2ZOIA

Neutron crystal structure of photoactive yellow protein, wild type, at 295k
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title Low-barrier hydrogen bond in photoactive yellow protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2zoiA00
3VOLA 2L0WA 3HJKA 4JGPA 3C2WA 3BY8A 3IBRA 4WL9A 1V9ZA 3LIAA 1UGUA 2R78A 4R38A 2W27A 5AVFA 2QJ7A 4LRYC 1DRMA 4EETB 1BYWA 5IS1A 3FG8A 3LIEA 3LI9A 3LI8A 4R70A 2P7JA 5DKKA 3ZQ5A 1OJ5A 3E4OA 3K3DA 4HJ4A 3GECA 2CMNA 1T19A 3MFXA 1S1YA 3K3CA 3OLOA 4NXEA 4E04A 1DP6A 2PHYA 2L4RA 3A0VA 1P0ZA 4EESA 1S66L 1F9IA 3GDIA 3H82A 5F6AA 4LLOB 1JNUA 3MXQA 1OTIA 1D06A 3F1OA 1N9OA 3UB9A 1XJ3A 1KOUA 3CLOA 3UE6A 5DJTA 4I3JA 1T1AA 2HV1A 2YKHA 1DP8A 2ZOIA 1S4SA 2B02A 3T50A 2EA9A 2Z6DA 1XJ4A 2V9AA 2W0NA 2KDKA 4GHIB 3LIDA 4BBTA 1OT6A 1V9YA 4DJ3A 3H7WA 1VB6A 1OTDA 1XJ6A 4NXFA 4I3AA 3VE3A 1GSWA 4WUJA 5HD5A 2L1MA 4EXOA 2D02A 5A8BA 1WA9A 4HH2A 4I38A 2OOLA 3MR0A 4HP4A 5AVEA 4M4XA 5DKLA 5HWWA 1Y28A 4XT2A 5HDDA 1N9LA 5F5YA 4NXBA 3H82B 3MQOA 2V1AA 3F1NA 4K08A 3RH8B 2KX6A 5I5LA 2QHKA 2WKRA 3F1OB 4EEUA 3E4PA 4H6JB 2M1CA 1OTBA 5EFWA 4EW7A 4HH3A 1D7EA 2BASA 4GS9B 3UB7A 2VLGA 3IS2B 4PKYA 1ODVA 4WLAA 2QJ5A 4F3LA 4DJ2A 5J7EA 3H7WB 3HJIA 1DP9A 3KX0X 1LSWA 2PD7A 2PYRA 1X0OA 1N9NA 3E4QA 5HZHA 2QKPA 5HD3A 4KQDA 3NJAA 3UB8A 4GW9A 4EQ1A 4HIAA 3G6OA 3NHQA 2VV7A 3F1PA 5TBMA 4I5SA 1UWPX 4EERA 4XT2B 1TS6A 4R6LA 3H9WA 1T1BA 4HNBA 3D72A 4HOIA 2ZOHA 3BWLA 3F1NB 2JHEA 3MJQA 2ZBBA 2I9VA 4JGQA 4PKYG 3UMDA 3LYXA 3LIFA 3EEHA 5IU1A 1LSVA 3PHYA 3UMEA 3CAXA 2QWSA 5KIZA 4HJ3A 4KUOA 4JGOA 3VE4A 3B33A 1GSVA 4JGRA 1NWZA 2YKFA 2VV8A 5HDSA 3SW1A 4I3IA 2JN7A 4HI4A 3ICYA 2VV6A 2K7SA 3NOUC 5TBMB 5HSQA 1F98A 1EW0A 3NOTC 1S1ZA 1S4RA 1TS7A 1TS0A 1G28A 4RQ9A 2H28A 3ULFA 2PD8A 4HHDA 4HP9A 3UB6A 2PR6A 3PYPA 4GHIA 4HJ6A 1OT9A 5DJUA 4WF0A 2WKPA 3A0RA 3LICA 4LPZA 1S67L 1LL8A 1OTEA 2A24A 3RTYA 1GSXA 4R3AA 1UWNX 4L9GA 4WN5A 2PR5A 2D01A 2PYPA 1XJ2A 4HY8A 1MZUA 4L9EA 1OJGA 1T1CA 2GJ3A 1OTAA 4I39A 2OWJA 3CWFA 3FC7A 2J80A 5J3WA 4MN5A 3A0SA 2V0UA 5J4EA 4B9OA 4H6JA 4EEPA 2V0WA 1TS8A 2OWHA 4YWZA 1LSXA 4GS9A 3MQQA 3IS2A 5F69A 3LUQA 4NXGA 4GCZA 4LRXC 5HWTA 3C8CA 4F3LB 1T18A 2VEAA 2V1BA 1LT0A 1XFNA 2INWA 2WKQA 3BY9A 5HWVA 3NOPC 4L9FA 4BBVA 4BBUA 2A24B 5F68A 3LIBA 5G4ZA 3EWKA 5HDCA 4KUKA 3P7NA 1P97A 2Z6CA 3F1PB 1XFQA 2PDRA 4LRZE 4MN6A 5G4YA 4HQAA
chains in the Genus database with same CATH superfamily
3B47A 1H5XA 2JKTI 3LO7A 2ZL1B 3IX8A 1FCNA 3HJKA 4ZJ1A 3DTIA 1PFLA 1S0WA 1IOUA 4WL9A 4L0LA 3RXXA 4R1GA 3LR3A 2W27A 5AVFA 4LRYC 3BFEA 1IFQA 1K57C 4JXVA 5IS1A 3FG8A 3LI8A 1D1JA 2BLSA 5HL6A 4R70A 1ZG4A 2BG1A 3HLFA 3Q1FA 4Q0IA 1BULA 5U47A 1YLYA 3U4LP 1T19A 1ESIA 4X56A 3G35A 2W1TB 5I94A 4NXEA 4E04A 4BQMA 1W5DA 4B88A 1EWZA 2WGVA 1HLUP 2O0YA 5EM1A 1GHMA 3QP1A 3KYEA 4S2MA 5EVEA 5F6AA 4LLOB 1FR6A 1CI9A 1JNUA 4KZ3A 2LB9A 3GV9A 2P9VB 4IBXA 1KE3A 3F1OA 1N9OA 3KSHA 2C6WB 4YFMA 3CHWP 3OOVA 4E3OA 4G3KA 4KZ4A 4II7A 3A3IA 2RL3A 2Y2KA 4X25A 1T1AA 4MDZA 2YKHA 3NIAA 3DTEA 3KSFA 1S4SA 4C3QA 2B02A 3ZHHA 3T50A 2Z6DA 1EROA 1ES2A 4R0QA 4Y0OA 3WWXA 2EFXA 3UDIA 3VP1A 4E3NA 4Y5FA 3O3VA 1TVFA 5L8MA 3QP2A 5LBRA 1KGEA 4P85A 3FV7A 1M6KA 1PWGA 4LCMA 3OZHA 5E2EA 3ZYTA 4QY5A 1Y28A 2DMWA 1FQGA 3A3EA 3G2ZA 3U2AA 3ITAA 2GDNA 3BEBA 3MQOA 5AQ7A 3F1NA 4K08A 4KZ5A 2Y2OA 4JXGA 3E2KA 1S6RA 3O87A 1JWZA 3NC8A 4C75A 2BTFP 3DTKA 2HP6A 3V3RA 1H8YA 4GS9B 5FAPA 2G7UA 4R3JA 4E3JA 5CECA 3VOYA 3BLSA 4BD1A 1XXMA 2HDQA 4XUZA 1MC0A 1O07A 2VKSA 4C6YA 4LFUA 3LR5A 2XSSA 4E6WA 1E25A 1LSWA 1F2KA 5E43A 3E4QA 3O88A 2XQZA 3HVFA 4N92A 3TW8A 2VK3A 4UA7A 1J3WA 1LLBA 1BT5A 2JCHA 5TBMA 4DF6A 4I5SA 1N4OA 4NKPA 2G2UA 4FTXA 4HOIA 3GR2A 3UDXA 4BWIA 4Q0HA 3MJQA 2XROA 1H8MA 3IT9A 2I9VA 3LYXA 1K55C 3JYIA 3LIFA 3IF6A 4RX2A 4FD8A 1LSVA 2WAEA 2XD1A 4EUZA 3GRJA 3VE4A 4CLCC 5D3OA 5DF8A 5DF9A 2XFSA 1GSVA 5GL9A 4N9KA 2XLNA 1TDGA 3BQ8A 1TEMA 1XGIA 4OQGA 3A3DA 1K6SA 5FEFA 4IBRA 4MN7A 4DXBA 3FPVA 3ZGAB 3P98A 2K7SA 2JKRI 2XEPA 4GOGA 1ES5A 5EE8A 1LI0A 4N9LA 1DJBA 3HCYA 5G18A 2XA7S 1S4RA 3M6HA 4ID4A 1NLZA 2H28A 1ESUA 3A3FA 4GHIA 2WKPA 4WEKA 2O99A 3A0RA 1NZOA 4LPZA 4Y13A 1Z09A 1S67L 1PWDA 2OLUA 4IVKA 2A24A 1GSXA 4R3AA 4OQIA 5FA7A 5CXWA 2KOIA 4WN5A 2V20A 2IWCA 2P08A 4OQ0A 1XJ2A 3CMZA 1MZUA 4OP8A 3BW6A 4OONA 2DNSA 5HARA 4EUVA 1YAXA 3IX3A 4MBFA 4KZAA 2Y4AA 2EFUA 1PW1A 2ZL1A 2P74A 4UA9A 5J3WA 2V0UA 3ZDJA 2ZQCA 4MCWA 4S2IA 4H6JA 2ZD8A 1L0DA 1TS8A 1LL9A 1IYPA 2OWHA 4DKIA 3C7UA 3KSGA 2XR0A 2R9XA 4RA7A 4KZ7A 2XDMA 3ZG0A 4Z9QA 4LV2A 3IS2A 4IHQA 3LY4A 3LUQA 4OQHA 4LRXC 5HWTA 4WZ5C 1LT0A 2INWA 3IH9A 3VP0A 2WUQA 3WRTA 5CTMA 2W1TA 1SHVA 4XXRA 3WS1A 2ZQ9A 1XP4A 2QYBA 2EXBA 5FQQA 2UWXA 4X53A 1BLCA 4P87A 2WK0A 3HLDA 1E4DA 4NEED 3G2YA 1P97A 2Z6CA 2P9VA 5EM0A 4LRZE 3OPLA 5M19A 2XA7M 3VOZA 3T1XA 4UAAA 3FPWA 3BM6A 2L0WA 3C2WA 3S4XA 3R4KA 3LCEA 5FAOA 3IBRA 4B93A 3GVBA 1V9ZA 1UGUA 3LEZA 1H3QA 2EWWA 1DRMA 4EETB 1HVBA 3MXRA 2W3EA 4KZ8A 2P7JA 3PTEA 1JWPA 3I7JA 1MBLA 1OJ5A 3K3DA 4S2PA 4FH4A 4HBUA 3GSGA 3HL9A 3C4PA 3K3CA 3OLOA 1YSQA 3GQZA 4QD4A 2CC1A 3A0VA 1P0ZA 2WAFA 4EESA 3GDIA 4BJPA 3RJUA 2Y2QA 1ES3A 4X55A 3MXQA 3SH8A 3UB9A 1SDEA 1KOUA 3CJMA 2QPNA 1YSPA 3MZDA 1PZOA 2Y2LA 5HAQA 3VSLA 3B3XA 1DP8A 2W0NA 5CERA 1HD8A 1TD5A 2KDKA 3S7NA 1WE4A 4GHIB 2Y2MA 4CLCE 2XD5A 4BBTA 1OT6A 2HJ9C 4DJ3A 2GNXA 1K57A 4PM8A 5EOEA 1GHPA 3FZCA 2Y8HA 1OTDA 3S22A 4M3KA 1W7FA 4QWOA 4MBHA 3E0YA 2PRFA 4GN2A 2HJEA 3MXSA 1KGGA 1WA9A 3MZFA 3DTMA 3M2KA 5EVIB 4U0TA 1I5QA 4PM5A 1NJ4A 4AFIA 4DE1A 5AQBA 5FDSA 1VM1A 5CRFA 4CJNA 3T1SA 4NXBA 5KMWA 1KVLA 1BTLA 1NRFA 4NG2A 4JPMA 2V1AA 4A5RA 3IQAA 1K54C 2WKRA 3IXDA 4X68A 2WZZA 4H6JB 5L09A 2ZC7A 3C4OA 1G6AA 2HDUA 4GLQA 2ZMVA 3CUEA 4JXSA 5FASA 2XGNA 5CHUA 1VEUA 2VLGA 3IS2B 5GLDA 1ODVA 1K0KA 3EGDC 2Y2NA 1CK3A 3C5AA 2ZQ8A 2VGKA 3H7WB 3HJIA 2NUTC 2FFFB 1M40A 1MPLA 5C5KA 3KX0X 2PD7A 2O9AA 2WGWB 4X1LA 5HZHA 4GDBA 3MS6A 4ZAMA 2OLVA 5HD3A 1K25A 4JF4A 2J3TC 4QB8A 3LR4A 4O7DA 4ME4A 3UB8A 2VA0A 1L0FA 1GA0A 4EQ1A 3G6OA 3BFGA 2DCFA 4BENA 3N8LA 5JYOA 1LL5A 4OLDA 3KYZA 1CF0A 1UWPX 4EERA 4XT2B 4O8GA 3SOIA 4R6LA 5EPHA 5FQIA 3T4QA 1JVJA 4S2LA 2HGVA 2ZBBA 4GZBA 4JGQA 4E3KA 4YOFA 3UMDA 1O7EA 2V1ZA 2HDRA 3DW0A 2ZM8A 1L2SA 4EBPA 1YPRA 5IU1A 2J9OA 3BRMA 3CAXA 5KIZA 4P6ZS 4JXWA 5A92A 4FOFA 1QMEA 4HJ3A 2A3UA 5EVID 4QPRA 1DJCA 2O9CA 2PU2A 3T4OA 2LB5A 1SDNA 2VGLS 4JF6A 1GHIA 3PAEA 2YKFA 5FAQA 2VV8A 5HAIA 3RFBA 4KQQA 2Y2PA 2B95A 4R4SA 4R23A 4I3IA 3IXGA 3VV4A 3L7HA 2JN7A 4HI4A 3QP8A 1BLHA 3ICYA 1JTDA 2B5RA 5HSQA 3G31A 1YQSA 1EW0A 3MKEA 4WELA 4ARZB 3D3OA 3CI6A 3W4PA 1TS7A 5A91A 1TS0A 2EXAA 4RQ9A 4FH2A 4PM6A 1JTGA 3ULFA 2E8JA 1U60A 1W63M 4HHDA 4HP9A 2M7VA 3UPNA 3P01A 5K5BA 1OT9A 5DJUA 5GHXA 4MMNA 3O5YA 4EBNA 2IWDA 4K0XA 1EI5A 5DTKA 3RTYA 1PNEA 5DFXA 3FKWA 3HUOA 1G6OA 3CZDA 1UWNX 3SS4A 2H0YA 3Q7VB 1PZPA 3BJNA 3S7PA 4B4ZA 2PYPA 1MY8A 4HY8A 4FUWA 1I2SA 2EX6A 1OJGA 3M2JA 1T1CA 4Q0JA 4RVAA 4X6TA 4I39A 4LGWA 2OWJA 2Y55A 2Y2HA 3UPPA 5FQKA 3CWFA 2W3GA 2W3FA 2J80A 2JE5A 1PIOA 4MN5A 2JBFA 5J4EA 1GCEA 3TRCA 1F5MA 1LSXA 2K31A 5FI7A 1VEUB 4X1MA 4EQIA 1KDSA 4P6ZM 3WS5A 5L07A 3P09A 4Y3IA 2HPBA 5KSCA 1YLWA 3T1RA 5CGWA 2VGLM 2V1BA 3EOIA 2WKQA 5E2GA 4DXCA 1FCOA 1ACFA 5HWVA 5AJGA 4L9FA 5E2HA 2OV5A 1KVMA 3IHBA 3OBFA 3G4PA 3EWKA 2HZ5A 4KUKA 3ZCZA 3OCLA 2IA2A 3PBNA 1FIKA 5GHZA 4JLFA 4P0MA 4YNRA 2K2NA 1ALQA 4K0WA 3DAVA 3GMWA 1NYYA 4P6BA 4OPYA 4DE3A 1SKOB 4JGPA 4WYYA 5FEGA 3BY8A 1AXBA 1XPBA 1AWIA 2R78A 4R38A 3QHYA 3TE8A 1RGYA 2OAP1 2QJ7A 4DE2A 4JBFA 3IF6C 3JVUA 4S2NC 2VZWA 1N9BA 3A3JA 4WZ5A 2E8IA 2Z2MB 1VETB 3GECA 2CMNA 5EVIA 1NYMA 1MWSA 2J9PA 4IJGA 4E3MA 1DP6A 2PHYA 2J3TD 4DDYA 3ZG9B 4E3IA 2L4RA 2A2LA 3AGEA 2HDSA 4UHUA 1S66L 1F9IA 1K56D 4ESPA 1ZTUA 1YLPA 2HF6A 3TSGA 4CQHA 1OTIA 1D06A 5A90A 5KZHA 3G34A 3IBJA 4O0PA 4KZ9A 1JWVA 3PBQA 5GLCA 3UE6A 4KZ6A 5DJTA 2A49A 1K4FA 3IXBA 1XGJA 3G32A 2ZOIA 3HUMA 3WRZA 1PRQA 3NDGA 3UNWA 3W4OA 3LIDA 1H8ZA 2O9BA 1V9YA 5EECA 3H7WA 1I2WA 4Y0UA 3DBAA 1KE4A 1XJ6A 3DWKA 1ERQA 2WGWA 4I3AA 3VE3A 3V67A 3IWIA 4CLCB 4EXOA 4OKPA 4ZDXA 4HH2A 1ZG6A 3N8SA 4HP4A 3WS2A 4LCLA 5AVEA 1RP5A 1SKFA 4M4XA 5M1AA 3B42A 3N6IA 5AQ9A 2PT7A 4XT2A 3SS5A 5HDDA 3SS3A 1N9LA 5F5YA 2NUPC 1ZHHB 4UEYA 3H82B 1DJAA 1MXOA 4GB7A 3MZEA 3RH8B 2J3WA 3W2ZA 4OPQA 4KZBA 2J8YA 4EEUA 3ZVTA 2M1CA 4ZBEA 3BFFA 5EFWA 4D60A 2QMIA 5TJJA 1D7EA 5GHYA 2BASA 2Q9NA 4X69A 2R9WA 3SZTA 1PYYA 4WLAA 2QJ5A 3WS4A 1YM1A 5CEDA 1HZOA 4MBKA 4DJ2A 5A93A 2ZJ9A 1SCWA 3OC2A 4H8RA 2JKFA 1N9NA 1MWRA 3NECA 3ZNTA 2QKPA 5GLAA 5L10A 3T4TA 3LFVA 2MJ6A 4HEFA 2Y79A 4HIAA 5GLBA 2X01A 3R7WB 2EX2A 3NHQA 4UA6A 4E3LA 2Y2GA 1OPXA 3T4KA 1TS6A 3V5MA 2HP5A 1TDLA 4JKTA 5E2FA 3VMAA 1T1BA 4WEJA 4ARZA 3D72A 3FKVA 4GD6A 3G30A 2Y2JA 3IWOA 1K54A 2W1RA 3HUNA 2JHEA 4BLMA 1L0GA 3ZG7B 2Y91A 1VQQA 3PAGA 4LV3A 1J9MA 5DTSA 5FSRA 3NBLA 4IUHA 4R3BA 2ZC6B 3UMEA 4G3VA 1FCMA 1ES4A 5CHJA 4OP5A 2QWSA 3PBSA 4CLCD 5FDHA 4S2KA 4KUOA 3QNCA 2Q9MA 4JGOA 4U0XA 4G3WA 3Q7VA 1IYOA 2H10A 1CEFA 1PI4A 4WZ4A 3MFDA 3N8RA 3IX4A 5HDSA 2VJWA 3SW1A 3WS0A 3JVVA 1GA9A 2ZC3B 2GX5A 3W8KA 1K56A 1YT4A 4N1HA 3VP4A 3C30A 3NOUC 1CI8A 3HLCA 1F98A 3FWLA 4KG6A 2B18A 3UY6A 4BMWA 3BFCA 1S1ZA 4GJ4A 3O86A 1G28A 4NETA 4NK3A 2PD8A 4KQOA 2VX8A 3CG5A 5KSHA 3L9KA 3UB6A 1XX2A 3D9YA 4HJ6A 2QZ6A 3KSIA 5FI2A 2EX8A 4OOYA 4ETZA 1IELA 3NULA 4LV1A 1OTEA 4U3TA 2OSUA 3QP5A 5CHMA 5JYPA 4L9GA 2PR5A 4KENB 3EQVA 1H0MA 1NXYA 4L9EA 5CX7A 1Z6FA 3EQUA 4E6XA 5BOHA 5TR7A 2GJ3A 1KGFA 3BLMA 1CQAA 3SH7A 3FC7A 1SZVA 4QHCA 1P9RA 1SKOA 1XA1A 5DFYA 3EEAA 1OMEA 1W8QA 3AGFA 3QP6A 4EEPA 3LR0A 3MMHA 2XK1A 4PHTA 5CEBA 4YWZA 4MEZA 3VP3A 3CUEC 3MQQA 2WKIA 3N7WA 3LEQA 5F69A 1NY0A 5HPFA 4GCZA 2W3HA 3IHAA 4PAUA 5M18A 2VEAA 4EBLA 1VETA 1XFNA 4FCFA 2ZQ7A 5HX9A 3Q81A 1TF1A 2C5WB 5HFOA 4BBVA 4BBUA 3Q7ZA 3T1QB 4OVDA 5FL3A 4R4RA 5F68A 3LIBA 3BFDA 1K6RA 2JKTM 3S7QA 2XRNA 3NI9A 3QNBA 1YLJA 4OLGA 4KG2A 2ZC4B 5IT5A 5DF7A 2PDRA 2XH9A 4DMZA 1IKIA 4DN0A 3PXPA 4IVIA 2Y59A 4Y0TA 3VOLA 4ZJ3A 2X71A 3ZFZA 1K55A 1L3LA 3LIAA 4LV0A 1DY6A 4WMCD 1ONGA 1Q2QA 3IXHA 3HLWA 1W63Q 2FZ0A 5AQAA 4QY6A 1BYWA 4CPKA 3LIEA 3LI9A 1STZA 2V8FA 5DKKA 4DE0A 3ZQ5A 3E98A 3E4OA 3M6BA 3OPHA 3MBZA 4CLCA 4HJ4A 2J7VA 5F1FA 3LGOA 3MFXA 2FH5A 1S1YA 1YLTA 3BYDA 3V50A 2Y2IA 5EUAA 2DRWA 3UN7A 4OPZA 3AGDA 3H82A 3HLGA 3HREA 4XUXA 5TFQA 2WADA 1FOFA 3VFFA 2XFTA 2PBYA 3NDEA 2EX9A 2WGIA 1W79A 1XJ3A 1XA7A 5HAPA 3CLOA 2I72A 1RCJA 4I3JA 2FFYA 2HV1A 1FSYA 3HLEA 2EA9A 2W3DA 2ZC5B 2UV0E 2V2FF 3PR6A 1XJ4A 4DRTA 2V9AA 1LHYA 3VSKA 1E3UD 5F82A 5FATA 1G5UA 2G2WA 3MQ0A 3C38A 1VB6A 3CPTA 2PBDP 4S2NA 1CEGA 4NXFA 1GSWA 4WUJA 4EV4A 5HD5A 4PMAA 2L1MA 1K38A 4F94A 2D02A 5A8BA 3Q07A 3IH8A 4I38A 1K4EA 2OOLA 4PM7A 3MR0A 3DWZA 2M7UA 3D4FA 2IWBA 3V39A 1WYCA 3R7WA 5DKLA 5HWWA 1PW8A 3VFHA 4EU0A 1Y54A 2VGJA 3NY4A 5F1GA 3KO6A 4PPRA 4GD8A 4GKUA 1FILA 3UE0A 5CGXA 3VP2A 1P9WA 1FSWA 4HBTA 2KX6A 5I5LA 1KDWA 3JPUA 2QHKA 3K2NA 4PM9A 3F1OB 4Y2FA 3E4PA 3HLBA 4Z1WA 4O01A 3OCNA 1PI5A 1OTBA 4RYEA 1BLPA 4EW7A 5FQJA 4HH3A 4Y7PA 3C7VA 1ZC2A 1BSGA 1PWCA 5FQ9A 3OPPA 5HPIA 3UB7A 3TOIA 4RX3A 1YMSA 4PKYA 4ZTKA 1QMFA 5EV0A 3PBOA 2Z2LB 4F3LA 1IYSA 5J7EA 1L0EA 2XF3A 1DP9A 2WYXA 3IF5A 3NCKA 4IUKA 1IEMA 2PYRA 1X0OA 4OOLA 4YINA 4Q8IA 3PBRA 2ZM2A 2OAQ1 2JKGA 1YLZA 3LY3A 4KQDA 1MWUA 3NJAA 3T4JA 1ERMA 4GW9A 3V3SA 1A0KA 2VV7A 3F1PA 3W4QA 4DDSA 2JC7A 5HW3A 5EVLA 5J8XA 3H9WA 5EOOA 4HNBA 3T4LA 2ZOHA 4ZRRA 3BWLA 3F1NB 3UE3A 4PKYG 3BECA 4B4XA 1HTZA 3Q82A 4WMCA 4OH0A 4MNRA 3E2LA 1WYBA 3EEHA 3EGXC 5IHVA 3PHYA 4GNUA 4N1XA 3N4IA 4KQRA 4EWFA 4OOMA 3UB5P 3ZG5A 3UE1A 4UQIS 3SH9A 1CJFA 2JKRM 2KLIA 5EVIC 3B33A 4JGRA 1NWZA 1Q2PA 2ZMFA 3TG9A 1Y4OA 5TGFA 2H0TA 4QU3A 2WKHA 3QP4A 3PBTA 5FI6A 3GTCA 1ONHA 1YMXA 3ITBA 2VV6A 1IYQA 5DVAA 3T4SA 3UO9A 1LI9A 5TBMB 3S7OA 5L2FA 3NOTC 3ZG8B 1RGZA 2EWVA 4Y15A 4IEDA 2ZMAA 2PAVP 3ISGA 2Q0OA 2PR6A 3PYPA 2HP9A 1E3UA 2V8CA 3IF6B 2ZQDA 4WF0A 3HBRA 3LICA 3CPTB 2WZXA 3T12B 5FQMA 1LL8A 2ZLYA 1ZKJA 1XKZA 4ZJ2A 5CGSA 4WBGA 3OPRA 4WM9A 2D01A 1KE0A 2RCXA 4LENA 1MKMA 3UDFA 1OTAA 4OPRA 2H5SA 2PU4A 5DTTA 2GZAA 4HESA 4BL2A 3A0SA 4KG5A 5CTNA 2AVXA 3CITA 4MLLA 4B9OA 3BQAA 4FSFA 2WKEA 1NZUA 2V0WA 1YKDA 2ZM0A 2P04A 3S1YA 4GS9A 1BZAA 1BLSA 2X02A 3ZNYA 3UPOA 1C3BA 4UQIM 4NXGA 3C8CA 3MKFA 4F3LB 1T18A 4BD0A 1IKGA 2ZQAA 4D2OA 2ACGA 3BY9A 1NRJA 3RXWA 3NOPC 3TJZC 5MC7A 2A24B 3FYZA 1NLYA 4QJGA 5G4ZA 4BL3A 4GDNA 5HL1A 1VHMA 1W8YA 3MSHA 5HDCA 3IWQA 4ETXA 1FR1A 4S2JA 4K91A 1G68A 3P7NA 3ZVWA 3KYQA 1MWTA 3F1PB 1XFQA 1MKIA 4Y17A 4JF5A 1BUEA 4MN6A 4HQAA 4S2OA 5G4YA 5F83A 3MF0A
chains in the Genus database with same CATH topology
4YNRA 2K2NA 3B47A 4DN0A 3FPWA 3PXPA 2JKTI 3VOLA 2L0WA 3HJKA 4JGPA 3C2WA 3R4KA 3BY8A 3IBRA 4B93A 1IOUA 4WL9A 1V9ZA 3LIAA 1UGUA 2R78A 4L0LA 3LR3A 4R38A 2W27A 1H3QA 5AVFA 1W63Q 2FZ0A 2EWWA 2OAP1 2QJ7A 4LRYC 3TE8A 1IFQA 1DRMA 4EETB 1BYWA 5IS1A 3FG8A 3LIEA 3LI9A 2W3EA 3LI8A 5HL6A 3JVUA 4R70A 2P7JA 1STZA 5DKKA 4Q0IA 3ZQ5A 2VZWA 3E98A 1OJ5A 3E4OA 3K3DA 4CLCA 4HJ4A 3GECA 2CMNA 1T19A 3MFXA 2FH5A 1S1YA 3K3CA 2W1TB 3OLOA 4IJGA 1YSQA 4NXEA 4E04A 1DP6A 2PHYA 2J3TD 2O0YA 2L4RA 2A2LA 3A0VA 1P0ZA 4EESA 1S66L 1F9IA 3GDIA 3H82A 5F6AA 1ZTUA 4LLOB 1JNUA 2LB9A 2HF6A 4BJPA 3MXQA 4CQHA 1OTIA 1D06A 3F1OA 1N9OA 3KSHA 3OOVA 3UB9A 3IBJA 4O0PA 1XJ3A 1KOUA 4G3KA 4II7A 3CLOA 3PBQA 3UE6A 1YSPA 5DJTA 4I3JA 1T1AA 4MDZA 2HV1A 2YKHA 1DP8A 2ZOIA 3KSFA 1S4SA 2B02A 3T50A 2Z6DA 2EA9A 2W3DA 3PR6A 1XJ4A 2V9AA 2W0NA 1TD5A 2KDKA 3S7NA 4GHIB 3LIDA 4CLCE 4BBTA 1OT6A 2HJ9C 1V9YA 2O9BA 4DJ3A 3MQ0A 3C38A 3H7WA 2GNXA 1VB6A 2Y8HA 3DBAA 1OTDA 4Y5FA 1XJ6A 5L8MA 4NXFA 4I3AA 3VE3A 1GSWA 4WUJA 3V67A 5HD5A 3E0YA 5LBRA 2L1MA 4CLCB 4EXOA 2HJEA 2D02A 5A8BA 1WA9A 4HH2A 4I38A 2OOLA 3MR0A 4HP4A 5AVEA 2M7UA 4AFIA 4M4XA 3R7WA 3ZYTA 5DKLA 5HWWA 3B42A 1Y28A 4EU0A 2PT7A 4XT2A 3KO6A 5HDDA 1N9LA 5F5YA 2DMWA 4NXBA 2NUPC 1ZHHB 4UEYA 3U2AA 3H82B 3MQOA 1P9WA 2V1AA 3F1NA 4K08A 3RH8B 2J3WA 2KX6A 5I5LA 3W2ZA 2QHKA 3K2NA 2WKRA 3F1OB 4Y2FA 3E4PA 4EEUA 4H6JB 2M1CA 4Z1WA 4O01A 3OCNA 1OTBA 5EFWA 4EW7A 4HH3A 3MF0A 5TJJA 4GLQA 2ZMVA 1D7EA 2BASA 3CUEA 4GS9B 2G7UA 5HPIA 3UB7A 2VLGA 3IS2B 4PKYA 1ODVA 4WLAA 2QJ5A 3EGDC 1MC0A 3PBOA 2VKSA 4F3LA 4DJ2A 5J7EA 3H7WB 3HJIA 3LR5A 2NUTC 1DP9A 2XSSA 4IUKA 5C5KA 3KX0X 1LSWA 3OC2A 2PD7A 2PYRA 2O9AA 1X0OA 1N9NA 3E4QA 4OOLA 5HZHA 3PBRA 2QKPA 2OAQ1 5HD3A 3T4TA 3TW8A 2J3TC 3LR4A 3LFVA 4KQDA 2MJ6A 3NJAA 4ME4A 2Y79A 3UB8A 3T4JA 2VA0A 4GW9A 4EQ1A 4HIAA 3G6OA 3R7WB 3NHQA 2VV7A 3F1PA 3KYZA 5TBMA 4I5SA 1UWPX 4EERA 1OPXA 4O8GA 4XT2B 4NKPA 3T4KA 1TS6A 4R6LA 3H9WA 1T1BA 4WEJA 4HNBA 4ARZA 3D72A 3T4LA 4HOIA 3T4QA 2ZOHA 4ZRRA 3BWLA 3F1NB 4BWIA 2W1RA 2JHEA 4Q0HA 3MJQA 2HGVA 2XROA 1H8MA 3UE3A 2ZBBA 2I9VA 4JGQA 4PKYG 4YOFA 3UMDA 3LYXA 3LIFA 4IUHA 3EEHA 5IU1A 3EGXC 1LSVA 3PHYA 3UMEA 4G3VA 3CAXA 2QWSA 3PBSA 4CLCD 4OOMA 4P6ZS 5KIZA 4FOFA 4HJ3A 4KUOA 4JGOA 4QPRA 4UQIS 3VE4A 4G3WA 4CLCC 2O9CA 2JKRM 2KLIA 5DF9A 2LB5A 3T4OA 2VGLS 3B33A 1GSVA 4JGRA 1NWZA 2ZMFA 2YKFA 3BQ8A 2VV8A 5HDSA 3RFBA 2VJWA 3SW1A 3PBTA 4I3IA 3VV4A 4MN7A 2JN7A 4HI4A 3JVVA 3ICYA 2VV6A 3FPVA 2GX5A 2K7SA 2JKRI 3T4SA 3C30A 3NOUC 5TBMB 3S7OA 5HSQA 1F98A 2B18A 1EW0A 3NOTC 4BMWA 3HCYA 1S1ZA 4WELA 4ARZB 2EWVA 3D3OA 4GJ4A 3CI6A 2XA7S 1S4RA 1TS7A 1TS0A 1G28A 4RQ9A 1NLZA 2H28A 3ULFA 2PD8A 4KQOA 1W63M 2VX8A 4HHDA 5KSHA 4HP9A 2M7VA 3UB6A 2PR6A 3P01A 3PYPA 4GHIA 4HJ6A 1OT9A 5K5BA 5DJUA 3KSIA 4WF0A 2WKPA 4MMNA 2O99A 3O5YA 3A0RA 4WEKA 3LICA 4LPZA 4ETZA 1S67L 1LL8A 1OTEA 2A24A 3RTYA 1GSXA 4R3AA 5DFXA 1G6OA 2KOIA 1UWNX 4L9GA 4WN5A 2PR5A 3EQVA 3BJNA 2D01A 3S7PA 2PYPA 2P08A 1XJ2A 4HY8A 1MZUA 4L9EA 1OJGA 5CX7A 3BW6A 1T1CA 3EQUA 1MKMA 2GJ3A 4Q0JA 4EUVA 1OTAA 1YAXA 4I39A 2OWJA 3CWFA 2W3GA 3FC7A 2W3FA 1P9RA 2GZAA 2J80A 5J3WA 4MN5A 3A0SA 2V0UA 3EEAA 5DFYA 5J4EA 3CITA 4MCWA 4B9OA 3BQAA 4FSFA 4H6JA 4EEPA 3LR0A 2V0WA 1YKDA 3TRCA 1TS8A 1F5MA 3MMHA 2OWHA 2P04A 4PHTA 4YWZA 3KSGA 1LSXA 2K31A 3CUEC 4GS9A 3MQQA 4P6ZM 3IS2A 4IHQA 4Y3IA 5F69A 3LUQA 4UQIM 4NXGA 4GCZA 4LRXC 2W3HA 5HPFA 5HWTA 3C8CA 4F3LB 4PAUA 1T18A 2VGLM 2VEAA 2V1BA 1LT0A 1XFNA 2INWA 3EOIA 2WKQA 2W1TA 3BY9A 1NRJA 5HWVA 1TF1A 5AJGA 3TJZC 3NOPC 5MC7A 4L9FA 4BBVA 4BBUA 2A24B 1NLYA 2QYBA 5FL3A 5F68A 3LIBA 5G4ZA 3OBFA 2JKTM 3EWKA 1VHMA 3S7QA 2XRNA 5HDCA 4KUKA 4ETXA 4NEED 3P7NA 1P97A 5IT5A 2Z6CA 3KYQA 3OCLA 2IA2A 3F1PB 1XFQA 2PDRA 4LRZE 3PBNA 4MN6A 5G4YA 4HQAA 2XA7M 4DMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VOL A;  2L0W A;  3HJK A;  4JGP A;  3C2W A;  3BY8 A;  3IBR A;  4WL9 A;  1V9Z A;  3LIA A;  1UGU A;  2R78 A;  4R38 A;  2W27 A;  5AVF A;  2QJ7 A;  4LRY C;  1DRM A;  4EET B;  1BYW A;  5IS1 A;  3FG8 A;  3LIE A;  3LI9 A;  3LI8 A;  4R70 A;  2P7J A;  5DKK A;  3ZQ5 A;  1OJ5 A;  3E4O A;  3K3D A;  4HJ4 A;  3GEC A;  2CMN A;  1T19 A;  3MFX A;  1S1Y A;  3K3C A;  3OLO A;  4NXE A;  4E04 A;  1DP6 A;  2PHY A;  2L4R A;  3A0V A;  1P0Z A;  4EES A;  1S66 L;  1F9I A;  3GDI A;  3H82 A;  5F6A A;  4LLO B;  1JNU A;  3MXQ A;  1OTI A;  1D06 A;  3F1O A;  1N9O A;  3UB9 A;  1XJ3 A;  1KOU A;  3CLO A;  3UE6 A;  5DJT A;  4I3J A;  1T1A A;  2HV1 A;  2YKH A;  1DP8 A;  2ZOI A;  1S4S A;  2B02 A;  3T50 A;  2EA9 A;  2Z6D A;  1XJ4 A;  2V9A A;  2W0N A;  2KDK A;  4GHI B;  3LID A;  4BBT A;  1OT6 A;  1V9Y A;  4DJ3 A;  3H7W A;  1VB6 A;  1OTD A;  1XJ6 A;  4NXF A;  4I3A A;  3VE3 A;  1GSW A;  4WUJ A;  5HD5 A;  2L1M A;  4EXO A;  2D02 A;  5A8B A;  1WA9 A;  4HH2 A;  4I38 A;  2OOL A;  3MR0 A;  4HP4 A;  5AVE A;  4M4X A;  5DKL A;  5HWW A;  1Y28 A;  4XT2 A;  5HDD A;  1N9L A;  5F5Y A;  4NXB A;  3H82 B;  3MQO A;  2V1A A;  3F1N A;  4K08 A;  3RH8 B;  2KX6 A;  5I5L A;  2QHK A;  2WKR A;  3F1O B;  4EEU A;  3E4P A;  4H6J B;  2M1C A;  1OTB A;  5EFW A;  4EW7 A;  4HH3 A;  1D7E A;  2BAS A;  4GS9 B;  3UB7 A;  2VLG A;  3IS2 B;  4PKY A;  1ODV A;  4WLA A;  2QJ5 A;  4F3L A;  4DJ2 A;  5J7E A;  3H7W B;  3HJI A;  1DP9 A;  3KX0 X;  1LSW A;  2PD7 A;  2PYR A;  1X0O A;  1N9N A;  3E4Q A;  5HZH A;  2QKP A;  5HD3 A;  4KQD A;  3NJA A;  3UB8 A;  4GW9 A;  4EQ1 A;  4HIA A;  3G6O A;  3NHQ A;  2VV7 A;  3F1P A;  5TBM A;  4I5S A;  1UWP X;  4EER A;  4XT2 B;  1TS6 A;  4R6L A;  3H9W A;  1T1B A;  4HNB A;  3D72 A;  4HOI A;  2ZOH A;  3BWL A;  3F1N B;  2JHE A;  3MJQ A;  2ZBB A;  2I9V A;  4JGQ A;  4PKY G;  3UMD A;  3LYX A;  3LIF A;  3EEH A;  5IU1 A;  1LSV A;  3PHY A;  3UME A;  3CAX A;  2QWS A;  5KIZ A;  4HJ3 A;  4KUO A;  4JGO A;  3VE4 A;  3B33 A;  1GSV A;  4JGR A;  1NWZ A;  2YKF A;  2VV8 A;  5HDS A;  3SW1 A;  4I3I A;  2JN7 A;  4HI4 A;  3ICY A;  2VV6 A;  2K7S A;  3NOU C;  5TBM B;  5HSQ A;  1F98 A;  1EW0 A;  3NOT C;  1S1Z A;  1S4R A;  1TS7 A;  1TS0 A;  1G28 A;  4RQ9 A;  2H28 A;  3ULF A;  2PD8 A;  4HHD A;  4HP9 A;  3UB6 A;  2PR6 A;  3PYP A;  4GHI A;  4HJ6 A;  1OT9 A;  5DJU A;  4WF0 A;  2WKP A;  3A0R A;  3LIC A;  4LPZ A;  1S67 L;  1LL8 A;  1OTE A;  2A24 A;  3RTY A;  1GSX A;  4R3A A;  1UWN X;  4L9G A;  4WN5 A;  2PR5 A;  2D01 A;  2PYP A;  1XJ2 A;  4HY8 A;  1MZU A;  4L9E A;  1OJG A;  1T1C A;  2GJ3 A;  1OTA A;  4I39 A;  2OWJ A;  3CWF A;  3FC7 A;  2J80 A;  5J3W A;  4MN5 A;  3A0S A;  2V0U A;  5J4E A;  4B9O A;  4H6J A;  4EEP A;  2V0W A;  1TS8 A;  2OWH A;  4YWZ A;  1LSX A;  4GS9 A;  3MQQ A;  3IS2 A;  5F69 A;  3LUQ A;  4NXG A;  4GCZ A;  4LRX C;  5HWT A;  3C8C A;  4F3L B;  1T18 A;  2VEA A;  2V1B A;  1LT0 A;  1XFN A;  2INW A;  2WKQ A;  3BY9 A;  5HWV A;  3NOP C;  4L9F A;  4BBV A;  4BBU A;  2A24 B;  5F68 A;  3LIB A;  5G4Z A;  3EWK A;  5HDC A;  4KUK A;  3P7N A;  1P97 A;  2Z6C A;  3F1P B;  1XFQ A;  2PDR A;  4LRZ E;  4MN6 A;  5G4Y A;  4HQA A; 
#chains in the Genus database with same CATH topology
 3B47 A;  1H5X A;  2JKT I;  3LO7 A;  2ZL1 B;  3IX8 A;  1FCN A;  3HJK A;  4ZJ1 A;  3DTI A;  1PFL A;  1S0W A;  1IOU A;  4WL9 A;  4L0L A;  3RXX A;  4R1G A;  3LR3 A;  2W27 A;  5AVF A;  4LRY C;  3BFE A;  1IFQ A;  1K57 C;  4JXV A;  5IS1 A;  3FG8 A;  3LI8 A;  1D1J A;  2BLS A;  5HL6 A;  4R70 A;  1ZG4 A;  2BG1 A;  3HLF A;  3Q1F A;  4Q0I A;  1BUL A;  5U47 A;  1YLY A;  3U4L P;  1T19 A;  1ESI A;  4X56 A;  3G35 A;  2W1T B;  5I94 A;  4NXE A;  4E04 A;  4BQM A;  1W5D A;  4B88 A;  1EWZ A;  2WGV A;  1HLU P;  2O0Y A;  5EM1 A;  1GHM A;  3QP1 A;  3KYE A;  4S2M A;  5EVE A;  5F6A A;  4LLO B;  1FR6 A;  1CI9 A;  1JNU A;  4KZ3 A;  2LB9 A;  3GV9 A;  2P9V B;  4IBX A;  1KE3 A;  3F1O A;  1N9O A;  3KSH A;  2C6W B;  4YFM A;  3CHW P;  3OOV A;  4E3O A;  4G3K A;  4KZ4 A;  4II7 A;  3A3I A;  2RL3 A;  2Y2K A;  4X25 A;  1T1A A;  4MDZ A;  2YKH A;  3NIA A;  3DTE A;  3KSF A;  1S4S A;  4C3Q A;  2B02 A;  3ZHH A;  3T50 A;  2Z6D A;  1ERO A;  1ES2 A;  4R0Q A;  4Y0O A;  3WWX A;  2EFX A;  3UDI A;  3VP1 A;  4E3N A;  4Y5F A;  3O3V A;  1TVF A;  5L8M A;  3QP2 A;  5LBR A;  1KGE A;  4P85 A;  3FV7 A;  1M6K A;  1PWG A;  4LCM A;  3OZH A;  5E2E A;  3ZYT A;  4QY5 A;  1Y28 A;  2DMW A;  1FQG A;  3A3E A;  3G2Z A;  3U2A A;  3ITA A;  2GDN A;  3BEB A;  3MQO A;  5AQ7 A;  3F1N A;  4K08 A;  4KZ5 A;  2Y2O A;  4JXG A;  3E2K A;  1S6R A;  3O87 A;  1JWZ A;  3NC8 A;  4C75 A;  2BTF P;  3DTK A;  2HP6 A;  3V3R A;  1H8Y A;  4GS9 B;  5FAP A;  2G7U A;  4R3J A;  4E3J A;  5CEC A;  3VOY A;  3BLS A;  4BD1 A;  1XXM A;  2HDQ A;  4XUZ A;  1MC0 A;  1O07 A;  2VKS A;  4C6Y A;  4LFU A;  3LR5 A;  2XSS A;  4E6W A;  1E25 A;  1LSW A;  1F2K A;  5E43 A;  3E4Q A;  3O88 A;  2XQZ A;  3HVF A;  4N92 A;  3TW8 A;  2VK3 A;  4UA7 A;  1J3W A;  1LLB A;  1BT5 A;  2JCH A;  5TBM A;  4DF6 A;  4I5S A;  1N4O A;  4NKP A;  2G2U A;  4FTX A;  4HOI A;  3GR2 A;  3UDX A;  4BWI A;  4Q0H A;  3MJQ A;  2XRO A;  1H8M A;  3IT9 A;  2I9V A;  3LYX A;  1K55 C;  3JYI A;  3LIF A;  3IF6 A;  4RX2 A;  4FD8 A;  1LSV A;  2WAE A;  2XD1 A;  4EUZ A;  3GRJ A;  3VE4 A;  4CLC C;  5D3O A;  5DF8 A;  5DF9 A;  2XFS A;  1GSV A;  5GL9 A;  4N9K A;  2XLN A;  1TDG A;  3BQ8 A;  1TEM A;  1XGI A;  4OQG A;  3A3D A;  1K6S A;  5FEF A;  4IBR A;  4MN7 A;  4DXB A;  3FPV A;  3ZGA B;  3P98 A;  2K7S A;  2JKR I;  2XEP A;  4GOG A;  1ES5 A;  5EE8 A;  1LI0 A;  4N9L A;  1DJB A;  3HCY A;  5G18 A;  2XA7 S;  1S4R A;  3M6H A;  4ID4 A;  1NLZ A;  2H28 A;  1ESU A;  3A3F A;  4GHI A;  2WKP A;  4WEK A;  2O99 A;  3A0R A;  1NZO A;  4LPZ A;  4Y13 A;  1Z09 A;  1S67 L;  1PWD A;  2OLU A;  4IVK A;  2A24 A;  1GSX A;  4R3A A;  4OQI A;  5FA7 A;  5CXW A;  2KOI A;  4WN5 A;  2V20 A;  2IWC A;  2P08 A;  4OQ0 A;  1XJ2 A;  3CMZ A;  1MZU A;  4OP8 A;  3BW6 A;  4OON A;  2DNS A;  5HAR A;  4EUV A;  1YAX A;  3IX3 A;  4MBF A;  4KZA A;  2Y4A A;  2EFU A;  1PW1 A;  2ZL1 A;  2P74 A;  4UA9 A;  5J3W A;  2V0U A;  3ZDJ A;  2ZQC A;  4MCW A;  4S2I A;  4H6J A;  2ZD8 A;  1L0D A;  1TS8 A;  1LL9 A;  1IYP A;  2OWH A;  4DKI A;  3C7U A;  3KSG A;  2XR0 A;  2R9X A;  4RA7 A;  4KZ7 A;  2XDM A;  3ZG0 A;  4Z9Q A;  4LV2 A;  3IS2 A;  4IHQ A;  3LY4 A;  3LUQ A;  4OQH A;  4LRX C;  5HWT A;  4WZ5 C;  1LT0 A;  2INW A;  3IH9 A;  3VP0 A;  2WUQ A;  3WRT A;  5CTM A;  2W1T A;  1SHV A;  4XXR A;  3WS1 A;  2ZQ9 A;  1XP4 A;  2QYB A;  2EXB A;  5FQQ A;  2UWX A;  4X53 A;  1BLC A;  4P87 A;  2WK0 A;  3HLD A;  1E4D A;  4NEE D;  3G2Y A;  1P97 A;  2Z6C A;  2P9V A;  5EM0 A;  4LRZ E;  3OPL A;  5M19 A;  2XA7 M;  3VOZ A;  3T1X A;  4UAA A;  3FPW A;  3BM6 A;  2L0W A;  3C2W A;  3S4X A;  3R4K A;  3LCE A;  5FAO A;  3IBR A;  4B93 A;  3GVB A;  1V9Z A;  1UGU A;  3LEZ A;  1H3Q A;  2EWW A;  1DRM A;  4EET B;  1HVB A;  3MXR A;  2W3E A;  4KZ8 A;  2P7J A;  3PTE A;  1JWP A;  3I7J A;  1MBL A;  1OJ5 A;  3K3D A;  4S2P A;  4FH4 A;  4HBU A;  3GSG A;  3HL9 A;  3C4P A;  3K3C A;  3OLO A;  1YSQ A;  3GQZ A;  4QD4 A;  2CC1 A;  3A0V A;  1P0Z A;  2WAF A;  4EES A;  3GDI A;  4BJP A;  3RJU A;  2Y2Q A;  1ES3 A;  4X55 A;  3MXQ A;  3SH8 A;  3UB9 A;  1SDE A;  1KOU A;  3CJM A;  2QPN A;  1YSP A;  3MZD A;  1PZO A;  2Y2L A;  5HAQ A;  3VSL A;  3B3X A;  1DP8 A;  2W0N A;  5CER A;  1HD8 A;  1TD5 A;  2KDK A;  3S7N A;  1WE4 A;  4GHI B;  2Y2M A;  4CLC E;  2XD5 A;  4BBT A;  1OT6 A;  2HJ9 C;  4DJ3 A;  2GNX A;  1K57 A;  4PM8 A;  5EOE A;  1GHP A;  3FZC A;  2Y8H A;  1OTD A;  3S22 A;  4M3K A;  1W7F A;  4QWO A;  4MBH A;  3E0Y A;  2PRF A;  4GN2 A;  2HJE A;  3MXS A;  1KGG A;  1WA9 A;  3MZF A;  3DTM A;  3M2K A;  5EVI B;  4U0T A;  1I5Q A;  4PM5 A;  1NJ4 A;  4AFI A;  4DE1 A;  5AQB A;  5FDS A;  1VM1 A;  5CRF A;  4CJN A;  3T1S A;  4NXB A;  5KMW A;  1KVL A;  1BTL A;  1NRF A;  4NG2 A;  4JPM A;  2V1A A;  4A5R A;  3IQA A;  1K54 C;  2WKR A;  3IXD A;  4X68 A;  2WZZ A;  4H6J B;  5L09 A;  2ZC7 A;  3C4O A;  1G6A A;  2HDU A;  4GLQ A;  2ZMV A;  3CUE A;  4JXS A;  5FAS A;  2XGN A;  5CHU A;  1VEU A;  2VLG A;  3IS2 B;  5GLD A;  1ODV A;  1K0K A;  3EGD C;  2Y2N A;  1CK3 A;  3C5A A;  2ZQ8 A;  2VGK A;  3H7W B;  3HJI A;  2NUT C;  2FFF B;  1M40 A;  1MPL A;  5C5K A;  3KX0 X;  2PD7 A;  2O9A A;  2WGW B;  4X1L A;  5HZH A;  4GDB A;  3MS6 A;  4ZAM A;  2OLV A;  5HD3 A;  1K25 A;  4JF4 A;  2J3T C;  4QB8 A;  3LR4 A;  4O7D A;  4ME4 A;  3UB8 A;  2VA0 A;  1L0F A;  1GA0 A;  4EQ1 A;  3G6O A;  3BFG A;  2DCF A;  4BEN A;  3N8L A;  5JYO A;  1LL5 A;  4OLD A;  3KYZ A;  1CF0 A;  1UWP X;  4EER A;  4XT2 B;  4O8G A;  3SOI A;  4R6L A;  5EPH A;  5FQI A;  3T4Q A;  1JVJ A;  4S2L A;  2HGV A;  2ZBB A;  4GZB A;  4JGQ A;  4E3K A;  4YOF A;  3UMD A;  1O7E A;  2V1Z A;  2HDR A;  3DW0 A;  2ZM8 A;  1L2S A;  4EBP A;  1YPR A;  5IU1 A;  2J9O A;  3BRM A;  3CAX A;  5KIZ A;  4P6Z S;  4JXW A;  5A92 A;  4FOF A;  1QME A;  4HJ3 A;  2A3U A;  5EVI D;  4QPR A;  1DJC A;  2O9C A;  2PU2 A;  3T4O A;  2LB5 A;  1SDN A;  2VGL S;  4JF6 A;  1GHI A;  3PAE A;  2YKF A;  5FAQ A;  2VV8 A;  5HAI A;  3RFB A;  4KQQ A;  2Y2P A;  2B95 A;  4R4S A;  4R23 A;  4I3I A;  3IXG A;  3VV4 A;  3L7H A;  2JN7 A;  4HI4 A;  3QP8 A;  1BLH A;  3ICY A;  1JTD A;  2B5R A;  5HSQ A;  3G31 A;  1YQS A;  1EW0 A;  3MKE A;  4WEL A;  4ARZ B;  3D3O A;  3CI6 A;  3W4P A;  1TS7 A;  5A91 A;  1TS0 A;  2EXA A;  4RQ9 A;  4FH2 A;  4PM6 A;  1JTG A;  3ULF A;  2E8J A;  1U60 A;  1W63 M;  4HHD A;  4HP9 A;  2M7V A;  3UPN A;  3P01 A;  5K5B A;  1OT9 A;  5DJU A;  5GHX A;  4MMN A;  3O5Y A;  4EBN A;  2IWD A;  4K0X A;  1EI5 A;  5DTK A;  3RTY A;  1PNE A;  5DFX A;  3FKW A;  3HUO A;  1G6O A;  3CZD A;  1UWN X;  3SS4 A;  2H0Y A;  3Q7V B;  1PZP A;  3BJN A;  3S7P A;  4B4Z A;  2PYP A;  1MY8 A;  4HY8 A;  4FUW A;  1I2S A;  2EX6 A;  1OJG A;  3M2J A;  1T1C A;  4Q0J A;  4RVA A;  4X6T A;  4I39 A;  4LGW A;  2OWJ A;  2Y55 A;  2Y2H A;  3UPP A;  5FQK A;  3CWF A;  2W3G A;  2W3F A;  2J80 A;  2JE5 A;  1PIO A;  4MN5 A;  2JBF A;  5J4E A;  1GCE A;  3TRC A;  1F5M A;  1LSX A;  2K31 A;  5FI7 A;  1VEU B;  4X1M A;  4EQI A;  1KDS A;  4P6Z M;  3WS5 A;  5L07 A;  3P09 A;  4Y3I A;  2HPB A;  5KSC A;  1YLW A;  3T1R A;  5CGW A;  2VGL M;  2V1B A;  3EOI A;  2WKQ A;  5E2G A;  4DXC A;  1FCO A;  1ACF A;  5HWV A;  5AJG A;  4L9F A;  5E2H A;  2OV5 A;  1KVM A;  3IHB A;  3OBF A;  3G4P A;  3EWK A;  2HZ5 A;  4KUK A;  3ZCZ A;  3OCL A;  2IA2 A;  3PBN A;  1FIK A;  5GHZ A;  4JLF A;  4P0M A;  4YNR A;  2K2N A;  1ALQ A;  4K0W A;  3DAV A;  3GMW A;  1NYY A;  4P6B A;  4OPY A;  4DE3 A;  1SKO B;  4JGP A;  4WYY A;  5FEG A;  3BY8 A;  1AXB A;  1XPB A;  1AWI A;  2R78 A;  4R38 A;  3QHY A;  3TE8 A;  1RGY A;  2OAP 1;  2QJ7 A;  4DE2 A;  4JBF A;  3IF6 C;  3JVU A;  4S2N C;  2VZW A;  1N9B A;  3A3J A;  4WZ5 A;  2E8I A;  2Z2M B;  1VET B;  3GEC A;  2CMN A;  5EVI A;  1NYM A;  1MWS A;  2J9P A;  4IJG A;  4E3M A;  1DP6 A;  2PHY A;  2J3T D;  4DDY A;  3ZG9 B;  4E3I A;  2L4R A;  2A2L A;  3AGE A;  2HDS A;  4UHU A;  1S66 L;  1F9I A;  1K56 D;  4ESP A;  1ZTU A;  1YLP A;  2HF6 A;  3TSG A;  4CQH A;  1OTI A;  1D06 A;  5A90 A;  5KZH A;  3G34 A;  3IBJ A;  4O0P A;  4KZ9 A;  1JWV A;  3PBQ A;  5GLC A;  3UE6 A;  4KZ6 A;  5DJT A;  2A49 A;  1K4F A;  3IXB A;  1XGJ A;  3G32 A;  2ZOI A;  3HUM A;  3WRZ A;  1PRQ A;  3NDG A;  3UNW A;  3W4O A;  3LID A;  1H8Z A;  2O9B A;  1V9Y A;  5EEC A;  3H7W A;  1I2W A;  4Y0U A;  3DBA A;  1KE4 A;  1XJ6 A;  3DWK A;  1ERQ A;  2WGW A;  4I3A A;  3VE3 A;  3V67 A;  3IWI A;  4CLC B;  4EXO A;  4OKP A;  4ZDX A;  4HH2 A;  1ZG6 A;  3N8S A;  4HP4 A;  3WS2 A;  4LCL A;  5AVE A;  1RP5 A;  1SKF A;  4M4X A;  5M1A A;  3B42 A;  3N6I A;  5AQ9 A;  2PT7 A;  4XT2 A;  3SS5 A;  5HDD A;  3SS3 A;  1N9L A;  5F5Y A;  2NUP C;  1ZHH B;  4UEY A;  3H82 B;  1DJA A;  1MXO A;  4GB7 A;  3MZE A;  3RH8 B;  2J3W A;  3W2Z A;  4OPQ A;  4KZB A;  2J8Y A;  4EEU A;  3ZVT A;  2M1C A;  4ZBE A;  3BFF A;  5EFW A;  4D60 A;  2QMI A;  5TJJ A;  1D7E A;  5GHY A;  2BAS A;  2Q9N A;  4X69 A;  2R9W A;  3SZT A;  1PYY A;  4WLA A;  2QJ5 A;  3WS4 A;  1YM1 A;  5CED A;  1HZO A;  4MBK A;  4DJ2 A;  5A93 A;  2ZJ9 A;  1SCW A;  3OC2 A;  4H8R A;  2JKF A;  1N9N A;  1MWR A;  3NEC A;  3ZNT A;  2QKP A;  5GLA A;  5L10 A;  3T4T A;  3LFV A;  2MJ6 A;  4HEF A;  2Y79 A;  4HIA A;  5GLB A;  2X01 A;  3R7W B;  2EX2 A;  3NHQ A;  4UA6 A;  4E3L A;  2Y2G A;  1OPX A;  3T4K A;  1TS6 A;  3V5M A;  2HP5 A;  1TDL A;  4JKT A;  5E2F A;  3VMA A;  1T1B A;  4WEJ A;  4ARZ A;  3D72 A;  3FKV A;  4GD6 A;  3G30 A;  2Y2J A;  3IWO A;  1K54 A;  2W1R A;  3HUN A;  2JHE A;  4BLM A;  1L0G A;  3ZG7 B;  2Y91 A;  1VQQ A;  3PAG A;  4LV3 A;  1J9M A;  5DTS A;  5FSR A;  3NBL A;  4IUH A;  4R3B A;  2ZC6 B;  3UME A;  4G3V A;  1FCM A;  1ES4 A;  5CHJ A;  4OP5 A;  2QWS A;  3PBS A;  4CLC D;  5FDH A;  4S2K A;  4KUO A;  3QNC A;  2Q9M A;  4JGO A;  4U0X A;  4G3W A;  3Q7V A;  1IYO A;  2H10 A;  1CEF A;  1PI4 A;  4WZ4 A;  3MFD A;  3N8R A;  3IX4 A;  5HDS A;  2VJW A;  3SW1 A;  3WS0 A;  3JVV A;  1GA9 A;  2ZC3 B;  2GX5 A;  3W8K A;  1K56 A;  1YT4 A;  4N1H A;  3VP4 A;  3C30 A;  3NOU C;  1CI8 A;  3HLC A;  1F98 A;  3FWL A;  4KG6 A;  2B18 A;  3UY6 A;  4BMW A;  3BFC A;  1S1Z A;  4GJ4 A;  3O86 A;  1G28 A;  4NET A;  4NK3 A;  2PD8 A;  4KQO A;  2VX8 A;  3CG5 A;  5KSH A;  3L9K A;  3UB6 A;  1XX2 A;  3D9Y A;  4HJ6 A;  2QZ6 A;  3KSI A;  5FI2 A;  2EX8 A;  4OOY A;  4ETZ A;  1IEL A;  3NUL A;  4LV1 A;  1OTE A;  4U3T A;  2OSU A;  3QP5 A;  5CHM A;  5JYP A;  4L9G A;  2PR5 A;  4KEN B;  3EQV A;  1H0M A;  1NXY A;  4L9E A;  5CX7 A;  1Z6F A;  3EQU A;  4E6X A;  5BOH A;  5TR7 A;  2GJ3 A;  1KGF A;  3BLM A;  1CQA A;  3SH7 A;  3FC7 A;  1SZV A;  4QHC A;  1P9R A;  1SKO A;  1XA1 A;  5DFY A;  3EEA A;  1OME A;  1W8Q A;  3AGF A;  3QP6 A;  4EEP A;  3LR0 A;  3MMH A;  2XK1 A;  4PHT A;  5CEB A;  4YWZ A;  4MEZ A;  3VP3 A;  3CUE C;  3MQQ A;  2WKI A;  3N7W A;  3LEQ A;  5F69 A;  1NY0 A;  5HPF A;  4GCZ A;  2W3H A;  3IHA A;  4PAU A;  5M18 A;  2VEA A;  4EBL A;  1VET A;  1XFN A;  4FCF A;  2ZQ7 A;  5HX9 A;  3Q81 A;  1TF1 A;  2C5W B;  5HFO A;  4BBV A;  4BBU A;  3Q7Z A;  3T1Q B;  4OVD A;  5FL3 A;  4R4R A;  5F68 A;  3LIB A;  3BFD A;  1K6R A;  2JKT M;  3S7Q A;  2XRN A;  3NI9 A;  3QNB A;  1YLJ A;  4OLG A;  4KG2 A;  2ZC4 B;  5IT5 A;  5DF7 A;  2PDR A;  2XH9 A;  4DMZ A;  1IKI A;  4DN0 A;  3PXP A;  4IVI A;  2Y59 A;  4Y0T A;  3VOL A;  4ZJ3 A;  2X71 A;  3ZFZ A;  1K55 A;  1L3L A;  3LIA A;  4LV0 A;  1DY6 A;  4WMC D;  1ONG A;  1Q2Q A;  3IXH A;  3HLW A;  1W63 Q;  2FZ0 A;  5AQA A;  4QY6 A;  1BYW A;  4CPK A;  3LIE A;  3LI9 A;  1STZ A;  2V8F A;  5DKK A;  4DE0 A;  3ZQ5 A;  3E98 A;  3E4O A;  3M6B A;  3OPH A;  3MBZ A;  4CLC A;  4HJ4 A;  2J7V A;  5F1F A;  3LGO A;  3MFX A;  2FH5 A;  1S1Y A;  1YLT A;  3BYD A;  3V50 A;  2Y2I A;  5EUA A;  2DRW A;  3UN7 A;  4OPZ A;  3AGD A;  3H82 A;  3HLG A;  3HRE A;  4XUX A;  5TFQ A;  2WAD A;  1FOF A;  3VFF A;  2XFT A;  2PBY A;  3NDE A;  2EX9 A;  2WGI A;  1W79 A;  1XJ3 A;  1XA7 A;  5HAP A;  3CLO A;  2I72 A;  1RCJ A;  4I3J A;  2FFY A;  2HV1 A;  1FSY A;  3HLE A;  2EA9 A;  2W3D A;  2ZC5 B;  2UV0 E;  2V2F F;  3PR6 A;  1XJ4 A;  4DRT A;  2V9A A;  1LHY A;  3VSK A;  1E3U D;  5F82 A;  5FAT A;  1G5U A;  2G2W A;  3MQ0 A;  3C38 A;  1VB6 A;  3CPT A;  2PBD P;  4S2N A;  1CEG A;  4NXF A;  1GSW A;  4WUJ A;  4EV4 A;  5HD5 A;  4PMA A;  2L1M A;  1K38 A;  4F94 A;  2D02 A;  5A8B A;  3Q07 A;  3IH8 A;  4I38 A;  1K4E A;  2OOL A;  4PM7 A;  3MR0 A;  3DWZ A;  2M7U A;  3D4F A;  2IWB A;  3V39 A;  1WYC A;  3R7W A;  5DKL A;  5HWW A;  1PW8 A;  3VFH A;  4EU0 A;  1Y54 A;  2VGJ A;  3NY4 A;  5F1G A;  3KO6 A;  4PPR A;  4GD8 A;  4GKU A;  1FIL A;  3UE0 A;  5CGX A;  3VP2 A;  1P9W A;  1FSW A;  4HBT A;  2KX6 A;  5I5L A;  1KDW A;  3JPU A;  2QHK A;  3K2N A;  4PM9 A;  3F1O B;  4Y2F A;  3E4P A;  3HLB A;  4Z1W A;  4O01 A;  3OCN A;  1PI5 A;  1OTB A;  4RYE A;  1BLP A;  4EW7 A;  5FQJ A;  4HH3 A;  4Y7P A;  3C7V A;  1ZC2 A;  1BSG A;  1PWC A;  5FQ9 A;  3OPP A;  5HPI A;  3UB7 A;  3TOI A;  4RX3 A;  1YMS A;  4PKY A;  4ZTK A;  1QMF A;  5EV0 A;  3PBO A;  2Z2L B;  4F3L A;  1IYS A;  5J7E A;  1L0E A;  2XF3 A;  1DP9 A;  2WYX A;  3IF5 A;  3NCK A;  4IUK A;  1IEM A;  2PYR A;  1X0O A;  4OOL A;  4YIN A;  4Q8I A;  3PBR A;  2ZM2 A;  2OAQ 1;  2JKG A;  1YLZ A;  3LY3 A;  4KQD A;  1MWU A;  3NJA A;  3T4J A;  1ERM A;  4GW9 A;  3V3S A;  1A0K A;  2VV7 A;  3F1P A;  3W4Q A;  4DDS A;  2JC7 A;  5HW3 A;  5EVL A;  5J8X A;  3H9W A;  5EOO A;  4HNB A;  3T4L A;  2ZOH A;  4ZRR A;  3BWL A;  3F1N B;  3UE3 A;  4PKY G;  3BEC A;  4B4X A;  1HTZ A;  3Q82 A;  4WMC A;  4OH0 A;  4MNR A;  3E2L A;  1WYB A;  3EEH A;  3EGX C;  5IHV A;  3PHY A;  4GNU A;  4N1X A;  3N4I A;  4KQR A;  4EWF A;  4OOM A;  3UB5 P;  3ZG5 A;  3UE1 A;  4UQI S;  3SH9 A;  1CJF A;  2JKR M;  2KLI A;  5EVI C;  3B33 A;  4JGR A;  1NWZ A;  1Q2P A;  2ZMF A;  3TG9 A;  1Y4O A;  5TGF A;  2H0T A;  4QU3 A;  2WKH A;  3QP4 A;  3PBT A;  5FI6 A;  3GTC A;  1ONH A;  1YMX A;  3ITB A;  2VV6 A;  1IYQ A;  5DVA A;  3T4S A;  3UO9 A;  1LI9 A;  5TBM B;  3S7O A;  5L2F A;  3NOT C;  3ZG8 B;  1RGZ A;  2EWV A;  4Y15 A;  4IED A;  2ZMA A;  2PAV P;  3ISG A;  2Q0O A;  2PR6 A;  3PYP A;  2HP9 A;  1E3U A;  2V8C A;  3IF6 B;  2ZQD A;  4WF0 A;  3HBR A;  3LIC A;  3CPT B;  2WZX A;  3T12 B;  5FQM A;  1LL8 A;  2ZLY A;  1ZKJ A;  1XKZ A;  4ZJ2 A;  5CGS A;  4WBG A;  3OPR A;  4WM9 A;  2D01 A;  1KE0 A;  2RCX A;  4LEN A;  1MKM A;  3UDF A;  1OTA A;  4OPR A;  2H5S A;  2PU4 A;  5DTT A;  2GZA A;  4HES A;  4BL2 A;  3A0S A;  4KG5 A;  5CTN A;  2AVX A;  3CIT A;  4MLL A;  4B9O A;  3BQA A;  4FSF A;  2WKE A;  1NZU A;  2V0W A;  1YKD A;  2ZM0 A;  2P04 A;  3S1Y A;  4GS9 A;  1BZA A;  1BLS A;  2X02 A;  3ZNY A;  3UPO A;  1C3B A;  4UQI M;  4NXG A;  3C8C A;  3MKF A;  4F3L B;  1T18 A;  4BD0 A;  1IKG A;  2ZQA A;  4D2O A;  2ACG A;  3BY9 A;  1NRJ A;  3RXW A;  3NOP C;  3TJZ C;  5MC7 A;  2A24 B;  3FYZ A;  1NLY A;  4QJG A;  5G4Z A;  4BL3 A;  4GDN A;  5HL1 A;  1VHM A;  1W8Y A;  3MSH A;  5HDC A;  3IWQ A;  4ETX A;  1FR1 A;  4S2J A;  4K91 A;  1G68 A;  3P7N A;  3ZVW A;  3KYQ A;  1MWT A;  3F1P B;  1XFQ A;  1MKI A;  4Y17 A;  4JF5 A;  1BUE A;  4MN6 A;  4HQA A;  4S2O A;  5G4Y A;  5F83 A;  3MF0 A; 
#chains in the Genus database with same CATH homology
 4YNR A;  2K2N A;  3B47 A;  4DN0 A;  3FPW A;  3PXP A;  2JKT I;  3VOL A;  2L0W A;  3HJK A;  4JGP A;  3C2W A;  3R4K A;  3BY8 A;  3IBR A;  4B93 A;  1IOU A;  4WL9 A;  1V9Z A;  3LIA A;  1UGU A;  2R78 A;  4L0L A;  3LR3 A;  4R38 A;  2W27 A;  1H3Q A;  5AVF A;  1W63 Q;  2FZ0 A;  2EWW A;  2OAP 1;  2QJ7 A;  4LRY C;  3TE8 A;  1IFQ A;  1DRM A;  4EET B;  1BYW A;  5IS1 A;  3FG8 A;  3LIE A;  3LI9 A;  2W3E A;  3LI8 A;  5HL6 A;  3JVU A;  4R70 A;  2P7J A;  1STZ A;  5DKK A;  4Q0I A;  3ZQ5 A;  2VZW A;  3E98 A;  1OJ5 A;  3E4O A;  3K3D A;  4CLC A;  4HJ4 A;  3GEC A;  2CMN A;  1T19 A;  3MFX A;  2FH5 A;  1S1Y A;  3K3C A;  2W1T B;  3OLO A;  4IJG A;  1YSQ A;  4NXE A;  4E04 A;  1DP6 A;  2PHY A;  2J3T D;  2O0Y A;  2L4R A;  2A2L A;  3A0V A;  1P0Z A;  4EES A;  1S66 L;  1F9I A;  3GDI A;  3H82 A;  5F6A A;  1ZTU A;  4LLO B;  1JNU A;  2LB9 A;  2HF6 A;  4BJP A;  3MXQ A;  4CQH A;  1OTI A;  1D06 A;  3F1O A;  1N9O A;  3KSH A;  3OOV A;  3UB9 A;  3IBJ A;  4O0P A;  1XJ3 A;  1KOU A;  4G3K A;  4II7 A;  3CLO A;  3PBQ A;  3UE6 A;  1YSP A;  5DJT A;  4I3J A;  1T1A A;  4MDZ A;  2HV1 A;  2YKH A;  1DP8 A;  2ZOI A;  3KSF A;  1S4S A;  2B02 A;  3T50 A;  2Z6D A;  2EA9 A;  2W3D A;  3PR6 A;  1XJ4 A;  2V9A A;  2W0N A;  1TD5 A;  2KDK A;  3S7N A;  4GHI B;  3LID A;  4CLC E;  4BBT A;  1OT6 A;  2HJ9 C;  1V9Y A;  2O9B A;  4DJ3 A;  3MQ0 A;  3C38 A;  3H7W A;  2GNX A;  1VB6 A;  2Y8H A;  3DBA A;  1OTD A;  4Y5F A;  1XJ6 A;  5L8M A;  4NXF A;  4I3A A;  3VE3 A;  1GSW A;  4WUJ A;  3V67 A;  5HD5 A;  3E0Y A;  5LBR A;  2L1M A;  4CLC B;  4EXO A;  2HJE A;  2D02 A;  5A8B A;  1WA9 A;  4HH2 A;  4I38 A;  2OOL A;  3MR0 A;  4HP4 A;  5AVE A;  2M7U A;  4AFI A;  4M4X A;  3R7W A;  3ZYT A;  5DKL A;  5HWW A;  3B42 A;  1Y28 A;  4EU0 A;  2PT7 A;  4XT2 A;  3KO6 A;  5HDD A;  1N9L A;  5F5Y A;  2DMW A;  4NXB A;  2NUP C;  1ZHH B;  4UEY A;  3U2A A;  3H82 B;  3MQO A;  1P9W A;  2V1A A;  3F1N A;  4K08 A;  3RH8 B;  2J3W A;  2KX6 A;  5I5L A;  3W2Z A;  2QHK A;  3K2N A;  2WKR A;  3F1O B;  4Y2F A;  3E4P A;  4EEU A;  4H6J B;  2M1C A;  4Z1W A;  4O01 A;  3OCN A;  1OTB A;  5EFW A;  4EW7 A;  4HH3 A;  3MF0 A;  5TJJ A;  4GLQ A;  2ZMV A;  1D7E A;  2BAS A;  3CUE A;  4GS9 B;  2G7U A;  5HPI A;  3UB7 A;  2VLG A;  3IS2 B;  4PKY A;  1ODV A;  4WLA A;  2QJ5 A;  3EGD C;  1MC0 A;  3PBO A;  2VKS A;  4F3L A;  4DJ2 A;  5J7E A;  3H7W B;  3HJI A;  3LR5 A;  2NUT C;  1DP9 A;  2XSS A;  4IUK A;  5C5K A;  3KX0 X;  1LSW A;  3OC2 A;  2PD7 A;  2PYR A;  2O9A A;  1X0O A;  1N9N A;  3E4Q A;  4OOL A;  5HZH A;  3PBR A;  2QKP A;  2OAQ 1;  5HD3 A;  3T4T A;  3TW8 A;  2J3T C;  3LR4 A;  3LFV A;  4KQD A;  2MJ6 A;  3NJA A;  4ME4 A;  2Y79 A;  3UB8 A;  3T4J A;  2VA0 A;  4GW9 A;  4EQ1 A;  4HIA A;  3G6O A;  3R7W B;  3NHQ A;  2VV7 A;  3F1P A;  3KYZ A;  5TBM A;  4I5S A;  1UWP X;  4EER A;  1OPX A;  4O8G A;  4XT2 B;  4NKP A;  3T4K A;  1TS6 A;  4R6L A;  3H9W A;  1T1B A;  4WEJ A;  4HNB A;  4ARZ A;  3D72 A;  3T4L A;  4HOI A;  3T4Q A;  2ZOH A;  4ZRR A;  3BWL A;  3F1N B;  4BWI A;  2W1R A;  2JHE A;  4Q0H A;  3MJQ A;  2HGV A;  2XRO A;  1H8M A;  3UE3 A;  2ZBB A;  2I9V A;  4JGQ A;  4PKY G;  4YOF A;  3UMD A;  3LYX A;  3LIF A;  4IUH A;  3EEH A;  5IU1 A;  3EGX C;  1LSV A;  3PHY A;  3UME A;  4G3V A;  3CAX A;  2QWS A;  3PBS A;  4CLC D;  4OOM A;  4P6Z S;  5KIZ A;  4FOF A;  4HJ3 A;  4KUO A;  4JGO A;  4QPR A;  4UQI S;  3VE4 A;  4G3W A;  4CLC C;  2O9C A;  2JKR M;  2KLI A;  5DF9 A;  2LB5 A;  3T4O A;  2VGL S;  3B33 A;  1GSV A;  4JGR A;  1NWZ A;  2ZMF A;  2YKF A;  3BQ8 A;  2VV8 A;  5HDS A;  3RFB A;  2VJW A;  3SW1 A;  3PBT A;  4I3I A;  3VV4 A;  4MN7 A;  2JN7 A;  4HI4 A;  3JVV A;  3ICY A;  2VV6 A;  3FPV A;  2GX5 A;  2K7S A;  2JKR I;  3T4S A;  3C30 A;  3NOU C;  5TBM B;  3S7O A;  5HSQ A;  1F98 A;  2B18 A;  1EW0 A;  3NOT C;  4BMW A;  3HCY A;  1S1Z A;  4WEL A;  4ARZ B;  2EWV A;  3D3O A;  4GJ4 A;  3CI6 A;  2XA7 S;  1S4R A;  1TS7 A;  1TS0 A;  1G28 A;  4RQ9 A;  1NLZ A;  2H28 A;  3ULF A;  2PD8 A;  4KQO A;  1W63 M;  2VX8 A;  4HHD A;  5KSH A;  4HP9 A;  2M7V A;  3UB6 A;  2PR6 A;  3P01 A;  3PYP A;  4GHI A;  4HJ6 A;  1OT9 A;  5K5B A;  5DJU A;  3KSI A;  4WF0 A;  2WKP A;  4MMN A;  2O99 A;  3O5Y A;  3A0R A;  4WEK A;  3LIC A;  4LPZ A;  4ETZ A;  1S67 L;  1LL8 A;  1OTE A;  2A24 A;  3RTY A;  1GSX A;  4R3A A;  5DFX A;  1G6O A;  2KOI A;  1UWN X;  4L9G A;  4WN5 A;  2PR5 A;  3EQV A;  3BJN A;  2D01 A;  3S7P A;  2PYP A;  2P08 A;  1XJ2 A;  4HY8 A;  1MZU A;  4L9E A;  1OJG A;  5CX7 A;  3BW6 A;  1T1C A;  3EQU A;  1MKM A;  2GJ3 A;  4Q0J A;  4EUV A;  1OTA A;  1YAX A;  4I39 A;  2OWJ A;  3CWF A;  2W3G A;  3FC7 A;  2W3F A;  1P9R A;  2GZA A;  2J80 A;  5J3W A;  4MN5 A;  3A0S A;  2V0U A;  3EEA A;  5DFY A;  5J4E A;  3CIT A;  4MCW A;  4B9O A;  3BQA A;  4FSF A;  4H6J A;  4EEP A;  3LR0 A;  2V0W A;  1YKD A;  3TRC A;  1TS8 A;  1F5M A;  3MMH A;  2OWH A;  2P04 A;  4PHT A;  4YWZ A;  3KSG A;  1LSX A;  2K31 A;  3CUE C;  4GS9 A;  3MQQ A;  4P6Z M;  3IS2 A;  4IHQ A;  4Y3I A;  5F69 A;  3LUQ A;  4UQI M;  4NXG A;  4GCZ A;  4LRX C;  2W3H A;  5HPF A;  5HWT A;  3C8C A;  4F3L B;  4PAU A;  1T18 A;  2VGL M;  2VEA A;  2V1B A;  1LT0 A;  1XFN A;  2INW A;  3EOI A;  2WKQ A;  2W1T A;  3BY9 A;  1NRJ A;  5HWV A;  1TF1 A;  5AJG A;  3TJZ C;  3NOP C;  5MC7 A;  4L9F A;  4BBV A;  4BBU A;  2A24 B;  1NLY A;  2QYB A;  5FL3 A;  5F68 A;  3LIB A;  5G4Z A;  3OBF A;  2JKT M;  3EWK A;  1VHM A;  3S7Q A;  2XRN A;  5HDC A;  4KUK A;  4ETX A;  4NEE D;  3P7N A;  1P97 A;  5IT5 A;  2Z6C A;  3KYQ A;  3OCL A;  2IA2 A;  3F1P B;  1XFQ A;  2PDR A;  4LRZ E;  3PBN A;  4MN6 A;  5G4Y A;  4HQA A;  2XA7 M;  4DMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...