1GHMA

Structures of the acyl-enzyme complex of the staphylococcus aureus beta-lactamase mutant glu166asp:asn170gln with degraded cephaloridine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYDIELQYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Structures of the acyl-enzyme complexes of the Staphylococcus aureus beta-lactamase mutant Glu166Asp:Asn170Gln with benzylpenicillin and cephaloridine.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 93
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ghmA00
1KGEA 3QNCA 4Y0UA 3IXBA 1K25A 1MPLA 3HLWA 3S1YA 2Y91A 1L2SA 4BL3A 5EVIA 2WGWB 4S2PA 1MKIA 5EVIC 4IEDA 2WKEA 2EXBA 4P87A 5FAOA 4E6XA 2HP9A 3C7UA 4N92A 5E43A 2Z2LB 2XH9A 2G2UA 5KMWA 4Y7PA 3WRZA 4EQIA 4CJNA 1BLCA 1LLBA 1XA7A 4JPMA 1PZOA 2QMIA 1FCNA 2EFUA 3NC8A 3IF5A 1RP5A 2HP5A 3MKFA 1LI9A 3AGEA 1MWTA 1VQQA 3BFCA 1MWRA 1JVJA 1JWVA 4U0XA 4CPKA 3O3VA 2WKHA 2DNSA 3Q07A 1PWGA 4JBFA 3VFHA 3VOZA 2WYXA 4E3OA 1CEFA 1YLYA 1G68A 5CXWA 3P98A 4UA7A 1C3BA 2ZM2A 4S2IA 1YLWA 2WGWA 3MFDA 4LV1A 1JWZA 4C75A 1BZAA 3TG9A 3PBSA 3N7WA 3BECA 1ERQA 5GLCA 3UDIA 4E3NA 2Y2OA 4WELA 5FA7A 3ITAA 5FQ9A 2ZC6B 3HUMA 4BENA 4LV0A 3IXDA 2WAEA 2X02A 3Q1FA 3V5MA 3UNWA 1PIOA 3IWOA 5FQMA 3GQZA 1KVLA 4S2KA 1BUEA 2Q9MA 4RA7A 3RXXA 5A92A 1TDLA 2XFTA 4FH4A 2Y2NA 4EBPA 3A3IA 3G32A 5GLAA 4MNRA 3ZG0A 2XFSA 2UWXA 3SH8A 2XEPA 4UAAA 3FWLA 3WRTA 4DE2A 1KE0A 2XK1A 1WE4A 3MZFA 1YLZA 5F1FA 5M19A 3M6BA 4PPRA 1XKZA 4IVKA 4S2JA 3N8SA 5FQKA 5M18A 1CI8A 4A5RA 3PBNA 3BLMA 2JE5A 2P9VB 1RGYA 4IBXA 4KZ6A 1BTLA 4X56A 5F1GA 3ZVWA 2EX6A 5E2GA 4Z9QA 4KG5A 2RL3A 5CGSA 4JXVA 5CHUA 1GA9A 2WADA 4OOYA 5FI2A 4JLFA 4OVDA 1LI0A 1DJBA 1N4OA 1XP4A 3MXSA 3PTEA 4HEFA 3UPOA 3PBQA 2XD1A 1MXOA 2DCFA 5JYPA 5F82A 3MXRA 4R4RA 4HBTA 3EQUA 1NXYA 1PYYA 5GHZA 1I5QA 5HX9A 1PWDA 1SKFA 1ALQA 4BJPA 1SDNA 4KQQA 4FCFA 4KZBA 4WM9A 2P9VA 5DF7A 1XGIA 3Q82A 4WZ5A 4DRTA 4R23A 4WZ5C 3LY3A 4GD8A 3E2KA 2J8YA 4X69A 4DE1A 2EXAA 1FOFA 2JCHA 2HP6A 3TOIA 3OCLA 4JXSA 4IVIA 3ZG8B 5G18A 3BLSA 3HREA 3OC2A 1XGJA 2ZC4B 2HDQA 3UE0A 2PU2A 5FAQA 1PWCA 5FQJA 2E8IA 5CHMA 2P74A 4BLMA 4PM5A 5HL1A 4P85A 4EV4A 3IHAA 5FI7A 5GLBA 1CI9A 4B4ZA 5HAPA 2Y4AA 4KQRA 2XDMA 2JBFA 3VMAA 4D2OA 5DTTA 3DTMA 4QB8A 5A91A 3ITBA 3OCNA 3SS5A 2ZQAA 1J9MA 5EOOA 1K54A 2ZQ8A 3EQVA 3IF6A 3NBLA 1K54C 3IF6C 1MWSA 1NJ4A 5KZHA 1O7EA 3GV9A 2FFFB 3W4PA 2WKIA 2WZXA 3A3EA 4GZBA 1PI5A 4MEZA 4RYEA 4C6YA 4ZDXA 2ZQ9A 1W7FA 3FV7A 4OOLA 1K56D 1MY8A 1XPBA 1E3UD 1H8ZA 4ZJ3A 4KZ9A 5JYOA 4X68A 5D3OA 3WS5A 5A93A 4KZ8A 2IWCA 3P09A 3S4XA 1DY6A 1S0WA 3MZEA 4LV3A 5HARA 5CEDA 5A90A 2ZC3B 3O87A 3IWIA 2ZMAA 3HL9A 1ZG6A 5HFOA 1BULA 1KGGA 5EPHA 4GB7A 1Q2PA 3V39A 2Y55A 1K55A 4QU3A 1FR6A 3UPPA 1K55C 2Y2LA 2BLSA 1NZUA 4WZ4A 1BLHA 1K6RA 3C4PA 2V20A 5KSCA 4WMCA 1FQGA 1L0DA 3G2ZA 3PBRA 4N1XA 4P0MA 3RJUA 4EBNA 1YM1A 4KZ7A 4DXCA 3N4IA 4YFMA 5EUAA 1BT5A 4IBRA 4EBLA 4UA9A 3GMWA 4RX2A 5EOEA 1K57A 1L0GA 3W8KA 1K57C 1W5DA 5IHVA 4QD4A 1M40A 1U60A 3UO9A 3QNBA 1RCJA 1I2SA 2A49A 2VGJA 3O86A 1YQSA 3VP3A 2HDUA 2R9WA 3HLCA 4FD8A 3PBOA 4NETA 4KENB 4GKUA 2R9XA 2V2FF 3V3RA 1G6AA 3OPHA 1DJAA 3GVBA 4E3JA 4QHCA 1TDGA 2WK0A 2XD5A 4PM8A 5AQ9A 4K91A 3TSGA 4U3TA 2G2WA 3UY6A 3LEZA 5BOHA 1ZC2A 4OPRA 5CECA 2EX2A 2EX8A 3PAGA 4MBHA 1K4EA 4OPYA 5M1AA 3BRMA 4RVAA 2C5WB 2ZQCA 1GHIA 2XF3A 1CK3A 1GHPA 2Y2GA 5E2HA 1PW8A 1VM1A 3FKVA 5EVID 4GOGA 2Y2IA 5TR7A 4KZ3A 4Y0OA 1H8YA 5DTKA 3A3DA 1LHYA 4DE0A 2PU4A 3DWZA 4KZ5A 4NK3A 4OQ0A 3BM6A 3IT9A 4E3KA 1WYCA 4OP5A 4ZTKA 3I7JA 2OSUA 1K38A 4S2MA 2ZM8A 4DDYA 4E6WA 1FCMA 4JXWA 1YMXA 2DRWA 1IEMA 5U47A 2HDSA 1AXBA 3B3XA 1MBLA 3Q7ZA 3ZCZA 5CHJA 4ZAMA 3UN7A 2Y2QA 3WS4A 5E2EA 2ZQDA 3W4OA 1LL5A 1NYYA 4YINA 3NIAA 3IH8A 3IF6B 4UHUA 4DKIA 4OQHA 1KVMA 4OKPA 4ID4A 3HBRA 4S2NA 4DF6A 4WEKA 4P6BA 4QJGA 1KDSA 4S2NC 3W4QA 1SCWA 3M2KA 2J7VA 5GHXA 3CJMA 2XGNA 1YLPA 4B88A 3GTCA 1ZG4A 4KG2A 4E3LA 5EVLA 3SH9A 3QHYA 1QMEA 1RGZA 3CG5A 2OV5A 2XLNA 5GLDA 3WS0A 4QY6A 4WEJA 4HBUA 2OLUA 1BLPA 4JKTA 3AGDA 2X01A 4B4XA 4F94A 1YLTA 2FFYA 3VP0A 3C5AA 1FCOA 4X55A 3IHBA 1L0FA 1HVBA 4S2OA 2GDNA 2Y2HA 5DF8A 5DTSA 2WUQA 4GD6A 3C7VA 3FYZA 3ZG9B 4OLGA 1FR1A 1PZPA 2XQZA 1I2WA 2HDRA 3C4OA 3NDGA 1ONGA 2HPBA 4M3KA 3A3FA 5CTMA 5E2FA 1W79A 4MBFA 3WWXA 4DXBA 4OLDA 2Y59A 5CGWA 4HESA 4GDBA 4FSFA 2V1ZA 3NCKA 4KG6A 4O7DA 4ZJ2A 1IKGA 2C6WB 3G2YA 1GCEA 4ZBEA 2ZLYA 3N6IA 1IYOA 1JWPA 5CTNA 1NYMA 3IQAA 4KZAA 1JTDA 1IKIA 3SS3A 3GRJA 4EWFA 4ZJ1A 3HUNA 3Q7VA 3OPLA 3PAEA 3N8LA 4PM6A 4DE3A 4JXGA 2ZJ9A 4FH2A 4QY5A 2H10A 1IYSA 2H0TA 3MBZA 5CERA 5FATA 4GN2A 1ESUA 3DW0A 4K0XA 3BFGA 1BLSA 4OP8A 4OOMA 4OPZA 4LCLA 1IYPA 2Y2KA 2WGIA 1LL9A 4JF6A 3ZNYA 4N9LA 3MZDA 4PMAA 1NY0A 3OPRA 2B5RA 3GSGA 4R3BA 1GHMA 5GHYA 3HLDA 3SOIA 4DDSA 3V3SA 2XR0A 4R4SA 5HW3A 4RX3A 1NZOA 4OPQA 4LV2A 4S2LA 4R1GA 1HZOA 1XA1A 5J8XA 1W8QA 1M6KA 2Y2MA 1MWUA 3S22A 4R3JA 2QZ6A 5GL9A 2EX9A 3WS1A 1GA0A 1SDEA 3BFFA 4MLLA 3VSLA 3IXHA 5F83A 2ZQ7A 3NDEA 3VP2A 2Z2MB 4PM7A 4OQGA 1K6SA 5DF9A 2IWBA 2OLVA 2WGVA 2WAFA 1KE4A 3IWQA 3G35A 5FDHA 3ZVTA 2Y2PA 1DJCA 1SHVA 2Y2JA 2ZC7A 3BEBA 3HLBA 3G31A 3N8RA 3MKEA 4U0TA 2CC1A 5HAQA 5FI6A 3ISGA 4E3IA 1N9BA 3VOYA 1W8YA 1FSYA 2X71A 2H5SA 4C3QA 4H8RA 2I72A 3CZDA 1ONHA 2ZD8A 3V50A 3ZHHA 1YT4A 4GDNA 4OQIA 3BFEA 3ZGAB 5FASA 1EI5A 2JC7A 1YLJA 4N1HA 5AQ7A 4UA6A 3LO7A 4BD0A 4XXRA 5I94A 3VP1A 4E3MA 1E25A 5CRFA 2VGKA 3SS4A 2J9PA 1JTGA 3D4FA 4XUXA 2Q9NA 2BG1A 4JF4A 3DWKA 1ES3A 1ES4A 3G30A 3NY4A 5EE8A 3UE3A 1CEGA 1XX2A 3HLGA 1OMEA 3OZHA 2IWDA 4BL2A 1KGFA 2QPNA 5DVAA 3VP4A 4BD1A 3HLFA 2EFXA 4L0LA 1NRFA 1ZKJA 1K56A 5FQIA 1H5XA 4MBKA 3HVFA 5FSRA 1E3UA 4WMCD 1TEMA 3BFDA 3VSKA 3AGFA 1L0EA 2ZC5B 2J9OA 3JYIA 3FZCA 3M6HA 3E2LA 2H0YA 4OONA 1XXMA 1E4DA 3VFFA 1IELA 2RCXA 3RXWA 3SH7A 1O07A 3HLEA 1WYBA 3GR2A 4KZ4A 3ZDJA 3G34A 1FSWA 3ZNTA 4X53A 3NI9A 1YMSA 1HD8A 1HTZA 3Q7VB 3M2JA 1S6RA 4Y0TA 4KQOA 3A3JA 4LCMA 4EUZA 3ZG5A 1PI4A 4OH0A 5CEBA 4BQMA 1KDWA 4JF5A 5AQAA 1ERMA 1Z6FA 5FQQA 5HAIA 4K0WA 1EROA 5FAPA 5EVIB 4X6TA 2WZZA 5AQBA 3PBTA 3UDFA 5L2FA 3LCEA 1QMFA 3IXGA 3UDXA 1IYQA 4XUZA 4LENA 5EECA 3Q81A 5KSHA 1K4FA 1BSGA 2PBYA 4WYYA 1ES2A 3UPNA 4PM9A 1TVFA 4GNUA 4Q8IA 4WBGA 3CMZA 3HUOA 3BYDA 1Q2QA 3UE1A 2A3UA 1Y54A 1ESIA 4N9KA 3LY4A 3WS2A 1EWZA 1KE3A 3ZFZA 3O88A 3OPPA 5TGFA 5CGXA 3G4PA 1PW1A 3ZG7B 5TFQA 4R0QA 1ES5A 3FKWA 3IH9A 2ZM0A
chains in the Genus database with same CATH superfamily
1K25A 1MPLA 3HLWA 1XFQA 1YPRA 3CPTB 4P87A 2HP9A 1H3QA 2Z2LB 3VV4A 2G2UA 5KMWA 3EWKA 3LI9A 1XA7A 3C2WA 1LSVA 2EA9A 1FCNA 3IF5A 3MKFA 1LI9A 1VQQA 1MWRA 1JVJA 4U0XA 4CLCA 3Q07A 2WYXA 4CLCC 3C8CA 3KYQA 4UA7A 5EV0A 1YLWA 3IX8A 4F3LA 1CF0A 4C75A 2GX5A 3N7WA 4E3NA 4LFUA 2V1BA 4MDZA 1DP8A 3HUMA 4LRZE 3IXDA 5LBRA 3V5MA 3IWOA 3GQZA 3KSGA 2GZAA 3ZG0A 3W2ZA 3DAVA 4UAAA 3WRTA 1WE4A 2VJWA 4S2JA 3N8SA 2JE5A 2P9VB 1BTLA 2PT7A 5F1GA 4H6JA 5E2GA 3MJQA 1XP4A 3UPOA 3PBQA 5AJGA 1VEUB 4BJPA 2BTFP 2KLIA 5DF7A 4WM9A 1D1JA 2ZOIA 4WZ5A 1LSXA 4WZ5C 3E2KA 2J8YA 2EXAA 2PD8A 4ETXA 3NJAA 3ZG8B 3HREA 1OT6A 1TS7A 1PWCA 3DTIA 4LLOB 3OBFA 4BLMA 2O9AA 3IHAA 1T1CA 4FTXA 5L8MA 5TBMA 2B02A 3T4TA 2Y4AA 2JBFA 4LPZA 3T12B 4GCZA 3F1PA 4BBVA 3SS5A 4ESPA 1A0KA 3JPUA 2WZXA 2QHKA 3G6OA 4RYEA 4C6YA 3S7NA 4HQAA 4PKYG 4Y2FA 2VV7A 1MY8A 1XPBA 3WS5A 3CITA 1VETB 5HARA 5A90A 3IWIA 2ZMAA 4YOFA 1BULA 1FR6A 2BLSA 3ULFA 2O0YA 3C4PA 2V20A 3LEQA 5KSCA 1FQGA 1L0DA 3PBRA 4KZ7A 3N4IA 4YFMA 2WKRA 5HD5A 5EOEA 1L0GA 1W5DA 4QD4A 1M40A 1U60A 3QNBA 3GDIA 3O86A 2R9WA 4NETA 4GKUA 3UB7A 2WK0A 4Z1WA 5AQ9A 2G2WA 3UY6A 3LEZA 5CECA 2WKQA 4MBHA 4HJ4A 4GS9A 4I38A 5HWVA 4NG2A 1GHIA 1GSXA 2Y2GA 5E2HA 1PW8A 4GOGA 3E4PA 5TR7A 2HV1A 4HOIA 1EW0A 4X1MA 3OLOA 3DWZA 1K38A 3KSFA 4E6WA 3LIBA 1IEMA 4DN0A 3CUEA 5CHJA 3CUEC 1SKOB 3PR6A 4YINA 4HNBA 4HP9A 4UHUA 2FH5A 2BASA 1SZVA 3E4QA 4DKIA 4EW7A 4DF6A 4QJGA 4Q0JA 1SCWA 2XGNA 1YLPA 5K5BA 3A0RA 3IS2A 5EVLA 3SH9A 1QMEA 1RGZA 3CG5A 2OV5A 5GLDA 4MN5A 3AGDA 5HPIA 1YLTA 3C5AA 5C5KA 1L0FA 3C38A 2GDNA 1NLZA 2WUQA 4GD6A 3C7VA 1TS0A 1T1AA 5CX7A 4OLGA 1ACFA 1I2WA 2PHYA 1JNUA 2HJEA 4MBFA 5A8BA 5CTNA 1NYMA 2FZ0A 1IKIA 4EWFA 4NXFA 2PRFA 4JXGA 5DJUA 4R6LA 4FH2A 4QY5A 3QP2A 5CERA 4GN2A 3BFGA 4OP8A 4OOMA 4LCLA 1IYPA 1LL9A 3UB8A 2VKSA 2VEAA 3OPRA 2B5RA 3SOIA 1GHMA 5GHYA 3F1OA 2GNXA 2ZL1B 4I3JA 2O9CA 3H82B 4ME4A 3C30A 1MWUA 4R3JA 1GA0A 3CWFA 3VP2A 2Z2MB 1K6SA 3QP1A 5DF9A 2OLVA 2V1AA 2WAFA 1MC0A 5FDHA 5J3WA 3ZVTA 1S66L 1SHVA 5FDSA 5DKKA 3G31A 3CPTA 3IBJA 2NUPC 2CC1A 5HAQA 4IJGA 3ISGA 5FI6A 5HZHA 1FSYA 2OWJA 4H8RA 4D60A 4LRYC 4GHIB 3D9YA 2XA7M 5FASA 1OTBA 4UA6A 4BD0A 1NRJA 5I94A 1S67L 4E3MA 5CRFA 2VGKA 3D4FA 4XUXA 5G4ZA 4JF4A 1ES3A 3CHWP 3G30A 1OMEA 2PR5A 1KGFA 4YWZA 1FILA 4BD1A 1ZKJA 1XJ6A 5FQIA 1DRMA 1H5XA 3HVFA 4WMCD 3BFDA 3MFXA 3FZCA 3E2LA 1ZHHB 1IELA 2PDRA 3RXWA 1O07A 3ZDJA 3O5YA 2XRNA 1HTZA 4M4XA 1S6RA 4GJ4A 2ZBBA 5FQQA 4K0WA 1EROA 2JKFA 4RQ9A 2WZZA 3UDFA 3IXGA 4LENA 5EECA 1W63Q 4X1LA 1NWZA 4HP4A 4Q8IA 3BYDA 4N9KA 1Y54A 3KSIA 4CQHA 1EWZA 1KE3A 4G3KA 5TGFA 5CGXA 2OAQ1 1PW1A 5TFQA 1ES5A 2ZM0A 3QNCA 3S1YA 1BYWA 2L4RA 2Y91A 4EETB 2WKEA 2NUTC 5FAOA 4R70A 2QWSA 2K31A 4EEPA 4EQIA 1BLCA 2VA0A 1PZOA 1F5MA 3AGEA 1LSWA 1JWVA 3O3VA 5HDCA 2WKHA 4JBFA 3VFHA 1CEFA 1YLYA 3P98A 1C3BA 2WGWA 3MFDA 3A0SA 2OOLA 3BECA 1ERQA 1IOUA 4WELA 5FQ9A 1G5UA 2Y8HA 4LV0A 4WL9A 2X02A 1PIOA 1T1BA 1VETA 1KVLA 3S7OA 1TDLA 4EBPA 3A3IA 5EVEA 2UWXA 3FWLA 4DE2A 5F1FA 5M19A 4HH3A 1OPXA 1XKZA 5FQKA 4IUKA 3ZVWA 1Y28A 5CGSA 4JXVA 5CHUA 4OOYA 4JLFA 3LICA 5DFXA 1LI0A 3T1XA 2VK3A 3K3DA 4L9EA 5JYPA 4R4RA 1PYYA 5GHZA 1SKFA 1ALQA 4FCFA 2D01A 4LGWA 4DRTA 1W63M 4R23A 4GD8A 4JXSA 4GLQA 4IVIA 4G3WA 5G18A 3BLSA 3OC2A 3UE0A 2PU2A 3ICYA 4JGRA 1TS8A 2VZWA 2W3DA 2E8IA 3UB5P 2P74A 4MMNA 4P85A 4EV4A 5FI7A 2PD7A 5HAPA 4KQRA 3DTEA 3DTMA 4ARZB 1H8MA 2A2LA 3ITBA 1P97A 5IT5A 5EOOA 3EQVA 3NBLA 1OTDA 3TJZC 2W3EA 2FFFB 3W4PA 4ZDXA 1W7FA 2VLGA 3FV7A 1K56D 3LIAA 4Q0IA 4ZJ3A 4KZ9A 4X68A 5D3OA 3TRCA 2IWCA 1DY6A 2QKPA 2B18A 2HF6A 4LV3A 1ZG6A 2R78A 4X25A 1Q2PA 3V39A 3T4KA 1NZUA 3T4SA 1BLHA 1K6RA 2O9BA 5EFWA 4WMCA 5G4YA 4DXCA 2JN7A 3LR4A 5EUAA 1BT5A 4IBRA 3GMWA 2I9VA 1FIKA 4KQDA 1I2SA 2A24B 4FD8A 3PBOA 4KENB 2V2FF 3V3RA 3GVBA 1TDGA 4PM8A 5HWWA 4OPRA 1CJFA 3BQ8A 1P9WA 2EX8A 3K2NA 4EXOA 1K4EA 3BRMA 2Z6DA 2C5WB 2XF3A 1CK3A 5EVID 4JGQA 1VM1A 5F6AA 4KZ3A 4Y0OA 1H8YA 5TJJA 3A3DA 4O0PA 2PU4A 3IT9A 4ZTKA 3H7WB 1FCMA 3BW6A 3B33A 4EU0A 2DRWA 2IA2A 2LB9A 2HDSA 3B3XA 3Q7ZA 3ZCZA 3UN7A 3WS4A 1PFLA 3NIAA 4GHIA 4QPRA 4OKPA 4ID4A 4WEKA 1S1YA 4P6BA 1G28A 3W4QA 2J7VA 5GHXA 3GTCA 5F5YA 4KG2A 5HL6A 2XLNA 4QY6A 4HBUA 2OLUA 4B4XA 4F94A 2FFYA 1FCOA 4X55A 4I3AA 5DTSA 3FYZA 3ZG9B 3HJIA 1PZPA 3EGDC 1UWPX 5CTMA 3NDGA 4I5SA 1W79A 3T4LA 5J7EA 4L9GA 1XFNA 5CGWA 3EEAA 2JHEA 1GSWA 4O7DA 1IKGA 3G2YA 4ZBEA 2ZLYA 3SS3A 3HUNA 4I3IA 3VE3A 3OPLA 3PAEA 4DE3A 2H10A 1IYSA 3NOTC 5FATA 3DBAA 4OPZA 4GW9A 2Y2KA 4JF6A 3ZNYA 3U4LP 1S1ZA 1YSPA 1NY0A 4R3BA 1PRQA 4R4SA 1NZOA 2Z6CA 4S2LA 5J8XA 2EWWA 2PYRA 3NOUC 3WS1A 2JKRM 1SDEA 3BFFA 3VSLA 2ZQ7A 4PM7A 4OQGA 2IWBA 2WGVA 5FEFA 2Y2PA 2ZC7A 3BEBA 3N8RA 3LI8A 3MKEA 2V0UA 3UE6A 2H5SA 3SW1A 2JKGA 1YT4A 4OQIA 3BFEA 4XXRA 4JGPA 2J9PA 2Q9NA 2XA7S 1OJGA 3ZQ5A 5EE8A 3UE3A 4DJ2A 5HD3A 3OZHA 3HLGA 2QPNA 4K08A 4L0LA 3KYZA 1Y4OA 1K56A 1G6OA 2HGVA 5FSRA 1TEMA 3VSKA 3AGFA 2J9OA 4OONA 2M7UA 5J4EA 2OWHA 2W0NA 4KUOA 2RCXA 3HLEA 3GR2A 2ZMVA 4X53A 3NI9A 3Q7VB 3PHYA 4EUZA 4MCWA 2W3FA 5AQAA 4XT2B 3LIDA 4XUZA 3R7WA 3KX0X 1ODVA 1K4FA 3UPNA 2XSSA 4WBGA 2MJ6A 4Y17A 3HUOA 4EUVA 3UE1A 3L7HA 3O88A 3OPPA 2K2NA 4IUHA 2L1MA 4CLCB 3MBZA 1KGEA 4Y0UA 1L2SA 4BL3A 5EVIA 1V9YA 2ZMFA 5EVIC 4IEDA 3T4OA 1LLBA 4JPMA 3MS6A 3BFCA 3VOZA 5HPFA 3LR5A 4E3OA 1G68A 1TD5A 3IX3A 4S2IA 5DKLA 1BZAA 3TG9A 5GLCA 2Y2OA 5FA7A 3NOPC 3KYEA 2W3GA 4O8GA 3UNWA 3TW8A 1BUEA 2Q9MA 4NEED 3G32A 5GLAA 1XJ4A 2GJ3A 4MNRA 3BJNA 2XEPA 3T4JA 3MZFA 1YLZA 3VE4A 1CI8A 3SZTA 2V8FA 1RGYA 4KZ6A 4UQIM 4X56A 1KOUA 3CI6A 4PKYA 4DMZA 5L09A 4Z9QA 4Q0HA 1GA9A 2PYPA 4OVDA 3LGOA 1DJBA 2A24A 1LT0A 2XD1A 5F82A 3MXRA 3UB6A 1NXYA 4II7A 1I5QA 1PWDA 5F69A 1SDNA 4KQQA 4YNRA 2P9VA 2JKTI 2QYBA 4X69A 2JCHA 3TOIA 4EESA 2QJ7A 2W3HA 1XGJA 5FAQA 5CHMA 2J3TD 4PM5A 5HL1A 1S4SA 1VEUA 2Y79A 5GLBA 3B47A 4B4ZA 2V8CA 4D2OA 4QB8A 5A91A 3T1RA 1J9MA 1K54A 5HSQA 1K54C 3LR0A 4QWOA 1O7EA 3GV9A 2WKIA 3A3EA 4GZBA 4MEZA 4BMWA 2ZQ9A 4OOLA 2QJ5A 2P04A 1E3UD 5JYOA 3MXQA 3S4XA 1S0WA 5CEDA 3D72A 4EQ1A 2ZC3B 2J80A 3E98A 3HL9A 2ACGA 5HFOA 5EPHA 4GB7A 1K55A 4QU3A 3UPPA 1K55C 4WZ4A 1NLYA 4WF0A 4R3AA 3G2ZA 4N1XA 4CLCE 4P0MA 4EBNA 1YM1A 4UA9A 4RX2A 2K7SA 1VHMA 1K57A 1OTEA 3W8KA 1K57C 3MR0A 2P08A 3UO9A 2A49A 1YQSA 3LYXA 2HDUA 4PHTA 1DP6A 1G6AA 1DJAA 3U2AA 4E3JA 4QHCA 1F98A 4K91A 3TSGA 4E04A 4U3TA 5I5LA 5BOHA 1ZC2A 5IS1A 3PAGA 4OPYA 1T19A 1X0OA 2ZQCA 1GHPA 2KOIA 4IHQA 4EERA 5KIZA 3TE8A 1LHYA 4DE0A 2KDKA 5L10A 4WLAA 3IS2B 3BM6A 3EOIA 1WYCA 4OP5A 2OSUA 4S2MA 4ETZA 5U47A 4NXBA 2YKFA 5E2EA 2W1TB 3OOVA 1NYYA 4FUWA 5MC7A 3IH8A 3IF6B 4HY8A 2VV6A 4BBUA 1P0ZA 3WS0A 1BLPA 4JKTA 3VP0A 2UV0E 2Y2HA 5DF8A 1SKOA 3A0VA 2HDRA 2PAVP 3C4OA 5E2FA 2ZOHA 4DXBA 4OLDA 2Y59A 3BWLA 3NCKA 4KG6A 2C6WB 1GCEA 4P6ZS 3N6IA 4Y3IA 1JWPA 3IQAA 3T1SA 3GRJA 4ZJ1A 3Q7VA 3N8LA 4PM6A 2HJ9C 2H0TA 4K0XA 1BLSA 4XT2A 2WGIA 2W27A 1TS6A 3GSGA 3HLDA 1P9RA 3V3SA 5HW3A 4OPQA 4R1GA 1HZOA 1XA1A 1OT9A 5GL9A 2EX9A 5F83A 3NDEA 2E8JA 3T1QB 4I39A 1KE4A 4AFIA 2Y2JA 1DJCA 2XROA 3HLBA 4NKPA 3F1NB 1N9BA 3QP8A 4G3VA 3VOYA 1K0KA 5EM1A 4FOFA 2ZL1A 4C3QA 1S4RA 2I72A 2J3TC 3H82A 2ZD8A 2JKTM 3ZHHA 4GDNA 3ZGAB 1YLJA 4N1HA 5AQ7A 1ZTUA 4L9FA 3LR3A 2WKPA 3SS4A 2LB5A 3DWKA 1CEGA 4BL2A 2IWDA 4HH2A 5DVAA 3VP4A 2EFXA 1NRFA 1E3UA 2ZC5B 3JYIA 1E4DA 3VFFA 3H9WA 2INWA 3PYPA 1WYBA 5HWTA 3ZNTA 1YMSA 1HD8A 3D3OA 3M2JA 2PR6A 4Y0TA 4KQOA 3A3JA 4LCMA 1PI4A 4OH0A 4BQMA 4JF5A 3PXPA 1YAXA 5FAPA 4X6TA 5AQBA 3PBTA 5L2FA 3LCEA 4P6ZM 1QMFA 3UDXA 1IYQA 3MSHA 3E4OA 1MKMA 3Q81A 2PBYA 1BSGA 1ES2A 1OTIA 4PM9A 1TVFA 4GNUA 3RH8B 3CMZA 3P01A 3LY4A 3WS2A 5FEGA 3ZG7B 3IH9A 3KSHA 3IXBA 2WGWB 4S2PA 1MKIA 4EEUA 2EXBA 3B42A 4E6XA 3C7UA 4N92A 3E0YA 5E43A 2KX6A 2XH9A 2CMNA 4Y7PA 3WRZA 4CJNA 2EWVA 2QMIA 2EFUA 3NC8A 3S7PA 1RP5A 2HP5A 1MWTA 3S7QA 4HI4A 3L9KA 4CPKA 2DNSA 1PWGA 4Y13A 2W1RA 5CXWA 1VB6A 2ZM2A 4LV1A 1JWZA 1OJ5A 1XJ2A 3PBSA 3UDIA 1L3LA 3ITAA 2ZC6B 1J3WA 4BENA 2M1CA 2WAEA 3UB9A 3Q1FA 5FQMA 4S2KA 4RA7A 5A92A 3RXXA 3FPWA 2XFTA 4FH4A 2Y2NA 3EEHA 5HDDA 2XFSA 3SH8A 1KE0A 2XK1A 1N9NA 1WA9A 3M6BA 3NECA 4PPRA 4IVKA 3ZYTA 5M18A 4A5RA 3PBNA 3BLMA 1CQAA 3KO6A 4IBXA 2EX6A 4KG5A 2RL3A 3CLOA 2WADA 5FI2A 4UQIS 1N4OA 3MXSA 3VOLA 3DTKA 5DFYA 3PTEA 4HEFA 1MXOA 2DCFA 1YKDA 4HBTA 3EQUA 5HX9A 3CAXA 1LL8A 4KZBA 3HCYA 1XGIA 3Q82A 1MZUA 3LY3A 4DE1A 1FOFA 2HP6A 3OCLA 4B93A 2ZC4B 2HDQA 5FQJA 1Z09A 3K3CA 2VX8A 1F2KA 3NULA 1CI9A 2XDMA 3VMAA 3RTYA 3BY8A 5DTTA 3OCNA 2W1TA 2ZQAA 2ZQ8A 3IF6A 3IF6C 1MWSA 1NJ4A 3IBRA 3P7NA 5KZHA 4F3LB 3BQAA 1PI5A 3UMDA 4WUJA 5FL3A 4LRXC 1H8ZA 1HLUP 3T4QA 2VGLS 5A93A 4KZ8A 3P09A 3T50A 3MZEA 1IFQA 3O87A 4ARZA 1KGGA 3UMEA 2Y55A 3EGXC 5F68A 2Y2LA 3RFBA 2V9AA 3RJUA 2AVXA 4EBLA 4H6JB 3BY9A 1YSQA 2YKHA 4NXGA 3JVVA 5IHVA 1RCJA 1STZA 4NXEA 2VGJA 3VP3A 3HLCA 3MMHA 2R9XA 3OPHA 3LIFA 3FPVA 2XD5A 3QP6A 1D7EA 2EX2A 2B95A 5M1AA 4RVAA 5IU1A 2J3WA 3V67A 3FKVA 2Y2IA 3MF0A 5DTKA 4O01A 3HJKA 5EM0A 1OTAA 4KZ5A 4NK3A 4OQ0A 1XJ3A 4E3KA 2D02A 3I7JA 2ZM8A 5TBMB 4DDYA 3F1NA 4JXWA 1YMXA 4HIAA 1AXBA 2OAP1 1MBLA 4DJ3A 4ZAMA 3F1PB 4CLCD 2Y2QA 2ZQDA 3W4OA 1LL5A 1V9ZA 4KUKA 4OQHA 1KVMA 4S2NA 3HBRA 1KDSA 4S2NC 2Q0OA 3M2KA 3CJMA 4B88A 1ZG4A 4E3LA 3QHYA 3GECA 4WEJA 3JVUA 2X01A 2G7UA 3H7WA 3IHBA 2HZ5A 1HVBA 4S2OA 4HJ3A 1FR1A 2XQZA 5AVEA 4M3KA 1ONGA 2HPBA 3A3FA 5DJTA 3WWXA 3R4KA 4BBTA 4HESA 2VGLM 4GDBA 4FSFA 2V1ZA 4ZJ2A 1UGUA 1IYOA 4MN6A 2VV8A 1JTDA 4KZAA 3FG8A 2M7VA 3IX4A 5AVFA 2ZJ9A 1AWIA 1UWNX 1ESUA 3DW0A 2O99A 1N9OA 3LFVA 4N9LA 3MZDA 4PMAA 4Y5FA 4DDSA 2XR0A 4RX3A 4GS9B 4LV2A 4ZRRA 4HJ6A 1T18A 3NHQA 5L07A 3MQ0A 1W8QA 1M6KA 2Y2MA 1D06A 4R38A 3S22A 2QZ6A 4MLLA 3IXHA 3IWQA 3G35A 4UEYA 4U0TA 4E3IA 3MQOA 2H28A 1W8YA 2X71A 3MQQA 3CZDA 1ONHA 3V50A 2L0WA 1EI5A 2JC7A 3LO7A 3VP1A 1E25A 4BWIA 1JTGA 3QP5A 1PNEA 2BG1A 1ES4A 3QP4A 3NY4A 2JKRI 1TF1A 1XX2A 3HLFA 4PAUA 4MBKA 4MN7A 1L0EA 3M6HA 1GSVA 3R7WB 2H0YA 2V0WA 1XXMA 3SH7A 4Y15A 1F9IA 4KZ4A 3G34A 1FSWA 4B9OA 3LUQA 1N9LA 4JGOA 3ZG5A 2PBDP 5CEBA 1KDWA 1ERMA 1Z6FA 5HAIA 5HDSA 5EVIB 1DP9A 2DMWA 1H0MA 4WN5A 5KSHA 4WYYA 3LIEA 3F1OB 4HHDA 1Q2QA 2A3UA 1ESIA 3ZFZA 3G4PA 2P7JA 4R0QA 3FKWA 3FC7A
chains in the Genus database with same CATH topology
1KGEA 3QNCA 4Y0UA 3IXBA 1K25A 1MPLA 3HLWA 3S1YA 2Y91A 1L2SA 4BL3A 5EVIA 2WGWB 4S2PA 1MKIA 5EVIC 4IEDA 2WKEA 2EXBA 4P87A 5FAOA 4E6XA 2HP9A 3C7UA 4N92A 5E43A 2Z2LB 2XH9A 2G2UA 5KMWA 4Y7PA 3WRZA 4EQIA 4CJNA 1BLCA 1LLBA 1XA7A 4JPMA 1PZOA 2QMIA 1FCNA 2EFUA 3NC8A 3IF5A 1RP5A 2HP5A 3MKFA 1LI9A 3AGEA 1MWTA 1VQQA 3BFCA 1MWRA 1JVJA 1JWVA 4U0XA 4CPKA 3O3VA 2WKHA 2DNSA 3Q07A 1PWGA 4JBFA 3VFHA 3VOZA 2WYXA 4E3OA 1CEFA 1YLYA 1G68A 5CXWA 3P98A 4UA7A 1C3BA 2ZM2A 4S2IA 1YLWA 2WGWA 3MFDA 4LV1A 1JWZA 4C75A 1BZAA 3TG9A 3PBSA 3N7WA 3BECA 1ERQA 5GLCA 3UDIA 4E3NA 2Y2OA 4WELA 5FA7A 3ITAA 5FQ9A 2ZC6B 3HUMA 4BENA 4LV0A 3IXDA 2WAEA 2X02A 3Q1FA 3V5MA 3UNWA 1PIOA 3IWOA 5FQMA 3GQZA 1KVLA 4S2KA 1BUEA 2Q9MA 4RA7A 3RXXA 5A92A 1TDLA 2XFTA 4FH4A 2Y2NA 4EBPA 3A3IA 3G32A 5GLAA 4MNRA 3ZG0A 2XFSA 2UWXA 3SH8A 2XEPA 4UAAA 3FWLA 3WRTA 4DE2A 1KE0A 2XK1A 1WE4A 3MZFA 1YLZA 5F1FA 5M19A 3M6BA 4PPRA 1XKZA 4IVKA 4S2JA 3N8SA 5FQKA 5M18A 1CI8A 4A5RA 3PBNA 3BLMA 2JE5A 2P9VB 1RGYA 4IBXA 4KZ6A 1BTLA 4X56A 5F1GA 3ZVWA 2EX6A 5E2GA 4Z9QA 4KG5A 2RL3A 5CGSA 4JXVA 5CHUA 1GA9A 2WADA 4OOYA 5FI2A 4JLFA 4OVDA 1LI0A 1DJBA 1N4OA 1XP4A 3MXSA 3PTEA 4HEFA 3UPOA 3PBQA 2XD1A 1MXOA 2DCFA 5JYPA 5F82A 3MXRA 4R4RA 4HBTA 3EQUA 1NXYA 1PYYA 5GHZA 1I5QA 5HX9A 1PWDA 1SKFA 1ALQA 4BJPA 1SDNA 4KQQA 4FCFA 4KZBA 4WM9A 2P9VA 5DF7A 1XGIA 3Q82A 4WZ5A 4DRTA 4R23A 4WZ5C 3LY3A 4GD8A 3E2KA 2J8YA 4X69A 4DE1A 2EXAA 1FOFA 2JCHA 2HP6A 3TOIA 3OCLA 4JXSA 4IVIA 3ZG8B 5G18A 3BLSA 3HREA 3OC2A 1XGJA 2ZC4B 2HDQA 3UE0A 2PU2A 5FAQA 1PWCA 5FQJA 2E8IA 5CHMA 2P74A 4BLMA 4PM5A 5HL1A 4P85A 4EV4A 3IHAA 5FI7A 5GLBA 1CI9A 4B4ZA 5HAPA 2Y4AA 4KQRA 2XDMA 2JBFA 3VMAA 4D2OA 5DTTA 3DTMA 4QB8A 5A91A 3ITBA 3OCNA 3SS5A 2ZQAA 1J9MA 5EOOA 1K54A 2ZQ8A 3EQVA 3IF6A 3NBLA 1K54C 3IF6C 1MWSA 1NJ4A 5KZHA 1O7EA 3GV9A 2FFFB 3W4PA 2WKIA 2WZXA 3A3EA 4GZBA 1PI5A 4MEZA 4RYEA 4C6YA 4ZDXA 2ZQ9A 1W7FA 3FV7A 4OOLA 1K56D 1MY8A 1XPBA 1E3UD 1H8ZA 4ZJ3A 4KZ9A 5JYOA 4X68A 5D3OA 3WS5A 5A93A 4KZ8A 2IWCA 3P09A 3S4XA 1DY6A 1S0WA 3MZEA 4LV3A 5HARA 5CEDA 5A90A 2ZC3B 3O87A 3IWIA 2ZMAA 3HL9A 1ZG6A 5HFOA 1BULA 1KGGA 5EPHA 4GB7A 1Q2PA 3V39A 2Y55A 1K55A 4QU3A 1FR6A 3UPPA 1K55C 2Y2LA 2BLSA 1NZUA 4WZ4A 1BLHA 1K6RA 3C4PA 2V20A 5KSCA 4WMCA 1FQGA 1L0DA 3G2ZA 3PBRA 4N1XA 4P0MA 3RJUA 4EBNA 1YM1A 4KZ7A 4DXCA 3N4IA 4YFMA 5EUAA 1BT5A 4IBRA 4EBLA 4UA9A 3GMWA 4RX2A 5EOEA 1K57A 1L0GA 3W8KA 1K57C 1W5DA 5IHVA 4QD4A 1M40A 1U60A 3UO9A 3QNBA 1RCJA 1I2SA 2A49A 2VGJA 3O86A 1YQSA 3VP3A 2HDUA 2R9WA 3HLCA 4FD8A 3PBOA 4NETA 4KENB 4GKUA 2R9XA 2V2FF 3V3RA 1G6AA 3OPHA 1DJAA 3GVBA 4E3JA 4QHCA 1TDGA 2WK0A 2XD5A 4PM8A 5AQ9A 4K91A 3TSGA 4U3TA 2G2WA 3UY6A 3LEZA 5BOHA 1ZC2A 4OPRA 5CECA 2EX2A 2EX8A 3PAGA 4MBHA 1K4EA 4OPYA 5M1AA 3BRMA 4RVAA 2C5WB 2ZQCA 1GHIA 2XF3A 1CK3A 1GHPA 2Y2GA 5E2HA 1PW8A 1VM1A 3FKVA 5EVID 4GOGA 2Y2IA 5TR7A 4KZ3A 4Y0OA 1H8YA 5DTKA 3A3DA 1LHYA 4DE0A 2PU4A 3DWZA 4KZ5A 4NK3A 4OQ0A 3BM6A 3IT9A 4E3KA 1WYCA 4OP5A 4ZTKA 3I7JA 2OSUA 1K38A 4S2MA 2ZM8A 4DDYA 4E6WA 1FCMA 4JXWA 1YMXA 2DRWA 1IEMA 5U47A 2HDSA 1AXBA 3B3XA 1MBLA 3Q7ZA 3ZCZA 5CHJA 4ZAMA 3UN7A 2Y2QA 3WS4A 5E2EA 2ZQDA 3W4OA 1LL5A 1NYYA 4YINA 3NIAA 3IH8A 3IF6B 4UHUA 4DKIA 4OQHA 1KVMA 4OKPA 4ID4A 3HBRA 4S2NA 4DF6A 4WEKA 4P6BA 4QJGA 1KDSA 4S2NC 3W4QA 1SCWA 3M2KA 2J7VA 5GHXA 3CJMA 2XGNA 1YLPA 4B88A 3GTCA 1ZG4A 4KG2A 4E3LA 5EVLA 3SH9A 3QHYA 1QMEA 1RGZA 3CG5A 2OV5A 2XLNA 5GLDA 3WS0A 4QY6A 4WEJA 4HBUA 2OLUA 1BLPA 4JKTA 3AGDA 2X01A 4B4XA 4F94A 1YLTA 2FFYA 3VP0A 3C5AA 1FCOA 4X55A 3IHBA 1L0FA 1HVBA 4S2OA 2GDNA 2Y2HA 5DF8A 5DTSA 2WUQA 4GD6A 3C7VA 3FYZA 3ZG9B 4OLGA 1FR1A 1PZPA 2XQZA 1I2WA 2HDRA 3C4OA 3NDGA 1ONGA 2HPBA 4M3KA 3A3FA 5CTMA 5E2FA 1W79A 4MBFA 3WWXA 4DXBA 4OLDA 2Y59A 5CGWA 4HESA 4GDBA 4FSFA 2V1ZA 3NCKA 4KG6A 4O7DA 4ZJ2A 1IKGA 2C6WB 3G2YA 1GCEA 4ZBEA 2ZLYA 3N6IA 1IYOA 1JWPA 5CTNA 1NYMA 3IQAA 4KZAA 1JTDA 1IKIA 3SS3A 3GRJA 4EWFA 4ZJ1A 3HUNA 3Q7VA 3OPLA 3PAEA 3N8LA 4PM6A 4DE3A 4JXGA 2ZJ9A 4FH2A 4QY5A 2H10A 1IYSA 2H0TA 3MBZA 5CERA 5FATA 4GN2A 1ESUA 3DW0A 4K0XA 3BFGA 1BLSA 4OP8A 4OOMA 4OPZA 4LCLA 1IYPA 2Y2KA 2WGIA 1LL9A 4JF6A 3ZNYA 4N9LA 3MZDA 4PMAA 1NY0A 3OPRA 2B5RA 3GSGA 4R3BA 1GHMA 5GHYA 3HLDA 3SOIA 4DDSA 3V3SA 2XR0A 4R4SA 5HW3A 4RX3A 1NZOA 4OPQA 4LV2A 4S2LA 4R1GA 1HZOA 1XA1A 5J8XA 1W8QA 1M6KA 2Y2MA 1MWUA 3S22A 4R3JA 2QZ6A 5GL9A 2EX9A 3WS1A 1GA0A 1SDEA 3BFFA 4MLLA 3VSLA 3IXHA 5F83A 2ZQ7A 3NDEA 3VP2A 2Z2MB 4PM7A 4OQGA 1K6SA 5DF9A 2IWBA 2OLVA 2WGVA 2WAFA 1KE4A 3IWQA 3G35A 5FDHA 3ZVTA 2Y2PA 1DJCA 1SHVA 2Y2JA 2ZC7A 3BEBA 3HLBA 3G31A 3N8RA 3MKEA 4U0TA 2CC1A 5HAQA 5FI6A 3ISGA 4E3IA 1N9BA 3VOYA 1W8YA 1FSYA 2X71A 2H5SA 4C3QA 4H8RA 2I72A 3CZDA 1ONHA 2ZD8A 3V50A 3ZHHA 1YT4A 4GDNA 4OQIA 3BFEA 3ZGAB 5FASA 1EI5A 2JC7A 1YLJA 4N1HA 5AQ7A 4UA6A 3LO7A 4BD0A 4XXRA 5I94A 3VP1A 4E3MA 1E25A 5CRFA 2VGKA 3SS4A 2J9PA 1JTGA 3D4FA 4XUXA 2Q9NA 2BG1A 4JF4A 3DWKA 1ES3A 1ES4A 3G30A 3NY4A 5EE8A 3UE3A 1CEGA 1XX2A 3HLGA 1OMEA 3OZHA 2IWDA 4BL2A 1KGFA 2QPNA 5DVAA 3VP4A 4BD1A 3HLFA 2EFXA 4L0LA 1NRFA 1ZKJA 1K56A 5FQIA 1H5XA 4MBKA 3HVFA 5FSRA 1E3UA 4WMCD 1TEMA 3BFDA 3VSKA 3AGFA 1L0EA 2ZC5B 2J9OA 3JYIA 3FZCA 3M6HA 3E2LA 2H0YA 4OONA 1XXMA 1E4DA 3VFFA 1IELA 2RCXA 3RXWA 3SH7A 1O07A 3HLEA 1WYBA 3GR2A 4KZ4A 3ZDJA 3G34A 1FSWA 3ZNTA 4X53A 3NI9A 1YMSA 1HD8A 1HTZA 3Q7VB 3M2JA 1S6RA 4Y0TA 4KQOA 3A3JA 4LCMA 4EUZA 3ZG5A 1PI4A 4OH0A 5CEBA 4BQMA 1KDWA 4JF5A 5AQAA 1ERMA 1Z6FA 5FQQA 5HAIA 4K0WA 1EROA 5FAPA 5EVIB 4X6TA 2WZZA 5AQBA 3PBTA 3UDFA 5L2FA 3LCEA 1QMFA 3IXGA 3UDXA 1IYQA 4XUZA 4LENA 5EECA 3Q81A 5KSHA 1K4FA 1BSGA 2PBYA 4WYYA 1ES2A 3UPNA 4PM9A 1TVFA 4GNUA 4Q8IA 4WBGA 3CMZA 3HUOA 3BYDA 1Q2QA 3UE1A 2A3UA 1Y54A 1ESIA 4N9KA 3LY4A 3WS2A 1EWZA 1KE3A 3ZFZA 3O88A 3OPPA 5TGFA 5CGXA 3G4PA 1PW1A 3ZG7B 5TFQA 4R0QA 1ES5A 3FKWA 3IH9A 2ZM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KGE A;  3QNC A;  4Y0U A;  3IXB A;  1K25 A;  1MPL A;  3HLW A;  3S1Y A;  2Y91 A;  1L2S A;  4BL3 A;  5EVI A;  2WGW B;  4S2P A;  1MKI A;  5EVI C;  4IED A;  2WKE A;  2EXB A;  4P87 A;  5FAO A;  4E6X A;  2HP9 A;  3C7U A;  4N92 A;  5E43 A;  2Z2L B;  2XH9 A;  2G2U A;  5KMW A;  4Y7P A;  3WRZ A;  4EQI A;  4CJN A;  1BLC A;  1LLB A;  1XA7 A;  4JPM A;  1PZO A;  2QMI A;  1FCN A;  2EFU A;  3NC8 A;  3IF5 A;  1RP5 A;  2HP5 A;  3MKF A;  1LI9 A;  3AGE A;  1MWT A;  1VQQ A;  3BFC A;  1MWR A;  1JVJ A;  1JWV A;  4U0X A;  4CPK A;  3O3V A;  2WKH A;  2DNS A;  3Q07 A;  1PWG A;  4JBF A;  3VFH A;  3VOZ A;  2WYX A;  4E3O A;  1CEF A;  1YLY A;  1G68 A;  5CXW A;  3P98 A;  4UA7 A;  1C3B A;  2ZM2 A;  4S2I A;  1YLW A;  2WGW A;  3MFD A;  4LV1 A;  1JWZ A;  4C75 A;  1BZA A;  3TG9 A;  3PBS A;  3N7W A;  3BEC A;  1ERQ A;  5GLC A;  3UDI A;  4E3N A;  2Y2O A;  4WEL A;  5FA7 A;  3ITA A;  5FQ9 A;  2ZC6 B;  3HUM A;  4BEN A;  4LV0 A;  3IXD A;  2WAE A;  2X02 A;  3Q1F A;  3V5M A;  3UNW A;  1PIO A;  3IWO A;  5FQM A;  3GQZ A;  1KVL A;  4S2K A;  1BUE A;  2Q9M A;  4RA7 A;  3RXX A;  5A92 A;  1TDL A;  2XFT A;  4FH4 A;  2Y2N A;  4EBP A;  3A3I A;  3G32 A;  5GLA A;  4MNR A;  3ZG0 A;  2XFS A;  2UWX A;  3SH8 A;  2XEP A;  4UAA A;  3FWL A;  3WRT A;  4DE2 A;  1KE0 A;  2XK1 A;  1WE4 A;  3MZF A;  1YLZ A;  5F1F A;  5M19 A;  3M6B A;  4PPR A;  1XKZ A;  4IVK A;  4S2J A;  3N8S A;  5FQK A;  5M18 A;  1CI8 A;  4A5R A;  3PBN A;  3BLM A;  2JE5 A;  2P9V B;  1RGY A;  4IBX A;  4KZ6 A;  1BTL A;  4X56 A;  5F1G A;  3ZVW A;  2EX6 A;  5E2G A;  4Z9Q A;  4KG5 A;  2RL3 A;  5CGS A;  4JXV A;  5CHU A;  1GA9 A;  2WAD A;  4OOY A;  5FI2 A;  4JLF A;  4OVD A;  1LI0 A;  1DJB A;  1N4O A;  1XP4 A;  3MXS A;  3PTE A;  4HEF A;  3UPO A;  3PBQ A;  2XD1 A;  1MXO A;  2DCF A;  5JYP A;  5F82 A;  3MXR A;  4R4R A;  4HBT A;  3EQU A;  1NXY A;  1PYY A;  5GHZ A;  1I5Q A;  5HX9 A;  1PWD A;  1SKF A;  1ALQ A;  4BJP A;  1SDN A;  4KQQ A;  4FCF A;  4KZB A;  4WM9 A;  2P9V A;  5DF7 A;  1XGI A;  3Q82 A;  4WZ5 A;  4DRT A;  4R23 A;  4WZ5 C;  3LY3 A;  4GD8 A;  3E2K A;  2J8Y A;  4X69 A;  4DE1 A;  2EXA A;  1FOF A;  2JCH A;  2HP6 A;  3TOI A;  3OCL A;  4JXS A;  4IVI A;  3ZG8 B;  5G18 A;  3BLS A;  3HRE A;  3OC2 A;  1XGJ A;  2ZC4 B;  2HDQ A;  3UE0 A;  2PU2 A;  5FAQ A;  1PWC A;  5FQJ A;  2E8I A;  5CHM A;  2P74 A;  4BLM A;  4PM5 A;  5HL1 A;  4P85 A;  4EV4 A;  3IHA A;  5FI7 A;  5GLB A;  1CI9 A;  4B4Z A;  5HAP A;  2Y4A A;  4KQR A;  2XDM A;  2JBF A;  3VMA A;  4D2O A;  5DTT A;  3DTM A;  4QB8 A;  5A91 A;  3ITB A;  3OCN A;  3SS5 A;  2ZQA A;  1J9M A;  5EOO A;  1K54 A;  2ZQ8 A;  3EQV A;  3IF6 A;  3NBL A;  1K54 C;  3IF6 C;  1MWS A;  1NJ4 A;  5KZH A;  1O7E A;  3GV9 A;  2FFF B;  3W4P A;  2WKI A;  2WZX A;  3A3E A;  4GZB A;  1PI5 A;  4MEZ A;  4RYE A;  4C6Y A;  4ZDX A;  2ZQ9 A;  1W7F A;  3FV7 A;  4OOL A;  1K56 D;  1MY8 A;  1XPB A;  1E3U D;  1H8Z A;  4ZJ3 A;  4KZ9 A;  5JYO A;  4X68 A;  5D3O A;  3WS5 A;  5A93 A;  4KZ8 A;  2IWC A;  3P09 A;  3S4X A;  1DY6 A;  1S0W A;  3MZE A;  4LV3 A;  5HAR A;  5CED A;  5A90 A;  2ZC3 B;  3O87 A;  3IWI A;  2ZMA A;  3HL9 A;  1ZG6 A;  5HFO A;  1BUL A;  1KGG A;  5EPH A;  4GB7 A;  1Q2P A;  3V39 A;  2Y55 A;  1K55 A;  4QU3 A;  1FR6 A;  3UPP A;  1K55 C;  2Y2L A;  2BLS A;  1NZU A;  4WZ4 A;  1BLH A;  1K6R A;  3C4P A;  2V20 A;  5KSC A;  4WMC A;  1FQG A;  1L0D A;  3G2Z A;  3PBR A;  4N1X A;  4P0M A;  3RJU A;  4EBN A;  1YM1 A;  4KZ7 A;  4DXC A;  3N4I A;  4YFM A;  5EUA A;  1BT5 A;  4IBR A;  4EBL A;  4UA9 A;  3GMW A;  4RX2 A;  5EOE A;  1K57 A;  1L0G A;  3W8K A;  1K57 C;  1W5D A;  5IHV A;  4QD4 A;  1M40 A;  1U60 A;  3UO9 A;  3QNB A;  1RCJ A;  1I2S A;  2A49 A;  2VGJ A;  3O86 A;  1YQS A;  3VP3 A;  2HDU A;  2R9W A;  3HLC A;  4FD8 A;  3PBO A;  4NET A;  4KEN B;  4GKU A;  2R9X A;  2V2F F;  3V3R A;  1G6A A;  3OPH A;  1DJA A;  3GVB A;  4E3J A;  4QHC A;  1TDG A;  2WK0 A;  2XD5 A;  4PM8 A;  5AQ9 A;  4K91 A;  3TSG A;  4U3T A;  2G2W A;  3UY6 A;  3LEZ A;  5BOH A;  1ZC2 A;  4OPR A;  5CEC A;  2EX2 A;  2EX8 A;  3PAG A;  4MBH A;  1K4E A;  4OPY A;  5M1A A;  3BRM A;  4RVA A;  2C5W B;  2ZQC A;  1GHI A;  2XF3 A;  1CK3 A;  1GHP A;  2Y2G A;  5E2H A;  1PW8 A;  1VM1 A;  3FKV A;  5EVI D;  4GOG A;  2Y2I A;  5TR7 A;  4KZ3 A;  4Y0O A;  1H8Y A;  5DTK A;  3A3D A;  1LHY A;  4DE0 A;  2PU4 A;  3DWZ A;  4KZ5 A;  4NK3 A;  4OQ0 A;  3BM6 A;  3IT9 A;  4E3K A;  1WYC A;  4OP5 A;  4ZTK A;  3I7J A;  2OSU A;  1K38 A;  4S2M A;  2ZM8 A;  4DDY A;  4E6W A;  1FCM A;  4JXW A;  1YMX A;  2DRW A;  1IEM A;  5U47 A;  2HDS A;  1AXB A;  3B3X A;  1MBL A;  3Q7Z A;  3ZCZ A;  5CHJ A;  4ZAM A;  3UN7 A;  2Y2Q A;  3WS4 A;  5E2E A;  2ZQD A;  3W4O A;  1LL5 A;  1NYY A;  4YIN A;  3NIA A;  3IH8 A;  3IF6 B;  4UHU A;  4DKI A;  4OQH A;  1KVM A;  4OKP A;  4ID4 A;  3HBR A;  4S2N A;  4DF6 A;  4WEK A;  4P6B A;  4QJG A;  1KDS A;  4S2N C;  3W4Q A;  1SCW A;  3M2K A;  2J7V A;  5GHX A;  3CJM A;  2XGN A;  1YLP A;  4B88 A;  3GTC A;  1ZG4 A;  4KG2 A;  4E3L A;  5EVL A;  3SH9 A;  3QHY A;  1QME A;  1RGZ A;  3CG5 A;  2OV5 A;  2XLN A;  5GLD A;  3WS0 A;  4QY6 A;  4WEJ A;  4HBU A;  2OLU A;  1BLP A;  4JKT A;  3AGD A;  2X01 A;  4B4X A;  4F94 A;  1YLT A;  2FFY A;  3VP0 A;  3C5A A;  1FCO A;  4X55 A;  3IHB A;  1L0F A;  1HVB A;  4S2O A;  2GDN A;  2Y2H A;  5DF8 A;  5DTS A;  2WUQ A;  4GD6 A;  3C7V A;  3FYZ A;  3ZG9 B;  4OLG A;  1FR1 A;  1PZP A;  2XQZ A;  1I2W A;  2HDR A;  3C4O A;  3NDG A;  1ONG A;  2HPB A;  4M3K A;  3A3F A;  5CTM A;  5E2F A;  1W79 A;  4MBF A;  3WWX A;  4DXB A;  4OLD A;  2Y59 A;  5CGW A;  4HES A;  4GDB A;  4FSF A;  2V1Z A;  3NCK A;  4KG6 A;  4O7D A;  4ZJ2 A;  1IKG A;  2C6W B;  3G2Y A;  1GCE A;  4ZBE A;  2ZLY A;  3N6I A;  1IYO A;  1JWP A;  5CTN A;  1NYM A;  3IQA A;  4KZA A;  1JTD A;  1IKI A;  3SS3 A;  3GRJ A;  4EWF A;  4ZJ1 A;  3HUN A;  3Q7V A;  3OPL A;  3PAE A;  3N8L A;  4PM6 A;  4DE3 A;  4JXG A;  2ZJ9 A;  4FH2 A;  4QY5 A;  2H10 A;  1IYS A;  2H0T A;  3MBZ A;  5CER A;  5FAT A;  4GN2 A;  1ESU A;  3DW0 A;  4K0X A;  3BFG A;  1BLS A;  4OP8 A;  4OOM A;  4OPZ A;  4LCL A;  1IYP A;  2Y2K A;  2WGI A;  1LL9 A;  4JF6 A;  3ZNY A;  4N9L A;  3MZD A;  4PMA A;  1NY0 A;  3OPR A;  2B5R A;  3GSG A;  4R3B A;  1GHM A;  5GHY A;  3HLD A;  3SOI A;  4DDS A;  3V3S A;  2XR0 A;  4R4S A;  5HW3 A;  4RX3 A;  1NZO A;  4OPQ A;  4LV2 A;  4S2L A;  4R1G A;  1HZO A;  1XA1 A;  5J8X A;  1W8Q A;  1M6K A;  2Y2M A;  1MWU A;  3S22 A;  4R3J A;  2QZ6 A;  5GL9 A;  2EX9 A;  3WS1 A;  1GA0 A;  1SDE A;  3BFF A;  4MLL A;  3VSL A;  3IXH A;  5F83 A;  2ZQ7 A;  3NDE A;  3VP2 A;  2Z2M B;  4PM7 A;  4OQG A;  1K6S A;  5DF9 A;  2IWB A;  2OLV A;  2WGV A;  2WAF A;  1KE4 A;  3IWQ A;  3G35 A;  5FDH A;  3ZVT A;  2Y2P A;  1DJC A;  1SHV A;  2Y2J A;  2ZC7 A;  3BEB A;  3HLB A;  3G31 A;  3N8R A;  3MKE A;  4U0T A;  2CC1 A;  5HAQ A;  5FI6 A;  3ISG A;  4E3I A;  1N9B A;  3VOY A;  1W8Y A;  1FSY A;  2X71 A;  2H5S A;  4C3Q A;  4H8R A;  2I72 A;  3CZD A;  1ONH A;  2ZD8 A;  3V50 A;  3ZHH A;  1YT4 A;  4GDN A;  4OQI A;  3BFE A;  3ZGA B;  5FAS A;  1EI5 A;  2JC7 A;  1YLJ A;  4N1H A;  5AQ7 A;  4UA6 A;  3LO7 A;  4BD0 A;  4XXR A;  5I94 A;  3VP1 A;  4E3M A;  1E25 A;  5CRF A;  2VGK A;  3SS4 A;  2J9P A;  1JTG A;  3D4F A;  4XUX A;  2Q9N A;  2BG1 A;  4JF4 A;  3DWK A;  1ES3 A;  1ES4 A;  3G30 A;  3NY4 A;  5EE8 A;  3UE3 A;  1CEG A;  1XX2 A;  3HLG A;  1OME A;  3OZH A;  2IWD A;  4BL2 A;  1KGF A;  2QPN A;  5DVA A;  3VP4 A;  4BD1 A;  3HLF A;  2EFX A;  4L0L A;  1NRF A;  1ZKJ A;  1K56 A;  5FQI A;  1H5X A;  4MBK A;  3HVF A;  5FSR A;  1E3U A;  4WMC D;  1TEM A;  3BFD A;  3VSK A;  3AGF A;  1L0E A;  2ZC5 B;  2J9O A;  3JYI A;  3FZC A;  3M6H A;  3E2L A;  2H0Y A;  4OON A;  1XXM A;  1E4D A;  3VFF A;  1IEL A;  2RCX A;  3RXW A;  3SH7 A;  1O07 A;  3HLE A;  1WYB A;  3GR2 A;  4KZ4 A;  3ZDJ A;  3G34 A;  1FSW A;  3ZNT A;  4X53 A;  3NI9 A;  1YMS A;  1HD8 A;  1HTZ A;  3Q7V B;  3M2J A;  1S6R A;  4Y0T A;  4KQO A;  3A3J A;  4LCM A;  4EUZ A;  3ZG5 A;  1PI4 A;  4OH0 A;  5CEB A;  4BQM A;  1KDW A;  4JF5 A;  5AQA A;  1ERM A;  1Z6F A;  5FQQ A;  5HAI A;  4K0W A;  1ERO A;  5FAP A;  5EVI B;  4X6T A;  2WZZ A;  5AQB A;  3PBT A;  3UDF A;  5L2F A;  3LCE A;  1QMF A;  3IXG A;  3UDX A;  1IYQ A;  4XUZ A;  4LEN A;  5EEC A;  3Q81 A;  5KSH A;  1K4F A;  1BSG A;  2PBY A;  4WYY A;  1ES2 A;  3UPN A;  4PM9 A;  1TVF A;  4GNU A;  4Q8I A;  4WBG A;  3CMZ A;  3HUO A;  3BYD A;  1Q2Q A;  3UE1 A;  2A3U A;  1Y54 A;  1ESI A;  4N9K A;  3LY4 A;  3WS2 A;  1EWZ A;  1KE3 A;  3ZFZ A;  3O88 A;  3OPP A;  5TGF A;  5CGX A;  3G4P A;  1PW1 A;  3ZG7 B;  5TFQ A;  4R0Q A;  1ES5 A;  3FKW A;  3IH9 A;  2ZM0 A; 
#chains in the Genus database with same CATH topology
 1K25 A;  1MPL A;  3HLW A;  1XFQ A;  1YPR A;  3CPT B;  4P87 A;  2HP9 A;  1H3Q A;  2Z2L B;  3VV4 A;  2G2U A;  5KMW A;  3EWK A;  3LI9 A;  1XA7 A;  3C2W A;  1LSV A;  2EA9 A;  1FCN A;  3IF5 A;  3MKF A;  1LI9 A;  1VQQ A;  1MWR A;  1JVJ A;  4U0X A;  4CLC A;  3Q07 A;  2WYX A;  4CLC C;  3C8C A;  3KYQ A;  4UA7 A;  5EV0 A;  1YLW A;  3IX8 A;  4F3L A;  1CF0 A;  4C75 A;  2GX5 A;  3N7W A;  4E3N A;  4LFU A;  2V1B A;  4MDZ A;  1DP8 A;  3HUM A;  4LRZ E;  3IXD A;  5LBR A;  3V5M A;  3IWO A;  3GQZ A;  3KSG A;  2GZA A;  3ZG0 A;  3W2Z A;  3DAV A;  4UAA A;  3WRT A;  1WE4 A;  2VJW A;  4S2J A;  3N8S A;  2JE5 A;  2P9V B;  1BTL A;  2PT7 A;  5F1G A;  4H6J A;  5E2G A;  3MJQ A;  1XP4 A;  3UPO A;  3PBQ A;  5AJG A;  1VEU B;  4BJP A;  2BTF P;  2KLI A;  5DF7 A;  4WM9 A;  1D1J A;  2ZOI A;  4WZ5 A;  1LSX A;  4WZ5 C;  3E2K A;  2J8Y A;  2EXA A;  2PD8 A;  4ETX A;  3NJA A;  3ZG8 B;  3HRE A;  1OT6 A;  1TS7 A;  1PWC A;  3DTI A;  4LLO B;  3OBF A;  4BLM A;  2O9A A;  3IHA A;  1T1C A;  4FTX A;  5L8M A;  5TBM A;  2B02 A;  3T4T A;  2Y4A A;  2JBF A;  4LPZ A;  3T12 B;  4GCZ A;  3F1P A;  4BBV A;  3SS5 A;  4ESP A;  1A0K A;  3JPU A;  2WZX A;  2QHK A;  3G6O A;  4RYE A;  4C6Y A;  3S7N A;  4HQA A;  4PKY G;  4Y2F A;  2VV7 A;  1MY8 A;  1XPB A;  3WS5 A;  3CIT A;  1VET B;  5HAR A;  5A90 A;  3IWI A;  2ZMA A;  4YOF A;  1BUL A;  1FR6 A;  2BLS A;  3ULF A;  2O0Y A;  3C4P A;  2V20 A;  3LEQ A;  5KSC A;  1FQG A;  1L0D A;  3PBR A;  4KZ7 A;  3N4I A;  4YFM A;  2WKR A;  5HD5 A;  5EOE A;  1L0G A;  1W5D A;  4QD4 A;  1M40 A;  1U60 A;  3QNB A;  3GDI A;  3O86 A;  2R9W A;  4NET A;  4GKU A;  3UB7 A;  2WK0 A;  4Z1W A;  5AQ9 A;  2G2W A;  3UY6 A;  3LEZ A;  5CEC A;  2WKQ A;  4MBH A;  4HJ4 A;  4GS9 A;  4I38 A;  5HWV A;  4NG2 A;  1GHI A;  1GSX A;  2Y2G A;  5E2H A;  1PW8 A;  4GOG A;  3E4P A;  5TR7 A;  2HV1 A;  4HOI A;  1EW0 A;  4X1M A;  3OLO A;  3DWZ A;  1K38 A;  3KSF A;  4E6W A;  3LIB A;  1IEM A;  4DN0 A;  3CUE A;  5CHJ A;  3CUE C;  1SKO B;  3PR6 A;  4YIN A;  4HNB A;  4HP9 A;  4UHU A;  2FH5 A;  2BAS A;  1SZV A;  3E4Q A;  4DKI A;  4EW7 A;  4DF6 A;  4QJG A;  4Q0J A;  1SCW A;  2XGN A;  1YLP A;  5K5B A;  3A0R A;  3IS2 A;  5EVL A;  3SH9 A;  1QME A;  1RGZ A;  3CG5 A;  2OV5 A;  5GLD A;  4MN5 A;  3AGD A;  5HPI A;  1YLT A;  3C5A A;  5C5K A;  1L0F A;  3C38 A;  2GDN A;  1NLZ A;  2WUQ A;  4GD6 A;  3C7V A;  1TS0 A;  1T1A A;  5CX7 A;  4OLG A;  1ACF A;  1I2W A;  2PHY A;  1JNU A;  2HJE A;  4MBF A;  5A8B A;  5CTN A;  1NYM A;  2FZ0 A;  1IKI A;  4EWF A;  4NXF A;  2PRF A;  4JXG A;  5DJU A;  4R6L A;  4FH2 A;  4QY5 A;  3QP2 A;  5CER A;  4GN2 A;  3BFG A;  4OP8 A;  4OOM A;  4LCL A;  1IYP A;  1LL9 A;  3UB8 A;  2VKS A;  2VEA A;  3OPR A;  2B5R A;  3SOI A;  1GHM A;  5GHY A;  3F1O A;  2GNX A;  2ZL1 B;  4I3J A;  2O9C A;  3H82 B;  4ME4 A;  3C30 A;  1MWU A;  4R3J A;  1GA0 A;  3CWF A;  3VP2 A;  2Z2M B;  1K6S A;  3QP1 A;  5DF9 A;  2OLV A;  2V1A A;  2WAF A;  1MC0 A;  5FDH A;  5J3W A;  3ZVT A;  1S66 L;  1SHV A;  5FDS A;  5DKK A;  3G31 A;  3CPT A;  3IBJ A;  2NUP C;  2CC1 A;  5HAQ A;  4IJG A;  3ISG A;  5FI6 A;  5HZH A;  1FSY A;  2OWJ A;  4H8R A;  4D60 A;  4LRY C;  4GHI B;  3D9Y A;  2XA7 M;  5FAS A;  1OTB A;  4UA6 A;  4BD0 A;  1NRJ A;  5I94 A;  1S67 L;  4E3M A;  5CRF A;  2VGK A;  3D4F A;  4XUX A;  5G4Z A;  4JF4 A;  1ES3 A;  3CHW P;  3G30 A;  1OME A;  2PR5 A;  1KGF A;  4YWZ A;  1FIL A;  4BD1 A;  1ZKJ A;  1XJ6 A;  5FQI A;  1DRM A;  1H5X A;  3HVF A;  4WMC D;  3BFD A;  3MFX A;  3FZC A;  3E2L A;  1ZHH B;  1IEL A;  2PDR A;  3RXW A;  1O07 A;  3ZDJ A;  3O5Y A;  2XRN A;  1HTZ A;  4M4X A;  1S6R A;  4GJ4 A;  2ZBB A;  5FQQ A;  4K0W A;  1ERO A;  2JKF A;  4RQ9 A;  2WZZ A;  3UDF A;  3IXG A;  4LEN A;  5EEC A;  1W63 Q;  4X1L A;  1NWZ A;  4HP4 A;  4Q8I A;  3BYD A;  4N9K A;  1Y54 A;  3KSI A;  4CQH A;  1EWZ A;  1KE3 A;  4G3K A;  5TGF A;  5CGX A;  2OAQ 1;  1PW1 A;  5TFQ A;  1ES5 A;  2ZM0 A;  3QNC A;  3S1Y A;  1BYW A;  2L4R A;  2Y91 A;  4EET B;  2WKE A;  2NUT C;  5FAO A;  4R70 A;  2QWS A;  2K31 A;  4EEP A;  4EQI A;  1BLC A;  2VA0 A;  1PZO A;  1F5M A;  3AGE A;  1LSW A;  1JWV A;  3O3V A;  5HDC A;  2WKH A;  4JBF A;  3VFH A;  1CEF A;  1YLY A;  3P98 A;  1C3B A;  2WGW A;  3MFD A;  3A0S A;  2OOL A;  3BEC A;  1ERQ A;  1IOU A;  4WEL A;  5FQ9 A;  1G5U A;  2Y8H A;  4LV0 A;  4WL9 A;  2X02 A;  1PIO A;  1T1B A;  1VET A;  1KVL A;  3S7O A;  1TDL A;  4EBP A;  3A3I A;  5EVE A;  2UWX A;  3FWL A;  4DE2 A;  5F1F A;  5M19 A;  4HH3 A;  1OPX A;  1XKZ A;  5FQK A;  4IUK A;  3ZVW A;  1Y28 A;  5CGS A;  4JXV A;  5CHU A;  4OOY A;  4JLF A;  3LIC A;  5DFX A;  1LI0 A;  3T1X A;  2VK3 A;  3K3D A;  4L9E A;  5JYP A;  4R4R A;  1PYY A;  5GHZ A;  1SKF A;  1ALQ A;  4FCF A;  2D01 A;  4LGW A;  4DRT A;  1W63 M;  4R23 A;  4GD8 A;  4JXS A;  4GLQ A;  4IVI A;  4G3W A;  5G18 A;  3BLS A;  3OC2 A;  3UE0 A;  2PU2 A;  3ICY A;  4JGR A;  1TS8 A;  2VZW A;  2W3D A;  2E8I A;  3UB5 P;  2P74 A;  4MMN A;  4P85 A;  4EV4 A;  5FI7 A;  2PD7 A;  5HAP A;  4KQR A;  3DTE A;  3DTM A;  4ARZ B;  1H8M A;  2A2L A;  3ITB A;  1P97 A;  5IT5 A;  5EOO A;  3EQV A;  3NBL A;  1OTD A;  3TJZ C;  2W3E A;  2FFF B;  3W4P A;  4ZDX A;  1W7F A;  2VLG A;  3FV7 A;  1K56 D;  3LIA A;  4Q0I A;  4ZJ3 A;  4KZ9 A;  4X68 A;  5D3O A;  3TRC A;  2IWC A;  1DY6 A;  2QKP A;  2B18 A;  2HF6 A;  4LV3 A;  1ZG6 A;  2R78 A;  4X25 A;  1Q2P A;  3V39 A;  3T4K A;  1NZU A;  3T4S A;  1BLH A;  1K6R A;  2O9B A;  5EFW A;  4WMC A;  5G4Y A;  4DXC A;  2JN7 A;  3LR4 A;  5EUA A;  1BT5 A;  4IBR A;  3GMW A;  2I9V A;  1FIK A;  4KQD A;  1I2S A;  2A24 B;  4FD8 A;  3PBO A;  4KEN B;  2V2F F;  3V3R A;  3GVB A;  1TDG A;  4PM8 A;  5HWW A;  4OPR A;  1CJF A;  3BQ8 A;  1P9W A;  2EX8 A;  3K2N A;  4EXO A;  1K4E A;  3BRM A;  2Z6D A;  2C5W B;  2XF3 A;  1CK3 A;  5EVI D;  4JGQ A;  1VM1 A;  5F6A A;  4KZ3 A;  4Y0O A;  1H8Y A;  5TJJ A;  3A3D A;  4O0P A;  2PU4 A;  3IT9 A;  4ZTK A;  3H7W B;  1FCM A;  3BW6 A;  3B33 A;  4EU0 A;  2DRW A;  2IA2 A;  2LB9 A;  2HDS A;  3B3X A;  3Q7Z A;  3ZCZ A;  3UN7 A;  3WS4 A;  1PFL A;  3NIA A;  4GHI A;  4QPR A;  4OKP A;  4ID4 A;  4WEK A;  1S1Y A;  4P6B A;  1G28 A;  3W4Q A;  2J7V A;  5GHX A;  3GTC A;  5F5Y A;  4KG2 A;  5HL6 A;  2XLN A;  4QY6 A;  4HBU A;  2OLU A;  4B4X A;  4F94 A;  2FFY A;  1FCO A;  4X55 A;  4I3A A;  5DTS A;  3FYZ A;  3ZG9 B;  3HJI A;  1PZP A;  3EGD C;  1UWP X;  5CTM A;  3NDG A;  4I5S A;  1W79 A;  3T4L A;  5J7E A;  4L9G A;  1XFN A;  5CGW A;  3EEA A;  2JHE A;  1GSW A;  4O7D A;  1IKG A;  3G2Y A;  4ZBE A;  2ZLY A;  3SS3 A;  3HUN A;  4I3I A;  3VE3 A;  3OPL A;  3PAE A;  4DE3 A;  2H10 A;  1IYS A;  3NOT C;  5FAT A;  3DBA A;  4OPZ A;  4GW9 A;  2Y2K A;  4JF6 A;  3ZNY A;  3U4L P;  1S1Z A;  1YSP A;  1NY0 A;  4R3B A;  1PRQ A;  4R4S A;  1NZO A;  2Z6C A;  4S2L A;  5J8X A;  2EWW A;  2PYR A;  3NOU C;  3WS1 A;  2JKR M;  1SDE A;  3BFF A;  3VSL A;  2ZQ7 A;  4PM7 A;  4OQG A;  2IWB A;  2WGV A;  5FEF A;  2Y2P A;  2ZC7 A;  3BEB A;  3N8R A;  3LI8 A;  3MKE A;  2V0U A;  3UE6 A;  2H5S A;  3SW1 A;  2JKG A;  1YT4 A;  4OQI A;  3BFE A;  4XXR A;  4JGP A;  2J9P A;  2Q9N A;  2XA7 S;  1OJG A;  3ZQ5 A;  5EE8 A;  3UE3 A;  4DJ2 A;  5HD3 A;  3OZH A;  3HLG A;  2QPN A;  4K08 A;  4L0L A;  3KYZ A;  1Y4O A;  1K56 A;  1G6O A;  2HGV A;  5FSR A;  1TEM A;  3VSK A;  3AGF A;  2J9O A;  4OON A;  2M7U A;  5J4E A;  2OWH A;  2W0N A;  4KUO A;  2RCX A;  3HLE A;  3GR2 A;  2ZMV A;  4X53 A;  3NI9 A;  3Q7V B;  3PHY A;  4EUZ A;  4MCW A;  2W3F A;  5AQA A;  4XT2 B;  3LID A;  4XUZ A;  3R7W A;  3KX0 X;  1ODV A;  1K4F A;  3UPN A;  2XSS A;  4WBG A;  2MJ6 A;  4Y17 A;  3HUO A;  4EUV A;  3UE1 A;  3L7H A;  3O88 A;  3OPP A;  2K2N A;  4IUH A;  2L1M A;  4CLC B;  3MBZ A;  1KGE A;  4Y0U A;  1L2S A;  4BL3 A;  5EVI A;  1V9Y A;  2ZMF A;  5EVI C;  4IED A;  3T4O A;  1LLB A;  4JPM A;  3MS6 A;  3BFC A;  3VOZ A;  5HPF A;  3LR5 A;  4E3O A;  1G68 A;  1TD5 A;  3IX3 A;  4S2I A;  5DKL A;  1BZA A;  3TG9 A;  5GLC A;  2Y2O A;  5FA7 A;  3NOP C;  3KYE A;  2W3G A;  4O8G A;  3UNW A;  3TW8 A;  1BUE A;  2Q9M A;  4NEE D;  3G32 A;  5GLA A;  1XJ4 A;  2GJ3 A;  4MNR A;  3BJN A;  2XEP A;  3T4J A;  3MZF A;  1YLZ A;  3VE4 A;  1CI8 A;  3SZT A;  2V8F A;  1RGY A;  4KZ6 A;  4UQI M;  4X56 A;  1KOU A;  3CI6 A;  4PKY A;  4DMZ A;  5L09 A;  4Z9Q A;  4Q0H A;  1GA9 A;  2PYP A;  4OVD A;  3LGO A;  1DJB A;  2A24 A;  1LT0 A;  2XD1 A;  5F82 A;  3MXR A;  3UB6 A;  1NXY A;  4II7 A;  1I5Q A;  1PWD A;  5F69 A;  1SDN A;  4KQQ A;  4YNR A;  2P9V A;  2JKT I;  2QYB A;  4X69 A;  2JCH A;  3TOI A;  4EES A;  2QJ7 A;  2W3H A;  1XGJ A;  5FAQ A;  5CHM A;  2J3T D;  4PM5 A;  5HL1 A;  1S4S A;  1VEU A;  2Y79 A;  5GLB A;  3B47 A;  4B4Z A;  2V8C A;  4D2O A;  4QB8 A;  5A91 A;  3T1R A;  1J9M A;  1K54 A;  5HSQ A;  1K54 C;  3LR0 A;  4QWO A;  1O7E A;  3GV9 A;  2WKI A;  3A3E A;  4GZB A;  4MEZ A;  4BMW A;  2ZQ9 A;  4OOL A;  2QJ5 A;  2P04 A;  1E3U D;  5JYO A;  3MXQ A;  3S4X A;  1S0W A;  5CED A;  3D72 A;  4EQ1 A;  2ZC3 B;  2J80 A;  3E98 A;  3HL9 A;  2ACG A;  5HFO A;  5EPH A;  4GB7 A;  1K55 A;  4QU3 A;  3UPP A;  1K55 C;  4WZ4 A;  1NLY A;  4WF0 A;  4R3A A;  3G2Z A;  4N1X A;  4CLC E;  4P0M A;  4EBN A;  1YM1 A;  4UA9 A;  4RX2 A;  2K7S A;  1VHM A;  1K57 A;  1OTE A;  3W8K A;  1K57 C;  3MR0 A;  2P08 A;  3UO9 A;  2A49 A;  1YQS A;  3LYX A;  2HDU A;  4PHT A;  1DP6 A;  1G6A A;  1DJA A;  3U2A A;  4E3J A;  4QHC A;  1F98 A;  4K91 A;  3TSG A;  4E04 A;  4U3T A;  5I5L A;  5BOH A;  1ZC2 A;  5IS1 A;  3PAG A;  4OPY A;  1T19 A;  1X0O A;  2ZQC A;  1GHP A;  2KOI A;  4IHQ A;  4EER A;  5KIZ A;  3TE8 A;  1LHY A;  4DE0 A;  2KDK A;  5L10 A;  4WLA A;  3IS2 B;  3BM6 A;  3EOI A;  1WYC A;  4OP5 A;  2OSU A;  4S2M A;  4ETZ A;  5U47 A;  4NXB A;  2YKF A;  5E2E A;  2W1T B;  3OOV A;  1NYY A;  4FUW A;  5MC7 A;  3IH8 A;  3IF6 B;  4HY8 A;  2VV6 A;  4BBU A;  1P0Z A;  3WS0 A;  1BLP A;  4JKT A;  3VP0 A;  2UV0 E;  2Y2H A;  5DF8 A;  1SKO A;  3A0V A;  2HDR A;  2PAV P;  3C4O A;  5E2F A;  2ZOH A;  4DXB A;  4OLD A;  2Y59 A;  3BWL A;  3NCK A;  4KG6 A;  2C6W B;  1GCE A;  4P6Z S;  3N6I A;  4Y3I A;  1JWP A;  3IQA A;  3T1S A;  3GRJ A;  4ZJ1 A;  3Q7V A;  3N8L A;  4PM6 A;  2HJ9 C;  2H0T A;  4K0X A;  1BLS A;  4XT2 A;  2WGI A;  2W27 A;  1TS6 A;  3GSG A;  3HLD A;  1P9R A;  3V3S A;  5HW3 A;  4OPQ A;  4R1G A;  1HZO A;  1XA1 A;  1OT9 A;  5GL9 A;  2EX9 A;  5F83 A;  3NDE A;  2E8J A;  3T1Q B;  4I39 A;  1KE4 A;  4AFI A;  2Y2J A;  1DJC A;  2XRO A;  3HLB A;  4NKP A;  3F1N B;  1N9B A;  3QP8 A;  4G3V A;  3VOY A;  1K0K A;  5EM1 A;  4FOF A;  2ZL1 A;  4C3Q A;  1S4R A;  2I72 A;  2J3T C;  3H82 A;  2ZD8 A;  2JKT M;  3ZHH A;  4GDN A;  3ZGA B;  1YLJ A;  4N1H A;  5AQ7 A;  1ZTU A;  4L9F A;  3LR3 A;  2WKP A;  3SS4 A;  2LB5 A;  3DWK A;  1CEG A;  4BL2 A;  2IWD A;  4HH2 A;  5DVA A;  3VP4 A;  2EFX A;  1NRF A;  1E3U A;  2ZC5 B;  3JYI A;  1E4D A;  3VFF A;  3H9W A;  2INW A;  3PYP A;  1WYB A;  5HWT A;  3ZNT A;  1YMS A;  1HD8 A;  3D3O A;  3M2J A;  2PR6 A;  4Y0T A;  4KQO A;  3A3J A;  4LCM A;  1PI4 A;  4OH0 A;  4BQM A;  4JF5 A;  3PXP A;  1YAX A;  5FAP A;  4X6T A;  5AQB A;  3PBT A;  5L2F A;  3LCE A;  4P6Z M;  1QMF A;  3UDX A;  1IYQ A;  3MSH A;  3E4O A;  1MKM A;  3Q81 A;  2PBY A;  1BSG A;  1ES2 A;  1OTI A;  4PM9 A;  1TVF A;  4GNU A;  3RH8 B;  3CMZ A;  3P01 A;  3LY4 A;  3WS2 A;  5FEG A;  3ZG7 B;  3IH9 A;  3KSH A;  3IXB A;  2WGW B;  4S2P A;  1MKI A;  4EEU A;  2EXB A;  3B42 A;  4E6X A;  3C7U A;  4N92 A;  3E0Y A;  5E43 A;  2KX6 A;  2XH9 A;  2CMN A;  4Y7P A;  3WRZ A;  4CJN A;  2EWV A;  2QMI A;  2EFU A;  3NC8 A;  3S7P A;  1RP5 A;  2HP5 A;  1MWT A;  3S7Q A;  4HI4 A;  3L9K A;  4CPK A;  2DNS A;  1PWG A;  4Y13 A;  2W1R A;  5CXW A;  1VB6 A;  2ZM2 A;  4LV1 A;  1JWZ A;  1OJ5 A;  1XJ2 A;  3PBS A;  3UDI A;  1L3L A;  3ITA A;  2ZC6 B;  1J3W A;  4BEN A;  2M1C A;  2WAE A;  3UB9 A;  3Q1F A;  5FQM A;  4S2K A;  4RA7 A;  5A92 A;  3RXX A;  3FPW A;  2XFT A;  4FH4 A;  2Y2N A;  3EEH A;  5HDD A;  2XFS A;  3SH8 A;  1KE0 A;  2XK1 A;  1N9N A;  1WA9 A;  3M6B A;  3NEC A;  4PPR A;  4IVK A;  3ZYT A;  5M18 A;  4A5R A;  3PBN A;  3BLM A;  1CQA A;  3KO6 A;  4IBX A;  2EX6 A;  4KG5 A;  2RL3 A;  3CLO A;  2WAD A;  5FI2 A;  4UQI S;  1N4O A;  3MXS A;  3VOL A;  3DTK A;  5DFY A;  3PTE A;  4HEF A;  1MXO A;  2DCF A;  1YKD A;  4HBT A;  3EQU A;  5HX9 A;  3CAX A;  1LL8 A;  4KZB A;  3HCY A;  1XGI A;  3Q82 A;  1MZU A;  3LY3 A;  4DE1 A;  1FOF A;  2HP6 A;  3OCL A;  4B93 A;  2ZC4 B;  2HDQ A;  5FQJ A;  1Z09 A;  3K3C A;  2VX8 A;  1F2K A;  3NUL A;  1CI9 A;  2XDM A;  3VMA A;  3RTY A;  3BY8 A;  5DTT A;  3OCN A;  2W1T A;  2ZQA A;  2ZQ8 A;  3IF6 A;  3IF6 C;  1MWS A;  1NJ4 A;  3IBR A;  3P7N A;  5KZH A;  4F3L B;  3BQA A;  1PI5 A;  3UMD A;  4WUJ A;  5FL3 A;  4LRX C;  1H8Z A;  1HLU P;  3T4Q A;  2VGL S;  5A93 A;  4KZ8 A;  3P09 A;  3T50 A;  3MZE A;  1IFQ A;  3O87 A;  4ARZ A;  1KGG A;  3UME A;  2Y55 A;  3EGX C;  5F68 A;  2Y2L A;  3RFB A;  2V9A A;  3RJU A;  2AVX A;  4EBL A;  4H6J B;  3BY9 A;  1YSQ A;  2YKH A;  4NXG A;  3JVV A;  5IHV A;  1RCJ A;  1STZ A;  4NXE A;  2VGJ A;  3VP3 A;  3HLC A;  3MMH A;  2R9X A;  3OPH A;  3LIF A;  3FPV A;  2XD5 A;  3QP6 A;  1D7E A;  2EX2 A;  2B95 A;  5M1A A;  4RVA A;  5IU1 A;  2J3W A;  3V67 A;  3FKV A;  2Y2I A;  3MF0 A;  5DTK A;  4O01 A;  3HJK A;  5EM0 A;  1OTA A;  4KZ5 A;  4NK3 A;  4OQ0 A;  1XJ3 A;  4E3K A;  2D02 A;  3I7J A;  2ZM8 A;  5TBM B;  4DDY A;  3F1N A;  4JXW A;  1YMX A;  4HIA A;  1AXB A;  2OAP 1;  1MBL A;  4DJ3 A;  4ZAM A;  3F1P B;  4CLC D;  2Y2Q A;  2ZQD A;  3W4O A;  1LL5 A;  1V9Z A;  4KUK A;  4OQH A;  1KVM A;  4S2N A;  3HBR A;  1KDS A;  4S2N C;  2Q0O A;  3M2K A;  3CJM A;  4B88 A;  1ZG4 A;  4E3L A;  3QHY A;  3GEC A;  4WEJ A;  3JVU A;  2X01 A;  2G7U A;  3H7W A;  3IHB A;  2HZ5 A;  1HVB A;  4S2O A;  4HJ3 A;  1FR1 A;  2XQZ A;  5AVE A;  4M3K A;  1ONG A;  2HPB A;  3A3F A;  5DJT A;  3WWX A;  3R4K A;  4BBT A;  4HES A;  2VGL M;  4GDB A;  4FSF A;  2V1Z A;  4ZJ2 A;  1UGU A;  1IYO A;  4MN6 A;  2VV8 A;  1JTD A;  4KZA A;  3FG8 A;  2M7V A;  3IX4 A;  5AVF A;  2ZJ9 A;  1AWI A;  1UWN X;  1ESU A;  3DW0 A;  2O99 A;  1N9O A;  3LFV A;  4N9L A;  3MZD A;  4PMA A;  4Y5F A;  4DDS A;  2XR0 A;  4RX3 A;  4GS9 B;  4LV2 A;  4ZRR A;  4HJ6 A;  1T18 A;  3NHQ A;  5L07 A;  3MQ0 A;  1W8Q A;  1M6K A;  2Y2M A;  1D06 A;  4R38 A;  3S22 A;  2QZ6 A;  4MLL A;  3IXH A;  3IWQ A;  3G35 A;  4UEY A;  4U0T A;  4E3I A;  3MQO A;  2H28 A;  1W8Y A;  2X71 A;  3MQQ A;  3CZD A;  1ONH A;  3V50 A;  2L0W A;  1EI5 A;  2JC7 A;  3LO7 A;  3VP1 A;  1E25 A;  4BWI A;  1JTG A;  3QP5 A;  1PNE A;  2BG1 A;  1ES4 A;  3QP4 A;  3NY4 A;  2JKR I;  1TF1 A;  1XX2 A;  3HLF A;  4PAU A;  4MBK A;  4MN7 A;  1L0E A;  3M6H A;  1GSV A;  3R7W B;  2H0Y A;  2V0W A;  1XXM A;  3SH7 A;  4Y15 A;  1F9I A;  4KZ4 A;  3G34 A;  1FSW A;  4B9O A;  3LUQ A;  1N9L A;  4JGO A;  3ZG5 A;  2PBD P;  5CEB A;  1KDW A;  1ERM A;  1Z6F A;  5HAI A;  5HDS A;  5EVI B;  1DP9 A;  2DMW A;  1H0M A;  4WN5 A;  5KSH A;  4WYY A;  3LIE A;  3F1O B;  4HHD A;  1Q2Q A;  2A3U A;  1ESI A;  3ZFZ A;  3G4P A;  2P7J A;  4R0Q A;  3FKW A;  3FC7 A; 
#chains in the Genus database with same CATH homology
 1KGE A;  3QNC A;  4Y0U A;  3IXB A;  1K25 A;  1MPL A;  3HLW A;  3S1Y A;  2Y91 A;  1L2S A;  4BL3 A;  5EVI A;  2WGW B;  4S2P A;  1MKI A;  5EVI C;  4IED A;  2WKE A;  2EXB A;  4P87 A;  5FAO A;  4E6X A;  2HP9 A;  3C7U A;  4N92 A;  5E43 A;  2Z2L B;  2XH9 A;  2G2U A;  5KMW A;  4Y7P A;  3WRZ A;  4EQI A;  4CJN A;  1BLC A;  1LLB A;  1XA7 A;  4JPM A;  1PZO A;  2QMI A;  1FCN A;  2EFU A;  3NC8 A;  3IF5 A;  1RP5 A;  2HP5 A;  3MKF A;  1LI9 A;  3AGE A;  1MWT A;  1VQQ A;  3BFC A;  1MWR A;  1JVJ A;  1JWV A;  4U0X A;  4CPK A;  3O3V A;  2WKH A;  2DNS A;  3Q07 A;  1PWG A;  4JBF A;  3VFH A;  3VOZ A;  2WYX A;  4E3O A;  1CEF A;  1YLY A;  1G68 A;  5CXW A;  3P98 A;  4UA7 A;  1C3B A;  2ZM2 A;  4S2I A;  1YLW A;  2WGW A;  3MFD A;  4LV1 A;  1JWZ A;  4C75 A;  1BZA A;  3TG9 A;  3PBS A;  3N7W A;  3BEC A;  1ERQ A;  5GLC A;  3UDI A;  4E3N A;  2Y2O A;  4WEL A;  5FA7 A;  3ITA A;  5FQ9 A;  2ZC6 B;  3HUM A;  4BEN A;  4LV0 A;  3IXD A;  2WAE A;  2X02 A;  3Q1F A;  3V5M A;  3UNW A;  1PIO A;  3IWO A;  5FQM A;  3GQZ A;  1KVL A;  4S2K A;  1BUE A;  2Q9M A;  4RA7 A;  3RXX A;  5A92 A;  1TDL A;  2XFT A;  4FH4 A;  2Y2N A;  4EBP A;  3A3I A;  3G32 A;  5GLA A;  4MNR A;  3ZG0 A;  2XFS A;  2UWX A;  3SH8 A;  2XEP A;  4UAA A;  3FWL A;  3WRT A;  4DE2 A;  1KE0 A;  2XK1 A;  1WE4 A;  3MZF A;  1YLZ A;  5F1F A;  5M19 A;  3M6B A;  4PPR A;  1XKZ A;  4IVK A;  4S2J A;  3N8S A;  5FQK A;  5M18 A;  1CI8 A;  4A5R A;  3PBN A;  3BLM A;  2JE5 A;  2P9V B;  1RGY A;  4IBX A;  4KZ6 A;  1BTL A;  4X56 A;  5F1G A;  3ZVW A;  2EX6 A;  5E2G A;  4Z9Q A;  4KG5 A;  2RL3 A;  5CGS A;  4JXV A;  5CHU A;  1GA9 A;  2WAD A;  4OOY A;  5FI2 A;  4JLF A;  4OVD A;  1LI0 A;  1DJB A;  1N4O A;  1XP4 A;  3MXS A;  3PTE A;  4HEF A;  3UPO A;  3PBQ A;  2XD1 A;  1MXO A;  2DCF A;  5JYP A;  5F82 A;  3MXR A;  4R4R A;  4HBT A;  3EQU A;  1NXY A;  1PYY A;  5GHZ A;  1I5Q A;  5HX9 A;  1PWD A;  1SKF A;  1ALQ A;  4BJP A;  1SDN A;  4KQQ A;  4FCF A;  4KZB A;  4WM9 A;  2P9V A;  5DF7 A;  1XGI A;  3Q82 A;  4WZ5 A;  4DRT A;  4R23 A;  4WZ5 C;  3LY3 A;  4GD8 A;  3E2K A;  2J8Y A;  4X69 A;  4DE1 A;  2EXA A;  1FOF A;  2JCH A;  2HP6 A;  3TOI A;  3OCL A;  4JXS A;  4IVI A;  3ZG8 B;  5G18 A;  3BLS A;  3HRE A;  3OC2 A;  1XGJ A;  2ZC4 B;  2HDQ A;  3UE0 A;  2PU2 A;  5FAQ A;  1PWC A;  5FQJ A;  2E8I A;  5CHM A;  2P74 A;  4BLM A;  4PM5 A;  5HL1 A;  4P85 A;  4EV4 A;  3IHA A;  5FI7 A;  5GLB A;  1CI9 A;  4B4Z A;  5HAP A;  2Y4A A;  4KQR A;  2XDM A;  2JBF A;  3VMA A;  4D2O A;  5DTT A;  3DTM A;  4QB8 A;  5A91 A;  3ITB A;  3OCN A;  3SS5 A;  2ZQA A;  1J9M A;  5EOO A;  1K54 A;  2ZQ8 A;  3EQV A;  3IF6 A;  3NBL A;  1K54 C;  3IF6 C;  1MWS A;  1NJ4 A;  5KZH A;  1O7E A;  3GV9 A;  2FFF B;  3W4P A;  2WKI A;  2WZX A;  3A3E A;  4GZB A;  1PI5 A;  4MEZ A;  4RYE A;  4C6Y A;  4ZDX A;  2ZQ9 A;  1W7F A;  3FV7 A;  4OOL A;  1K56 D;  1MY8 A;  1XPB A;  1E3U D;  1H8Z A;  4ZJ3 A;  4KZ9 A;  5JYO A;  4X68 A;  5D3O A;  3WS5 A;  5A93 A;  4KZ8 A;  2IWC A;  3P09 A;  3S4X A;  1DY6 A;  1S0W A;  3MZE A;  4LV3 A;  5HAR A;  5CED A;  5A90 A;  2ZC3 B;  3O87 A;  3IWI A;  2ZMA A;  3HL9 A;  1ZG6 A;  5HFO A;  1BUL A;  1KGG A;  5EPH A;  4GB7 A;  1Q2P A;  3V39 A;  2Y55 A;  1K55 A;  4QU3 A;  1FR6 A;  3UPP A;  1K55 C;  2Y2L A;  2BLS A;  1NZU A;  4WZ4 A;  1BLH A;  1K6R A;  3C4P A;  2V20 A;  5KSC A;  4WMC A;  1FQG A;  1L0D A;  3G2Z A;  3PBR A;  4N1X A;  4P0M A;  3RJU A;  4EBN A;  1YM1 A;  4KZ7 A;  4DXC A;  3N4I A;  4YFM A;  5EUA A;  1BT5 A;  4IBR A;  4EBL A;  4UA9 A;  3GMW A;  4RX2 A;  5EOE A;  1K57 A;  1L0G A;  3W8K A;  1K57 C;  1W5D A;  5IHV A;  4QD4 A;  1M40 A;  1U60 A;  3UO9 A;  3QNB A;  1RCJ A;  1I2S A;  2A49 A;  2VGJ A;  3O86 A;  1YQS A;  3VP3 A;  2HDU A;  2R9W A;  3HLC A;  4FD8 A;  3PBO A;  4NET A;  4KEN B;  4GKU A;  2R9X A;  2V2F F;  3V3R A;  1G6A A;  3OPH A;  1DJA A;  3GVB A;  4E3J A;  4QHC A;  1TDG A;  2WK0 A;  2XD5 A;  4PM8 A;  5AQ9 A;  4K91 A;  3TSG A;  4U3T A;  2G2W A;  3UY6 A;  3LEZ A;  5BOH A;  1ZC2 A;  4OPR A;  5CEC A;  2EX2 A;  2EX8 A;  3PAG A;  4MBH A;  1K4E A;  4OPY A;  5M1A A;  3BRM A;  4RVA A;  2C5W B;  2ZQC A;  1GHI A;  2XF3 A;  1CK3 A;  1GHP A;  2Y2G A;  5E2H A;  1PW8 A;  1VM1 A;  3FKV A;  5EVI D;  4GOG A;  2Y2I A;  5TR7 A;  4KZ3 A;  4Y0O A;  1H8Y A;  5DTK A;  3A3D A;  1LHY A;  4DE0 A;  2PU4 A;  3DWZ A;  4KZ5 A;  4NK3 A;  4OQ0 A;  3BM6 A;  3IT9 A;  4E3K A;  1WYC A;  4OP5 A;  4ZTK A;  3I7J A;  2OSU A;  1K38 A;  4S2M A;  2ZM8 A;  4DDY A;  4E6W A;  1FCM A;  4JXW A;  1YMX A;  2DRW A;  1IEM A;  5U47 A;  2HDS A;  1AXB A;  3B3X A;  1MBL A;  3Q7Z A;  3ZCZ A;  5CHJ A;  4ZAM A;  3UN7 A;  2Y2Q A;  3WS4 A;  5E2E A;  2ZQD A;  3W4O A;  1LL5 A;  1NYY A;  4YIN A;  3NIA A;  3IH8 A;  3IF6 B;  4UHU A;  4DKI A;  4OQH A;  1KVM A;  4OKP A;  4ID4 A;  3HBR A;  4S2N A;  4DF6 A;  4WEK A;  4P6B A;  4QJG A;  1KDS A;  4S2N C;  3W4Q A;  1SCW A;  3M2K A;  2J7V A;  5GHX A;  3CJM A;  2XGN A;  1YLP A;  4B88 A;  3GTC A;  1ZG4 A;  4KG2 A;  4E3L A;  5EVL A;  3SH9 A;  3QHY A;  1QME A;  1RGZ A;  3CG5 A;  2OV5 A;  2XLN A;  5GLD A;  3WS0 A;  4QY6 A;  4WEJ A;  4HBU A;  2OLU A;  1BLP A;  4JKT A;  3AGD A;  2X01 A;  4B4X A;  4F94 A;  1YLT A;  2FFY A;  3VP0 A;  3C5A A;  1FCO A;  4X55 A;  3IHB A;  1L0F A;  1HVB A;  4S2O A;  2GDN A;  2Y2H A;  5DF8 A;  5DTS A;  2WUQ A;  4GD6 A;  3C7V A;  3FYZ A;  3ZG9 B;  4OLG A;  1FR1 A;  1PZP A;  2XQZ A;  1I2W A;  2HDR A;  3C4O A;  3NDG A;  1ONG A;  2HPB A;  4M3K A;  3A3F A;  5CTM A;  5E2F A;  1W79 A;  4MBF A;  3WWX A;  4DXB A;  4OLD A;  2Y59 A;  5CGW A;  4HES A;  4GDB A;  4FSF A;  2V1Z A;  3NCK A;  4KG6 A;  4O7D A;  4ZJ2 A;  1IKG A;  2C6W B;  3G2Y A;  1GCE A;  4ZBE A;  2ZLY A;  3N6I A;  1IYO A;  1JWP A;  5CTN A;  1NYM A;  3IQA A;  4KZA A;  1JTD A;  1IKI A;  3SS3 A;  3GRJ A;  4EWF A;  4ZJ1 A;  3HUN A;  3Q7V A;  3OPL A;  3PAE A;  3N8L A;  4PM6 A;  4DE3 A;  4JXG A;  2ZJ9 A;  4FH2 A;  4QY5 A;  2H10 A;  1IYS A;  2H0T A;  3MBZ A;  5CER A;  5FAT A;  4GN2 A;  1ESU A;  3DW0 A;  4K0X A;  3BFG A;  1BLS A;  4OP8 A;  4OOM A;  4OPZ A;  4LCL A;  1IYP A;  2Y2K A;  2WGI A;  1LL9 A;  4JF6 A;  3ZNY A;  4N9L A;  3MZD A;  4PMA A;  1NY0 A;  3OPR A;  2B5R A;  3GSG A;  4R3B A;  1GHM A;  5GHY A;  3HLD A;  3SOI A;  4DDS A;  3V3S A;  2XR0 A;  4R4S A;  5HW3 A;  4RX3 A;  1NZO A;  4OPQ A;  4LV2 A;  4S2L A;  4R1G A;  1HZO A;  1XA1 A;  5J8X A;  1W8Q A;  1M6K A;  2Y2M A;  1MWU A;  3S22 A;  4R3J A;  2QZ6 A;  5GL9 A;  2EX9 A;  3WS1 A;  1GA0 A;  1SDE A;  3BFF A;  4MLL A;  3VSL A;  3IXH A;  5F83 A;  2ZQ7 A;  3NDE A;  3VP2 A;  2Z2M B;  4PM7 A;  4OQG A;  1K6S A;  5DF9 A;  2IWB A;  2OLV A;  2WGV A;  2WAF A;  1KE4 A;  3IWQ A;  3G35 A;  5FDH A;  3ZVT A;  2Y2P A;  1DJC A;  1SHV A;  2Y2J A;  2ZC7 A;  3BEB A;  3HLB A;  3G31 A;  3N8R A;  3MKE A;  4U0T A;  2CC1 A;  5HAQ A;  5FI6 A;  3ISG A;  4E3I A;  1N9B A;  3VOY A;  1W8Y A;  1FSY A;  2X71 A;  2H5S A;  4C3Q A;  4H8R A;  2I72 A;  3CZD A;  1ONH A;  2ZD8 A;  3V50 A;  3ZHH A;  1YT4 A;  4GDN A;  4OQI A;  3BFE A;  3ZGA B;  5FAS A;  1EI5 A;  2JC7 A;  1YLJ A;  4N1H A;  5AQ7 A;  4UA6 A;  3LO7 A;  4BD0 A;  4XXR A;  5I94 A;  3VP1 A;  4E3M A;  1E25 A;  5CRF A;  2VGK A;  3SS4 A;  2J9P A;  1JTG A;  3D4F A;  4XUX A;  2Q9N A;  2BG1 A;  4JF4 A;  3DWK A;  1ES3 A;  1ES4 A;  3G30 A;  3NY4 A;  5EE8 A;  3UE3 A;  1CEG A;  1XX2 A;  3HLG A;  1OME A;  3OZH A;  2IWD A;  4BL2 A;  1KGF A;  2QPN A;  5DVA A;  3VP4 A;  4BD1 A;  3HLF A;  2EFX A;  4L0L A;  1NRF A;  1ZKJ A;  1K56 A;  5FQI A;  1H5X A;  4MBK A;  3HVF A;  5FSR A;  1E3U A;  4WMC D;  1TEM A;  3BFD A;  3VSK A;  3AGF A;  1L0E A;  2ZC5 B;  2J9O A;  3JYI A;  3FZC A;  3M6H A;  3E2L A;  2H0Y A;  4OON A;  1XXM A;  1E4D A;  3VFF A;  1IEL A;  2RCX A;  3RXW A;  3SH7 A;  1O07 A;  3HLE A;  1WYB A;  3GR2 A;  4KZ4 A;  3ZDJ A;  3G34 A;  1FSW A;  3ZNT A;  4X53 A;  3NI9 A;  1YMS A;  1HD8 A;  1HTZ A;  3Q7V B;  3M2J A;  1S6R A;  4Y0T A;  4KQO A;  3A3J A;  4LCM A;  4EUZ A;  3ZG5 A;  1PI4 A;  4OH0 A;  5CEB A;  4BQM A;  1KDW A;  4JF5 A;  5AQA A;  1ERM A;  1Z6F A;  5FQQ A;  5HAI A;  4K0W A;  1ERO A;  5FAP A;  5EVI B;  4X6T A;  2WZZ A;  5AQB A;  3PBT A;  3UDF A;  5L2F A;  3LCE A;  1QMF A;  3IXG A;  3UDX A;  1IYQ A;  4XUZ A;  4LEN A;  5EEC A;  3Q81 A;  5KSH A;  1K4F A;  1BSG A;  2PBY A;  4WYY A;  1ES2 A;  3UPN A;  4PM9 A;  1TVF A;  4GNU A;  4Q8I A;  4WBG A;  3CMZ A;  3HUO A;  3BYD A;  1Q2Q A;  3UE1 A;  2A3U A;  1Y54 A;  1ESI A;  4N9K A;  3LY4 A;  3WS2 A;  1EWZ A;  1KE3 A;  3ZFZ A;  3O88 A;  3OPP A;  5TGF A;  5CGX A;  3G4P A;  1PW1 A;  3ZG7 B;  5TFQ A;  4R0Q A;  1ES5 A;  3FKW A;  3IH9 A;  2ZM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...