3KSGA

Structure of frmsr of staphylococcus aureus (complex with substrate)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
153
structure length
153
Chain Sequence
TTINPTNYTLLKKQAASLIEDEHHMIAILSNMSALLNDNLDQINWVGFYLLEQNELILGPFQGHPASVHIPIGKGVCGTAVSERRTQVVADVHQFKGHIACDANSKSEIVVPIFKDDKIIGVLDIDAPITDRFDDNDKEHLEAIVKIIEKQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein
publication title Structure of fRMsr of Staphylococcus aureus
rcsb
source organism Staphylococcus aureus
total genus 43
structure length 153
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.8.4.14: L-methionine (R)-S-oxide reductase.
pdb deposition date 2009-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ksgA00
1MC0A 1YSPA 2K2NA 2W3HA 4MMNA 4Y5FA 3S7PA 3S7QA 3R4KA 4Y3IA 4PAUA 2W1TA 3S7OA 2O0YA 4Q0IA 1YKDA 5AJGA 4ETXA 1MKMA 3NHQA 4E04A 2KOIA 3K2NA 2ZMFA 4ETZA 4BWIA 1VHMA 4Y2FA 1TD5A 4LRXC 4O8GA 4DMZA 4LRYC 3KO6A 5HPFA 2W3EA 3EEAA 3ZQ5A 3KSFA 2O99A 3DBAA 3S7NA 1ZTUA 5LBRA 3G6OA 4IJGA 3O5YA 3LFVA 3VV4A 3W2ZA 4CQHA 2HGVA 2IA2A 2GX5A 3NOUC 3OBFA 2K31A 4FOFA 4Q0JA 3KSHA 5DFXA 5L8MA 3KSGA 1TF1A 2OOLA 3D3OA 4R70A 4EUVA 4GW9A 4IUKA 4LRZE 2KLIA 2VEAA 5HPIA 2W1TB 2VZWA 5HSQA 3CITA 3C2WA 2XROA 2Y79A 2Y8HA 4MCWA 2M7VA 2XRNA 4DN0A 1STZA 2O9BA 4O0PA 3NOTC 2B18A 3OOVA 4O01A 4G3WA 4Z1WA 3MQ0A 3NOPC 5K5BA 3CI6A 4EU0A 4RQ9A 2G7UA 3RFBA 2VKSA 5HL6A 5DFYA 2W3DA 2O9CA 3BJNA 3MMHA 4MDZA 2W3FA 3IBRA 3TRCA 4G3KA 2LB5A 2QYBA 4QPRA 2W1RA 5I5LA 2M7UA 1F5MA 2O9AA 2LB9A 4GLQA 4Q0HA 3IBJA 4IUHA 3E98A 3KSIA 5TJJA 3HCYA 4YNRA 4ZRRA 1YSQA 5C5KA 2XSSA 3MF0A 4G3VA 4YOFA 2VJWA 4MN7A 3E0YA 2W3GA 4R6LA 4ME4A
chains in the Genus database with same CATH superfamily
5FQIA 5TGFA 3BECA 3TSGA 4HY8A 5FSRA 3V50A 1LHYA 1XJ6A 5IS1A 5AJGA 3ZNTA 2MJ6A 3LR0A 1IEMA 4GHIA 5AVFA 1TD5A 4LV3A 3P09A 5HPFA 3PBRA 3K3CA 2W3EA 4KUOA 3E2KA 1IYPA 1HLUP 1VETB 2VK3A 2M1CA 3N6IA 3QHYA 2Y2QA 1K55C 4FH2A 4UQIS 3UMEA 1MXOA 3A3JA 5HDSA 3IHBA 4K0WA 5J8XA 3LR3A 1E4DA 1PWGA 2BASA 5AQ9A 2VGLM 3CITA 4OPZA 3OZHA 1K0KA 1O07A 1I2WA 3M2JA 4R4RA 1W79A 4XUXA 4N1XA 2M7VA 1STZA 3O88A 4WLAA 3VP0A 5KZHA 3IF5A 3O3VA 4GHIB 4H8RA 3OOVA 2HJ9C 3A3FA 2J3WA 3P7NA 4BLMA 4PM5A 3VP1A 2Y2JA 3VMAA 4UHUA 1KGGA 4Z9QA 3IF6B 4JKTA 3N8SA 2J7VA 5JYOA 5HW3A 2PYRA 3IBJA 1NJ4A 1YLWA 2ACGA 3BY9A 3KSIA 5TJJA 2OSUA 4I5SA 2FFFB 4P87A 3IXDA 4JXWA 3M6BA 4X68A 2W3GA 4X53A 2H0YA 1ZG4A 3UE6A 4OPQA 2D02A 3LCEA 4KZ3A 1MKMA 4FD8A 1J3WA 1VHMA 1T1CA 4H6JA 2WUQA 1T1BA 2INWA 4D60A 3DBAA 4IJGA 5M18A 3A3IA 1LI9A 4X56A 5A90A 3WS2A 3AGFA 4S2OA 3LYXA 2WADA 5EPHA 2QWSA 4QY5A 4A5RA 4Y13A 1YLJA 2KLIA 3WS0A 4JF4A 1DP9A 4RYEA 1OT6A 1BSGA 3CHWP 2X01A 2J3TD 5BOHA 1ONGA 3WRZA 4DE3A 2XRNA 1GSVA 3DW0A 4H6JB 2JC7A 1K56D 2Y2KA 4MN5A 1GSWA 3A0RA 3C30A 1LT0A 3CI6A 2Y4AA 3H7WA 3ZG9B 3MMHA 3PHYA 3VE4A 3WWXA 3UDIA 5GLCA 2JKGA 2DCFA 2O9AA 1L0FA 3BQAA 3BLMA 4IUHA 3E4QA 1ES2A 2H5SA 4ZRRA 4QU3A 3GQZA 5HZHA 3E0YA 5HDCA 5GHXA 3B33A 1YT4A 1KE3A 3IX8A 3C5AA 3Q07A 1Q2QA 2XK1A 5EVIB 3MFDA 2JKRM 4ETZA 1JWVA 2D01A 3H7WB 3HREA 1P9WA 1A0KA 3WRTA 4OP5A 3MZFA 5IU1A 1K6SA 3D72A 4HJ6A 1ALQA 1T19A 2HP5A 2UWXA 2XF3A 2G2UA 3G6OA 4FUWA 2ZQ8A 3HLFA 3T4LA 3OBFA 1PZOA 3LR5A 4RX3A 4CLCE 5FQJA 4F3LA 4MBFA 2WZXA 4E6XA 5EECA 2ZC7A 4PHTA 1VEUA 1FCMA 5F83A 4LRZE 1PYYA 4I39A 5AQ7A 2VEAA 2WK0A 4E3MA 1D06A 3H82A 2XROA 4KQOA 5HWWA 4PKYG 2JCHA 3EEHA 1DJAA 5FASA 5GLAA 3BY8A 4MNRA 1CJFA 1K57A 2G7UA 2Y2LA 2W3DA 3A0VA 4OQIA 2V8CA 2ZQ9A 2HV1A 1O7EA 5FAPA 3HL9A 3ZGAB 5FI7A 1NZUA 4GN2A 1LL5A 4GLQA 4F3LB 4OOYA 5A91A 3E98A 3UPOA 4EW7A 1Y4OA 1PNEA 3T4TA 2C5WB 3S4XA 1LL9A 3H82B 3I7JA 3NY4A 3FYZA 2Z6DA 2IWCA 3BRMA 1YSPA 4MMNA 4DE0A 5CECA 4X69A 2OAP1 1H8MA 4EEUA 1N9LA 3SS3A 4FH4A 4KQDA 2H10A 2WKPA 3FG8A 3ITAA 5TBMA 3A3DA 5MC7A 4ZJ1A 3G2ZA 4PPRA 1NY0A 2RL3A 2CMNA 2PD8A 4OPRA 2GX5A 2JN7A 2Y2GA 1JWZA 1ZHHB 3GDIA 2PD7A 4IVKA 1TF1A 3EWKA 1XJ4A 1YLTA 5EE8A 5F6AA 4JBFA 1ESUA 5FEFA 1L0EA 4OPYA 3ITBA 3PXPA 1M6KA 2V0UA 3N7WA 2ZM8A 3T4JA 3C7UA 4GZBA 4BL3A 4CPKA 3CJMA 5TBMB 1SKOB 1GSXA 3D9YA 4KENB 3NDEA 3JVVA 4G3KA 5F5YA 1OMEA 3OC2A 4HNBA 2E8JA 2ZC6B 5DF8A 4BD1A 2XGNA 3OCLA 2WGWA 1GHPA 3LIBA 2XFSA 1YSQA 4X1LA 5C5KA 3SOIA 1YQSA 2JHEA 3LIEA 1LSVA 4X6TA 5DTTA 1TDGA 2OLVA 1JTGA 1Z09A 2BLSA 1S1YA 1IFQA 1K56A 1UWNX 4X55A 4KQQA 5DKLA 2JKFA 5F69A 4P6ZM 4B9OA 1FSYA 4RX2A 3FWLA 3R7WA 2R78A 1YLZA 4ZJ3A 5J7EA 1LLBA 3Q7VA 4PM9A 3IT9A 2WGWB 3HBRA 3UB9A 3NDGA 4EUVA 3C8CA 1DY6A 5KSCA 3T4SA 4JF6A 5JYPA 2OLUA 1F9IA 3QP1A 5DTKA 5CXWA 4MCWA 4KUKA 5M19A 2YKHA 1LSWA 1BZAA 3LY3A 2ZQCA 3IX3A 1S0WA 2QHKA 5K5BA 2L4RA 3PAEA 1W63Q 3BJNA 2ZOHA 1DP6A 4GS9A 2LB5A 2OV5A 1IYQA 2W0NA 4S2MA 3QP8A 3MXQA 3KYZA 3UB8A 2P9VA 2HDUA 2UV0E 3NC8A 2ZC4B 1L0GA 2BG1A 3L7HA 2I72A 3HLEA 1MWTA 1GCEA 3AGDA 4DKIA 3S7OA 3NULA 3GRJA 1VETA 3VSLA 5AQAA 3DTIA 1VM1A 1T18A 4IVIA 2Z6CA 4GS9B 4YWZA 3PR6A 4JGPA 2Y2MA 3LICA 3V67A 3HLCA 4CQHA 4XT2B 4WYYA 1LL8A 2P9VB 2HDRA 4LCLA 3DTMA 4GW9A 2Y55A 4IBXA 2OAQ1 3EGXC 4N92A 4Y0TA 3ZHHA 4MLLA 1YLPA 1EW0A 3PBTA 3T1XA 5KMWA 3N4IA 4GDBA 1FR6A 4WF0A 3IF6A 4S2LA 3WS4A 4ARZA 1CI9A 4E3IA 1K6RA 2V1AA 4S2NA 5E2GA 2FZ0A 5AVEA 4U3TA 3V3SA 5F82A 3MXSA 1YLYA 2WYXA 3GV9A 2XLNA 3HUNA 3QP6A 4EERA 3DWZA 4EXOA 4I38A 2ZQAA 2JE5A 2XH9A 1AXBA 1IELA 5FQMA 1OTEA 4N9LA 4DRTA 2WKQA 2EFUA 4GD6A 3D4FA 3MF0A 4ME4A 2G2WA 1NZOA 3LI8A 3HLBA 2EFXA 3GVBA 5DVAA 4ARZB 3MQOA 4II7A 4EWFA 1RGZA 2O0YA 4HBUA 5GHZA 2H0TA 3ZG0A 3RJUA 4WELA 5HWVA 3PBSA 3OLOA 1XPBA 5HX9A 1W8YA 1RGYA 3EEAA 5FQKA 1CQAA 5CGWA 1FCOA 1EWZA 1K57C 3BYDA 4HH3A 3FKVA 4BBVA 2HGVA 4BBTA 4OLDA 4DDSA 1K54A 1KOUA 4WEKA 5E2FA 5A93A 2PDRA 2V1ZA 2PBYA 3E4PA 3W4QA 4UEYA 3GMWA 3RXWA 4ZJ2A 4EV4A 2ZMVA 3QNBA 1W63M 1ONHA 5HAPA 1EI5A 3M6HA 3N8RA 1JWPA 1ERQA 3BFDA 2V8FA 4LLOB 4L9EA 3F1NA 4BBUA 3TE8A 5DTSA 4BQMA 1TS7A 5IHVA 3UO9A 5DFYA 3MJQA 4WM9A 3UY6A 3CUEC 1LSXA 2M7UA 2BTFP 4NXBA 3FC7A 3P98A 3C7VA 4Q0HA 3RXXA 3V3RA 4QHCA 4KG5A 3F1PA 5EVIA 3UDFA 1I2SA 1BLCA 3HUMA 3BFCA 5CGSA 4Y5FA 4KZ9A 1TS6A 5J3WA 2WKHA 2W1TA 4S2KA 4WEJA 3LO7A 4HJ3A 1YKDA 3F1NB 5HD3A 3WS5A 5L2FA 2ZM2A 3UE0A 1E3UA 3ZCZA 4EETB 2V2FF 4O8GA 3KO6A 5EOEA 2QMIA 4P85A 1GHIA 4GD8A 1U60A 2WAEA 3B3XA 3CAXA 1BLPA 5GHYA 3KSFA 2EXBA 3HLDA 1ZTUA 4X1MA 4E3JA 5FQQA 3VV4A 5J4EA 4XXRA 4CLCD 2CC1A 1K4FA 3F1PB 3VP3A 3IXBA 1PZPA 3HUOA 4WBGA 5CEBA 3D3OA 3ZG8B 2PT7A 4I3AA 1E25A 5CX7A 5HPIA 1K55A 5CRFA 4E3OA 1WYBA 2W1TB 3UMDA 3T50A 3GTCA 3IWOA 2DRWA 2C6WB 4UA6A 2VV6A 4S2PA 3AGEA 5HD5A 1KVLA 4WN5A 3N8LA 3NIAA 3IS2A 1BYWA 3TJZC 4K91A 4C75A 1NYMA 4KQRA 5U47A 3QP5A 4AFIA 4CLCC 1XP4A 3PBOA 4JXSA 2B95A 5HL1A 1EROA 5FL3A 4KZBA 2ZC5B 4WZ4A 2VJWA 4MN7A 3BM6A 3KX0X 1TDLA 3ZYTA 4HOIA 1H3QA 4ZAMA 5EUAA 1HTZA 4Y3IA 1ESIA 3PYPA 2E8IA 1I5QA 1AWIA 1HD8A 3JPUA 1ZG6A 1G6OA 1MPLA 4P6BA 3WS1A 5CTNA 4RVAA 3IS2B 1KE4A 4NXGA 1PWCA 2DNSA 4LPZA 4GJ4A 4EEPA 5HWTA 2JKTI 3IWQA 2XD1A 1T1AA 3HJKA 4NXFA 4P0MA 4DE1A 4DJ3A 2V9AA 3PAGA 3LFVA 4FTXA 1W7FA 3MKFA 5E2EA 1IYOA 2QJ7A 3C4OA 2I9VA 2XD5A 2VV8A 4NK3A 4MBKA 3G31A 4IUKA 1LI0A 1SKOA 4GOGA 4LCMA 4MN6A 4WMCD 1RP5A 4Y0OA 1OTBA 2Y79A 4OVDA 2EA9A 1SHVA 4O01A 3U4LP 2HP9A 4KZAA 4WL9A 3FV7A 5TFQA 2GZAA 3SH9A 2WKIA 3VFFA 2QYBA 3UPPA 2W1RA 4KZ4A 3MBZA 5I5LA 4E6WA 2LB9A 3RTYA 3GSGA 1XA7A 3UPNA 4P6ZS 1BT5A 2PYPA 2XEPA 4I3JA 4ZDXA 5EM0A 3SH7A 2ZOIA 4OKPA 5KIZA 2HZ5A 5L07A 2Q9MA 3ZFZA 3TW8A 1MC0A 4OOLA 5CHJA 5G4YA 4OQGA 5EM1A 1CK3A 1BTLA 1K4EA 2K7SA 1HVBA 1OPXA 4EESA 1G6AA 4FSFA 3BFGA 2XR0A 2HDQA 4LRYC 3CMZA 1UWPX 4ZBEA 3FKWA 4HBTA 4S2NC 5EVLA 1NRFA 4NG2A 5L09A 1G68A 3BFFA 1MZUA 3LI9A 4HIAA 4S2IA 3TG9A 3NOUC 1P97A 4R23A 1KDWA 3KSHA 5DFXA 5CTMA 4R70A 4D2OA 4L0LA 1BLHA 1RCJA 2IWDA 4R4SA 1ES5A 4K0XA 3HJIA 4JGQA 3EOIA 2A49A 2XA7M 3ZG7B 5HSQA 3ZNYA 5CHMA 3JYIA 1SCWA 2B18A 1KDSA 1OJGA 2HP6A 5A92A 3ZG5A 2NUTC 4Z1WA 1H5XA 5DF9A 1DJCA 4EU0A 4RQ9A 3RFBA 4U0TA 2WKEA 4UAAA 3HVFA 2XDMA 2PU2A 4L9FA 4BJPA 2Y2PA 4JPMA 2EX8A 4U0XA 3E2LA 1G28A 5CHUA 3MZDA 1K38A 3VSKA 5DKKA 5IT5A 1K54C 2QJ5A 5EFWA 5CEDA 1ODVA 3SH8A 1S67L 4HJ4A 1Q2PA 3UDXA 4YINA 1OJ5A 3DTEA 1NWZA 5AQBA 4JF5A 3FPWA 1PRQA 3UE3A 3NHQA 2KOIA 5L10A 1FIKA 1VB6A 1OTDA 2Y2OA 4XT2A 4LRXC 2WZZA 5DJTA 5HARA 1H0MA 2ZL1A 3NECA 3KYEA 3LR4A 5FEGA 4L9GA 1XJ2A 3SS4A 3RH8B 3A0SA 3VOZA 1OT9A 1X0OA 4R0QA 4DF6A 5HFOA 5DF7A 5A8BA 4N1HA 1L0DA 3T4QA 1PW8A 2JKRI 1H8YA 4CJNA 5GLDA 3M2KA 1Y54A 5CGXA 2VGLS 3GR2A 5G18A 3FPVA 1FCNA 4GNUA 4OLGA 3L9KA 3S1YA 3T12B 2ZL1B 3QP4A 1S66L 3O87A 1CI8A 4OQ0A 3ULFA 2H28A 1SKFA 3TRCA 4DXCA 3NBLA 2Y2IA 1F5MA 2ZM0A 4Y15A 1OTIA 1FOFA 2QPNA 4O7DA 3T1RA 4WMCA 2IWBA 2JBFA 1J9MA 2ZC3B 1XKZA 1W8QA 3NJAA 2R9WA 2XSSA 4LGWA 1XGIA 4YOFA 1QMFA 3IWIA 4E3NA 3SZTA 2K2NA 2EWVA 3GECA 3S7QA 1H8ZA 1WE4A 3IQAA 1YAXA 4PM6A 4EQIA 3MQQA 3G4PA 4Y2FA 3CPTA 4QY6A 4EBNA 4KZ5A 1S6RA 2EWWA 4DE2A 4GKUA 2NUPC 5F68A 3VP2A 4QWOA 1S4SA 3U2AA 4BMWA 3ZQ5A 1L2SA 3CG5A 3MSHA 4Y7PA 5LBRA 1XX2A 1IKGA 4LFUA 4OH0A 4B4ZA 3W2ZA 2P08A 3EQUA 4LENA 2V1BA 4Q8IA 2K31A 2V20A 4LV0A 4Q0JA 4HHDA 1FQGA 4PM8A 1MY8A 3OPLA 2EX9A 3UNWA 1BUEA 1M40A 4KG6A 2Q9NA 3C2WA 4XUZA 2Y8HA 4KG2A 3BFEA 3EGDC 4DN0A 4O0PA 3CPTB 2PRFA 4UQIM 4IHQA 4WZ5A 2GJ3A 2GDNA 1NRJA 2GNXA 1FSWA 1UGUA 3W4OA 5HL6A 5E43A 3LY4A 2Y91A 5FQ9A 5EV0A 3LIDA 4OP8A 2HJEA 4S2JA 1NLZA 4RA7A 5I94A 4KZ7A 4IBRA 1D7EA 2A24A 3DAVA 4JGOA 1GHMA 4GCZA 3BW6A 2FFYA 4K08A 4PKYA 1SDEA 1N4OA 3VP4A 3LGOA 3OPRA 5FI6A 3R4KA 3Q81A 5EOOA 2J8YA 4Q0IA 2VGJA 4HEFA 4B93A 4ETXA 4E04A 1G5UA 3G32A 3P01A 5DJUA 5FAQA 1XXMA 3HLWA 3KYQA 5FDHA 3MS6A 2ZJ9A 3S7NA 3PTEA 3G2YA 2ZD8A 4QB8A 4QJGA 2A24B 2A2LA 1JNUA 4FCFA 2ZBBA 3KSGA 2Q0OA 2PBDP 3IXGA 4IEDA 2EX2A 4MBHA 3UE1A 1SDNA 2VGKA 5HAQA 4HQAA 2VZWA 3OCNA 2X02A 3O86A 3A3EA 3G34A 4EBLA 1KE0A 1MWSA 2W27A 1MWUA 1PIOA 1TS8A 1JTDA 3MQ0A 3Q1FA 1TS0A 4I3IA 1MWRA 2WAFA 3MZEA 2J3TC 4HP9A 5FI2A 2EX6A 3IBRA 2HDSA 3SW1A 1SZVA 5FATA 3LUQA 2WKRA 4YNRA 1S1ZA 5D3OA 4WUJA 1ZC2A 3T4OA 3H9WA 3IXHA 3MR0A 3S7PA 2L0WA 1BLSA 4ZTKA 3UB5P 2OWJA 4B88A 2P74A 3K2NA 2ZMFA 3B47A 3MFXA 3V39A 4DMZA 2VV7A 1MKIA 3E4OA 4R1GA 3LIFA 1S4RA 4YFMA 2O99A 1NYYA 2PR6A 1NXYA 4HH2A 3B42A 2FH5A 1V9ZA 4MEZA 3LEQA 1N9NA 1ES4A 5L8MA 2QZ6A 2Y2HA 1DRMA 3QP2A 3ZVWA 4GB7A 3OPHA 4B4XA 2EXAA 1PWDA 3DTKA 4JGRA 3VE3A 2Z2LB 1VEUB 3BLSA 3UN7A 4Y0UA 2WGVA 1DJBA 3NI9A 3FZCA 5HAIA 1DP8A 2KX6A 1D1JA 4HI4A 4DDYA 2O9CA 3IH9A 4MDZA 3ZVTA 3JVUA 1IOUA 4GDNA 4N9KA 4E3KA 2J9PA 3ZDJA 3IX4A 1C3BA 2A3UA 4F94A 1ERMA 3UB7A 2OWHA 4M4XA 4JXVA 3K3DA 4LV2A 3CUEA 1P0ZA 4OQHA 4R6LA 3V5MA 3T4KA 1PFLA 3BEBA 4NXEA 2WGIA 4NETA 2L1MA 4EQ1A 1FR1A 4NEED 1WYCA 1CEFA 1XFQA 2KDKA 1BULA 2ZMAA 2AVXA 4R3JA 1XA1A 3SS5A 2XA7S 3W4PA 1KVMA 2Z2MB 3VOYA 4E3LA 2IA2A 3TOIA 3PBQA 2B02A 1P9RA 2ZQDA 5F1GA 4EUZA 2OOLA 4JLFA 1PI5A 1WA9A 1XFNA 3LIAA 3IF6C 3CWFA 1IKIA 1N9BA 5CERA 4ESPA 4EBPA 1YMSA 2J9OA 4R3AA 1XGJA 1PW1A 4BENA 3VFHA 1QMEA 2ZLYA 5E2HA 3G30A 2V0WA 4BL2A 2PR5A 1GA9A 1V9YA 4G3WA 2R9XA 2HF6A 2Y2NA 2VKSA 2RCXA 2B5RA 2W3FA 4R3BA 1CEGA 3F1OA 3W8KA 4QPRA 1CF0A 4OOMA 3NCKA 5FA7A 5FDSA 4JXGA 5TR7A 4G3VA 2VA0A 3CLOA 1F2KA 1ACFA 4CLCA 3DWKA 4DJ2A 1OTAA 2PAVP 1YM1A 3QNCA 2W3HA 3VOLA 1TEMA 4C3QA 2PU4A 1KGEA 4PAUA 1Z6FA 4X25A 4R38A 1HZOA 1PI4A 2J80A 1W5DA 4Y17A 2P7JA 1IYSA 2Y59A 2X71A 4BWIA 2DMWA 3IHAA 3Q7ZA 3BQ8A 4NKPA 2PHYA 4LV1A 4ID4A 2XQZA 4WZ5C 2YKFA 3F1OB 2QKPA 3CZDA 3C4PA 1KGFA 5EVID 5EVEA 3UB6A 3BWLA 1GA0A 3O5YA 3Q82A 5KSHA 3T1SA 1YPRA 3IH8A 1MBLA 4PM7A 4FOFA 4UA7A 3R7WB 2ZQ7A 3T1QB 2VX8A 2P04A 1F98A 1N9OA 4CLCB 4C6YA 4QD4A 2VLGA 4KZ8A 3Q7VB 1VQQA 4HESA 1E3UD 1NLYA 1K25A 1L3LA 3LEZA 4M3KA 4OONA 4PMAA 3ICYA 2O9BA 1FILA 2XFTA 4UA9A 3NOTC 3PBNA 1XJ3A 3ISGA 2HPBA 3NOPC 5FAOA 3MXRA 3S22A 4BD0A 3OPPA 5EVIC 5HDDA 4DXBA 1ES3A 1Y28A 3MKEA 3HLGA 4HP4A 4KZ6A 3G35A 5GL9A 3HCYA 5M1AA 1YMXA 5GLBA 1ZKJA 2JKTM 5F1FA 3EQVA 3C38A 1TVFA 5G4ZA 1JVJA
chains in the Genus database with same CATH topology
3ZYTA 4PKYA 4HOIA 1H3QA 1S1YA 1IFQA 1UWNX 3R4KA 4Y3IA 3PYPA 4HY8A 5DKLA 4Q0IA 1XJ6A 5IS1A 5AJGA 5F69A 4B93A 4P6ZM 4B9OA 4ETXA 4E04A 2MJ6A 3LR0A 1G6OA 4GHIA 5AVFA 1TD5A 3P01A 5DJUA 3IS2B 3R7WA 2R78A 4NXGA 5HPFA 3KYQA 3PBRA 3K3CA 2W3EA 4LPZA 4GJ4A 4EEPA 4KUOA 5J7EA 5HWTA 3S7NA 2JKTI 1T1AA 3HJKA 4NXFA 4DJ3A 2V9AA 2M1CA 3LFVA 2A24B 2A2LA 2QJ7A 2I9VA 1JNUA 4UQIS 3UMEA 2VV8A 2ZBBA 3KSGA 3UB9A 5HDSA 4EUVA 3C8CA 4IUKA 3LR3A 3T4SA 2BASA 1F9IA 4HQAA 2VGLM 2VZWA 4MN6A 3CITA 1OTBA 3OCNA 2Y79A 4MCWA 2M7VA 4KUKA 1STZA 4WLAA 2EA9A 4GHIB 3OOVA 2YKHA 2W27A 4O01A 1LSWA 2HJ9C 4WL9A 2J3WA 3P7NA 1TS8A 2QHKA 3MQ0A 5K5BA 4I3IA 1TS0A 2L4RA 2GZAA 2J3TC 4HP9A 1W63Q 3BJNA 2ZOHA 1DP6A 3IBRA 4GS9A 2LB5A 2QYBA 2W1RA 5I5LA 2W0NA 2LB9A 3RTYA 2PYRA 3SW1A 3MXQA 3IBJA 4P6ZS 3BY9A 3KSIA 5TJJA 3LUQA 2WKRA 4YNRA 3KYZA 1S1ZA 4I5SA 2PYPA 4I3JA 3UB8A 4WUJA 2ZOIA 3T4OA 5KIZA 2W3GA 3H9WA 3MR0A 3TW8A 1MC0A 4OOLA 3S7PA 2L0WA 5G4YA 3UE6A 3S7OA 2D02A 2K7SA 2OWJA 1OPXA 1MKMA 4EESA 3K2NA 4FSFA 2ZMFA 1VHMA 1T1CA 4H6JA 3B47A 3MFXA 4DMZA 1T18A 4LRYC 1T1BA 2VV7A 2INWA 2Z6CA 4GS9B 4YWZA 3E4OA 1UWPX 3PR6A 4JGPA 3LIFA 1S4RA 2O99A 3DBAA 3LICA 3V67A 2PR6A 4IJGA 4HH2A 3B42A 2FH5A 1MZUA 1V9ZA 4CQHA 3LI9A 4HIAA 4XT2B 1LL8A 3NOUC 1N9NA 1P97A 3KSHA 5DFXA 3LYXA 5L8MA 2QWSA 4R70A 4L0LA 4GW9A 2OAQ1 2KLIA 1DRMA 1DP9A 3EGXC 1OT6A 3HJIA 4JGQA 3EOIA 2XA7M 2J3TD 5HSQA 1EW0A 3PBTA 4JGRA 3VE3A 2XRNA 1GSVA 4WF0A 2B18A 4H6JB 4ARZA 1OJGA 2NUTC 4Z1WA 2V1AA 1DP8A 4MN5A 5DF9A 1GSWA 2FZ0A 3A0RA 3C30A 1LT0A 3CI6A 2KX6A 4RQ9A 4EU0A 5AVEA 3RFBA 4HI4A 3H7WA 2O9CA 4MDZA 3MMHA 3PHYA 4EERA 4EXOA 4I38A 3VE4A 4L9FA 3JVUA 1IOUA 4BJPA 2O9AA 1OTEA 3BQAA 4IUHA 3E4QA 3UB7A 1G28A 4ZRRA 2OWHA 4M4XA 2WKQA 3MF0A 3K3DA 5DKKA 5HZHA 5IT5A 2QJ5A 3E0YA 3CUEA 1P0ZA 5EFWA 4R6LA 4ME4A 5HDCA 3LI8A 3B33A 1ODVA 3T4KA 1S67L 4HJ4A 4NXEA 4ARZB 3MQOA 1OJ5A 4II7A 1NWZA 4EQ1A 2L1MA 2O0YA 3FPWA 3UE3A 4NEED 2JKRM 3NHQA 2KOIA 4WELA 4ETZA 5HWVA 1VB6A 1OTDA 3OLOA 3PBSA 4XT2A 2D01A 3H7WB 4LRXC 1XFQA 2KDKA 1P9WA 5DJTA 3EEAA 5IU1A 3D72A 4HJ6A 2XA7S 3LR4A 1T19A 4L9GA 3G6OA 1XJ2A 3RH8B 4HH3A 4BBVA 2HGVA 2IA2A 4BBTA 3A0SA 1OT9A 1X0OA 3T4LA 3OBFA 1KOUA 3PBQA 4WEKA 2B02A 1P9RA 3LR5A 4CLCE 4F3LA 2OOLA 2PDRA 4PHTA 1WA9A 5A8BA 1XFNA 3LIAA 4LRZE 3CWFA 3E4PA 4I39A 3T4QA 2VEAA 4UEYA 2JKRI 2ZMVA 1D06A 3H82A 1W63M 2VGLS 4R3AA 2XROA 3FPVA 4KQOA 4LLOB 2V0WA 5HWWA 2PR5A 4PKYG 4L9EA 3EEHA 3F1NA 1V9YA 4BBUA 4G3WA 3TE8A 3BY8A 2HF6A 1S66L 2G7UA 1TS7A 2VKSA 5DFYA 2W3DA 3A0VA 3ULFA 2W3FA 3MJQA 2H28A 3TRCA 2HV1A 3CUEC 3F1OA 4QPRA 1LSXA 1F5MA 2M7UA 4NXBA 3FC7A 4GLQA 4Q0HA 4F3LB 1OTIA 3E98A 4OOMA 4EW7A 3NJAA 2XSSA 3F1PA 4G3VA 4YOFA 3T4TA 2VA0A 3CLOA 3H82B 4CLCA 4DJ2A 2Z6DA 1OTAA 1YSPA 2K2NA 2W3HA 4MMNA 3VOLA 4Y5FA 2EWVA 3GECA 3S7QA 2OAP1 1TS6A 1H8MA 4PAUA 4EEUA 5J3WA 1N9LA 4R38A 2W1TA 4WEJA 1YAXA 4HJ3A 1YKDA 3F1NB 2J80A 2P7JA 5HD3A 4EETB 4BWIA 3MQQA 2DMWA 4KQDA 2WKPA 4Y2FA 3BQ8A 2EWWA 3FG8A 4NKPA 4O8GA 2PHYA 2NUPC 5F68A 3KO6A 1S4SA 3U2AA 5TBMA 4BMWA 2YKFA 3F1OB 2QKPA 3CAXA 3ZQ5A 3KSFA 5MC7A 1ZTUA 5LBRA 3UB6A 3BWLA 3O5YA 5KSHA 3VV4A 3W2ZA 5J4EA 2CMNA 2P08A 2PD8A 3EQUA 2GX5A 4CLCD 2JN7A 2V1BA 3F1PB 1ZHHB 2K31A 4FOFA 4Q0JA 3R7WB 3GDIA 2PD7A 4HHDA 2VX8A 2P04A 1F98A 1TF1A 1N9OA 3D3OA 4CLCB 2PT7A 2VLGA 3EWKA 1XJ4A 4I3AA 5CX7A 5HPIA 5F6AA 1NLYA 2W1TB 3UMDA 3T50A 3PXPA 3C2WA 2V0UA 2Y8HA 3ICYA 3EGDC 4DN0A 2O9BA 4O0PA 3NOTC 3PBNA 3T4JA 1XJ3A 2VV6A 4UQIM 4IHQA 2GJ3A 5TBMB 1NRJA 2GNXA 1GSXA 1UGUA 5HD5A 3NOPC 4WN5A 5HL6A 3IS2A 1BYWA 3TJZC 3JVVA 5HDDA 4G3KA 5F5YA 3LIDA 1Y28A 3OC2A 4HNBA 4AFIA 4CLCC 4HP4A 2HJEA 3PBOA 1NLZA 3OCLA 3HCYA 3LIBA 5FL3A 1D7EA 1YSQA 2A24A 5C5KA 2JKTM 3EQVA 4JGOA 2JHEA 2VJWA 3LIEA 1LSVA 4GCZA 4MN7A 3C38A 3KX0X 5G4ZA 3BW6A 4K08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MC0 A;  1YSP A;  2K2N A;  2W3H A;  4MMN A;  4Y5F A;  3S7P A;  3S7Q A;  3R4K A;  4Y3I A;  4PAU A;  2W1T A;  3S7O A;  2O0Y A;  4Q0I A;  1YKD A;  5AJG A;  4ETX A;  1MKM A;  3NHQ A;  4E04 A;  2KOI A;  3K2N A;  2ZMF A;  4ETZ A;  4BWI A;  1VHM A;  4Y2F A;  1TD5 A;  4LRX C;  4O8G A;  4DMZ A;  4LRY C;  3KO6 A;  5HPF A;  2W3E A;  3EEA A;  3ZQ5 A;  3KSF A;  2O99 A;  3DBA A;  3S7N A;  1ZTU A;  5LBR A;  3G6O A;  4IJG A;  3O5Y A;  3LFV A;  3VV4 A;  3W2Z A;  4CQH A;  2HGV A;  2IA2 A;  2GX5 A;  3NOU C;  3OBF A;  2K31 A;  4FOF A;  4Q0J A;  3KSH A;  5DFX A;  5L8M A;  3KSG A;  1TF1 A;  2OOL A;  3D3O A;  4R70 A;  4EUV A;  4GW9 A;  4IUK A;  4LRZ E;  2KLI A;  2VEA A;  5HPI A;  2W1T B;  2VZW A;  5HSQ A;  3CIT A;  3C2W A;  2XRO A;  2Y79 A;  2Y8H A;  4MCW A;  2M7V A;  2XRN A;  4DN0 A;  1STZ A;  2O9B A;  4O0P A;  3NOT C;  2B18 A;  3OOV A;  4O01 A;  4G3W A;  4Z1W A;  3MQ0 A;  3NOP C;  5K5B A;  3CI6 A;  4EU0 A;  4RQ9 A;  2G7U A;  3RFB A;  2VKS A;  5HL6 A;  5DFY A;  2W3D A;  2O9C A;  3BJN A;  3MMH A;  4MDZ A;  2W3F A;  3IBR A;  3TRC A;  4G3K A;  2LB5 A;  2QYB A;  4QPR A;  2W1R A;  5I5L A;  2M7U A;  1F5M A;  2O9A A;  2LB9 A;  4GLQ A;  4Q0H A;  3IBJ A;  4IUH A;  3E98 A;  3KSI A;  5TJJ A;  3HCY A;  4YNR A;  4ZRR A;  1YSQ A;  5C5K A;  2XSS A;  3MF0 A;  4G3V A;  4YOF A;  2VJW A;  4MN7 A;  3E0Y A;  2W3G A;  4R6L A;  4ME4 A; 
#chains in the Genus database with same CATH topology
 5FQI A;  5TGF A;  3BEC A;  3TSG A;  4HY8 A;  5FSR A;  3V50 A;  1LHY A;  1XJ6 A;  5IS1 A;  5AJG A;  3ZNT A;  2MJ6 A;  3LR0 A;  1IEM A;  4GHI A;  5AVF A;  1TD5 A;  4LV3 A;  3P09 A;  5HPF A;  3PBR A;  3K3C A;  2W3E A;  4KUO A;  3E2K A;  1IYP A;  1HLU P;  1VET B;  2VK3 A;  2M1C A;  3N6I A;  3QHY A;  2Y2Q A;  1K55 C;  4FH2 A;  4UQI S;  3UME A;  1MXO A;  3A3J A;  5HDS A;  3IHB A;  4K0W A;  5J8X A;  3LR3 A;  1E4D A;  1PWG A;  2BAS A;  5AQ9 A;  2VGL M;  3CIT A;  4OPZ A;  3OZH A;  1K0K A;  1O07 A;  1I2W A;  3M2J A;  4R4R A;  1W79 A;  4XUX A;  4N1X A;  2M7V A;  1STZ A;  3O88 A;  4WLA A;  3VP0 A;  5KZH A;  3IF5 A;  3O3V A;  4GHI B;  4H8R A;  3OOV A;  2HJ9 C;  3A3F A;  2J3W A;  3P7N A;  4BLM A;  4PM5 A;  3VP1 A;  2Y2J A;  3VMA A;  4UHU A;  1KGG A;  4Z9Q A;  3IF6 B;  4JKT A;  3N8S A;  2J7V A;  5JYO A;  5HW3 A;  2PYR A;  3IBJ A;  1NJ4 A;  1YLW A;  2ACG A;  3BY9 A;  3KSI A;  5TJJ A;  2OSU A;  4I5S A;  2FFF B;  4P87 A;  3IXD A;  4JXW A;  3M6B A;  4X68 A;  2W3G A;  4X53 A;  2H0Y A;  1ZG4 A;  3UE6 A;  4OPQ A;  2D02 A;  3LCE A;  4KZ3 A;  1MKM A;  4FD8 A;  1J3W A;  1VHM A;  1T1C A;  4H6J A;  2WUQ A;  1T1B A;  2INW A;  4D60 A;  3DBA A;  4IJG A;  5M18 A;  3A3I A;  1LI9 A;  4X56 A;  5A90 A;  3WS2 A;  3AGF A;  4S2O A;  3LYX A;  2WAD A;  5EPH A;  2QWS A;  4QY5 A;  4A5R A;  4Y13 A;  1YLJ A;  2KLI A;  3WS0 A;  4JF4 A;  1DP9 A;  4RYE A;  1OT6 A;  1BSG A;  3CHW P;  2X01 A;  2J3T D;  5BOH A;  1ONG A;  3WRZ A;  4DE3 A;  2XRN A;  1GSV A;  3DW0 A;  4H6J B;  2JC7 A;  1K56 D;  2Y2K A;  4MN5 A;  1GSW A;  3A0R A;  3C30 A;  1LT0 A;  3CI6 A;  2Y4A A;  3H7W A;  3ZG9 B;  3MMH A;  3PHY A;  3VE4 A;  3WWX A;  3UDI A;  5GLC A;  2JKG A;  2DCF A;  2O9A A;  1L0F A;  3BQA A;  3BLM A;  4IUH A;  3E4Q A;  1ES2 A;  2H5S A;  4ZRR A;  4QU3 A;  3GQZ A;  5HZH A;  3E0Y A;  5HDC A;  5GHX A;  3B33 A;  1YT4 A;  1KE3 A;  3IX8 A;  3C5A A;  3Q07 A;  1Q2Q A;  2XK1 A;  5EVI B;  3MFD A;  2JKR M;  4ETZ A;  1JWV A;  2D01 A;  3H7W B;  3HRE A;  1P9W A;  1A0K A;  3WRT A;  4OP5 A;  3MZF A;  5IU1 A;  1K6S A;  3D72 A;  4HJ6 A;  1ALQ A;  1T19 A;  2HP5 A;  2UWX A;  2XF3 A;  2G2U A;  3G6O A;  4FUW A;  2ZQ8 A;  3HLF A;  3T4L A;  3OBF A;  1PZO A;  3LR5 A;  4RX3 A;  4CLC E;  5FQJ A;  4F3L A;  4MBF A;  2WZX A;  4E6X A;  5EEC A;  2ZC7 A;  4PHT A;  1VEU A;  1FCM A;  5F83 A;  4LRZ E;  1PYY A;  4I39 A;  5AQ7 A;  2VEA A;  2WK0 A;  4E3M A;  1D06 A;  3H82 A;  2XRO A;  4KQO A;  5HWW A;  4PKY G;  2JCH A;  3EEH A;  1DJA A;  5FAS A;  5GLA A;  3BY8 A;  4MNR A;  1CJF A;  1K57 A;  2G7U A;  2Y2L A;  2W3D A;  3A0V A;  4OQI A;  2V8C A;  2ZQ9 A;  2HV1 A;  1O7E A;  5FAP A;  3HL9 A;  3ZGA B;  5FI7 A;  1NZU A;  4GN2 A;  1LL5 A;  4GLQ A;  4F3L B;  4OOY A;  5A91 A;  3E98 A;  3UPO A;  4EW7 A;  1Y4O A;  1PNE A;  3T4T A;  2C5W B;  3S4X A;  1LL9 A;  3H82 B;  3I7J A;  3NY4 A;  3FYZ A;  2Z6D A;  2IWC A;  3BRM A;  1YSP A;  4MMN A;  4DE0 A;  5CEC A;  4X69 A;  2OAP 1;  1H8M A;  4EEU A;  1N9L A;  3SS3 A;  4FH4 A;  4KQD A;  2H10 A;  2WKP A;  3FG8 A;  3ITA A;  5TBM A;  3A3D A;  5MC7 A;  4ZJ1 A;  3G2Z A;  4PPR A;  1NY0 A;  2RL3 A;  2CMN A;  2PD8 A;  4OPR A;  2GX5 A;  2JN7 A;  2Y2G A;  1JWZ A;  1ZHH B;  3GDI A;  2PD7 A;  4IVK A;  1TF1 A;  3EWK A;  1XJ4 A;  1YLT A;  5EE8 A;  5F6A A;  4JBF A;  1ESU A;  5FEF A;  1L0E A;  4OPY A;  3ITB A;  3PXP A;  1M6K A;  2V0U A;  3N7W A;  2ZM8 A;  3T4J A;  3C7U A;  4GZB A;  4BL3 A;  4CPK A;  3CJM A;  5TBM B;  1SKO B;  1GSX A;  3D9Y A;  4KEN B;  3NDE A;  3JVV A;  4G3K A;  5F5Y A;  1OME A;  3OC2 A;  4HNB A;  2E8J A;  2ZC6 B;  5DF8 A;  4BD1 A;  2XGN A;  3OCL A;  2WGW A;  1GHP A;  3LIB A;  2XFS A;  1YSQ A;  4X1L A;  5C5K A;  3SOI A;  1YQS A;  2JHE A;  3LIE A;  1LSV A;  4X6T A;  5DTT A;  1TDG A;  2OLV A;  1JTG A;  1Z09 A;  2BLS A;  1S1Y A;  1IFQ A;  1K56 A;  1UWN X;  4X55 A;  4KQQ A;  5DKL A;  2JKF A;  5F69 A;  4P6Z M;  4B9O A;  1FSY A;  4RX2 A;  3FWL A;  3R7W A;  2R78 A;  1YLZ A;  4ZJ3 A;  5J7E A;  1LLB A;  3Q7V A;  4PM9 A;  3IT9 A;  2WGW B;  3HBR A;  3UB9 A;  3NDG A;  4EUV A;  3C8C A;  1DY6 A;  5KSC A;  3T4S A;  4JF6 A;  5JYP A;  2OLU A;  1F9I A;  3QP1 A;  5DTK A;  5CXW A;  4MCW A;  4KUK A;  5M19 A;  2YKH A;  1LSW A;  1BZA A;  3LY3 A;  2ZQC A;  3IX3 A;  1S0W A;  2QHK A;  5K5B A;  2L4R A;  3PAE A;  1W63 Q;  3BJN A;  2ZOH A;  1DP6 A;  4GS9 A;  2LB5 A;  2OV5 A;  1IYQ A;  2W0N A;  4S2M A;  3QP8 A;  3MXQ A;  3KYZ A;  3UB8 A;  2P9V A;  2HDU A;  2UV0 E;  3NC8 A;  2ZC4 B;  1L0G A;  2BG1 A;  3L7H A;  2I72 A;  3HLE A;  1MWT A;  1GCE A;  3AGD A;  4DKI A;  3S7O A;  3NUL A;  3GRJ A;  1VET A;  3VSL A;  5AQA A;  3DTI A;  1VM1 A;  1T18 A;  4IVI A;  2Z6C A;  4GS9 B;  4YWZ A;  3PR6 A;  4JGP A;  2Y2M A;  3LIC A;  3V67 A;  3HLC A;  4CQH A;  4XT2 B;  4WYY A;  1LL8 A;  2P9V B;  2HDR A;  4LCL A;  3DTM A;  4GW9 A;  2Y55 A;  4IBX A;  2OAQ 1;  3EGX C;  4N92 A;  4Y0T A;  3ZHH A;  4MLL A;  1YLP A;  1EW0 A;  3PBT A;  3T1X A;  5KMW A;  3N4I A;  4GDB A;  1FR6 A;  4WF0 A;  3IF6 A;  4S2L A;  3WS4 A;  4ARZ A;  1CI9 A;  4E3I A;  1K6R A;  2V1A A;  4S2N A;  5E2G A;  2FZ0 A;  5AVE A;  4U3T A;  3V3S A;  5F82 A;  3MXS A;  1YLY A;  2WYX A;  3GV9 A;  2XLN A;  3HUN A;  3QP6 A;  4EER A;  3DWZ A;  4EXO A;  4I38 A;  2ZQA A;  2JE5 A;  2XH9 A;  1AXB A;  1IEL A;  5FQM A;  1OTE A;  4N9L A;  4DRT A;  2WKQ A;  2EFU A;  4GD6 A;  3D4F A;  3MF0 A;  4ME4 A;  2G2W A;  1NZO A;  3LI8 A;  3HLB A;  2EFX A;  3GVB A;  5DVA A;  4ARZ B;  3MQO A;  4II7 A;  4EWF A;  1RGZ A;  2O0Y A;  4HBU A;  5GHZ A;  2H0T A;  3ZG0 A;  3RJU A;  4WEL A;  5HWV A;  3PBS A;  3OLO A;  1XPB A;  5HX9 A;  1W8Y A;  1RGY A;  3EEA A;  5FQK A;  1CQA A;  5CGW A;  1FCO A;  1EWZ A;  1K57 C;  3BYD A;  4HH3 A;  3FKV A;  4BBV A;  2HGV A;  4BBT A;  4OLD A;  4DDS A;  1K54 A;  1KOU A;  4WEK A;  5E2F A;  5A93 A;  2PDR A;  2V1Z A;  2PBY A;  3E4P A;  3W4Q A;  4UEY A;  3GMW A;  3RXW A;  4ZJ2 A;  4EV4 A;  2ZMV A;  3QNB A;  1W63 M;  1ONH A;  5HAP A;  1EI5 A;  3M6H A;  3N8R A;  1JWP A;  1ERQ A;  3BFD A;  2V8F A;  4LLO B;  4L9E A;  3F1N A;  4BBU A;  3TE8 A;  5DTS A;  4BQM A;  1TS7 A;  5IHV A;  3UO9 A;  5DFY A;  3MJQ A;  4WM9 A;  3UY6 A;  3CUE C;  1LSX A;  2M7U A;  2BTF P;  4NXB A;  3FC7 A;  3P98 A;  3C7V A;  4Q0H A;  3RXX A;  3V3R A;  4QHC A;  4KG5 A;  3F1P A;  5EVI A;  3UDF A;  1I2S A;  1BLC A;  3HUM A;  3BFC A;  5CGS A;  4Y5F A;  4KZ9 A;  1TS6 A;  5J3W A;  2WKH A;  2W1T A;  4S2K A;  4WEJ A;  3LO7 A;  4HJ3 A;  1YKD A;  3F1N B;  5HD3 A;  3WS5 A;  5L2F A;  2ZM2 A;  3UE0 A;  1E3U A;  3ZCZ A;  4EET B;  2V2F F;  4O8G A;  3KO6 A;  5EOE A;  2QMI A;  4P85 A;  1GHI A;  4GD8 A;  1U60 A;  2WAE A;  3B3X A;  3CAX A;  1BLP A;  5GHY A;  3KSF A;  2EXB A;  3HLD A;  1ZTU A;  4X1M A;  4E3J A;  5FQQ A;  3VV4 A;  5J4E A;  4XXR A;  4CLC D;  2CC1 A;  1K4F A;  3F1P B;  3VP3 A;  3IXB A;  1PZP A;  3HUO A;  4WBG A;  5CEB A;  3D3O A;  3ZG8 B;  2PT7 A;  4I3A A;  1E25 A;  5CX7 A;  5HPI A;  1K55 A;  5CRF A;  4E3O A;  1WYB A;  2W1T B;  3UMD A;  3T50 A;  3GTC A;  3IWO A;  2DRW A;  2C6W B;  4UA6 A;  2VV6 A;  4S2P A;  3AGE A;  5HD5 A;  1KVL A;  4WN5 A;  3N8L A;  3NIA A;  3IS2 A;  1BYW A;  3TJZ C;  4K91 A;  4C75 A;  1NYM A;  4KQR A;  5U47 A;  3QP5 A;  4AFI A;  4CLC C;  1XP4 A;  3PBO A;  4JXS A;  2B95 A;  5HL1 A;  1ERO A;  5FL3 A;  4KZB A;  2ZC5 B;  4WZ4 A;  2VJW A;  4MN7 A;  3BM6 A;  3KX0 X;  1TDL A;  3ZYT A;  4HOI A;  1H3Q A;  4ZAM A;  5EUA A;  1HTZ A;  4Y3I A;  1ESI A;  3PYP A;  2E8I A;  1I5Q A;  1AWI A;  1HD8 A;  3JPU A;  1ZG6 A;  1G6O A;  1MPL A;  4P6B A;  3WS1 A;  5CTN A;  4RVA A;  3IS2 B;  1KE4 A;  4NXG A;  1PWC A;  2DNS A;  4LPZ A;  4GJ4 A;  4EEP A;  5HWT A;  2JKT I;  3IWQ A;  2XD1 A;  1T1A A;  3HJK A;  4NXF A;  4P0M A;  4DE1 A;  4DJ3 A;  2V9A A;  3PAG A;  3LFV A;  4FTX A;  1W7F A;  3MKF A;  5E2E A;  1IYO A;  2QJ7 A;  3C4O A;  2I9V A;  2XD5 A;  2VV8 A;  4NK3 A;  4MBK A;  3G31 A;  4IUK A;  1LI0 A;  1SKO A;  4GOG A;  4LCM A;  4MN6 A;  4WMC D;  1RP5 A;  4Y0O A;  1OTB A;  2Y79 A;  4OVD A;  2EA9 A;  1SHV A;  4O01 A;  3U4L P;  2HP9 A;  4KZA A;  4WL9 A;  3FV7 A;  5TFQ A;  2GZA A;  3SH9 A;  2WKI A;  3VFF A;  2QYB A;  3UPP A;  2W1R A;  4KZ4 A;  3MBZ A;  5I5L A;  4E6W A;  2LB9 A;  3RTY A;  3GSG A;  1XA7 A;  3UPN A;  4P6Z S;  1BT5 A;  2PYP A;  2XEP A;  4I3J A;  4ZDX A;  5EM0 A;  3SH7 A;  2ZOI A;  4OKP A;  5KIZ A;  2HZ5 A;  5L07 A;  2Q9M A;  3ZFZ A;  3TW8 A;  1MC0 A;  4OOL A;  5CHJ A;  5G4Y A;  4OQG A;  5EM1 A;  1CK3 A;  1BTL A;  1K4E A;  2K7S A;  1HVB A;  1OPX A;  4EES A;  1G6A A;  4FSF A;  3BFG A;  2XR0 A;  2HDQ A;  4LRY C;  3CMZ A;  1UWP X;  4ZBE A;  3FKW A;  4HBT A;  4S2N C;  5EVL A;  1NRF A;  4NG2 A;  5L09 A;  1G68 A;  3BFF A;  1MZU A;  3LI9 A;  4HIA A;  4S2I A;  3TG9 A;  3NOU C;  1P97 A;  4R23 A;  1KDW A;  3KSH A;  5DFX A;  5CTM A;  4R70 A;  4D2O A;  4L0L A;  1BLH A;  1RCJ A;  2IWD A;  4R4S A;  1ES5 A;  4K0X A;  3HJI A;  4JGQ A;  3EOI A;  2A49 A;  2XA7 M;  3ZG7 B;  5HSQ A;  3ZNY A;  5CHM A;  3JYI A;  1SCW A;  2B18 A;  1KDS A;  1OJG A;  2HP6 A;  5A92 A;  3ZG5 A;  2NUT C;  4Z1W A;  1H5X A;  5DF9 A;  1DJC A;  4EU0 A;  4RQ9 A;  3RFB A;  4U0T A;  2WKE A;  4UAA A;  3HVF A;  2XDM A;  2PU2 A;  4L9F A;  4BJP A;  2Y2P A;  4JPM A;  2EX8 A;  4U0X A;  3E2L A;  1G28 A;  5CHU A;  3MZD A;  1K38 A;  3VSK A;  5DKK A;  5IT5 A;  1K54 C;  2QJ5 A;  5EFW A;  5CED A;  1ODV A;  3SH8 A;  1S67 L;  4HJ4 A;  1Q2P A;  3UDX A;  4YIN A;  1OJ5 A;  3DTE A;  1NWZ A;  5AQB A;  4JF5 A;  3FPW A;  1PRQ A;  3UE3 A;  3NHQ A;  2KOI A;  5L10 A;  1FIK A;  1VB6 A;  1OTD A;  2Y2O A;  4XT2 A;  4LRX C;  2WZZ A;  5DJT A;  5HAR A;  1H0M A;  2ZL1 A;  3NEC A;  3KYE A;  3LR4 A;  5FEG A;  4L9G A;  1XJ2 A;  3SS4 A;  3RH8 B;  3A0S A;  3VOZ A;  1OT9 A;  1X0O A;  4R0Q A;  4DF6 A;  5HFO A;  5DF7 A;  5A8B A;  4N1H A;  1L0D A;  3T4Q A;  1PW8 A;  2JKR I;  1H8Y A;  4CJN A;  5GLD A;  3M2K A;  1Y54 A;  5CGX A;  2VGL S;  3GR2 A;  5G18 A;  3FPV A;  1FCN A;  4GNU A;  4OLG A;  3L9K A;  3S1Y A;  3T12 B;  2ZL1 B;  3QP4 A;  1S66 L;  3O87 A;  1CI8 A;  4OQ0 A;  3ULF A;  2H28 A;  1SKF A;  3TRC A;  4DXC A;  3NBL A;  2Y2I A;  1F5M A;  2ZM0 A;  4Y15 A;  1OTI A;  1FOF A;  2QPN A;  4O7D A;  3T1R A;  4WMC A;  2IWB A;  2JBF A;  1J9M A;  2ZC3 B;  1XKZ A;  1W8Q A;  3NJA A;  2R9W A;  2XSS A;  4LGW A;  1XGI A;  4YOF A;  1QMF A;  3IWI A;  4E3N A;  3SZT A;  2K2N A;  2EWV A;  3GEC A;  3S7Q A;  1H8Z A;  1WE4 A;  3IQA A;  1YAX A;  4PM6 A;  4EQI A;  3MQQ A;  3G4P A;  4Y2F A;  3CPT A;  4QY6 A;  4EBN A;  4KZ5 A;  1S6R A;  2EWW A;  4DE2 A;  4GKU A;  2NUP C;  5F68 A;  3VP2 A;  4QWO A;  1S4S A;  3U2A A;  4BMW A;  3ZQ5 A;  1L2S A;  3CG5 A;  3MSH A;  4Y7P A;  5LBR A;  1XX2 A;  1IKG A;  4LFU A;  4OH0 A;  4B4Z A;  3W2Z A;  2P08 A;  3EQU A;  4LEN A;  2V1B A;  4Q8I A;  2K31 A;  2V20 A;  4LV0 A;  4Q0J A;  4HHD A;  1FQG A;  4PM8 A;  1MY8 A;  3OPL A;  2EX9 A;  3UNW A;  1BUE A;  1M40 A;  4KG6 A;  2Q9N A;  3C2W A;  4XUZ A;  2Y8H A;  4KG2 A;  3BFE A;  3EGD C;  4DN0 A;  4O0P A;  3CPT B;  2PRF A;  4UQI M;  4IHQ A;  4WZ5 A;  2GJ3 A;  2GDN A;  1NRJ A;  2GNX A;  1FSW A;  1UGU A;  3W4O A;  5HL6 A;  5E43 A;  3LY4 A;  2Y91 A;  5FQ9 A;  5EV0 A;  3LID A;  4OP8 A;  2HJE A;  4S2J A;  1NLZ A;  4RA7 A;  5I94 A;  4KZ7 A;  4IBR A;  1D7E A;  2A24 A;  3DAV A;  4JGO A;  1GHM A;  4GCZ A;  3BW6 A;  2FFY A;  4K08 A;  4PKY A;  1SDE A;  1N4O A;  3VP4 A;  3LGO A;  3OPR A;  5FI6 A;  3R4K A;  3Q81 A;  5EOO A;  2J8Y A;  4Q0I A;  2VGJ A;  4HEF A;  4B93 A;  4ETX A;  4E04 A;  1G5U A;  3G32 A;  3P01 A;  5DJU A;  5FAQ A;  1XXM A;  3HLW A;  3KYQ A;  5FDH A;  3MS6 A;  2ZJ9 A;  3S7N A;  3PTE A;  3G2Y A;  2ZD8 A;  4QB8 A;  4QJG A;  2A24 B;  2A2L A;  1JNU A;  4FCF A;  2ZBB A;  3KSG A;  2Q0O A;  2PBD P;  3IXG A;  4IED A;  2EX2 A;  4MBH A;  3UE1 A;  1SDN A;  2VGK A;  5HAQ A;  4HQA A;  2VZW A;  3OCN A;  2X02 A;  3O86 A;  3A3E A;  3G34 A;  4EBL A;  1KE0 A;  1MWS A;  2W27 A;  1MWU A;  1PIO A;  1TS8 A;  1JTD A;  3MQ0 A;  3Q1F A;  1TS0 A;  4I3I A;  1MWR A;  2WAF A;  3MZE A;  2J3T C;  4HP9 A;  5FI2 A;  2EX6 A;  3IBR A;  2HDS A;  3SW1 A;  1SZV A;  5FAT A;  3LUQ A;  2WKR A;  4YNR A;  1S1Z A;  5D3O A;  4WUJ A;  1ZC2 A;  3T4O A;  3H9W A;  3IXH A;  3MR0 A;  3S7P A;  2L0W A;  1BLS A;  4ZTK A;  3UB5 P;  2OWJ A;  4B88 A;  2P74 A;  3K2N A;  2ZMF A;  3B47 A;  3MFX A;  3V39 A;  4DMZ A;  2VV7 A;  1MKI A;  3E4O A;  4R1G A;  3LIF A;  1S4R A;  4YFM A;  2O99 A;  1NYY A;  2PR6 A;  1NXY A;  4HH2 A;  3B42 A;  2FH5 A;  1V9Z A;  4MEZ A;  3LEQ A;  1N9N A;  1ES4 A;  5L8M A;  2QZ6 A;  2Y2H A;  1DRM A;  3QP2 A;  3ZVW A;  4GB7 A;  3OPH A;  4B4X A;  2EXA A;  1PWD A;  3DTK A;  4JGR A;  3VE3 A;  2Z2L B;  1VEU B;  3BLS A;  3UN7 A;  4Y0U A;  2WGV A;  1DJB A;  3NI9 A;  3FZC A;  5HAI A;  1DP8 A;  2KX6 A;  1D1J A;  4HI4 A;  4DDY A;  2O9C A;  3IH9 A;  4MDZ A;  3ZVT A;  3JVU A;  1IOU A;  4GDN A;  4N9K A;  4E3K A;  2J9P A;  3ZDJ A;  3IX4 A;  1C3B A;  2A3U A;  4F94 A;  1ERM A;  3UB7 A;  2OWH A;  4M4X A;  4JXV A;  3K3D A;  4LV2 A;  3CUE A;  1P0Z A;  4OQH A;  4R6L A;  3V5M A;  3T4K A;  1PFL A;  3BEB A;  4NXE A;  2WGI A;  4NET A;  2L1M A;  4EQ1 A;  1FR1 A;  4NEE D;  1WYC A;  1CEF A;  1XFQ A;  2KDK A;  1BUL A;  2ZMA A;  2AVX A;  4R3J A;  1XA1 A;  3SS5 A;  2XA7 S;  3W4P A;  1KVM A;  2Z2M B;  3VOY A;  4E3L A;  2IA2 A;  3TOI A;  3PBQ A;  2B02 A;  1P9R A;  2ZQD A;  5F1G A;  4EUZ A;  2OOL A;  4JLF A;  1PI5 A;  1WA9 A;  1XFN A;  3LIA A;  3IF6 C;  3CWF A;  1IKI A;  1N9B A;  5CER A;  4ESP A;  4EBP A;  1YMS A;  2J9O A;  4R3A A;  1XGJ A;  1PW1 A;  4BEN A;  3VFH A;  1QME A;  2ZLY A;  5E2H A;  3G30 A;  2V0W A;  4BL2 A;  2PR5 A;  1GA9 A;  1V9Y A;  4G3W A;  2R9X A;  2HF6 A;  2Y2N A;  2VKS A;  2RCX A;  2B5R A;  2W3F A;  4R3B A;  1CEG A;  3F1O A;  3W8K A;  4QPR A;  1CF0 A;  4OOM A;  3NCK A;  5FA7 A;  5FDS A;  4JXG A;  5TR7 A;  4G3V A;  2VA0 A;  3CLO A;  1F2K A;  1ACF A;  4CLC A;  3DWK A;  4DJ2 A;  1OTA A;  2PAV P;  1YM1 A;  3QNC A;  2W3H A;  3VOL A;  1TEM A;  4C3Q A;  2PU4 A;  1KGE A;  4PAU A;  1Z6F A;  4X25 A;  4R38 A;  1HZO A;  1PI4 A;  2J80 A;  1W5D A;  4Y17 A;  2P7J A;  1IYS A;  2Y59 A;  2X71 A;  4BWI A;  2DMW A;  3IHA A;  3Q7Z A;  3BQ8 A;  4NKP A;  2PHY A;  4LV1 A;  4ID4 A;  2XQZ A;  4WZ5 C;  2YKF A;  3F1O B;  2QKP A;  3CZD A;  3C4P A;  1KGF A;  5EVI D;  5EVE A;  3UB6 A;  3BWL A;  1GA0 A;  3O5Y A;  3Q82 A;  5KSH A;  3T1S A;  1YPR A;  3IH8 A;  1MBL A;  4PM7 A;  4FOF A;  4UA7 A;  3R7W B;  2ZQ7 A;  3T1Q B;  2VX8 A;  2P04 A;  1F98 A;  1N9O A;  4CLC B;  4C6Y A;  4QD4 A;  2VLG A;  4KZ8 A;  3Q7V B;  1VQQ A;  4HES A;  1E3U D;  1NLY A;  1K25 A;  1L3L A;  3LEZ A;  4M3K A;  4OON A;  4PMA A;  3ICY A;  2O9B A;  1FIL A;  2XFT A;  4UA9 A;  3NOT C;  3PBN A;  1XJ3 A;  3ISG A;  2HPB A;  3NOP C;  5FAO A;  3MXR A;  3S22 A;  4BD0 A;  3OPP A;  5EVI C;  5HDD A;  4DXB A;  1ES3 A;  1Y28 A;  3MKE A;  3HLG A;  4HP4 A;  4KZ6 A;  3G35 A;  5GL9 A;  3HCY A;  5M1A A;  1YMX A;  5GLB A;  1ZKJ A;  2JKT M;  5F1F A;  3EQV A;  3C38 A;  1TVF A;  5G4Z A;  1JVJ A; 
#chains in the Genus database with same CATH homology
 3ZYT A;  4PKY A;  4HOI A;  1H3Q A;  1S1Y A;  1IFQ A;  1UWN X;  3R4K A;  4Y3I A;  3PYP A;  4HY8 A;  5DKL A;  4Q0I A;  1XJ6 A;  5IS1 A;  5AJG A;  5F69 A;  4B93 A;  4P6Z M;  4B9O A;  4ETX A;  4E04 A;  2MJ6 A;  3LR0 A;  1G6O A;  4GHI A;  5AVF A;  1TD5 A;  3P01 A;  5DJU A;  3IS2 B;  3R7W A;  2R78 A;  4NXG A;  5HPF A;  3KYQ A;  3PBR A;  3K3C A;  2W3E A;  4LPZ A;  4GJ4 A;  4EEP A;  4KUO A;  5J7E A;  5HWT A;  3S7N A;  2JKT I;  1T1A A;  3HJK A;  4NXF A;  4DJ3 A;  2V9A A;  2M1C A;  3LFV A;  2A24 B;  2A2L A;  2QJ7 A;  2I9V A;  1JNU A;  4UQI S;  3UME A;  2VV8 A;  2ZBB A;  3KSG A;  3UB9 A;  5HDS A;  4EUV A;  3C8C A;  4IUK A;  3LR3 A;  3T4S A;  2BAS A;  1F9I A;  4HQA A;  2VGL M;  2VZW A;  4MN6 A;  3CIT A;  1OTB A;  3OCN A;  2Y79 A;  4MCW A;  2M7V A;  4KUK A;  1STZ A;  4WLA A;  2EA9 A;  4GHI B;  3OOV A;  2YKH A;  2W27 A;  4O01 A;  1LSW A;  2HJ9 C;  4WL9 A;  2J3W A;  3P7N A;  1TS8 A;  2QHK A;  3MQ0 A;  5K5B A;  4I3I A;  1TS0 A;  2L4R A;  2GZA A;  2J3T C;  4HP9 A;  1W63 Q;  3BJN A;  2ZOH A;  1DP6 A;  3IBR A;  4GS9 A;  2LB5 A;  2QYB A;  2W1R A;  5I5L A;  2W0N A;  2LB9 A;  3RTY A;  2PYR A;  3SW1 A;  3MXQ A;  3IBJ A;  4P6Z S;  3BY9 A;  3KSI A;  5TJJ A;  3LUQ A;  2WKR A;  4YNR A;  3KYZ A;  1S1Z A;  4I5S A;  2PYP A;  4I3J A;  3UB8 A;  4WUJ A;  2ZOI A;  3T4O A;  5KIZ A;  2W3G A;  3H9W A;  3MR0 A;  3TW8 A;  1MC0 A;  4OOL A;  3S7P A;  2L0W A;  5G4Y A;  3UE6 A;  3S7O A;  2D02 A;  2K7S A;  2OWJ A;  1OPX A;  1MKM A;  4EES A;  3K2N A;  4FSF A;  2ZMF A;  1VHM A;  1T1C A;  4H6J A;  3B47 A;  3MFX A;  4DMZ A;  1T18 A;  4LRY C;  1T1B A;  2VV7 A;  2INW A;  2Z6C A;  4GS9 B;  4YWZ A;  3E4O A;  1UWP X;  3PR6 A;  4JGP A;  3LIF A;  1S4R A;  2O99 A;  3DBA A;  3LIC A;  3V67 A;  2PR6 A;  4IJG A;  4HH2 A;  3B42 A;  2FH5 A;  1MZU A;  1V9Z A;  4CQH A;  3LI9 A;  4HIA A;  4XT2 B;  1LL8 A;  3NOU C;  1N9N A;  1P97 A;  3KSH A;  5DFX A;  3LYX A;  5L8M A;  2QWS A;  4R70 A;  4L0L A;  4GW9 A;  2OAQ 1;  2KLI A;  1DRM A;  1DP9 A;  3EGX C;  1OT6 A;  3HJI A;  4JGQ A;  3EOI A;  2XA7 M;  2J3T D;  5HSQ A;  1EW0 A;  3PBT A;  4JGR A;  3VE3 A;  2XRN A;  1GSV A;  4WF0 A;  2B18 A;  4H6J B;  4ARZ A;  1OJG A;  2NUT C;  4Z1W A;  2V1A A;  1DP8 A;  4MN5 A;  5DF9 A;  1GSW A;  2FZ0 A;  3A0R A;  3C30 A;  1LT0 A;  3CI6 A;  2KX6 A;  4RQ9 A;  4EU0 A;  5AVE A;  3RFB A;  4HI4 A;  3H7W A;  2O9C A;  4MDZ A;  3MMH A;  3PHY A;  4EER A;  4EXO A;  4I38 A;  3VE4 A;  4L9F A;  3JVU A;  1IOU A;  4BJP A;  2O9A A;  1OTE A;  3BQA A;  4IUH A;  3E4Q A;  3UB7 A;  1G28 A;  4ZRR A;  2OWH A;  4M4X A;  2WKQ A;  3MF0 A;  3K3D A;  5DKK A;  5HZH A;  5IT5 A;  2QJ5 A;  3E0Y A;  3CUE A;  1P0Z A;  5EFW A;  4R6L A;  4ME4 A;  5HDC A;  3LI8 A;  3B33 A;  1ODV A;  3T4K A;  1S67 L;  4HJ4 A;  4NXE A;  4ARZ B;  3MQO A;  1OJ5 A;  4II7 A;  1NWZ A;  4EQ1 A;  2L1M A;  2O0Y A;  3FPW A;  3UE3 A;  4NEE D;  2JKR M;  3NHQ A;  2KOI A;  4WEL A;  4ETZ A;  5HWV A;  1VB6 A;  1OTD A;  3OLO A;  3PBS A;  4XT2 A;  2D01 A;  3H7W B;  4LRX C;  1XFQ A;  2KDK A;  1P9W A;  5DJT A;  3EEA A;  5IU1 A;  3D72 A;  4HJ6 A;  2XA7 S;  3LR4 A;  1T19 A;  4L9G A;  3G6O A;  1XJ2 A;  3RH8 B;  4HH3 A;  4BBV A;  2HGV A;  2IA2 A;  4BBT A;  3A0S A;  1OT9 A;  1X0O A;  3T4L A;  3OBF A;  1KOU A;  3PBQ A;  4WEK A;  2B02 A;  1P9R A;  3LR5 A;  4CLC E;  4F3L A;  2OOL A;  2PDR A;  4PHT A;  1WA9 A;  5A8B A;  1XFN A;  3LIA A;  4LRZ E;  3CWF A;  3E4P A;  4I39 A;  3T4Q A;  2VEA A;  4UEY A;  2JKR I;  2ZMV A;  1D06 A;  3H82 A;  1W63 M;  2VGL S;  4R3A A;  2XRO A;  3FPV A;  4KQO A;  4LLO B;  2V0W A;  5HWW A;  2PR5 A;  4PKY G;  4L9E A;  3EEH A;  3F1N A;  1V9Y A;  4BBU A;  4G3W A;  3TE8 A;  3BY8 A;  2HF6 A;  1S66 L;  2G7U A;  1TS7 A;  2VKS A;  5DFY A;  2W3D A;  3A0V A;  3ULF A;  2W3F A;  3MJQ A;  2H28 A;  3TRC A;  2HV1 A;  3CUE C;  3F1O A;  4QPR A;  1LSX A;  1F5M A;  2M7U A;  4NXB A;  3FC7 A;  4GLQ A;  4Q0H A;  4F3L B;  1OTI A;  3E98 A;  4OOM A;  4EW7 A;  3NJA A;  2XSS A;  3F1P A;  4G3V A;  4YOF A;  3T4T A;  2VA0 A;  3CLO A;  3H82 B;  4CLC A;  4DJ2 A;  2Z6D A;  1OTA A;  1YSP A;  2K2N A;  2W3H A;  4MMN A;  3VOL A;  4Y5F A;  2EWV A;  3GEC A;  3S7Q A;  2OAP 1;  1TS6 A;  1H8M A;  4PAU A;  4EEU A;  5J3W A;  1N9L A;  4R38 A;  2W1T A;  4WEJ A;  1YAX A;  4HJ3 A;  1YKD A;  3F1N B;  2J80 A;  2P7J A;  5HD3 A;  4EET B;  4BWI A;  3MQQ A;  2DMW A;  4KQD A;  2WKP A;  4Y2F A;  3BQ8 A;  2EWW A;  3FG8 A;  4NKP A;  4O8G A;  2PHY A;  2NUP C;  5F68 A;  3KO6 A;  1S4S A;  3U2A A;  5TBM A;  4BMW A;  2YKF A;  3F1O B;  2QKP A;  3CAX A;  3ZQ5 A;  3KSF A;  5MC7 A;  1ZTU A;  5LBR A;  3UB6 A;  3BWL A;  3O5Y A;  5KSH A;  3VV4 A;  3W2Z A;  5J4E A;  2CMN A;  2P08 A;  2PD8 A;  3EQU A;  2GX5 A;  4CLC D;  2JN7 A;  2V1B A;  3F1P B;  1ZHH B;  2K31 A;  4FOF A;  4Q0J A;  3R7W B;  3GDI A;  2PD7 A;  4HHD A;  2VX8 A;  2P04 A;  1F98 A;  1TF1 A;  1N9O A;  3D3O A;  4CLC B;  2PT7 A;  2VLG A;  3EWK A;  1XJ4 A;  4I3A A;  5CX7 A;  5HPI A;  5F6A A;  1NLY A;  2W1T B;  3UMD A;  3T50 A;  3PXP A;  3C2W A;  2V0U A;  2Y8H A;  3ICY A;  3EGD C;  4DN0 A;  2O9B A;  4O0P A;  3NOT C;  3PBN A;  3T4J A;  1XJ3 A;  2VV6 A;  4UQI M;  4IHQ A;  2GJ3 A;  5TBM B;  1NRJ A;  2GNX A;  1GSX A;  1UGU A;  5HD5 A;  3NOP C;  4WN5 A;  5HL6 A;  3IS2 A;  1BYW A;  3TJZ C;  3JVV A;  5HDD A;  4G3K A;  5F5Y A;  3LID A;  1Y28 A;  3OC2 A;  4HNB A;  4AFI A;  4CLC C;  4HP4 A;  2HJE A;  3PBO A;  1NLZ A;  3OCL A;  3HCY A;  3LIB A;  5FL3 A;  1D7E A;  1YSQ A;  2A24 A;  5C5K A;  2JKT M;  3EQV A;  4JGO A;  2JHE A;  2VJW A;  3LIE A;  1LSV A;  4GCZ A;  4MN7 A;  3C38 A;  3KX0 X;  5G4Z A;  3BW6 A;  4K08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...