3KSGA

Structure of frmsr of staphylococcus aureus (complex with substrate)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
153
structure length
153
Chain Sequence
TTINPTNYTLLKKQAASLIEDEHHMIAILSNMSALLNDNLDQINWVGFYLLEQNELILGPFQGHPASVHIPIGKGVCGTAVSERRTQVVADVHQFKGHIACDANSKSEIVVPIFKDDKIIGVLDIDAPITDRFDDNDKEHLEAIVKIIEKQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of fRMsr of Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein
total genus 43
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2009-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ksgA00
3E0YA 4FOFA 3IBJA 2VEAA 4ETZA 3IBRA 3D3OA 3TRCA 2GX5A 4ME4A 3NOTC 3LFVA 2Y79A 2W3EA 4MCWA 1YKDA 2VZWA 2O9CA 2O9AA 3C2WA 4IJGA 3W2ZA 3OOVA 5I5LA 2HGVA 2XRNA 5HSQA 3OBFA 3S7NA 5HPIA 5DFYA 4GW9A 4G3VA 3ZQ5A 3E98A 4EU0A 4ETXA 3HCYA 1ZTUA 4DN0A 4Q0JA 4YOFA 1VHMA 4MMNA 3BJNA 2M7UA 4Y3IA 2K2NA 4RQ9A 3DBAA 2W3DA 4Z1WA 4GLQA 4IUHA 2OOLA 5L8MA 4MDZA 2ZMFA 4LRXC 2XSSA 1F5MA 4EUVA 4IUKA 2KLIA 2W1TB 5TJJA 3KSHA 3R4KA 4MN7A 4R6LA 5LBRA 2IA2A 2Y8HA 2B18A 4DMZA 4LRYC 4O0PA 3MF0A 2O9BA 4O01A 3MMHA 3NOPC 1MKMA 4O8GA 2W3FA 3S7QA 5AJGA 4PAUA 3CI6A 2W1TA 1STZA 1YSPA 2VJWA 2O99A 4BWIA 4CQHA 3MQ0A 3NHQA 5DFXA 1TF1A 1TD5A 2KOIA 3S7OA 4LRZE 2M7VA 4R70A 1MC0A 3VV4A 3CITA 3KSFA 3EEAA 3S7PA 4E04A 2LB5A 3G6OA 3KSGA 4Y2FA 2K31A 4Q0HA 4YNRA 2XROA 3K2NA 3RFBA 3NOUC 4QPRA 2VKSA 3O5YA 2O0YA 1YSQA 3KO6A 2W3HA 4G3WA 5C5KA 4Y5FA 2G7UA 5HL6A 4ZRRA 3KSIA 2W3GA 5HPFA 2LB9A 4Q0IA 5K5BA 4G3KA 2QYBA 2W1RA
chains in the Genus database with same CATH superfamily
1JWZA 1G68A 1SKOB 4R3JA 2V8FA 1K55C 3WS1A 3W4OA 4HH3A 1S66L 1GHMA 4WZ4A 1LSVA 2O9CA 4MBFA 1ES5A 3OOVA 3IWIA 5HPIA 3WWXA 1S67L 3UB6A 3QP2A 2Y2OA 3E98A 5IS1A 3CUEC 1L2SA 4ETXA 1ZTUA 5CERA 5HAIA 1LI0A 3HLEA 3ZG8B 1WYBA 1DJBA 5E2FA 2W0NA 1SDEA 5IT5A 4KQOA 2E8IA 3OPRA 3NDEA 2GZAA 2IWDA 3MZEA 3M6HA 1NY0A 2QJ7A 4DMZA 1CF0A 2ZQ8A 1W5DA 4EBLA 2J3WA 3SH8A 1CEFA 1JWPA 4BD1A 3EQUA 1VQQA 5I94A 1IELA 3HLCA 2O99A 4BWIA 1XGIA 4HH2A 5F1FA 4LRZE 4QB8A 5F82A 1L0DA 1SCWA 1K56D 3HREA 3NULA 3IXBA 3C7UA 3HL9A 2R9WA 4PHTA 5M1AA 5L09A 3BFDA 1N9OA 2JHEA 4OPQA 3S1YA 4S2JA 3JVUA 3T1XA 3IH9A 2V20A 4GOGA 3GDIA 3VP0A 3LI9A 4X53A 1KE4A 2ZLYA 4C75A 4L9GA 5J7EA 1RCJA 1HLUP 2DNSA 2EFXA 1G6AA 5EVIC 1P9WA 4NXGA 3JVVA 4DRTA 4LV0A 2UWXA 3OPHA 2HV1A 3B47A 2VGLM 4WZ5C 5HW3A 3UPNA 4B88A 1QMEA 1TDLA 2W3DA 1GHIA 1GSXA 5EOOA 1MZUA 3P7NA 1YAXA 4EUVA 5EFWA 3BECA 5LBRA 5F1GA 4L9EA 2V9AA 1CK3A 1LL9A 1OTAA 3HJKA 2XEPA 5FI7A 3ZFZA 3T4KA 2EX8A 5AJGA 4EEUA 1GCEA 4KG2A 3W4QA 1XA7A 2P04A 3D9YA 4KZ9A 5G18A 2ZM2A 1PZPA 1E3UA 1MKIA 2C6WB 3RXXA 2ZBBA 1E3UD 3KSFA 1ODVA 2JE5A 3SOIA 2GNXA 3P01A 4AFIA 2V8CA 1K0KA 3NOUC 4PM6A 2H28A 2VKSA 4GS9B 3QP1A 5E2GA 5TR7A 4Y7PA 1XPBA 2OWJA 1U60A 3QP4A 4B4XA 2EXAA 4H6JB 4R1GA 3D3OA 1W63Q 3QP6A 1H5XA 1BZAA 2Y79A 4LLOB 4EEPA 3MZDA 4WYYA 4PKYA 3MKEA 5FA7A 4EU0A 4I38A 3A3DA 2QWSA 2M7UA 3UE6A 4Y3IA 3WS4A 4HI4A 3GMWA 3EGXC 2PU4A 1PI5A 5F83A 3QNCA 3Q81A 1Y28A 5DKLA 1F5MA 1SHVA 3BY9A 3VSKA 1OTBA 3VP1A 4LV2A 3LR3A 5HD5A 2A2LA 1XX2A 1K56A 4OPYA 1BLHA 2P9VB 3DTKA 5CEDA 2ZQDA 3VFHA 3CG5A 4JPMA 3AGDA 1S6RA 1YLTA 3VOYA 2BG1A 3G35A 5FI2A 3N8LA 3BFEA 1N9NA 3A3IA 3IT9A 3HJIA 3TE8A 5FL3A 2ZC6B 4JGQA 3PHYA 3S7PA 4UEYA 2Z6DA 1P97A 1BULA 3T4OA 3FV7A 2JKRI 3MQQA 2PDRA 4XT2B 4Y2FA 4Q0HA 4I5SA 4BBVA 1ZC2A 1KVMA 2WYXA 5AQAA 4BQMA 4GNUA 3VFFA 3FPWA 4WZ5A 4EV4A 3TW8A 1K4EA 3NY4A 4WMCD 3G34A 2RCXA 5HWTA 2QYBA 2W1RA 1M40A 4NK3A 2ZC7A 4FOFA 3IXDA 3IS2B 2QJ5A 2Y2MA 1IKGA 1CQAA 2VEAA 3IBRA 2WZXA 1YLYA 4UA6A 2X01A 1H8ZA 5EM1A 4JF4A 2JC7A 4JLFA 1RGYA 2R9XA 4DE3A 4UHUA 2XFSA 2Y4AA 3OC2A 4BENA 1PWDA 4OOYA 3A3EA 4OPRA 1PRQA 4GLQA 4EQIA 3P09A 2XSSA 3PBNA 4BLMA 4P6ZM 2EFUA 2XD5A 1ZKJA 4MN7A 4WBGA 1JVJA 4HESA 5M19A 3A0VA 2ZC5B 2WKEA 4LCMA 3EEHA 1D06A 3A3FA 5F5YA 2EWVA 2EA9A 1JNUA 3ZGAB 4YWZA 3NHQA 1OJ5A 5F68A 5AQ7A 4EBPA 1WYCA 3E4QA 4R4SA 5JYOA 3CZDA 3G6OA 3GV9A 1E25A 3CHWP 1PI4A 5FQ9A 4L0LA 4OQGA 2B5RA 5CHUA 4HJ4A 3FYZA 3RXWA 3PXPA 2CC1A 3LCEA 1D1JA 4QY5A 2PD7A 3CMZA 5TFQA 2EWWA 3V39A 5EVLA 4RX2A 3UE1A 4X6TA 2H10A 4PM8A 3IX8A 4IJGA 2E8JA 1JWVA 4L9FA 2IWBA 3C5AA 2ZL1B 3ZQ5A 3HBRA 3F1OA 3LR5A 2YKHA 2J9PA 2Y2GA 5A91A 5DF8A 4LV1A 1P0ZA 5EVIA 1BT5A 3H82B 3LEZA 1XJ4A 5KSCA 5FAOA 1AWIA 3BFFA 4R6LA 4NETA 5DJUA 1DP8A 4LRYC 3DWZA 3MF0A 3DW0A 4Y13A 3R7WA 3S7QA 2W1TA 1O7EA 3UN7A 3T4SA 1Y54A 5HFOA 3SS3A 5KMWA 2BLSA 4EUZA 3HVFA 2OWHA 2L4RA 1YLWA 3E4PA 3BYDA 3OLOA 1G28A 2I9VA 4I3JA 4YINA 3C4OA 1DJAA 2A24A 4IVIA 4BMWA 4I39A 1OTIA 4XT2A 5DKKA 1MBLA 1ZG4A 2ZM8A 5HL6A 2W3GA 5AVEA 1VB6A 2LB9A 2JKFA 2WKIA 2I72A 3GTCA 3E0YA 1A0KA 4X25A 3HUNA 4K91A 4KUKA 4ETZA 2J3TD 1PWGA 3BM6A 3LFVA 3SH7A 5EVIB 3ZVWA 1SDNA 4X1MA 2VV6A 4P87A 3FC7A 4QU3A 5I5LA 2ZC4B 2HGVA 2C5WB 4S2NA 3UDFA 2ACGA 3IXGA 4OQHA 4MMNA 1Z09A 3QHYA 3PAGA 3GR2A 1LI9A 3LO7A 4QY6A 2XD1A 5DF7A 4IHQA 1KVLA 1IYSA 4MDZA 3BLSA 1VEUB 3BW6A 3UB9A 2J3TC 2A24B 4A5RA 1MKMA 2JBFA 2OLUA 2JKTM 3HUMA 4PM7A 3LIAA 4EBNA 5GLAA 2JKTI 4CLCB 4B4ZA 1EW0A 4OPZA 4RA7A 3OCNA 4C3QA 3ICYA 3A3JA 4ZJ2A 3AGFA 2KOIA 4RVAA 3KYQA 4EERA 2AVXA 4YNRA 4KQRA 1D7EA 4DF6A 3UY6A 2EX2A 3IS2A 3VP4A 3ZG0A 3IH8A 5CXWA 5J4EA 1JTDA 1XXMA 2VGLS 1OT9A 4EXOA 3N6IA 1PWCA 4OKPA 3VOLA 2W3EA 5GLDA 3T1SA 2O9AA 2V0WA 5GL9A 3W4PA 3OBFA 1LL8A 2Z2LB 4N1HA 3B33A 2P9VA 5FQMA 2ZL1A 4GB7A 5GLCA 1PYYA 1L0GA 2WAEA 2V1AA 3DTEA 3WRTA 1ESUA 4RQ9A 3WS5A 1TS8A 4HIAA 4PM9A 2G2UA 1XJ6A 5EVID 1IEMA 2DRWA 1S0WA 4HHDA 3ZCZA 3TOIA 3IX3A 4N1XA 4X55A 3BRMA 4S2NC 4HNBA 4O7DA 3ULFA 1NRJA 2Y2KA 2WKHA 4FD8A 4KG5A 1XP4A 3O87A 4LV3A 3H82A 3RTYA 1XJ2A 3ZDJA 2V0UA 2GDNA 1FR1A 2J80A 4R3BA 3S22A 3V3SA 2M7VA 3VV4A 3G30A 1LHYA 1GSWA 3N7WA 5G4YA 3SW1A 2FFYA 3NCKA 3IF5A 3PR6A 2XQZA 2O0YA 4BBTA 5C5KA 2L1MA 3BY8A 4S2LA 2DMWA 4Q0IA 4G3KA 4E3IA 5FAPA 3NECA 3T50A 1FIKA 4HQAA 4KZ6A 3SH9A 4C6YA 3ZVTA 2VLGA 4K08A 1C3BA 4ME4A 3WS2A 1DP6A 1BLCA 3MSHA 2RL3A 3TSGA 4NKPA 4P6ZS 4S2PA 3HLDA 1XFNA 2UV0E 4U0TA 3MS6A 3IF6C 1TDGA 2VV7A 3LYXA 4UAAA 4ARZB 3C38A 1EROA 3T4QA 4P85A 1F98A 4E3KA 1T1BA 4WLAA 2P7JA 3TJZC 1MWTA 5CTMA 3GECA 4KQDA 5KSHA 4IBXA 4JGPA 2QPNA 4KQQA 5E43A 4FTXA 1E4DA 2PR5A 1MPLA 1XA1A 1FCOA 4EWFA 4GHIB 2ZQCA 5A93A 1KE0A 1Q2PA 1YMXA 2HP5A 5E2HA 1WE4A 3FKVA 2H0YA 4BL3A 1ONHA 4WF0A 4CJNA 3MXQA 3P98A 4EQ1A 3BQ8A 5CECA 3DWKA 3MQ0A 4HBUA 3WS0A 4JF6A 2NUPC 3UNWA 3V67A 3IWOA 5AVFA 1BLPA 3KSGA 2K31A 3MJQA 5EVEA 1NRFA 2CMNA 4E3MA 3HLGA 3OPPA 3LR4A 1OPXA 1FCNA 2W3HA 1OTEA 4HP9A 3ITBA 1KGEA 5FASA 4MN5A 5FDHA 1MXOA 2HP9A 5DVAA 1DJCA 5EV0A 1UGUA 1DY6A 5F69A 4Y15A 4F3LA 3SS5A 3UPPA 4KZ5A 5HX9A 3M2KA 3OZHA 1NYYA 4GD6A 3IF6B 5DF9A 1ERQA 1ES3A 3D72A 3T4TA 3VP3A 3CAXA 2XRNA 4JGOA 2WKRA 3GQZA 4PKYG 4R38A 4D2OA 5FQJA 4WUJA 5DTKA 5HDCA 5AQBA 5EUAA 4MN6A 1ZHHB 4X69A 1OMEA 2H5SA 4NXBA 4IUHA 5EM0A 2G2WA 3H7WB 2Y2NA 4EW7A 1S4RA 4XUZA 4O8GA 3PAEA 2H0TA 4DJ2A 3A0RA 3B42A 3CI6A 3H7WA 1STZA 3MXRA 4I3AA 3EGDC 3E2KA 3UMEA 4CQHA 4HJ6A 1K38A 4FCFA 4EESA 1N9LA 5FI6A 4IEDA 4ZAMA 4R70A 1MC0A 3C8CA 2Q0OA 3VE3A 1OTDA 1MWRA 1Q2QA 3BFGA 4X1LA 2HDUA 3NC8A 5U47A 4CLCD 3HLFA 3ZG9B 4QPRA 3GRJA 3Q82A 3ZHHA 4U3TA 3QP8A 3SZTA 1LSWA 3VE4A 5HWVA 2XDMA 2B02A 2WUQA 5F6AA 1XFQA 3IBJA 2INWA 1FR6A 4DXCA 4YFMA 1IKIA 2J7VA 2YKFA 4QHCA 1IFQA 2X02A 3PBOA 4H6JA 5CTNA 4GW9A 5A90A 3CWFA 3PBTA 4WMCA 2ZJ9A 4QD4A 2WAFA 4R0QA 3RH8B 2IWCA 2P08A 2K2NA 2PAVP 2WKPA 4JXGA 1EWZA 4NXEA 5CHJA 2XLNA 4FSFA 5GHXA 5A8BA 3S4XA 2Y8HA 3LY4A 4OH0A 5FEGA 4O01A 1XKZA 2EX6A 4JKTA 4X56A 4E3LA 3K3CA 1W8QA 4FUWA 3LIDA 2BASA 5CGXA 3M6BA 4PM5A 4HBTA 2XH9A 5DFXA 4JXVA 2A3UA 3DAVA 4KZ3A 3ZG5A 3NJAA 4OP5A 4ZJ3A 3NIAA 1V9YA 1I2WA 4MEZA 1HD8A 4E3JA 2ZD8A 4K0WA 3TG9A 4OLGA 1IYQA 3LIFA 5HPFA 3O3VA 2PHYA 4ZTKA 2HPBA 4OVDA 3KYEA 2QKPA 3JPUA 4NEED 5HAPA 4E6XA 4U0XA 3CPTA 3GSGA 1S4SA 2Z6CA 2JN7A 4LENA 4ESPA 1K54C 1YLZA 2ZM0A 4IVKA 4DE0A 3NOTC 2KDKA 1ACFA 2ZOHA 4MBKA 3F1PA 3ZNYA 4IBRA 1I5QA 1S1YA 4G3VA 1H8MA 1JTGA 2X71A 2WKQA 3T1RA 3MFXA 3MKFA 1FILA 2ZMAA 1GSVA 4KZ4A 4KZ7A 3DBAA 1YQSA 4MBHA 1FOFA 5HDSA 2OOLA 2WGVA 5BOHA 4LRXC 3C7VA 3OPLA 3FWLA 2W1TB 1TS0A 1NJ4A 5FQKA 2VGKA 3EQVA 1K6RA 5DTSA 3VSLA 3MBZA 2OLVA 4GDBA 5HD3A 3Q07A 4JGRA 3QNBA 5TGFA 2FFFB 2XR0A 2XA7S 1VEUA 3U2AA 1FCMA 4BD0A 4B9OA 3IHBA 3G31A 3CITA 3EEAA 3FG8A 4DDYA 3PBRA 1EI5A 1OJGA 4GDNA 2PYRA 2QZ6A 3K3DA 1G6OA 1MWUA 3UB8A 3F1NB 4PPRA 1LLBA 2NUTC 1PIOA 1GHPA 3KO6A 4JXSA 3D4FA 4LCLA 4ZRRA 2PD8A 2QMIA 2OV5A 4XUXA 4F3LB 3F1NA 2DCFA 1ONGA 1YPRA 2VK3A 1K57C 5KIZA 3ITAA 3UB7A 3FKWA 5FSRA 1QMFA 3C2WA 5HSQA 5DFYA 4HJ3A 5D3OA 3MZFA 4WEJA 3N8SA 4YOFA 2KX6A 2VGJA 4M3KA 3BJNA 3ZG7B 3G2ZA 4DXBA 4M4XA 2ZMVA 2WGIA 1K57A 5G4ZA 4NG2A 4ID4A 2J9OA 4JBFA 4MNRA 3W8KA 4IUKA 5HWWA 4UQIS 3L7HA 4QJGA 2B18A 4HEFA 1YM1A 3T1QB 3N8RA 3PTEA 1K6SA 3GVBA 3T4JA 4Y0TA 5FQQA 2XA7M 4P0MA 1RGZA 2ZC3B 1MWSA 2L0WA 5M18A 2MJ6A 2WADA 5L07A 3MR0A 2XROA 2Y2IA 3K2NA 5MC7A 1K25A 3BFCA 3NBLA 1NZOA 3UDIA 3R7WB 5E2EA 3DTIA 1FQGA 3EWKA 3LGOA 2PBYA 3VOZA 1HVBA 1W63M 2JKRM 5FEFA 1HZOA 4OOMA 2WK0A 1GA9A 2Y2PA 4KZBA 3TRCA 2GX5A 5HAQA 4QWOA 5A92A 4MCWA 1LSXA 3ZYTA 1YKDA 2R78A 4F94A 1X0OA 3A0SA 3W2ZA 3KYZA 1W79A 4E3NA 3DTMA 3S7NA 2HDSA 1UWNX 1N9BA 3HLWA 4DE1A 3V5MA 4B93A 4Q0JA 1CJFA 1CI8A 4R3AA 1H3QA 2Z2MB 3WRZA 2GJ3A 4E3OA 2V1ZA 4WN5A 4R23A 3OCLA 5GLBA 2BTFP 5EE8A 4BJPA 2KLIA 1KDWA 1W7FA 2IA2A 3O86A 1TS6A 2O9BA 4I3IA 3MMHA 2W3FA 4Y17A 3EOIA 3U4LP 4II7A 1YSPA 5J3WA 1L0EA 4WL9A 1NYMA 3PBSA 3IHAA 3G2YA 3LICA 3BEBA 2WGWA 3T12B 3UO9A 1XGJA 3H9WA 4UA9A 4Q8IA 4ZJ1A 4P6BA 4E04A 3NDGA 1BUEA 1ES4A 5HDDA 2LB5A 4OQIA 3CLOA 5CRFA 1Y4OA 3LEQA 5FAQA 1OT6A 2B95A 4FH2A 4OONA 3CPTB 1PW1A 4Y5FA 3KSIA 1NZUA 4Y0OA 2Q9NA 3CUEA 4KZAA 3LIEA 3IQAA 2D01A 4RX3A 2OAQ1 2VZWA 1VETB 3IX4A 2Y2JA 1GA0A 4ARZA 2HZ5A 1PW8A 4GHIA 1N4OA 1FSWA 1YLJA 2J8YA 3HCYA 2XK1A 4DN0A 4DE2A 1O07A 5IU1A 3BQAA 3UDXA 4N9KA 1IYOA 1W8YA 4OOLA 1CI9A 1XJ3A 2JCHA 4RYEA 3V3RA 3NI9A 4MLLA 3RJUA 4DDSA 3Q7VA 1BYWA 3FPVA 1MY8A 2VJWA 3M2JA 3MFDA 1T19A 1ESIA 3F1PB 2OAP1 1TF1A 1VM1A 2D02A 5GHYA 2JKGA 3FZCA 3E4OA 4JXWA 1T18A 5GHZA 2ZQ7A 3BWLA 3HLBA 2W27A 2VX8A 2PR6A 4KG6A 1M6KA 3C30A 3O5YA 4GN2A 1L3LA 3QP5A 5HZHA 5FDSA 5J8XA 1ZG6A 4K0XA 5HL1A 3IF6A 1T1CA 1YT4A 3HUOA 4CLCE 4D60A 4Z9QA 1J3WA 4Y0UA 1T1AA 1HTZA 1ERMA 3JYIA 1DP9A 2Y91A 3PBQA 3UPOA 2HJEA 1KGGA 1RP5A 4LGWA 4GS9A 1PNEA 4OP8A 1AXBA 4PMAA 5DJTA 3C4PA 3L9KA 1DRMA 2FZ0A 5HARA 4S2KA 1VHMA 2ZQAA 2ZQ9A 2PBDP 3CJMA 2Y2LA 1IYPA 3LI8A 2FH5A 4Z1WA 1H8YA 1UWPX 3F1OB 2ZOIA 3I7JA 3O88A 5L10A 2XF3A 4LPZA 1K54A 1SKOA 5AQ9A 5CGSA 2Y2QA 5TJJA 1S1ZA 5CGWA 3KX0X 1K4FA 3KSHA 4CLCA 3V50A 2A49A 1KDSA 4H8RA 1YMSA 4S2IA 2HF6A 5CEBA 4PAUA 4CPKA 1Z6FA 1I2SA 4N92A 3G4PA 4NXFA 4E6WA 5EPHA 1NLZA 2PT7A 5FATA 2HDQA 3UMDA 1BTLA 4OLDA 4GJ4A 3UE0A 4LFUA 1F2KA 4CLCC 1LT0A 3SS4A 5L2FA 5TBMA 4ZBEA 2OSUA 2EX9A 2P74A 2XFTA 2Q9MA 5IHVA 1SKFA 4HP4A 1ALQA 1J9MA 2VA0A 1YSQA 2PU2A 4G3WA 2G7UA 1TVFA 1LL5A 1YLPA 2HDRA 3G32A 4WEKA 4HOIA 3LIBA 4XXRA 4OQ0A 4GD8A 4GCZA 1NXYA 4R4RA 3BLMA 1TEMA 2V1BA 4X68A 1KOUA 1G5UA 2PRFA 2PYPA 1VETA 1SZVA 5EECA 4UQIM 2Y55A 4WM9A 2HP6A 1NLYA 1WA9A 3AGEA 1BSGA 1PFLA 1NWZA 1H0MA 1L0FA 4WELA 2EXBA 3IXHA 4EETB 5JYPA 4BL2A 3LY3A 4KZ8A 2WZZA 4ZDXA 4GKUA 5L8MA 3LUQA 2ZMFA 3LR0A 3B3XA 2V2FF 4S2MA 1V9ZA 5CHMA 3R4KA 4O0PA 5TBMB 5CX7A 2VV8A 3MXSA 3NOPC 1PZOA 3ZNTA 1ES2A 1P9RA 2WGWB 4JF5A 3PYPA 4KUOA 3IWQA 3Q7VB 2Y2HA 1BLSA 3N4IA 4N9LA 4FH4A 1TS7A 1IOUA 2XGNA 1TD5A 5FQIA 3UE3A 1KE3A 3S7OA 4DJ3A 4DKIA 3T4LA 1K55A 2M1CA 3VP2A 2K7SA 4S2OA 3Q1FA 3RFBA 3ISGA 3UB5P 1CEGA 4GZBA 3E2LA 4KENB 4UA7A 1F9IA 2Y59A 5EOEA 3MQOA 3Q7ZA 5DTTA 3VMAA 4BBUA 1KGFA 5KZHA 5K5BA 2HJ9C 2QHKA 4HY8A 1FSYA
chains in the Genus database with same CATH topology
2JKRM 2PD7A 4OOMA 1UGUA 5F69A 3TRCA 2GX5A 2EWWA 4F3LA 4HH3A 4MCWA 1LSXA 3ZYTA 1S66L 1YKDA 5DF9A 1LSVA 2O9CA 3D72A 3T4TA 2R78A 4IJGA 1X0OA 4MN5A 3A0SA 3W2ZA 3KYZA 3CAXA 3OOVA 2XRNA 4JGOA 4L9FA 3S7NA 2WKRA 1UWNX 5HPIA 1S67L 4PKYG 3UB6A 3ZQ5A 3E98A 5IS1A 3F1OA 4R38A 3CUEC 3LR5A 2YKHA 4ETXA 1ZTUA 4WUJA 4B93A 4Q0JA 5HDCA 4R3AA 1H3QA 2GJ3A 4MN6A 1ZHHB 4WN5A 2W0NA 5IT5A 3OCLA 4NXBA 1P0ZA 4IUHA 4KQOA 3H82B 1XJ4A 4BJPA 2GZAA 2KLIA 4R6LA 5DJUA 2QJ7A 4DMZA 2IA2A 3H7WB 1DP8A 4LRYC 1TS6A 3MF0A 4EW7A 2O9BA 4I3IA 1S4RA 2J3WA 3MMHA 3R7WA 3S7QA 4O8GA 2W3FA 3EOIA 4DJ2A 4II7A 3A0RA 3B42A 3CI6A 2W1TA 1STZA 3H7WA 1YSPA 3EQUA 5J3WA 4WL9A 4I3AA 3EGDC 3T4SA 3PBSA 3UMEA 2O99A 4BWIA 4CQHA 4HJ6A 3LICA 4EESA 2OWHA 2L4RA 4HH2A 1N9LA 3H9WA 3E4PA 4LRZE 3OLOA 1G28A 1MC0A 2I9VA 3C8CA 4I3JA 1OTDA 4R70A 3VE3A 4E04A 2A24A 5HDDA 4BMWA 4CLCD 2LB5A 3CLOA 4I39A 1OTIA 4XT2A 5DKKA 4PHTA 1N9OA 2JHEA 1OT6A 4QPRA 4Y5FA 5HL6A 1LSWA 3JVUA 3KSIA 2W3GA 5AVEA 1VB6A 3VE4A 5HWVA 2LB9A 3CUEA 2B02A 3E0YA 3GDIA 5F6AA 1XFQA 3LI9A 3IBJA 2INWA 4KUKA 4ETZA 3LIEA 4L9GA 2D01A 2J3TD 5J7EA 2YKFA 2OAQ1 3LFVA 1IFQA 2VZWA 1P9WA 4NXGA 2VV6A 4ARZA 3JVVA 3FC7A 5I5LA 3PBOA 4GHIA 4H6JA 2HGVA 2HV1A 3B47A 4GW9A 2VGLM 3CWFA 3PBTA 3HCYA 4DN0A 4MMNA 3RH8B 2P08A 2K2NA 5IU1A 3BQAA 2WKPA 2W3DA 4NXEA 4IHQA 4FSFA 1GSXA 4MDZA 1MZUA 3P7NA 1YAXA 4EUVA 4OOLA 1XJ3A 3BW6A 5EFWA 5A8BA 3UB9A 5LBRA 2J3TC 2Y8HA 4L9EA 2V9AA 4O01A 2A24B 1MKMA 1OTAA 3HJKA 3T4KA 5AJGA 2JKTM 3LIAA 4EEUA 2JKTI 3K3CA 1BYWA 3FPVA 2VJWA 3LIDA 2BASA 4CLCB 1EW0A 2P04A 1T19A 3OCNA 3ICYA 3F1PB 2OAP1 5DFXA 1TF1A 2D02A 2KOIA 3E4OA 2ZBBA 1T18A 3KSFA 3KYQA 3NJAA 4EERA 1ODVA 3BWLA 2GNXA 3P01A 1V9YA 2W27A 4YNRA 4AFIA 2VX8A 2PR6A 1D7EA 3NOUC 2H28A 2VKSA 3C30A 3O5YA 3IS2A 4GS9B 3LIFA 5HPFA 2PHYA 5HZHA 5J4EA 2QKPA 4NEED 2VGLS 1OT9A 2OWJA 1T1CA 1S4SA 4CLCE 4EXOA 2Z6CA 2JN7A 4H6JB 3D3OA 1W63Q 1T1AA 3VOLA 3NOTC 2Y79A 2W3EA 4LLOB 2KDKA 2O9AA 2V0WA 4EEPA 2ZOHA 1DP9A 3F1PA 3PBQA 2HJEA 4GS9A 3OBFA 1LL8A 1S1YA 4G3VA 5DJTA 4PKYA 3B33A 1H8MA 1DRMA 4EU0A 2FZ0A 2WKQA 4I38A 3MFXA 1VHMA 2QWSA 2M7UA 2V1AA 3UE6A 4Y3IA 1GSVA 4RQ9A 3DBAA 4HI4A 3LI8A 2FH5A 1TS8A 4HIAA 4Z1WA 1UWPX 3F1OB 2ZOIA 3EGXC 5HDSA 2OOLA 1XJ6A 4LPZA 4LRXC 1Y28A 5DKLA 1F5MA 3BY9A 1OTBA 2W1TB 1S1ZA 5TJJA 3LR3A 3KX0X 5HD5A 3KSHA 1TS0A 2A2LA 4HHDA 4CLCA 3EQVA 4HNBA 2HF6A 3ULFA 1NRJA 4PAUA 5HD3A 4JGRA 4NXFA 3H82A 3RTYA 1N9NA 1XJ2A 2XA7S 1NLZA 2PT7A 3HJIA 3U2AA 3TE8A 3UMDA 5FL3A 2V0UA 4B9OA 4GJ4A 2J80A 4JGQA 2M7VA 4CLCC 3VV4A 3CITA 1LT0A 3PHYA 3S7PA 3EEAA 1GSWA 3FG8A 5TBMA 4UEYA 2Z6DA 1P97A 5G4YA 3PBRA 1OJGA 3T4OA 2JKRI 3SW1A 3MQQA 2PYRA 2PDRA 3K3DA 4XT2B 4Y2FA 1G6OA 4Q0HA 4I5SA 4BBVA 4HP4A 3UB8A 3F1NB 3PR6A 2NUTC 3FPWA 2VA0A 2O0YA 4BBTA 1YSQA 3TW8A 3KO6A 5C5KA 4G3WA 2G7UA 2L1MA 3BY8A 4ZRRA 2DMWA 2PD8A 4WEKA 4Q0IA 5HWTA 4F3LB 4G3KA 4HOIA 3LIBA 3F1NA 2QYBA 2W1RA 4FOFA 3IS2B 4GCZA 4HQAA 3T50A 2QJ5A 2VEAA 3IBRA 2VLGA 4K08A 4ME4A 1DP6A 5KIZA 3UB7A 2V1BA 1KOUA 2PYPA 3C2WA 4NKPA 4P6ZS 4UQIM 5HSQA 1XFNA 5DFYA 1NLYA 1WA9A 4HJ3A 1NWZA 3OC2A 4WEJA 4WELA 2VV7A 4YOFA 4EETB 2KX6A 3LYXA 3BJNA 4ARZB 3C38A 4M4XA 3T4QA 2ZMVA 5G4ZA 1F98A 1T1BA 4WLAA 2P7JA 4GLQA 5L8MA 3TJZC 3LUQA 2ZMFA 3GECA 2XSSA 3LR0A 3PBNA 4IUKA 5HWWA 4KQDA 5KSHA 4P6ZM 4UQIS 4JGPA 1V9ZA 3R4KA 4MN7A 2B18A 4O0PA 2PR5A 5TBMB 5CX7A 2VV8A 3NOPC 4GHIB 3A0VA 1P9RA 3T4JA 3PYPA 3EEHA 1D06A 4KUOA 5F5YA 2EWVA 2XA7M 4WF0A 2EA9A 1JNUA 3MXQA 4EQ1A 3BQ8A 3MQ0A 4YWZA 3NHQA 1OJ5A 1TS7A 5F68A 1IOUA 1TD5A 3UE3A 3S7OA 4DJ3A 2NUPC 2L0WA 3T4LA 3V67A 3E4QA 5AVFA 2MJ6A 2M1CA 3G6OA 2K7SA 3KSGA 2K31A 3MR0A 3MJQA 2XROA 3K2NA 3RFBA 5MC7A 2CMNA 1F9IA 3LR4A 1OPXA 3R7WB 3MQOA 2W3HA 4L0LA 3EWKA 1OTEA 4BBUA 4HP9A 4HJ4A 5K5BA 2HJ9C 2QHKA 1W63M 3PXPA 4HY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E0Y A;  4FOF A;  3IBJ A;  2VEA A;  4ETZ A;  3IBR A;  3D3O A;  3TRC A;  2GX5 A;  4ME4 A;  3NOT C;  3LFV A;  2Y79 A;  2W3E A;  4MCW A;  1YKD A;  2VZW A;  2O9C A;  2O9A A;  3C2W A;  4IJG A;  3W2Z A;  3OOV A;  5I5L A;  2HGV A;  2XRN A;  5HSQ A;  3OBF A;  3S7N A;  5HPI A;  5DFY A;  4GW9 A;  4G3V A;  3ZQ5 A;  3E98 A;  4EU0 A;  4ETX A;  3HCY A;  1ZTU A;  4DN0 A;  4Q0J A;  4YOF A;  1VHM A;  4MMN A;  3BJN A;  2M7U A;  4Y3I A;  2K2N A;  4RQ9 A;  3DBA A;  2W3D A;  4Z1W A;  4GLQ A;  4IUH A;  2OOL A;  5L8M A;  4MDZ A;  2ZMF A;  4LRX C;  2XSS A;  1F5M A;  4EUV A;  4IUK A;  2KLI A;  2W1T B;  5TJJ A;  3KSH A;  3R4K A;  4MN7 A;  4R6L A;  5LBR A;  2IA2 A;  2Y8H A;  2B18 A;  4DMZ A;  4LRY C;  4O0P A;  3MF0 A;  2O9B A;  4O01 A;  3MMH A;  3NOP C;  1MKM A;  4O8G A;  2W3F A;  3S7Q A;  5AJG A;  4PAU A;  3CI6 A;  2W1T A;  1STZ A;  1YSP A;  2VJW A;  2O99 A;  4BWI A;  4CQH A;  3MQ0 A;  3NHQ A;  5DFX A;  1TF1 A;  1TD5 A;  2KOI A;  3S7O A;  4LRZ E;  2M7V A;  4R70 A;  1MC0 A;  3VV4 A;  3CIT A;  3KSF A;  3EEA A;  3S7P A;  4E04 A;  2LB5 A;  3G6O A;  3KSG A;  4Y2F A;  2K31 A;  4Q0H A;  4YNR A;  2XRO A;  3K2N A;  3RFB A;  3NOU C;  4QPR A;  2VKS A;  3O5Y A;  2O0Y A;  1YSQ A;  3KO6 A;  2W3H A;  4G3W A;  5C5K A;  4Y5F A;  2G7U A;  5HL6 A;  4ZRR A;  3KSI A;  2W3G A;  5HPF A;  2LB9 A;  4Q0I A;  5K5B A;  4G3K A;  2QYB A;  2W1R A; 
#chains in the Genus database with same CATH topology
 1JWZ A;  1G68 A;  1SKO B;  4R3J A;  2V8F A;  1K55 C;  3WS1 A;  3W4O A;  4HH3 A;  1S66 L;  1GHM A;  4WZ4 A;  1LSV A;  2O9C A;  4MBF A;  1ES5 A;  3OOV A;  3IWI A;  5HPI A;  3WWX A;  1S67 L;  3UB6 A;  3QP2 A;  2Y2O A;  3E98 A;  5IS1 A;  3CUE C;  1L2S A;  4ETX A;  1ZTU A;  5CER A;  5HAI A;  1LI0 A;  3HLE A;  3ZG8 B;  1WYB A;  1DJB A;  5E2F A;  2W0N A;  1SDE A;  5IT5 A;  4KQO A;  2E8I A;  3OPR A;  3NDE A;  2GZA A;  2IWD A;  3MZE A;  3M6H A;  1NY0 A;  2QJ7 A;  4DMZ A;  1CF0 A;  2ZQ8 A;  1W5D A;  4EBL A;  2J3W A;  3SH8 A;  1CEF A;  1JWP A;  4BD1 A;  3EQU A;  1VQQ A;  5I94 A;  1IEL A;  3HLC A;  2O99 A;  4BWI A;  1XGI A;  4HH2 A;  5F1F A;  4LRZ E;  4QB8 A;  5F82 A;  1L0D A;  1SCW A;  1K56 D;  3HRE A;  3NUL A;  3IXB A;  3C7U A;  3HL9 A;  2R9W A;  4PHT A;  5M1A A;  5L09 A;  3BFD A;  1N9O A;  2JHE A;  4OPQ A;  3S1Y A;  4S2J A;  3JVU A;  3T1X A;  3IH9 A;  2V20 A;  4GOG A;  3GDI A;  3VP0 A;  3LI9 A;  4X53 A;  1KE4 A;  2ZLY A;  4C75 A;  4L9G A;  5J7E A;  1RCJ A;  1HLU P;  2DNS A;  2EFX A;  1G6A A;  5EVI C;  1P9W A;  4NXG A;  3JVV A;  4DRT A;  4LV0 A;  2UWX A;  3OPH A;  2HV1 A;  3B47 A;  2VGL M;  4WZ5 C;  5HW3 A;  3UPN A;  4B88 A;  1QME A;  1TDL A;  2W3D A;  1GHI A;  1GSX A;  5EOO A;  1MZU A;  3P7N A;  1YAX A;  4EUV A;  5EFW A;  3BEC A;  5LBR A;  5F1G A;  4L9E A;  2V9A A;  1CK3 A;  1LL9 A;  1OTA A;  3HJK A;  2XEP A;  5FI7 A;  3ZFZ A;  3T4K A;  2EX8 A;  5AJG A;  4EEU A;  1GCE A;  4KG2 A;  3W4Q A;  1XA7 A;  2P04 A;  3D9Y A;  4KZ9 A;  5G18 A;  2ZM2 A;  1PZP A;  1E3U A;  1MKI A;  2C6W B;  3RXX A;  2ZBB A;  1E3U D;  3KSF A;  1ODV A;  2JE5 A;  3SOI A;  2GNX A;  3P01 A;  4AFI A;  2V8C A;  1K0K A;  3NOU C;  4PM6 A;  2H28 A;  2VKS A;  4GS9 B;  3QP1 A;  5E2G A;  5TR7 A;  4Y7P A;  1XPB A;  2OWJ A;  1U60 A;  3QP4 A;  4B4X A;  2EXA A;  4H6J B;  4R1G A;  3D3O A;  1W63 Q;  3QP6 A;  1H5X A;  1BZA A;  2Y79 A;  4LLO B;  4EEP A;  3MZD A;  4WYY A;  4PKY A;  3MKE A;  5FA7 A;  4EU0 A;  4I38 A;  3A3D A;  2QWS A;  2M7U A;  3UE6 A;  4Y3I A;  3WS4 A;  4HI4 A;  3GMW A;  3EGX C;  2PU4 A;  1PI5 A;  5F83 A;  3QNC A;  3Q81 A;  1Y28 A;  5DKL A;  1F5M A;  1SHV A;  3BY9 A;  3VSK A;  1OTB A;  3VP1 A;  4LV2 A;  3LR3 A;  5HD5 A;  2A2L A;  1XX2 A;  1K56 A;  4OPY A;  1BLH A;  2P9V B;  3DTK A;  5CED A;  2ZQD A;  3VFH A;  3CG5 A;  4JPM A;  3AGD A;  1S6R A;  1YLT A;  3VOY A;  2BG1 A;  3G35 A;  5FI2 A;  3N8L A;  3BFE A;  1N9N A;  3A3I A;  3IT9 A;  3HJI A;  3TE8 A;  5FL3 A;  2ZC6 B;  4JGQ A;  3PHY A;  3S7P A;  4UEY A;  2Z6D A;  1P97 A;  1BUL A;  3T4O A;  3FV7 A;  2JKR I;  3MQQ A;  2PDR A;  4XT2 B;  4Y2F A;  4Q0H A;  4I5S A;  4BBV A;  1ZC2 A;  1KVM A;  2WYX A;  5AQA A;  4BQM A;  4GNU A;  3VFF A;  3FPW A;  4WZ5 A;  4EV4 A;  3TW8 A;  1K4E A;  3NY4 A;  4WMC D;  3G34 A;  2RCX A;  5HWT A;  2QYB A;  2W1R A;  1M40 A;  4NK3 A;  2ZC7 A;  4FOF A;  3IXD A;  3IS2 B;  2QJ5 A;  2Y2M A;  1IKG A;  1CQA A;  2VEA A;  3IBR A;  2WZX A;  1YLY A;  4UA6 A;  2X01 A;  1H8Z A;  5EM1 A;  4JF4 A;  2JC7 A;  4JLF A;  1RGY A;  2R9X A;  4DE3 A;  4UHU A;  2XFS A;  2Y4A A;  3OC2 A;  4BEN A;  1PWD A;  4OOY A;  3A3E A;  4OPR A;  1PRQ A;  4GLQ A;  4EQI A;  3P09 A;  2XSS A;  3PBN A;  4BLM A;  4P6Z M;  2EFU A;  2XD5 A;  1ZKJ A;  4MN7 A;  4WBG A;  1JVJ A;  4HES A;  5M19 A;  3A0V A;  2ZC5 B;  2WKE A;  4LCM A;  3EEH A;  1D06 A;  3A3F A;  5F5Y A;  2EWV A;  2EA9 A;  1JNU A;  3ZGA B;  4YWZ A;  3NHQ A;  1OJ5 A;  5F68 A;  5AQ7 A;  4EBP A;  1WYC A;  3E4Q A;  4R4S A;  5JYO A;  3CZD A;  3G6O A;  3GV9 A;  1E25 A;  3CHW P;  1PI4 A;  5FQ9 A;  4L0L A;  4OQG A;  2B5R A;  5CHU A;  4HJ4 A;  3FYZ A;  3RXW A;  3PXP A;  2CC1 A;  3LCE A;  1D1J A;  4QY5 A;  2PD7 A;  3CMZ A;  5TFQ A;  2EWW A;  3V39 A;  5EVL A;  4RX2 A;  3UE1 A;  4X6T A;  2H10 A;  4PM8 A;  3IX8 A;  4IJG A;  2E8J A;  1JWV A;  4L9F A;  2IWB A;  3C5A A;  2ZL1 B;  3ZQ5 A;  3HBR A;  3F1O A;  3LR5 A;  2YKH A;  2J9P A;  2Y2G A;  5A91 A;  5DF8 A;  4LV1 A;  1P0Z A;  5EVI A;  1BT5 A;  3H82 B;  3LEZ A;  1XJ4 A;  5KSC A;  5FAO A;  1AWI A;  3BFF A;  4R6L A;  4NET A;  5DJU A;  1DP8 A;  4LRY C;  3DWZ A;  3MF0 A;  3DW0 A;  4Y13 A;  3R7W A;  3S7Q A;  2W1T A;  1O7E A;  3UN7 A;  3T4S A;  1Y54 A;  5HFO A;  3SS3 A;  5KMW A;  2BLS A;  4EUZ A;  3HVF A;  2OWH A;  2L4R A;  1YLW A;  3E4P A;  3BYD A;  3OLO A;  1G28 A;  2I9V A;  4I3J A;  4YIN A;  3C4O A;  1DJA A;  2A24 A;  4IVI A;  4BMW A;  4I39 A;  1OTI A;  4XT2 A;  5DKK A;  1MBL A;  1ZG4 A;  2ZM8 A;  5HL6 A;  2W3G A;  5AVE A;  1VB6 A;  2LB9 A;  2JKF A;  2WKI A;  2I72 A;  3GTC A;  3E0Y A;  1A0K A;  4X25 A;  3HUN A;  4K91 A;  4KUK A;  4ETZ A;  2J3T D;  1PWG A;  3BM6 A;  3LFV A;  3SH7 A;  5EVI B;  3ZVW A;  1SDN A;  4X1M A;  2VV6 A;  4P87 A;  3FC7 A;  4QU3 A;  5I5L A;  2ZC4 B;  2HGV A;  2C5W B;  4S2N A;  3UDF A;  2ACG A;  3IXG A;  4OQH A;  4MMN A;  1Z09 A;  3QHY A;  3PAG A;  3GR2 A;  1LI9 A;  3LO7 A;  4QY6 A;  2XD1 A;  5DF7 A;  4IHQ A;  1KVL A;  1IYS A;  4MDZ A;  3BLS A;  1VEU B;  3BW6 A;  3UB9 A;  2J3T C;  2A24 B;  4A5R A;  1MKM A;  2JBF A;  2OLU A;  2JKT M;  3HUM A;  4PM7 A;  3LIA A;  4EBN A;  5GLA A;  2JKT I;  4CLC B;  4B4Z A;  1EW0 A;  4OPZ A;  4RA7 A;  3OCN A;  4C3Q A;  3ICY A;  3A3J A;  4ZJ2 A;  3AGF A;  2KOI A;  4RVA A;  3KYQ A;  4EER A;  2AVX A;  4YNR A;  4KQR A;  1D7E A;  4DF6 A;  3UY6 A;  2EX2 A;  3IS2 A;  3VP4 A;  3ZG0 A;  3IH8 A;  5CXW A;  5J4E A;  1JTD A;  1XXM A;  2VGL S;  1OT9 A;  4EXO A;  3N6I A;  1PWC A;  4OKP A;  3VOL A;  2W3E A;  5GLD A;  3T1S A;  2O9A A;  2V0W A;  5GL9 A;  3W4P A;  3OBF A;  1LL8 A;  2Z2L B;  4N1H A;  3B33 A;  2P9V A;  5FQM A;  2ZL1 A;  4GB7 A;  5GLC A;  1PYY A;  1L0G A;  2WAE A;  2V1A A;  3DTE A;  3WRT A;  1ESU A;  4RQ9 A;  3WS5 A;  1TS8 A;  4HIA A;  4PM9 A;  2G2U A;  1XJ6 A;  5EVI D;  1IEM A;  2DRW A;  1S0W A;  4HHD A;  3ZCZ A;  3TOI A;  3IX3 A;  4N1X A;  4X55 A;  3BRM A;  4S2N C;  4HNB A;  4O7D A;  3ULF A;  1NRJ A;  2Y2K A;  2WKH A;  4FD8 A;  4KG5 A;  1XP4 A;  3O87 A;  4LV3 A;  3H82 A;  3RTY A;  1XJ2 A;  3ZDJ A;  2V0U A;  2GDN A;  1FR1 A;  2J80 A;  4R3B A;  3S22 A;  3V3S A;  2M7V A;  3VV4 A;  3G30 A;  1LHY A;  1GSW A;  3N7W A;  5G4Y A;  3SW1 A;  2FFY A;  3NCK A;  3IF5 A;  3PR6 A;  2XQZ A;  2O0Y A;  4BBT A;  5C5K A;  2L1M A;  3BY8 A;  4S2L A;  2DMW A;  4Q0I A;  4G3K A;  4E3I A;  5FAP A;  3NEC A;  3T50 A;  1FIK A;  4HQA A;  4KZ6 A;  3SH9 A;  4C6Y A;  3ZVT A;  2VLG A;  4K08 A;  1C3B A;  4ME4 A;  3WS2 A;  1DP6 A;  1BLC A;  3MSH A;  2RL3 A;  3TSG A;  4NKP A;  4P6Z S;  4S2P A;  3HLD A;  1XFN A;  2UV0 E;  4U0T A;  3MS6 A;  3IF6 C;  1TDG A;  2VV7 A;  3LYX A;  4UAA A;  4ARZ B;  3C38 A;  1ERO A;  3T4Q A;  4P85 A;  1F98 A;  4E3K A;  1T1B A;  4WLA A;  2P7J A;  3TJZ C;  1MWT A;  5CTM A;  3GEC A;  4KQD A;  5KSH A;  4IBX A;  4JGP A;  2QPN A;  4KQQ A;  5E43 A;  4FTX A;  1E4D A;  2PR5 A;  1MPL A;  1XA1 A;  1FCO A;  4EWF A;  4GHI B;  2ZQC A;  5A93 A;  1KE0 A;  1Q2P A;  1YMX A;  2HP5 A;  5E2H A;  1WE4 A;  3FKV A;  2H0Y A;  4BL3 A;  1ONH A;  4WF0 A;  4CJN A;  3MXQ A;  3P98 A;  4EQ1 A;  3BQ8 A;  5CEC A;  3DWK A;  3MQ0 A;  4HBU A;  3WS0 A;  4JF6 A;  2NUP C;  3UNW A;  3V67 A;  3IWO A;  5AVF A;  1BLP A;  3KSG A;  2K31 A;  3MJQ A;  5EVE A;  1NRF A;  2CMN A;  4E3M A;  3HLG A;  3OPP A;  3LR4 A;  1OPX A;  1FCN A;  2W3H A;  1OTE A;  4HP9 A;  3ITB A;  1KGE A;  5FAS A;  4MN5 A;  5FDH A;  1MXO A;  2HP9 A;  5DVA A;  1DJC A;  5EV0 A;  1UGU A;  1DY6 A;  5F69 A;  4Y15 A;  4F3L A;  3SS5 A;  3UPP A;  4KZ5 A;  5HX9 A;  3M2K A;  3OZH A;  1NYY A;  4GD6 A;  3IF6 B;  5DF9 A;  1ERQ A;  1ES3 A;  3D72 A;  3T4T A;  3VP3 A;  3CAX A;  2XRN A;  4JGO A;  2WKR A;  3GQZ A;  4PKY G;  4R38 A;  4D2O A;  5FQJ A;  4WUJ A;  5DTK A;  5HDC A;  5AQB A;  5EUA A;  4MN6 A;  1ZHH B;  4X69 A;  1OME A;  2H5S A;  4NXB A;  4IUH A;  5EM0 A;  2G2W A;  3H7W B;  2Y2N A;  4EW7 A;  1S4R A;  4XUZ A;  4O8G A;  3PAE A;  2H0T A;  4DJ2 A;  3A0R A;  3B42 A;  3CI6 A;  3H7W A;  1STZ A;  3MXR A;  4I3A A;  3EGD C;  3E2K A;  3UME A;  4CQH A;  4HJ6 A;  1K38 A;  4FCF A;  4EES A;  1N9L A;  5FI6 A;  4IED A;  4ZAM A;  4R70 A;  1MC0 A;  3C8C A;  2Q0O A;  3VE3 A;  1OTD A;  1MWR A;  1Q2Q A;  3BFG A;  4X1L A;  2HDU A;  3NC8 A;  5U47 A;  4CLC D;  3HLF A;  3ZG9 B;  4QPR A;  3GRJ A;  3Q82 A;  3ZHH A;  4U3T A;  3QP8 A;  3SZT A;  1LSW A;  3VE4 A;  5HWV A;  2XDM A;  2B02 A;  2WUQ A;  5F6A A;  1XFQ A;  3IBJ A;  2INW A;  1FR6 A;  4DXC A;  4YFM A;  1IKI A;  2J7V A;  2YKF A;  4QHC A;  1IFQ A;  2X02 A;  3PBO A;  4H6J A;  5CTN A;  4GW9 A;  5A90 A;  3CWF A;  3PBT A;  4WMC A;  2ZJ9 A;  4QD4 A;  2WAF A;  4R0Q A;  3RH8 B;  2IWC A;  2P08 A;  2K2N A;  2PAV P;  2WKP A;  4JXG A;  1EWZ A;  4NXE A;  5CHJ A;  2XLN A;  4FSF A;  5GHX A;  5A8B A;  3S4X A;  2Y8H A;  3LY4 A;  4OH0 A;  5FEG A;  4O01 A;  1XKZ A;  2EX6 A;  4JKT A;  4X56 A;  4E3L A;  3K3C A;  1W8Q A;  4FUW A;  3LID A;  2BAS A;  5CGX A;  3M6B A;  4PM5 A;  4HBT A;  2XH9 A;  5DFX A;  4JXV A;  2A3U A;  3DAV A;  4KZ3 A;  3ZG5 A;  3NJA A;  4OP5 A;  4ZJ3 A;  3NIA A;  1V9Y A;  1I2W A;  4MEZ A;  1HD8 A;  4E3J A;  2ZD8 A;  4K0W A;  3TG9 A;  4OLG A;  1IYQ A;  3LIF A;  5HPF A;  3O3V A;  2PHY A;  4ZTK A;  2HPB A;  4OVD A;  3KYE A;  2QKP A;  3JPU A;  4NEE D;  5HAP A;  4E6X A;  4U0X A;  3CPT A;  3GSG A;  1S4S A;  2Z6C A;  2JN7 A;  4LEN A;  4ESP A;  1K54 C;  1YLZ A;  2ZM0 A;  4IVK A;  4DE0 A;  3NOT C;  2KDK A;  1ACF A;  2ZOH A;  4MBK A;  3F1P A;  3ZNY A;  4IBR A;  1I5Q A;  1S1Y A;  4G3V A;  1H8M A;  1JTG A;  2X71 A;  2WKQ A;  3T1R A;  3MFX A;  3MKF A;  1FIL A;  2ZMA A;  1GSV A;  4KZ4 A;  4KZ7 A;  3DBA A;  1YQS A;  4MBH A;  1FOF A;  5HDS A;  2OOL A;  2WGV A;  5BOH A;  4LRX C;  3C7V A;  3OPL A;  3FWL A;  2W1T B;  1TS0 A;  1NJ4 A;  5FQK A;  2VGK A;  3EQV A;  1K6R A;  5DTS A;  3VSL A;  3MBZ A;  2OLV A;  4GDB A;  5HD3 A;  3Q07 A;  4JGR A;  3QNB A;  5TGF A;  2FFF B;  2XR0 A;  2XA7 S;  1VEU A;  3U2A A;  1FCM A;  4BD0 A;  4B9O A;  3IHB A;  3G31 A;  3CIT A;  3EEA A;  3FG8 A;  4DDY A;  3PBR A;  1EI5 A;  1OJG A;  4GDN A;  2PYR A;  2QZ6 A;  3K3D A;  1G6O A;  1MWU A;  3UB8 A;  3F1N B;  4PPR A;  1LLB A;  2NUT C;  1PIO A;  1GHP A;  3KO6 A;  4JXS A;  3D4F A;  4LCL A;  4ZRR A;  2PD8 A;  2QMI A;  2OV5 A;  4XUX A;  4F3L B;  3F1N A;  2DCF A;  1ONG A;  1YPR A;  2VK3 A;  1K57 C;  5KIZ A;  3ITA A;  3UB7 A;  3FKW A;  5FSR A;  1QMF A;  3C2W A;  5HSQ A;  5DFY A;  4HJ3 A;  5D3O A;  3MZF A;  4WEJ A;  3N8S A;  4YOF A;  2KX6 A;  2VGJ A;  4M3K A;  3BJN A;  3ZG7 B;  3G2Z A;  4DXB A;  4M4X A;  2ZMV A;  2WGI A;  1K57 A;  5G4Z A;  4NG2 A;  4ID4 A;  2J9O A;  4JBF A;  4MNR A;  3W8K A;  4IUK A;  5HWW A;  4UQI S;  3L7H A;  4QJG A;  2B18 A;  4HEF A;  1YM1 A;  3T1Q B;  3N8R A;  3PTE A;  1K6S A;  3GVB A;  3T4J A;  4Y0T A;  5FQQ A;  2XA7 M;  4P0M A;  1RGZ A;  2ZC3 B;  1MWS A;  2L0W A;  5M18 A;  2MJ6 A;  2WAD A;  5L07 A;  3MR0 A;  2XRO A;  2Y2I A;  3K2N A;  5MC7 A;  1K25 A;  3BFC A;  3NBL A;  1NZO A;  3UDI A;  3R7W B;  5E2E A;  3DTI A;  1FQG A;  3EWK A;  3LGO A;  2PBY A;  3VOZ A;  1HVB A;  1W63 M;  2JKR M;  5FEF A;  1HZO A;  4OOM A;  2WK0 A;  1GA9 A;  2Y2P A;  4KZB A;  3TRC A;  2GX5 A;  5HAQ A;  4QWO A;  5A92 A;  4MCW A;  1LSX A;  3ZYT A;  1YKD A;  2R78 A;  4F94 A;  1X0O A;  3A0S A;  3W2Z A;  3KYZ A;  1W79 A;  4E3N A;  3DTM A;  3S7N A;  2HDS A;  1UWN X;  1N9B A;  3HLW A;  4DE1 A;  3V5M A;  4B93 A;  4Q0J A;  1CJF A;  1CI8 A;  4R3A A;  1H3Q A;  2Z2M B;  3WRZ A;  2GJ3 A;  4E3O A;  2V1Z A;  4WN5 A;  4R23 A;  3OCL A;  5GLB A;  2BTF P;  5EE8 A;  4BJP A;  2KLI A;  1KDW A;  1W7F A;  2IA2 A;  3O86 A;  1TS6 A;  2O9B A;  4I3I A;  3MMH A;  2W3F A;  4Y17 A;  3EOI A;  3U4L P;  4II7 A;  1YSP A;  5J3W A;  1L0E A;  4WL9 A;  1NYM A;  3PBS A;  3IHA A;  3G2Y A;  3LIC A;  3BEB A;  2WGW A;  3T12 B;  3UO9 A;  1XGJ A;  3H9W A;  4UA9 A;  4Q8I A;  4ZJ1 A;  4P6B A;  4E04 A;  3NDG A;  1BUE A;  1ES4 A;  5HDD A;  2LB5 A;  4OQI A;  3CLO A;  5CRF A;  1Y4O A;  3LEQ A;  5FAQ A;  1OT6 A;  2B95 A;  4FH2 A;  4OON A;  3CPT B;  1PW1 A;  4Y5F A;  3KSI A;  1NZU A;  4Y0O A;  2Q9N A;  3CUE A;  4KZA A;  3LIE A;  3IQA A;  2D01 A;  4RX3 A;  2OAQ 1;  2VZW A;  1VET B;  3IX4 A;  2Y2J A;  1GA0 A;  4ARZ A;  2HZ5 A;  1PW8 A;  4GHI A;  1N4O A;  1FSW A;  1YLJ A;  2J8Y A;  3HCY A;  2XK1 A;  4DN0 A;  4DE2 A;  1O07 A;  5IU1 A;  3BQA A;  3UDX A;  4N9K A;  1IYO A;  1W8Y A;  4OOL A;  1CI9 A;  1XJ3 A;  2JCH A;  4RYE A;  3V3R A;  3NI9 A;  4MLL A;  3RJU A;  4DDS A;  3Q7V A;  1BYW A;  3FPV A;  1MY8 A;  2VJW A;  3M2J A;  3MFD A;  1T19 A;  1ESI A;  3F1P B;  2OAP 1;  1TF1 A;  1VM1 A;  2D02 A;  5GHY A;  2JKG A;  3FZC A;  3E4O A;  4JXW A;  1T18 A;  5GHZ A;  2ZQ7 A;  3BWL A;  3HLB A;  2W27 A;  2VX8 A;  2PR6 A;  4KG6 A;  1M6K A;  3C30 A;  3O5Y A;  4GN2 A;  1L3L A;  3QP5 A;  5HZH A;  5FDS A;  5J8X A;  1ZG6 A;  4K0X A;  5HL1 A;  3IF6 A;  1T1C A;  1YT4 A;  3HUO A;  4CLC E;  4D60 A;  4Z9Q A;  1J3W A;  4Y0U A;  1T1A A;  1HTZ A;  1ERM A;  3JYI A;  1DP9 A;  2Y91 A;  3PBQ A;  3UPO A;  2HJE A;  1KGG A;  1RP5 A;  4LGW A;  4GS9 A;  1PNE A;  4OP8 A;  1AXB A;  4PMA A;  5DJT A;  3C4P A;  3L9K A;  1DRM A;  2FZ0 A;  5HAR A;  4S2K A;  1VHM A;  2ZQA A;  2ZQ9 A;  2PBD P;  3CJM A;  2Y2L A;  1IYP A;  3LI8 A;  2FH5 A;  4Z1W A;  1H8Y A;  1UWP X;  3F1O B;  2ZOI A;  3I7J A;  3O88 A;  5L10 A;  2XF3 A;  4LPZ A;  1K54 A;  1SKO A;  5AQ9 A;  5CGS A;  2Y2Q A;  5TJJ A;  1S1Z A;  5CGW A;  3KX0 X;  1K4F A;  3KSH A;  4CLC A;  3V50 A;  2A49 A;  1KDS A;  4H8R A;  1YMS A;  4S2I A;  2HF6 A;  5CEB A;  4PAU A;  4CPK A;  1Z6F A;  1I2S A;  4N92 A;  3G4P A;  4NXF A;  4E6W A;  5EPH A;  1NLZ A;  2PT7 A;  5FAT A;  2HDQ A;  3UMD A;  1BTL A;  4OLD A;  4GJ4 A;  3UE0 A;  4LFU A;  1F2K A;  4CLC C;  1LT0 A;  3SS4 A;  5L2F A;  5TBM A;  4ZBE A;  2OSU A;  2EX9 A;  2P74 A;  2XFT A;  2Q9M A;  5IHV A;  1SKF A;  4HP4 A;  1ALQ A;  1J9M A;  2VA0 A;  1YSQ A;  2PU2 A;  4G3W A;  2G7U A;  1TVF A;  1LL5 A;  1YLP A;  2HDR A;  3G32 A;  4WEK A;  4HOI A;  3LIB A;  4XXR A;  4OQ0 A;  4GD8 A;  4GCZ A;  1NXY A;  4R4R A;  3BLM A;  1TEM A;  2V1B A;  4X68 A;  1KOU A;  1G5U A;  2PRF A;  2PYP A;  1VET A;  1SZV A;  5EEC A;  4UQI M;  2Y55 A;  4WM9 A;  2HP6 A;  1NLY A;  1WA9 A;  3AGE A;  1BSG A;  1PFL A;  1NWZ A;  1H0M A;  1L0F A;  4WEL A;  2EXB A;  3IXH A;  4EET B;  5JYP A;  4BL2 A;  3LY3 A;  4KZ8 A;  2WZZ A;  4ZDX A;  4GKU A;  5L8M A;  3LUQ A;  2ZMF A;  3LR0 A;  3B3X A;  2V2F F;  4S2M A;  1V9Z A;  5CHM A;  3R4K A;  4O0P A;  5TBM B;  5CX7 A;  2VV8 A;  3MXS A;  3NOP C;  1PZO A;  3ZNT A;  1ES2 A;  1P9R A;  2WGW B;  4JF5 A;  3PYP A;  4KUO A;  3IWQ A;  3Q7V B;  2Y2H A;  1BLS A;  3N4I A;  4N9L A;  4FH4 A;  1TS7 A;  1IOU A;  2XGN A;  1TD5 A;  5FQI A;  3UE3 A;  1KE3 A;  3S7O A;  4DJ3 A;  4DKI A;  3T4L A;  1K55 A;  2M1C A;  3VP2 A;  2K7S A;  4S2O A;  3Q1F A;  3RFB A;  3ISG A;  3UB5 P;  1CEG A;  4GZB A;  3E2L A;  4KEN B;  4UA7 A;  1F9I A;  2Y59 A;  5EOE A;  3MQO A;  3Q7Z A;  5DTT A;  3VMA A;  4BBU A;  1KGF A;  5KZH A;  5K5B A;  2HJ9 C;  2QHK A;  4HY8 A;  1FSY A; 
#chains in the Genus database with same CATH homology
 2JKR M;  2PD7 A;  4OOM A;  1UGU A;  5F69 A;  3TRC A;  2GX5 A;  2EWW A;  4F3L A;  4HH3 A;  4MCW A;  1LSX A;  3ZYT A;  1S66 L;  1YKD A;  5DF9 A;  1LSV A;  2O9C A;  3D72 A;  3T4T A;  2R78 A;  4IJG A;  1X0O A;  4MN5 A;  3A0S A;  3W2Z A;  3KYZ A;  3CAX A;  3OOV A;  2XRN A;  4JGO A;  4L9F A;  3S7N A;  2WKR A;  1UWN X;  5HPI A;  1S67 L;  4PKY G;  3UB6 A;  3ZQ5 A;  3E98 A;  5IS1 A;  3F1O A;  4R38 A;  3CUE C;  3LR5 A;  2YKH A;  4ETX A;  1ZTU A;  4WUJ A;  4B93 A;  4Q0J A;  5HDC A;  4R3A A;  1H3Q A;  2GJ3 A;  4MN6 A;  1ZHH B;  4WN5 A;  2W0N A;  5IT5 A;  3OCL A;  4NXB A;  1P0Z A;  4IUH A;  4KQO A;  3H82 B;  1XJ4 A;  4BJP A;  2GZA A;  2KLI A;  4R6L A;  5DJU A;  2QJ7 A;  4DMZ A;  2IA2 A;  3H7W B;  1DP8 A;  4LRY C;  1TS6 A;  3MF0 A;  4EW7 A;  2O9B A;  4I3I A;  1S4R A;  2J3W A;  3MMH A;  3R7W A;  3S7Q A;  4O8G A;  2W3F A;  3EOI A;  4DJ2 A;  4II7 A;  3A0R A;  3B42 A;  3CI6 A;  2W1T A;  1STZ A;  3H7W A;  1YSP A;  3EQU A;  5J3W A;  4WL9 A;  4I3A A;  3EGD C;  3T4S A;  3PBS A;  3UME A;  2O99 A;  4BWI A;  4CQH A;  4HJ6 A;  3LIC A;  4EES A;  2OWH A;  2L4R A;  4HH2 A;  1N9L A;  3H9W A;  3E4P A;  4LRZ E;  3OLO A;  1G28 A;  1MC0 A;  2I9V A;  3C8C A;  4I3J A;  1OTD A;  4R70 A;  3VE3 A;  4E04 A;  2A24 A;  5HDD A;  4BMW A;  4CLC D;  2LB5 A;  3CLO A;  4I39 A;  1OTI A;  4XT2 A;  5DKK A;  4PHT A;  1N9O A;  2JHE A;  1OT6 A;  4QPR A;  4Y5F A;  5HL6 A;  1LSW A;  3JVU A;  3KSI A;  2W3G A;  5AVE A;  1VB6 A;  3VE4 A;  5HWV A;  2LB9 A;  3CUE A;  2B02 A;  3E0Y A;  3GDI A;  5F6A A;  1XFQ A;  3LI9 A;  3IBJ A;  2INW A;  4KUK A;  4ETZ A;  3LIE A;  4L9G A;  2D01 A;  2J3T D;  5J7E A;  2YKF A;  2OAQ 1;  3LFV A;  1IFQ A;  2VZW A;  1P9W A;  4NXG A;  2VV6 A;  4ARZ A;  3JVV A;  3FC7 A;  5I5L A;  3PBO A;  4GHI A;  4H6J A;  2HGV A;  2HV1 A;  3B47 A;  4GW9 A;  2VGL M;  3CWF A;  3PBT A;  3HCY A;  4DN0 A;  4MMN A;  3RH8 B;  2P08 A;  2K2N A;  5IU1 A;  3BQA A;  2WKP A;  2W3D A;  4NXE A;  4IHQ A;  4FSF A;  1GSX A;  4MDZ A;  1MZU A;  3P7N A;  1YAX A;  4EUV A;  4OOL A;  1XJ3 A;  3BW6 A;  5EFW A;  5A8B A;  3UB9 A;  5LBR A;  2J3T C;  2Y8H A;  4L9E A;  2V9A A;  4O01 A;  2A24 B;  1MKM A;  1OTA A;  3HJK A;  3T4K A;  5AJG A;  2JKT M;  3LIA A;  4EEU A;  2JKT I;  3K3C A;  1BYW A;  3FPV A;  2VJW A;  3LID A;  2BAS A;  4CLC B;  1EW0 A;  2P04 A;  1T19 A;  3OCN A;  3ICY A;  3F1P B;  2OAP 1;  5DFX A;  1TF1 A;  2D02 A;  2KOI A;  3E4O A;  2ZBB A;  1T18 A;  3KSF A;  3KYQ A;  3NJA A;  4EER A;  1ODV A;  3BWL A;  2GNX A;  3P01 A;  1V9Y A;  2W27 A;  4YNR A;  4AFI A;  2VX8 A;  2PR6 A;  1D7E A;  3NOU C;  2H28 A;  2VKS A;  3C30 A;  3O5Y A;  3IS2 A;  4GS9 B;  3LIF A;  5HPF A;  2PHY A;  5HZH A;  5J4E A;  2QKP A;  4NEE D;  2VGL S;  1OT9 A;  2OWJ A;  1T1C A;  1S4S A;  4CLC E;  4EXO A;  2Z6C A;  2JN7 A;  4H6J B;  3D3O A;  1W63 Q;  1T1A A;  3VOL A;  3NOT C;  2Y79 A;  2W3E A;  4LLO B;  2KDK A;  2O9A A;  2V0W A;  4EEP A;  2ZOH A;  1DP9 A;  3F1P A;  3PBQ A;  2HJE A;  4GS9 A;  3OBF A;  1LL8 A;  1S1Y A;  4G3V A;  5DJT A;  4PKY A;  3B33 A;  1H8M A;  1DRM A;  4EU0 A;  2FZ0 A;  2WKQ A;  4I38 A;  3MFX A;  1VHM A;  2QWS A;  2M7U A;  2V1A A;  3UE6 A;  4Y3I A;  1GSV A;  4RQ9 A;  3DBA A;  4HI4 A;  3LI8 A;  2FH5 A;  1TS8 A;  4HIA A;  4Z1W A;  1UWP X;  3F1O B;  2ZOI A;  3EGX C;  5HDS A;  2OOL A;  1XJ6 A;  4LPZ A;  4LRX C;  1Y28 A;  5DKL A;  1F5M A;  3BY9 A;  1OTB A;  2W1T B;  1S1Z A;  5TJJ A;  3LR3 A;  3KX0 X;  5HD5 A;  3KSH A;  1TS0 A;  2A2L A;  4HHD A;  4CLC A;  3EQV A;  4HNB A;  2HF6 A;  3ULF A;  1NRJ A;  4PAU A;  5HD3 A;  4JGR A;  4NXF A;  3H82 A;  3RTY A;  1N9N A;  1XJ2 A;  2XA7 S;  1NLZ A;  2PT7 A;  3HJI A;  3U2A A;  3TE8 A;  3UMD A;  5FL3 A;  2V0U A;  4B9O A;  4GJ4 A;  2J80 A;  4JGQ A;  2M7V A;  4CLC C;  3VV4 A;  3CIT A;  1LT0 A;  3PHY A;  3S7P A;  3EEA A;  1GSW A;  3FG8 A;  5TBM A;  4UEY A;  2Z6D A;  1P97 A;  5G4Y A;  3PBR A;  1OJG A;  3T4O A;  2JKR I;  3SW1 A;  3MQQ A;  2PYR A;  2PDR A;  3K3D A;  4XT2 B;  4Y2F A;  1G6O A;  4Q0H A;  4I5S A;  4BBV A;  4HP4 A;  3UB8 A;  3F1N B;  3PR6 A;  2NUT C;  3FPW A;  2VA0 A;  2O0Y A;  4BBT A;  1YSQ A;  3TW8 A;  3KO6 A;  5C5K A;  4G3W A;  2G7U A;  2L1M A;  3BY8 A;  4ZRR A;  2DMW A;  2PD8 A;  4WEK A;  4Q0I A;  5HWT A;  4F3L B;  4G3K A;  4HOI A;  3LIB A;  3F1N A;  2QYB A;  2W1R A;  4FOF A;  3IS2 B;  4GCZ A;  4HQA A;  3T50 A;  2QJ5 A;  2VEA A;  3IBR A;  2VLG A;  4K08 A;  4ME4 A;  1DP6 A;  5KIZ A;  3UB7 A;  2V1B A;  1KOU A;  2PYP A;  3C2W A;  4NKP A;  4P6Z S;  4UQI M;  5HSQ A;  1XFN A;  5DFY A;  1NLY A;  1WA9 A;  4HJ3 A;  1NWZ A;  3OC2 A;  4WEJ A;  4WEL A;  2VV7 A;  4YOF A;  4EET B;  2KX6 A;  3LYX A;  3BJN A;  4ARZ B;  3C38 A;  4M4X A;  3T4Q A;  2ZMV A;  5G4Z A;  1F98 A;  1T1B A;  4WLA A;  2P7J A;  4GLQ A;  5L8M A;  3TJZ C;  3LUQ A;  2ZMF A;  3GEC A;  2XSS A;  3LR0 A;  3PBN A;  4IUK A;  5HWW A;  4KQD A;  5KSH A;  4P6Z M;  4UQI S;  4JGP A;  1V9Z A;  3R4K A;  4MN7 A;  2B18 A;  4O0P A;  2PR5 A;  5TBM B;  5CX7 A;  2VV8 A;  3NOP C;  4GHI B;  3A0V A;  1P9R A;  3T4J A;  3PYP A;  3EEH A;  1D06 A;  4KUO A;  5F5Y A;  2EWV A;  2XA7 M;  4WF0 A;  2EA9 A;  1JNU A;  3MXQ A;  4EQ1 A;  3BQ8 A;  3MQ0 A;  4YWZ A;  3NHQ A;  1OJ5 A;  1TS7 A;  5F68 A;  1IOU A;  1TD5 A;  3UE3 A;  3S7O A;  4DJ3 A;  2NUP C;  2L0W A;  3T4L A;  3V67 A;  3E4Q A;  5AVF A;  2MJ6 A;  2M1C A;  3G6O A;  2K7S A;  3KSG A;  2K31 A;  3MR0 A;  3MJQ A;  2XRO A;  3K2N A;  3RFB A;  5MC7 A;  2CMN A;  1F9I A;  3LR4 A;  1OPX A;  3R7W B;  3MQO A;  2W3H A;  4L0L A;  3EWK A;  1OTE A;  4BBU A;  4HP9 A;  4HJ4 A;  5K5B A;  2HJ9 C;  2QHK A;  1W63 M;  3PXP A;  4HY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...