 2KX6A 3NOTC 3UPPA 3HLCA 5HD5A 3VOYA 2ZD8A 4A5RA 3NHQA 4R3AA 4BD0A 1MBLA 1JWPA 2ZC6B 4JXWA 2XRNA 3ZCZA 5CGXA 2W27A 1ES4A 4MEZA 4WZ5A 4OOMA 3ZDJA 5GLCA 5CX7A 1LT0A 4DKIA 4YINA 3M6BA 5DJTA 1WE4A 2CMNA 2P74A 2ZQAA 4EBNA 4QPRA 3V50A 3A3IA 4LENA 4QY6A 3B42A 3C30A 3D3OA 3CUEA 5HPIA 4OVDA 2DMWA 1VQQA 1YPRA 2K7SA 2Y2MA 2DCFA 4HOIA 1JTGA 3SH7A 2PU2A 5L09A
chains in the Genus database with same CATH topology
4UQIS 3LR5A 3UMDA 3E98A 5F68A 5FL3A 5C5KA 4GHIA 2VJWA 4OOLA 4WUJA 1GSVA 2VV7A 3EGDC 5KSHA 3BWLA 3C38A 1T1AA 2XA7S 4R70A 3LIAA 4NXFA 2P7JA 1S66L 3LR4A 1NLZA 4HJ4A 4NKPA 3IS2A 4XT2A 5EFWA 2OOLA 3GECA 1MKMA 3NJAA 4KQOA 4FSFA 4GW9A 2QHKA 5HWVA 1LSWA 3R7WA 3BQAA 2QJ5A 2PDRA 1TS8A 1GSXA 4B93A 1DP9A 3EWKA 1DP6A 1NLYA 1W63M 2VZWA 4LRYC 3KSFA 1STZA 1G28A 4DJ2A 1F9IA 4H6JA 3RTYA 2PD7A 1NRJA 4PHTA 2HJ9C 1JNUA 2JHEA 3MFXA 4HHDA 3T4QA 3S7QA 3S7PA 1T19A 2FZ0A 3U2AA 1XFNA 1WA9A 2PYRA 3UB6A 3UMEA 1XJ4A 2L4RA 3KYZA 4EU0A 3T4TA 2V1AA 3IBJA 3H7WA 3K2NA 1MZUA 3D72A 1VHMA 3T4JA 3OLOA 2KLIA 2NUPC 4HI4A 2JKTI 4ARZA 1XJ2A 3UB9A 4BWIA 1T1CA 2GX5A 4CQHA 5DJUA 1D7EA 3VE4A 4UEYA 3OCNA 4HY8A 1LL8A 5TBMA 2W3GA 2Z6CA 4MN5A 1IOUA 2W0NA 2J3TD 3RH8B 5HSQA 3CITA 5J7EA 3T50A 5HDDA 4ETXA 3H82B 3LR3A 4GS9A 1OT6A 4I39A 3JVVA 5HWWA 2J3TC 3BJNA 2VEAA 1LSVA 4P6ZM 3SW1A 2ZBBA 4Z1WA 3E4OA 1V9ZA 4HQAA 2GZAA 2KDKA 3E4PA 3K3DA 4GS9B 2L1MA 1H3QA 2W1TA 4CLCB 1TF1A 2V0WA 2OWJA 4I3AA 4EEPA 4HH2A 1G6OA 2L0WA 2OWHA 1VB6A 4AFIA 4NXGA 4ETZA 2R78A 1OTDA 1OJ5A 2OAP1 2PR5A 1P9RA 5DFYA 2VA0A 5K5BA 3T4KA 5HL6A 3C2WA 2QYBA 2VGLS 3LI9A 1N9LA 2JKTM 3LIEA 4K08A 4GHIB 3O5YA 4EUVA 2PR6A 2V0UA 2W3FA 5DKKA 4L0LA 3KX0X 4DN0A 3P01A 1TS6A 4R6LA 1S1ZA 2OAQ1 4L9FA 3T4OA 3CLOA 1ZHHB 4NXEA 5L8MA 1UWNX 4G3WA 5J3WA 3IS2B 4JGRA 4XT2B 4GCZA 2O9CA 5IS1A 1LSXA 1OPXA 3OC2A 2QWSA 4G3VA 3ZQ5A 2K2NA 2LB9A 3LYXA 1S67L 5HD3A 1ODVA 2PT7A 3R7WB 3VOLA 3LIBA 4L9EA 2HGVA 4JGOA 2A24A 4II7A 2IA2A 3FPVA 3FC7A 1MC0A 2ZOHA 1OT9A 4Y2FA 3VE3A 1S1YA 2P04A 3KSGA 3NOUC 4R38A 2VKSA 3MMHA 2O99A 3ULFA 3LICA 1TS7A 4EEUA 4F3LA 4H6JB 3JVUA 2EWVA 3PXPA 1ZTUA 3PBTA 4MMNA 2XROA 1P0ZA 5DFXA 3MQQA 3MF0A 5TJJA 2QKPA 3CWFA 4RQ9A 4EETB 1OTIA 2PYPA 4FOFA 3LIDA 4I5SA 4WLAA 4LRZE 1GSWA 2YKFA 3H7WB 4CLCE 4I3IA 3TJZC 3BW6A 2W3DA 4HP9A 2JN7A 4PKYG 3UB7A 3EQUA 2A2LA 2INWA 4Y5FA 5G4YA 1S4RA 4BMWA 4HJ6A 4ARZB 3ICYA 5F69A 2JKRI 2O9AA 4HIAA 2LB5A 4JGQA 4DMZA 3UE6A 3VV4A 4LLOB 5AVFA 2D02A 4HP4A 4MCWA 4P6ZS 5TBMB 1T18A 3G6OA 4YOFA 4BBUA 2P08A 3CI6A 1YSPA 4IUHA 5HPFA 3EEHA 4MDZA 3F1PA 4PKYA 4E04A 4EQ1A 3S7NA 1N9NA 3NOPC 2FH5A 2NUTC 3DBAA 1F5MA 4I38A 2Y79A 4WL9A 3F1PB 2EWWA 2HF6A 3FG8A 5DF9A 3MR0A 3H9WA 2M7UA 4KUOA 1XJ6A 2W1TB 5DKLA 5IU1A 2D01A 3CAXA 2V9AA 2W3HA 4DJ3A 4IHQA 1UGUA 1OTBA 1DRMA 1X0OA 5F6AA 2K31A 4HNBA 2M7VA 5LBRA 3FPWA 2VLGA 1OTAA 5AJGA 4MN7A 4HJ3A 3UB8A 4O8GA 3V67A 3OOVA 2GJ3A 3T4SA 4B9OA 2WKQA 3BY9A 2O9BA 3IBRA 4CLCD 3HJIA 2BASA 3B33A 3OBFA 2HV1A 1TS0A 4CLCC 3KO6A 4GJ4A 4G3KA 3MJQA 2V1BA 3A0VA 3F1OA 4I3JA 4L9GA 2H28A 3EQVA 2JKRM 1T1BA 4ME4A 2VV6A 4HH3A 4UQIM 3S7OA 2XSSA 3F1OB 3CUEC 1P97A 4WELA 2Z6DA 1YKDA 3OCLA 2VGLM 4Q0JA 3LUQA 4LRXC 3PR6A 2XA7M 3F1NA 3LFVA 3PBSA 4O01A 3T4LA 4WEKA 1P9WA 4EESA 1DP8A 3TE8A 3MQ0A 3PYPA 1V9YA 1OTEA 4WN5A 3F1NB 4Q0HA 4M4XA 5F5YA 2I9VA 1KOUA 2A24B 3ZYTA 4EXOA 3BY8A 3LIFA 5AVEA 3BQ8A 4IJGA 3TRCA 2O0YA 1XJ3A 5HDSA 4KQDA 2WKPA 3EOIA 4Q0IA 4O0PA 1D06A 2WKRA 3C8CA 1YAXA 2KOIA 2J3WA 2ZMVA 4EERA 4F3LB 3HCYA 3PBQA 1NWZA 4BBVA 3P7NA 4MN6A 2B18A 3KSIA 4IUKA 2YKHA 1W63Q 2PD8A 3MQOA 4PAUA 4YNRA 2G7UA 3KSHA 2GNXA 3EGXC 1YSQA 1EW0A 3K3CA 4NXBA 2ZMFA 1IFQA 1BYWA 2VX8A 3PBNA 3KYQA 4Y3IA 2KX6A 1OJGA 3W2ZA 4BBTA 4LPZA 3NOTC 2W1RA 5HD5A 3E4QA 3E0YA 3HJKA 4GLQA 3LR0A 3NHQA 1XFQA 3A0SA 2B02A 4R3AA 1N9OA 3TW8A 2QJ7A 2HJEA 3PBOA 2Y8HA 3PBRA 4YWZA 4NEED 2XRNA 2W3EA 3H82A 2W27A 3MXQA 5IT5A 4OOMA 5G4ZA 3UE3A 5CX7A 2M1CA 3RFBA 1LT0A 4BJPA 3PHYA 5DJTA 4WF0A 1Y28A 5KIZA 5I5LA 3A0RA 2CMNA 2ZOIA 3GDIA 4CLCA 2MJ6A 5HDCA 5J4EA 4QPRA 2EA9A 1S4SA 4EW7A 4WEJA 3R4KA 2PHYA 1F98A 2VV8A 4KUKA 3B42A 1TD5A 3C30A 5HWTA 2J80A 5HZHA 4ZRRA 3D3OA 3CUEA 3LI8A 5HPIA 3EEAA 2DMWA 1UWPX 2K7SA 3B47A 1H8MA 5A8BA 4HOIA 5MC7A 4JGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQ0 A;  3BJN A;  2VEA A;  4Z1W A;  2W3D A;  3E98 A;  4Q0H A;  4Y5F A;  5C5K A;  2VJW A;  4IJG A;  2W1T A;  3TRC A;  1TF1 A;  2O0Y A;  2O9A A;  4Q0I A;  4R70 A;  4O0P A;  2LB5 A;  4DMZ A;  2KOI A;  3VV4 A;  3HCY A;  4MCW A;  4ETZ A;  3G6O A;  2OOL A;  4YOF A;  1MKM A;  2B18 A;  3KSI A;  3CI6 A;  4IUK A;  1YSP A;  4IUH A;  5HPF A;  5DFY A;  4MDZ A;  4PAU A;  4YNR A;  4GW9 A;  2G7U A;  3KSH A;  5K5B A;  4E04 A;  1YSQ A;  5HL6 A;  3S7N A;  3C2W A;  2QYB A;  2ZMF A;  3NOP C;  3DBA A;  1F5M A;  2Y79 A;  4Y3I A;  3W2Z A;  3O5Y A;  2VZW A;  3NOT C;  4LRY C;  2W1R A;  4EUV A;  2M7U A;  2W3F A;  3KSF A;  1STZ A;  2W1T B;  3E0Y A;  4GLQ A;  4DN0 A;  3NHQ A;  2W3H A;  4R6L A;  2K31 A;  3S7Q A;  2M7V A;  5LBR A;  5L8M A;  4G3W A;  2Y8H A;  3S7P A;  5AJG A;  4MN7 A;  2XRN A;  2W3E A;  2O9C A;  4O8G A;  3OOV A;  4EU0 A;  4G3V A;  3ZQ5 A;  2K2N A;  2LB9 A;  3IBJ A;  3K2N A;  2O9B A;  3IBR A;  3RFB A;  3OBF A;  1VHM A;  2HGV A;  2KLI A;  2IA2 A;  5I5L A;  3KO6 A;  1MC0 A;  4G3K A;  4BWI A;  2GX5 A;  4Y2F A;  4CQH A;  4QPR A;  3KSG A;  3NOU C;  2VKS A;  3MMH A;  2O99 A;  3R4K A;  4ME4 A;  1TD5 A;  3S7O A;  2XSS A;  2W3G A;  4ZRR A;  1ZTU A;  1YKD A;  3D3O A;  5HPI A;  4MMN A;  2XRO A;  4Q0J A;  5DFX A;  3EEA A;  3MF0 A;  5TJJ A;  4LRX C;  4RQ9 A;  3CIT A;  5HSQ A;  3LFV A;  4O01 A;  4ETX A;  4FOF A;  4LRZ E; 
#chains in the Genus database with same CATH topology
 5CHM A;  3UMD A;  3VSL A;  1ZC2 A;  4OPZ A;  4HES A;  3EGD C;  2OSU A;  5TR7 A;  5AQ7 A;  3UPO A;  5DF8 A;  4HJ4 A;  4JF4 A;  1IEL A;  5FQJ A;  1MKM A;  2QPN A;  1SKO B;  2Y4A A;  5AQB A;  4BEN A;  1GSX A;  3SZT A;  4Y17 A;  4B93 A;  1H8Y A;  4S2N A;  1IYS A;  4LV3 A;  5J8X A;  4LRY C;  3V39 A;  1STZ A;  3G2Y A;  4C3Q A;  4DJ2 A;  1F9I A;  2PU4 A;  3RTY A;  2PD7 A;  3G4P A;  4E3J A;  2JHE A;  3MFX A;  1XKZ A;  2PYR A;  3UB6 A;  2L4R A;  5EVI A;  2EX9 A;  3K2N A;  1PW8 A;  3H7W A;  1MZU A;  4U3T A;  1K4F A;  3T4J A;  2KLI A;  1XXM A;  4KQR A;  2JKT I;  1XJ2 A;  2EX8 A;  1YMX A;  5DJU A;  3HUM A;  1SKF A;  1D7E A;  5FQI A;  4S2P A;  5HAI A;  4Z9Q A;  4HY8 A;  2W3G A;  1GA0 A;  4RA7 A;  2V2F F;  1XGJ A;  2W0N A;  1KE3 A;  3RH8 B;  5HSQ A;  5J7E A;  5HDD A;  5FA7 A;  4KZ5 A;  2X71 A;  2A3U A;  3LR3 A;  1OT6 A;  3JVV A;  5FAS A;  4KZ9 A;  4QWO A;  3SW1 A;  1YLZ A;  4DDY A;  1IYQ A;  1GHM A;  1ZKJ A;  2Y2N A;  5FEG A;  1G6O A;  2OWH A;  1BSG A;  1VB6 A;  5HW3 A;  4P85 A;  3E2K A;  2R78 A;  2OV5 A;  4OOY A;  1OJ5 A;  4N1X A;  4X55 A;  3G2Z A;  4N9K A;  5TGF A;  1EWZ A;  1N9L A;  2JKT M;  4GHI B;  3O5Y A;  2V0U A;  4OP8 A;  4WBG A;  3BFC A;  3KX0 X;  4DN0 A;  3P01 A;  1TS6 A;  4R6L A;  2OAQ 1;  3T4O A;  1K55 C;  1ZHH B;  3L9K A;  5L2F A;  5L8M A;  2EX2 A;  5J3W A;  4XT2 B;  1E3U D;  3NIA A;  3CMZ A;  1L0G A;  2PT7 A;  1I5Q A;  3FWL A;  4OQI A;  3LIB A;  4QY5 A;  3ZG0 A;  4Y7P A;  5G18 A;  1MWT A;  3FC7 A;  3BFG A;  2O99 A;  2IWB A;  5CGS A;  4OQG A;  2BLS A;  1PYY A;  1GCE A;  1ZTU A;  3N6I A;  3PBT A;  4JXV A;  4MMN A;  1HTZ A;  3C4O A;  2XRO A;  3MQQ A;  4RQ9 A;  4LV0 A;  2EX6 A;  2HP9 A;  4FOF A;  2ZL1 B;  1FOF A;  4U0X A;  1ERM A;  4CLC E;  4I3I A;  3TJZ C;  3BW6 A;  4HP9 A;  3UB7 A;  1XPB A;  2JN7 A;  1L3L A;  2P9V B;  4PM9 A;  5GLD A;  4OPY A;  2ZQ7 A;  4JF5 A;  2JKR I;  4EUZ A;  1KE4 A;  4JGQ A;  4DMZ A;  4LLO B;  5AVF A;  3ZG8 B;  3BLM A;  4MBH A;  3QHY A;  4MCW A;  5TBM B;  4X6T A;  4X1L A;  5HPF A;  3EEH A;  4N9L A;  2QZ6 A;  2WGI A;  1FSW A;  4WL9 A;  2EWW A;  5F1F A;  3FG8 A;  4RYE A;  3MR0 A;  4ID4 A;  2EXA A;  4KUO A;  1F2K A;  1VET B;  2W1T B;  4JLF A;  5DKL A;  1XA1 A;  3CAX A;  4IHQ A;  4GD8 A;  3IHB A;  3UO9 A;  5KMW A;  1L2S A;  4PM7 A;  5DVA A;  4ZTK A;  4B9O A;  2GJ3 A;  3BY9 A;  3BYD A;  3Q7Z A;  3QNC A;  5FI7 A;  2CC1 A;  2BAS A;  3UNW A;  3G34 A;  2VGK A;  1PI5 A;  3MZE A;  3Q82 A;  4R4S A;  5HL1 A;  1FIL A;  3MJQ A;  2V1B A;  3F1O A;  2Z2M B;  4S2K A;  4L9G A;  2JKR M;  4ME4 A;  2VV6 A;  4HH3 A;  4UQI M;  3SS5 A;  3S7O A;  1BUE A;  3F1O B;  1P97 A;  1YKD A;  2VGL M;  3DWZ A;  3LUQ A;  4DE2 A;  4R4R A;  2XA7 M;  1P9W A;  1DP8 A;  1V9Y A;  1OTE A;  1AWI A;  4M4X A;  5F5Y A;  3ZNY A;  1XP4 A;  2WK0 A;  3TRC A;  1FR6 A;  4K0X A;  4LGW A;  4Q0I A;  5DTK A;  2Q0O A;  3UE1 A;  3C8C A;  3GV9 A;  2KOI A;  2J3W A;  4F3L B;  4ZJ1 A;  2WKI A;  4KZ7 A;  1TEM A;  2ZC3 B;  5CGW A;  2Y2G A;  4BL2 A;  2GNX A;  3RXX A;  1ONG A;  3N8S A;  1EW0 A;  2Y2K A;  4NXB A;  4OQ0 A;  1K38 A;  3GQZ A;  3PBN A;  3JPU A;  4ZJ2 A;  1MWU A;  3P98 A;  2W1R A;  3UY6 A;  3HJK A;  3ZFZ A;  3LR0 A;  1GHP A;  3ISG A;  1XFQ A;  3A0S A;  2B02 A;  4FH2 A;  4E3L A;  5EVI D;  1N9O A;  2WAF A;  1K6S A;  2Y8H A;  3UE0 A;  4YWZ A;  4NEE D;  1HZO A;  2ZM2 A;  3H82 A;  4KZA A;  1W7F A;  5G4Z A;  2I72 A;  4E3K A;  5EM0 A;  4BJP A;  3PHY A;  4WF0 A;  3U4L P;  3A0R A;  2MJ6 A;  4D60 A;  5J4E A;  4OQH A;  4EW7 A;  1JTD A;  3R4K A;  5GL9 A;  5CHU A;  3ZNT A;  1SDE A;  2VV8 A;  3LEZ A;  4KUK A;  1YLP A;  5HWT A;  3OPP A;  5HZH A;  3LI8 A;  1UWP X;  5MC7 A;  4JGP A;  5EM1 A;  3D4F A;  1PZP A;  3VFH A;  2JE5 A;  5C5K A;  2C6W B;  4OOL A;  1GSV A;  4WMC A;  3WS2 A;  3C38 A;  3N4I A;  5GHY A;  3LIA A;  4NXF A;  3MKE A;  3NCK A;  2P7J A;  1S66 L;  3W8K A;  3DTM A;  3ZHH A;  5EFW A;  3IS2 A;  3IWQ A;  2OOL A;  3LY3 A;  5CHJ A;  1ERQ A;  4FSF A;  4GW9 A;  5FQM A;  2UWX A;  2PBY A;  3BQA A;  2QJ5 A;  5M18 A;  2Y2J A;  1DP9 A;  3EWK A;  4RX2 A;  1MWS A;  1DP6 A;  5E2F A;  3SS4 A;  1NLY A;  1W63 M;  1TDL A;  3CG5 A;  3KSF A;  3MXS A;  4H6J A;  2HJ9 C;  3LEQ A;  4HHD A;  3T4Q A;  2B5R A;  2Q9M A;  3DAV A;  3IXG A;  3MFD A;  2WGV A;  1FQG A;  2FZ0 A;  1XFN A;  1WA9 A;  3UME A;  4D2O A;  4EU0 A;  3T4T A;  2V1A A;  4MNR A;  5DTT A;  1YMS A;  1K0K A;  2FFY A;  2WKE A;  2ACG A;  3OLO A;  4DRT A;  4HI4 A;  3VFF A;  2GX5 A;  4BLM A;  1DJC A;  4UEY A;  4F94 A;  1WYC A;  3OCN A;  2IWD A;  2Y2P A;  2HDQ A;  3M2K A;  4K0W A;  1LL8 A;  4MN5 A;  1IOU A;  4WZ4 A;  3HLF A;  4MLL A;  3BLS A;  4ZBE A;  2BG1 A;  2VEA A;  4P6B A;  3N8R A;  3CHW P;  1N4O A;  1BLP A;  2GZA A;  1CI9 A;  2KDK A;  3E4P A;  2L1M A;  3QP2 A;  1ZG4 A;  2J7V A;  4B4X A;  4EEP A;  2L0W A;  4OPR A;  3JYI A;  4AFI A;  4S2M A;  3O86 A;  1PWC A;  1K55 A;  1NXY A;  5E2E A;  1H8Z A;  1ACF A;  1GHI A;  1NYY A;  3IF6 C;  3T4K A;  3GMW A;  5HL6 A;  3RJU A;  3LI9 A;  3OPL A;  2ZLY A;  4GZB A;  4BD1 A;  4E3M A;  3NBL A;  3BFF A;  3ZG7 B;  1A0K A;  1I2S A;  5E2G A;  1FCM A;  4DE3 A;  2WGW A;  1O7E A;  4GCZ A;  2O9C A;  4KG6 A;  5IS1 A;  1OPX A;  2E8J A;  3P09 A;  4G3V A;  1RGY A;  2ZC4 B;  3LYX A;  4R3J A;  3DWK A;  3SH9 A;  1J9M A;  1K56 A;  4L9E A;  1NZU A;  4JGO A;  2A24 A;  4II7 A;  2Y91 A;  2G2U A;  3MMH A;  3VP4 A;  3LIC A;  4XUX A;  1NJ4 A;  3IF5 A;  3T12 B;  1PRQ A;  1O07 A;  1U60 A;  1HD8 A;  3JVU A;  3PXP A;  1P0Z A;  5F1G A;  3CWF A;  1K54 A;  1LI0 A;  3LID A;  4X56 A;  4I5S A;  5EVI B;  3HLG A;  4LRZ E;  3GTC A;  3H7W B;  2ZC5 B;  5EV0 A;  2W3D A;  4PKY G;  1MXO A;  1CK3 A;  4Y5F A;  2XFS A;  2OLU A;  3VP1 A;  5F69 A;  3VOZ A;  3QP4 A;  3MS6 A;  2O9A A;  4HIA A;  5HAQ A;  4Y0O A;  5EE8 A;  2D02 A;  4HP4 A;  1LL5 A;  1T18 A;  2WYX A;  4YOF A;  3T1S A;  3CI6 A;  3DTE A;  1ONH A;  4IUH A;  1W5D A;  3MZD A;  4E3O A;  3PTE A;  3FV7 A;  5GLB A;  4C75 A;  1ERO A;  3NOP C;  4FUW A;  2NUT C;  2XGN A;  2IWC A;  4I38 A;  4LV1 A;  2V9A A;  1K57 C;  1FIK A;  2M7V A;  5LBR A;  3IH9 A;  5FAQ A;  4KG5 A;  1XGI A;  4UA9 A;  4HJ3 A;  3OOV A;  4WZ5 C;  4N1H A;  2HV1 A;  2WAE A;  4KZ8 A;  4UA6 A;  5CTM A;  4DXC A;  4G3K A;  4EBL A;  2XD5 A;  3G31 A;  4LV2 A;  5F82 A;  1RP5 A;  1YT4 A;  5AQA A;  2GDN A;  1H5X A;  1K4E A;  3CUE C;  3PR6 A;  3VP2 A;  4WEK A;  4E6W A;  3HLE A;  1D1J A;  3MQ0 A;  3OPH A;  4WMC D;  1IYO A;  3LO7 A;  1ES2 A;  5E43 A;  4Y0U A;  3HUO A;  4IJG A;  4HEF A;  1XJ3 A;  4KQD A;  3M2J A;  1D06 A;  1YAX A;  5HAP A;  3T1X A;  3S22 A;  1SZV A;  4FD8 A;  4DXB A;  1DJA A;  3KSI A;  2PD8 A;  3MQO A;  3B3X A;  4PAU A;  1FR1 A;  2JC7 A;  2XF3 A;  3KSH A;  4S2I A;  4EV4 A;  2EFX A;  3K3C A;  1CEG A;  2ZMF A;  1FSY A;  2VX8 A;  3KYQ A;  3W2Z A;  2Y2H A;  4LPZ A;  2DNS A;  3E0Y A;  4GLQ A;  3IXH A;  2Y59 A;  2QJ7 A;  2HJE A;  5FI2 A;  5EOO A;  1CEF A;  2W3E A;  3VMA A;  1Z09 A;  5IT5 A;  3UE3 A;  2M1C A;  3RFB A;  4KZ3 A;  4PM8 A;  1L0D A;  5FAP A;  1H0M A;  1Y28 A;  5KIZ A;  2ZOI A;  4CLC A;  5JYO A;  5M1A A;  4WEJ A;  3VP0 A;  2PHY A;  1G68 A;  4NET A;  5KSC A;  3FZC A;  1ESI A;  5TFQ A;  2J80 A;  2X02 A;  4ZRR A;  2DRW A;  3IWI A;  5GHX A;  3MSH A;  1H8M A;  5A8B A;  4NK3 A;  4GOG A;  4R0Q A;  1PI4 A;  3WS4 A;  4UQI S;  2WZZ A;  3LR5 A;  4HBU A;  5FQK A;  1BLC A;  4P0M A;  5FL3 A;  2VJW A;  3ITB A;  4E6X A;  5KSH A;  3WS5 A;  3BWL A;  2HP6 A;  1T1A A;  3NY4 A;  2XA7 S;  1YM1 A;  4R70 A;  4QHC A;  5I94 A;  1PIO A;  3HLW A;  3BRM A;  1ESU A;  1NLZ A;  5F83 A;  3ZVW A;  2PAV P;  3ZGA B;  1KGG A;  4NKP A;  3W4P A;  5L10 A;  2AVX A;  4BQM A;  2ZJ9 A;  2V1Z A;  4N92 A;  1JVJ A;  5HWV A;  1LSW A;  3R7W A;  2PDR A;  5HX9 A;  3M6H A;  3C7V A;  2A49 A;  4O7D A;  1G28 A;  3FYZ A;  4ESP A;  5HFO A;  1KDW A;  3TG9 A;  1JNU A;  3S7Q A;  1T19 A;  3U2A A;  1K56 D;  4KG2 A;  1XJ4 A;  2UV0 E;  1Y54 A;  4OH0 A;  3FKV A;  1LHY A;  3AGE A;  5GHZ A;  2NUP C;  1SHV A;  4ARZ A;  1TVF A;  3UB9 A;  5A91 A;  4OON A;  2Q9N A;  4Y15 A;  3UDX A;  3VE4 A;  5M19 A;  5FI6 A;  2XFT A;  3S4X A;  2Z6C A;  1W79 A;  2J3T D;  4X68 A;  3CIT A;  2HDS A;  1GA9 A;  1BUL A;  4ETX A;  3H82 B;  3ITA A;  4GS9 A;  5HWW A;  3V3S A;  3BJN A;  4S2L A;  1LSV A;  4P6Z M;  4PM5 A;  3QP6 A;  2WUQ A;  2WAD A;  1V9Z A;  1PFL A;  4OLG A;  2HZ5 A;  3NDG A;  4GS9 B;  1H3Q A;  2WKH A;  1TF1 A;  4I3A A;  4HH2 A;  4LCM A;  3UB5 P;  4NXG A;  4ETZ A;  1OTD A;  4GN2 A;  2WZX A;  1LLB A;  1Y4O A;  2PR5 A;  1CF0 A;  2Z2L B;  4KZ6 A;  4XXR A;  2VA0 A;  1MY8 A;  5K5B A;  4EBP A;  1DJB A;  3NC8 A;  4LFU A;  2QYB A;  2XEP A;  5FAO A;  4RVA A;  2Y2L A;  3AGF A;  4K08 A;  1AXB A;  5EVL A;  3C5A A;  2VK3 A;  1MKI A;  4L0L A;  4RX3 A;  4DE0 A;  1PNE A;  1S1Z A;  3DW0 A;  4L9F A;  3VP3 A;  3CLO A;  4QB8 A;  3V5M A;  4NXE A;  4G3W A;  3IS2 B;  4JGR A;  1C3B A;  3O3V A;  3HVF A;  5FQQ A;  2ZM8 A;  1KGE A;  2QWS A;  1S67 L;  4IVK A;  1ODV A;  4QD4 A;  3VOL A;  1BTL A;  2IA2 A;  3IX8 A;  5HAR A;  3FPV A;  1MC0 A;  2ZOH A;  1OT9 A;  2P04 A;  3KSG A;  3NOU C;  5DTS A;  4R38 A;  2VKS A;  4GB7 A;  3UDF A;  2XDM A;  3ULF A;  1TS7 A;  4EEU A;  4H6J B;  3A3E A;  1NRF A;  2EWV A;  4R1G A;  3W4Q A;  3MF0 A;  5CXW A;  4GKU A;  2YKF A;  1FCN A;  3T1Q B;  4XUZ A;  4GDN A;  3EQU A;  2INW A;  1BZA A;  3DTI A;  3G30 A;  2Y2Q A;  4X53 A;  4JF6 A;  2V8C A;  3ICY A;  4CJN A;  3MBZ A;  2LB5 A;  3UE6 A;  2JCH A;  2B95 A;  3Q1F A;  3NEC A;  3BEC A;  3ZVT A;  3G6O A;  1WYB A;  4BBU A;  1IYP A;  3SS3 A;  1K57 A;  3PAG A;  4MDZ A;  3F1P A;  1Q2Q A;  1KGF A;  1RCJ A;  4R23 A;  3BM6 A;  3S7N A;  1CI8 A;  1N9N A;  2XQZ A;  2FH5 A;  3DBA A;  3F1P B;  5U47 A;  5DF9 A;  1LI9 A;  5L07 A;  1LL9 A;  2ZQC A;  3WRT A;  4P87 A;  4WYY A;  2W3H A;  5CER A;  4DJ3 A;  1OTB A;  1X0O A;  2ZM0 A;  1JWV A;  3HLD A;  4HNB A;  3FPW A;  2VLG A;  3W4O A;  5AJG A;  3UB8 A;  4O8G A;  2O9B A;  4IVI A;  3IBR A;  4CLC D;  2EXB A;  3B33 A;  3OBF A;  3IT9 A;  1TS0 A;  3C4P A;  2RL3 A;  3KO6 A;  3WS0 A;  1BLS A;  2V20 A;  2J9P A;  3A3J A;  3EQV A;  1T1B A;  1YLY A;  2V8F A;  2XSS A;  3OCL A;  4KZB A;  4JKT A;  4S2O A;  2HDR A;  3GRJ A;  1SKO A;  2WGW B;  3MZF A;  4GD6 A;  5KZH A;  3T4L A;  4EES A;  2ZQD A;  5EEC A;  4HBT A;  4WN5 A;  1SDN A;  3HBR A;  2RCX A;  2ZQ8 A;  2I9V A;  3A3F A;  3Q7V A;  2A24 B;  4OLD A;  5EVE A;  1NZO A;  3ZYT A;  2OLV A;  3LIF A;  5AVE A;  4YFM A;  4IBX A;  5HDS A;  3EOI A;  3ZG9 B;  3Q7V B;  4E3N A;  2ZMV A;  4R3B A;  4JXS A;  1YLT A;  3HCY A;  3HUN A;  3PBQ A;  2H0Y A;  3P7N A;  2B18 A;  1W63 Q;  5JYP A;  3IXD A;  3G32 A;  3SOI A;  1YSQ A;  4B4Z A;  2R9W A;  1OJG A;  4BBT A;  4PMA A;  3E4Q A;  3IH8 A;  1HLU P;  2E8I A;  3TW8 A;  3PBO A;  1KDS A;  2J8Y A;  3PBR A;  3MXQ A;  3QP5 A;  2BTF P;  3GVB A;  3L7H A;  4Q8I A;  5I5L A;  1KE0 A;  3GDI A;  5HDC A;  5IHV A;  2EA9 A;  4QJG A;  1S4S A;  2H5S A;  1F98 A;  1TD5 A;  3GSG A;  2HP5 A;  3HL9 A;  3EEA A;  3NUL A;  5E2H A;  3B47 A;  4FH4 A;  4X69 A;  2H10 A;  1N9B A;  5EPH A;  4EQ1 A;  4JPM A;  3O87 A;  1QMF A;  1XA7 A;  5AQ9 A;  3E98 A;  2XH9 A;  5F68 A;  3TSG A;  4GHI A;  4WUJ A;  2JKG A;  4H8R A;  1OME A;  1NYM A;  2VV7 A;  3MXR A;  1VEU A;  3WRZ A;  3NI9 A;  2EFU A;  1VEU B;  3LR4 A;  1PWG A;  4XT2 A;  3LY4 A;  3GEC A;  3QP1 A;  4OKP A;  3NJA A;  2XD1 A;  4KQO A;  1W8Y A;  3N7W A;  2QHK A;  2ZC7 A;  1TS8 A;  4UAA A;  3KYE A;  2XLN A;  3IHA A;  4EQI A;  1FCO A;  4ZDX A;  3WWX A;  2VZW A;  3RXW A;  3UN7 A;  1S6R A;  4MBF A;  1NRJ A;  1YQS A;  4PHT A;  3QNB A;  4PPR A;  3S7P A;  4JXG A;  5GLA A;  5EUA A;  3KYZ A;  2ZL1 A;  4S2N C;  4C6Y A;  3IBJ A;  3CZD A;  3D72 A;  1VHM A;  2P9V A;  1K25 A;  3N8L A;  2Y2O A;  4GDB A;  2Y55 A;  4BWI A;  4WM9 A;  1T1C A;  4CQH A;  4Y13 A;  3I7J A;  1SCW A;  4DF6 A;  5TBM A;  5EVI C;  4DE1 A;  1YLJ A;  4IED A;  1K54 C;  5D3O A;  3T50 A;  2J9O A;  5A92 A;  3BEB A;  4Y0T A;  4ZJ3 A;  1MWR A;  4I39 A;  1K6R A;  2HPB A;  2J3T C;  2ZBB A;  4Z1W A;  4DDS A;  3E4O A;  4HQA A;  1M6K A;  3K3D A;  4FTX A;  1J3W A;  1E4D A;  4UA7 A;  1VET A;  2W1T A;  3E2L A;  3DTK A;  4CLC B;  2V0W A;  4S2J A;  2OWJ A;  2H0T A;  5EOE A;  4M3K A;  2OAP 1;  3UDI A;  1P9R A;  5DFY A;  1ES5 A;  1PWD A;  2ZQ9 A;  3VSK A;  4QU3 A;  5FDH A;  3C2W A;  2VGL S;  4E3I A;  3LIE A;  5CEC A;  4EUV A;  2PR6 A;  2W3F A;  5DKK A;  1S0W A;  3MKF A;  2QMI A;  1IKI A;  1IEM A;  3OZH A;  2C5W B;  4U0T A;  1UWN X;  4IBR A;  5CTN A;  3SH8 A;  4JBF A;  1LSX A;  2XR0 A;  3OC2 A;  4MBK A;  3ZQ5 A;  2K2N A;  2LB9 A;  5HD3 A;  1EI5 A;  1BT5 A;  3T1R A;  1CQA A;  3R7W B;  4FCF A;  2HGV A;  3IX4 A;  3CPT A;  5FQ9 A;  3IXB A;  4Y2F A;  3VE3 A;  1S1Y A;  4LCL A;  3V3R A;  3CPT B;  1XX2 A;  5A93 A;  5CRF A;  4F3L A;  1Z6F A;  1PW1 A;  1JWZ A;  4NG2 A;  3FKW A;  2PRF A;  5DFX A;  2X01 A;  5TJJ A;  2QKP A;  4EET B;  1OTI A;  2PYP A;  2JBF A;  2HDU A;  1HVB A;  1RGZ A;  4WLA A;  3A3D A;  1GSW A;  5FSR A;  3D9Y A;  1VM1 A;  2A2L A;  3UPN A;  5G4Y A;  1S4R A;  3TOI A;  4BMW A;  4HJ6 A;  5FEF A;  3HLB A;  4CPK A;  4ARZ B;  4ZAM A;  3VV4 A;  4PM6 A;  4P6Z S;  5FDS A;  1ALQ A;  2VGJ A;  2P08 A;  4KZ4 A;  1Q2P A;  1YSP A;  3C7U A;  3Q07 A;  3BFE A;  3WS1 A;  5DF7 A;  4PKY A;  4E04 A;  3IF6 A;  3Q81 A;  3PAE A;  1DY6 A;  1F5M A;  2Y79 A;  2HF6 A;  3IF6 B;  3H9W A;  2FFF B;  2M7U A;  3BFD A;  1XJ6 A;  5IU1 A;  2D01 A;  1MPL A;  1UGU A;  1DRM A;  5F6A A;  2K31 A;  4KQQ A;  3CJM A;  1L0E A;  1OTA A;  3IX3 A;  4MN7 A;  1BLH A;  3V67 A;  3T4S A;  2WKQ A;  5CEB A;  1L0F A;  1NY0 A;  3G35 A;  3HJI A;  4B88 A;  3QP8 A;  3AGD A;  3GR2 A;  1E3U A;  1YLW A;  5A90 A;  4GNU A;  2Y2I A;  3LGO A;  4CLC C;  4GJ4 A;  3A0V A;  3S1Y A;  3NDE A;  4I3J A;  4KEN B;  2PBD P;  2XK1 A;  2H28 A;  1M40 A;  4WEL A;  2G2W A;  2Z6D A;  4Q0J A;  5FAT A;  3IQA A;  4LRX C;  3O88 A;  3LFV A;  3F1N A;  4K91 A;  3PBS A;  4O01 A;  5BOH A;  3TE8 A;  4X25 A;  3PYP A;  2ZMA A;  3F1N B;  1G6A A;  4Q0H A;  1KOU A;  3OPR A;  4EXO A;  3BY8 A;  4BL3 A;  3BQ8 A;  4EWF A;  2O0Y A;  3LCE A;  2WKP A;  4O0P A;  2WKR A;  4EER A;  3ZG5 A;  1ES3 A;  1KVL A;  1NWZ A;  1TDG A;  1PZO A;  4BBV A;  4MN6 A;  4IUK A;  1E25 A;  2YKH A;  3HRE A;  4OPQ A;  4YNR A;  3IWO A;  1KVM A;  2G7U A;  3EGX C;  2R9X A;  1ZG6 A;  2JKF A;  1G5U A;  1W8Q A;  4UHU A;  1IKG A;  1I2W A;  4X1M A;  1CJF A;  4OP5 A;  1IFQ A;  1BYW A;  5CED A;  1QME A;  4Y3I A;  2KX6 A;  3NOT C;  3UPP A;  3HLC A;  5HD5 A;  3VOY A;  2ZD8 A;  4A5R A;  3NHQ A;  4R3A A;  4BD0 A;  1MBL A;  1JWP A;  2ZC6 B;  4JXW A;  2XRN A;  3ZCZ A;  5CGX A;  2W27 A;  1ES4 A;  4MEZ A;  4WZ5 A;  4OOM A;  3ZDJ A;  5GLC A;  5CX7 A;  1LT0 A;  4DKI A;  4YIN A;  3M6B A;  5DJT A;  1WE4 A;  2CMN A;  2P74 A;  2ZQA A;  4EBN A;  4QPR A;  3V50 A;  3A3I A;  4LEN A;  4QY6 A;  3B42 A;  3C30 A;  3D3O A;  3CUE A;  5HPI A;  4OVD A;  2DMW A;  1VQQ A;  1YPR A;  2K7S A;  2Y2M A;  2DCF A;  4HOI A;  1JTG A;  3SH7 A;  2PU2 A;  5L09 A; 
#chains in the Genus database with same CATH homology
 4UQI S;  3LR5 A;  3UMD A;  3E98 A;  5F68 A;  5FL3 A;  5C5K A;  4GHI A;  2VJW A;  4OOL A;  4WUJ A;  1GSV A;  2VV7 A;  3EGD C;  5KSH A;  3BWL A;  3C38 A;  1T1A A;  2XA7 S;  4R70 A;  3LIA A;  4NXF A;  2P7J A;  1S66 L;  3LR4 A;  1NLZ A;  4HJ4 A;  4NKP A;  3IS2 A;  4XT2 A;  5EFW A;  2OOL A;  3GEC A;  1MKM A;  3NJA A;  4KQO A;  4FSF A;  4GW9 A;  2QHK A;  5HWV A;  1LSW A;  3R7W A;  3BQA A;  2QJ5 A;  2PDR A;  1TS8 A;  1GSX A;  4B93 A;  1DP9 A;  3EWK A;  1DP6 A;  1NLY A;  1W63 M;  2VZW A;  4LRY C;  3KSF A;  1STZ A;  1G28 A;  4DJ2 A;  1F9I A;  4H6J A;  3RTY A;  2PD7 A;  1NRJ A;  4PHT A;  2HJ9 C;  1JNU A;  2JHE A;  3MFX A;  4HHD A;  3T4Q A;  3S7Q A;  3S7P A;  1T19 A;  2FZ0 A;  3U2A A;  1XFN A;  1WA9 A;  2PYR A;  3UB6 A;  3UME A;  1XJ4 A;  2L4R A;  3KYZ A;  4EU0 A;  3T4T A;  2V1A A;  3IBJ A;  3H7W A;  3K2N A;  1MZU A;  3D72 A;  1VHM A;  3T4J A;  3OLO A;  2KLI A;  2NUP C;  4HI4 A;  2JKT I;  4ARZ A;  1XJ2 A;  3UB9 A;  4BWI A;  1T1C A;  2GX5 A;  4CQH A;  5DJU A;  1D7E A;  3VE4 A;  4UEY A;  3OCN A;  4HY8 A;  1LL8 A;  5TBM A;  2W3G A;  2Z6C A;  4MN5 A;  1IOU A;  2W0N A;  2J3T D;  3RH8 B;  5HSQ A;  3CIT A;  5J7E A;  3T50 A;  5HDD A;  4ETX A;  3H82 B;  3LR3 A;  4GS9 A;  1OT6 A;  4I39 A;  3JVV A;  5HWW A;  2J3T C;  3BJN A;  2VEA A;  1LSV A;  4P6Z M;  3SW1 A;  2ZBB A;  4Z1W A;  3E4O A;  1V9Z A;  4HQA A;  2GZA A;  2KDK A;  3E4P A;  3K3D A;  4GS9 B;  2L1M A;  1H3Q A;  2W1T A;  4CLC B;  1TF1 A;  2V0W A;  2OWJ A;  4I3A A;  4EEP A;  4HH2 A;  1G6O A;  2L0W A;  2OWH A;  1VB6 A;  4AFI A;  4NXG A;  4ETZ A;  2R78 A;  1OTD A;  1OJ5 A;  2OAP 1;  2PR5 A;  1P9R A;  5DFY A;  2VA0 A;  5K5B A;  3T4K A;  5HL6 A;  3C2W A;  2QYB A;  2VGL S;  3LI9 A;  1N9L A;  2JKT M;  3LIE A;  4K08 A;  4GHI B;  3O5Y A;  4EUV A;  2PR6 A;  2V0U A;  2W3F A;  5DKK A;  4L0L A;  3KX0 X;  4DN0 A;  3P01 A;  1TS6 A;  4R6L A;  1S1Z A;  2OAQ 1;  4L9F A;  3T4O A;  3CLO A;  1ZHH B;  4NXE A;  5L8M A;  1UWN X;  4G3W A;  5J3W A;  3IS2 B;  4JGR A;  4XT2 B;  4GCZ A;  2O9C A;  5IS1 A;  1LSX A;  1OPX A;  3OC2 A;  2QWS A;  4G3V A;  3ZQ5 A;  2K2N A;  2LB9 A;  3LYX A;  1S67 L;  5HD3 A;  1ODV A;  2PT7 A;  3R7W B;  3VOL A;  3LIB A;  4L9E A;  2HGV A;  4JGO A;  2A24 A;  4II7 A;  2IA2 A;  3FPV A;  3FC7 A;  1MC0 A;  2ZOH A;  1OT9 A;  4Y2F A;  3VE3 A;  1S1Y A;  2P04 A;  3KSG A;  3NOU C;  4R38 A;  2VKS A;  3MMH A;  2O99 A;  3ULF A;  3LIC A;  1TS7 A;  4EEU A;  4F3L A;  4H6J B;  3JVU A;  2EWV A;  3PXP A;  1ZTU A;  3PBT A;  4MMN A;  2XRO A;  1P0Z A;  5DFX A;  3MQQ A;  3MF0 A;  5TJJ A;  2QKP A;  3CWF A;  4RQ9 A;  4EET B;  1OTI A;  2PYP A;  4FOF A;  3LID A;  4I5S A;  4WLA A;  4LRZ E;  1GSW A;  2YKF A;  3H7W B;  4CLC E;  4I3I A;  3TJZ C;  3BW6 A;  2W3D A;  4HP9 A;  2JN7 A;  4PKY G;  3UB7 A;  3EQU A;  2A2L A;  2INW A;  4Y5F A;  5G4Y A;  1S4R A;  4BMW A;  4HJ6 A;  4ARZ B;  3ICY A;  5F69 A;  2JKR I;  2O9A A;  4HIA A;  2LB5 A;  4JGQ A;  4DMZ A;  3UE6 A;  3VV4 A;  4LLO B;  5AVF A;  2D02 A;  4HP4 A;  4MCW A;  4P6Z S;  5TBM B;  1T18 A;  3G6O A;  4YOF A;  4BBU A;  2P08 A;  3CI6 A;  1YSP A;  4IUH A;  5HPF A;  3EEH A;  4MDZ A;  3F1P A;  4PKY A;  4E04 A;  4EQ1 A;  3S7N A;  1N9N A;  3NOP C;  2FH5 A;  2NUT C;  3DBA A;  1F5M A;  4I38 A;  2Y79 A;  4WL9 A;  3F1P B;  2EWW A;  2HF6 A;  3FG8 A;  5DF9 A;  3MR0 A;  3H9W A;  2M7U A;  4KUO A;  1XJ6 A;  2W1T B;  5DKL A;  5IU1 A;  2D01 A;  3CAX A;  2V9A A;  2W3H A;  4DJ3 A;  4IHQ A;  1UGU A;  1OTB A;  1DRM A;  1X0O A;  5F6A A;  2K31 A;  4HNB A;  2M7V A;  5LBR A;  3FPW A;  2VLG A;  1OTA A;  5AJG A;  4MN7 A;  4HJ3 A;  3UB8 A;  4O8G A;  3V67 A;  3OOV A;  2GJ3 A;  3T4S A;  4B9O A;  2WKQ A;  3BY9 A;  2O9B A;  3IBR A;  4CLC D;  3HJI A;  2BAS A;  3B33 A;  3OBF A;  2HV1 A;  1TS0 A;  4CLC C;  3KO6 A;  4GJ4 A;  4G3K A;  3MJQ A;  2V1B A;  3A0V A;  3F1O A;  4I3J A;  4L9G A;  2H28 A;  3EQV A;  2JKR M;  1T1B A;  4ME4 A;  2VV6 A;  4HH3 A;  4UQI M;  3S7O A;  2XSS A;  3F1O B;  3CUE C;  1P97 A;  4WEL A;  2Z6D A;  1YKD A;  3OCL A;  2VGL M;  4Q0J A;  3LUQ A;  4LRX C;  3PR6 A;  2XA7 M;  3F1N A;  3LFV A;  3PBS A;  4O01 A;  3T4L A;  4WEK A;  1P9W A;  4EES A;  1DP8 A;  3TE8 A;  3MQ0 A;  3PYP A;  1V9Y A;  1OTE A;  4WN5 A;  3F1N B;  4Q0H A;  4M4X A;  5F5Y A;  2I9V A;  1KOU A;  2A24 B;  3ZYT A;  4EXO A;  3BY8 A;  3LIF A;  5AVE A;  3BQ8 A;  4IJG A;  3TRC A;  2O0Y A;  1XJ3 A;  5HDS A;  4KQD A;  2WKP A;  3EOI A;  4Q0I A;  4O0P A;  1D06 A;  2WKR A;  3C8C A;  1YAX A;  2KOI A;  2J3W A;  2ZMV A;  4EER A;  4F3L B;  3HCY A;  3PBQ A;  1NWZ A;  4BBV A;  3P7N A;  4MN6 A;  2B18 A;  3KSI A;  4IUK A;  2YKH A;  1W63 Q;  2PD8 A;  3MQO A;  4PAU A;  4YNR A;  2G7U A;  3KSH A;  2GNX A;  3EGX C;  1YSQ A;  1EW0 A;  3K3C A;  4NXB A;  2ZMF A;  1IFQ A;  1BYW A;  2VX8 A;  3PBN A;  3KYQ A;  4Y3I A;  2KX6 A;  1OJG A;  3W2Z A;  4BBT A;  4LPZ A;  3NOT C;  2W1R A;  5HD5 A;  3E4Q A;  3E0Y A;  3HJK A;  4GLQ A;  3LR0 A;  3NHQ A;  1XFQ A;  3A0S A;  2B02 A;  4R3A A;  1N9O A;  3TW8 A;  2QJ7 A;  2HJE A;  3PBO A;  2Y8H A;  3PBR A;  4YWZ A;  4NEE D;  2XRN A;  2W3E A;  3H82 A;  2W27 A;  3MXQ A;  5IT5 A;  4OOM A;  5G4Z A;  3UE3 A;  5CX7 A;  2M1C A;  3RFB A;  1LT0 A;  4BJP A;  3PHY A;  5DJT A;  4WF0 A;  1Y28 A;  5KIZ A;  5I5L A;  3A0R A;  2CMN A;  2ZOI A;  3GDI A;  4CLC A;  2MJ6 A;  5HDC A;  5J4E A;  4QPR A;  2EA9 A;  1S4S A;  4EW7 A;  4WEJ A;  3R4K A;  2PHY A;  1F98 A;  2VV8 A;  4KUK A;  3B42 A;  1TD5 A;  3C30 A;  5HWT A;  2J80 A;  5HZH A;  4ZRR A;  3D3O A;  3CUE A;  3LI8 A;  5HPI A;  3EEA A;  2DMW A;  1UWP X;  2K7S A;  3B47 A;  1H8M A;  5A8B A;  4HOI A;  5MC7 A;  4JGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...