1GHMA

Structures of the acyl-enzyme complex of the staphylococcus aureus beta-lactamase mutant glu166asp:asn170gln with degraded cephaloridine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYDIELQYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
publication title Structures of the acyl-enzyme complexes of the Staphylococcus aureus beta-lactamase mutant Glu166Asp:Asn170Gln with benzylpenicillin and cephaloridine.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 93
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ghmA00
1RCJA 5KSCA 1VM1A 3NBLA 2J7VA 4JLFA 2EX6A 4DDYA 4QB8A 2DRWA 4Y0TA 1ZKJA 2P9VA 3JYIA 5EUAA 4RYEA 1TDLA 1XPBA 3RJUA 3OPHA 4E6XA 3IH8A 3G34A 1BT5A 2J9PA 1JWZA 2HPBA 1CK3A 2Y2QA 1JWPA 3FKVA 4BL2A 4EUZA 4ZJ3A 1K55A 2ZJ9A 3N8LA 2WKHA 1KE0A 1PIOA 3HUNA 3OPPA 4GN2A 5GLCA 3GR2A 5CRFA 1EWZA 4P0MA 1VQQA 4UA9A 4O7DA 3VSKA 1SDEA 3E2KA 5GHYA 5FQ9A 4JPMA 2IWBA 4OLGA 1BLCA 3A3IA 1CEFA 4ZJ1A 4P6BA 3V3RA 3AGDA 4OONA 3WS2A 5M1AA 3ZFZA 3IF6C 4RX2A 4JXWA 3BFEA 4WELA 1W7FA 3ZVTA 2H0TA 3HLDA 3NY4A 2X02A 5G18A 4IEDA 5KMWA 1GCEA 5A92A 4R3BA 5EVIC 1KDWA 5CEDA 5HX9A 3NCKA 4GNUA 4RVAA 5KSHA 3GVBA 1XP4A 1YLZA 4S2IA 1LL9A 2Z2LB 3UPPA 4B4XA 2XLNA 1FQGA 1MWUA 4GOGA 5TGFA 3G2YA 3Q81A 1ERQA 4FH4A 5CGXA 5EE8A 3HVFA 4JF6A 3UPNA 3MZEA 3IHAA 1L0GA 4KZ4A 1GA0A 3PBTA 3PAEA 3S4XA 3VSLA 2Y2PA 2BLSA 2ZC3B 4KZ7A 3UE3A 2P74A 4EBLA 1M6KA 4UA6A 4E3JA 1H8ZA 1NJ4A 1FCOA 4X53A 1ES5A 4WBGA 5CGWA 2DCFA 3VP1A 1HD8A 1ES4A 4DE1A 1FR6A 3MBZA 3BFDA 2Y2GA 5JYPA 5GHXA 3GMWA 4NK3A 2V1ZA 1YMXA 3ZGAB 4PM6A 1JTGA 1ONHA 2ZQAA 3GQZA 4OQHA 2ZC4B 5DF9A 1K54A 3B3XA 3OCLA 4JXGA 1I5QA 4BQMA 1K56D 5CTMA 4S2MA 1CEGA 1PW8A 1MKIA 1XKZA 3FYZA 4QY6A 3ZG0A 3HUMA 1E3UA 3TG9A 4Y7PA 1E4DA 5EOEA 2XR0A 4A5RA 3MXRA 3VP0A 1NRFA 4KZ8A 2JBFA 4K91A 4KZ9A 5TFQA 1L2SA 5FQMA 1E3UD 2WGWA 1SKFA 2EX8A 2X71A 2Y2IA 4R0QA 4KQOA 3HUOA 5JYOA 4XUXA 1NZUA 3WS0A 1WYBA 3A3JA 3IXGA 4CPKA 1NXYA 1ERMA 4ZAMA 5FASA 4OPYA 2WADA 3G35A 4GD8A 3RXWA 3UPOA 4DE3A 1FSWA 2RCXA 1WYCA 1Z6FA 3O87A 4R3JA 4JXVA 1FOFA 2ZC6B 3LY3A 4UAAA 2Y2OA 4LV3A 1K57C 4WMCA 1YLYA 1LI0A 2WKIA 3BFGA 4KZBA 5FQJA 3VFHA 1W79A 3BYDA 3V39A 3N6IA 4K0XA 1BLHA 3WWXA 4WMCD 3UO9A 1LHYA 1Q2PA 4JKTA 2XEPA 2WZXA 4S2JA 3W4OA 4UA7A 4OP8A 2Y2NA 3IWOA 3M2KA 3CMZA 1ZC2A 3IWQA 4JBFA 5FQKA 4KG6A 2ZM8A 2ZLYA 4WZ5C 4LCMA 3MKFA 3LY4A 4MEZA 1MPLA 4KENB 1YLJA 3BECA 2VGJA 2WYXA 4BJPA 1XA7A 2QZ6A 2EXBA 2H0YA 2ZQ9A 5EPHA 4UHUA 3C4OA 4EBNA 4BL3A 3VP2A 4HBTA 4B88A 5E2EA 2OLVA 1S6RA 4OQ0A 1I2WA 3OZHA 1MWRA 5FQIA 2JE5A 2J9OA 1PZPA 4OQGA 5EECA 3BLMA 3EQVA 4OVDA 5CECA 4KG5A 3OPRA 1XGIA 5E2HA 2HP5A 4OH0A 4N1HA 1PI4A 1W5DA 5EOOA 5BOHA 2XH9A 2HDRA 1E25A 1IYOA 1QMFA 3MFDA 4FH2A 1ZG6A 5CHUA 1K4EA 1FCMA 3ZCZA 3UN7A 5FQQA 2Q9MA 2ZMAA 4FCFA 4DXCA 1GHMA 2WGVA 2ZM0A 3CJMA 3GRJA 3WS4A 2XK1A 5E43A 1XX2A 4HBUA 2HDUA 2X01A 1YM1A 2P9VB 2J8YA 3SOIA 1OMEA 4R4SA 2C5WB 4S2OA 1C3BA 3O88A 2ZQ7A 1PYYA 3O3VA 3WRTA 3A3FA 4QU3A 5L2FA 1ALQA 4S2NC 5I94A 4D2OA 2EFXA 1BLPA 2XGNA 3GSGA 3IF6A 4OPZA 4H8RA 3UNWA 1SCWA 2HDQA 3CG5A 3Q07A 5F82A 4U0TA 3ZG9B 1CI8A 3C5AA 4Y0OA 4XXRA 4GDBA 1NYMA 3OC2A 5A90A 3VOYA 5EVIA 3DTMA 1KGFA 1YLTA 3MKEA 2HP6A 2XFTA 3TSGA 5HL1A 3UDXA 1IKGA 3VP3A 2E8IA 2Q9NA 1J9MA 2OLUA 3BRMA 4DRTA 3ZVWA 5EVID 1K6SA 1ES2A 1YMSA 4LCLA 3E2LA 5DF7A 2XD1A 3EQUA 3GV9A 4ZBEA 1BLSA 5AQ7A 3BFFA 3UDFA 2Y59A 1XXMA 1MXOA 2ZM2A 3DWKA 5D3OA 1K56A 5E2GA 1GHPA 2G2UA 3IF6B 5CERA 4IBRA 5CTNA 1FCNA 3VOZA 4F94A 1RP5A 2HDSA 1NZOA 2XQZA 2H10A 4WEKA 3UDIA 3WS5A 3CZDA 4GDNA 4OOLA 1KVMA 2WKEA 3AGEA 3N8SA 3LCEA 1BSGA 3G30A 3G4PA 5M18A 3V50A 3UE1A 1PWCA 1TDGA 4E6WA 4WM9A 3A3EA 4HEFA 5F83A 1YT4A 3LEZA 3FWLA 4IBXA 4KG2A 4LENA 1MWTA 4MBKA 2Y2LA 1HVBA 4KQRA 5AQAA 1ZG4A 2QMIA 4GB7A 1O07A 4JXSA 1YLPA 2EXAA 3HLEA 4QHCA 5KZHA 3SS5A 4DKIA 1PWDA 2OSUA 2Y2MA 5CHJA 3DWZA 3BEBA 4N1XA 4FSFA 3S1YA 5FAOA 2Y55A 1NY0A 2I72A 4EQIA 1IEMA 1KVLA 2ZQ8A 4PPRA 5GLBA 3UY6A 1ESUA 5CEBA 4GKUA 4GZBA 4OP5A 4WZ4A 1SDNA 1Q2QA 3NI9A 3OPLA 2G2WA 2OV5A 2Z2MB 1MY8A 3Q7VA 2V20A 1K25A 5DVAA 3SH8A 5HAQA 1ONGA 5FSRA 4DE2A 1YQSA 5FATA 5GHZA 3SH9A 3IT9A 2WGWB 4PMAA 1PI5A 3Q7ZA 3PAGA 4MNRA 4OOMA 1S0WA 2ZD8A 3ITAA 4R4RA 4S2KA 3ZG8B 3ZG5A 1GHIA 1G6AA 3C4PA 2QPNA 1MWSA 4MLLA 1IYPA 3Q1FA 3LO7A 3SS4A 2WK0A 3A3DA 1BULA 1K57A 2A49A 4X6TA 4ZDXA 1QMEA 2WAEA 2Y4AA 4N92A 5DTKA 5FDHA 4E3OA 4X69A 4JF4A 1M40A 4X55A 3HLBA 4ZTKA 5CGSA 2DNSA 1RGZA 3P09A 3NDGA 4OLDA 5CXWA 4Z9QA 3HLFA 3Q7VB 2WGIA 1I2SA 3FZCA 3PBQA 2IWCA 4WZ5A 2UWXA 3HL9A 2PBYA 3N8RA 1K55C 2GDNA 5A93A 1KE3A 2CC1A 3D4FA 4E3LA 2WUQA 5DF8A 2C6WB 3V5MA 2V2FF 5F1FA 2Y2HA 4BENA 4ZJ2A 3IQAA 3IF5A 1N4OA 2ZQCA 3IXBA 3QNBA 3RXXA 4E3MA 1PZOA 4BLMA 1BZAA 3VMAA 1HTZA 2JCHA 3VFFA 3ZG7B 1FR1A 1K4FA 5E2FA 3M2JA 3QHYA 2VGKA 1L0EA 1DJAA 5GL9A 3HBRA 1PWGA 4KZ3A 3TOIA 4N9LA 2HP9A 1WE4A 1L0DA 4DDSA 2FFFB 3I7JA 3ISGA 1H8YA 2Y2JA 1DJCA 1H5XA 3SH7A 3C7VA 3HLWA 4S2PA 1BTLA 3UE0A 4LV1A 3SS3A 3ZNYA 1N9BA 1TVFA 2R9XA 2PU4A 2XFSA 1LI9A 4LV0A 4OPQA 3DW0A 4S2LA 4WEJA 3FV7A 3W4PA 4DF6A 1XA1A 4EBPA 1IELA 1PW1A 4P85A 1IKIA 4WYYA 5IHVA 5HFOA 4S2NA 4X68A 4CJNA 4K0WA 2XDMA 1L0FA 4R1GA 5GLAA 3WS1A 3P98A 4KZ6A 4DXBA 4QJGA 4C75A 5FI6A 2RL3A 2Y2KA 2WZZA 4E3IA 3G32A 1KGEA 4QD4A 5DTTA 1JVJA 2Y91A 3Q82A 4QY5A 3BLSA 4E3KA 1LL5A 4OOYA 4L0LA 4LV2A 2ZC7A 4IVIA 3ZDJA 5FAPA 1XGJA 2WAFA 5GLDA 5A91A 1O7EA 1RGYA 2EX2A 5CHMA 3FKWA 5EVLA 4DE0A 2XD5A 3PBNA 1K54C 5FI7A 1FSYA 2JC7A 2PU2A 1CI9A 1HZOA 3IXDA 4BD0A 4Q8IA 4PM5A 1U60A 4E3NA 4PM9A 1JTDA 5EVIB 2EX9A 4GD6A 1LLBA 4RX3A 1DJBA 4U3TA 4U0XA 5HARA 3IWIA 1IYQA 4IVKA 2B5RA 3MZDA 4NETA 4OPRA 4HESA 1IYSA 1W8QA 5HAPA 1KE4A 3BM6A 4MBFA 2ZC5B 1SHVA 1DY6A 1G68A 3AGFA 2BG1A 1EI5A 3M6HA 1ES3A 5FAQA 3G2ZA 3W4QA 3MXSA 4OKPA 1KDSA 5DTSA 3PBOA 4KZAA 5HAIA 4XUZA 4JF5A 2IWDA 3G31A 5FI2A 5HW3A 4Y0UA 3PBSA 4C6YA 4M3KA 3MZFA 3IH9A 1JWVA 3HREA 2EFUA 1BUEA 1W8YA 3HLGA 4C3QA 3IHBA 4X56A 3HLCA 2FFYA 2R9WA 3BFCA 4PM8A 4PM7A 4RA7A 5U47A 2XF3A 5TR7A 2ZQDA 1Y54A 5F1GA 3VP4A 2H5SA 3O86A 3WRZA 3OCNA 3C7UA 1KGGA 5M19A 1K38A 3NC8A 5AQ9A 1ESIA 4R23A 5J8XA 2A3UA 4KQQA 4EWFA 3N7WA 4P87A 3N4IA 4ID4A 3NIAA 1GA9A 3PTEA 4N9KA 3M6BA 3GTCA 5AQBA 1YLWA 3S22A 1NYYA 3ZHHA 3V3SA 1AXBA 1TEMA 3QNCA 3ITBA 1MBLA 3NDEA 4B4ZA 3ZNTA 3PBRA 4MBHA 4YFMA 4BD1A 4EV4A 4FD8A 3IXHA 4KZ5A 4OQIA 3W8KA 5FA7A 1EROA 4YINA 1K6RA
chains in the Genus database with same CATH superfamily
1VM1A 3NBLA 2EX6A 5LBRA 1TDLA 2ZBBA 3IH8A 1NLYA 2HPBA 3FKVA 4EUZA 3N8LA 1KE0A 5CRFA 4JGQA 3CUEC 4UA9A 3VSKA 5GHYA 4OLGA 2O99A 3A3IA 4CQHA 2A24B 5M1AA 4HJ6A 4RX2A 1W7FA 3ZVTA 2PR6A 2V0WA 2PBDP 5A92A 2O9BA 5EVIC 1T1CA 1YAXA 5HX9A 4GNUA 1YLZA 1LL9A 1XFNA 3T1RA 3BY9A 4CLCB 3Q81A 1N9NA 3IHAA 4KZ4A 1GA0A 3PBTA 5DKKA 3R7WA 3PAEA 2P74A 2QJ7A 1FCOA 4WBGA 5CGWA 3VP1A 4DN0A 3HJKA 3BFDA 2Y2GA 5GHXA 1W63Q 4LRYC 4NK3A 2V1ZA 3ZGAB 4PM6A 5TBMA 5C5KA 2J3TD 1K56D 3ZG0A 4BWIA 1E4DA 3HJIA 2XR0A 3MXRA 3VP0A 1NRFA 4KZ9A 2WGWA 5HDCA 2EX8A 4GJ4A 5EV0A 5HDSA 4KQOA 2FH5A 1NZUA 3WS0A 3A3JA 3QP6A 5DJTA 1ERMA 4ZAMA 5FASA 4OPYA 3G35A 2RCXA 4F3LB 2ZC6B 3LY3A 3T50A 4UAAA 4KZBA 3F1NA 1TS0A 4K0XA 5IU1A 4JKTA 2XEPA 2W3DA 4S2JA 3LY4A 1MPLA 4BJPA 3BECA 2WYXA 2ZQ9A 5EPHA 3VP2A 2K2NA 5G4ZA 3LIAA 2OLVA 1S6RA 2M7UA 1I2WA 1MWRA 3EQVA 5CECA 4KG5A 1XGIA 5EOOA 5DFXA 5BOHA 1E25A 1UGUA 1V9ZA 5CHUA 1K4EA 1FCMA 3ZCZA 2K31A 2Q9MA 3S7PA 1OPXA 2JKFA 2ZM0A 4I39A 2YKFA 3FG8A 5IT5A 1OMEA 2C5WB 2ZQ7A 1PYYA 1MC0A 3A3FA 4QU3A 4S2NC 5I94A 4OPZA 3UNWA 3CG5A 3Q07A 5F82A 3ZG9B 4KUOA 5A90A 1KGFA 5HL1A 2E8IA 1J9MA 2OLUA 5CX7A 2M1CA 4WN5A 1ES2A 1YMSA 4IJGA 3EQUA 3GV9A 4ZBEA 1BLSA 1S1ZA 5AQ7A 2Y59A 2ZM2A 1K56A 2JHEA 5CTNA 4F94A 1RP5A 3WS5A 3ULFA 3CZDA 3R4KA 3N8SA 5HWVA 1SZVA 1PWCA 2OOLA 3VE3A 3FWLA 4KQRA 1HVBA 3RH8B 4MMNA 3S7OA 2WKPA 2QWSA 2DMWA 1WA9A 2Y2MA 1VEUA 3RTYA 3TW8A 2OAQ1 4N1XA 1XJ2A 4EQIA 4PPRA 1BYWA 1P9RA 4OP5A 1SDNA 1Q2QA 2O9AA 2Z2MB 3CLOA 4DE2A 2W0NA 3EOIA 4PHTA 3Q7ZA 4EEPA 4EQ1A 4OOMA 3ITAA 4S2KA 1GHIA 3IX8A 1MWSA 4MN5A 1Z09A 3LYXA 5L07A 2W3HA 2VK3A 2ZL1B 1K57A 2A49A 4X69A 3CAXA 4X55A 2FZ0A 2DNSA 4X1MA 4OLDA 1TF1A 3FZCA 3EGXC 1N9LA 2KX6A 5A93A 4II7A 2CC1A 3F1OB 4WLAA 3V5MA 3LIEA 3IQAA 3QNBA 3RXXA 1PZOA 4BLMA 1BZAA 2V1AA 2W3FA 2ZMFA 1K4FA 3H9WA 3M2JA 3QHYA 4O0PA 2VGKA 2BASA 3LICA 4KZ3A 5IS1A 3TOIA 4IUHA 3I7JA 3BW6A 1H8YA 1H5XA 4ME4A 1N9BA 1J3WA 3IS2A 3E98A 4HP4A 4LV0A 1XA1A 4EBPA 4WYYA 1PW1A 4CJNA 2XDMA 4R1GA 3WS1A 3LIFA 4C75A 1LT0A 2HZ5A 4NXFA 2YKHA 3LR0A 3DBAA 1LL5A 2J3TC 4L0LA 5FAPA 2W1TB 3MR0A 1O7EA 5CHMA 1XFQA 3MQ0A 4MCWA 1K54C 5FI7A 1FSYA 2JC7A 2PU2A 4E3NA 5EVIB 4R3AA 4RX3A 4FTXA 4CLCE 4IVKA 3P7NA 2B5RA 4HESA 1F5MA 4YNRA 2W3GA 1EI5A 3W4QA 1PNEA 1XJ3A 3MXSA 4RQ9A 2HJEA 1PRQA 4OKPA 3CI6A 4KZAA 4JF5A 3ZYTA 5FI2A 4C6YA 3KX0X 2EWVA 4M3KA 3MZFA 1T18A 1IOUA 2EFUA 2EWWA 3HLGA 4X56A 2V8CA 2XF3A 1T1BA 2L1MA 5F1GA 3UB9A 2H5SA 1KGGA 3BJNA 3TE8A 4R23A 5J8XA 2JKRI 4N9KA 1ZTUA 1AXBA 3QNCA 3D9YA 3VOLA 4BD1A 3LI8A 2JKRM 3IXHA 1G6OA 1RCJA 2J7VA 4QB8A 2DRWA 3JYIA 1XPBA 1S66L 2XROA 4FOFA 5F69A 1JWPA 4B93A 4ZJ3A 2A2LA 5GLCA 3F1PA 2LB9A 4Y15A 3E2KA 4L9EA 2IWBA 1BLCA 3AGDA 4OONA 2PT7A 2PHYA 2H0TA 1MKMA 4QWOA 3T1SA 2G7UA 1GSVA 5G18A 1NWZA 2WKQA 4IEDA 1GCEA 4R3BA 4UQIS 3NCKA 4ARZA 3GVBA 4S2IA 1A0KA 2Z2LB 1FQGA 3G2YA 3T1XA 4FH4A 5EE8A 5EM1A 3MZEA 1EW0A 3S4XA 4HQAA 2BLSA 4ETZA 3UE3A 1M6KA 1H8ZA 1NJ4A 3CITA 1HD8A 1ES4A 3GMWA 3NOTC 4LLOB 1YMXA 4B9OA 1ONHA 2ZQAA 1HLUP 2UV0E 2ZC4B 5CTMA 1PW8A 3HUMA 1E3UA 5EOEA 3R7WB 1LL8A 4HI4A 4KZ8A 5TFQA 1SKFA 3T1QB 1LSWA 2X71A 1NLZA 4I3IA 3QP1A 5HWWA 3IXGA 5TBMB 1NXYA 2WADA 3UPOA 3H82A 4JXVA 1FOFA 4LV3A 4WMCA 2WKIA 1FILA 4R6LA 1W79A 5HWTA 3UO9A 1LHYA 1H8MA 4EERA 2WZXA 3B47A 3W4OA 4OP8A 2Y2NA 2PD7A 5FQKA 2Z6DA 2Z6CA 4KG6A 2ZM8A 4LCMA 4MEZA 4KENB 1XA7A 2QZ6A 2H0YA 4EBNA 4UHUA 3C4OA 2ACGA 4BL3A 4DJ3A 4QPRA 4HBTA 4BBUA 2PDRA 5AVFA 2JE5A 5HPIA 5AJGA 5EECA 2GJ3A 3OPRA 3JPUA 2HP5A 1F9IA 1QMFA 3MFDA 4M4XA 3GECA 3IX4A 3IBJA 4FCFA 4DXCA 1GHMA 1D06A 2KOIA 5E43A 1F2KA 2HDUA 2ZOHA 2P9VB 1VB6A 3LFVA 3SOIA 1C3BA 3EEHA 1P9WA 3GSGA 3IF6A 4YWZA 2HDQA 4UEYA 3U2AA 1CI8A 4XXRA 4GDBA 4JGRA 1OTIA 1TD5A 4Y3IA 2Y79A 1TS7A 5FEFA 4BBTA 2NUTC 3RFBA 1YPRA 1XXMA 3LGOA 3VOZA 4GHIA 2HDSA 4WEKA 3UDIA 3EWKA 3G6OA 3DTEA 3PHYA 2VV6A 1BSGA 3G30A 3L9KA 4HEFA 5F83A 5L8MA 4IBXA 4R38A 3TJZC 4MBKA 4PKYG 2ZOIA 4GB7A 1D7EA 4QHCA 4JXSA 1O07A 1ACFA 2PR5A 2VLGA 5KZHA 1PWDA 5CHJA 3FPWA 4HNBA 4L9GA 3BEBA 4Y13A 2Y55A 2I72A 2ZQ8A 1ESUA 4GZBA 4WZ4A 2OV5A 3OPLA 3E4QA 3T4OA 1K25A 3LR4A 1ONGA 1OJ5A 5FATA 4O8GA 3IT9A 3SH9A 4MNRA 3ZG8B 5KMWA 3ZG5A 1S0WA 4LRZE 1G6AA 3C4PA 1S4SA 1SKOA 3SS4A 3CPTB 1DP8A 2Y4AA 4JF4A 3HLBA 1RGZA 2M7VA 3GDIA 3KYEA 3HLFA 2WGIA 4WZ5A 1CQAA 2UWXA 2A24A 3N8RA 2HF6A 1KE3A 5F1FA 4BENA 3NOPC 1N4OA 3IXBA 4I3AA 5I5LA 1HTZA 2JCHA 1FR1A 3MMHA 3S7QA 1PWGA 3A0SA 4CLCA 4N9LA 2HP9A 1L0DA 2FFFB 4LRXC 1X0OA 3SH7A 3UE6A 4S2PA 1BTLA 3T4SA 3SS3A 3ZNYA 2R9XA 2KLIA 4S2LA 3D72A 3FV7A 3A0VA 2VKSA 4P85A 5IHVA 1IKIA 1DP9A 2VV7A 4X68A 3FC7A 1L0FA 5GLAA 4DXBA 5EVEA 4Q0IA 3ZQ5A 5F5YA 4E3IA 1JVJA 4QY5A 3ZDJA 1XGJA 5GLDA 5A91A 2EX2A 2GNXA 3FKWA 3PBNA 2ZMVA 4Q8IA 2XSSA 1LLBA 3IWIA 1IYQA 3LEQA 4NETA 3UB7A 1IYSA 1W8QA 5HAPA 1KE4A 2ZC5B 1VETB 4F3LA 2P04A 5FAQA 1UWPX 1UWNX 1W63M 3V67A 4G3WA 3E0YA 4XUZA 4MN6A 1STZA 1W8YA 4C3QA 3IHBA 3HLCA 2R9WA 3BFCA 2B95A 2ZQDA 1Y54A 3O86A 3C7UA 3NC8A 1ESIA 4KQQA 4KQDA 4EWFA 3N7WA 4P87A 3N4IA 4ID4A 1GA9A 4AFIA 4XT2B 3PR6A 4YOFA 5J4EA 5TJJA 1TEMA 3ITBA 1MBLA 3IBRA 3PBRA 4YFMA 4FD8A 3W8KA 5FA7A 1EROA 3H7WB 3BQ8A 1H0MA 4DDYA 1ZKJA 3JVVA 3RJUA 3OPHA 3G34A 1BT5A 2Y2QA 4KUKA 1K55A 2ZJ9A 4GN2A 3HUNA 4Y5FA 3GR2A 4P0MA 4Z1WA 1SDEA 4LFUA 5FQ9A 4JPMA 1CEFA 4ZJ1A 3V3RA 5HL6A 2EA9A 3ZFZA 5K5BA 2QJ5A 3DAVA 3HLDA 3NY4A 3BWLA 3C2WA 5EM0A 1KDWA 4X1LA 4NEED 4B4XA 3T4QA 2XLNA 1DRMA 1MWUA 4GOGA 1ERQA 5CGXA 3HVFA 1AWIA 1L0GA 4GLQA 4EESA 5F68A 2Y2PA 2VZWA 1ES5A 1GSXA 4DE1A 1FR6A 5HSQA 5JYPA 3KYQA 4ARZB 4HOIA 4GS9A 1JTGA 3TRCA 3OLOA 1Y28A 3GQZA 4OQHA 5DF9A 5L09A 3OCLA 1CEGA 4R70A 1MKIA 2PD8A 3FYZA 4QY6A 4Y7PA 1H3QA 4A5RA 4BMWA 2JBFA 4K91A 1L2SA 1E3UD 2V0UA 2Y2IA 1S4RA 5JYOA 4XUXA 2XRNA 2ZL1A 3E4OA 4HH2A 3RXWA 5DFYA 4DE3A 1FSWA 4R3JA 2QKPA 2Y2OA 1K57C 1YLYA 1LI0A 4GW9A 3T4LA 2KDKA 3QP8A 3BYDA 3V39A 3N6IA 1BLHA 2K7SA 4WMCD 3CHWP 3F1OA 4UA7A 1IFQA 3VV4A 1DP6A 3IWQA 3SZTA 1YLJA 4B88A 2AVXA 2W27A 4OQGA 4OVDA 5E2HA 4OH0A 4N1HA 1PI4A 2XH9A 2HDRA 3O5YA 1IYOA 1ZG6A 4H6JB 3UN7A 2VA0A 3MQOA 3C30A 2OWJA 2WGVA 3CJMA 3GRJA 3WS4A 1XX2A 1YM1A 2MJ6A 3CUEA 4R4SA 4NXBA 4S2OA 3O3VA 3MFXA 1KOUA 4D2OA 2EFXA 1BLPA 2XGNA 4HHDA 3NHQA 2W1TA 4U0TA 2VJWA 1XJ4A 5EVIA 3TSGA 3UDXA 3VP3A 2Q9NA 3ZVWA 1K6SA 1OTBA 2XD1A 3BFFA 4HJ4A 3UDFA 3SW1A 3DWKA 3KSFA 5E2GA 1GHPA 2G2UA 3IF6B 4IBRA 4MDZA 2WKEA 3AGEA 3G4PA 3V50A 1TDGA 4E6WA 1YT4A 3LEZA 4HY8A 4KG2A 2VX8A 3PYPA 1CJFA 2Y2LA 5AQAA 2PRFA 1ZG4A 2QMIA 4DMZA 4IHQA 1YLPA 3HLEA 3EEAA 3SS5A 4DKIA 4HJ3A 5MC7A 2OSUA 3DWZA 3UB6A 1OTDA 3D3OA 4FSFA 3UB8A 5FAOA 1NY0A 1IEMA 3UY6A 5CEBA 3NI9A 2G2WA 1MY8A 3Q7VA 3SH8A 3UB5P 5HAQA 5FSRA 1YQSA 5GHZA 1LSXA 2WGWB 4PMAA 4R4RA 2ZD8A 4BBVA 2VGLM 2QPNA 4MLLA 3U4LP 3LO7A 4I38A 4X6TA 1BULA 3T4TA 5DTKA 2WAEA 5FDHA 4E3OA 1M40A 4O01A 4ZTKA 5HD3A 3P09A 5CXWA 4Z9QA 3DTKA 2GX5A 3F1NB 1I2SA 3PBQA 3LUQA 2IWCA 2VV8A 3T4JA 3HL9A 3NULA 3K3CA 4E3LA 5DF8A 2PAVP 2C6WB 4ZJ2A 2ZQCA 1SKOB 4E3MA 4I3JA 3VMAA 3MSHA 5F6AA 1L0EA 1DJAA 5GL9A 3W2ZA 2HJ9C 4NXGA 4DDSA 3ISGA 2Y2JA 2CMNA 3LIBA 4CLCD 3C7VA 3HLWA 1N9OA 3UE0A 4ESPA 1TVFA 2PU4A 1LI9A 4HP9A 4OPQA 3DW0A 3W4PA 3K3DA 4DF6A 4EUVA 1IELA 5HFOA 4S2NA 4K0WA 5L10A 5FI6A 2WZZA 3G32A 1KGEA 4QD4A 5DTTA 3Q82A 4E3KA 4OOYA 4LV2A 2ZC7A 4IVIA 5EVLA 4DE0A 2O0YA 1HZOA 3KO6A 1JTDA 2EX9A 1V9YA 3UMDA 4EW7A 3MZDA 5DKLA 3T12B 3KSGA 1G68A 3AGFA 4HIAA 1OJGA 3M6HA 1ES3A 4JGPA 3G2ZA 1NRJA 3MF0A 4JGOA 5DTSA 5HAIA 1VHMA 3PBSA 2J3WA 1P0ZA 1T1AA 3IH9A 2Q0OA 1BUEA 2HGVA 5U47A 4RA7A 2L4RA 4Q0HA 2QYBA 3VP4A 1VEUB 3EGDC 5M19A 1T19A 3NECA 1YSPA 2A3UA 3PTEA 3QP2A 2P7JA 5AQBA 1YLWA 1NYYA 3V3SA 2B18A 4B4ZA 4X25A 4MBHA 4KZ5A 2QHKA 1K6RA 4ZRRA 5KSCA 4JLFA 4Y0TA 2P9VA 5EUAA 4RYEA 3K2NA 3MQQA 3FPVA 4E6XA 4D60A 2J9PA 1JWZA 1CK3A 1PFLA 4EU0A 4BL2A 3E4PA 2WKHA 3LI9A 1PIOA 3OPPA 1EWZA 3KYZA 1VQQA 4O7DA 4NXEA 4K08A 3LIDA 4P6BA 5HZHA 4GCZA 3BY8A 3WS2A 3IF6C 4JXWA 3BFEA 4WELA 2X02A 4EETB 5CEDA 5J7EA 4RVAA 5KSHA 1XP4A 3OOVA 5AVEA 3UPPA 5TGFA 4G3VA 4NG2A 4JF6A 3UPNA 1YSQA 3IS2B 3VSLA 4KZ7A 3QP4A 2ZC3B 4EBLA 4UA6A 1JNUA 4E3JA 4IUKA 4X53A 2DCFA 3MBZA 5J3WA 1S67L 5HDDA 4PAUA 4FUWA 3QP5A 1K54A 3B3XA 4JXGA 1I5QA 4BQMA 2VEAA 4S2MA 1XKZA 4G3KA 5EFWA 3TG9A 1YKDA 5FQMA 4WL9A 3KSIA 4R0QA 4E04A 1OTAA 5KIZA 3HUOA 3CPTA 1WYBA 4GS9B 4CPKA 1GSWA 4GD8A 3OBFA 1WYCA 1Z6FA 3O87A 2JN7A 3NOUC 5FQJA 3BFGA 3VFHA 3WWXA 1Q2PA 2OWHA 2L0WA 3IWOA 3M2KA 4JBFA 3CMZA 1ZC2A 4L9FA 2ZLYA 4WZ5C 3MKFA 1TS6A 1OT9A 2VGJA 2EXBA 5FDSA 5A8BA 1LSVA 2E8JA 3LR5A 5E2EA 1S1YA 4OQ0A 3OZHA 5FQIA 2J9OA 1PZPA 2B02A 3BLMA 1W5DA 2H28A 3C38A 4WF0A 1L3LA 4FH2A 2PYRA 4CLCC 5FQQA 4EXOA 2ZMAA 4EEUA 1ODVA 2J80A 3L7HA 2I9VA 2XK1A 4HBUA 2X01A 2Y8HA 2LB5A 2J8YA 3O88A 3WRTA 5L2FA 1ALQA 4Y17A 4LGWA 3F1PB 4H8RA 1SCWA 3CWFA 3C5AA 4Y0OA 4Q0JA 1NYMA 3S7NA 3OC2A 3VOYA 3LR3A 3DTMA 1YLTA 3MKEA 2HP6A 2XFTA 1IKGA 1OT6A 4ETXA 4MN7A 3BRMA 4DRTA 5EVID 4LCLA 2P08A 3E2LA 3JVUA 5DF7A 5HD5A 1VETA 5D3OA 1MXOA 5CERA 1FCNA 2XQZA 1NZOA 2H10A 1K0KA 4GDNA 4OOLA 1KVMA 3LCEA 5FEGA 2BTFP 3UE1A 4WM9A 3A3EA 4LPZA 3IX3A 4LENA 1MWTA 4I5SA 2V8FA 2EXAA 2D02A 5G4YA 3S1YA 1KVLA 2R78A 5GLBA 4XT2A 4GKUA 5M18A 2W3EA 2V20A 5HPFA 3PXPA 5DVAA 1PI5A 3PAGA 2O9CA 3B42A 3H7WA 1IYPA 3Q1FA 5DJUA 2WK0A 3A3DA 4ZDXA 1QMEA 4N92A 3H82B 5CGSA 1FIKA 2INWA 3NDGA 1MZUA 2OAP1 3Q7VB 2PBYA 1K55C 2GDNA 3D4FA 2WUQA 2V2FF 2Y2HA 3A0RA 3IF5A 3KSHA 1TS8A 3VFFA 3ZG7B 5E2FA 5FL3A 2NUPC 1G28A 3HBRA 3DTIA 1WE4A 4NKPA 3UMEA 2V1BA 1DJCA 3BQAA 1OTEA 4UQIM 4LV1A 3ICYA 2XFSA 4PKYA 2WKRA 4WEJA 2GZAA 3HCYA 3P98A 4KZ6A 4QJGA 3VE4A 2RL3A 2Y2KA 2PYPA 2Y91A 3BLSA 2W1RA 2JKTI 3T4KA 4WUJA 1XJ6A 3NJAA 2V9AA 2WAFA 4DJ2A 1RGYA 1F98A 2XD5A 3MJQA 3IXDA 1CI9A 4BD0A 4PM5A 1U60A 1ZHHB 3MXQA 4PM9A 2XA7M 2JKTM 4GD6A 1DJBA 3P01A 4U3TA 4U0XA 5HARA 4OPRA 2JKGA 2XA7S 3BM6A 4MBFA 4Y2FA 1SHVA 1DY6A 2BG1A 4GHIB 1KDSA 2IA2A 3PBOA 2IWDA 3G31A 5HW3A 4Y0UA 3MS6A 1JWVA 3C8CA 3HREA 4P6ZM 4PM8A 1D1JA 2FFYA 4PM7A 5TR7A 3WRZA 4P6ZS 3OCNA 1K38A 5AQ9A 2HV1A 1CF0A 2VGLS 1G5UA 3NIAA 1P97A 4HH3A 3M6BA 3GTCA 2D01A 3S22A 3ZHHA 3NDEA 4H6JA 3ZNTA 4EV4A 3B33A 4OQIA 1Y4OA 4YINA
chains in the Genus database with same CATH topology
1RCJA 5KSCA 1VM1A 3NBLA 2J7VA 4JLFA 2EX6A 4DDYA 4QB8A 2DRWA 4Y0TA 1ZKJA 2P9VA 3JYIA 5EUAA 4RYEA 1TDLA 1XPBA 3RJUA 3OPHA 4E6XA 3IH8A 3G34A 1BT5A 2J9PA 1JWZA 2HPBA 1CK3A 2Y2QA 1JWPA 3FKVA 4BL2A 4EUZA 4ZJ3A 1K55A 2ZJ9A 3N8LA 2WKHA 1KE0A 1PIOA 3HUNA 3OPPA 4GN2A 5GLCA 3GR2A 5CRFA 1EWZA 4P0MA 1VQQA 4UA9A 4O7DA 3VSKA 1SDEA 3E2KA 5GHYA 5FQ9A 4JPMA 2IWBA 4OLGA 1BLCA 3A3IA 1CEFA 4ZJ1A 4P6BA 3V3RA 3AGDA 4OONA 3WS2A 5M1AA 3ZFZA 3IF6C 4RX2A 4JXWA 3BFEA 4WELA 1W7FA 3ZVTA 2H0TA 3HLDA 3NY4A 2X02A 5G18A 4IEDA 5KMWA 1GCEA 5A92A 4R3BA 5EVIC 1KDWA 5CEDA 5HX9A 3NCKA 4GNUA 4RVAA 5KSHA 3GVBA 1XP4A 1YLZA 4S2IA 1LL9A 2Z2LB 3UPPA 4B4XA 2XLNA 1FQGA 1MWUA 4GOGA 5TGFA 3G2YA 3Q81A 1ERQA 4FH4A 5CGXA 5EE8A 3HVFA 4JF6A 3UPNA 3MZEA 3IHAA 1L0GA 4KZ4A 1GA0A 3PBTA 3PAEA 3S4XA 3VSLA 2Y2PA 2BLSA 2ZC3B 4KZ7A 3UE3A 2P74A 4EBLA 1M6KA 4UA6A 4E3JA 1H8ZA 1NJ4A 1FCOA 4X53A 1ES5A 4WBGA 5CGWA 2DCFA 3VP1A 1HD8A 1ES4A 4DE1A 1FR6A 3MBZA 3BFDA 2Y2GA 5JYPA 5GHXA 3GMWA 4NK3A 2V1ZA 1YMXA 3ZGAB 4PM6A 1JTGA 1ONHA 2ZQAA 3GQZA 4OQHA 2ZC4B 5DF9A 1K54A 3B3XA 3OCLA 4JXGA 1I5QA 4BQMA 1K56D 5CTMA 4S2MA 1CEGA 1PW8A 1MKIA 1XKZA 3FYZA 4QY6A 3ZG0A 3HUMA 1E3UA 3TG9A 4Y7PA 1E4DA 5EOEA 2XR0A 4A5RA 3MXRA 3VP0A 1NRFA 4KZ8A 2JBFA 4K91A 4KZ9A 5TFQA 1L2SA 5FQMA 1E3UD 2WGWA 1SKFA 2EX8A 2X71A 2Y2IA 4R0QA 4KQOA 3HUOA 5JYOA 4XUXA 1NZUA 3WS0A 1WYBA 3A3JA 3IXGA 4CPKA 1NXYA 1ERMA 4ZAMA 5FASA 4OPYA 2WADA 3G35A 4GD8A 3RXWA 3UPOA 4DE3A 1FSWA 2RCXA 1WYCA 1Z6FA 3O87A 4R3JA 4JXVA 1FOFA 2ZC6B 3LY3A 4UAAA 2Y2OA 4LV3A 1K57C 4WMCA 1YLYA 1LI0A 2WKIA 3BFGA 4KZBA 5FQJA 3VFHA 1W79A 3BYDA 3V39A 3N6IA 4K0XA 1BLHA 3WWXA 4WMCD 3UO9A 1LHYA 1Q2PA 4JKTA 2XEPA 2WZXA 4S2JA 3W4OA 4UA7A 4OP8A 2Y2NA 3IWOA 3M2KA 3CMZA 1ZC2A 3IWQA 4JBFA 5FQKA 4KG6A 2ZM8A 2ZLYA 4WZ5C 4LCMA 3MKFA 3LY4A 4MEZA 1MPLA 4KENB 1YLJA 3BECA 2VGJA 2WYXA 4BJPA 1XA7A 2QZ6A 2EXBA 2H0YA 2ZQ9A 5EPHA 4UHUA 3C4OA 4EBNA 4BL3A 3VP2A 4HBTA 4B88A 5E2EA 2OLVA 1S6RA 4OQ0A 1I2WA 3OZHA 1MWRA 5FQIA 2JE5A 2J9OA 1PZPA 4OQGA 5EECA 3BLMA 3EQVA 4OVDA 5CECA 4KG5A 3OPRA 1XGIA 5E2HA 2HP5A 4OH0A 4N1HA 1PI4A 1W5DA 5EOOA 5BOHA 2XH9A 2HDRA 1E25A 1IYOA 1QMFA 3MFDA 4FH2A 1ZG6A 5CHUA 1K4EA 1FCMA 3ZCZA 3UN7A 5FQQA 2Q9MA 2ZMAA 4FCFA 4DXCA 1GHMA 2WGVA 2ZM0A 3CJMA 3GRJA 3WS4A 2XK1A 5E43A 1XX2A 4HBUA 2HDUA 2X01A 1YM1A 2P9VB 2J8YA 3SOIA 1OMEA 4R4SA 2C5WB 4S2OA 1C3BA 3O88A 2ZQ7A 1PYYA 3O3VA 3WRTA 3A3FA 4QU3A 5L2FA 1ALQA 4S2NC 5I94A 4D2OA 2EFXA 1BLPA 2XGNA 3GSGA 3IF6A 4OPZA 4H8RA 3UNWA 1SCWA 2HDQA 3CG5A 3Q07A 5F82A 4U0TA 3ZG9B 1CI8A 3C5AA 4Y0OA 4XXRA 4GDBA 1NYMA 3OC2A 5A90A 3VOYA 5EVIA 3DTMA 1KGFA 1YLTA 3MKEA 2HP6A 2XFTA 3TSGA 5HL1A 3UDXA 1IKGA 3VP3A 2E8IA 2Q9NA 1J9MA 2OLUA 3BRMA 4DRTA 3ZVWA 5EVID 1K6SA 1ES2A 1YMSA 4LCLA 3E2LA 5DF7A 2XD1A 3EQUA 3GV9A 4ZBEA 1BLSA 5AQ7A 3BFFA 3UDFA 2Y59A 1XXMA 1MXOA 2ZM2A 3DWKA 5D3OA 1K56A 5E2GA 1GHPA 2G2UA 3IF6B 5CERA 4IBRA 5CTNA 1FCNA 3VOZA 4F94A 1RP5A 2HDSA 1NZOA 2XQZA 2H10A 4WEKA 3UDIA 3WS5A 3CZDA 4GDNA 4OOLA 1KVMA 2WKEA 3AGEA 3N8SA 3LCEA 1BSGA 3G30A 3G4PA 5M18A 3V50A 3UE1A 1PWCA 1TDGA 4E6WA 4WM9A 3A3EA 4HEFA 5F83A 1YT4A 3LEZA 3FWLA 4IBXA 4KG2A 4LENA 1MWTA 4MBKA 2Y2LA 1HVBA 4KQRA 5AQAA 1ZG4A 2QMIA 4GB7A 1O07A 4JXSA 1YLPA 2EXAA 3HLEA 4QHCA 5KZHA 3SS5A 4DKIA 1PWDA 2OSUA 2Y2MA 5CHJA 3DWZA 3BEBA 4N1XA 4FSFA 3S1YA 5FAOA 2Y55A 1NY0A 2I72A 4EQIA 1IEMA 1KVLA 2ZQ8A 4PPRA 5GLBA 3UY6A 1ESUA 5CEBA 4GKUA 4GZBA 4OP5A 4WZ4A 1SDNA 1Q2QA 3NI9A 3OPLA 2G2WA 2OV5A 2Z2MB 1MY8A 3Q7VA 2V20A 1K25A 5DVAA 3SH8A 5HAQA 1ONGA 5FSRA 4DE2A 1YQSA 5FATA 5GHZA 3SH9A 3IT9A 2WGWB 4PMAA 1PI5A 3Q7ZA 3PAGA 4MNRA 4OOMA 1S0WA 2ZD8A 3ITAA 4R4RA 4S2KA 3ZG8B 3ZG5A 1GHIA 1G6AA 3C4PA 2QPNA 1MWSA 4MLLA 1IYPA 3Q1FA 3LO7A 3SS4A 2WK0A 3A3DA 1BULA 1K57A 2A49A 4X6TA 4ZDXA 1QMEA 2WAEA 2Y4AA 4N92A 5DTKA 5FDHA 4E3OA 4X69A 4JF4A 1M40A 4X55A 3HLBA 4ZTKA 5CGSA 2DNSA 1RGZA 3P09A 3NDGA 4OLDA 5CXWA 4Z9QA 3HLFA 3Q7VB 2WGIA 1I2SA 3FZCA 3PBQA 2IWCA 4WZ5A 2UWXA 3HL9A 2PBYA 3N8RA 1K55C 2GDNA 5A93A 1KE3A 2CC1A 3D4FA 4E3LA 2WUQA 5DF8A 2C6WB 3V5MA 2V2FF 5F1FA 2Y2HA 4BENA 4ZJ2A 3IQAA 3IF5A 1N4OA 2ZQCA 3IXBA 3QNBA 3RXXA 4E3MA 1PZOA 4BLMA 1BZAA 3VMAA 1HTZA 2JCHA 3VFFA 3ZG7B 1FR1A 1K4FA 5E2FA 3M2JA 3QHYA 2VGKA 1L0EA 1DJAA 5GL9A 3HBRA 1PWGA 4KZ3A 3TOIA 4N9LA 2HP9A 1WE4A 1L0DA 4DDSA 2FFFB 3I7JA 3ISGA 1H8YA 2Y2JA 1DJCA 1H5XA 3SH7A 3C7VA 3HLWA 4S2PA 1BTLA 3UE0A 4LV1A 3SS3A 3ZNYA 1N9BA 1TVFA 2R9XA 2PU4A 2XFSA 1LI9A 4LV0A 4OPQA 3DW0A 4S2LA 4WEJA 3FV7A 3W4PA 4DF6A 1XA1A 4EBPA 1IELA 1PW1A 4P85A 1IKIA 4WYYA 5IHVA 5HFOA 4S2NA 4X68A 4CJNA 4K0WA 2XDMA 1L0FA 4R1GA 5GLAA 3WS1A 3P98A 4KZ6A 4DXBA 4QJGA 4C75A 5FI6A 2RL3A 2Y2KA 2WZZA 4E3IA 3G32A 1KGEA 4QD4A 5DTTA 1JVJA 2Y91A 3Q82A 4QY5A 3BLSA 4E3KA 1LL5A 4OOYA 4L0LA 4LV2A 2ZC7A 4IVIA 3ZDJA 5FAPA 1XGJA 2WAFA 5GLDA 5A91A 1O7EA 1RGYA 2EX2A 5CHMA 3FKWA 5EVLA 4DE0A 2XD5A 3PBNA 1K54C 5FI7A 1FSYA 2JC7A 2PU2A 1CI9A 1HZOA 3IXDA 4BD0A 4Q8IA 4PM5A 1U60A 4E3NA 4PM9A 1JTDA 5EVIB 2EX9A 4GD6A 1LLBA 4RX3A 1DJBA 4U3TA 4U0XA 5HARA 3IWIA 1IYQA 4IVKA 2B5RA 3MZDA 4NETA 4OPRA 4HESA 1IYSA 1W8QA 5HAPA 1KE4A 3BM6A 4MBFA 2ZC5B 1SHVA 1DY6A 1G68A 3AGFA 2BG1A 1EI5A 3M6HA 1ES3A 5FAQA 3G2ZA 3W4QA 3MXSA 4OKPA 1KDSA 5DTSA 3PBOA 4KZAA 5HAIA 4XUZA 4JF5A 2IWDA 3G31A 5FI2A 5HW3A 4Y0UA 3PBSA 4C6YA 4M3KA 3MZFA 3IH9A 1JWVA 3HREA 2EFUA 1BUEA 1W8YA 3HLGA 4C3QA 3IHBA 4X56A 3HLCA 2FFYA 2R9WA 3BFCA 4PM8A 4PM7A 4RA7A 5U47A 2XF3A 5TR7A 2ZQDA 1Y54A 5F1GA 3VP4A 2H5SA 3O86A 3WRZA 3OCNA 3C7UA 1KGGA 5M19A 1K38A 3NC8A 5AQ9A 1ESIA 4R23A 5J8XA 2A3UA 4KQQA 4EWFA 3N7WA 4P87A 3N4IA 4ID4A 3NIAA 1GA9A 3PTEA 4N9KA 3M6BA 3GTCA 5AQBA 1YLWA 3S22A 1NYYA 3ZHHA 3V3SA 1AXBA 1TEMA 3QNCA 3ITBA 1MBLA 3NDEA 4B4ZA 3ZNTA 3PBRA 4MBHA 4YFMA 4BD1A 4EV4A 4FD8A 3IXHA 4KZ5A 4OQIA 3W8KA 5FA7A 1EROA 4YINA 1K6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RCJ A;  5KSC A;  1VM1 A;  3NBL A;  2J7V A;  4JLF A;  2EX6 A;  4DDY A;  4QB8 A;  2DRW A;  4Y0T A;  1ZKJ A;  2P9V A;  3JYI A;  5EUA A;  4RYE A;  1TDL A;  1XPB A;  3RJU A;  3OPH A;  4E6X A;  3IH8 A;  3G34 A;  1BT5 A;  2J9P A;  1JWZ A;  2HPB A;  1CK3 A;  2Y2Q A;  1JWP A;  3FKV A;  4BL2 A;  4EUZ A;  4ZJ3 A;  1K55 A;  2ZJ9 A;  3N8L A;  2WKH A;  1KE0 A;  1PIO A;  3HUN A;  3OPP A;  4GN2 A;  5GLC A;  3GR2 A;  5CRF A;  1EWZ A;  4P0M A;  1VQQ A;  4UA9 A;  4O7D A;  3VSK A;  1SDE A;  3E2K A;  5GHY A;  5FQ9 A;  4JPM A;  2IWB A;  4OLG A;  1BLC A;  3A3I A;  1CEF A;  4ZJ1 A;  4P6B A;  3V3R A;  3AGD A;  4OON A;  3WS2 A;  5M1A A;  3ZFZ A;  3IF6 C;  4RX2 A;  4JXW A;  3BFE A;  4WEL A;  1W7F A;  3ZVT A;  2H0T A;  3HLD A;  3NY4 A;  2X02 A;  5G18 A;  4IED A;  5KMW A;  1GCE A;  5A92 A;  4R3B A;  5EVI C;  1KDW A;  5CED A;  5HX9 A;  3NCK A;  4GNU A;  4RVA A;  5KSH A;  3GVB A;  1XP4 A;  1YLZ A;  4S2I A;  1LL9 A;  2Z2L B;  3UPP A;  4B4X A;  2XLN A;  1FQG A;  1MWU A;  4GOG A;  5TGF A;  3G2Y A;  3Q81 A;  1ERQ A;  4FH4 A;  5CGX A;  5EE8 A;  3HVF A;  4JF6 A;  3UPN A;  3MZE A;  3IHA A;  1L0G A;  4KZ4 A;  1GA0 A;  3PBT A;  3PAE A;  3S4X A;  3VSL A;  2Y2P A;  2BLS A;  2ZC3 B;  4KZ7 A;  3UE3 A;  2P74 A;  4EBL A;  1M6K A;  4UA6 A;  4E3J A;  1H8Z A;  1NJ4 A;  1FCO A;  4X53 A;  1ES5 A;  4WBG A;  5CGW A;  2DCF A;  3VP1 A;  1HD8 A;  1ES4 A;  4DE1 A;  1FR6 A;  3MBZ A;  3BFD A;  2Y2G A;  5JYP A;  5GHX A;  3GMW A;  4NK3 A;  2V1Z A;  1YMX A;  3ZGA B;  4PM6 A;  1JTG A;  1ONH A;  2ZQA A;  3GQZ A;  4OQH A;  2ZC4 B;  5DF9 A;  1K54 A;  3B3X A;  3OCL A;  4JXG A;  1I5Q A;  4BQM A;  1K56 D;  5CTM A;  4S2M A;  1CEG A;  1PW8 A;  1MKI A;  1XKZ A;  3FYZ A;  4QY6 A;  3ZG0 A;  3HUM A;  1E3U A;  3TG9 A;  4Y7P A;  1E4D A;  5EOE A;  2XR0 A;  4A5R A;  3MXR A;  3VP0 A;  1NRF A;  4KZ8 A;  2JBF A;  4K91 A;  4KZ9 A;  5TFQ A;  1L2S A;  5FQM A;  1E3U D;  2WGW A;  1SKF A;  2EX8 A;  2X71 A;  2Y2I A;  4R0Q A;  4KQO A;  3HUO A;  5JYO A;  4XUX A;  1NZU A;  3WS0 A;  1WYB A;  3A3J A;  3IXG A;  4CPK A;  1NXY A;  1ERM A;  4ZAM A;  5FAS A;  4OPY A;  2WAD A;  3G35 A;  4GD8 A;  3RXW A;  3UPO A;  4DE3 A;  1FSW A;  2RCX A;  1WYC A;  1Z6F A;  3O87 A;  4R3J A;  4JXV A;  1FOF A;  2ZC6 B;  3LY3 A;  4UAA A;  2Y2O A;  4LV3 A;  1K57 C;  4WMC A;  1YLY A;  1LI0 A;  2WKI A;  3BFG A;  4KZB A;  5FQJ A;  3VFH A;  1W79 A;  3BYD A;  3V39 A;  3N6I A;  4K0X A;  1BLH A;  3WWX A;  4WMC D;  3UO9 A;  1LHY A;  1Q2P A;  4JKT A;  2XEP A;  2WZX A;  4S2J A;  3W4O A;  4UA7 A;  4OP8 A;  2Y2N A;  3IWO A;  3M2K A;  3CMZ A;  1ZC2 A;  3IWQ A;  4JBF A;  5FQK A;  4KG6 A;  2ZM8 A;  2ZLY A;  4WZ5 C;  4LCM A;  3MKF A;  3LY4 A;  4MEZ A;  1MPL A;  4KEN B;  1YLJ A;  3BEC A;  2VGJ A;  2WYX A;  4BJP A;  1XA7 A;  2QZ6 A;  2EXB A;  2H0Y A;  2ZQ9 A;  5EPH A;  4UHU A;  3C4O A;  4EBN A;  4BL3 A;  3VP2 A;  4HBT A;  4B88 A;  5E2E A;  2OLV A;  1S6R A;  4OQ0 A;  1I2W A;  3OZH A;  1MWR A;  5FQI A;  2JE5 A;  2J9O A;  1PZP A;  4OQG A;  5EEC A;  3BLM A;  3EQV A;  4OVD A;  5CEC A;  4KG5 A;  3OPR A;  1XGI A;  5E2H A;  2HP5 A;  4OH0 A;  4N1H A;  1PI4 A;  1W5D A;  5EOO A;  5BOH A;  2XH9 A;  2HDR A;  1E25 A;  1IYO A;  1QMF A;  3MFD A;  4FH2 A;  1ZG6 A;  5CHU A;  1K4E A;  1FCM A;  3ZCZ A;  3UN7 A;  5FQQ A;  2Q9M A;  2ZMA A;  4FCF A;  4DXC A;  1GHM A;  2WGV A;  2ZM0 A;  3CJM A;  3GRJ A;  3WS4 A;  2XK1 A;  5E43 A;  1XX2 A;  4HBU A;  2HDU A;  2X01 A;  1YM1 A;  2P9V B;  2J8Y A;  3SOI A;  1OME A;  4R4S A;  2C5W B;  4S2O A;  1C3B A;  3O88 A;  2ZQ7 A;  1PYY A;  3O3V A;  3WRT A;  3A3F A;  4QU3 A;  5L2F A;  1ALQ A;  4S2N C;  5I94 A;  4D2O A;  2EFX A;  1BLP A;  2XGN A;  3GSG A;  3IF6 A;  4OPZ A;  4H8R A;  3UNW A;  1SCW A;  2HDQ A;  3CG5 A;  3Q07 A;  5F82 A;  4U0T A;  3ZG9 B;  1CI8 A;  3C5A A;  4Y0O A;  4XXR A;  4GDB A;  1NYM A;  3OC2 A;  5A90 A;  3VOY A;  5EVI A;  3DTM A;  1KGF A;  1YLT A;  3MKE A;  2HP6 A;  2XFT A;  3TSG A;  5HL1 A;  3UDX A;  1IKG A;  3VP3 A;  2E8I A;  2Q9N A;  1J9M A;  2OLU A;  3BRM A;  4DRT A;  3ZVW A;  5EVI D;  1K6S A;  1ES2 A;  1YMS A;  4LCL A;  3E2L A;  5DF7 A;  2XD1 A;  3EQU A;  3GV9 A;  4ZBE A;  1BLS A;  5AQ7 A;  3BFF A;  3UDF A;  2Y59 A;  1XXM A;  1MXO A;  2ZM2 A;  3DWK A;  5D3O A;  1K56 A;  5E2G A;  1GHP A;  2G2U A;  3IF6 B;  5CER A;  4IBR A;  5CTN A;  1FCN A;  3VOZ A;  4F94 A;  1RP5 A;  2HDS A;  1NZO A;  2XQZ A;  2H10 A;  4WEK A;  3UDI A;  3WS5 A;  3CZD A;  4GDN A;  4OOL A;  1KVM A;  2WKE A;  3AGE A;  3N8S A;  3LCE A;  1BSG A;  3G30 A;  3G4P A;  5M18 A;  3V50 A;  3UE1 A;  1PWC A;  1TDG A;  4E6W A;  4WM9 A;  3A3E A;  4HEF A;  5F83 A;  1YT4 A;  3LEZ A;  3FWL A;  4IBX A;  4KG2 A;  4LEN A;  1MWT A;  4MBK A;  2Y2L A;  1HVB A;  4KQR A;  5AQA A;  1ZG4 A;  2QMI A;  4GB7 A;  1O07 A;  4JXS A;  1YLP A;  2EXA A;  3HLE A;  4QHC A;  5KZH A;  3SS5 A;  4DKI A;  1PWD A;  2OSU A;  2Y2M A;  5CHJ A;  3DWZ A;  3BEB A;  4N1X A;  4FSF A;  3S1Y A;  5FAO A;  2Y55 A;  1NY0 A;  2I72 A;  4EQI A;  1IEM A;  1KVL A;  2ZQ8 A;  4PPR A;  5GLB A;  3UY6 A;  1ESU A;  5CEB A;  4GKU A;  4GZB A;  4OP5 A;  4WZ4 A;  1SDN A;  1Q2Q A;  3NI9 A;  3OPL A;  2G2W A;  2OV5 A;  2Z2M B;  1MY8 A;  3Q7V A;  2V20 A;  1K25 A;  5DVA A;  3SH8 A;  5HAQ A;  1ONG A;  5FSR A;  4DE2 A;  1YQS A;  5FAT A;  5GHZ A;  3SH9 A;  3IT9 A;  2WGW B;  4PMA A;  1PI5 A;  3Q7Z A;  3PAG A;  4MNR A;  4OOM A;  1S0W A;  2ZD8 A;  3ITA A;  4R4R A;  4S2K A;  3ZG8 B;  3ZG5 A;  1GHI A;  1G6A A;  3C4P A;  2QPN A;  1MWS A;  4MLL A;  1IYP A;  3Q1F A;  3LO7 A;  3SS4 A;  2WK0 A;  3A3D A;  1BUL A;  1K57 A;  2A49 A;  4X6T A;  4ZDX A;  1QME A;  2WAE A;  2Y4A A;  4N92 A;  5DTK A;  5FDH A;  4E3O A;  4X69 A;  4JF4 A;  1M40 A;  4X55 A;  3HLB A;  4ZTK A;  5CGS A;  2DNS A;  1RGZ A;  3P09 A;  3NDG A;  4OLD A;  5CXW A;  4Z9Q A;  3HLF A;  3Q7V B;  2WGI A;  1I2S A;  3FZC A;  3PBQ A;  2IWC A;  4WZ5 A;  2UWX A;  3HL9 A;  2PBY A;  3N8R A;  1K55 C;  2GDN A;  5A93 A;  1KE3 A;  2CC1 A;  3D4F A;  4E3L A;  2WUQ A;  5DF8 A;  2C6W B;  3V5M A;  2V2F F;  5F1F A;  2Y2H A;  4BEN A;  4ZJ2 A;  3IQA A;  3IF5 A;  1N4O A;  2ZQC A;  3IXB A;  3QNB A;  3RXX A;  4E3M A;  1PZO A;  4BLM A;  1BZA A;  3VMA A;  1HTZ A;  2JCH A;  3VFF A;  3ZG7 B;  1FR1 A;  1K4F A;  5E2F A;  3M2J A;  3QHY A;  2VGK A;  1L0E A;  1DJA A;  5GL9 A;  3HBR A;  1PWG A;  4KZ3 A;  3TOI A;  4N9L A;  2HP9 A;  1WE4 A;  1L0D A;  4DDS A;  2FFF B;  3I7J A;  3ISG A;  1H8Y A;  2Y2J A;  1DJC A;  1H5X A;  3SH7 A;  3C7V A;  3HLW A;  4S2P A;  1BTL A;  3UE0 A;  4LV1 A;  3SS3 A;  3ZNY A;  1N9B A;  1TVF A;  2R9X A;  2PU4 A;  2XFS A;  1LI9 A;  4LV0 A;  4OPQ A;  3DW0 A;  4S2L A;  4WEJ A;  3FV7 A;  3W4P A;  4DF6 A;  1XA1 A;  4EBP A;  1IEL A;  1PW1 A;  4P85 A;  1IKI A;  4WYY A;  5IHV A;  5HFO A;  4S2N A;  4X68 A;  4CJN A;  4K0W A;  2XDM A;  1L0F A;  4R1G A;  5GLA A;  3WS1 A;  3P98 A;  4KZ6 A;  4DXB A;  4QJG A;  4C75 A;  5FI6 A;  2RL3 A;  2Y2K A;  2WZZ A;  4E3I A;  3G32 A;  1KGE A;  4QD4 A;  5DTT A;  1JVJ A;  2Y91 A;  3Q82 A;  4QY5 A;  3BLS A;  4E3K A;  1LL5 A;  4OOY A;  4L0L A;  4LV2 A;  2ZC7 A;  4IVI A;  3ZDJ A;  5FAP A;  1XGJ A;  2WAF A;  5GLD A;  5A91 A;  1O7E A;  1RGY A;  2EX2 A;  5CHM A;  3FKW A;  5EVL A;  4DE0 A;  2XD5 A;  3PBN A;  1K54 C;  5FI7 A;  1FSY A;  2JC7 A;  2PU2 A;  1CI9 A;  1HZO A;  3IXD A;  4BD0 A;  4Q8I A;  4PM5 A;  1U60 A;  4E3N A;  4PM9 A;  1JTD A;  5EVI B;  2EX9 A;  4GD6 A;  1LLB A;  4RX3 A;  1DJB A;  4U3T A;  4U0X A;  5HAR A;  3IWI A;  1IYQ A;  4IVK A;  2B5R A;  3MZD A;  4NET A;  4OPR A;  4HES A;  1IYS A;  1W8Q A;  5HAP A;  1KE4 A;  3BM6 A;  4MBF A;  2ZC5 B;  1SHV A;  1DY6 A;  1G68 A;  3AGF A;  2BG1 A;  1EI5 A;  3M6H A;  1ES3 A;  5FAQ A;  3G2Z A;  3W4Q A;  3MXS A;  4OKP A;  1KDS A;  5DTS A;  3PBO A;  4KZA A;  5HAI A;  4XUZ A;  4JF5 A;  2IWD A;  3G31 A;  5FI2 A;  5HW3 A;  4Y0U A;  3PBS A;  4C6Y A;  4M3K A;  3MZF A;  3IH9 A;  1JWV A;  3HRE A;  2EFU A;  1BUE A;  1W8Y A;  3HLG A;  4C3Q A;  3IHB A;  4X56 A;  3HLC A;  2FFY A;  2R9W A;  3BFC A;  4PM8 A;  4PM7 A;  4RA7 A;  5U47 A;  2XF3 A;  5TR7 A;  2ZQD A;  1Y54 A;  5F1G A;  3VP4 A;  2H5S A;  3O86 A;  3WRZ A;  3OCN A;  3C7U A;  1KGG A;  5M19 A;  1K38 A;  3NC8 A;  5AQ9 A;  1ESI A;  4R23 A;  5J8X A;  2A3U A;  4KQQ A;  4EWF A;  3N7W A;  4P87 A;  3N4I A;  4ID4 A;  3NIA A;  1GA9 A;  3PTE A;  4N9K A;  3M6B A;  3GTC A;  5AQB A;  1YLW A;  3S22 A;  1NYY A;  3ZHH A;  3V3S A;  1AXB A;  1TEM A;  3QNC A;  3ITB A;  1MBL A;  3NDE A;  4B4Z A;  3ZNT A;  3PBR A;  4MBH A;  4YFM A;  4BD1 A;  4EV4 A;  4FD8 A;  3IXH A;  4KZ5 A;  4OQI A;  3W8K A;  5FA7 A;  1ERO A;  4YIN A;  1K6R A; 
#chains in the Genus database with same CATH topology
 1VM1 A;  3NBL A;  2EX6 A;  5LBR A;  1TDL A;  2ZBB A;  3IH8 A;  1NLY A;  2HPB A;  3FKV A;  4EUZ A;  3N8L A;  1KE0 A;  5CRF A;  4JGQ A;  3CUE C;  4UA9 A;  3VSK A;  5GHY A;  4OLG A;  2O99 A;  3A3I A;  4CQH A;  2A24 B;  5M1A A;  4HJ6 A;  4RX2 A;  1W7F A;  3ZVT A;  2PR6 A;  2V0W A;  2PBD P;  5A92 A;  2O9B A;  5EVI C;  1T1C A;  1YAX A;  5HX9 A;  4GNU A;  1YLZ A;  1LL9 A;  1XFN A;  3T1R A;  3BY9 A;  4CLC B;  3Q81 A;  1N9N A;  3IHA A;  4KZ4 A;  1GA0 A;  3PBT A;  5DKK A;  3R7W A;  3PAE A;  2P74 A;  2QJ7 A;  1FCO A;  4WBG A;  5CGW A;  3VP1 A;  4DN0 A;  3HJK A;  3BFD A;  2Y2G A;  5GHX A;  1W63 Q;  4LRY C;  4NK3 A;  2V1Z A;  3ZGA B;  4PM6 A;  5TBM A;  5C5K A;  2J3T D;  1K56 D;  3ZG0 A;  4BWI A;  1E4D A;  3HJI A;  2XR0 A;  3MXR A;  3VP0 A;  1NRF A;  4KZ9 A;  2WGW A;  5HDC A;  2EX8 A;  4GJ4 A;  5EV0 A;  5HDS A;  4KQO A;  2FH5 A;  1NZU A;  3WS0 A;  3A3J A;  3QP6 A;  5DJT A;  1ERM A;  4ZAM A;  5FAS A;  4OPY A;  3G35 A;  2RCX A;  4F3L B;  2ZC6 B;  3LY3 A;  3T50 A;  4UAA A;  4KZB A;  3F1N A;  1TS0 A;  4K0X A;  5IU1 A;  4JKT A;  2XEP A;  2W3D A;  4S2J A;  3LY4 A;  1MPL A;  4BJP A;  3BEC A;  2WYX A;  2ZQ9 A;  5EPH A;  3VP2 A;  2K2N A;  5G4Z A;  3LIA A;  2OLV A;  1S6R A;  2M7U A;  1I2W A;  1MWR A;  3EQV A;  5CEC A;  4KG5 A;  1XGI A;  5EOO A;  5DFX A;  5BOH A;  1E25 A;  1UGU A;  1V9Z A;  5CHU A;  1K4E A;  1FCM A;  3ZCZ A;  2K31 A;  2Q9M A;  3S7P A;  1OPX A;  2JKF A;  2ZM0 A;  4I39 A;  2YKF A;  3FG8 A;  5IT5 A;  1OME A;  2C5W B;  2ZQ7 A;  1PYY A;  1MC0 A;  3A3F A;  4QU3 A;  4S2N C;  5I94 A;  4OPZ A;  3UNW A;  3CG5 A;  3Q07 A;  5F82 A;  3ZG9 B;  4KUO A;  5A90 A;  1KGF A;  5HL1 A;  2E8I A;  1J9M A;  2OLU A;  5CX7 A;  2M1C A;  4WN5 A;  1ES2 A;  1YMS A;  4IJG A;  3EQU A;  3GV9 A;  4ZBE A;  1BLS A;  1S1Z A;  5AQ7 A;  2Y59 A;  2ZM2 A;  1K56 A;  2JHE A;  5CTN A;  4F94 A;  1RP5 A;  3WS5 A;  3ULF A;  3CZD A;  3R4K A;  3N8S A;  5HWV A;  1SZV A;  1PWC A;  2OOL A;  3VE3 A;  3FWL A;  4KQR A;  1HVB A;  3RH8 B;  4MMN A;  3S7O A;  2WKP A;  2QWS A;  2DMW A;  1WA9 A;  2Y2M A;  1VEU A;  3RTY A;  3TW8 A;  2OAQ 1;  4N1X A;  1XJ2 A;  4EQI A;  4PPR A;  1BYW A;  1P9R A;  4OP5 A;  1SDN A;  1Q2Q A;  2O9A A;  2Z2M B;  3CLO A;  4DE2 A;  2W0N A;  3EOI A;  4PHT A;  3Q7Z A;  4EEP A;  4EQ1 A;  4OOM A;  3ITA A;  4S2K A;  1GHI A;  3IX8 A;  1MWS A;  4MN5 A;  1Z09 A;  3LYX A;  5L07 A;  2W3H A;  2VK3 A;  2ZL1 B;  1K57 A;  2A49 A;  4X69 A;  3CAX A;  4X55 A;  2FZ0 A;  2DNS A;  4X1M A;  4OLD A;  1TF1 A;  3FZC A;  3EGX C;  1N9L A;  2KX6 A;  5A93 A;  4II7 A;  2CC1 A;  3F1O B;  4WLA A;  3V5M A;  3LIE A;  3IQA A;  3QNB A;  3RXX A;  1PZO A;  4BLM A;  1BZA A;  2V1A A;  2W3F A;  2ZMF A;  1K4F A;  3H9W A;  3M2J A;  3QHY A;  4O0P A;  2VGK A;  2BAS A;  3LIC A;  4KZ3 A;  5IS1 A;  3TOI A;  4IUH A;  3I7J A;  3BW6 A;  1H8Y A;  1H5X A;  4ME4 A;  1N9B A;  1J3W A;  3IS2 A;  3E98 A;  4HP4 A;  4LV0 A;  1XA1 A;  4EBP A;  4WYY A;  1PW1 A;  4CJN A;  2XDM A;  4R1G A;  3WS1 A;  3LIF A;  4C75 A;  1LT0 A;  2HZ5 A;  4NXF A;  2YKH A;  3LR0 A;  3DBA A;  1LL5 A;  2J3T C;  4L0L A;  5FAP A;  2W1T B;  3MR0 A;  1O7E A;  5CHM A;  1XFQ A;  3MQ0 A;  4MCW A;  1K54 C;  5FI7 A;  1FSY A;  2JC7 A;  2PU2 A;  4E3N A;  5EVI B;  4R3A A;  4RX3 A;  4FTX A;  4CLC E;  4IVK A;  3P7N A;  2B5R A;  4HES A;  1F5M A;  4YNR A;  2W3G A;  1EI5 A;  3W4Q A;  1PNE A;  1XJ3 A;  3MXS A;  4RQ9 A;  2HJE A;  1PRQ A;  4OKP A;  3CI6 A;  4KZA A;  4JF5 A;  3ZYT A;  5FI2 A;  4C6Y A;  3KX0 X;  2EWV A;  4M3K A;  3MZF A;  1T18 A;  1IOU A;  2EFU A;  2EWW A;  3HLG A;  4X56 A;  2V8C A;  2XF3 A;  1T1B A;  2L1M A;  5F1G A;  3UB9 A;  2H5S A;  1KGG A;  3BJN A;  3TE8 A;  4R23 A;  5J8X A;  2JKR I;  4N9K A;  1ZTU A;  1AXB A;  3QNC A;  3D9Y A;  3VOL A;  4BD1 A;  3LI8 A;  2JKR M;  3IXH A;  1G6O A;  1RCJ A;  2J7V A;  4QB8 A;  2DRW A;  3JYI A;  1XPB A;  1S66 L;  2XRO A;  4FOF A;  5F69 A;  1JWP A;  4B93 A;  4ZJ3 A;  2A2L A;  5GLC A;  3F1P A;  2LB9 A;  4Y15 A;  3E2K A;  4L9E A;  2IWB A;  1BLC A;  3AGD A;  4OON A;  2PT7 A;  2PHY A;  2H0T A;  1MKM A;  4QWO A;  3T1S A;  2G7U A;  1GSV A;  5G18 A;  1NWZ A;  2WKQ A;  4IED A;  1GCE A;  4R3B A;  4UQI S;  3NCK A;  4ARZ A;  3GVB A;  4S2I A;  1A0K A;  2Z2L B;  1FQG A;  3G2Y A;  3T1X A;  4FH4 A;  5EE8 A;  5EM1 A;  3MZE A;  1EW0 A;  3S4X A;  4HQA A;  2BLS A;  4ETZ A;  3UE3 A;  1M6K A;  1H8Z A;  1NJ4 A;  3CIT A;  1HD8 A;  1ES4 A;  3GMW A;  3NOT C;  4LLO B;  1YMX A;  4B9O A;  1ONH A;  2ZQA A;  1HLU P;  2UV0 E;  2ZC4 B;  5CTM A;  1PW8 A;  3HUM A;  1E3U A;  5EOE A;  3R7W B;  1LL8 A;  4HI4 A;  4KZ8 A;  5TFQ A;  1SKF A;  3T1Q B;  1LSW A;  2X71 A;  1NLZ A;  4I3I A;  3QP1 A;  5HWW A;  3IXG A;  5TBM B;  1NXY A;  2WAD A;  3UPO A;  3H82 A;  4JXV A;  1FOF A;  4LV3 A;  4WMC A;  2WKI A;  1FIL A;  4R6L A;  1W79 A;  5HWT A;  3UO9 A;  1LHY A;  1H8M A;  4EER A;  2WZX A;  3B47 A;  3W4O A;  4OP8 A;  2Y2N A;  2PD7 A;  5FQK A;  2Z6D A;  2Z6C A;  4KG6 A;  2ZM8 A;  4LCM A;  4MEZ A;  4KEN B;  1XA7 A;  2QZ6 A;  2H0Y A;  4EBN A;  4UHU A;  3C4O A;  2ACG A;  4BL3 A;  4DJ3 A;  4QPR A;  4HBT A;  4BBU A;  2PDR A;  5AVF A;  2JE5 A;  5HPI A;  5AJG A;  5EEC A;  2GJ3 A;  3OPR A;  3JPU A;  2HP5 A;  1F9I A;  1QMF A;  3MFD A;  4M4X A;  3GEC A;  3IX4 A;  3IBJ A;  4FCF A;  4DXC A;  1GHM A;  1D06 A;  2KOI A;  5E43 A;  1F2K A;  2HDU A;  2ZOH A;  2P9V B;  1VB6 A;  3LFV A;  3SOI A;  1C3B A;  3EEH A;  1P9W A;  3GSG A;  3IF6 A;  4YWZ A;  2HDQ A;  4UEY A;  3U2A A;  1CI8 A;  4XXR A;  4GDB A;  4JGR A;  1OTI A;  1TD5 A;  4Y3I A;  2Y79 A;  1TS7 A;  5FEF A;  4BBT A;  2NUT C;  3RFB A;  1YPR A;  1XXM A;  3LGO A;  3VOZ A;  4GHI A;  2HDS A;  4WEK A;  3UDI A;  3EWK A;  3G6O A;  3DTE A;  3PHY A;  2VV6 A;  1BSG A;  3G30 A;  3L9K A;  4HEF A;  5F83 A;  5L8M A;  4IBX A;  4R38 A;  3TJZ C;  4MBK A;  4PKY G;  2ZOI A;  4GB7 A;  1D7E A;  4QHC A;  4JXS A;  1O07 A;  1ACF A;  2PR5 A;  2VLG A;  5KZH A;  1PWD A;  5CHJ A;  3FPW A;  4HNB A;  4L9G A;  3BEB A;  4Y13 A;  2Y55 A;  2I72 A;  2ZQ8 A;  1ESU A;  4GZB A;  4WZ4 A;  2OV5 A;  3OPL A;  3E4Q A;  3T4O A;  1K25 A;  3LR4 A;  1ONG A;  1OJ5 A;  5FAT A;  4O8G A;  3IT9 A;  3SH9 A;  4MNR A;  3ZG8 B;  5KMW A;  3ZG5 A;  1S0W A;  4LRZ E;  1G6A A;  3C4P A;  1S4S A;  1SKO A;  3SS4 A;  3CPT B;  1DP8 A;  2Y4A A;  4JF4 A;  3HLB A;  1RGZ A;  2M7V A;  3GDI A;  3KYE A;  3HLF A;  2WGI A;  4WZ5 A;  1CQA A;  2UWX A;  2A24 A;  3N8R A;  2HF6 A;  1KE3 A;  5F1F A;  4BEN A;  3NOP C;  1N4O A;  3IXB A;  4I3A A;  5I5L A;  1HTZ A;  2JCH A;  1FR1 A;  3MMH A;  3S7Q A;  1PWG A;  3A0S A;  4CLC A;  4N9L A;  2HP9 A;  1L0D A;  2FFF B;  4LRX C;  1X0O A;  3SH7 A;  3UE6 A;  4S2P A;  1BTL A;  3T4S A;  3SS3 A;  3ZNY A;  2R9X A;  2KLI A;  4S2L A;  3D72 A;  3FV7 A;  3A0V A;  2VKS A;  4P85 A;  5IHV A;  1IKI A;  1DP9 A;  2VV7 A;  4X68 A;  3FC7 A;  1L0F A;  5GLA A;  4DXB A;  5EVE A;  4Q0I A;  3ZQ5 A;  5F5Y A;  4E3I A;  1JVJ A;  4QY5 A;  3ZDJ A;  1XGJ A;  5GLD A;  5A91 A;  2EX2 A;  2GNX A;  3FKW A;  3PBN A;  2ZMV A;  4Q8I A;  2XSS A;  1LLB A;  3IWI A;  1IYQ A;  3LEQ A;  4NET A;  3UB7 A;  1IYS A;  1W8Q A;  5HAP A;  1KE4 A;  2ZC5 B;  1VET B;  4F3L A;  2P04 A;  5FAQ A;  1UWP X;  1UWN X;  1W63 M;  3V67 A;  4G3W A;  3E0Y A;  4XUZ A;  4MN6 A;  1STZ A;  1W8Y A;  4C3Q A;  3IHB A;  3HLC A;  2R9W A;  3BFC A;  2B95 A;  2ZQD A;  1Y54 A;  3O86 A;  3C7U A;  3NC8 A;  1ESI A;  4KQQ A;  4KQD A;  4EWF A;  3N7W A;  4P87 A;  3N4I A;  4ID4 A;  1GA9 A;  4AFI A;  4XT2 B;  3PR6 A;  4YOF A;  5J4E A;  5TJJ A;  1TEM A;  3ITB A;  1MBL A;  3IBR A;  3PBR A;  4YFM A;  4FD8 A;  3W8K A;  5FA7 A;  1ERO A;  3H7W B;  3BQ8 A;  1H0M A;  4DDY A;  1ZKJ A;  3JVV A;  3RJU A;  3OPH A;  3G34 A;  1BT5 A;  2Y2Q A;  4KUK A;  1K55 A;  2ZJ9 A;  4GN2 A;  3HUN A;  4Y5F A;  3GR2 A;  4P0M A;  4Z1W A;  1SDE A;  4LFU A;  5FQ9 A;  4JPM A;  1CEF A;  4ZJ1 A;  3V3R A;  5HL6 A;  2EA9 A;  3ZFZ A;  5K5B A;  2QJ5 A;  3DAV A;  3HLD A;  3NY4 A;  3BWL A;  3C2W A;  5EM0 A;  1KDW A;  4X1L A;  4NEE D;  4B4X A;  3T4Q A;  2XLN A;  1DRM A;  1MWU A;  4GOG A;  1ERQ A;  5CGX A;  3HVF A;  1AWI A;  1L0G A;  4GLQ A;  4EES A;  5F68 A;  2Y2P A;  2VZW A;  1ES5 A;  1GSX A;  4DE1 A;  1FR6 A;  5HSQ A;  5JYP A;  3KYQ A;  4ARZ B;  4HOI A;  4GS9 A;  1JTG A;  3TRC A;  3OLO A;  1Y28 A;  3GQZ A;  4OQH A;  5DF9 A;  5L09 A;  3OCL A;  1CEG A;  4R70 A;  1MKI A;  2PD8 A;  3FYZ A;  4QY6 A;  4Y7P A;  1H3Q A;  4A5R A;  4BMW A;  2JBF A;  4K91 A;  1L2S A;  1E3U D;  2V0U A;  2Y2I A;  1S4R A;  5JYO A;  4XUX A;  2XRN A;  2ZL1 A;  3E4O A;  4HH2 A;  3RXW A;  5DFY A;  4DE3 A;  1FSW A;  4R3J A;  2QKP A;  2Y2O A;  1K57 C;  1YLY A;  1LI0 A;  4GW9 A;  3T4L A;  2KDK A;  3QP8 A;  3BYD A;  3V39 A;  3N6I A;  1BLH A;  2K7S A;  4WMC D;  3CHW P;  3F1O A;  4UA7 A;  1IFQ A;  3VV4 A;  1DP6 A;  3IWQ A;  3SZT A;  1YLJ A;  4B88 A;  2AVX A;  2W27 A;  4OQG A;  4OVD A;  5E2H A;  4OH0 A;  4N1H A;  1PI4 A;  2XH9 A;  2HDR A;  3O5Y A;  1IYO A;  1ZG6 A;  4H6J B;  3UN7 A;  2VA0 A;  3MQO A;  3C30 A;  2OWJ A;  2WGV A;  3CJM A;  3GRJ A;  3WS4 A;  1XX2 A;  1YM1 A;  2MJ6 A;  3CUE A;  4R4S A;  4NXB A;  4S2O A;  3O3V A;  3MFX A;  1KOU A;  4D2O A;  2EFX A;  1BLP A;  2XGN A;  4HHD A;  3NHQ A;  2W1T A;  4U0T A;  2VJW A;  1XJ4 A;  5EVI A;  3TSG A;  3UDX A;  3VP3 A;  2Q9N A;  3ZVW A;  1K6S A;  1OTB A;  2XD1 A;  3BFF A;  4HJ4 A;  3UDF A;  3SW1 A;  3DWK A;  3KSF A;  5E2G A;  1GHP A;  2G2U A;  3IF6 B;  4IBR A;  4MDZ A;  2WKE A;  3AGE A;  3G4P A;  3V50 A;  1TDG A;  4E6W A;  1YT4 A;  3LEZ A;  4HY8 A;  4KG2 A;  2VX8 A;  3PYP A;  1CJF A;  2Y2L A;  5AQA A;  2PRF A;  1ZG4 A;  2QMI A;  4DMZ A;  4IHQ A;  1YLP A;  3HLE A;  3EEA A;  3SS5 A;  4DKI A;  4HJ3 A;  5MC7 A;  2OSU A;  3DWZ A;  3UB6 A;  1OTD A;  3D3O A;  4FSF A;  3UB8 A;  5FAO A;  1NY0 A;  1IEM A;  3UY6 A;  5CEB A;  3NI9 A;  2G2W A;  1MY8 A;  3Q7V A;  3SH8 A;  3UB5 P;  5HAQ A;  5FSR A;  1YQS A;  5GHZ A;  1LSX A;  2WGW B;  4PMA A;  4R4R A;  2ZD8 A;  4BBV A;  2VGL M;  2QPN A;  4MLL A;  3U4L P;  3LO7 A;  4I38 A;  4X6T A;  1BUL A;  3T4T A;  5DTK A;  2WAE A;  5FDH A;  4E3O A;  1M40 A;  4O01 A;  4ZTK A;  5HD3 A;  3P09 A;  5CXW A;  4Z9Q A;  3DTK A;  2GX5 A;  3F1N B;  1I2S A;  3PBQ A;  3LUQ A;  2IWC A;  2VV8 A;  3T4J A;  3HL9 A;  3NUL A;  3K3C A;  4E3L A;  5DF8 A;  2PAV P;  2C6W B;  4ZJ2 A;  2ZQC A;  1SKO B;  4E3M A;  4I3J A;  3VMA A;  3MSH A;  5F6A A;  1L0E A;  1DJA A;  5GL9 A;  3W2Z A;  2HJ9 C;  4NXG A;  4DDS A;  3ISG A;  2Y2J A;  2CMN A;  3LIB A;  4CLC D;  3C7V A;  3HLW A;  1N9O A;  3UE0 A;  4ESP A;  1TVF A;  2PU4 A;  1LI9 A;  4HP9 A;  4OPQ A;  3DW0 A;  3W4P A;  3K3D A;  4DF6 A;  4EUV A;  1IEL A;  5HFO A;  4S2N A;  4K0W A;  5L10 A;  5FI6 A;  2WZZ A;  3G32 A;  1KGE A;  4QD4 A;  5DTT A;  3Q82 A;  4E3K A;  4OOY A;  4LV2 A;  2ZC7 A;  4IVI A;  5EVL A;  4DE0 A;  2O0Y A;  1HZO A;  3KO6 A;  1JTD A;  2EX9 A;  1V9Y A;  3UMD A;  4EW7 A;  3MZD A;  5DKL A;  3T12 B;  3KSG A;  1G68 A;  3AGF A;  4HIA A;  1OJG A;  3M6H A;  1ES3 A;  4JGP A;  3G2Z A;  1NRJ A;  3MF0 A;  4JGO A;  5DTS A;  5HAI A;  1VHM A;  3PBS A;  2J3W A;  1P0Z A;  1T1A A;  3IH9 A;  2Q0O A;  1BUE A;  2HGV A;  5U47 A;  4RA7 A;  2L4R A;  4Q0H A;  2QYB A;  3VP4 A;  1VEU B;  3EGD C;  5M19 A;  1T19 A;  3NEC A;  1YSP A;  2A3U A;  3PTE A;  3QP2 A;  2P7J A;  5AQB A;  1YLW A;  1NYY A;  3V3S A;  2B18 A;  4B4Z A;  4X25 A;  4MBH A;  4KZ5 A;  2QHK A;  1K6R A;  4ZRR A;  5KSC A;  4JLF A;  4Y0T A;  2P9V A;  5EUA A;  4RYE A;  3K2N A;  3MQQ A;  3FPV A;  4E6X A;  4D60 A;  2J9P A;  1JWZ A;  1CK3 A;  1PFL A;  4EU0 A;  4BL2 A;  3E4P A;  2WKH A;  3LI9 A;  1PIO A;  3OPP A;  1EWZ A;  3KYZ A;  1VQQ A;  4O7D A;  4NXE A;  4K08 A;  3LID A;  4P6B A;  5HZH A;  4GCZ A;  3BY8 A;  3WS2 A;  3IF6 C;  4JXW A;  3BFE A;  4WEL A;  2X02 A;  4EET B;  5CED A;  5J7E A;  4RVA A;  5KSH A;  1XP4 A;  3OOV A;  5AVE A;  3UPP A;  5TGF A;  4G3V A;  4NG2 A;  4JF6 A;  3UPN A;  1YSQ A;  3IS2 B;  3VSL A;  4KZ7 A;  3QP4 A;  2ZC3 B;  4EBL A;  4UA6 A;  1JNU A;  4E3J A;  4IUK A;  4X53 A;  2DCF A;  3MBZ A;  5J3W A;  1S67 L;  5HDD A;  4PAU A;  4FUW A;  3QP5 A;  1K54 A;  3B3X A;  4JXG A;  1I5Q A;  4BQM A;  2VEA A;  4S2M A;  1XKZ A;  4G3K A;  5EFW A;  3TG9 A;  1YKD A;  5FQM A;  4WL9 A;  3KSI A;  4R0Q A;  4E04 A;  1OTA A;  5KIZ A;  3HUO A;  3CPT A;  1WYB A;  4GS9 B;  4CPK A;  1GSW A;  4GD8 A;  3OBF A;  1WYC A;  1Z6F A;  3O87 A;  2JN7 A;  3NOU C;  5FQJ A;  3BFG A;  3VFH A;  3WWX A;  1Q2P A;  2OWH A;  2L0W A;  3IWO A;  3M2K A;  4JBF A;  3CMZ A;  1ZC2 A;  4L9F A;  2ZLY A;  4WZ5 C;  3MKF A;  1TS6 A;  1OT9 A;  2VGJ A;  2EXB A;  5FDS A;  5A8B A;  1LSV A;  2E8J A;  3LR5 A;  5E2E A;  1S1Y A;  4OQ0 A;  3OZH A;  5FQI A;  2J9O A;  1PZP A;  2B02 A;  3BLM A;  1W5D A;  2H28 A;  3C38 A;  4WF0 A;  1L3L A;  4FH2 A;  2PYR A;  4CLC C;  5FQQ A;  4EXO A;  2ZMA A;  4EEU A;  1ODV A;  2J80 A;  3L7H A;  2I9V A;  2XK1 A;  4HBU A;  2X01 A;  2Y8H A;  2LB5 A;  2J8Y A;  3O88 A;  3WRT A;  5L2F A;  1ALQ A;  4Y17 A;  4LGW A;  3F1P B;  4H8R A;  1SCW A;  3CWF A;  3C5A A;  4Y0O A;  4Q0J A;  1NYM A;  3S7N A;  3OC2 A;  3VOY A;  3LR3 A;  3DTM A;  1YLT A;  3MKE A;  2HP6 A;  2XFT A;  1IKG A;  1OT6 A;  4ETX A;  4MN7 A;  3BRM A;  4DRT A;  5EVI D;  4LCL A;  2P08 A;  3E2L A;  3JVU A;  5DF7 A;  5HD5 A;  1VET A;  5D3O A;  1MXO A;  5CER A;  1FCN A;  2XQZ A;  1NZO A;  2H10 A;  1K0K A;  4GDN A;  4OOL A;  1KVM A;  3LCE A;  5FEG A;  2BTF P;  3UE1 A;  4WM9 A;  3A3E A;  4LPZ A;  3IX3 A;  4LEN A;  1MWT A;  4I5S A;  2V8F A;  2EXA A;  2D02 A;  5G4Y A;  3S1Y A;  1KVL A;  2R78 A;  5GLB A;  4XT2 A;  4GKU A;  5M18 A;  2W3E A;  2V20 A;  5HPF A;  3PXP A;  5DVA A;  1PI5 A;  3PAG A;  2O9C A;  3B42 A;  3H7W A;  1IYP A;  3Q1F A;  5DJU A;  2WK0 A;  3A3D A;  4ZDX A;  1QME A;  4N92 A;  3H82 B;  5CGS A;  1FIK A;  2INW A;  3NDG A;  1MZU A;  2OAP 1;  3Q7V B;  2PBY A;  1K55 C;  2GDN A;  3D4F A;  2WUQ A;  2V2F F;  2Y2H A;  3A0R A;  3IF5 A;  3KSH A;  1TS8 A;  3VFF A;  3ZG7 B;  5E2F A;  5FL3 A;  2NUP C;  1G28 A;  3HBR A;  3DTI A;  1WE4 A;  4NKP A;  3UME A;  2V1B A;  1DJC A;  3BQA A;  1OTE A;  4UQI M;  4LV1 A;  3ICY A;  2XFS A;  4PKY A;  2WKR A;  4WEJ A;  2GZA A;  3HCY A;  3P98 A;  4KZ6 A;  4QJG A;  3VE4 A;  2RL3 A;  2Y2K A;  2PYP A;  2Y91 A;  3BLS A;  2W1R A;  2JKT I;  3T4K A;  4WUJ A;  1XJ6 A;  3NJA A;  2V9A A;  2WAF A;  4DJ2 A;  1RGY A;  1F98 A;  2XD5 A;  3MJQ A;  3IXD A;  1CI9 A;  4BD0 A;  4PM5 A;  1U60 A;  1ZHH B;  3MXQ A;  4PM9 A;  2XA7 M;  2JKT M;  4GD6 A;  1DJB A;  3P01 A;  4U3T A;  4U0X A;  5HAR A;  4OPR A;  2JKG A;  2XA7 S;  3BM6 A;  4MBF A;  4Y2F A;  1SHV A;  1DY6 A;  2BG1 A;  4GHI B;  1KDS A;  2IA2 A;  3PBO A;  2IWD A;  3G31 A;  5HW3 A;  4Y0U A;  3MS6 A;  1JWV A;  3C8C A;  3HRE A;  4P6Z M;  4PM8 A;  1D1J A;  2FFY A;  4PM7 A;  5TR7 A;  3WRZ A;  4P6Z S;  3OCN A;  1K38 A;  5AQ9 A;  2HV1 A;  1CF0 A;  2VGL S;  1G5U A;  3NIA A;  1P97 A;  4HH3 A;  3M6B A;  3GTC A;  2D01 A;  3S22 A;  3ZHH A;  3NDE A;  4H6J A;  3ZNT A;  4EV4 A;  3B33 A;  4OQI A;  1Y4O A;  4YIN A; 
#chains in the Genus database with same CATH homology
 1RCJ A;  5KSC A;  1VM1 A;  3NBL A;  2J7V A;  4JLF A;  2EX6 A;  4DDY A;  4QB8 A;  2DRW A;  4Y0T A;  1ZKJ A;  2P9V A;  3JYI A;  5EUA A;  4RYE A;  1TDL A;  1XPB A;  3RJU A;  3OPH A;  4E6X A;  3IH8 A;  3G34 A;  1BT5 A;  2J9P A;  1JWZ A;  2HPB A;  1CK3 A;  2Y2Q A;  1JWP A;  3FKV A;  4BL2 A;  4EUZ A;  4ZJ3 A;  1K55 A;  2ZJ9 A;  3N8L A;  2WKH A;  1KE0 A;  1PIO A;  3HUN A;  3OPP A;  4GN2 A;  5GLC A;  3GR2 A;  5CRF A;  1EWZ A;  4P0M A;  1VQQ A;  4UA9 A;  4O7D A;  3VSK A;  1SDE A;  3E2K A;  5GHY A;  5FQ9 A;  4JPM A;  2IWB A;  4OLG A;  1BLC A;  3A3I A;  1CEF A;  4ZJ1 A;  4P6B A;  3V3R A;  3AGD A;  4OON A;  3WS2 A;  5M1A A;  3ZFZ A;  3IF6 C;  4RX2 A;  4JXW A;  3BFE A;  4WEL A;  1W7F A;  3ZVT A;  2H0T A;  3HLD A;  3NY4 A;  2X02 A;  5G18 A;  4IED A;  5KMW A;  1GCE A;  5A92 A;  4R3B A;  5EVI C;  1KDW A;  5CED A;  5HX9 A;  3NCK A;  4GNU A;  4RVA A;  5KSH A;  3GVB A;  1XP4 A;  1YLZ A;  4S2I A;  1LL9 A;  2Z2L B;  3UPP A;  4B4X A;  2XLN A;  1FQG A;  1MWU A;  4GOG A;  5TGF A;  3G2Y A;  3Q81 A;  1ERQ A;  4FH4 A;  5CGX A;  5EE8 A;  3HVF A;  4JF6 A;  3UPN A;  3MZE A;  3IHA A;  1L0G A;  4KZ4 A;  1GA0 A;  3PBT A;  3PAE A;  3S4X A;  3VSL A;  2Y2P A;  2BLS A;  2ZC3 B;  4KZ7 A;  3UE3 A;  2P74 A;  4EBL A;  1M6K A;  4UA6 A;  4E3J A;  1H8Z A;  1NJ4 A;  1FCO A;  4X53 A;  1ES5 A;  4WBG A;  5CGW A;  2DCF A;  3VP1 A;  1HD8 A;  1ES4 A;  4DE1 A;  1FR6 A;  3MBZ A;  3BFD A;  2Y2G A;  5JYP A;  5GHX A;  3GMW A;  4NK3 A;  2V1Z A;  1YMX A;  3ZGA B;  4PM6 A;  1JTG A;  1ONH A;  2ZQA A;  3GQZ A;  4OQH A;  2ZC4 B;  5DF9 A;  1K54 A;  3B3X A;  3OCL A;  4JXG A;  1I5Q A;  4BQM A;  1K56 D;  5CTM A;  4S2M A;  1CEG A;  1PW8 A;  1MKI A;  1XKZ A;  3FYZ A;  4QY6 A;  3ZG0 A;  3HUM A;  1E3U A;  3TG9 A;  4Y7P A;  1E4D A;  5EOE A;  2XR0 A;  4A5R A;  3MXR A;  3VP0 A;  1NRF A;  4KZ8 A;  2JBF A;  4K91 A;  4KZ9 A;  5TFQ A;  1L2S A;  5FQM A;  1E3U D;  2WGW A;  1SKF A;  2EX8 A;  2X71 A;  2Y2I A;  4R0Q A;  4KQO A;  3HUO A;  5JYO A;  4XUX A;  1NZU A;  3WS0 A;  1WYB A;  3A3J A;  3IXG A;  4CPK A;  1NXY A;  1ERM A;  4ZAM A;  5FAS A;  4OPY A;  2WAD A;  3G35 A;  4GD8 A;  3RXW A;  3UPO A;  4DE3 A;  1FSW A;  2RCX A;  1WYC A;  1Z6F A;  3O87 A;  4R3J A;  4JXV A;  1FOF A;  2ZC6 B;  3LY3 A;  4UAA A;  2Y2O A;  4LV3 A;  1K57 C;  4WMC A;  1YLY A;  1LI0 A;  2WKI A;  3BFG A;  4KZB A;  5FQJ A;  3VFH A;  1W79 A;  3BYD A;  3V39 A;  3N6I A;  4K0X A;  1BLH A;  3WWX A;  4WMC D;  3UO9 A;  1LHY A;  1Q2P A;  4JKT A;  2XEP A;  2WZX A;  4S2J A;  3W4O A;  4UA7 A;  4OP8 A;  2Y2N A;  3IWO A;  3M2K A;  3CMZ A;  1ZC2 A;  3IWQ A;  4JBF A;  5FQK A;  4KG6 A;  2ZM8 A;  2ZLY A;  4WZ5 C;  4LCM A;  3MKF A;  3LY4 A;  4MEZ A;  1MPL A;  4KEN B;  1YLJ A;  3BEC A;  2VGJ A;  2WYX A;  4BJP A;  1XA7 A;  2QZ6 A;  2EXB A;  2H0Y A;  2ZQ9 A;  5EPH A;  4UHU A;  3C4O A;  4EBN A;  4BL3 A;  3VP2 A;  4HBT A;  4B88 A;  5E2E A;  2OLV A;  1S6R A;  4OQ0 A;  1I2W A;  3OZH A;  1MWR A;  5FQI A;  2JE5 A;  2J9O A;  1PZP A;  4OQG A;  5EEC A;  3BLM A;  3EQV A;  4OVD A;  5CEC A;  4KG5 A;  3OPR A;  1XGI A;  5E2H A;  2HP5 A;  4OH0 A;  4N1H A;  1PI4 A;  1W5D A;  5EOO A;  5BOH A;  2XH9 A;  2HDR A;  1E25 A;  1IYO A;  1QMF A;  3MFD A;  4FH2 A;  1ZG6 A;  5CHU A;  1K4E A;  1FCM A;  3ZCZ A;  3UN7 A;  5FQQ A;  2Q9M A;  2ZMA A;  4FCF A;  4DXC A;  1GHM A;  2WGV A;  2ZM0 A;  3CJM A;  3GRJ A;  3WS4 A;  2XK1 A;  5E43 A;  1XX2 A;  4HBU A;  2HDU A;  2X01 A;  1YM1 A;  2P9V B;  2J8Y A;  3SOI A;  1OME A;  4R4S A;  2C5W B;  4S2O A;  1C3B A;  3O88 A;  2ZQ7 A;  1PYY A;  3O3V A;  3WRT A;  3A3F A;  4QU3 A;  5L2F A;  1ALQ A;  4S2N C;  5I94 A;  4D2O A;  2EFX A;  1BLP A;  2XGN A;  3GSG A;  3IF6 A;  4OPZ A;  4H8R A;  3UNW A;  1SCW A;  2HDQ A;  3CG5 A;  3Q07 A;  5F82 A;  4U0T A;  3ZG9 B;  1CI8 A;  3C5A A;  4Y0O A;  4XXR A;  4GDB A;  1NYM A;  3OC2 A;  5A90 A;  3VOY A;  5EVI A;  3DTM A;  1KGF A;  1YLT A;  3MKE A;  2HP6 A;  2XFT A;  3TSG A;  5HL1 A;  3UDX A;  1IKG A;  3VP3 A;  2E8I A;  2Q9N A;  1J9M A;  2OLU A;  3BRM A;  4DRT A;  3ZVW A;  5EVI D;  1K6S A;  1ES2 A;  1YMS A;  4LCL A;  3E2L A;  5DF7 A;  2XD1 A;  3EQU A;  3GV9 A;  4ZBE A;  1BLS A;  5AQ7 A;  3BFF A;  3UDF A;  2Y59 A;  1XXM A;  1MXO A;  2ZM2 A;  3DWK A;  5D3O A;  1K56 A;  5E2G A;  1GHP A;  2G2U A;  3IF6 B;  5CER A;  4IBR A;  5CTN A;  1FCN A;  3VOZ A;  4F94 A;  1RP5 A;  2HDS A;  1NZO A;  2XQZ A;  2H10 A;  4WEK A;  3UDI A;  3WS5 A;  3CZD A;  4GDN A;  4OOL A;  1KVM A;  2WKE A;  3AGE A;  3N8S A;  3LCE A;  1BSG A;  3G30 A;  3G4P A;  5M18 A;  3V50 A;  3UE1 A;  1PWC A;  1TDG A;  4E6W A;  4WM9 A;  3A3E A;  4HEF A;  5F83 A;  1YT4 A;  3LEZ A;  3FWL A;  4IBX A;  4KG2 A;  4LEN A;  1MWT A;  4MBK A;  2Y2L A;  1HVB A;  4KQR A;  5AQA A;  1ZG4 A;  2QMI A;  4GB7 A;  1O07 A;  4JXS A;  1YLP A;  2EXA A;  3HLE A;  4QHC A;  5KZH A;  3SS5 A;  4DKI A;  1PWD A;  2OSU A;  2Y2M A;  5CHJ A;  3DWZ A;  3BEB A;  4N1X A;  4FSF A;  3S1Y A;  5FAO A;  2Y55 A;  1NY0 A;  2I72 A;  4EQI A;  1IEM A;  1KVL A;  2ZQ8 A;  4PPR A;  5GLB A;  3UY6 A;  1ESU A;  5CEB A;  4GKU A;  4GZB A;  4OP5 A;  4WZ4 A;  1SDN A;  1Q2Q A;  3NI9 A;  3OPL A;  2G2W A;  2OV5 A;  2Z2M B;  1MY8 A;  3Q7V A;  2V20 A;  1K25 A;  5DVA A;  3SH8 A;  5HAQ A;  1ONG A;  5FSR A;  4DE2 A;  1YQS A;  5FAT A;  5GHZ A;  3SH9 A;  3IT9 A;  2WGW B;  4PMA A;  1PI5 A;  3Q7Z A;  3PAG A;  4MNR A;  4OOM A;  1S0W A;  2ZD8 A;  3ITA A;  4R4R A;  4S2K A;  3ZG8 B;  3ZG5 A;  1GHI A;  1G6A A;  3C4P A;  2QPN A;  1MWS A;  4MLL A;  1IYP A;  3Q1F A;  3LO7 A;  3SS4 A;  2WK0 A;  3A3D A;  1BUL A;  1K57 A;  2A49 A;  4X6T A;  4ZDX A;  1QME A;  2WAE A;  2Y4A A;  4N92 A;  5DTK A;  5FDH A;  4E3O A;  4X69 A;  4JF4 A;  1M40 A;  4X55 A;  3HLB A;  4ZTK A;  5CGS A;  2DNS A;  1RGZ A;  3P09 A;  3NDG A;  4OLD A;  5CXW A;  4Z9Q A;  3HLF A;  3Q7V B;  2WGI A;  1I2S A;  3FZC A;  3PBQ A;  2IWC A;  4WZ5 A;  2UWX A;  3HL9 A;  2PBY A;  3N8R A;  1K55 C;  2GDN A;  5A93 A;  1KE3 A;  2CC1 A;  3D4F A;  4E3L A;  2WUQ A;  5DF8 A;  2C6W B;  3V5M A;  2V2F F;  5F1F A;  2Y2H A;  4BEN A;  4ZJ2 A;  3IQA A;  3IF5 A;  1N4O A;  2ZQC A;  3IXB A;  3QNB A;  3RXX A;  4E3M A;  1PZO A;  4BLM A;  1BZA A;  3VMA A;  1HTZ A;  2JCH A;  3VFF A;  3ZG7 B;  1FR1 A;  1K4F A;  5E2F A;  3M2J A;  3QHY A;  2VGK A;  1L0E A;  1DJA A;  5GL9 A;  3HBR A;  1PWG A;  4KZ3 A;  3TOI A;  4N9L A;  2HP9 A;  1WE4 A;  1L0D A;  4DDS A;  2FFF B;  3I7J A;  3ISG A;  1H8Y A;  2Y2J A;  1DJC A;  1H5X A;  3SH7 A;  3C7V A;  3HLW A;  4S2P A;  1BTL A;  3UE0 A;  4LV1 A;  3SS3 A;  3ZNY A;  1N9B A;  1TVF A;  2R9X A;  2PU4 A;  2XFS A;  1LI9 A;  4LV0 A;  4OPQ A;  3DW0 A;  4S2L A;  4WEJ A;  3FV7 A;  3W4P A;  4DF6 A;  1XA1 A;  4EBP A;  1IEL A;  1PW1 A;  4P85 A;  1IKI A;  4WYY A;  5IHV A;  5HFO A;  4S2N A;  4X68 A;  4CJN A;  4K0W A;  2XDM A;  1L0F A;  4R1G A;  5GLA A;  3WS1 A;  3P98 A;  4KZ6 A;  4DXB A;  4QJG A;  4C75 A;  5FI6 A;  2RL3 A;  2Y2K A;  2WZZ A;  4E3I A;  3G32 A;  1KGE A;  4QD4 A;  5DTT A;  1JVJ A;  2Y91 A;  3Q82 A;  4QY5 A;  3BLS A;  4E3K A;  1LL5 A;  4OOY A;  4L0L A;  4LV2 A;  2ZC7 A;  4IVI A;  3ZDJ A;  5FAP A;  1XGJ A;  2WAF A;  5GLD A;  5A91 A;  1O7E A;  1RGY A;  2EX2 A;  5CHM A;  3FKW A;  5EVL A;  4DE0 A;  2XD5 A;  3PBN A;  1K54 C;  5FI7 A;  1FSY A;  2JC7 A;  2PU2 A;  1CI9 A;  1HZO A;  3IXD A;  4BD0 A;  4Q8I A;  4PM5 A;  1U60 A;  4E3N A;  4PM9 A;  1JTD A;  5EVI B;  2EX9 A;  4GD6 A;  1LLB A;  4RX3 A;  1DJB A;  4U3T A;  4U0X A;  5HAR A;  3IWI A;  1IYQ A;  4IVK A;  2B5R A;  3MZD A;  4NET A;  4OPR A;  4HES A;  1IYS A;  1W8Q A;  5HAP A;  1KE4 A;  3BM6 A;  4MBF A;  2ZC5 B;  1SHV A;  1DY6 A;  1G68 A;  3AGF A;  2BG1 A;  1EI5 A;  3M6H A;  1ES3 A;  5FAQ A;  3G2Z A;  3W4Q A;  3MXS A;  4OKP A;  1KDS A;  5DTS A;  3PBO A;  4KZA A;  5HAI A;  4XUZ A;  4JF5 A;  2IWD A;  3G31 A;  5FI2 A;  5HW3 A;  4Y0U A;  3PBS A;  4C6Y A;  4M3K A;  3MZF A;  3IH9 A;  1JWV A;  3HRE A;  2EFU A;  1BUE A;  1W8Y A;  3HLG A;  4C3Q A;  3IHB A;  4X56 A;  3HLC A;  2FFY A;  2R9W A;  3BFC A;  4PM8 A;  4PM7 A;  4RA7 A;  5U47 A;  2XF3 A;  5TR7 A;  2ZQD A;  1Y54 A;  5F1G A;  3VP4 A;  2H5S A;  3O86 A;  3WRZ A;  3OCN A;  3C7U A;  1KGG A;  5M19 A;  1K38 A;  3NC8 A;  5AQ9 A;  1ESI A;  4R23 A;  5J8X A;  2A3U A;  4KQQ A;  4EWF A;  3N7W A;  4P87 A;  3N4I A;  4ID4 A;  3NIA A;  1GA9 A;  3PTE A;  4N9K A;  3M6B A;  3GTC A;  5AQB A;  1YLW A;  3S22 A;  1NYY A;  3ZHH A;  3V3S A;  1AXB A;  1TEM A;  3QNC A;  3ITB A;  1MBL A;  3NDE A;  4B4Z A;  3ZNT A;  3PBR A;  4MBH A;  4YFM A;  4BD1 A;  4EV4 A;  4FD8 A;  3IXH A;  4KZ5 A;  4OQI A;  3W8K A;  5FA7 A;  1ERO A;  4YIN A;  1K6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...