1GHMA

Structures of the acyl-enzyme complex of the staphylococcus aureus beta-lactamase mutant glu166asp:asn170gln with degraded cephaloridine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
257
Chain Sequence
b'KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYDIELQYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Structures of the acyl-enzyme complexes of the Staphylococcus aureus beta-lactamase mutant Glu166Asp:Asn170Gln with benzylpenicillin and cephaloridine.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 93
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ghmA00
2ZLYA 4OQIA 3IWOA 2HP6A 2V20A 4E3MA 5HW3A 3PBRA 4P85A 4OPRA 4WMCA 1NYMA 2E8IA 5U47A 2XD5A 3HLWA 1NYYA 3IXGA 1XA7A 3ZNYA 2QPNA 4OQ0A 5EECA 3UE3A 1AXBA 5CGSA 1PI4A 2ZC7A 1WYBA 4EBNA 3FKWA 1Z6FA 3HBRA 1ERQA 4MLLA 1Q2PA 4WEJA 1W8QA 2CC1A 3HREA 4IBXA 2Y91A 3QNBA 5FQJA 1I5QA 2Y2NA 3G32A 3OPPA 3DTMA 2WGIA 5GL9A 3ZG7B 2ZD8A 4MEZA 3SS5A 5KMWA 4MBHA 1JWVA 2H10A 4DXBA 3GQZA 1EI5A 4WYYA 1GA9A 4GNUA 4P6BA 1XX2A 3NI9A 1ZC2A 5FAOA 3BEBA 3VOYA 3ZHHA 2ZMAA 5F82A 4ZTKA 3LCEA 1YLJA 2ZQDA 4Y0OA 3TOIA 1XPBA 1K57C 1NY0A 2P9VA 4GD6A 3IHBA 1BTLA 1K6SA 1ERMA 2WK0A 3RXXA 5BOHA 3GSGA 5GLAA 1YLTA 4MNRA 3TG9A 3BFEA 4JBFA 3Q1FA 1IELA 3M6BA 4JXVA 5CTNA 3IT9A 2WZZA 1K55C 2WAEA 3C4OA 3C5AA 5CHJA 1SDEA 1FOFA 3IQAA 2ZQCA 5EVIB 3AGDA 4OONA 3A3FA 5E2HA 4DE2A 2JCHA 4S2NC 4OOYA 1KGGA 2XFSA 4IEDA 3FWLA 2HPBA 4R23A 1EROA 4X6TA 4R3BA 4E3JA 4WZ4A 5HL1A 4UA7A 5AQBA 2WGVA 2GDNA 3ZVWA 1TDLA 2FFFB 3BFCA 4QB8A 4ZJ3A 3C7VA 1ES5A 3VMAA 5L2FA 1W8YA 2J7VA 4KG2A 4QHCA 2VGKA 3ZVTA 1L0EA 2V1ZA 3OZHA 4XUZA 3CMZA 3MFDA 3E2KA 2WKHA 3MKEA 1BLPA 4IVKA 3WS5A 1MBLA 4HBTA 1ZKJA 4GDBA 3IF6C 3MKFA 5AQAA 1PWCA 4DKIA 4WZ5A 3BFFA 4R4SA 4PMAA 4E3OA 1XXMA 3BM6A 3O88A 2A49A 4N1XA 4P87A 4YFMA 4EBLA 1BLSA 2OLUA 1NJ4A 3PBSA 2ZQ8A 2JE5A 4PM5A 4JXSA 5GHZA 1QMEA 5TFQA 2EX6A 5CEDA 2X02A 4RYEA 4WELA 2QMIA 5EPHA 4QY6A 4B4XA 5HFOA 3VOZA 4QU3A 3TSGA 1S0WA 3BFGA 4GB7A 4E3KA 1KE0A 1G68A 1IEMA 2H5SA 3CJMA 4IBRA 4S2KA 1XA1A 3V3RA 3NDGA 1BLHA 1PZOA 4LV2A 5KSCA 3HLEA 4OKPA 1FR6A 1TEMA 3S4XA 2P9VB 1IYSA 4BLMA 1K6RA 4D2OA 1QMFA 1L0FA 1MWTA 1YLWA 2WAFA 4JXWA 4Y0TA 1JVJA 1W79A 5DF9A 3FZCA 2Y2HA 1K56A 4E6WA 3PBOA 5AQ9A 1K54C 1I2SA 1NZUA 3A3EA 5DTTA 5TR7A 4S2PA 4BENA 1HZOA 4WBGA 4U3TA 2X01A 2H0TA 4QY5A 4GKUA 5EUAA 1L0GA 3UPNA 5DF8A 4N9KA 3G4PA 1XKZA 3ITBA 1NXYA 4ZJ2A 1W7FA 3HLDA 4OPQA 4JXGA 1FCOA 1H8ZA 3GV9A 3UO9A 1LLBA 4FH2A 4FCFA 4JKTA 5DTSA 4WEKA 1MWUA 4EWFA 5AQ7A 2G2UA 2P74A 1K55A 1Q2QA 2DNSA 3OPRA 5HAIA 3UY6A 1RGYA 3EQUA 3WWXA 5GHXA 2XR0A 2EXAA 1MKIA 5JYOA 1M6KA 5KSHA 1ES4A 5HAPA 1CI8A 2Y55A 3D4FA 5JYPA 4N1HA 4S2NA 1CK3A 3PTEA 2IWBA 4MBFA 4DDSA 2OSUA 1PIOA 3DW0A 3QNCA 4OLDA 4H8RA 1PW1A 5CEBA 5CECA 4S2IA 1S6RA 3HLFA 1E3UD 2XD1A 1E25A 3UN7A 1BULA 5FAQA 1SCWA 3O86A 4UHUA 5FDHA 3I7JA 4KZ5A 4X55A 5EOEA 3WS4A 4JLFA 1DJBA 3UDIA 5GLCA 3PAEA 2Y2GA 4KZ7A 5DF7A 4FH4A 4LV3A 1EWZA 1KDSA 2EFUA 2PU4A 5DVAA 2OV5A 3V5MA 3IF6A 5EVID 1KDWA 5CXWA 2XEPA 5EVLA 1FCMA 4GZBA 1K38A 2H0YA 1FSWA 3N7WA 1N4OA 3ZDJA 3UPPA 1WE4A 2EX2A 3NCKA 3ZNTA 5E43A 4E3IA 1CEGA 1JWPA 2WYXA 2J9PA 2ZQ7A 4E6XA 4RA7A 4WMCD 3MZEA 5E2EA 1LI9A 2WGWA 1ES2A 4GOGA 4UAAA 4ID4A 1ZG6A 1SHVA 5FQ9A 2B5RA 2A3UA 3PBTA 4FSFA 5CGWA 3BYDA 4NETA 3G35A 5GLBA 4OQGA 2XFTA 4KQQA 3LY4A 1O7EA 2DCFA 3UPOA 3VP0A 5CHUA 1LL5A 5J8XA 1BT5A 4OPYA 4R4RA 1GCEA 4S2MA 3RJUA 1K54A 2QZ6A 4RVAA 4KZ3A 3VP4A 3BLSA 1BUEA 3ZG5A 2WADA 5EOOA 2Y2LA 1BLCA 3WS2A 1TDGA 5F1GA 2HDRA 4BQMA 1FCNA 1VM1A 3RXWA 3S22A 2PBYA 2Y2PA 4CPKA 1NZOA 3BLMA 5FASA 3MXSA 1K4FA 1LHYA 2Y2KA 3C7UA 4OP5A 3CZDA 1KVMA 4Y7PA 3WS1A 4GN2A 1K25A 2ZM2A 3VFFA 5GHYA 4B4ZA 4OOMA 3JYIA 1ESUA 5A93A 4UA6A 4UA9A 4ZAMA 2IWDA 2XK1A 3LO7A 2HP9A 1LI0A 3S1YA 3HUMA 4LV0A 1HVBA 4IVIA 2PU2A 4U0XA 4Q8IA 4DDYA 3VP3A 3ITAA 3N6IA 1M40A 1YT4A 5GLDA 3W4OA 5E2GA 2EX8A 2XF3A 4MBKA 3IF6B 2UWXA 4DRTA 3G31A 3IWQA 4HEFA 3SS3A 2Z2LB 3M2JA 1LL9A 4YINA 4JF4A 2Y2OA 2Y2JA 3OCLA 3ZGAB 3IH9A 5HARA 5FQKA 3NC8A 1N9BA 2Q9NA 3W4QA 4B88A 3SH8A 3HLBA 4FD8A 3O87A 4EV4A 5FQMA 5HAQA 2ZC4B 4LV1A 4BJPA 2XDMA 1KVLA 2OLVA 5M19A 2JBFA 1IYOA 5FSRA 5FATA 4PM6A 1MPLA 4ZDXA 3C4PA 1YQSA 2Y2QA 5M1AA 3HUOA 3IXBA 2C6WB 5IHVA 3MBZA 2XQZA 2BLSA 3ISGA 1L0DA 5CERA 5I94A 1YMSA 3HUNA 4PM7A 4S2OA 1XGIA 2Q9MA 2ZQ9A 1JWZA 5CHMA 5FA7A 1YLPA 2EFXA 3G34A 3Q7ZA 5G18A 4C75A 4E3LA 2ZJ9A 4DXCA 2WZXA 3V50A 4R3JA 3ZG8B 1GHIA 3A3JA 4N9LA 3A3IA 1YM1A 3SS4A 4DF6A 3OPHA 4DE1A 3FV7A 1U60A 1Y54A 3M6HA 3BFDA 4RX3A 4S2JA 4R0QA 3MZDA 1MY8A 1MWSA 4OH0A 3IXDA 1DY6A 1BZAA 2R9WA 1K4EA 3W4PA 3AGEA 4ZJ1A 1K56D 4X69A 3PBNA 4CJNA 2J8YA 3FYZA 3B3XA 3V39A 5EE8A 3GMWA 1JTDA 5DTKA 2RCXA 3AGFA 5FQQA 4OQHA 1IYPA 2G2WA 4N92A 3BECA 4KZ8A 3ZG9B 4LCMA 1IYQA 1DJAA 2XH9A 1O07A 4GDNA 1RGZA 5FAPA 5A90A 4EBPA 2Y59A 1PWGA 4BL2A 1CI9A 2ZC3B 3LEZA 1WYCA 4XUXA 3SOIA 3IXHA 4M3KA 2BG1A 2HDUA 5FI2A 3OC2A 3UE0A 1NRFA 1XP4A 3ZG0A 4OVDA 2FFYA 4KZBA 3V3SA 3ZCZA 3MXRA 3N4IA 1RCJA 3Q07A 3G2YA 1GA0A 1ALQA 3EQVA 5TGFA 3PBQA 4KQOA 5F1FA 1IKGA 4PM8A 4XXRA 2DRWA 4GD8A 4X56A 1PWDA 3CG5A 3N8RA 5FI7A 1TVFA 1H8YA 3GRJA 2VGJA 5M18A 5EVIC 3UDXA 4LCLA 3UNWA 4RX2A 1E4DA 1SDNA 2Y2IA 2Y4AA 1KGFA 1KGEA 3LY3A 2R9XA 4U0TA 4KENB 4OOLA 3WRTA 4BD0A 3IWIA 1ONGA 4ZBEA 4DE3A 4E3NA 2ZM0A 5CGXA 3VSKA 2XGNA 3HL9A 3GR2A 2I72A 4QD4A 3NDEA 2HDQA 4Y0UA 4Z9QA 1HD8A 4L0LA 3Q7VA 4C6YA 1PW8A 1VQQA 2J9OA 2ZQAA 3MZFA 3ZFZA 5D3OA 1YMXA 4KZ6A 1BSGA 1PZPA 4JF6A 3WS0A 3DWKA 1MWRA 3IHAA 4O7DA 3VP1A 3M2KA 1I2WA 3GTCA 1IKIA 1ESIA 4BD1A 2WKEA 4X53A 3HVFA 3N8SA 1KE4A 3NIAA 1FQGA 4QJGA 4OP8A 4WM9A 1OMEA 2JC7A 2WUQA 4A5RA 3FKVA 4BL3A 1ZG4A 3P09A 1W5DA 4F94A 3NY4A 4PPRA 4KQRA 5HX9A 5F83A 4OPZA 2ZC5B 1YLZA 2EXBA 1DJCA 1FR1A 4K91A 2WGWB 1H5XA 3OCNA 3Q81A 4EUZA 3IH8A 5KZHA 2ZM8A 4KG5A 1JTGA 3SH9A 3DWZA 3PAGA 4LENA 1G6AA 3VSLA 1PYYA 1J9MA 4HBUA 1C3BA 2Y2MA 4KZ9A 1RP5A 4KZ4A 1GHMA 3N8LA 4JPMA 5FQIA 3UE1A 4DE0A 4X68A 3BRMA 3O3VA 1FSYA 2XLNA 3NBLA 4EQIA 1L2SA 5A91A 3A3DA 3OPLA 2ZC6B 2IWCA 3QHYA 4PM9A 3W8KA 5E2FA 4K0XA 3Q82A 3G2ZA 3WRZA 1E3UA 1XGJA 4NK3A 2HDSA 3HLGA 4JF5A 1CEFA 3VP2A 3E2LA 2HP5A 4S2LA 2C5WB 3VFHA 4C3QA 4P0MA 2V2FF 1YLYA 5A92A 4OLGA 3UDFA 1PI5A 2RL3A 1HTZA 2EX9A 3IF5A 3SH7A 4HESA 1KE3A 2X71A 4R1GA 4K0WA 1K57A 3HLCA 5CTMA 4KZAA 5EVIA 3G30A 1GHPA 3P98A 3Q7VB 1ONHA 4KG6A 5FI6A 2Z2MB 3GVBA 1SKFA 5CRFA 1MXOA 2WKIA 1ES3A 4WZ5C
chains in the Genus database with same CATH superfamily
5IT5A 2HP6A 3H7WB 4NXFA 4E3MA 5HW3A 3PBRA 4WMCA 3HLWA 3H9WA 1PI4A 4O8GA 3HBRA 2Y91A 3OPPA 3DTMA 1GSVA 4MEZA 3SS5A 5KMWA 4P6BA 3BEBA 3ZHHA 5F82A 3LCEA 1YLJA 4Y0OA 1XPBA 3LR0A 1WA9A 5L09A 2KLIA 1K6SA 5GLAA 1F2KA 4JBFA 3IT9A 2WZZA 1FOFA 2KOIA 3A3FA 5E2HA 3F1PA 3TJZC 2PAVP 4MN6A 4QB8A 4ZJ3A 3VMAA 3T1QB 4KG2A 3ZVTA 2V1ZA 3MFDA 2WKPA 4IVKA 4GDBA 5AQAA 1PWCA 4DKIA 4R4SA 4E3OA 4YFMA 3MXQA 2J3WA 1BLSA 2OLUA 2ZQ8A 4PM5A 1TS7A 4WN5A 5GHZA 1QMEA 2EX6A 5HWWA 2X02A 5MC7A 2VV7A 3VOZA 3BFGA 3S7NA 2H5SA 4IBRA 1XA1A 3V3RA 2JKTI 1PZOA 3PHYA 4BBUA 3S4XA 1FR6A 3LIFA 1KOUA 4JXWA 2WAFA 4Y0TA 4XT2B 5TR7A 4R6LA 2AVXA 4QY5A 4GKUA 4WLAA 4N9KA 3ITBA 1W7FA 3HLDA 4OPQA 3F1PB 3W2ZA 3UO9A 4HP9A 1MWUA 5AQ7A 1Q2QA 1OTEA 2EXAA 1LL8A 1M6KA 3UMDA 4S2NA 3C38A 4EW7A 5HDCA 2IWBA 3QNCA 2EWWA 5CECA 4S2IA 2EWVA 3HLFA 5HD5A 5FAQA 5F6AA 1T1CA 4X55A 2Y2GA 4KZ7A 3T4LA 4JGQA 1FSWA 3UPPA 2EX2A 4JGPA 2V1BA 3MR0A 2J80A 2K31A 3KYEA 3LY4A 4KQQA 5CHUA 1LL5A 3QP5A 5FDSA 4S2MA 4UEYA 1K54A 2QZ6A 3RJUA 4KZ3A 3S7OA 2WADA 5EOOA 1BLCA 3WS2A 1TDGA 2PHYA 5F1GA 2EA9A 3E0YA 5HZHA 1W63Q 5HD3A 1Y4OA 2M1CA 4FOFA 1KVMA 4GN2A 3VFFA 3JYIA 1ESUA 4ZAMA 2PD7A 5HWVA 2KDKA 3LO7A 2HP9A 3DAVA 4LV0A 2W1RA 3ITAA 1YT4A 3W4OA 2XF3A 4MBKA 4DRTA 2UWXA 1CQAA 4F3LA 2Z2LB 3M2JA 4YINA 4JF4A 3SZTA 3ZGAB 3IH9A 3CAXA 3W4QA 5C5KA 4EV4A 4LV1A 4BJPA 2OLVA 3LGOA 2O99A 4HP4A 4DJ2A 3ULFA 4NXBA 4JGRA 1OT9A 2C6WB 2E8JA 4ZRRA 3MBZA 5IHVA 1UWNX 5EM1A 1NLYA 5CERA 4X1MA 5CHMA 1XGIA 2Q9MA 3TW8A 1YLPA 3Q7ZA 3UMEA 3CPTA 4Y2FA 3OPHA 3FV7A 4RX3A 4S2JA 1MY8A 1FIKA 1BZAA 3BY9A 2QHKA 2QYBA 2J8YA 3FYZA 4OQHA 1IYPA 4F3LB 3ZG9B 3E4OA 5J4EA 5A90A 2B95A 3LEZA 1WYCA 2VGLM 4XUXA 3IXHA 4IHQA 2HDUA 3A0VA 1XP4A 4OVDA 5IS1A 3MXRA 2ZMFA 1RCJA 4GCZA 1AWIA 1GA0A 4KQOA 3GRJA 2VGJA 3CPTB 5M18A 3CWFA 5KIZA 4LCLA 3UNWA 5G4YA 4BMWA 3LY3A 4Q0JA 4OOLA 4K08A 4ZBEA 4H6JB 3NJAA 3VSKA 2XGNA 2HDQA 4D60A 5I5LA 1PW8A 3MZFA 3ZFZA 1YMXA 2HV1A 4JF6A 3DWKA 4O7DA 3VP1A 3NIAA 2JKFA 2WUQA 4A5RA 3P09A 1W5DA 2OAP1 3HJIA 4F94A 3IX3A 5F83A 1S1ZA 1XJ4A 3OCNA 4EUZA 3PAGA 3VSLA 1C3BA 4Y13A 1T1BA 3CUEC 3UE1A 4X68A 1L2SA 2XRNA 3W8KA 2K7SA 1LSVA 2VGLS 3HLGA 4PAUA 4S2LA 4P0MA 2VK3A 4I3JA 2V2FF 2VJWA 4OLGA 4EXOA 2X71A 4LLOB 3HLCA 5CTMA 1K0KA 1F9IA 4RQ9A 5CRFA 4LPZA 2WKIA 4R23A 4R38A 1PNEA 2ZLYA 4OQIA 3IWOA 2W3GA 4FTXA 1NYMA 3BQAA 2XD5A 1YSPA 1T1AA 3UE3A 3UB7A 3FKWA 2W3FA 5DFYA 3HJKA 5FQJA 3HREA 2V9AA 1I5QA 5GL9A 3ZG7B 1ZHHB 2H10A 4WYYA 1GA9A 1XX2A 5FAOA 3T4SA 3VV4A 4ZTKA 2QJ5A 3TOIA 1P9RA 1K57C 3LI8A 2P9VA 1BTLA 1ERMA 5BOHA 4ME4A 3BFEA 1IELA 3M6BA 5CTNA 2O0YA 1K55C 2WAEA 3C5AA 5CHJA 3IQAA 2ZQCA 4OONA 3O5YA 4DE2A 1KGGA 3FWLA 3DTIA 2HPBA 4R3BA 5HL1A 2V0WA 4UA7A 2GDNA 3ZVWA 1TDLA 2JHEA 1W8YA 2J7VA 3EOIA 2I9VA 4CLCE 3CMZA 4I39A 1BLPA 4LRYC 2ACGA 1MBLA 3IF6C 3BFFA 4PMAA 2A49A 3F1NA 3VOLA 1NJ4A 5AJGA 1MC0A 5CEDA 2ZL1A 5EPHA 4WELA 2QMIA 4B4XA 4JGOA 1BYWA 1NRJA 4DJ3A 3JVVA 1KE0A 3CJMA 1DP6A 1TEMA 1IYSA 2P9VB 4I3AA 4D2OA 1QMFA 2O9AA 2BTFP 1W79A 2Y2HA 3JPUA 1NZUA 2GZAA 3D72A 4U3TA 4LRZE 1L0GA 4HNBA 3UPNA 3G4PA 1XKZA 2W3DA 4B93A 1H8ZA 2O9BA 3D3OA 4FH2A 4JKTA 4EWFA 2DNSA 5GHXA 3BWLA 1MKIA 1ES4A 3DTKA 3PXPA 3D4FA 5JYPA 1CK3A 4H8RA 1YKDA 1TD5A 3F1NB 1SCWA 5FDHA 3T50A 5EOEA 4JLFA 1DJBA 3UDIA 5DF7A 4LV3A 1KDSA 2EFUA 3LR3A 5EVID 1G6OA 1KDWA 2HF6A 1FCMA 3QP4A 1K38A 2H0YA 1N4OA 2B02A 3ZDJA 2VLGA 5J7EA 4HHDA 1VHMA 3NCKA 4NXEA 3ZNTA 4ARZA 2WYXA 2J9PA 5EV0A 1DP9A 4E6XA 1IOUA 1LI9A 1LT0A 4UAAA 1OTAA 1LSXA 3CHWP 4CLCC 5CGWA 2LB9A 3BYDA 3LIBA 3G35A 4OQGA 5HPIA 2XFTA 3UE6A 2DCFA 2Z6CA 3NOTC 3EGDC 3VP0A 1BT5A 4RVAA 4HH3A 3VP4A 3BLSA 1F98A 3S22A 4CPKA 3BLMA 2XROA 3TRCA 3T1RA 3T12B 4Y7PA 2GX5A 5GHYA 2IWDA 2XK1A 4EQ1A 1XJ2A 3RH8B 3S1YA 3T4OA 4IVIA 4Q8IA 3IBJA 4DDYA 1TS6A 1J3WA 1PRQA 3IWQA 4HEFA 2OWJA 3SS3A 4E04A 2Y2OA 2Y2JA 3OCLA 3NC8A 1N9BA 2Q9NA 3C8CA 4ARZB 3O87A 2L1MA 2XDMA 2WKQA 5M19A 1IYOA 5FSRA 4PM6A 4HI4A 3C4PA 3EEAA 1D06A 3IXBA 3QP6A 2W3EA 4S2OA 5FA7A 4C75A 4E3LA 2EFXA 3V50A 1GHIA 4DF6A 1JNUA 1U60A 1Y54A 1LSWA 3M6HA 3BFDA 1V9YA 1MWSA 1DY6A 4O01A 1K4EA 2NUTC 4ZJ1A 1K56D 4HJ6A 4LFUA 4CJNA 2ZBBA 3IX4A 5L07A 2Z6DA 3AGFA 3C2WA 5FQQA 2G2WA 4LCMA 1IYQA 4HJ4A 4EBPA 3SOIA 1VB6A 2BG1A 3MQ0A 5FI2A 3OC2A 4KZBA 2DMWA 4O0PA 5TBMA 3G2YA 2JKRI 5TGFA 3PBQA 4XXRA 1IKGA 2DRWA 4GD8A 1PWDA 3CG5A 2ZOHA 3UDXA 4RX2A 1E4DA 2Y2IA 2Y4AA 1KGEA 2R9XA 3P01A 2UV0E 4BD0A 4E3NA 4DE3A 2ZM0A 1D1JA 5HDSA 3GR2A 4QD4A 1P9WA 3KYZA 2J9OA 2ZQAA 4ETXA 5D3OA 1BSGA 1PZPA 1I2WA 3GTCA 4BD1A 1TF1A 3HVFA 4G3KA 1FQGA 1T19A 4OP8A 4WM9A 3UB5P 1F5MA 4BL3A 1XJ6A 1ZG4A 2L0WA 4QWOA 3IH8A 3SH9A 1G6AA 5TBMB 5IU1A 1J9MA 3K2NA 4KZ9A 4KUOA 1MKMA 4EQIA 3O3VA 4IJGA 3A3DA 3OPLA 1G28A 4PM9A 4PKYG 3Q82A 3WRZA 2HDSA 5DJTA 2HP5A 3NOUC 4IUHA 4Y17A 3NOPC 1YLYA 3UDFA 5F5YA 1PI5A 3SH7A 4HESA 4R1GA 4K0WA 1K57A 2HJ9C 5EVIA 3G30A 3OLOA 4GS9A 4KG6A 2G7UA 4DMZA 3GVBA 1SKFA 4AFIA 1MXOA 2JKGA 4MN7A 4P85A 2FZ0A 5U47A 4ESPA 1NYYA 3IXGA 5DJUA 1ZTUA 2QPNA 5EECA 1AXBA 3OOVA 5CGSA 4EBNA 2NUPC 1Z6FA 4MLLA 3IS2A 1Q2PA 4IBXA 2CC1A 3QNBA 2WGIA 4GJ4A 1X0OA 1HLUP 5DKKA 2ZD8A 1JWVA 5J3WA 1ZC2A 5FL3A 2Y8HA 4QPRA 2ZQDA 3EEHA 1NY0A 4NEED 3IHBA 3RXXA 3GSGA 1YLTA 2VEAA 2P7JA 2PYRA 2D01A 3TG9A 1TS8A 4JXVA 3MF0A 1ACFA 1SDEA 5EVIB 4LRXC 3AGDA 3BW6A 4GS9B 5HDDA 4S2NC 4NG2A 4IEDA 4NXGA 1EROA 4X6TA 3VE4A 1DP8A 2FFFB 3C7VA 1ES5A 5L2FA 2VGKA 4XUZA 3OZHA 4I38A 3E2KA 2WKHA 4YWZA 3WS5A 4HBTA 1ZKJA 3MKFA 3U2AA 3IS2B 4WZ5A 4N1XA 3O88A 4P87A 3PBSA 3OBFA 4BWIA 5HSQA 5TFQA 4QY6A 3KSHA 4QU3A 1S0WA 3L7HA 4GB7A 4S2KA 5KSCA 4OKPA 1L0FA 4MDZA 1JVJA 1K56A 4E6WA 1OTIA 5AQ9A 1PFLA 1K54C 1I2SA 3A3EA 2M7UA 5DTTA 4WBGA 1EW0A 2X01A 2J3TC 5EUAA 2QKPA 5DF8A 1NXYA 4JXGA 2PR6A 3GV9A 3LIAA 5DTSA 3T4QA 4WEKA 2G2UA 3OPRA 3UY6A 5JYOA 2PDRA 5KSHA 5HAPA 1CI8A 2Y55A 4NKPA 2XA7M 4N1HA 2Y79A 4OLDA 4Y5FA 1PW1A 3KO6A 1E3UD 2XD1A 3TE8A 1DRMA 2PT7A 3UN7A 3IX8A 3I7JA 3WS4A 2FH5A 3LFVA 3EWKA 4FH4A 4YNRA 3BJNA 2PU4A 2YKFA 1OJGA 4WL9A 2OV5A 5CXWA 1NWZA 2XEPA 1L3LA 4GZBA 3N7WA 5E43A 4E3IA 1JWPA 4RA7A 3MZEA 5E2EA 2WGWA 4P6ZM 4DN0A 4ID4A 1ZG6A 1SHVA 5A8BA 2B5RA 2A3UA 2VZWA 4NETA 1O7EA 4EEPA 2P04A 4OPYA 4R4RA 1GCEA 4PHTA 1BUEA 2Y2LA 4Q0IA 2HDRA 3RXWA 3MJQA 2PBYA 2Y2PA 2K2NA 1NZOA 5FASA 1LHYA 3C7UA 4OP5A 3CZDA 1K25A 2ZM2A 4B4ZA 1W63M 4EESA 3DBAA 5A93A 2JKRM 3E98A 1VETA 3HUMA 2PU2A 4U0XA 3VP3A 3N6IA 1M40A 5E2GA 3G31A 4UQIM 2XA7S 1LL9A 5FQKA 1Z09A 3H82A 4FD8A 4EETB 2V1AA 5FQMA 5HAQA 2ZC4B 1A0KA 2J3TD 3E4QA 2JBFA 1MPLA 4Y3IA 4M4XA 2Y2QA 4LGWA 2XQZA 3MMHA 2BLSA 3ISGA 5I94A 1YMSA 3HUNA 1OTDA 3B33A 2ZJ9A 4DXCA 4R3JA 3T4TA 2PBDP 1S67L 1YM1A 3VE3A 4DE1A 4R0QA 3MZDA 3IXDA 1IFQA 2VX8A 3W4PA 3AGEA 4EU0A 1VETB 4X69A 3PBNA 2ZL1B 4FUWA 5EE8A 3KX0X 5DTKA 1ODVA 1S4SA 2RCXA 3FPVA 3D9YA 4HOIA 4N92A 3BECA 4KZ8A 2XH9A 1O07A 5F68A 3QP8A 3H82B 5FAPA 4L9GA 4BL2A 2ZC3B 1YPRA 1UGUA 3UE0A 3ZQ5A 1N9LA 3ZG0A 3V3SA 5G4ZA 4X25A 1TS0A 4PKYA 3ZCZA 1SKOA 3N4IA 3BQ8A 1OT6A 1ALQA 5F1FA 4UQIS 4PM8A 4X56A 2HJEA 1TVFA 3QP1A 1H8YA 3LYXA 5FEGA 4II7A 3LR5A 1KGFA 2HGVA 5AVEA 4XT2A 2W0NA 2QJ7A 3IWIA 2W3HA 5CGXA 5DKLA 3HL9A 2I72A 3NDEA 4Y0UA 1MZUA 1VQQA 4Z1WA 2A24A 5L8MA 3WS0A 1MWRA 2MJ6A 1N9OA 3M2KA 3NULA 1IKIA 3JVUA 4X53A 3HCYA 3LIEA 5F69A 4MN5A 3NY4A 4KQRA 4OPZA 3K3DA 1YLZA 2EXBA 1FR1A 4I5SA 1SKOB 5KZHA 3R7WA 2ZM8A 4KG5A 3KSFA 4LENA 1RP5A 2GJ3A 3N8LA 4DE0A 1P97A 2XLNA 2ZC6B 3G2ZA 1E3UA 1XGJA 4NK3A 1CEFA 3RFBA 3VFHA 4C3QA 1FILA 1HTZA 2EX9A 2RL3A 3IF5A 1KE3A 2W1TA 2KX6A 3P98A 2JN7A 2L4RA 5FI6A 2Z2MB 2A24B 1ES3A 3E4PA 2V20A 4OPRA 3G6OA 2E8IA 1XA7A 3ZNYA 2OOLA 3CLOA 4OQ0A 3MFXA 5K5BA 2ZC7A 1WYBA 1ERQA 4WEJA 1W8QA 1N9NA 2Y2NA 3G32A 4CLCD 4EERA 3R7WB 4MBHA 3T4JA 4DXBA 3GQZA 1EI5A 4GNUA 3NI9A 3B47A 3VOYA 2ZMAA 3K3CA 4GD6A 2WK0A 2CMNA 3MQQA 4MNRA 3Q1FA 1P0ZA 3C4OA 3CUEA 4KQDA 2W1TB 3LIDA 3BY8A 4EUVA 1Y28A 5HWTA 3T1SA 2V8CA 4BBVA 2JCHA 4GLQA 4OOYA 2XFSA 3RTYA 2P08A 4E3JA 4WZ4A 4HIAA 2OAQ1 5AQBA 2WGVA 3BFCA 4QHCA 1L0EA 1SZVA 1OJ5A 2Q0OA 1GSWA 2LB5A 3MKEA 1XXMA 3BM6A 4EBLA 3PYPA 2JE5A 4JXSA 2INWA 4RYEA 2W27A 4HJ3A 5HFOA 3TSGA 4E3KA 1G68A 1IEMA 3NDGA 1BLHA 4LV2A 3HLEA 3KSGA 1CF0A 4BLMA 1K6RA 1YLWA 1MWTA 5DF9A 4B9OA 2VKSA 3FZCA 4Y15A 3PBOA 2IA2A 4S2PA 4BENA 1HZOA 2H0TA 4HY8A 3IBRA 5EM0A 4ZJ2A 1FCOA 3SW1A 3F1OA 1LLBA 4FCFA 4ETZA 2P74A 1K55A 5HAIA 2V8FA 1RGYA 2WKRA 3EQUA 3WWXA 3A0SA 2XR0A 4Q0HA 2H28A 4H6JA 3PTEA 1T18A 4HQAA 4MBFA 4DDSA 2OSUA 1PIOA 3DW0A 3KYQA 5CEBA 1S6RA 4IUKA 1E25A 1BULA 3O86A 4UHUA 4L9EA 4KZ5A 2VA0A 3L9KA 5FEFA 5DFXA 3LUQA 5GLCA 3PAEA 2YKHA 1EWZA 5DVAA 3V5MA 3IF6A 5EVLA 4G3WA 3UB6A 1WE4A 4R70A 2OWHA 3MS6A 3S7PA 4MMNA 5LBRA 1CEGA 2ZQ7A 3T1XA 4WMCD 4GOGA 1ES2A 5FQ9A 3MQOA 3A0RA 3PBTA 4FSFA 2O9CA 2GNXA 3CI6A 2ZOIA 5GLBA 2R78A 2QWSA 2A2LA 3NHQA 3UPOA 5J8XA 3F1OB 3ICYA 4YOFA 3ZG5A 1YAXA 4BQMA 1FCNA 1VM1A 1NLZA 3LR4A 3MXSA 1K4FA 2Y2KA 3WS1A 2PRFA 4OOMA 4UA6A 1OTBA 4UA9A 5CX7A 1LI0A 1XJ3A 1HVBA 3CITA 5GLDA 2EX8A 3IF6B 4G3VA 3T4KA 5HARA 2HZ5A 3PR6A 1H0MA 4B88A 1XFQA 3SH8A 3HLBA 2PD8A 5EFWA 5L10A 1V9ZA 5TJJA 1KVLA 2ZMVA 5EVEA 1G5UA 5FATA 4ZDXA 1YQSA 3FPWA 5M1AA 3HUOA 1L0DA 4PM7A 1D7EA 1VEUA 2ZQ9A 1JWZA 2BASA 3G34A 3R4KA 5G18A 2WZXA 3ZG8B 3A3JA 4N9LA 3A3IA 3SS4A 4CLCA 5AVFA 4WF0A 2VV6A 3EGXC 4OH0A 1OPXA 3UB8A 1GSXA 2R9WA 3GDIA 4MCWA 2JKTM 3GECA 3B3XA 4R3AA 3V39A 3ZYTA 3GMWA 3P7NA 4WUJA 1JTDA 3FG8A 3MSHA 4GHIA 2B18A 1DJAA 4GDNA 3S7QA 1RGZA 2Y59A 1PWGA 1CI9A 4M3KA 2V0UA 1STZA 3LICA 2PYPA 1NRFA 2FFYA 3V67A 2XSSA 1S1YA 3Q07A 1S66L 3EQVA 1XFNA 4L9FA 1VEUB 3N8RA 5FI7A 5EVIC 3LEQA 3B42A 4BBTA 4EEUA 1SDNA 4CLCB 3QP2A 4U0TA 4KENB 3WRTA 4X1LA 1ONGA 4Z9QA 4CQHA 1HD8A 1CJFA 3FC7A 3Q7VA 4L0LA 4C6YA 4KZ6A 3LI9A 3IHAA 1H3QA 3C30A 3DTEA 1ESIA 1UWPX 2WKEA 3H7WA 4KUKA 3UB9A 3N8SA 3NECA 1KE4A 4QJGA 4GHIB 1OMEA 2JC7A 3KSIA 3FKVA 2VV8A 2PR5A 4PPRA 5HX9A 4HH2A 2ZC5B 1DJCA 4K91A 2WGWB 1H5XA 3Q81A 1JTGA 3DWZA 1S4RA 1PYYA 2M7VA 5HL6A 4HBUA 2Y2MA 4KZ4A 4GW9A 1GHMA 2D02A 4JPMA 5FQIA 3BRMA 1FSYA 3NBLA 5A91A 2IWCA 3QHYA 5E2FA 4K0XA 4JF5A 3VP2A 3E2LA 2C5WB 4I3IA 5A92A 4P6ZS 4KZAA 1GHPA 3Q7VB 1H8MA 1YSQA 1ONHA 5HPFA 3U4LP 4WZ5C
chains in the Genus database with same CATH topology
2ZLYA 4OQIA 3IWOA 2HP6A 2V20A 4E3MA 5HW3A 3PBRA 4P85A 4OPRA 4WMCA 1NYMA 2E8IA 5U47A 2XD5A 3HLWA 1NYYA 3IXGA 1XA7A 3ZNYA 2QPNA 4OQ0A 5EECA 3UE3A 1AXBA 5CGSA 1PI4A 2ZC7A 1WYBA 4EBNA 3FKWA 1Z6FA 3HBRA 1ERQA 4MLLA 1Q2PA 4WEJA 1W8QA 2CC1A 3HREA 4IBXA 2Y91A 3QNBA 5FQJA 1I5QA 2Y2NA 3G32A 3OPPA 3DTMA 2WGIA 5GL9A 3ZG7B 2ZD8A 4MEZA 3SS5A 5KMWA 4MBHA 1JWVA 2H10A 4DXBA 3GQZA 1EI5A 4WYYA 1GA9A 4GNUA 4P6BA 1XX2A 3NI9A 1ZC2A 5FAOA 3BEBA 3VOYA 3ZHHA 2ZMAA 5F82A 4ZTKA 3LCEA 1YLJA 2ZQDA 4Y0OA 3TOIA 1XPBA 1K57C 1NY0A 2P9VA 4GD6A 3IHBA 1BTLA 1K6SA 1ERMA 2WK0A 3RXXA 5BOHA 3GSGA 5GLAA 1YLTA 4MNRA 3TG9A 3BFEA 4JBFA 3Q1FA 1IELA 3M6BA 4JXVA 5CTNA 3IT9A 2WZZA 1K55C 2WAEA 3C4OA 3C5AA 5CHJA 1SDEA 1FOFA 3IQAA 2ZQCA 5EVIB 3AGDA 4OONA 3A3FA 5E2HA 4DE2A 2JCHA 4S2NC 4OOYA 1KGGA 2XFSA 4IEDA 3FWLA 2HPBA 4R23A 1EROA 4X6TA 4R3BA 4E3JA 4WZ4A 5HL1A 4UA7A 5AQBA 2WGVA 2GDNA 3ZVWA 1TDLA 2FFFB 3BFCA 4QB8A 4ZJ3A 3C7VA 1ES5A 3VMAA 5L2FA 1W8YA 2J7VA 4KG2A 4QHCA 2VGKA 3ZVTA 1L0EA 2V1ZA 3OZHA 4XUZA 3CMZA 3MFDA 3E2KA 2WKHA 3MKEA 1BLPA 4IVKA 3WS5A 1MBLA 4HBTA 1ZKJA 4GDBA 3IF6C 3MKFA 5AQAA 1PWCA 4DKIA 4WZ5A 3BFFA 4R4SA 4PMAA 4E3OA 1XXMA 3BM6A 3O88A 2A49A 4N1XA 4P87A 4YFMA 4EBLA 1BLSA 2OLUA 1NJ4A 3PBSA 2ZQ8A 2JE5A 4PM5A 4JXSA 5GHZA 1QMEA 5TFQA 2EX6A 5CEDA 2X02A 4RYEA 4WELA 2QMIA 5EPHA 4QY6A 4B4XA 5HFOA 3VOZA 4QU3A 3TSGA 1S0WA 3BFGA 4GB7A 4E3KA 1KE0A 1G68A 1IEMA 2H5SA 3CJMA 4IBRA 4S2KA 1XA1A 3V3RA 3NDGA 1BLHA 1PZOA 4LV2A 5KSCA 3HLEA 4OKPA 1FR6A 1TEMA 3S4XA 2P9VB 1IYSA 4BLMA 1K6RA 4D2OA 1QMFA 1L0FA 1MWTA 1YLWA 2WAFA 4JXWA 4Y0TA 1JVJA 1W79A 5DF9A 3FZCA 2Y2HA 1K56A 4E6WA 3PBOA 5AQ9A 1K54C 1I2SA 1NZUA 3A3EA 5DTTA 5TR7A 4S2PA 4BENA 1HZOA 4WBGA 4U3TA 2X01A 2H0TA 4QY5A 4GKUA 5EUAA 1L0GA 3UPNA 5DF8A 4N9KA 3G4PA 1XKZA 3ITBA 1NXYA 4ZJ2A 1W7FA 3HLDA 4OPQA 4JXGA 1FCOA 1H8ZA 3GV9A 3UO9A 1LLBA 4FH2A 4FCFA 4JKTA 5DTSA 4WEKA 1MWUA 4EWFA 5AQ7A 2G2UA 2P74A 1K55A 1Q2QA 2DNSA 3OPRA 5HAIA 3UY6A 1RGYA 3EQUA 3WWXA 5GHXA 2XR0A 2EXAA 1MKIA 5JYOA 1M6KA 5KSHA 1ES4A 5HAPA 1CI8A 2Y55A 3D4FA 5JYPA 4N1HA 4S2NA 1CK3A 3PTEA 2IWBA 4MBFA 4DDSA 2OSUA 1PIOA 3DW0A 3QNCA 4OLDA 4H8RA 1PW1A 5CEBA 5CECA 4S2IA 1S6RA 3HLFA 1E3UD 2XD1A 1E25A 3UN7A 1BULA 5FAQA 1SCWA 3O86A 4UHUA 5FDHA 3I7JA 4KZ5A 4X55A 5EOEA 3WS4A 4JLFA 1DJBA 3UDIA 5GLCA 3PAEA 2Y2GA 4KZ7A 5DF7A 4FH4A 4LV3A 1EWZA 1KDSA 2EFUA 2PU4A 5DVAA 2OV5A 3V5MA 3IF6A 5EVID 1KDWA 5CXWA 2XEPA 5EVLA 1FCMA 4GZBA 1K38A 2H0YA 1FSWA 3N7WA 1N4OA 3ZDJA 3UPPA 1WE4A 2EX2A 3NCKA 3ZNTA 5E43A 4E3IA 1CEGA 1JWPA 2WYXA 2J9PA 2ZQ7A 4E6XA 4RA7A 4WMCD 3MZEA 5E2EA 1LI9A 2WGWA 1ES2A 4GOGA 4UAAA 4ID4A 1ZG6A 1SHVA 5FQ9A 2B5RA 2A3UA 3PBTA 4FSFA 5CGWA 3BYDA 4NETA 3G35A 5GLBA 4OQGA 2XFTA 4KQQA 3LY4A 1O7EA 2DCFA 3UPOA 3VP0A 5CHUA 1LL5A 5J8XA 1BT5A 4OPYA 4R4RA 1GCEA 4S2MA 3RJUA 1K54A 2QZ6A 4RVAA 4KZ3A 3VP4A 3BLSA 1BUEA 3ZG5A 2WADA 5EOOA 2Y2LA 1BLCA 3WS2A 1TDGA 5F1GA 2HDRA 4BQMA 1FCNA 1VM1A 3RXWA 3S22A 2PBYA 2Y2PA 4CPKA 1NZOA 3BLMA 5FASA 3MXSA 1K4FA 1LHYA 2Y2KA 3C7UA 4OP5A 3CZDA 1KVMA 4Y7PA 3WS1A 4GN2A 1K25A 2ZM2A 3VFFA 5GHYA 4B4ZA 4OOMA 3JYIA 1ESUA 5A93A 4UA6A 4UA9A 4ZAMA 2IWDA 2XK1A 3LO7A 2HP9A 1LI0A 3S1YA 3HUMA 4LV0A 1HVBA 4IVIA 2PU2A 4U0XA 4Q8IA 4DDYA 3VP3A 3ITAA 3N6IA 1M40A 1YT4A 5GLDA 3W4OA 5E2GA 2EX8A 2XF3A 4MBKA 3IF6B 2UWXA 4DRTA 3G31A 3IWQA 4HEFA 3SS3A 2Z2LB 3M2JA 1LL9A 4YINA 4JF4A 2Y2OA 2Y2JA 3OCLA 3ZGAB 3IH9A 5HARA 5FQKA 3NC8A 1N9BA 2Q9NA 3W4QA 4B88A 3SH8A 3HLBA 4FD8A 3O87A 4EV4A 5FQMA 5HAQA 2ZC4B 4LV1A 4BJPA 2XDMA 1KVLA 2OLVA 5M19A 2JBFA 1IYOA 5FSRA 5FATA 4PM6A 1MPLA 4ZDXA 3C4PA 1YQSA 2Y2QA 5M1AA 3HUOA 3IXBA 2C6WB 5IHVA 3MBZA 2XQZA 2BLSA 3ISGA 1L0DA 5CERA 5I94A 1YMSA 3HUNA 4PM7A 4S2OA 1XGIA 2Q9MA 2ZQ9A 1JWZA 5CHMA 5FA7A 1YLPA 2EFXA 3G34A 3Q7ZA 5G18A 4C75A 4E3LA 2ZJ9A 4DXCA 2WZXA 3V50A 4R3JA 3ZG8B 1GHIA 3A3JA 4N9LA 3A3IA 1YM1A 3SS4A 4DF6A 3OPHA 4DE1A 3FV7A 1U60A 1Y54A 3M6HA 3BFDA 4RX3A 4S2JA 4R0QA 3MZDA 1MY8A 1MWSA 4OH0A 3IXDA 1DY6A 1BZAA 2R9WA 1K4EA 3W4PA 3AGEA 4ZJ1A 1K56D 4X69A 3PBNA 4CJNA 2J8YA 3FYZA 3B3XA 3V39A 5EE8A 3GMWA 1JTDA 5DTKA 2RCXA 3AGFA 5FQQA 4OQHA 1IYPA 2G2WA 4N92A 3BECA 4KZ8A 3ZG9B 4LCMA 1IYQA 1DJAA 2XH9A 1O07A 4GDNA 1RGZA 5FAPA 5A90A 4EBPA 2Y59A 1PWGA 4BL2A 1CI9A 2ZC3B 3LEZA 1WYCA 4XUXA 3SOIA 3IXHA 4M3KA 2BG1A 2HDUA 5FI2A 3OC2A 3UE0A 1NRFA 1XP4A 3ZG0A 4OVDA 2FFYA 4KZBA 3V3SA 3ZCZA 3MXRA 3N4IA 1RCJA 3Q07A 3G2YA 1GA0A 1ALQA 3EQVA 5TGFA 3PBQA 4KQOA 5F1FA 1IKGA 4PM8A 4XXRA 2DRWA 4GD8A 4X56A 1PWDA 3CG5A 3N8RA 5FI7A 1TVFA 1H8YA 3GRJA 2VGJA 5M18A 5EVIC 3UDXA 4LCLA 3UNWA 4RX2A 1E4DA 1SDNA 2Y2IA 2Y4AA 1KGFA 1KGEA 3LY3A 2R9XA 4U0TA 4KENB 4OOLA 3WRTA 4BD0A 3IWIA 1ONGA 4ZBEA 4DE3A 4E3NA 2ZM0A 5CGXA 3VSKA 2XGNA 3HL9A 3GR2A 2I72A 4QD4A 3NDEA 2HDQA 4Y0UA 4Z9QA 1HD8A 4L0LA 3Q7VA 4C6YA 1PW8A 1VQQA 2J9OA 2ZQAA 3MZFA 3ZFZA 5D3OA 1YMXA 4KZ6A 1BSGA 1PZPA 4JF6A 3WS0A 3DWKA 1MWRA 3IHAA 4O7DA 3VP1A 3M2KA 1I2WA 3GTCA 1IKIA 1ESIA 4BD1A 2WKEA 4X53A 3HVFA 3N8SA 1KE4A 3NIAA 1FQGA 4QJGA 4OP8A 4WM9A 1OMEA 2JC7A 2WUQA 4A5RA 3FKVA 4BL3A 1ZG4A 3P09A 1W5DA 4F94A 3NY4A 4PPRA 4KQRA 5HX9A 5F83A 4OPZA 2ZC5B 1YLZA 2EXBA 1DJCA 1FR1A 4K91A 2WGWB 1H5XA 3OCNA 3Q81A 4EUZA 3IH8A 5KZHA 2ZM8A 4KG5A 1JTGA 3SH9A 3DWZA 3PAGA 4LENA 1G6AA 3VSLA 1PYYA 1J9MA 4HBUA 1C3BA 2Y2MA 4KZ9A 1RP5A 4KZ4A 1GHMA 3N8LA 4JPMA 5FQIA 3UE1A 4DE0A 4X68A 3BRMA 3O3VA 1FSYA 2XLNA 3NBLA 4EQIA 1L2SA 5A91A 3A3DA 3OPLA 2ZC6B 2IWCA 3QHYA 4PM9A 3W8KA 5E2FA 4K0XA 3Q82A 3G2ZA 3WRZA 1E3UA 1XGJA 4NK3A 2HDSA 3HLGA 4JF5A 1CEFA 3VP2A 3E2LA 2HP5A 4S2LA 2C5WB 3VFHA 4C3QA 4P0MA 2V2FF 1YLYA 5A92A 4OLGA 3UDFA 1PI5A 2RL3A 1HTZA 2EX9A 3IF5A 3SH7A 4HESA 1KE3A 2X71A 4R1GA 4K0WA 1K57A 3HLCA 5CTMA 4KZAA 5EVIA 3G30A 1GHPA 3P98A 3Q7VB 1ONHA 4KG6A 5FI6A 2Z2MB 3GVBA 1SKFA 5CRFA 1MXOA 2WKIA 1ES3A 4WZ5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZLY A;  4OQI A;  3IWO A;  2HP6 A;  2V20 A;  4E3M A;  5HW3 A;  3PBR A;  4P85 A;  4OPR A;  4WMC A;  1NYM A;  2E8I A;  5U47 A;  2XD5 A;  3HLW A;  1NYY A;  3IXG A;  1XA7 A;  3ZNY A;  2QPN A;  4OQ0 A;  5EEC A;  3UE3 A;  1AXB A;  5CGS A;  1PI4 A;  2ZC7 A;  1WYB A;  4EBN A;  3FKW A;  1Z6F A;  3HBR A;  1ERQ A;  4MLL A;  1Q2P A;  4WEJ A;  1W8Q A;  2CC1 A;  3HRE A;  4IBX A;  2Y91 A;  3QNB A;  5FQJ A;  1I5Q A;  2Y2N A;  3G32 A;  3OPP A;  3DTM A;  2WGI A;  5GL9 A;  3ZG7 B;  2ZD8 A;  4MEZ A;  3SS5 A;  5KMW A;  4MBH A;  1JWV A;  2H10 A;  4DXB A;  3GQZ A;  1EI5 A;  4WYY A;  1GA9 A;  4GNU A;  4P6B A;  1XX2 A;  3NI9 A;  1ZC2 A;  5FAO A;  3BEB A;  3VOY A;  3ZHH A;  2ZMA A;  5F82 A;  4ZTK A;  3LCE A;  1YLJ A;  2ZQD A;  4Y0O A;  3TOI A;  1XPB A;  1K57 C;  1NY0 A;  2P9V A;  4GD6 A;  3IHB A;  1BTL A;  1K6S A;  1ERM A;  2WK0 A;  3RXX A;  5BOH A;  3GSG A;  5GLA A;  1YLT A;  4MNR A;  3TG9 A;  3BFE A;  4JBF A;  3Q1F A;  1IEL A;  3M6B A;  4JXV A;  5CTN A;  3IT9 A;  2WZZ A;  1K55 C;  2WAE A;  3C4O A;  3C5A A;  5CHJ A;  1SDE A;  1FOF A;  3IQA A;  2ZQC A;  5EVI B;  3AGD A;  4OON A;  3A3F A;  5E2H A;  4DE2 A;  2JCH A;  4S2N C;  4OOY A;  1KGG A;  2XFS A;  4IED A;  3FWL A;  2HPB A;  4R23 A;  1ERO A;  4X6T A;  4R3B A;  4E3J A;  4WZ4 A;  5HL1 A;  4UA7 A;  5AQB A;  2WGV A;  2GDN A;  3ZVW A;  1TDL A;  2FFF B;  3BFC A;  4QB8 A;  4ZJ3 A;  3C7V A;  1ES5 A;  3VMA A;  5L2F A;  1W8Y A;  2J7V A;  4KG2 A;  4QHC A;  2VGK A;  3ZVT A;  1L0E A;  2V1Z A;  3OZH A;  4XUZ A;  3CMZ A;  3MFD A;  3E2K A;  2WKH A;  3MKE A;  1BLP A;  4IVK A;  3WS5 A;  1MBL A;  4HBT A;  1ZKJ A;  4GDB A;  3IF6 C;  3MKF A;  5AQA A;  1PWC A;  4DKI A;  4WZ5 A;  3BFF A;  4R4S A;  4PMA A;  4E3O A;  1XXM A;  3BM6 A;  3O88 A;  2A49 A;  4N1X A;  4P87 A;  4YFM A;  4EBL A;  1BLS A;  2OLU A;  1NJ4 A;  3PBS A;  2ZQ8 A;  2JE5 A;  4PM5 A;  4JXS A;  5GHZ A;  1QME A;  5TFQ A;  2EX6 A;  5CED A;  2X02 A;  4RYE A;  4WEL A;  2QMI A;  5EPH A;  4QY6 A;  4B4X A;  5HFO A;  3VOZ A;  4QU3 A;  3TSG A;  1S0W A;  3BFG A;  4GB7 A;  4E3K A;  1KE0 A;  1G68 A;  1IEM A;  2H5S A;  3CJM A;  4IBR A;  4S2K A;  1XA1 A;  3V3R A;  3NDG A;  1BLH A;  1PZO A;  4LV2 A;  5KSC A;  3HLE A;  4OKP A;  1FR6 A;  1TEM A;  3S4X A;  2P9V B;  1IYS A;  4BLM A;  1K6R A;  4D2O A;  1QMF A;  1L0F A;  1MWT A;  1YLW A;  2WAF A;  4JXW A;  4Y0T A;  1JVJ A;  1W79 A;  5DF9 A;  3FZC A;  2Y2H A;  1K56 A;  4E6W A;  3PBO A;  5AQ9 A;  1K54 C;  1I2S A;  1NZU A;  3A3E A;  5DTT A;  5TR7 A;  4S2P A;  4BEN A;  1HZO A;  4WBG A;  4U3T A;  2X01 A;  2H0T A;  4QY5 A;  4GKU A;  5EUA A;  1L0G A;  3UPN A;  5DF8 A;  4N9K A;  3G4P A;  1XKZ A;  3ITB A;  1NXY A;  4ZJ2 A;  1W7F A;  3HLD A;  4OPQ A;  4JXG A;  1FCO A;  1H8Z A;  3GV9 A;  3UO9 A;  1LLB A;  4FH2 A;  4FCF A;  4JKT A;  5DTS A;  4WEK A;  1MWU A;  4EWF A;  5AQ7 A;  2G2U A;  2P74 A;  1K55 A;  1Q2Q A;  2DNS A;  3OPR A;  5HAI A;  3UY6 A;  1RGY A;  3EQU A;  3WWX A;  5GHX A;  2XR0 A;  2EXA A;  1MKI A;  5JYO A;  1M6K A;  5KSH A;  1ES4 A;  5HAP A;  1CI8 A;  2Y55 A;  3D4F A;  5JYP A;  4N1H A;  4S2N A;  1CK3 A;  3PTE A;  2IWB A;  4MBF A;  4DDS A;  2OSU A;  1PIO A;  3DW0 A;  3QNC A;  4OLD A;  4H8R A;  1PW1 A;  5CEB A;  5CEC A;  4S2I A;  1S6R A;  3HLF A;  1E3U D;  2XD1 A;  1E25 A;  3UN7 A;  1BUL A;  5FAQ A;  1SCW A;  3O86 A;  4UHU A;  5FDH A;  3I7J A;  4KZ5 A;  4X55 A;  5EOE A;  3WS4 A;  4JLF A;  1DJB A;  3UDI A;  5GLC A;  3PAE A;  2Y2G A;  4KZ7 A;  5DF7 A;  4FH4 A;  4LV3 A;  1EWZ A;  1KDS A;  2EFU A;  2PU4 A;  5DVA A;  2OV5 A;  3V5M A;  3IF6 A;  5EVI D;  1KDW A;  5CXW A;  2XEP A;  5EVL A;  1FCM A;  4GZB A;  1K38 A;  2H0Y A;  1FSW A;  3N7W A;  1N4O A;  3ZDJ A;  3UPP A;  1WE4 A;  2EX2 A;  3NCK A;  3ZNT A;  5E43 A;  4E3I A;  1CEG A;  1JWP A;  2WYX A;  2J9P A;  2ZQ7 A;  4E6X A;  4RA7 A;  4WMC D;  3MZE A;  5E2E A;  1LI9 A;  2WGW A;  1ES2 A;  4GOG A;  4UAA A;  4ID4 A;  1ZG6 A;  1SHV A;  5FQ9 A;  2B5R A;  2A3U A;  3PBT A;  4FSF A;  5CGW A;  3BYD A;  4NET A;  3G35 A;  5GLB A;  4OQG A;  2XFT A;  4KQQ A;  3LY4 A;  1O7E A;  2DCF A;  3UPO A;  3VP0 A;  5CHU A;  1LL5 A;  5J8X A;  1BT5 A;  4OPY A;  4R4R A;  1GCE A;  4S2M A;  3RJU A;  1K54 A;  2QZ6 A;  4RVA A;  4KZ3 A;  3VP4 A;  3BLS A;  1BUE A;  3ZG5 A;  2WAD A;  5EOO A;  2Y2L A;  1BLC A;  3WS2 A;  1TDG A;  5F1G A;  2HDR A;  4BQM A;  1FCN A;  1VM1 A;  3RXW A;  3S22 A;  2PBY A;  2Y2P A;  4CPK A;  1NZO A;  3BLM A;  5FAS A;  3MXS A;  1K4F A;  1LHY A;  2Y2K A;  3C7U A;  4OP5 A;  3CZD A;  1KVM A;  4Y7P A;  3WS1 A;  4GN2 A;  1K25 A;  2ZM2 A;  3VFF A;  5GHY A;  4B4Z A;  4OOM A;  3JYI A;  1ESU A;  5A93 A;  4UA6 A;  4UA9 A;  4ZAM A;  2IWD A;  2XK1 A;  3LO7 A;  2HP9 A;  1LI0 A;  3S1Y A;  3HUM A;  4LV0 A;  1HVB A;  4IVI A;  2PU2 A;  4U0X A;  4Q8I A;  4DDY A;  3VP3 A;  3ITA A;  3N6I A;  1M40 A;  1YT4 A;  5GLD A;  3W4O A;  5E2G A;  2EX8 A;  2XF3 A;  4MBK A;  3IF6 B;  2UWX A;  4DRT A;  3G31 A;  3IWQ A;  4HEF A;  3SS3 A;  2Z2L B;  3M2J A;  1LL9 A;  4YIN A;  4JF4 A;  2Y2O A;  2Y2J A;  3OCL A;  3ZGA B;  3IH9 A;  5HAR A;  5FQK A;  3NC8 A;  1N9B A;  2Q9N A;  3W4Q A;  4B88 A;  3SH8 A;  3HLB A;  4FD8 A;  3O87 A;  4EV4 A;  5FQM A;  5HAQ A;  2ZC4 B;  4LV1 A;  4BJP A;  2XDM A;  1KVL A;  2OLV A;  5M19 A;  2JBF A;  1IYO A;  5FSR A;  5FAT A;  4PM6 A;  1MPL A;  4ZDX A;  3C4P A;  1YQS A;  2Y2Q A;  5M1A A;  3HUO A;  3IXB A;  2C6W B;  5IHV A;  3MBZ A;  2XQZ A;  2BLS A;  3ISG A;  1L0D A;  5CER A;  5I94 A;  1YMS A;  3HUN A;  4PM7 A;  4S2O A;  1XGI A;  2Q9M A;  2ZQ9 A;  1JWZ A;  5CHM A;  5FA7 A;  1YLP A;  2EFX A;  3G34 A;  3Q7Z A;  5G18 A;  4C75 A;  4E3L A;  2ZJ9 A;  4DXC A;  2WZX A;  3V50 A;  4R3J A;  3ZG8 B;  1GHI A;  3A3J A;  4N9L A;  3A3I A;  1YM1 A;  3SS4 A;  4DF6 A;  3OPH A;  4DE1 A;  3FV7 A;  1U60 A;  1Y54 A;  3M6H A;  3BFD A;  4RX3 A;  4S2J A;  4R0Q A;  3MZD A;  1MY8 A;  1MWS A;  4OH0 A;  3IXD A;  1DY6 A;  1BZA A;  2R9W A;  1K4E A;  3W4P A;  3AGE A;  4ZJ1 A;  1K56 D;  4X69 A;  3PBN A;  4CJN A;  2J8Y A;  3FYZ A;  3B3X A;  3V39 A;  5EE8 A;  3GMW A;  1JTD A;  5DTK A;  2RCX A;  3AGF A;  5FQQ A;  4OQH A;  1IYP A;  2G2W A;  4N92 A;  3BEC A;  4KZ8 A;  3ZG9 B;  4LCM A;  1IYQ A;  1DJA A;  2XH9 A;  1O07 A;  4GDN A;  1RGZ A;  5FAP A;  5A90 A;  4EBP A;  2Y59 A;  1PWG A;  4BL2 A;  1CI9 A;  2ZC3 B;  3LEZ A;  1WYC A;  4XUX A;  3SOI A;  3IXH A;  4M3K A;  2BG1 A;  2HDU A;  5FI2 A;  3OC2 A;  3UE0 A;  1NRF A;  1XP4 A;  3ZG0 A;  4OVD A;  2FFY A;  4KZB A;  3V3S A;  3ZCZ A;  3MXR A;  3N4I A;  1RCJ A;  3Q07 A;  3G2Y A;  1GA0 A;  1ALQ A;  3EQV A;  5TGF A;  3PBQ A;  4KQO A;  5F1F A;  1IKG A;  4PM8 A;  4XXR A;  2DRW A;  4GD8 A;  4X56 A;  1PWD A;  3CG5 A;  3N8R A;  5FI7 A;  1TVF A;  1H8Y A;  3GRJ A;  2VGJ A;  5M18 A;  5EVI C;  3UDX A;  4LCL A;  3UNW A;  4RX2 A;  1E4D A;  1SDN A;  2Y2I A;  2Y4A A;  1KGF A;  1KGE A;  3LY3 A;  2R9X A;  4U0T A;  4KEN B;  4OOL A;  3WRT A;  4BD0 A;  3IWI A;  1ONG A;  4ZBE A;  4DE3 A;  4E3N A;  2ZM0 A;  5CGX A;  3VSK A;  2XGN A;  3HL9 A;  3GR2 A;  2I72 A;  4QD4 A;  3NDE A;  2HDQ A;  4Y0U A;  4Z9Q A;  1HD8 A;  4L0L A;  3Q7V A;  4C6Y A;  1PW8 A;  1VQQ A;  2J9O A;  2ZQA A;  3MZF A;  3ZFZ A;  5D3O A;  1YMX A;  4KZ6 A;  1BSG A;  1PZP A;  4JF6 A;  3WS0 A;  3DWK A;  1MWR A;  3IHA A;  4O7D A;  3VP1 A;  3M2K A;  1I2W A;  3GTC A;  1IKI A;  1ESI A;  4BD1 A;  2WKE A;  4X53 A;  3HVF A;  3N8S A;  1KE4 A;  3NIA A;  1FQG A;  4QJG A;  4OP8 A;  4WM9 A;  1OME A;  2JC7 A;  2WUQ A;  4A5R A;  3FKV A;  4BL3 A;  1ZG4 A;  3P09 A;  1W5D A;  4F94 A;  3NY4 A;  4PPR A;  4KQR A;  5HX9 A;  5F83 A;  4OPZ A;  2ZC5 B;  1YLZ A;  2EXB A;  1DJC A;  1FR1 A;  4K91 A;  2WGW B;  1H5X A;  3OCN A;  3Q81 A;  4EUZ A;  3IH8 A;  5KZH A;  2ZM8 A;  4KG5 A;  1JTG A;  3SH9 A;  3DWZ A;  3PAG A;  4LEN A;  1G6A A;  3VSL A;  1PYY A;  1J9M A;  4HBU A;  1C3B A;  2Y2M A;  4KZ9 A;  1RP5 A;  4KZ4 A;  1GHM A;  3N8L A;  4JPM A;  5FQI A;  3UE1 A;  4DE0 A;  4X68 A;  3BRM A;  3O3V A;  1FSY A;  2XLN A;  3NBL A;  4EQI A;  1L2S A;  5A91 A;  3A3D A;  3OPL A;  2ZC6 B;  2IWC A;  3QHY A;  4PM9 A;  3W8K A;  5E2F A;  4K0X A;  3Q82 A;  3G2Z A;  3WRZ A;  1E3U A;  1XGJ A;  4NK3 A;  2HDS A;  3HLG A;  4JF5 A;  1CEF A;  3VP2 A;  3E2L A;  2HP5 A;  4S2L A;  2C5W B;  3VFH A;  4C3Q A;  4P0M A;  2V2F F;  1YLY A;  5A92 A;  4OLG A;  3UDF A;  1PI5 A;  2RL3 A;  1HTZ A;  2EX9 A;  3IF5 A;  3SH7 A;  4HES A;  1KE3 A;  2X71 A;  4R1G A;  4K0W A;  1K57 A;  3HLC A;  5CTM A;  4KZA A;  5EVI A;  3G30 A;  1GHP A;  3P98 A;  3Q7V B;  1ONH A;  4KG6 A;  5FI6 A;  2Z2M B;  3GVB A;  1SKF A;  5CRF A;  1MXO A;  2WKI A;  1ES3 A;  4WZ5 C; 
#chains in the Genus database with same CATH topology
 5IT5 A;  2HP6 A;  3H7W B;  4NXF A;  4E3M A;  5HW3 A;  3PBR A;  4WMC A;  3HLW A;  3H9W A;  1PI4 A;  4O8G A;  3HBR A;  2Y91 A;  3OPP A;  3DTM A;  1GSV A;  4MEZ A;  3SS5 A;  5KMW A;  4P6B A;  3BEB A;  3ZHH A;  5F82 A;  3LCE A;  1YLJ A;  4Y0O A;  1XPB A;  3LR0 A;  1WA9 A;  5L09 A;  2KLI A;  1K6S A;  5GLA A;  1F2K A;  4JBF A;  3IT9 A;  2WZZ A;  1FOF A;  2KOI A;  3A3F A;  5E2H A;  3F1P A;  3TJZ C;  2PAV P;  4MN6 A;  4QB8 A;  4ZJ3 A;  3VMA A;  3T1Q B;  4KG2 A;  3ZVT A;  2V1Z A;  3MFD A;  2WKP A;  4IVK A;  4GDB A;  5AQA A;  1PWC A;  4DKI A;  4R4S A;  4E3O A;  4YFM A;  3MXQ A;  2J3W A;  1BLS A;  2OLU A;  2ZQ8 A;  4PM5 A;  1TS7 A;  4WN5 A;  5GHZ A;  1QME A;  2EX6 A;  5HWW A;  2X02 A;  5MC7 A;  2VV7 A;  3VOZ A;  3BFG A;  3S7N A;  2H5S A;  4IBR A;  1XA1 A;  3V3R A;  2JKT I;  1PZO A;  3PHY A;  4BBU A;  3S4X A;  1FR6 A;  3LIF A;  1KOU A;  4JXW A;  2WAF A;  4Y0T A;  4XT2 B;  5TR7 A;  4R6L A;  2AVX A;  4QY5 A;  4GKU A;  4WLA A;  4N9K A;  3ITB A;  1W7F A;  3HLD A;  4OPQ A;  3F1P B;  3W2Z A;  3UO9 A;  4HP9 A;  1MWU A;  5AQ7 A;  1Q2Q A;  1OTE A;  2EXA A;  1LL8 A;  1M6K A;  3UMD A;  4S2N A;  3C38 A;  4EW7 A;  5HDC A;  2IWB A;  3QNC A;  2EWW A;  5CEC A;  4S2I A;  2EWV A;  3HLF A;  5HD5 A;  5FAQ A;  5F6A A;  1T1C A;  4X55 A;  2Y2G A;  4KZ7 A;  3T4L A;  4JGQ A;  1FSW A;  3UPP A;  2EX2 A;  4JGP A;  2V1B A;  3MR0 A;  2J80 A;  2K31 A;  3KYE A;  3LY4 A;  4KQQ A;  5CHU A;  1LL5 A;  3QP5 A;  5FDS A;  4S2M A;  4UEY A;  1K54 A;  2QZ6 A;  3RJU A;  4KZ3 A;  3S7O A;  2WAD A;  5EOO A;  1BLC A;  3WS2 A;  1TDG A;  2PHY A;  5F1G A;  2EA9 A;  3E0Y A;  5HZH A;  1W63 Q;  5HD3 A;  1Y4O A;  2M1C A;  4FOF A;  1KVM A;  4GN2 A;  3VFF A;  3JYI A;  1ESU A;  4ZAM A;  2PD7 A;  5HWV A;  2KDK A;  3LO7 A;  2HP9 A;  3DAV A;  4LV0 A;  2W1R A;  3ITA A;  1YT4 A;  3W4O A;  2XF3 A;  4MBK A;  4DRT A;  2UWX A;  1CQA A;  4F3L A;  2Z2L B;  3M2J A;  4YIN A;  4JF4 A;  3SZT A;  3ZGA B;  3IH9 A;  3CAX A;  3W4Q A;  5C5K A;  4EV4 A;  4LV1 A;  4BJP A;  2OLV A;  3LGO A;  2O99 A;  4HP4 A;  4DJ2 A;  3ULF A;  4NXB A;  4JGR A;  1OT9 A;  2C6W B;  2E8J A;  4ZRR A;  3MBZ A;  5IHV A;  1UWN X;  5EM1 A;  1NLY A;  5CER A;  4X1M A;  5CHM A;  1XGI A;  2Q9M A;  3TW8 A;  1YLP A;  3Q7Z A;  3UME A;  3CPT A;  4Y2F A;  3OPH A;  3FV7 A;  4RX3 A;  4S2J A;  1MY8 A;  1FIK A;  1BZA A;  3BY9 A;  2QHK A;  2QYB A;  2J8Y A;  3FYZ A;  4OQH A;  1IYP A;  4F3L B;  3ZG9 B;  3E4O A;  5J4E A;  5A90 A;  2B95 A;  3LEZ A;  1WYC A;  2VGL M;  4XUX A;  3IXH A;  4IHQ A;  2HDU A;  3A0V A;  1XP4 A;  4OVD A;  5IS1 A;  3MXR A;  2ZMF A;  1RCJ A;  4GCZ A;  1AWI A;  1GA0 A;  4KQO A;  3GRJ A;  2VGJ A;  3CPT B;  5M18 A;  3CWF A;  5KIZ A;  4LCL A;  3UNW A;  5G4Y A;  4BMW A;  3LY3 A;  4Q0J A;  4OOL A;  4K08 A;  4ZBE A;  4H6J B;  3NJA A;  3VSK A;  2XGN A;  2HDQ A;  4D60 A;  5I5L A;  1PW8 A;  3MZF A;  3ZFZ A;  1YMX A;  2HV1 A;  4JF6 A;  3DWK A;  4O7D A;  3VP1 A;  3NIA A;  2JKF A;  2WUQ A;  4A5R A;  3P09 A;  1W5D A;  2OAP 1;  3HJI A;  4F94 A;  3IX3 A;  5F83 A;  1S1Z A;  1XJ4 A;  3OCN A;  4EUZ A;  3PAG A;  3VSL A;  1C3B A;  4Y13 A;  1T1B A;  3CUE C;  3UE1 A;  4X68 A;  1L2S A;  2XRN A;  3W8K A;  2K7S A;  1LSV A;  2VGL S;  3HLG A;  4PAU A;  4S2L A;  4P0M A;  2VK3 A;  4I3J A;  2V2F F;  2VJW A;  4OLG A;  4EXO A;  2X71 A;  4LLO B;  3HLC A;  5CTM A;  1K0K A;  1F9I A;  4RQ9 A;  5CRF A;  4LPZ A;  2WKI A;  4R23 A;  4R38 A;  1PNE A;  2ZLY A;  4OQI A;  3IWO A;  2W3G A;  4FTX A;  1NYM A;  3BQA A;  2XD5 A;  1YSP A;  1T1A A;  3UE3 A;  3UB7 A;  3FKW A;  2W3F A;  5DFY A;  3HJK A;  5FQJ A;  3HRE A;  2V9A A;  1I5Q A;  5GL9 A;  3ZG7 B;  1ZHH B;  2H10 A;  4WYY A;  1GA9 A;  1XX2 A;  5FAO A;  3T4S A;  3VV4 A;  4ZTK A;  2QJ5 A;  3TOI A;  1P9R A;  1K57 C;  3LI8 A;  2P9V A;  1BTL A;  1ERM A;  5BOH A;  4ME4 A;  3BFE A;  1IEL A;  3M6B A;  5CTN A;  2O0Y A;  1K55 C;  2WAE A;  3C5A A;  5CHJ A;  3IQA A;  2ZQC A;  4OON A;  3O5Y A;  4DE2 A;  1KGG A;  3FWL A;  3DTI A;  2HPB A;  4R3B A;  5HL1 A;  2V0W A;  4UA7 A;  2GDN A;  3ZVW A;  1TDL A;  2JHE A;  1W8Y A;  2J7V A;  3EOI A;  2I9V A;  4CLC E;  3CMZ A;  4I39 A;  1BLP A;  4LRY C;  2ACG A;  1MBL A;  3IF6 C;  3BFF A;  4PMA A;  2A49 A;  3F1N A;  3VOL A;  1NJ4 A;  5AJG A;  1MC0 A;  5CED A;  2ZL1 A;  5EPH A;  4WEL A;  2QMI A;  4B4X A;  4JGO A;  1BYW A;  1NRJ A;  4DJ3 A;  3JVV A;  1KE0 A;  3CJM A;  1DP6 A;  1TEM A;  1IYS A;  2P9V B;  4I3A A;  4D2O A;  1QMF A;  2O9A A;  2BTF P;  1W79 A;  2Y2H A;  3JPU A;  1NZU A;  2GZA A;  3D72 A;  4U3T A;  4LRZ E;  1L0G A;  4HNB A;  3UPN A;  3G4P A;  1XKZ A;  2W3D A;  4B93 A;  1H8Z A;  2O9B A;  3D3O A;  4FH2 A;  4JKT A;  4EWF A;  2DNS A;  5GHX A;  3BWL A;  1MKI A;  1ES4 A;  3DTK A;  3PXP A;  3D4F A;  5JYP A;  1CK3 A;  4H8R A;  1YKD A;  1TD5 A;  3F1N B;  1SCW A;  5FDH A;  3T50 A;  5EOE A;  4JLF A;  1DJB A;  3UDI A;  5DF7 A;  4LV3 A;  1KDS A;  2EFU A;  3LR3 A;  5EVI D;  1G6O A;  1KDW A;  2HF6 A;  1FCM A;  3QP4 A;  1K38 A;  2H0Y A;  1N4O A;  2B02 A;  3ZDJ A;  2VLG A;  5J7E A;  4HHD A;  1VHM A;  3NCK A;  4NXE A;  3ZNT A;  4ARZ A;  2WYX A;  2J9P A;  5EV0 A;  1DP9 A;  4E6X A;  1IOU A;  1LI9 A;  1LT0 A;  4UAA A;  1OTA A;  1LSX A;  3CHW P;  4CLC C;  5CGW A;  2LB9 A;  3BYD A;  3LIB A;  3G35 A;  4OQG A;  5HPI A;  2XFT A;  3UE6 A;  2DCF A;  2Z6C A;  3NOT C;  3EGD C;  3VP0 A;  1BT5 A;  4RVA A;  4HH3 A;  3VP4 A;  3BLS A;  1F98 A;  3S22 A;  4CPK A;  3BLM A;  2XRO A;  3TRC A;  3T1R A;  3T12 B;  4Y7P A;  2GX5 A;  5GHY A;  2IWD A;  2XK1 A;  4EQ1 A;  1XJ2 A;  3RH8 B;  3S1Y A;  3T4O A;  4IVI A;  4Q8I A;  3IBJ A;  4DDY A;  1TS6 A;  1J3W A;  1PRQ A;  3IWQ A;  4HEF A;  2OWJ A;  3SS3 A;  4E04 A;  2Y2O A;  2Y2J A;  3OCL A;  3NC8 A;  1N9B A;  2Q9N A;  3C8C A;  4ARZ B;  3O87 A;  2L1M A;  2XDM A;  2WKQ A;  5M19 A;  1IYO A;  5FSR A;  4PM6 A;  4HI4 A;  3C4P A;  3EEA A;  1D06 A;  3IXB A;  3QP6 A;  2W3E A;  4S2O A;  5FA7 A;  4C75 A;  4E3L A;  2EFX A;  3V50 A;  1GHI A;  4DF6 A;  1JNU A;  1U60 A;  1Y54 A;  1LSW A;  3M6H A;  3BFD A;  1V9Y A;  1MWS A;  1DY6 A;  4O01 A;  1K4E A;  2NUT C;  4ZJ1 A;  1K56 D;  4HJ6 A;  4LFU A;  4CJN A;  2ZBB A;  3IX4 A;  5L07 A;  2Z6D A;  3AGF A;  3C2W A;  5FQQ A;  2G2W A;  4LCM A;  1IYQ A;  4HJ4 A;  4EBP A;  3SOI A;  1VB6 A;  2BG1 A;  3MQ0 A;  5FI2 A;  3OC2 A;  4KZB A;  2DMW A;  4O0P A;  5TBM A;  3G2Y A;  2JKR I;  5TGF A;  3PBQ A;  4XXR A;  1IKG A;  2DRW A;  4GD8 A;  1PWD A;  3CG5 A;  2ZOH A;  3UDX A;  4RX2 A;  1E4D A;  2Y2I A;  2Y4A A;  1KGE A;  2R9X A;  3P01 A;  2UV0 E;  4BD0 A;  4E3N A;  4DE3 A;  2ZM0 A;  1D1J A;  5HDS A;  3GR2 A;  4QD4 A;  1P9W A;  3KYZ A;  2J9O A;  2ZQA A;  4ETX A;  5D3O A;  1BSG A;  1PZP A;  1I2W A;  3GTC A;  4BD1 A;  1TF1 A;  3HVF A;  4G3K A;  1FQG A;  1T19 A;  4OP8 A;  4WM9 A;  3UB5 P;  1F5M A;  4BL3 A;  1XJ6 A;  1ZG4 A;  2L0W A;  4QWO A;  3IH8 A;  3SH9 A;  1G6A A;  5TBM B;  5IU1 A;  1J9M A;  3K2N A;  4KZ9 A;  4KUO A;  1MKM A;  4EQI A;  3O3V A;  4IJG A;  3A3D A;  3OPL A;  1G28 A;  4PM9 A;  4PKY G;  3Q82 A;  3WRZ A;  2HDS A;  5DJT A;  2HP5 A;  3NOU C;  4IUH A;  4Y17 A;  3NOP C;  1YLY A;  3UDF A;  5F5Y A;  1PI5 A;  3SH7 A;  4HES A;  4R1G A;  4K0W A;  1K57 A;  2HJ9 C;  5EVI A;  3G30 A;  3OLO A;  4GS9 A;  4KG6 A;  2G7U A;  4DMZ A;  3GVB A;  1SKF A;  4AFI A;  1MXO A;  2JKG A;  4MN7 A;  4P85 A;  2FZ0 A;  5U47 A;  4ESP A;  1NYY A;  3IXG A;  5DJU A;  1ZTU A;  2QPN A;  5EEC A;  1AXB A;  3OOV A;  5CGS A;  4EBN A;  2NUP C;  1Z6F A;  4MLL A;  3IS2 A;  1Q2P A;  4IBX A;  2CC1 A;  3QNB A;  2WGI A;  4GJ4 A;  1X0O A;  1HLU P;  5DKK A;  2ZD8 A;  1JWV A;  5J3W A;  1ZC2 A;  5FL3 A;  2Y8H A;  4QPR A;  2ZQD A;  3EEH A;  1NY0 A;  4NEE D;  3IHB A;  3RXX A;  3GSG A;  1YLT A;  2VEA A;  2P7J A;  2PYR A;  2D01 A;  3TG9 A;  1TS8 A;  4JXV A;  3MF0 A;  1ACF A;  1SDE A;  5EVI B;  4LRX C;  3AGD A;  3BW6 A;  4GS9 B;  5HDD A;  4S2N C;  4NG2 A;  4IED A;  4NXG A;  1ERO A;  4X6T A;  3VE4 A;  1DP8 A;  2FFF B;  3C7V A;  1ES5 A;  5L2F A;  2VGK A;  4XUZ A;  3OZH A;  4I38 A;  3E2K A;  2WKH A;  4YWZ A;  3WS5 A;  4HBT A;  1ZKJ A;  3MKF A;  3U2A A;  3IS2 B;  4WZ5 A;  4N1X A;  3O88 A;  4P87 A;  3PBS A;  3OBF A;  4BWI A;  5HSQ A;  5TFQ A;  4QY6 A;  3KSH A;  4QU3 A;  1S0W A;  3L7H A;  4GB7 A;  4S2K A;  5KSC A;  4OKP A;  1L0F A;  4MDZ A;  1JVJ A;  1K56 A;  4E6W A;  1OTI A;  5AQ9 A;  1PFL A;  1K54 C;  1I2S A;  3A3E A;  2M7U A;  5DTT A;  4WBG A;  1EW0 A;  2X01 A;  2J3T C;  5EUA A;  2QKP A;  5DF8 A;  1NXY A;  4JXG A;  2PR6 A;  3GV9 A;  3LIA A;  5DTS A;  3T4Q A;  4WEK A;  2G2U A;  3OPR A;  3UY6 A;  5JYO A;  2PDR A;  5KSH A;  5HAP A;  1CI8 A;  2Y55 A;  4NKP A;  2XA7 M;  4N1H A;  2Y79 A;  4OLD A;  4Y5F A;  1PW1 A;  3KO6 A;  1E3U D;  2XD1 A;  3TE8 A;  1DRM A;  2PT7 A;  3UN7 A;  3IX8 A;  3I7J A;  3WS4 A;  2FH5 A;  3LFV A;  3EWK A;  4FH4 A;  4YNR A;  3BJN A;  2PU4 A;  2YKF A;  1OJG A;  4WL9 A;  2OV5 A;  5CXW A;  1NWZ A;  2XEP A;  1L3L A;  4GZB A;  3N7W A;  5E43 A;  4E3I A;  1JWP A;  4RA7 A;  3MZE A;  5E2E A;  2WGW A;  4P6Z M;  4DN0 A;  4ID4 A;  1ZG6 A;  1SHV A;  5A8B A;  2B5R A;  2A3U A;  2VZW A;  4NET A;  1O7E A;  4EEP A;  2P04 A;  4OPY A;  4R4R A;  1GCE A;  4PHT A;  1BUE A;  2Y2L A;  4Q0I A;  2HDR A;  3RXW A;  3MJQ A;  2PBY A;  2Y2P A;  2K2N A;  1NZO A;  5FAS A;  1LHY A;  3C7U A;  4OP5 A;  3CZD A;  1K25 A;  2ZM2 A;  4B4Z A;  1W63 M;  4EES A;  3DBA A;  5A93 A;  2JKR M;  3E98 A;  1VET A;  3HUM A;  2PU2 A;  4U0X A;  3VP3 A;  3N6I A;  1M40 A;  5E2G A;  3G31 A;  4UQI M;  2XA7 S;  1LL9 A;  5FQK A;  1Z09 A;  3H82 A;  4FD8 A;  4EET B;  2V1A A;  5FQM A;  5HAQ A;  2ZC4 B;  1A0K A;  2J3T D;  3E4Q A;  2JBF A;  1MPL A;  4Y3I A;  4M4X A;  2Y2Q A;  4LGW A;  2XQZ A;  3MMH A;  2BLS A;  3ISG A;  5I94 A;  1YMS A;  3HUN A;  1OTD A;  3B33 A;  2ZJ9 A;  4DXC A;  4R3J A;  3T4T A;  2PBD P;  1S67 L;  1YM1 A;  3VE3 A;  4DE1 A;  4R0Q A;  3MZD A;  3IXD A;  1IFQ A;  2VX8 A;  3W4P A;  3AGE A;  4EU0 A;  1VET B;  4X69 A;  3PBN A;  2ZL1 B;  4FUW A;  5EE8 A;  3KX0 X;  5DTK A;  1ODV A;  1S4S A;  2RCX A;  3FPV A;  3D9Y A;  4HOI A;  4N92 A;  3BEC A;  4KZ8 A;  2XH9 A;  1O07 A;  5F68 A;  3QP8 A;  3H82 B;  5FAP A;  4L9G A;  4BL2 A;  2ZC3 B;  1YPR A;  1UGU A;  3UE0 A;  3ZQ5 A;  1N9L A;  3ZG0 A;  3V3S A;  5G4Z A;  4X25 A;  1TS0 A;  4PKY A;  3ZCZ A;  1SKO A;  3N4I A;  3BQ8 A;  1OT6 A;  1ALQ A;  5F1F A;  4UQI S;  4PM8 A;  4X56 A;  2HJE A;  1TVF A;  3QP1 A;  1H8Y A;  3LYX A;  5FEG A;  4II7 A;  3LR5 A;  1KGF A;  2HGV A;  5AVE A;  4XT2 A;  2W0N A;  2QJ7 A;  3IWI A;  2W3H A;  5CGX A;  5DKL A;  3HL9 A;  2I72 A;  3NDE A;  4Y0U A;  1MZU A;  1VQQ A;  4Z1W A;  2A24 A;  5L8M A;  3WS0 A;  1MWR A;  2MJ6 A;  1N9O A;  3M2K A;  3NUL A;  1IKI A;  3JVU A;  4X53 A;  3HCY A;  3LIE A;  5F69 A;  4MN5 A;  3NY4 A;  4KQR A;  4OPZ A;  3K3D A;  1YLZ A;  2EXB A;  1FR1 A;  4I5S A;  1SKO B;  5KZH A;  3R7W A;  2ZM8 A;  4KG5 A;  3KSF A;  4LEN A;  1RP5 A;  2GJ3 A;  3N8L A;  4DE0 A;  1P97 A;  2XLN A;  2ZC6 B;  3G2Z A;  1E3U A;  1XGJ A;  4NK3 A;  1CEF A;  3RFB A;  3VFH A;  4C3Q A;  1FIL A;  1HTZ A;  2EX9 A;  2RL3 A;  3IF5 A;  1KE3 A;  2W1T A;  2KX6 A;  3P98 A;  2JN7 A;  2L4R A;  5FI6 A;  2Z2M B;  2A24 B;  1ES3 A;  3E4P A;  2V20 A;  4OPR A;  3G6O A;  2E8I A;  1XA7 A;  3ZNY A;  2OOL A;  3CLO A;  4OQ0 A;  3MFX A;  5K5B A;  2ZC7 A;  1WYB A;  1ERQ A;  4WEJ A;  1W8Q A;  1N9N A;  2Y2N A;  3G32 A;  4CLC D;  4EER A;  3R7W B;  4MBH A;  3T4J A;  4DXB A;  3GQZ A;  1EI5 A;  4GNU A;  3NI9 A;  3B47 A;  3VOY A;  2ZMA A;  3K3C A;  4GD6 A;  2WK0 A;  2CMN A;  3MQQ A;  4MNR A;  3Q1F A;  1P0Z A;  3C4O A;  3CUE A;  4KQD A;  2W1T B;  3LID A;  3BY8 A;  4EUV A;  1Y28 A;  5HWT A;  3T1S A;  2V8C A;  4BBV A;  2JCH A;  4GLQ A;  4OOY A;  2XFS A;  3RTY A;  2P08 A;  4E3J A;  4WZ4 A;  4HIA A;  2OAQ 1;  5AQB A;  2WGV A;  3BFC A;  4QHC A;  1L0E A;  1SZV A;  1OJ5 A;  2Q0O A;  1GSW A;  2LB5 A;  3MKE A;  1XXM A;  3BM6 A;  4EBL A;  3PYP A;  2JE5 A;  4JXS A;  2INW A;  4RYE A;  2W27 A;  4HJ3 A;  5HFO A;  3TSG A;  4E3K A;  1G68 A;  1IEM A;  3NDG A;  1BLH A;  4LV2 A;  3HLE A;  3KSG A;  1CF0 A;  4BLM A;  1K6R A;  1YLW A;  1MWT A;  5DF9 A;  4B9O A;  2VKS A;  3FZC A;  4Y15 A;  3PBO A;  2IA2 A;  4S2P A;  4BEN A;  1HZO A;  2H0T A;  4HY8 A;  3IBR A;  5EM0 A;  4ZJ2 A;  1FCO A;  3SW1 A;  3F1O A;  1LLB A;  4FCF A;  4ETZ A;  2P74 A;  1K55 A;  5HAI A;  2V8F A;  1RGY A;  2WKR A;  3EQU A;  3WWX A;  3A0S A;  2XR0 A;  4Q0H A;  2H28 A;  4H6J A;  3PTE A;  1T18 A;  4HQA A;  4MBF A;  4DDS A;  2OSU A;  1PIO A;  3DW0 A;  3KYQ A;  5CEB A;  1S6R A;  4IUK A;  1E25 A;  1BUL A;  3O86 A;  4UHU A;  4L9E A;  4KZ5 A;  2VA0 A;  3L9K A;  5FEF A;  5DFX A;  3LUQ A;  5GLC A;  3PAE A;  2YKH A;  1EWZ A;  5DVA A;  3V5M A;  3IF6 A;  5EVL A;  4G3W A;  3UB6 A;  1WE4 A;  4R70 A;  2OWH A;  3MS6 A;  3S7P A;  4MMN A;  5LBR A;  1CEG A;  2ZQ7 A;  3T1X A;  4WMC D;  4GOG A;  1ES2 A;  5FQ9 A;  3MQO A;  3A0R A;  3PBT A;  4FSF A;  2O9C A;  2GNX A;  3CI6 A;  2ZOI A;  5GLB A;  2R78 A;  2QWS A;  2A2L A;  3NHQ A;  3UPO A;  5J8X A;  3F1O B;  3ICY A;  4YOF A;  3ZG5 A;  1YAX A;  4BQM A;  1FCN A;  1VM1 A;  1NLZ A;  3LR4 A;  3MXS A;  1K4F A;  2Y2K A;  3WS1 A;  2PRF A;  4OOM A;  4UA6 A;  1OTB A;  4UA9 A;  5CX7 A;  1LI0 A;  1XJ3 A;  1HVB A;  3CIT A;  5GLD A;  2EX8 A;  3IF6 B;  4G3V A;  3T4K A;  5HAR A;  2HZ5 A;  3PR6 A;  1H0M A;  4B88 A;  1XFQ A;  3SH8 A;  3HLB A;  2PD8 A;  5EFW A;  5L10 A;  1V9Z A;  5TJJ A;  1KVL A;  2ZMV A;  5EVE A;  1G5U A;  5FAT A;  4ZDX A;  1YQS A;  3FPW A;  5M1A A;  3HUO A;  1L0D A;  4PM7 A;  1D7E A;  1VEU A;  2ZQ9 A;  1JWZ A;  2BAS A;  3G34 A;  3R4K A;  5G18 A;  2WZX A;  3ZG8 B;  3A3J A;  4N9L A;  3A3I A;  3SS4 A;  4CLC A;  5AVF A;  4WF0 A;  2VV6 A;  3EGX C;  4OH0 A;  1OPX A;  3UB8 A;  1GSX A;  2R9W A;  3GDI A;  4MCW A;  2JKT M;  3GEC A;  3B3X A;  4R3A A;  3V39 A;  3ZYT A;  3GMW A;  3P7N A;  4WUJ A;  1JTD A;  3FG8 A;  3MSH A;  4GHI A;  2B18 A;  1DJA A;  4GDN A;  3S7Q A;  1RGZ A;  2Y59 A;  1PWG A;  1CI9 A;  4M3K A;  2V0U A;  1STZ A;  3LIC A;  2PYP A;  1NRF A;  2FFY A;  3V67 A;  2XSS A;  1S1Y A;  3Q07 A;  1S66 L;  3EQV A;  1XFN A;  4L9F A;  1VEU B;  3N8R A;  5FI7 A;  5EVI C;  3LEQ A;  3B42 A;  4BBT A;  4EEU A;  1SDN A;  4CLC B;  3QP2 A;  4U0T A;  4KEN B;  3WRT A;  4X1L A;  1ONG A;  4Z9Q A;  4CQH A;  1HD8 A;  1CJF A;  3FC7 A;  3Q7V A;  4L0L A;  4C6Y A;  4KZ6 A;  3LI9 A;  3IHA A;  1H3Q A;  3C30 A;  3DTE A;  1ESI A;  1UWP X;  2WKE A;  3H7W A;  4KUK A;  3UB9 A;  3N8S A;  3NEC A;  1KE4 A;  4QJG A;  4GHI B;  1OME A;  2JC7 A;  3KSI A;  3FKV A;  2VV8 A;  2PR5 A;  4PPR A;  5HX9 A;  4HH2 A;  2ZC5 B;  1DJC A;  4K91 A;  2WGW B;  1H5X A;  3Q81 A;  1JTG A;  3DWZ A;  1S4R A;  1PYY A;  2M7V A;  5HL6 A;  4HBU A;  2Y2M A;  4KZ4 A;  4GW9 A;  1GHM A;  2D02 A;  4JPM A;  5FQI A;  3BRM A;  1FSY A;  3NBL A;  5A91 A;  2IWC A;  3QHY A;  5E2F A;  4K0X A;  4JF5 A;  3VP2 A;  3E2L A;  2C5W B;  4I3I A;  5A92 A;  4P6Z S;  4KZA A;  1GHP A;  3Q7V B;  1H8M A;  1YSQ A;  1ONH A;  5HPF A;  3U4L P;  4WZ5 C; 
#chains in the Genus database with same CATH homology
 2ZLY A;  4OQI A;  3IWO A;  2HP6 A;  2V20 A;  4E3M A;  5HW3 A;  3PBR A;  4P85 A;  4OPR A;  4WMC A;  1NYM A;  2E8I A;  5U47 A;  2XD5 A;  3HLW A;  1NYY A;  3IXG A;  1XA7 A;  3ZNY A;  2QPN A;  4OQ0 A;  5EEC A;  3UE3 A;  1AXB A;  5CGS A;  1PI4 A;  2ZC7 A;  1WYB A;  4EBN A;  3FKW A;  1Z6F A;  3HBR A;  1ERQ A;  4MLL A;  1Q2P A;  4WEJ A;  1W8Q A;  2CC1 A;  3HRE A;  4IBX A;  2Y91 A;  3QNB A;  5FQJ A;  1I5Q A;  2Y2N A;  3G32 A;  3OPP A;  3DTM A;  2WGI A;  5GL9 A;  3ZG7 B;  2ZD8 A;  4MEZ A;  3SS5 A;  5KMW A;  4MBH A;  1JWV A;  2H10 A;  4DXB A;  3GQZ A;  1EI5 A;  4WYY A;  1GA9 A;  4GNU A;  4P6B A;  1XX2 A;  3NI9 A;  1ZC2 A;  5FAO A;  3BEB A;  3VOY A;  3ZHH A;  2ZMA A;  5F82 A;  4ZTK A;  3LCE A;  1YLJ A;  2ZQD A;  4Y0O A;  3TOI A;  1XPB A;  1K57 C;  1NY0 A;  2P9V A;  4GD6 A;  3IHB A;  1BTL A;  1K6S A;  1ERM A;  2WK0 A;  3RXX A;  5BOH A;  3GSG A;  5GLA A;  1YLT A;  4MNR A;  3TG9 A;  3BFE A;  4JBF A;  3Q1F A;  1IEL A;  3M6B A;  4JXV A;  5CTN A;  3IT9 A;  2WZZ A;  1K55 C;  2WAE A;  3C4O A;  3C5A A;  5CHJ A;  1SDE A;  1FOF A;  3IQA A;  2ZQC A;  5EVI B;  3AGD A;  4OON A;  3A3F A;  5E2H A;  4DE2 A;  2JCH A;  4S2N C;  4OOY A;  1KGG A;  2XFS A;  4IED A;  3FWL A;  2HPB A;  4R23 A;  1ERO A;  4X6T A;  4R3B A;  4E3J A;  4WZ4 A;  5HL1 A;  4UA7 A;  5AQB A;  2WGV A;  2GDN A;  3ZVW A;  1TDL A;  2FFF B;  3BFC A;  4QB8 A;  4ZJ3 A;  3C7V A;  1ES5 A;  3VMA A;  5L2F A;  1W8Y A;  2J7V A;  4KG2 A;  4QHC A;  2VGK A;  3ZVT A;  1L0E A;  2V1Z A;  3OZH A;  4XUZ A;  3CMZ A;  3MFD A;  3E2K A;  2WKH A;  3MKE A;  1BLP A;  4IVK A;  3WS5 A;  1MBL A;  4HBT A;  1ZKJ A;  4GDB A;  3IF6 C;  3MKF A;  5AQA A;  1PWC A;  4DKI A;  4WZ5 A;  3BFF A;  4R4S A;  4PMA A;  4E3O A;  1XXM A;  3BM6 A;  3O88 A;  2A49 A;  4N1X A;  4P87 A;  4YFM A;  4EBL A;  1BLS A;  2OLU A;  1NJ4 A;  3PBS A;  2ZQ8 A;  2JE5 A;  4PM5 A;  4JXS A;  5GHZ A;  1QME A;  5TFQ A;  2EX6 A;  5CED A;  2X02 A;  4RYE A;  4WEL A;  2QMI A;  5EPH A;  4QY6 A;  4B4X A;  5HFO A;  3VOZ A;  4QU3 A;  3TSG A;  1S0W A;  3BFG A;  4GB7 A;  4E3K A;  1KE0 A;  1G68 A;  1IEM A;  2H5S A;  3CJM A;  4IBR A;  4S2K A;  1XA1 A;  3V3R A;  3NDG A;  1BLH A;  1PZO A;  4LV2 A;  5KSC A;  3HLE A;  4OKP A;  1FR6 A;  1TEM A;  3S4X A;  2P9V B;  1IYS A;  4BLM A;  1K6R A;  4D2O A;  1QMF A;  1L0F A;  1MWT A;  1YLW A;  2WAF A;  4JXW A;  4Y0T A;  1JVJ A;  1W79 A;  5DF9 A;  3FZC A;  2Y2H A;  1K56 A;  4E6W A;  3PBO A;  5AQ9 A;  1K54 C;  1I2S A;  1NZU A;  3A3E A;  5DTT A;  5TR7 A;  4S2P A;  4BEN A;  1HZO A;  4WBG A;  4U3T A;  2X01 A;  2H0T A;  4QY5 A;  4GKU A;  5EUA A;  1L0G A;  3UPN A;  5DF8 A;  4N9K A;  3G4P A;  1XKZ A;  3ITB A;  1NXY A;  4ZJ2 A;  1W7F A;  3HLD A;  4OPQ A;  4JXG A;  1FCO A;  1H8Z A;  3GV9 A;  3UO9 A;  1LLB A;  4FH2 A;  4FCF A;  4JKT A;  5DTS A;  4WEK A;  1MWU A;  4EWF A;  5AQ7 A;  2G2U A;  2P74 A;  1K55 A;  1Q2Q A;  2DNS A;  3OPR A;  5HAI A;  3UY6 A;  1RGY A;  3EQU A;  3WWX A;  5GHX A;  2XR0 A;  2EXA A;  1MKI A;  5JYO A;  1M6K A;  5KSH A;  1ES4 A;  5HAP A;  1CI8 A;  2Y55 A;  3D4F A;  5JYP A;  4N1H A;  4S2N A;  1CK3 A;  3PTE A;  2IWB A;  4MBF A;  4DDS A;  2OSU A;  1PIO A;  3DW0 A;  3QNC A;  4OLD A;  4H8R A;  1PW1 A;  5CEB A;  5CEC A;  4S2I A;  1S6R A;  3HLF A;  1E3U D;  2XD1 A;  1E25 A;  3UN7 A;  1BUL A;  5FAQ A;  1SCW A;  3O86 A;  4UHU A;  5FDH A;  3I7J A;  4KZ5 A;  4X55 A;  5EOE A;  3WS4 A;  4JLF A;  1DJB A;  3UDI A;  5GLC A;  3PAE A;  2Y2G A;  4KZ7 A;  5DF7 A;  4FH4 A;  4LV3 A;  1EWZ A;  1KDS A;  2EFU A;  2PU4 A;  5DVA A;  2OV5 A;  3V5M A;  3IF6 A;  5EVI D;  1KDW A;  5CXW A;  2XEP A;  5EVL A;  1FCM A;  4GZB A;  1K38 A;  2H0Y A;  1FSW A;  3N7W A;  1N4O A;  3ZDJ A;  3UPP A;  1WE4 A;  2EX2 A;  3NCK A;  3ZNT A;  5E43 A;  4E3I A;  1CEG A;  1JWP A;  2WYX A;  2J9P A;  2ZQ7 A;  4E6X A;  4RA7 A;  4WMC D;  3MZE A;  5E2E A;  1LI9 A;  2WGW A;  1ES2 A;  4GOG A;  4UAA A;  4ID4 A;  1ZG6 A;  1SHV A;  5FQ9 A;  2B5R A;  2A3U A;  3PBT A;  4FSF A;  5CGW A;  3BYD A;  4NET A;  3G35 A;  5GLB A;  4OQG A;  2XFT A;  4KQQ A;  3LY4 A;  1O7E A;  2DCF A;  3UPO A;  3VP0 A;  5CHU A;  1LL5 A;  5J8X A;  1BT5 A;  4OPY A;  4R4R A;  1GCE A;  4S2M A;  3RJU A;  1K54 A;  2QZ6 A;  4RVA A;  4KZ3 A;  3VP4 A;  3BLS A;  1BUE A;  3ZG5 A;  2WAD A;  5EOO A;  2Y2L A;  1BLC A;  3WS2 A;  1TDG A;  5F1G A;  2HDR A;  4BQM A;  1FCN A;  1VM1 A;  3RXW A;  3S22 A;  2PBY A;  2Y2P A;  4CPK A;  1NZO A;  3BLM A;  5FAS A;  3MXS A;  1K4F A;  1LHY A;  2Y2K A;  3C7U A;  4OP5 A;  3CZD A;  1KVM A;  4Y7P A;  3WS1 A;  4GN2 A;  1K25 A;  2ZM2 A;  3VFF A;  5GHY A;  4B4Z A;  4OOM A;  3JYI A;  1ESU A;  5A93 A;  4UA6 A;  4UA9 A;  4ZAM A;  2IWD A;  2XK1 A;  3LO7 A;  2HP9 A;  1LI0 A;  3S1Y A;  3HUM A;  4LV0 A;  1HVB A;  4IVI A;  2PU2 A;  4U0X A;  4Q8I A;  4DDY A;  3VP3 A;  3ITA A;  3N6I A;  1M40 A;  1YT4 A;  5GLD A;  3W4O A;  5E2G A;  2EX8 A;  2XF3 A;  4MBK A;  3IF6 B;  2UWX A;  4DRT A;  3G31 A;  3IWQ A;  4HEF A;  3SS3 A;  2Z2L B;  3M2J A;  1LL9 A;  4YIN A;  4JF4 A;  2Y2O A;  2Y2J A;  3OCL A;  3ZGA B;  3IH9 A;  5HAR A;  5FQK A;  3NC8 A;  1N9B A;  2Q9N A;  3W4Q A;  4B88 A;  3SH8 A;  3HLB A;  4FD8 A;  3O87 A;  4EV4 A;  5FQM A;  5HAQ A;  2ZC4 B;  4LV1 A;  4BJP A;  2XDM A;  1KVL A;  2OLV A;  5M19 A;  2JBF A;  1IYO A;  5FSR A;  5FAT A;  4PM6 A;  1MPL A;  4ZDX A;  3C4P A;  1YQS A;  2Y2Q A;  5M1A A;  3HUO A;  3IXB A;  2C6W B;  5IHV A;  3MBZ A;  2XQZ A;  2BLS A;  3ISG A;  1L0D A;  5CER A;  5I94 A;  1YMS A;  3HUN A;  4PM7 A;  4S2O A;  1XGI A;  2Q9M A;  2ZQ9 A;  1JWZ A;  5CHM A;  5FA7 A;  1YLP A;  2EFX A;  3G34 A;  3Q7Z A;  5G18 A;  4C75 A;  4E3L A;  2ZJ9 A;  4DXC A;  2WZX A;  3V50 A;  4R3J A;  3ZG8 B;  1GHI A;  3A3J A;  4N9L A;  3A3I A;  1YM1 A;  3SS4 A;  4DF6 A;  3OPH A;  4DE1 A;  3FV7 A;  1U60 A;  1Y54 A;  3M6H A;  3BFD A;  4RX3 A;  4S2J A;  4R0Q A;  3MZD A;  1MY8 A;  1MWS A;  4OH0 A;  3IXD A;  1DY6 A;  1BZA A;  2R9W A;  1K4E A;  3W4P A;  3AGE A;  4ZJ1 A;  1K56 D;  4X69 A;  3PBN A;  4CJN A;  2J8Y A;  3FYZ A;  3B3X A;  3V39 A;  5EE8 A;  3GMW A;  1JTD A;  5DTK A;  2RCX A;  3AGF A;  5FQQ A;  4OQH A;  1IYP A;  2G2W A;  4N92 A;  3BEC A;  4KZ8 A;  3ZG9 B;  4LCM A;  1IYQ A;  1DJA A;  2XH9 A;  1O07 A;  4GDN A;  1RGZ A;  5FAP A;  5A90 A;  4EBP A;  2Y59 A;  1PWG A;  4BL2 A;  1CI9 A;  2ZC3 B;  3LEZ A;  1WYC A;  4XUX A;  3SOI A;  3IXH A;  4M3K A;  2BG1 A;  2HDU A;  5FI2 A;  3OC2 A;  3UE0 A;  1NRF A;  1XP4 A;  3ZG0 A;  4OVD A;  2FFY A;  4KZB A;  3V3S A;  3ZCZ A;  3MXR A;  3N4I A;  1RCJ A;  3Q07 A;  3G2Y A;  1GA0 A;  1ALQ A;  3EQV A;  5TGF A;  3PBQ A;  4KQO A;  5F1F A;  1IKG A;  4PM8 A;  4XXR A;  2DRW A;  4GD8 A;  4X56 A;  1PWD A;  3CG5 A;  3N8R A;  5FI7 A;  1TVF A;  1H8Y A;  3GRJ A;  2VGJ A;  5M18 A;  5EVI C;  3UDX A;  4LCL A;  3UNW A;  4RX2 A;  1E4D A;  1SDN A;  2Y2I A;  2Y4A A;  1KGF A;  1KGE A;  3LY3 A;  2R9X A;  4U0T A;  4KEN B;  4OOL A;  3WRT A;  4BD0 A;  3IWI A;  1ONG A;  4ZBE A;  4DE3 A;  4E3N A;  2ZM0 A;  5CGX A;  3VSK A;  2XGN A;  3HL9 A;  3GR2 A;  2I72 A;  4QD4 A;  3NDE A;  2HDQ A;  4Y0U A;  4Z9Q A;  1HD8 A;  4L0L A;  3Q7V A;  4C6Y A;  1PW8 A;  1VQQ A;  2J9O A;  2ZQA A;  3MZF A;  3ZFZ A;  5D3O A;  1YMX A;  4KZ6 A;  1BSG A;  1PZP A;  4JF6 A;  3WS0 A;  3DWK A;  1MWR A;  3IHA A;  4O7D A;  3VP1 A;  3M2K A;  1I2W A;  3GTC A;  1IKI A;  1ESI A;  4BD1 A;  2WKE A;  4X53 A;  3HVF A;  3N8S A;  1KE4 A;  3NIA A;  1FQG A;  4QJG A;  4OP8 A;  4WM9 A;  1OME A;  2JC7 A;  2WUQ A;  4A5R A;  3FKV A;  4BL3 A;  1ZG4 A;  3P09 A;  1W5D A;  4F94 A;  3NY4 A;  4PPR A;  4KQR A;  5HX9 A;  5F83 A;  4OPZ A;  2ZC5 B;  1YLZ A;  2EXB A;  1DJC A;  1FR1 A;  4K91 A;  2WGW B;  1H5X A;  3OCN A;  3Q81 A;  4EUZ A;  3IH8 A;  5KZH A;  2ZM8 A;  4KG5 A;  1JTG A;  3SH9 A;  3DWZ A;  3PAG A;  4LEN A;  1G6A A;  3VSL A;  1PYY A;  1J9M A;  4HBU A;  1C3B A;  2Y2M A;  4KZ9 A;  1RP5 A;  4KZ4 A;  1GHM A;  3N8L A;  4JPM A;  5FQI A;  3UE1 A;  4DE0 A;  4X68 A;  3BRM A;  3O3V A;  1FSY A;  2XLN A;  3NBL A;  4EQI A;  1L2S A;  5A91 A;  3A3D A;  3OPL A;  2ZC6 B;  2IWC A;  3QHY A;  4PM9 A;  3W8K A;  5E2F A;  4K0X A;  3Q82 A;  3G2Z A;  3WRZ A;  1E3U A;  1XGJ A;  4NK3 A;  2HDS A;  3HLG A;  4JF5 A;  1CEF A;  3VP2 A;  3E2L A;  2HP5 A;  4S2L A;  2C5W B;  3VFH A;  4C3Q A;  4P0M A;  2V2F F;  1YLY A;  5A92 A;  4OLG A;  3UDF A;  1PI5 A;  2RL3 A;  1HTZ A;  2EX9 A;  3IF5 A;  3SH7 A;  4HES A;  1KE3 A;  2X71 A;  4R1G A;  4K0W A;  1K57 A;  3HLC A;  5CTM A;  4KZA A;  5EVI A;  3G30 A;  1GHP A;  3P98 A;  3Q7V B;  1ONH A;  4KG6 A;  5FI6 A;  2Z2M B;  3GVB A;  1SKF A;  5CRF A;  1MXO A;  2WKI A;  1ES3 A;  4WZ5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...