2ZOIA

Neutron crystal structure of photoactive yellow protein, wild type, at 295k
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Photoactive yellow protein
publication title Low-barrier hydrogen bond in photoactive yellow protein
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2zoiA00
2BASA 3LYXA 4EEUA 3LUQA 3UB8A 4HP4A 3FC7A 5DJUA 1UWNX 3LI9A 4HJ3A 3T50A 3F1NB 4BBUA 2JHEA 1GSVA 1OJGA 2A24B 3SW1A 1LSVA 2OWJA 3F1PB 3MFXA 5TBMA 4GS9A 2ZOHA 4HOIA 2VV7A 1XJ6A 4RQ9A 5F6AA 3BY9A 4WUJA 4NXGA 3H7WB 2PYPA 4YWZA 4EERA 3G6OA 1S1YA 5KIZA 3PYPA 3MR0A 3MJQA 3FG8A 4XT2A 2PD7A 5HDDA 3NHQA 4I38A 1DP6A 3GECA 2CMNA 1LSWA 4JGOA 2KX6A 1OTAA 3LIFA 3C8CA 4L9EA 4F3LB 3H82A 2W0NA 3CAXA 3D72A 5HWWA 5G4YA 2WKPA 2L4RA 2L0WA 3P7NA 1T19A 2OOLA 4EETB 3C2WA 3ZQ5A 3HJKA 4R70A 5F69A 2QKPA 4BBTA 1XFNA 5HD5A 2PD8A 5F68A 3ICYA 1G28A 5J7EA 3BY8A 4R3AA 1X0OA 4HI4A 3MQQA 2VV8A 3UMEA 2V1AA 3IS2A 3IBRA 4H6JA 5HSQA 2I9VA 3A0VA 3LICA 2YKHA 1VB6A 1UWPX 4LLOB 4GS9B 2GJ3A 1N9LA 2WKRA 3LIAA 5HDSA 2VEAA 3UB7A 1S4SA 2PYRA 4LPZA 5AVEA 1XJ2A 4JGRA 1LSXA 3NOPC 1V9ZA 1BYWA 5F5YA 4HY8A 1JNUA 2QWSA 3BWLA 1DP8A 2VV6A 4GHIA 4MN5A 3VE4A 4L9GA 1GSWA 3RTYA 2YKFA 5HWVA 4HIAA 5A8BA 1OTEA 3F1NA 2KDKA 4R38A 1MZUA 1S66L 2V1BA 1NWZA 2L1MA 4HHDA 2JN7A 5J3WA 1Y28A 1N9NA 2QJ7A 4HQAA 1XJ3A 5DKLA 4GCZA 2M1CA 1T18A 2PR6A 4I5SA 4EXOA 4I3JA 4NXEA 1TS8A 5HDCA 1KOUA 4LRZE 1V9YA 4HNBA 5DJTA 4BBVA 3F1OB 4I3AA 3HJIA 3E4PA 3IS2B 1OT9A 5AVFA 4H6JB 4GW9A 2V0UA 2OWHA 4K08A 3LIDA 4DJ3A 2ZOIA 4EW7A 4PKYA 1D06A 4PKYG 4M4XA 3NOTC 2VLGA 1TS6A 3LI8A 3NOUC 1OT6A 5TBMB 4KUOA 4HH2A 3PHYA 1P97A 1OJ5A 1LT0A 2V9AA 3UB6A 4LRYC 4GHIB 5EFWA 4HJ6A 4B9OA 1EW0A 3A0SA 2PDRA 1DP9A 2D01A 2Z6CA 3CLOA 4XT2B 3EWKA 1TS0A 1TS7A 1S1ZA 2QJ5A 4I3IA 4KQDA 4WF0A 2HV1A 4WLAA 3UE6A 3UB9A 3B33A 3VE3A 1OTIA 4DJ2A 3OLOA 2A24A 3LIBA 3F1PA 1DRMA 2EA9A 1S67L 2PHYA 2K7SA 4EEPA 2R78A 3K3DA 1P0ZA 3LIEA 3H82B 4JGPA 4LRXC 5HD3A 1GSXA 1F9IA 2P7JA 4L9FA 2H28A 4EQ1A 2INWA 5IU1A 4MN6A 2QHKA 1T1AA 3CWFA 3H7WA 3UMDA 1XFQA 3H9WA 1UGUA 3K3CA 1T1CA 4JGQA 1D7EA 1F98A 1T1BA 4HP9A 5HWTA 5G4ZA 3RH8B 4NXFA 4E04A 3VOLA 5J4EA 3MQOA 4NXBA 1LL8A 1ODVA 4HH3A 3EEHA 4WN5A 5DKKA 5IS1A 4HJ4A 3MXQA 3A0RA 5I5LA 2V0WA 4F3LA 3GDIA 2WKQA 4EESA 2ZBBA 3E4OA 3NJAA 1XJ4A 4R6LA 2B02A 1N9OA 1OTDA 4I39A 4WL9A 2W27A 1WA9A 2J80A 5HZHA 2PR5A 3F1OA 2D02A 1S4RA 1OTBA 4KUKA 3ULFA 3E4QA 2Z6DA 3KX0X
chains in the Genus database with same CATH superfamily
4U0TA 4E3NA 3VP2A 3E0YA 2JHEA 1ES4A 1OJGA 1FIKA 3T12B 5CGWA 2A24B 4GD8A 3IQAA 3BECA 4E3LA 4N1HA 4O8GA 4HOIA 1XJ6A 5F6AA 1F5MA 3T4TA 3HLCA 1NLYA 3BY9A 3AGEA 4WUJA 5L10A 3H7WB 4BD1A 2HGVA 4OQ0A 5CTMA 2VZWA 4YWZA 1ZTUA 1W7FA 2R9XA 3BM6A 3PYPA 3MR0A 3MZFA 2MJ6A 3VP1A 3KSFA 3MZEA 3ISGA 3KYEA 5KZHA 2HDUA 2WGWA 2EXAA 3V5MA 3NHQA 4MN7A 3WRTA 1L3LA 4EWFA 1LSWA 4BL2A 4IBXA 1OTAA 3C8CA 3CITA 3ZNYA 4ZJ1A 2HDQA 5BOHA 3H82A 1KVLA 3D72A 5HWWA 2ZJ9A 2FFYA 4IVIA 2L0WA 1T19A 4JLFA 2XD5A 2ZMFA 3KO6A 4BMWA 5F69A 4BBTA 5A93A 2QKPA 2O99A 1C3BA 3Q7VA 4EU0A 4CLCD 4ZAMA 4JF6A 3V67A 5F68A 1K38A 1W5DA 1IKIA 3A3IA 1X0OA 4OQIA 4HI4A 3FPVA 3T1SA 3UMEA 5L07A 2LB5A 1W8YA 3PAGA 3IS2A 4QB8A 4P85A 1Z6FA 3CZDA 5FQQA 5HSQA 2Y2NA 2BTFP 1KE4A 4MCWA 3BLSA 3DTKA 4E3KA 1HLUP 3IF6C 1N9LA 3E2LA 2WKRA 3PBTA 5HDSA 2O9BA 4GZBA 3WS4A 1KGGA 3N6IA 2VEAA 4O0PA 5GL9A 4IJGA 2XEPA 1KGFA 4XXRA 4LPZA 4JGRA 5EUAA 1V9ZA 3T1QB 1YLZA 1BYWA 5GLDA 2JE5A 3MXRA 3O86A 5FATA 1L0FA 3N4IA 3O88A 2VV6A 3JVVA 5M19A 3PBSA 1CI9A 4DKIA 1GSWA 2YKFA 3CPTB 2WGWB 3SS5A 1JWVA 2Y91A 2KLIA 4OOLA 1H8YA 2C6WB 3S1YA 2ZL1A 1I2WA 5D3OA 2PBYA 4E3JA 1W8QA 2E8IA 1S66L 1LI0A 1NYMA 1K55C 1TEMA 5CTNA 4ZJ2A 5AQ9A 2L1MA 3A3JA 4HHDA 3BEBA 1BLSA 4R4RA 3MMHA 5DF8A 5J3WA 3V50A 2V1ZA 1ZG4A 3LGOA 5DKLA 5FAPA 1HTZA 4Z9QA 3ZG7B 4E3IA 4D60A 3G31A 2PR6A 5DTTA 3B3XA 3Q7VB 3ITBA 1ES5A 4Q0HA 1YSQA 5FQJA 4EBPA 4HNBA 2O0YA 4RX3A 3L7HA 4BBVA 4HESA 4I3AA 3IXGA 2Y2MA 1K6RA 3IS2B 1OT9A 1FOFA 4GW9A 5DFYA 1PRQA 1ES3A 5GLBA 2V0UA 1RCJA 5F82A 2ZOIA 4EW7A 4PKYA 4IUKA 4M4XA 2ZC3B 3VSLA 4JXSA 3C4PA 4HEFA 4P0MA 3JVUA 3GQZA 4HH2A 4JXVA 1AWIA 5M1AA 4UQIS 4DMZA 4F94A 5M18A 2EXBA 3IH8A 3FKVA 4KZ9A 4Q8IA 4KZ5A 3HVFA 4CPKA 1EW0A 3D9YA 5HL1A 3A0SA 4MBHA 3SS4A 2PDRA 3HLWA 5JYPA 1BLHA 4Y0UA 3IF6A 1DP9A 4ZDXA 4BJPA 3IWIA 3C38A 2HZ5A 4S2MA 2JC7A 4UQIM 4KQDA 3RJUA 2HV1A 4WLAA 2JBFA 3NC8A 3UB9A 5KMWA 3IXHA 2JKRI 4N92A 2Y2JA 3F1PA 5FAQA 5FAOA 1FR6A 2R78A 1PWCA 1ALQA 1IELA 4IHQA 3HUNA 2JKFA 2UV0E 4EQ1A 1G5UA 2WKEA 2QPNA 3MSHA 2W3FA 2Y2IA 3IWQA 2Y2GA 3HL9A 4IVKA 2G7UA 5CGSA 5EE8A 3QP5A 2GZAA 3QP1A 1TD5A 3UN7A 2Y8HA 3BFGA 1K55A 4K0XA 5HAPA 2PU2A 5CHUA 1F98A 3O5YA 2XF3A 5G4ZA 1L2SA 3G32A 4NXFA 3MQ0A 3WWXA 1CK3A 4HH3A 3ZVWA 3C7VA 2A3UA 3EEHA 1YSPA 4WZ5C 3MXSA 5IS1A 4LCMA 2IWCA 3ZCZA 3CUEC 4F3LA 3GDIA 4X25A 2OV5A 2IWDA 2ZMVA 1BZAA 3E98A 5AJGA 5EV0A 3BYDA 4OP8A 1YLYA 2EX2A 1O07A 5JYOA 3W2ZA 2X01A 2W27A 4FD8A 5HZHA 2Y2OA 3MF0A 2RCXA 1S4RA 5U47A 3VP3A 1JTDA 1OTBA 3ZGAB 4X56A 4LV1A 3FKWA 1TDLA 1VM1A 1Y4OA 4Y0OA 4C6YA 3RXXA 3ULFA 4RYEA 4S2LA 3VOYA 2XRNA 5FSRA 3VP0A 4EEUA 4B4XA 3BFDA 2I72A 4HP4A 4HJ3A 3LI9A 3S7OA 3ZDJA 2VKSA 4AFIA 1SZVA 1EROA 3F1PB 3R4KA 3UY6A 3T4QA 5EVIC 5TBMA 4GS9A 5HPFA 1XA1A 4RQ9A 1WYBA 1F2KA 1XP4A 3KSGA 4NXGA 4QY6A 1K56A 4JXGA 4LFUA 4XUXA 1Q2PA 1W79A 1P9RA 1S1YA 3MJQA 4P87A 5E2HA 3B47A 3UE3A 5AQBA 3M2JA 2Y2LA 4PM6A 4Z1WA 2V8FA 4JXWA 4X1MA 1PI4A 1DP6A 1N9BA 1GHMA 1GHPA 2KX6A 1IYQA 5FI6A 3LIFA 3M2KA 3RXWA 3OPHA 4F3LB 4CLCB 1KE3A 3ZG9B 2W0NA 4PMAA 4MNRA 4DRTA 5G4YA 3HCYA 2WKPA 3KYQA 3S7QA 3P7NA 4N9LA 4EETB 1TVFA 3ZQ5A 1ES2A 3HJKA 2M7VA 1XFNA 5FA7A 5DVAA 2ZLYA 2PD8A 3GTCA 1G28A 1CF0A 1DJCA 2X71A 4WZ5A 5FEGA 2Y4AA 2X02A 3CUEA 4PHTA 1JTGA 2Y55A 3LEZA 4H6JA 2H10A 4MMNA 2I9VA 3LICA 1H0MA 4OPYA 2CC1A 2YKHA 3WS1A 4E3OA 2PBDP 5HFOA 3PAEA 2ZQ8A 2P9VA 4Q0JA 5CEBA 1H8ZA 4GS9B 1VETA 3M6BA 4PM5A 1IYOA 2J3TC 5FQKA 4ZJ3A 1PZPA 3HLEA 4GN2A 3NOPC 1PFLA 3A3EA 5F5YA 4OOMA 4NETA 3EQVA 1GA0A 5A92A 5E2GA 3T4KA 2A2LA 4GHIA 2Y2QA 4X6TA 3IBJA 1MWSA 2VA0A 5EM0A 5KSHA 1HZOA 3RTYA 2JKRM 5HWVA 1A0KA 1VEUA 3P01A 4KZ3A 5EVIA 5A8BA 1OTEA 3F1NA 2HPBA 3BLMA 3ZFZA 5MC7A 1IKGA 1YLWA 2XK1A 2E8JA 1MZUA 1K57A 2HJ9C 4B4ZA 5DFXA 4OPZA 2PAVP 1L0DA 4OH0A 2RL3A 4GCZA 4NK3A 2M1CA 3WS5A 3OPLA 1GHIA 1NLZA 5CX7A 3S7NA 4OLDA 1XA7A 3SH9A 2OSUA 4IEDA 1ESUA 4I5SA 2V8CA 4HBTA 4WELA 5EM1A 3EGXC 5HDCA 1KOUA 3C4OA 2M7UA 3G2YA 3LO7A 1N4OA 4G3KA 4QWOA 3E4PA 1PW1A 1FCMA 2XH9A 5FQMA 1E4DA 4H6JB 3NBLA 2W3EA 2QZ6A 2XDMA 3LIDA 4DJ3A 1YLPA 2B18A 4QU3A 1PWGA 2P9VB 3IXBA 3ITAA 4Y17A 4NEED 1CJFA 3OBFA 2GDNA 4EBNA 3NIAA 4UHUA 2V2FF 1TS6A 1P9WA 1FSYA 3GV9A 3VFHA 4GDBA 2WGIA 4UA7A 2HP6A 2XD1A 1OT6A 4KUOA 2Y2HA 3HLGA 1LT0A 5HX9A 1ZKJA 3NDGA 5GHXA 4YNRA 4GHIB 5EFWA 3GVBA 2JCHA 4DF6A 2J7VA 3HUOA 1KE0A 1ERMA 2WK0A 4K91A 3GR2A 3CLOA 5EPHA 1STZA 3EWKA 2IWBA 4ZBEA 1TS0A 4C3QA 3IX8A 3IF5A 4I3IA 4KQQA 3UO9A 2ZC6B 5HAQA 1K56D 4Q0IA 5EOEA 4E3MA 3ZVTA 3VE3A 4PM8A 2VGKA 4MDZA 2P08A 2K7SA 4OPRA 1RGZA 3VFFA 3H82B 2WAFA 3LR3A 4S2KA 4OONA 1E25A 3P98A 1YLJA 2VJWA 2INWA 5IU1A 1I2SA 2WKHA 3LR0A 4FH2A 4MN6A 3HREA 2ZQDA 1LLBA 3IHAA 4E6WA 3UE1A 1CEFA 3L9KA 1XX2A 1I5QA 5CGXA 3H9WA 2JKTI 3VP4A 3G2ZA 1SCWA 1UGUA 3T4SA 1T1CA 3N8LA 4UA9A 4R23A 3MZDA 2XROA 3PTEA 1NRJA 4CLCE 4E04A 2Q9NA 3CG5A 3MQOA 1LL8A 3QP4A 1ODVA 4PPRA 2WZZA 4OOYA 5DKKA 5FDHA 1YT4A 2ZM0A 3O87A 5CHMA 3FV7A 3W4PA 4R3JA 4HJ4A 3A0RA 3PR6A 1FR1A 1BLPA 3QHYA 3BRMA 4O7DA 1ERQA 2WZXA 4MLLA 1MWRA 3EOIA 3HLDA 1NZOA 2O9CA 4II7A 5A91A 2B02A 1U60A 4WL9A 4YFMA 3NULA 1WA9A 2J80A 3HBRA 4B93A 1J9MA 2PR5A 3F1OA 3N8SA 5GHYA 2HDSA 4RX2A 4A5RA 1Q2QA 4JPMA 3TSGA 3C30A 4RA7A 1KGEA 3SOIA 2BASA 3G34A 4S2IA 5F1FA 3LYXA 3OZHA 4JF4A 3LUQA 3UB8A 4Y2FA 3FC7A 1UWNX 1VHMA 5DJUA 1VQQA 2FZ0A 2HDRA 1FSWA 5CRFA 2ZL1B 3SW1A 1LSVA 2ZOHA 3U4LP 5TR7A 2VV7A 5I94A 1NY0A 2H0YA 4OVDA 5G18A 3GRJA 2ZQCA 4OLGA 5FQ9A 3C5AA 3AGDA 5EVID 1BUEA 3PBOA 2PYPA 3BW6A 3UB5P 4EERA 3QP2A 4KZ7A 3G6OA 4EQIA 3IXDA 2Y59A 4N9KA 5L2FA 4WEKA 3FG8A 3BFFA 3HLFA 4OQGA 1G6AA 4DN0A 4XT2A 3PBQA 3E2KA 5DTKA 3DAVA 2C5WB 5HPIA 4WYYA 4E6XA 4CJNA 3UPNA 4P6BA 3M6HA 2CMNA 1JVJA 3W4OA 1NZUA 3EEAA 4BENA 4L9EA 3NECA 4S2NC 4WM9A 5FL3A 2Y79A 2WUQA 2XFSA 3DBAA 1PZOA 3SH8A 2W3HA 3UDXA 2P04A 4NKPA 2O9AA 4R4SA 4QPRA 2OOLA 3GSGA 3C2WA 2ZQ7A 3BQAA 4ME4A 2P74A 5GLAA 4ETXA 4R70A 3LR4A 5LBRA 3IT9A 1NRFA 4LCLA 3W4QA 5DTSA 1YLTA 4EUVA 3A3FA 3ICYA 5J7EA 3MS6A 3BY8A 4EUZA 2BG1A 4R3AA 3UNWA 1OMEA 2VV8A 1QMEA 2EX9A 2FFFB 1KDSA 4H8RA 2XLNA 3R7WA 3IBRA 4FSFA 5EECA 5AQ7A 3IF6B 4R3BA 2XA7S 1ZG6A 1MKMA 3QNCA 1H3QA 1PIOA 4LLOB 2K2NA 2GJ3A 2ZC5B 4KZ8A 3LIAA 4X55A 4MBKA 4KG6A 3UB7A 3SS3A 2DRWA 3NDEA 5AVEA 1XJ2A 5L8MA 5HL6A 1TDGA 2Q0OA 2J3TD 1WYCA 5F83A 4S2OA 1JNUA 2QWSA 3MBZA 2XA7M 1DP8A 1PYYA 2DMWA 4FOFA 1G6OA 3DWZA 3T4LA 3BJNA 3Q81A 1YAXA 3V3RA 5FEFA 4XUZA 1EWZA 2WGVA 4L0LA 5FASA 4DE3A 4U3TA 4WZ4A 1FCOA 1GCEA 1K4FA 5DF9A 2JKTM 4GOGA 2JN7A 1Y28A 1T18A 2ZC4B 1LHYA 4MEZA 4S2PA 2W3DA 2XGNA 5A90A 4KG2A 2WADA 4DE0A 4HBUA 4QHCA 4NXEA 3PBRA 3VOZA 3PXPA 2PU4A 1YQSA 4LRZE 5C5KA 3VMAA 1YKDA 4OPQA 1M40A 5DJTA 3LY4A 2QMIA 4IBRA 4KG5A 3HJIA 3W8KA 1OPXA 4S2NA 3FYZA 2XQZA 1NJ4A 3G4PA 4JKTA 2G2WA 5HW3A 1H5XA 2BLSA 1AXBA 1D06A 4N1XA 3O3VA 4DE1A 5IT5A 4M3KA 2J9PA 5J8XA 3NOTC 1BULA 1EI5A 1MPLA 3EQUA 2WAEA 5TBMB 4YINA 1WE4A 1P97A 2V9AA 4Y13A 3IX3A 4WMCA 4KQOA 1DJAA 1S6RA 4LRYC 4HJ6A 2VGLS 3UPPA 1YMSA 4B9OA 2VGJA 3T1XA 3FZCA 3KSHA 5CEDA 3AGFA 1SHVA 3S22A 3IX4A 1TS7A 4ZRRA 1SDNA 3TOIA 1L0GA 4ESPA 4QD4A 2Q9MA 4G3VA 3B33A 1K6SA 4DJ2A 2VGLM 3NCKA 2EA9A 2PHYA 1S67L 5TGFA 4EEPA 2ZM8A 4OQHA 3K3DA 2J8YA 4UEYA 1P0ZA 4IUHA 1TF1A 3OCLA 5CXWA 5E2FA 4JGPA 4LRXC 1GSXA 1F9IA 2P7JA 2H28A 3FPWA 5FQIA 1ACFA 3LFVA 1YMXA 3N7WA 1SKOA 1D1JA 4PM7A 3B42A 4GD6A 1IFQA 2XR0A 3UMDA 3CPTA 2WYXA 1BTLA 3DTEA 3K3CA 4BL3A 4BWIA 4FH4A 1PWDA 3TE8A 1D7EA 3S7PA 2IA2A 4LENA 3C7UA 5KSCA 5J4EA 1PI5A 5L09A 3V39A 1E3UA 3VV4A 2EWWA 1LL9A 1K0KA 1XGJA 2OLVA 3LCEA 2V0WA 5K5BA 2WKQA 2J3WA 1VETB 4EESA 2ZBBA 3KSIA 3E4OA 3NJAA 3QP8A 1XJ4A 4QJGA 3WS2A 4R6LA 3UDIA 1O7EA 1N9OA 1ONGA 2D02A 1HVBA 5TJJA 1FQGA 2R9WA 4KUKA 2EX6A 5EVLA 4JF5A 2ZM2A 3ZHHA 4YOFA 1SKFA 2Y2PA 3DTMA 1VEUB 3I7JA 4FCFA 4G3WA 4MBFA 5DF7A 5EVIB 3ZNTA 3T50A 3IWOA 4BBUA 1PW8A 3F1NB 2Z2MB 5CECA 1GSVA 1MXOA 1CEGA 5FDSA 2W3GA 2OWJA 1MBLA 3CI6A 3MFXA 1NXYA 1RP5A 4OP5A 4X1LA 3UPOA 2HP9A 4O01A 3HUMA 4X69A 4RVAA 5HARA 3JPUA 4GB7A 1SKOB 3ZG5A 4EV4A 2DCFA 5KIZA 1QMFA 4X68A 3Q82A 1YM1A 4X53A 3TJZC 2XFTA 2EFUA 3OPRA 2PD7A 5HDDA 4I38A 3GECA 3NY4A 2Y2KA 2K31A 3CJMA 3BQ8A 1FCNA 4Y5FA 4JGOA 4WEJA 1MKIA 1ESIA 2VK3A 1K54C 3Q1FA 2NUPC 4B88A 3CAXA 3TW8A 2B95A 1MY8A 3PBNA 4CLCC 2L4RA 2ZQAA 4Y15A 3D4FA 4GJ4A 4Y3IA 3NI9A 4R1GA 5TFQA 5HD5A 3T4OA 3DWKA 1IOUA 3MQQA 3TRCA 4KZ6A 1KVMA 1ZHHB 1JWPA 2V1AA 3DTIA 4PM9A 2W1TA 4PAUA 5EOOA 3A0VA 1RGYA 5F1GA 1VB6A 4WMCD 1UWPX 1DY6A 4WBGA 5E2EA 3MKFA 4R0QA 4DDYA 3T1RA 2FH5A 4DXCA 4U0XA 1S4SA 2H5SA 2PYRA 1Z09A 1LSXA 3ZYTA 3QP6A 3OCNA 3OOVA 5GHZA 5HAIA 2LB9A 1H8MA 3CMZA 4HY8A 5GLCA 2HJEA 3BWLA 1ONHA 2GX5A 1CQAA 5IHVA 3BFEA 4CQHA 4MN5A 3VE4A 5AQAA 4L9GA 1SDEA 1IYSA 4DXBA 1J3WA 3ZG0A 2NUTC 3DW0A 4HIAA 2W1RA 1KDWA 5E43A 2KDKA 3BFCA 4R38A 3MFDA 4LV0A 4S2JA 2AVXA 3A3DA 4LV2A 2V1BA 4GKUA 4ARZA 4GDNA 1NWZA 1W63M 1HD8A 3S4XA 3T4JA 1N9NA 2QJ7A 4HQAA 2XSSA 1XJ3A 3V3SA 2OLUA 1CI8A 2WKIA 3UE0A 2ACGA 1MWTA 2HF6A 1PNEA 4EXOA 1L0EA 4OKPA 4I3JA 1TS8A 4KENB 3SZTA 3G30A 1V9YA 1LI9A 1E3UD 3F1OB 1K54A 1BLCA 2EFXA 3K2NA 5AVFA 1W63Q 2W1TB 3LR5A 1JWZA 2OWHA 1MWUA 2G2UA 4K08A 4CLCA 1BSGA 2UWXA 4PKYG 1DJBA 4BD0A 2VLGA 4FUWA 3OC2A 4QY5A 1YPRA 4KQRA 4Y7PA 3LI8A 2OAP1 1MC0A 2VX8A 3NOUC 2EX8A 2PRFA 2OAQ1 4C75A 5CHJA 3PHYA 2DNSA 1OJ5A 3P09A 3UB6A 1XGIA 2KOIA 3SH7A 2ZMAA 3EGDC 4UAAA 3VSKA 3IH9A 2GNXA 4DDSA 4ID4A 4BQMA 1XPBA 2D01A 2Z6CA 4BLMA 3GMWA 4XT2B 3RFBA 3LY3A 5CERA 4GNUA 3HLBA 1S1ZA 2QJ5A 3FWLA 1K4EA 2PT7A 4P6ZS 4WF0A 4KZAA 3WRZA 3UE6A 1NYYA 1Y54A 4ARZB 3G35A 1OTIA 4GLQA 4DE2A 1K57C 3OLOA 4UA6A 3OPPA 2A24A 3LIBA 2EWVA 1DRMA 5EVEA 3LIEA 5HD3A 1BT5A 4L9FA 2QHKA 5FI7A 1T1AA 2ZD8A 3TG9A 2ZC7A 3CWFA 5FI2A 3H7WA 2QYBA 4P6ZM 3N8RA 1XFQA 4D2OA 4ETZA 3U2AA 4FTXA 4JGQA 4Y0TA 3CHWP 4LGWA 1ZC2A 1T1BA 4HP9A 5HWTA 3RH8B 1IYPA 1GA9A 3VOLA 4NXBA 4WN5A 4KZBA 3R7WB 3Q7ZA 3MXQA 3QNBA 2ZQ9A 5I5LA 2Z2LB 4NG2A 1XXMA 4KZ4A 3ZG8B 2A49A 1K25A 2V20A 3IHBA 3UDFA 2J9OA 4I39A 1OTDA 3KYZA 2H0TA 4JBFA 1G68A 3Q07A 1FILA 3MKEA 4LV3A 1IEMA 2B5RA 1S0WA 3D3OA 1XKZA 3WS0A 1M6KA 1LL5A 3E4QA 3JYIA 2Z6DA 4EBLA 3KX0X 4K0WA 2JKGA 2HP5A 3LEQA 4ZTKA
chains in the Genus database with same CATH topology
2BASA 3LYXA 4EEUA 3LUQA 3UB8A 3E0YA 4G3WA 4HP4A 4Y2FA 3FC7A 1UWNX 1VHMA 3LI9A 4HJ3A 5DJUA 3F1NB 3T50A 2JHEA 3S7OA 4BBUA 2FZ0A 2VKSA 1GSVA 1OJGA 4AFIA 2A24B 2W3GA 3SW1A 1LSVA 2OWJA 3F1PB 3R4KA 3T4QA 3CI6A 3MFXA 5TBMA 4GS9A 5HPFA 2ZOHA 4O8GA 4HOIA 2VV7A 1XJ6A 4O01A 4RQ9A 5F6AA 1F5MA 3T4TA 1NLYA 3BY9A 4WUJA 3KSGA 4NXGA 3PBOA 3H7WB 2PYPA 2HGVA 3BW6A 2VZWA 4YWZA 4EERA 3G6OA 1ZTUA 1P9RA 1S1YA 5KIZA 3PYPA 3MR0A 4WEKA 2MJ6A 3MJQA 3FG8A 3B47A 3UE3A 4DN0A 3KSFA 4XT2A 3PBQA 3TJZC 5HPIA 4Z1WA 2PD7A 5HDDA 3NHQA 4MN7A 4I38A 1DP6A 3GECA 2K31A 3BQ8A 2CMNA 4Y5FA 1LSWA 4JGOA 4WEJA 2KX6A 1OTAA 3LIFA 3C8CA 3CITA 3EEAA 4L9EA 4F3LB 4CLCB 3H82A 2W0NA 2NUPC 5FL3A 2Y79A 3CAXA 3D72A 5HWWA 3TW8A 5G4YA 3DBAA 3HCYA 2WKPA 3PBNA 4CLCC 3KYQA 2L4RA 2W3HA 2P04A 4NKPA 2O9AA 2L0WA 3S7QA 3P7NA 4QPRA 1T19A 2OOLA 4EETB 3C2WA 2ZMFA 3BQAA 4GJ4A 4ME4A 3ZQ5A 3KO6A 4BMWA 4ETXA 3HJKA 4R70A 3LR4A 2QKPA 4Y3IA 5F69A 5LBRA 1XFNA 2M7VA 4BBTA 2O99A 4EU0A 4CLCD 3V67A 5HD5A 2PD8A 5F68A 4EUVA 3ICYA 1G28A 3T4OA 5J7EA 3BY8A 4R3AA 1X0OA 4HI4A 1IOUA 3MQQA 3FPVA 2VV8A 3UMEA 3TRCA 3CUEA 2LB5A 1ZHHB 4PHTA 2V1AA 3IS2A 3R7WA 3IBRA 4H6JA 2W1TA 4FSFA 4PAUA 4MMNA 5HSQA 2I9VA 2XA7S 3A0VA 3LICA 2YKHA 1VB6A 1MKMA 1UWPX 1H3QA 4MCWA 4Q0JA 4LLOB 2K2NA 4GS9B 2GJ3A 1N9LA 2WKRA 3LIAA 3PBTA 5HDSA 2O9BA 2J3TC 2FH5A 2VEAA 3UB7A 4O0PA 1S4SA 4IJGA 2PYRA 4LPZA 5AVEA 1XJ2A 4JGRA 1LSXA 5L8MA 3ZYTA 3OCNA 3OOVA 3NOPC 1V9ZA 5HL6A 1BYWA 5F5YA 2LB9A 2J3TD 1H8MA 4OOMA 4HY8A 1JNUA 2QWSA 3EQVA 2HJEA 2XA7M 3BWLA 1DP8A 2GX5A 2VV6A 3JVVA 3T4KA 2A2LA 4CQHA 3PBSA 4GHIA 3IBJA 4MN5A 3VE4A 4L9GA 2DMWA 2VA0A 5KSHA 1GSWA 3RTYA 2YKFA 2NUTC 2JKRM 4FOFA 5HWVA 1G6OA 4HIAA 3P01A 2W1RA 2KLIA 3T4LA 3BJNA 4OOLA 5A8BA 1OTEA 3F1NA 2KDKA 1YAXA 5MC7A 4R38A 1MZUA 2HJ9C 5DFXA 4L0LA 1S66L 2V1BA 4ARZA 1NWZA 5DF9A 2JKTM 2L1MA 4HHDA 1W63M 2JN7A 5J3WA 3MMHA 1Y28A 3T4JA 1N9NA 2QJ7A 4HQAA 2XSSA 1XJ3A 5DKLA 4GCZA 2M1CA 1T18A 1NLZA 5CX7A 2PR6A 2HF6A 3S7NA 2W3DA 4I5SA 4EXOA 4Q0HA 4WELA 4I3JA 4NXEA 1TS8A 1YSQA 3EGXC 3PBRA 5HDCA 1KOUA 3PXPA 5C5KA 4LRZE 1V9YA 4HNBA 1YKDA 2O0YA 2M7UA 5DJTA 4BBVA 3F1OB 4I3AA 4G3KA 3HJIA 1OPXA 3E4PA 3IS2B 3K2NA 1OT9A 5AVFA 1W63Q 2W1TB 4GW9A 4H6JB 3LR5A 5DFYA 2V0UA 2OWHA 2W3EA 4K08A 3LIDA 4DJ3A 2ZOIA 4CLCA 2B18A 4EW7A 4PKYA 1D06A 4PKYG 4IUKA 4M4XA 4NEED 3OBFA 5IT5A 3NOTC 2VLGA 3OC2A 1TS6A 3LI8A 1P9WA 2OAP1 1MC0A 2VX8A 3NOUC 3JVUA 3EQUA 1OT6A 5TBMB 2OAQ1 4KUOA 4HH2A 3PHYA 1P97A 4UQIS 1OJ5A 4DMZA 1LT0A 2V9AA 3UB6A 4KQOA 2KOIA 4LRYC 4YNRA 4GHIB 5EFWA 3EGDC 4HJ6A 2VGLS 4B9OA 2GNXA 1EW0A 3A0SA 3KSHA 2PDRA 1DP9A 2D01A 2Z6CA 3CLOA 4BJPA 4XT2B 1STZA 3C38A 3EWKA 3RFBA 1TS0A 1TS7A 1S1ZA 2QJ5A 4ZRRA 2PT7A 4P6ZS 4I3IA 4UQIM 4KQDA 4WF0A 2HV1A 4WLAA 4Q0IA 3UE6A 3UB9A 4G3VA 4ARZB 3B33A 3VE3A 1OTIA 4GLQA 4DJ2A 3OLOA 2JKRI 2VGLM 2A24A 3LIBA 4MDZA 2EWVA 3F1PA 1DRMA 2EA9A 1S67L 2P08A 2K7SA 2PHYA 4EEPA 2R78A 3K3DA 4UEYA 1P0ZA 3LIEA 4IUHA 1TF1A 3H82B 3OCLA 4JGPA 4LRXC 3LR3A 4IHQA 5HD3A 1GSXA 1F9IA 2P7JA 4L9FA 2H28A 3FPWA 2VJWA 4EQ1A 2INWA 5IU1A 3LFVA 3LR0A 4MN6A 2QHKA 1T1AA 3CWFA 3H7WA 2QYBA 4P6ZM 3B42A 1IFQA 2W3FA 3UMDA 1XFQA 3H9WA 2G7UA 2JKTI 2GZAA 4ETZA 3U2AA 1TD5A 1UGUA 3K3CA 3T4SA 1T1CA 4JGQA 2Y8HA 4BWIA 3TE8A 1D7EA 3S7PA 2XROA 1F98A 2IA2A 1T1BA 4HP9A 1NRJA 3O5YA 5HWTA 5G4ZA 4CLCE 3RH8B 4NXFA 3MQ0A 4E04A 3VOLA 5J4EA 3MQOA 4NXBA 1LL8A 1ODVA 4HH3A 3EEHA 1YSPA 4WN5A 5DKKA 3R7WB 5IS1A 3VV4A 2EWWA 4HJ4A 3MXQA 3A0RA 5I5LA 3CUEC 3PR6A 2V0WA 4F3LA 3GDIA 5K5BA 2ZMVA 3E98A 5AJGA 2WKQA 2J3WA 4EESA 2ZBBA 3KSIA 3E4OA 3NJAA 3EOIA 1XJ4A 2O9CA 4II7A 4R6LA 2B02A 1N9OA 1OTDA 4I39A 3W2ZA 4WL9A 3KYZA 2W27A 1WA9A 2J80A 5HZHA 4B93A 3MF0A 2PR5A 3F1OA 2D02A 1S4RA 5TJJA 1OTBA 4KUKA 3D3OA 3ULFA 3E4QA 2Z6DA 3C30A 3KX0X 2XRNA 4YOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BAS A;  3LYX A;  4EEU A;  3LUQ A;  3UB8 A;  4HP4 A;  3FC7 A;  5DJU A;  1UWN X;  3LI9 A;  4HJ3 A;  3T50 A;  3F1N B;  4BBU A;  2JHE A;  1GSV A;  1OJG A;  2A24 B;  3SW1 A;  1LSV A;  2OWJ A;  3F1P B;  3MFX A;  5TBM A;  4GS9 A;  2ZOH A;  4HOI A;  2VV7 A;  1XJ6 A;  4RQ9 A;  5F6A A;  3BY9 A;  4WUJ A;  4NXG A;  3H7W B;  2PYP A;  4YWZ A;  4EER A;  3G6O A;  1S1Y A;  5KIZ A;  3PYP A;  3MR0 A;  3MJQ A;  3FG8 A;  4XT2 A;  2PD7 A;  5HDD A;  3NHQ A;  4I38 A;  1DP6 A;  3GEC A;  2CMN A;  1LSW A;  4JGO A;  2KX6 A;  1OTA A;  3LIF A;  3C8C A;  4L9E A;  4F3L B;  3H82 A;  2W0N A;  3CAX A;  3D72 A;  5HWW A;  5G4Y A;  2WKP A;  2L4R A;  2L0W A;  3P7N A;  1T19 A;  2OOL A;  4EET B;  3C2W A;  3ZQ5 A;  3HJK A;  4R70 A;  5F69 A;  2QKP A;  4BBT A;  1XFN A;  5HD5 A;  2PD8 A;  5F68 A;  3ICY A;  1G28 A;  5J7E A;  3BY8 A;  4R3A A;  1X0O A;  4HI4 A;  3MQQ A;  2VV8 A;  3UME A;  2V1A A;  3IS2 A;  3IBR A;  4H6J A;  5HSQ A;  2I9V A;  3A0V A;  3LIC A;  2YKH A;  1VB6 A;  1UWP X;  4LLO B;  4GS9 B;  2GJ3 A;  1N9L A;  2WKR A;  3LIA A;  5HDS A;  2VEA A;  3UB7 A;  1S4S A;  2PYR A;  4LPZ A;  5AVE A;  1XJ2 A;  4JGR A;  1LSX A;  3NOP C;  1V9Z A;  1BYW A;  5F5Y A;  4HY8 A;  1JNU A;  2QWS A;  3BWL A;  1DP8 A;  2VV6 A;  4GHI A;  4MN5 A;  3VE4 A;  4L9G A;  1GSW A;  3RTY A;  2YKF A;  5HWV A;  4HIA A;  5A8B A;  1OTE A;  3F1N A;  2KDK A;  4R38 A;  1MZU A;  1S66 L;  2V1B A;  1NWZ A;  2L1M A;  4HHD A;  2JN7 A;  5J3W A;  1Y28 A;  1N9N A;  2QJ7 A;  4HQA A;  1XJ3 A;  5DKL A;  4GCZ A;  2M1C A;  1T18 A;  2PR6 A;  4I5S A;  4EXO A;  4I3J A;  4NXE A;  1TS8 A;  5HDC A;  1KOU A;  4LRZ E;  1V9Y A;  4HNB A;  5DJT A;  4BBV A;  3F1O B;  4I3A A;  3HJI A;  3E4P A;  3IS2 B;  1OT9 A;  5AVF A;  4H6J B;  4GW9 A;  2V0U A;  2OWH A;  4K08 A;  3LID A;  4DJ3 A;  2ZOI A;  4EW7 A;  4PKY A;  1D06 A;  4PKY G;  4M4X A;  3NOT C;  2VLG A;  1TS6 A;  3LI8 A;  3NOU C;  1OT6 A;  5TBM B;  4KUO A;  4HH2 A;  3PHY A;  1P97 A;  1OJ5 A;  1LT0 A;  2V9A A;  3UB6 A;  4LRY C;  4GHI B;  5EFW A;  4HJ6 A;  4B9O A;  1EW0 A;  3A0S A;  2PDR A;  1DP9 A;  2D01 A;  2Z6C A;  3CLO A;  4XT2 B;  3EWK A;  1TS0 A;  1TS7 A;  1S1Z A;  2QJ5 A;  4I3I A;  4KQD A;  4WF0 A;  2HV1 A;  4WLA A;  3UE6 A;  3UB9 A;  3B33 A;  3VE3 A;  1OTI A;  4DJ2 A;  3OLO A;  2A24 A;  3LIB A;  3F1P A;  1DRM A;  2EA9 A;  1S67 L;  2PHY A;  2K7S A;  4EEP A;  2R78 A;  3K3D A;  1P0Z A;  3LIE A;  3H82 B;  4JGP A;  4LRX C;  5HD3 A;  1GSX A;  1F9I A;  2P7J A;  4L9F A;  2H28 A;  4EQ1 A;  2INW A;  5IU1 A;  4MN6 A;  2QHK A;  1T1A A;  3CWF A;  3H7W A;  3UMD A;  1XFQ A;  3H9W A;  1UGU A;  3K3C A;  1T1C A;  4JGQ A;  1D7E A;  1F98 A;  1T1B A;  4HP9 A;  5HWT A;  5G4Z A;  3RH8 B;  4NXF A;  4E04 A;  3VOL A;  5J4E A;  3MQO A;  4NXB A;  1LL8 A;  1ODV A;  4HH3 A;  3EEH A;  4WN5 A;  5DKK A;  5IS1 A;  4HJ4 A;  3MXQ A;  3A0R A;  5I5L A;  2V0W A;  4F3L A;  3GDI A;  2WKQ A;  4EES A;  2ZBB A;  3E4O A;  3NJA A;  1XJ4 A;  4R6L A;  2B02 A;  1N9O A;  1OTD A;  4I39 A;  4WL9 A;  2W27 A;  1WA9 A;  2J80 A;  5HZH A;  2PR5 A;  3F1O A;  2D02 A;  1S4R A;  1OTB A;  4KUK A;  3ULF A;  3E4Q A;  2Z6D A;  3KX0 X; 
#chains in the Genus database with same CATH topology
 4U0T A;  4E3N A;  3VP2 A;  3E0Y A;  2JHE A;  1ES4 A;  1OJG A;  1FIK A;  3T12 B;  5CGW A;  2A24 B;  4GD8 A;  3IQA A;  3BEC A;  4E3L A;  4N1H A;  4O8G A;  4HOI A;  1XJ6 A;  5F6A A;  1F5M A;  3T4T A;  3HLC A;  1NLY A;  3BY9 A;  3AGE A;  4WUJ A;  5L10 A;  3H7W B;  4BD1 A;  2HGV A;  4OQ0 A;  5CTM A;  2VZW A;  4YWZ A;  1ZTU A;  1W7F A;  2R9X A;  3BM6 A;  3PYP A;  3MR0 A;  3MZF A;  2MJ6 A;  3VP1 A;  3KSF A;  3MZE A;  3ISG A;  3KYE A;  5KZH A;  2HDU A;  2WGW A;  2EXA A;  3V5M A;  3NHQ A;  4MN7 A;  3WRT A;  1L3L A;  4EWF A;  1LSW A;  4BL2 A;  4IBX A;  1OTA A;  3C8C A;  3CIT A;  3ZNY A;  4ZJ1 A;  2HDQ A;  5BOH A;  3H82 A;  1KVL A;  3D72 A;  5HWW A;  2ZJ9 A;  2FFY A;  4IVI A;  2L0W A;  1T19 A;  4JLF A;  2XD5 A;  2ZMF A;  3KO6 A;  4BMW A;  5F69 A;  4BBT A;  5A93 A;  2QKP A;  2O99 A;  1C3B A;  3Q7V A;  4EU0 A;  4CLC D;  4ZAM A;  4JF6 A;  3V67 A;  5F68 A;  1K38 A;  1W5D A;  1IKI A;  3A3I A;  1X0O A;  4OQI A;  4HI4 A;  3FPV A;  3T1S A;  3UME A;  5L07 A;  2LB5 A;  1W8Y A;  3PAG A;  3IS2 A;  4QB8 A;  4P85 A;  1Z6F A;  3CZD A;  5FQQ A;  5HSQ A;  2Y2N A;  2BTF P;  1KE4 A;  4MCW A;  3BLS A;  3DTK A;  4E3K A;  1HLU P;  3IF6 C;  1N9L A;  3E2L A;  2WKR A;  3PBT A;  5HDS A;  2O9B A;  4GZB A;  3WS4 A;  1KGG A;  3N6I A;  2VEA A;  4O0P A;  5GL9 A;  4IJG A;  2XEP A;  1KGF A;  4XXR A;  4LPZ A;  4JGR A;  5EUA A;  1V9Z A;  3T1Q B;  1YLZ A;  1BYW A;  5GLD A;  2JE5 A;  3MXR A;  3O86 A;  5FAT A;  1L0F A;  3N4I A;  3O88 A;  2VV6 A;  3JVV A;  5M19 A;  3PBS A;  1CI9 A;  4DKI A;  1GSW A;  2YKF A;  3CPT B;  2WGW B;  3SS5 A;  1JWV A;  2Y91 A;  2KLI A;  4OOL A;  1H8Y A;  2C6W B;  3S1Y A;  2ZL1 A;  1I2W A;  5D3O A;  2PBY A;  4E3J A;  1W8Q A;  2E8I A;  1S66 L;  1LI0 A;  1NYM A;  1K55 C;  1TEM A;  5CTN A;  4ZJ2 A;  5AQ9 A;  2L1M A;  3A3J A;  4HHD A;  3BEB A;  1BLS A;  4R4R A;  3MMH A;  5DF8 A;  5J3W A;  3V50 A;  2V1Z A;  1ZG4 A;  3LGO A;  5DKL A;  5FAP A;  1HTZ A;  4Z9Q A;  3ZG7 B;  4E3I A;  4D60 A;  3G31 A;  2PR6 A;  5DTT A;  3B3X A;  3Q7V B;  3ITB A;  1ES5 A;  4Q0H A;  1YSQ A;  5FQJ A;  4EBP A;  4HNB A;  2O0Y A;  4RX3 A;  3L7H A;  4BBV A;  4HES A;  4I3A A;  3IXG A;  2Y2M A;  1K6R A;  3IS2 B;  1OT9 A;  1FOF A;  4GW9 A;  5DFY A;  1PRQ A;  1ES3 A;  5GLB A;  2V0U A;  1RCJ A;  5F82 A;  2ZOI A;  4EW7 A;  4PKY A;  4IUK A;  4M4X A;  2ZC3 B;  3VSL A;  4JXS A;  3C4P A;  4HEF A;  4P0M A;  3JVU A;  3GQZ A;  4HH2 A;  4JXV A;  1AWI A;  5M1A A;  4UQI S;  4DMZ A;  4F94 A;  5M18 A;  2EXB A;  3IH8 A;  3FKV A;  4KZ9 A;  4Q8I A;  4KZ5 A;  3HVF A;  4CPK A;  1EW0 A;  3D9Y A;  5HL1 A;  3A0S A;  4MBH A;  3SS4 A;  2PDR A;  3HLW A;  5JYP A;  1BLH A;  4Y0U A;  3IF6 A;  1DP9 A;  4ZDX A;  4BJP A;  3IWI A;  3C38 A;  2HZ5 A;  4S2M A;  2JC7 A;  4UQI M;  4KQD A;  3RJU A;  2HV1 A;  4WLA A;  2JBF A;  3NC8 A;  3UB9 A;  5KMW A;  3IXH A;  2JKR I;  4N92 A;  2Y2J A;  3F1P A;  5FAQ A;  5FAO A;  1FR6 A;  2R78 A;  1PWC A;  1ALQ A;  1IEL A;  4IHQ A;  3HUN A;  2JKF A;  2UV0 E;  4EQ1 A;  1G5U A;  2WKE A;  2QPN A;  3MSH A;  2W3F A;  2Y2I A;  3IWQ A;  2Y2G A;  3HL9 A;  4IVK A;  2G7U A;  5CGS A;  5EE8 A;  3QP5 A;  2GZA A;  3QP1 A;  1TD5 A;  3UN7 A;  2Y8H A;  3BFG A;  1K55 A;  4K0X A;  5HAP A;  2PU2 A;  5CHU A;  1F98 A;  3O5Y A;  2XF3 A;  5G4Z A;  1L2S A;  3G32 A;  4NXF A;  3MQ0 A;  3WWX A;  1CK3 A;  4HH3 A;  3ZVW A;  3C7V A;  2A3U A;  3EEH A;  1YSP A;  4WZ5 C;  3MXS A;  5IS1 A;  4LCM A;  2IWC A;  3ZCZ A;  3CUE C;  4F3L A;  3GDI A;  4X25 A;  2OV5 A;  2IWD A;  2ZMV A;  1BZA A;  3E98 A;  5AJG A;  5EV0 A;  3BYD A;  4OP8 A;  1YLY A;  2EX2 A;  1O07 A;  5JYO A;  3W2Z A;  2X01 A;  2W27 A;  4FD8 A;  5HZH A;  2Y2O A;  3MF0 A;  2RCX A;  1S4R A;  5U47 A;  3VP3 A;  1JTD A;  1OTB A;  3ZGA B;  4X56 A;  4LV1 A;  3FKW A;  1TDL A;  1VM1 A;  1Y4O A;  4Y0O A;  4C6Y A;  3RXX A;  3ULF A;  4RYE A;  4S2L A;  3VOY A;  2XRN A;  5FSR A;  3VP0 A;  4EEU A;  4B4X A;  3BFD A;  2I72 A;  4HP4 A;  4HJ3 A;  3LI9 A;  3S7O A;  3ZDJ A;  2VKS A;  4AFI A;  1SZV A;  1ERO A;  3F1P B;  3R4K A;  3UY6 A;  3T4Q A;  5EVI C;  5TBM A;  4GS9 A;  5HPF A;  1XA1 A;  4RQ9 A;  1WYB A;  1F2K A;  1XP4 A;  3KSG A;  4NXG A;  4QY6 A;  1K56 A;  4JXG A;  4LFU A;  4XUX A;  1Q2P A;  1W79 A;  1P9R A;  1S1Y A;  3MJQ A;  4P87 A;  5E2H A;  3B47 A;  3UE3 A;  5AQB A;  3M2J A;  2Y2L A;  4PM6 A;  4Z1W A;  2V8F A;  4JXW A;  4X1M A;  1PI4 A;  1DP6 A;  1N9B A;  1GHM A;  1GHP A;  2KX6 A;  1IYQ A;  5FI6 A;  3LIF A;  3M2K A;  3RXW A;  3OPH A;  4F3L B;  4CLC B;  1KE3 A;  3ZG9 B;  2W0N A;  4PMA A;  4MNR A;  4DRT A;  5G4Y A;  3HCY A;  2WKP A;  3KYQ A;  3S7Q A;  3P7N A;  4N9L A;  4EET B;  1TVF A;  3ZQ5 A;  1ES2 A;  3HJK A;  2M7V A;  1XFN A;  5FA7 A;  5DVA A;  2ZLY A;  2PD8 A;  3GTC A;  1G28 A;  1CF0 A;  1DJC A;  2X71 A;  4WZ5 A;  5FEG A;  2Y4A A;  2X02 A;  3CUE A;  4PHT A;  1JTG A;  2Y55 A;  3LEZ A;  4H6J A;  2H10 A;  4MMN A;  2I9V A;  3LIC A;  1H0M A;  4OPY A;  2CC1 A;  2YKH A;  3WS1 A;  4E3O A;  2PBD P;  5HFO A;  3PAE A;  2ZQ8 A;  2P9V A;  4Q0J A;  5CEB A;  1H8Z A;  4GS9 B;  1VET A;  3M6B A;  4PM5 A;  1IYO A;  2J3T C;  5FQK A;  4ZJ3 A;  1PZP A;  3HLE A;  4GN2 A;  3NOP C;  1PFL A;  3A3E A;  5F5Y A;  4OOM A;  4NET A;  3EQV A;  1GA0 A;  5A92 A;  5E2G A;  3T4K A;  2A2L A;  4GHI A;  2Y2Q A;  4X6T A;  3IBJ A;  1MWS A;  2VA0 A;  5EM0 A;  5KSH A;  1HZO A;  3RTY A;  2JKR M;  5HWV A;  1A0K A;  1VEU A;  3P01 A;  4KZ3 A;  5EVI A;  5A8B A;  1OTE A;  3F1N A;  2HPB A;  3BLM A;  3ZFZ A;  5MC7 A;  1IKG A;  1YLW A;  2XK1 A;  2E8J A;  1MZU A;  1K57 A;  2HJ9 C;  4B4Z A;  5DFX A;  4OPZ A;  2PAV P;  1L0D A;  4OH0 A;  2RL3 A;  4GCZ A;  4NK3 A;  2M1C A;  3WS5 A;  3OPL A;  1GHI A;  1NLZ A;  5CX7 A;  3S7N A;  4OLD A;  1XA7 A;  3SH9 A;  2OSU A;  4IED A;  1ESU A;  4I5S A;  2V8C A;  4HBT A;  4WEL A;  5EM1 A;  3EGX C;  5HDC A;  1KOU A;  3C4O A;  2M7U A;  3G2Y A;  3LO7 A;  1N4O A;  4G3K A;  4QWO A;  3E4P A;  1PW1 A;  1FCM A;  2XH9 A;  5FQM A;  1E4D A;  4H6J B;  3NBL A;  2W3E A;  2QZ6 A;  2XDM A;  3LID A;  4DJ3 A;  1YLP A;  2B18 A;  4QU3 A;  1PWG A;  2P9V B;  3IXB A;  3ITA A;  4Y17 A;  4NEE D;  1CJF A;  3OBF A;  2GDN A;  4EBN A;  3NIA A;  4UHU A;  2V2F F;  1TS6 A;  1P9W A;  1FSY A;  3GV9 A;  3VFH A;  4GDB A;  2WGI A;  4UA7 A;  2HP6 A;  2XD1 A;  1OT6 A;  4KUO A;  2Y2H A;  3HLG A;  1LT0 A;  5HX9 A;  1ZKJ A;  3NDG A;  5GHX A;  4YNR A;  4GHI B;  5EFW A;  3GVB A;  2JCH A;  4DF6 A;  2J7V A;  3HUO A;  1KE0 A;  1ERM A;  2WK0 A;  4K91 A;  3GR2 A;  3CLO A;  5EPH A;  1STZ A;  3EWK A;  2IWB A;  4ZBE A;  1TS0 A;  4C3Q A;  3IX8 A;  3IF5 A;  4I3I A;  4KQQ A;  3UO9 A;  2ZC6 B;  5HAQ A;  1K56 D;  4Q0I A;  5EOE A;  4E3M A;  3ZVT A;  3VE3 A;  4PM8 A;  2VGK A;  4MDZ A;  2P08 A;  2K7S A;  4OPR A;  1RGZ A;  3VFF A;  3H82 B;  2WAF A;  3LR3 A;  4S2K A;  4OON A;  1E25 A;  3P98 A;  1YLJ A;  2VJW A;  2INW A;  5IU1 A;  1I2S A;  2WKH A;  3LR0 A;  4FH2 A;  4MN6 A;  3HRE A;  2ZQD A;  1LLB A;  3IHA A;  4E6W A;  3UE1 A;  1CEF A;  3L9K A;  1XX2 A;  1I5Q A;  5CGX A;  3H9W A;  2JKT I;  3VP4 A;  3G2Z A;  1SCW A;  1UGU A;  3T4S A;  1T1C A;  3N8L A;  4UA9 A;  4R23 A;  3MZD A;  2XRO A;  3PTE A;  1NRJ A;  4CLC E;  4E04 A;  2Q9N A;  3CG5 A;  3MQO A;  1LL8 A;  3QP4 A;  1ODV A;  4PPR A;  2WZZ A;  4OOY A;  5DKK A;  5FDH A;  1YT4 A;  2ZM0 A;  3O87 A;  5CHM A;  3FV7 A;  3W4P A;  4R3J A;  4HJ4 A;  3A0R A;  3PR6 A;  1FR1 A;  1BLP A;  3QHY A;  3BRM A;  4O7D A;  1ERQ A;  2WZX A;  4MLL A;  1MWR A;  3EOI A;  3HLD A;  1NZO A;  2O9C A;  4II7 A;  5A91 A;  2B02 A;  1U60 A;  4WL9 A;  4YFM A;  3NUL A;  1WA9 A;  2J80 A;  3HBR A;  4B93 A;  1J9M A;  2PR5 A;  3F1O A;  3N8S A;  5GHY A;  2HDS A;  4RX2 A;  4A5R A;  1Q2Q A;  4JPM A;  3TSG A;  3C30 A;  4RA7 A;  1KGE A;  3SOI A;  2BAS A;  3G34 A;  4S2I A;  5F1F A;  3LYX A;  3OZH A;  4JF4 A;  3LUQ A;  3UB8 A;  4Y2F A;  3FC7 A;  1UWN X;  1VHM A;  5DJU A;  1VQQ A;  2FZ0 A;  2HDR A;  1FSW A;  5CRF A;  2ZL1 B;  3SW1 A;  1LSV A;  2ZOH A;  3U4L P;  5TR7 A;  2VV7 A;  5I94 A;  1NY0 A;  2H0Y A;  4OVD A;  5G18 A;  3GRJ A;  2ZQC A;  4OLG A;  5FQ9 A;  3C5A A;  3AGD A;  5EVI D;  1BUE A;  3PBO A;  2PYP A;  3BW6 A;  3UB5 P;  4EER A;  3QP2 A;  4KZ7 A;  3G6O A;  4EQI A;  3IXD A;  2Y59 A;  4N9K A;  5L2F A;  4WEK A;  3FG8 A;  3BFF A;  3HLF A;  4OQG A;  1G6A A;  4DN0 A;  4XT2 A;  3PBQ A;  3E2K A;  5DTK A;  3DAV A;  2C5W B;  5HPI A;  4WYY A;  4E6X A;  4CJN A;  3UPN A;  4P6B A;  3M6H A;  2CMN A;  1JVJ A;  3W4O A;  1NZU A;  3EEA A;  4BEN A;  4L9E A;  3NEC A;  4S2N C;  4WM9 A;  5FL3 A;  2Y79 A;  2WUQ A;  2XFS A;  3DBA A;  1PZO A;  3SH8 A;  2W3H A;  3UDX A;  2P04 A;  4NKP A;  2O9A A;  4R4S A;  4QPR A;  2OOL A;  3GSG A;  3C2W A;  2ZQ7 A;  3BQA A;  4ME4 A;  2P74 A;  5GLA A;  4ETX A;  4R70 A;  3LR4 A;  5LBR A;  3IT9 A;  1NRF A;  4LCL A;  3W4Q A;  5DTS A;  1YLT A;  4EUV A;  3A3F A;  3ICY A;  5J7E A;  3MS6 A;  3BY8 A;  4EUZ A;  2BG1 A;  4R3A A;  3UNW A;  1OME A;  2VV8 A;  1QME A;  2EX9 A;  2FFF B;  1KDS A;  4H8R A;  2XLN A;  3R7W A;  3IBR A;  4FSF A;  5EEC A;  5AQ7 A;  3IF6 B;  4R3B A;  2XA7 S;  1ZG6 A;  1MKM A;  3QNC A;  1H3Q A;  1PIO A;  4LLO B;  2K2N A;  2GJ3 A;  2ZC5 B;  4KZ8 A;  3LIA A;  4X55 A;  4MBK A;  4KG6 A;  3UB7 A;  3SS3 A;  2DRW A;  3NDE A;  5AVE A;  1XJ2 A;  5L8M A;  5HL6 A;  1TDG A;  2Q0O A;  2J3T D;  1WYC A;  5F83 A;  4S2O A;  1JNU A;  2QWS A;  3MBZ A;  2XA7 M;  1DP8 A;  1PYY A;  2DMW A;  4FOF A;  1G6O A;  3DWZ A;  3T4L A;  3BJN A;  3Q81 A;  1YAX A;  3V3R A;  5FEF A;  4XUZ A;  1EWZ A;  2WGV A;  4L0L A;  5FAS A;  4DE3 A;  4U3T A;  4WZ4 A;  1FCO A;  1GCE A;  1K4F A;  5DF9 A;  2JKT M;  4GOG A;  2JN7 A;  1Y28 A;  1T18 A;  2ZC4 B;  1LHY A;  4MEZ A;  4S2P A;  2W3D A;  2XGN A;  5A90 A;  4KG2 A;  2WAD A;  4DE0 A;  4HBU A;  4QHC A;  4NXE A;  3PBR A;  3VOZ A;  3PXP A;  2PU4 A;  1YQS A;  4LRZ E;  5C5K A;  3VMA A;  1YKD A;  4OPQ A;  1M40 A;  5DJT A;  3LY4 A;  2QMI A;  4IBR A;  4KG5 A;  3HJI A;  3W8K A;  1OPX A;  4S2N A;  3FYZ A;  2XQZ A;  1NJ4 A;  3G4P A;  4JKT A;  2G2W A;  5HW3 A;  1H5X A;  2BLS A;  1AXB A;  1D06 A;  4N1X A;  3O3V A;  4DE1 A;  5IT5 A;  4M3K A;  2J9P A;  5J8X A;  3NOT C;  1BUL A;  1EI5 A;  1MPL A;  3EQU A;  2WAE A;  5TBM B;  4YIN A;  1WE4 A;  1P97 A;  2V9A A;  4Y13 A;  3IX3 A;  4WMC A;  4KQO A;  1DJA A;  1S6R A;  4LRY C;  4HJ6 A;  2VGL S;  3UPP A;  1YMS A;  4B9O A;  2VGJ A;  3T1X A;  3FZC A;  3KSH A;  5CED A;  3AGF A;  1SHV A;  3S22 A;  3IX4 A;  1TS7 A;  4ZRR A;  1SDN A;  3TOI A;  1L0G A;  4ESP A;  4QD4 A;  2Q9M A;  4G3V A;  3B33 A;  1K6S A;  4DJ2 A;  2VGL M;  3NCK A;  2EA9 A;  2PHY A;  1S67 L;  5TGF A;  4EEP A;  2ZM8 A;  4OQH A;  3K3D A;  2J8Y A;  4UEY A;  1P0Z A;  4IUH A;  1TF1 A;  3OCL A;  5CXW A;  5E2F A;  4JGP A;  4LRX C;  1GSX A;  1F9I A;  2P7J A;  2H28 A;  3FPW A;  5FQI A;  1ACF A;  3LFV A;  1YMX A;  3N7W A;  1SKO A;  1D1J A;  4PM7 A;  3B42 A;  4GD6 A;  1IFQ A;  2XR0 A;  3UMD A;  3CPT A;  2WYX A;  1BTL A;  3DTE A;  3K3C A;  4BL3 A;  4BWI A;  4FH4 A;  1PWD A;  3TE8 A;  1D7E A;  3S7P A;  2IA2 A;  4LEN A;  3C7U A;  5KSC A;  5J4E A;  1PI5 A;  5L09 A;  3V39 A;  1E3U A;  3VV4 A;  2EWW A;  1LL9 A;  1K0K A;  1XGJ A;  2OLV A;  3LCE A;  2V0W A;  5K5B A;  2WKQ A;  2J3W A;  1VET B;  4EES A;  2ZBB A;  3KSI A;  3E4O A;  3NJA A;  3QP8 A;  1XJ4 A;  4QJG A;  3WS2 A;  4R6L A;  3UDI A;  1O7E A;  1N9O A;  1ONG A;  2D02 A;  1HVB A;  5TJJ A;  1FQG A;  2R9W A;  4KUK A;  2EX6 A;  5EVL A;  4JF5 A;  2ZM2 A;  3ZHH A;  4YOF A;  1SKF A;  2Y2P A;  3DTM A;  1VEU B;  3I7J A;  4FCF A;  4G3W A;  4MBF A;  5DF7 A;  5EVI B;  3ZNT A;  3T50 A;  3IWO A;  4BBU A;  1PW8 A;  3F1N B;  2Z2M B;  5CEC A;  1GSV A;  1MXO A;  1CEG A;  5FDS A;  2W3G A;  2OWJ A;  1MBL A;  3CI6 A;  3MFX A;  1NXY A;  1RP5 A;  4OP5 A;  4X1L A;  3UPO A;  2HP9 A;  4O01 A;  3HUM A;  4X69 A;  4RVA A;  5HAR A;  3JPU A;  4GB7 A;  1SKO B;  3ZG5 A;  4EV4 A;  2DCF A;  5KIZ A;  1QMF A;  4X68 A;  3Q82 A;  1YM1 A;  4X53 A;  3TJZ C;  2XFT A;  2EFU A;  3OPR A;  2PD7 A;  5HDD A;  4I38 A;  3GEC A;  3NY4 A;  2Y2K A;  2K31 A;  3CJM A;  3BQ8 A;  1FCN A;  4Y5F A;  4JGO A;  4WEJ A;  1MKI A;  1ESI A;  2VK3 A;  1K54 C;  3Q1F A;  2NUP C;  4B88 A;  3CAX A;  3TW8 A;  2B95 A;  1MY8 A;  3PBN A;  4CLC C;  2L4R A;  2ZQA A;  4Y15 A;  3D4F A;  4GJ4 A;  4Y3I A;  3NI9 A;  4R1G A;  5TFQ A;  5HD5 A;  3T4O A;  3DWK A;  1IOU A;  3MQQ A;  3TRC A;  4KZ6 A;  1KVM A;  1ZHH B;  1JWP A;  2V1A A;  3DTI A;  4PM9 A;  2W1T A;  4PAU A;  5EOO A;  3A0V A;  1RGY A;  5F1G A;  1VB6 A;  4WMC D;  1UWP X;  1DY6 A;  4WBG A;  5E2E A;  3MKF A;  4R0Q A;  4DDY A;  3T1R A;  2FH5 A;  4DXC A;  4U0X A;  1S4S A;  2H5S A;  2PYR A;  1Z09 A;  1LSX A;  3ZYT A;  3QP6 A;  3OCN A;  3OOV A;  5GHZ A;  5HAI A;  2LB9 A;  1H8M A;  3CMZ A;  4HY8 A;  5GLC A;  2HJE A;  3BWL A;  1ONH A;  2GX5 A;  1CQA A;  5IHV A;  3BFE A;  4CQH A;  4MN5 A;  3VE4 A;  5AQA A;  4L9G A;  1SDE A;  1IYS A;  4DXB A;  1J3W A;  3ZG0 A;  2NUT C;  3DW0 A;  4HIA A;  2W1R A;  1KDW A;  5E43 A;  2KDK A;  3BFC A;  4R38 A;  3MFD A;  4LV0 A;  4S2J A;  2AVX A;  3A3D A;  4LV2 A;  2V1B A;  4GKU A;  4ARZ A;  4GDN A;  1NWZ A;  1W63 M;  1HD8 A;  3S4X A;  3T4J A;  1N9N A;  2QJ7 A;  4HQA A;  2XSS A;  1XJ3 A;  3V3S A;  2OLU A;  1CI8 A;  2WKI A;  3UE0 A;  2ACG A;  1MWT A;  2HF6 A;  1PNE A;  4EXO A;  1L0E A;  4OKP A;  4I3J A;  1TS8 A;  4KEN B;  3SZT A;  3G30 A;  1V9Y A;  1LI9 A;  1E3U D;  3F1O B;  1K54 A;  1BLC A;  2EFX A;  3K2N A;  5AVF A;  1W63 Q;  2W1T B;  3LR5 A;  1JWZ A;  2OWH A;  1MWU A;  2G2U A;  4K08 A;  4CLC A;  1BSG A;  2UWX A;  4PKY G;  1DJB A;  4BD0 A;  2VLG A;  4FUW A;  3OC2 A;  4QY5 A;  1YPR A;  4KQR A;  4Y7P A;  3LI8 A;  2OAP 1;  1MC0 A;  2VX8 A;  3NOU C;  2EX8 A;  2PRF A;  2OAQ 1;  4C75 A;  5CHJ A;  3PHY A;  2DNS A;  1OJ5 A;  3P09 A;  3UB6 A;  1XGI A;  2KOI A;  3SH7 A;  2ZMA A;  3EGD C;  4UAA A;  3VSK A;  3IH9 A;  2GNX A;  4DDS A;  4ID4 A;  4BQM A;  1XPB A;  2D01 A;  2Z6C A;  4BLM A;  3GMW A;  4XT2 B;  3RFB A;  3LY3 A;  5CER A;  4GNU A;  3HLB A;  1S1Z A;  2QJ5 A;  3FWL A;  1K4E A;  2PT7 A;  4P6Z S;  4WF0 A;  4KZA A;  3WRZ A;  3UE6 A;  1NYY A;  1Y54 A;  4ARZ B;  3G35 A;  1OTI A;  4GLQ A;  4DE2 A;  1K57 C;  3OLO A;  4UA6 A;  3OPP A;  2A24 A;  3LIB A;  2EWV A;  1DRM A;  5EVE A;  3LIE A;  5HD3 A;  1BT5 A;  4L9F A;  2QHK A;  5FI7 A;  1T1A A;  2ZD8 A;  3TG9 A;  2ZC7 A;  3CWF A;  5FI2 A;  3H7W A;  2QYB A;  4P6Z M;  3N8R A;  1XFQ A;  4D2O A;  4ETZ A;  3U2A A;  4FTX A;  4JGQ A;  4Y0T A;  3CHW P;  4LGW A;  1ZC2 A;  1T1B A;  4HP9 A;  5HWT A;  3RH8 B;  1IYP A;  1GA9 A;  3VOL A;  4NXB A;  4WN5 A;  4KZB A;  3R7W B;  3Q7Z A;  3MXQ A;  3QNB A;  2ZQ9 A;  5I5L A;  2Z2L B;  4NG2 A;  1XXM A;  4KZ4 A;  3ZG8 B;  2A49 A;  1K25 A;  2V20 A;  3IHB A;  3UDF A;  2J9O A;  4I39 A;  1OTD A;  3KYZ A;  2H0T A;  4JBF A;  1G68 A;  3Q07 A;  1FIL A;  3MKE A;  4LV3 A;  1IEM A;  2B5R A;  1S0W A;  3D3O A;  1XKZ A;  3WS0 A;  1M6K A;  1LL5 A;  3E4Q A;  3JYI A;  2Z6D A;  4EBL A;  3KX0 X;  4K0W A;  2JKG A;  2HP5 A;  3LEQ A;  4ZTK A; 
#chains in the Genus database with same CATH homology
 2BAS A;  3LYX A;  4EEU A;  3LUQ A;  3UB8 A;  3E0Y A;  4G3W A;  4HP4 A;  4Y2F A;  3FC7 A;  1UWN X;  1VHM A;  3LI9 A;  4HJ3 A;  5DJU A;  3F1N B;  3T50 A;  2JHE A;  3S7O A;  4BBU A;  2FZ0 A;  2VKS A;  1GSV A;  1OJG A;  4AFI A;  2A24 B;  2W3G A;  3SW1 A;  1LSV A;  2OWJ A;  3F1P B;  3R4K A;  3T4Q A;  3CI6 A;  3MFX A;  5TBM A;  4GS9 A;  5HPF A;  2ZOH A;  4O8G A;  4HOI A;  2VV7 A;  1XJ6 A;  4O01 A;  4RQ9 A;  5F6A A;  1F5M A;  3T4T A;  1NLY A;  3BY9 A;  4WUJ A;  3KSG A;  4NXG A;  3PBO A;  3H7W B;  2PYP A;  2HGV A;  3BW6 A;  2VZW A;  4YWZ A;  4EER A;  3G6O A;  1ZTU A;  1P9R A;  1S1Y A;  5KIZ A;  3PYP A;  3MR0 A;  4WEK A;  2MJ6 A;  3MJQ A;  3FG8 A;  3B47 A;  3UE3 A;  4DN0 A;  3KSF A;  4XT2 A;  3PBQ A;  3TJZ C;  5HPI A;  4Z1W A;  2PD7 A;  5HDD A;  3NHQ A;  4MN7 A;  4I38 A;  1DP6 A;  3GEC A;  2K31 A;  3BQ8 A;  2CMN A;  4Y5F A;  1LSW A;  4JGO A;  4WEJ A;  2KX6 A;  1OTA A;  3LIF A;  3C8C A;  3CIT A;  3EEA A;  4L9E A;  4F3L B;  4CLC B;  3H82 A;  2W0N A;  2NUP C;  5FL3 A;  2Y79 A;  3CAX A;  3D72 A;  5HWW A;  3TW8 A;  5G4Y A;  3DBA A;  3HCY A;  2WKP A;  3PBN A;  4CLC C;  3KYQ A;  2L4R A;  2W3H A;  2P04 A;  4NKP A;  2O9A A;  2L0W A;  3S7Q A;  3P7N A;  4QPR A;  1T19 A;  2OOL A;  4EET B;  3C2W A;  2ZMF A;  3BQA A;  4GJ4 A;  4ME4 A;  3ZQ5 A;  3KO6 A;  4BMW A;  4ETX A;  3HJK A;  4R70 A;  3LR4 A;  2QKP A;  4Y3I A;  5F69 A;  5LBR A;  1XFN A;  2M7V A;  4BBT A;  2O99 A;  4EU0 A;  4CLC D;  3V67 A;  5HD5 A;  2PD8 A;  5F68 A;  4EUV A;  3ICY A;  1G28 A;  3T4O A;  5J7E A;  3BY8 A;  4R3A A;  1X0O A;  4HI4 A;  1IOU A;  3MQQ A;  3FPV A;  2VV8 A;  3UME A;  3TRC A;  3CUE A;  2LB5 A;  1ZHH B;  4PHT A;  2V1A A;  3IS2 A;  3R7W A;  3IBR A;  4H6J A;  2W1T A;  4FSF A;  4PAU A;  4MMN A;  5HSQ A;  2I9V A;  2XA7 S;  3A0V A;  3LIC A;  2YKH A;  1VB6 A;  1MKM A;  1UWP X;  1H3Q A;  4MCW A;  4Q0J A;  4LLO B;  2K2N A;  4GS9 B;  2GJ3 A;  1N9L A;  2WKR A;  3LIA A;  3PBT A;  5HDS A;  2O9B A;  2J3T C;  2FH5 A;  2VEA A;  3UB7 A;  4O0P A;  1S4S A;  4IJG A;  2PYR A;  4LPZ A;  5AVE A;  1XJ2 A;  4JGR A;  1LSX A;  5L8M A;  3ZYT A;  3OCN A;  3OOV A;  3NOP C;  1V9Z A;  5HL6 A;  1BYW A;  5F5Y A;  2LB9 A;  2J3T D;  1H8M A;  4OOM A;  4HY8 A;  1JNU A;  2QWS A;  3EQV A;  2HJE A;  2XA7 M;  3BWL A;  1DP8 A;  2GX5 A;  2VV6 A;  3JVV A;  3T4K A;  2A2L A;  4CQH A;  3PBS A;  4GHI A;  3IBJ A;  4MN5 A;  3VE4 A;  4L9G A;  2DMW A;  2VA0 A;  5KSH A;  1GSW A;  3RTY A;  2YKF A;  2NUT C;  2JKR M;  4FOF A;  5HWV A;  1G6O A;  4HIA A;  3P01 A;  2W1R A;  2KLI A;  3T4L A;  3BJN A;  4OOL A;  5A8B A;  1OTE A;  3F1N A;  2KDK A;  1YAX A;  5MC7 A;  4R38 A;  1MZU A;  2HJ9 C;  5DFX A;  4L0L A;  1S66 L;  2V1B A;  4ARZ A;  1NWZ A;  5DF9 A;  2JKT M;  2L1M A;  4HHD A;  1W63 M;  2JN7 A;  5J3W A;  3MMH A;  1Y28 A;  3T4J A;  1N9N A;  2QJ7 A;  4HQA A;  2XSS A;  1XJ3 A;  5DKL A;  4GCZ A;  2M1C A;  1T18 A;  1NLZ A;  5CX7 A;  2PR6 A;  2HF6 A;  3S7N A;  2W3D A;  4I5S A;  4EXO A;  4Q0H A;  4WEL A;  4I3J A;  4NXE A;  1TS8 A;  1YSQ A;  3EGX C;  3PBR A;  5HDC A;  1KOU A;  3PXP A;  5C5K A;  4LRZ E;  1V9Y A;  4HNB A;  1YKD A;  2O0Y A;  2M7U A;  5DJT A;  4BBV A;  3F1O B;  4I3A A;  4G3K A;  3HJI A;  1OPX A;  3E4P A;  3IS2 B;  3K2N A;  1OT9 A;  5AVF A;  1W63 Q;  2W1T B;  4GW9 A;  4H6J B;  3LR5 A;  5DFY A;  2V0U A;  2OWH A;  2W3E A;  4K08 A;  3LID A;  4DJ3 A;  2ZOI A;  4CLC A;  2B18 A;  4EW7 A;  4PKY A;  1D06 A;  4PKY G;  4IUK A;  4M4X A;  4NEE D;  3OBF A;  5IT5 A;  3NOT C;  2VLG A;  3OC2 A;  1TS6 A;  3LI8 A;  1P9W A;  2OAP 1;  1MC0 A;  2VX8 A;  3NOU C;  3JVU A;  3EQU A;  1OT6 A;  5TBM B;  2OAQ 1;  4KUO A;  4HH2 A;  3PHY A;  1P97 A;  4UQI S;  1OJ5 A;  4DMZ A;  1LT0 A;  2V9A A;  3UB6 A;  4KQO A;  2KOI A;  4LRY C;  4YNR A;  4GHI B;  5EFW A;  3EGD C;  4HJ6 A;  2VGL S;  4B9O A;  2GNX A;  1EW0 A;  3A0S A;  3KSH A;  2PDR A;  1DP9 A;  2D01 A;  2Z6C A;  3CLO A;  4BJP A;  4XT2 B;  1STZ A;  3C38 A;  3EWK A;  3RFB A;  1TS0 A;  1TS7 A;  1S1Z A;  2QJ5 A;  4ZRR A;  2PT7 A;  4P6Z S;  4I3I A;  4UQI M;  4KQD A;  4WF0 A;  2HV1 A;  4WLA A;  4Q0I A;  3UE6 A;  3UB9 A;  4G3V A;  4ARZ B;  3B33 A;  3VE3 A;  1OTI A;  4GLQ A;  4DJ2 A;  3OLO A;  2JKR I;  2VGL M;  2A24 A;  3LIB A;  4MDZ A;  2EWV A;  3F1P A;  1DRM A;  2EA9 A;  1S67 L;  2P08 A;  2K7S A;  2PHY A;  4EEP A;  2R78 A;  3K3D A;  4UEY A;  1P0Z A;  3LIE A;  4IUH A;  1TF1 A;  3H82 B;  3OCL A;  4JGP A;  4LRX C;  3LR3 A;  4IHQ A;  5HD3 A;  1GSX A;  1F9I A;  2P7J A;  4L9F A;  2H28 A;  3FPW A;  2VJW A;  4EQ1 A;  2INW A;  5IU1 A;  3LFV A;  3LR0 A;  4MN6 A;  2QHK A;  1T1A A;  3CWF A;  3H7W A;  2QYB A;  4P6Z M;  3B42 A;  1IFQ A;  2W3F A;  3UMD A;  1XFQ A;  3H9W A;  2G7U A;  2JKT I;  2GZA A;  4ETZ A;  3U2A A;  1TD5 A;  1UGU A;  3K3C A;  3T4S A;  1T1C A;  4JGQ A;  2Y8H A;  4BWI A;  3TE8 A;  1D7E A;  3S7P A;  2XRO A;  1F98 A;  2IA2 A;  1T1B A;  4HP9 A;  1NRJ A;  3O5Y A;  5HWT A;  5G4Z A;  4CLC E;  3RH8 B;  4NXF A;  3MQ0 A;  4E04 A;  3VOL A;  5J4E A;  3MQO A;  4NXB A;  1LL8 A;  1ODV A;  4HH3 A;  3EEH A;  1YSP A;  4WN5 A;  5DKK A;  3R7W B;  5IS1 A;  3VV4 A;  2EWW A;  4HJ4 A;  3MXQ A;  3A0R A;  5I5L A;  3CUE C;  3PR6 A;  2V0W A;  4F3L A;  3GDI A;  5K5B A;  2ZMV A;  3E98 A;  5AJG A;  2WKQ A;  2J3W A;  4EES A;  2ZBB A;  3KSI A;  3E4O A;  3NJA A;  3EOI A;  1XJ4 A;  2O9C A;  4II7 A;  4R6L A;  2B02 A;  1N9O A;  1OTD A;  4I39 A;  3W2Z A;  4WL9 A;  3KYZ A;  2W27 A;  1WA9 A;  2J80 A;  5HZH A;  4B93 A;  3MF0 A;  2PR5 A;  3F1O A;  2D02 A;  1S4R A;  5TJJ A;  1OTB A;  4KUK A;  3D3O A;  3ULF A;  3E4Q A;  2Z6D A;  3C30 A;  3KX0 X;  2XRN A;  4YOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...