4HJ6A

Crystal structure of rhodobacter sphaeroides lov protein
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
175
structure length
175
Chain Sequence
b'DQKQFEKIRAVFDRSGVALTLVDMSLPEQPLVLANPPFLRMTGYTEGQILGFNCRFLQRGDENAQARADIRDALKLGRELQVVLRNYRANDEPFDNLLFLHPVGGRPDAPDYFLGSQFELGRSGNSEEAAAAGHAGALTGELARIGTVAARLEMDSRRHLAQAAAALVRAWERRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LOV protein
molecule tags Signaling protein
source organism Rhodobacter sphaeroides
publication title Light-induced subunit dissociation by a light-oxygen-voltage domain photoreceptor from Rhodobacter sphaeroides.
pubmed doi rcsb
total genus 54
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hj6A00
1TS0A 2D01A 2L4RA 4BBUA 4KQDA 4WUJA 4LRYC 2K7SA 2JN7A 2L0WA 3NOTC 4HP4A 4XT2B 1N9LA 5A8BA 1OT6A 5F69A 5TBMA 3GECA 3VE4A 2WKRA 4R6LA 4HI4A 3LICA 4F3LB 2GJ3A 3T50A 2W27A 1OT9A 1S1ZA 3ULFA 1S4SA 4K08A 5DJTA 4PKYA 3UB8A 1XJ6A 2QWSA 3C2WA 3K3DA 4H6JB 2PDRA 1XFNA 3FG8A 1BYWA 4M4XA 5HD5A 3UMDA 3IBRA 3LIAA 3E4OA 1DRMA 3PYPA 3LI8A 5KIZA 2V9AA 4HNBA 1TS8A 1XJ3A 4R38A 3RH8B 1T18A 2PD8A 3F1OA 1D7EA 1Y28A 4GS9A 5F6AA 4I39A 4PKYG 1GSXA 1UGUA 1TS7A 5AVFA 2HV1A 1DP6A 1G28A 4JGQA 5HSQA 4WLAA 4I3AA 1LSVA 3UE6A 2OWJA 4LRZE 5DKKA 5IS1A 2PD7A 4HH3A 3UB9A 5DKLA 4BBTA 2V1BA 4YWZA 1OTEA 1LSXA 3LIEA 3LI9A 1LL8A 1P0ZA 2YKHA 3GDIA 3LIBA 4EETB 1ODVA 1GSWA 1OJ5A 5TBMB 4EEPA 1S66L 4DJ3A 2B02A 3H7WA 1XJ4A 5HWWA 3HJKA 2ZBBA 3MR0A 2D02A 2H28A 3B33A 1DP8A 1UWPX 3CLOA 3F1NA 4H6JA 3LUQA 4KUOA 5G4ZA 3UB7A 4BBVA 3LYXA 5I5LA 5J3WA 3UB6A 1UWNX 2L1MA 1OTBA 3F1PA 5HD3A 3F1NB 2QKPA 5EFWA 2CMNA 5HDSA 3A0RA 4I3IA 3LIDA 2WKPA 1JNUA 2Z6DA 2VV6A 4KUKA 1N9OA 1S67L 3H82A 1T1AA 4GW9A 3NJAA 4EXOA 4NXBA 2OOLA 4GS9B 2W0NA 4NXGA 3K3CA 2VLGA 3EWKA 3BY8A 5HDDA 3VOLA 2EA9A 3LIFA 1XFQA 3P7NA 5AVEA 2V1AA 2VV7A 4LRXC 4WL9A 1T19A 1OTAA 3MQOA 3MFXA 2PHYA 4EW7A 3C8CA 4HHDA 3MJQA 5IU1A 3UMEA 3IS2B 3D72A 3ZQ5A 1LSWA 3A0VA 1OJGA 3F1PB 2PYPA 3E4QA 1LT0A 4HP9A 4I5SA 5F68A 2QJ5A 5DJUA 5HDCA 5F5YA 1OTIA 1P97A 1V9ZA 2R78A 3F1OB 1F9IA 4E04A 2INWA 4MN6A 3ICYA 3MQQA 3H7WB 5HZHA 4GHIA 2Z6CA 4EERA 1N9NA 1X0OA 4GCZA 2OWHA 2ZOHA 3BY9A 3VE3A 2KDKA 1T1BA 3HJIA 2A24A 4MN5A 3A0SA 2KX6A 1S4RA 1DP9A 3CWFA 4I3JA 4LLOB 3RTYA 2VEAA 1GSVA 4HQAA 2A24B 2QJ7A 3BWLA 3IS2A 4NXEA 1VB6A 1XJ2A 4JGRA 5J7EA 3KX0X 4HY8A 1OTDA 3G6OA 1KOUA 4WF0A 5HWTA 1EW0A 4R3AA 2BASA 4HJ6A 4EQ1A 4I38A 4L9GA 3NOUC 4NXFA 2VV8A 1NWZA 1MZUA 1T1CA 2PR5A 1S1YA 3EEHA 2ZOIA 4HJ4A 3NHQA 4HIAA 3H9WA 4HH2A 4B9OA 1V9YA 3FC7A 1F98A 4GHIB 3MXQA 4DJ2A 2V0WA 2I9VA 3OLOA 1TS6A 1WA9A 2JHEA 2QHKA 1D06A 4LPZA 4R70A 4HJ3A 4WN5A 3SW1A 2V0UA 2PYRA 2J80A 3PHYA 4F3LA 2P7JA 4HOIA 4EESA 5HWVA 4RQ9A 4EEUA 3NOPC 4L9EA 2WKQA 5G4YA 4JGPA 5J4EA 3CAXA 3E4PA 4JGOA 2YKFA 2M1CA 2PR6A 4XT2A 3H82B 4L9FA
chains in the Genus database with same CATH superfamily
4BBUA 1P9RA 1IYOA 5F69A 3GTCA 4E3IA 1PZPA 1CF0A 4NETA 3GMWA 2VA0A 3UB8A 4H6JB 4KQOA 2B18A 3QP5A 5F1FA 1FQGA 4UA6A 4HNBA 3MKFA 4G3WA 3TE8A 5FI6A 1HTZA 5F6AA 4HEFA 4OVDA 4R1GA 2A49A 2VGLM 1G28A 1WE4A 4ZJ2A 3TG9A 5GL9A 2OWJA 4QD4A 2HDSA 1IOUA 2ZM2A 1K57A 1OJ5A 1ESUA 3WS5A 2KOIA 5DF7A 3UB6A 2Q0OA 3M2KA 3R4KA 1VEUB 2Z6DA 1S67L 2OSUA 1T1AA 4GW9A 4XXRA 1ZHHB 3E98A 3EWKA 5HDDA 4BMWA 2XFTA 1SDEA 3MFXA 1OPXA 3GRJA 5F68A 4II7A 3T1QB 1YSPA 4HBTA 1YLYA 3VE3A 4R3JA 3VP0A 4HQAA 1KGEA 1K54A 2HJ9C 3NHQA 5I94A 2ZC7A 4GD6A 4IHQA 2EXBA 3KSFA 4JLFA 3LR3A 4DE0A 4Y7PA 4HOIA 3HLCA 2WK0A 3N7WA 2EX9A 2QZ6A 4KZ7A 4LRYC 4HP4A 4ARZB 1SDNA 1L0EA 2HP9A 1W63Q 1BLHA 4ZBEA 2JKTI 1K55C 2EXAA 2Y2MA 2HJEA 4EV4A 2E8IA 1DRMA 2H5SA 4B4ZA 1PNEA 4PM7A 1KDWA 4S2PA 5TGFA 1OTEA 4C6YA 3BRMA 3JVUA 3OCLA 2KLIA 1GSWA 4DJ3A 2B95A 2M7UA 4E04A 3WRTA 5FAPA 1FR1A 3H82A 1HD8A 3WS0A 4OP5A 4NXGA 2ZM8A 2HDUA 2HPBA 3WS2A 3E4QA 1W8YA 1CEFA 5F5YA 3F1OB 3IXHA 4PM9A 4DE1A 3RJUA 4MDZA 3AGEA 5HZHA 1TEMA 1IKIA 1XA7A 4Z1WA 1DY6A 1LL5A 3G6OA 1KOUA 2DNSA 3NOUC 1T1CA 4HJ4A 5A92A 4BD0A 1XKZA 3VV4A 1V9YA 4MN7A 2V0WA 1ES2A 3W2ZA 1ERQA 1O7EA 3QP6A 4LPZA 2W3DA 1JTGA 2XFSA 3UPPA 5AQ7A 2VGKA 3PBSA 3TJZC 2Y2OA 3GSGA 4FTXA 5A8BA 4DKIA 3N8SA 3LICA 1OT9A 3N8RA 4OPZA 2FFYA 5HD5A 5TFQA 1L2SA 5IHVA 3HUOA 3VMAA 2XH9A 5EVLA 1XGJA 2MJ6A 4HH3A 3IF6A 2K2NA 3LIEA 5FASA 2J3TD 3UDXA 3DTKA 5FQQA 1DP8A 4O01A 4GDBA 1IYPA 4QB8A 3LY3A 2L1MA 5LBRA 2XD5A 3KO6A 3UPNA 4EXOA 5U47A 3K3CA 4U3TA 3R7WB 3ZFZA 4KQRA 1GHMA 4HBUA 2PHYA 3MJQA 5GLBA 4NKPA 2PYPA 3VP2A 4AFIA 1OTIA 4N1XA 5GLDA 5E2GA 2Q9NA 5JYOA 3E2KA 3BFGA 2A24A 1DP9A 3QP1A 3A3FA 1VB6A 3HUNA 4JF5A 4R3AA 4I38A 1S1YA 2J9OA 4FSFA 4IUKA 3K2NA 1WA9A 3IQAA 2QHKA 4GN2A 2IWBA 3LO7A 4CQHA 4OOMA 1U60A 1H8YA 2P9VB 4ESPA 1YKDA 5FI7A 5AJGA 4DDSA 4OONA 3NCKA 3IX8A 2XF3A 1N9LA 3NIAA 4WBGA 1BLCA 4QPRA 5JYPA 4GD8A 1L0FA 2RL3A 3K3DA 4PHTA 5HAQA 3VSKA 4FH4A 3LI8A 3UE3A 3ZHHA 1XGIA 1GSXA 3CPTB 3LGOA 4E3LA 1NY0A 2W1TB 4KZ3A 3A3JA 4UAAA 1P0ZA 3V3RA 3DW0A 4Y3IA 1EI5A 5HWWA 3KYQA 4Y15A 1MC0A 3UY6A 3B33A 4KUOA 4UEYA 1AXBA 1W79A 5J3WA 3S22A 3LIDA 2VV6A 3M6HA 1YLTA 3D4FA 1W5DA 5HL6A 3LIFA 5DF9A 2ACGA 2V1AA 2J9PA 4OLGA 4OPYA 5HX9A 5HW3A 4GB7A 4GHIA 4EERA 4C75A 2KDKA 4R3BA 4NXEA 4PPRA 4MBFA 2J3WA 1NXYA 2ZOIA 5FQKA 3BFDA 5M19A 3WWXA 4Z9QA 4ZJ1A 2HP6A 1OMEA 3PHYA 3HREA 2ZMAA 2WGIA 3E4PA 4E3NA 1PI4A 3SS5A 2D01A 1TVFA 1K56A 4WUJA 5EOOA 4Y0TA 3ZVTA 4IBXA 2DCFA 1BSGA 4WZ5A 5F82A 3MSHA 4Y0OA 4F3LB 2W27A 4K08A 1XJ6A 4QY6A 3FG8A 1NLZA 3WRZA 3WS1A 4Y2FA 5KIZA 3BW6A 2H0YA 1DJAA 3KSHA 1QMFA 1UGUA 2HV1A 3MKEA 5FQJA 5CTNA 4KENB 1NYYA 1S66L 3EGXC 4Y0UA 3HJKA 4HESA 4DE3A 3F1NA 1KE3A 4YNRA 1D1JA 3SH8A 1ZG4A 1H0MA 4WMCD 3VOLA 3VP4A 3ITBA 3P7NA 1ES5A 2XROA 3LR5A 3D72A 4Q0JA 3ZDJA 1S6RA 5MC7A 3H7WB 4CLCA 1G68A 1SKFA 2JKRM 4JF6A 4I3JA 2JCHA 5EM1A 3MBZA 2VV8A 4A5RA 3VSLA 1NLYA 1F98A 2Y2GA 2ZM0A 1BLPA 2Y2NA 1J9MA 5HARA 3SH9A 4ZRRA 4JGPA 5EECA 4M4XA 1JTDA 5AQBA 2W1RA 5HAIA 3NOTC 4K91A 3IXDA 3T50A 1S1ZA 3C2WA 5KSHA 1PYYA 2QPNA 3BQ8A 3HVFA 4OQIA 4KZAA 4N9LA 1D7EA 4WEJA 3MZDA 2HF6A 3S7NA 2ZLYA 3HLFA 2V1ZA 5A91A 3CHWP 3BJNA 3GDIA 2EFUA 3S4XA 1W7FA 3CZDA 3T4OA 2HDRA 3SZTA 4LV3A 2Y2HA 1ALQA 3Q7VB 4X25A 4Q8IA 3LYXA 4OKPA 5BOHA 3F1NB 3FV7A 1JNUA 1SCWA 3OBFA 4D60A 1I5QA 1H8MA 2ZQ8A 4YINA 4HP9A 4EBNA 5DVAA 2ZJ9A 3UDFA 4EBPA 3VFFA 3IXBA 3TRCA 4EQIA 3PAEA 5A93A 4OOYA 3HJIA 4MBHA 4KZ4A 4LCMA 2QJ7A 3BM6A 2X01A 4RVAA 2ZC6B 2Y2IA 4QU3A 1GCEA 5FAQA 4HIAA 1O07A 1YM1A 4IUHA 1KGGA 5F83A 2ZQ7A 4R70A 2H10A 4ZTKA 1P9WA 1SZVA 3SW1A 1KVMA 1NRFA 1RGZA 3BYDA 4FOFA 5G4YA 4O8GA 4DN0A 3T4KA 2L4RA 2WKIA 1ERMA 3VP3A 3LCEA 4XT2B 1PW1A 1E3UA 3ZGAB 3ZNTA 3ULFA 5DTKA 3HLEA 4KZ5A 3V3SA 2X02A 4OQHA 5HPFA 3LR0A 3CUEC 3VOZA 1Y28A 3P98A 4KZ6A 4S2KA 5EVIA 3MS6A 3JVVA 1AWIA 5FQMA 5DKLA 2R9XA 3IWOA 3WS4A 3NDEA 5CHJA 5HPIA 2H28A 3V67A 3MXSA 4R4RA 3CG5A 3A3DA 4DE2A 1K4FA 5FL3A 2EA9A 5DFYA 3Q07A 4DF6A 4EW7A 2JKFA 3KSGA 1LSWA 3UN7A 3F1PB 4JXWA 1P97A 1F9IA 5M1AA 2OWHA 3JPUA 1LI9A 4P6BA 4K0XA 3FKVA 3GV9A 1GSVA 1NJ4A 5GLAA 2NUPC 1K6SA 1LLBA 1SKOA 1MWRA 3ZG0A 2Y2QA 4DXBA 2ZC3B 4B9OA 4DDYA 3FC7A 1CK3A 4GHIB 1TS6A 5E2FA 5K5BA 3C5AA 3IHAA 2J7VA 3HCYA 2V0UA 2P7JA 3VFHA 4GDNA 1ZKJA 3E2LA 2XDMA 4XT2A 5EVIC 4GJ4A 1GA0A 4GNUA 4CLCE 1PWCA 5CXWA 1OT6A 4S2IA 3HLWA 2VGJA 5C5KA 1CQAA 3IX3A 4PKYA 1NYMA 3E4OA 4E3OA 1XJ3A 1XP4A 4B88A 1T18A 4GS9A 2W1TA 3EOIA 5HSQA 1JWPA 2IWDA 2XQZA 5L10A 1YT4A 2JKRI 3BFEA 3CPTA 1J3WA 1M6KA 2OAP1 4LGWA 4KZBA 3Q82A 4U0XA 2B02A 1XJ4A 3BQAA 5CGWA 3Q7ZA 3UB7A 2ZQAA 1YLPA 3NJAA 1NZUA 1S0WA 4X68A 1XFQA 4PMAA 2Y59A 3SOIA 3UE0A 4JF4A 4HHDA 4S2NC 2W3FA 3A0VA 5HDCA 2QJ5A 2Z2LB 4MN6A 3BFFA 3MZEA 2V20A 2O99A 4S2JA 1HVBA 2ZC4B 3LEZA 3RTYA 4QWOA 2W3GA 3EQUA 4N92A 3DAVA 3O3VA 4HJ6A 4L9GA 2XR0A 2IA2A 3NDGA 3H9WA 4HH2A 4DJ2A 3Q81A 2Y2PA 4FH2A 3IF5A 4ZJ3A 4CPKA 2E8JA 3IWIA 1WYBA 4CLCC 4E6WA 2WKQA 3E0YA 3Q1FA 2UV0E 1ZG6A 1ONHA 5FSRA 2JN7A 3T12B 3PR6A 1Y54A 4P0MA 4X69A 4WELA 2M7VA 1VETB 3UMDA 1HZOA 5CGXA 3PYPA 5FEGA 1ONGA 3RH8B 3S1YA 3F1OA 5TJJA 4FD8A 4MCWA 4LV1A 5FATA 2G7UA 4OP8A 4ID4A 1FOFA 5KMWA 3UB9A 4K0WA 3W4QA 1LSXA 3HLDA 4JXVA 1VM1A 1L3LA 2CC1A 4MNRA 3DTIA 3M6BA 3UDIA 3OPRA 1UWNX 5M18A 5EFWA 5HDSA 3A0RA 4I3IA 2WKPA 5AQ9A 4KG6A 1MWSA 2VLGA 2ZMVA 5AVEA 3ITAA 3FWLA 2BTFP 4FUWA 4JXSA 2WUQA 3N8LA 4I5SA 1LT0A 4OPRA 2XD1A 1YLWA 2Y2KA 4EU0A 4R0QA 2ZOHA 4OH0A 2QYBA 1T1BA 3OOVA 5FDHA 1YQSA 1NRJA 2J8YA 3EEAA 3B42A 4JGRA 2G2UA 5J7EA 4WF0A 3RXXA 1BTLA 1I2SA 3ISGA 1H5XA 1PI5A 3FYZA 1M40A 4Y17A 1VHMA 5GHYA 1XPBA 3VP1A 4MBKA 3SS4A 2P08A 3NBLA 1XXMA 2PR6A 3H82B 4YFMA 3FPWA 5E2HA 3P01A 4OPQA 5DF8A 3OCNA 1W63M 1FSWA 4D2OA 1S4SA 2FZ0A 1L0DA 1G6AA 4WYYA 2G2WA 4BJPA 1MBLA 3HBRA 4S2MA 5E43A 4KG2A 1TF1A 1FCNA 5DKKA 5IS1A 4EUVA 3TSGA 1ODVA 2XA7M 2R9WA 5CHMA 4ETXA 3IHBA 1IELA 2PU4A 3MR0A 1LHYA 1PWDA 3PBNA 2DRWA 2OLVA 3F1PA 1OTBA 3CJMA 3CITA 2PAVP 2P9VA 4KUKA 4Y5FA 3HUMA 2OOLA 2W0NA 3HLBA 1K25A 1K54C 2FH5A 2XGNA 3NULA 4LRXC 4BLMA 1A0KA 3QP2A 1YLJA 2V8CA 1OJGA 4QY5A 2R78A 3V39A 1KE0A 4UQIM 4IEDA 3QP8A 3KSIA 1F2KA 2ZD8A 5HWTA 4ARZA 1EW0A 1YLZA 1BULA 1BUEA 5L8MA 3QHYA 2IWCA 2QMIA 3D9YA 2I9VA 5DTSA 3BLSA 3G30A 4HJ3A 3OPHA 2B5RA 4R23A 1MPLA 2JBFA 4QJGA 1BT5A 2A2LA 1FR6A 2YKFA 2ZMFA 1IKGA 4KQDA 3A3IA 4LV2A 4CJNA 4DRTA 3VE4A 3ZG9B 2WZZA 3Q7VA 1LI0A 1BZAA 3LIAA 5EOEA 4X6TA 1TS8A 1VQQA 1PZOA 4PKYG 3C4PA 3DBAA 1H8ZA 1GHIA 2LB9A 4E6XA 4EETB 1RP5A 3A3EA 4ETZA 3PBQA 1L0GA 3OPLA 1FIKA 3DWKA 2BLSA 2ZQ9A 3I7JA 1N9OA 3C4OA 3LEQA 1Q2QA 3C38A 4KZ8A 1ES3A 2Q9MA 1DJCA 1T19A 3MQOA 3QNCA 3C8CA 4X53A 5L07A 2Y79A 3PBOA 5F1GA 4P85A 1N4OA 3PTEA 2PT7A 3ZVWA 3ZG8B 2O9CA 4BL2A 2Z6CA 2GNXA 1N9NA 1X0OA 3IH8A 4JPMA 3IS2A 3IX4A 2OLUA 1XJ2A 4F94A 4C3QA 1ESIA 4OLDA 1OTDA 4E3JA 2BASA 4BD1A 5CECA 3NY4A 1KGFA 1MZUA 2PR5A 2P04A 3BEBA 1IYSA 3CMZA 4R4SA 3U4LP 3UO9A 4WM9A 2V8FA 1Z6FA 3CUEA 4WN5A 1Q2PA 2LB5A 4FCFA 5HWVA 4X1MA 3NOPC 4JGOA 2PBDP 4L9FA 2C5WB 3QP4A 3V5MA 3DWZA 3ZG5A 1PWGA 4HI4A 2PU2A 2WYXA 5L2FA 2O9BA 4S2OA 1I2WA 1IEMA 1MXOA 4GLQA 4WZ4A 3BECA 4EUZA 4R38A 4WEKA 4BL3A 4JGQA 1XX2A 4I3AA 3UE6A 5HFOA 4OOLA 4BBTA 5CHUA 5HL1A 3LI9A 2YKHA 1K4EA 4XUXA 1JVJA 2HGVA 4RX3A 2PRFA 3CLOA 1UWPX 2Y55A 3FKWA 5I5LA 1KE4A 1YMXA 3SS3A 4BWIA 1YMSA 2CMNA 4DMZA 3T1XA 4ZAMA 3PBTA 1MKIA 3G34A 4JKTA 1MY8A 3ICYA 1STZA 4PAUA 1IFQA 2I72A 2P74A 5DTTA 1S4RA 2Y4AA 4IBRA 2A24B 3SH7A 3KX0X 3IH9A 4LENA 1N9BA 1D06A 1NZOA 3HLGA 2RCXA 1EWZA 2C6WB 4GOGA 2Y2LA 4EESA 4EEUA 4L9EA 2Z2MB 3TOIA 1KDSA 2M1CA 3DTEA 1PRQA 4U0TA 4KG5A 5DJTA 2FFFB 2PDRA 3GR2A 1BYWA 2WAFA 4B4XA 3IBRA 3QNBA 1K56D 2HZ5A 2K31A 3T4TA 3G35A 5CGSA 2JC7A 1BLSA 5DFXA 2PD7A 2VKSA 2V1BA 5CEDA 3FPVA 1FSYA 3T4SA 3LIBA 3T4LA 1YAXA 3H7WA 4CLCB 5G4ZA 3AGFA 1G6OA 3CI6A 4BBVA 2ZL1B 4KZ9A 4RA7A 2QKPA 2Y8HA 3B3XA 2W3HA 4G3VA 4Q0HA 3NECA 5GHXA 4NXBA 1VEUA 3T4QA 2WGWA 4EBLA 3D3OA 5CEBA 3IBJA 2A3UA 4UHUA 4H8RA 4WL9A 2WAEA 1TDGA 2AVXA 4G3KA 5DJUA 2INWA 5GLCA 3KYEA 4JXGA 3G2YA 1DJBA 2HDQA 2WZXA 1HLUP 4EWFA 4PM5A 5FDSA 3UNWA 1PW8A 2EX2A 3DTMA 2VEAA 3OZHA 2V2FF 2H0TA 4BQMA 2JKGA 3IXGA 3IWQA 3ZNYA 3PBRA 1KVLA 3EEHA 3LY4A 3UE1A 3L9KA 3IF6C 4E3MA 1PFLA 2ZL1A 2XA7S 4F3LA 4BENA 2XSSA 5FQ9A 1W8QA 2GX5A 5KSCA 4GZBA 3GECA 4O0PA 2GJ3A 2O9AA 4PM6A 1TDLA 2QWSA 2J3TC 2ZQDA 3G4PA 1XFNA 5EPHA 2V9AA 1VETA 2WKEA 2XEPA 3ZCZA 5AVFA 1K0KA 5D3OA 3LR4A 4WLAA 1LSVA 2BG1A 1CJFA 3GVBA 2XRNA 2WGWB 3MF0A 5L09A 1GHPA 3MMHA 3LUQA 3GQZA 4DXCA 3MZFA 4RX2A 2W3EA 3EQVA 5FI2A 4UQIS 5HD3A 3TW8A 3U2AA 3O5YA 5HAPA 4GS9B 2XK1A 4QHCA 4MMNA 1IYQA 5FEFA 3G2ZA 1Y4OA 3NC8A 1V9ZA 5CERA 1C3BA 4WMCA 1ACFA 4RYEA 5EM0A 2PBYA 3PXPA 1YPRA 3V50A 1E4DA 3CWFA 3IF6B 3B47A 2GDNA 3BWLA 5E2EA 2VX8A 2GZAA 2NUTC 3M2JA 3S7QA 4Y13A 1SHVA 3O88A 4NXFA 3BLMA 3G32A 1K55A 2X71A 4ME4A 3KYZA 3MXQA 3UPOA 3OLOA 3EGDC 1MWUA 2VK3A 5KZHA 3C7UA 4XUZA 2OAQ1 1H3QA 3O87A 2ZQCA 1MKMA 4PM8A 4LCLA 4M3KA 1ZTUA 1LL9A 5TBMA 4NEED 4R6LA 5EUAA 4UA9A 3BFCA 1RGYA 1PIOA 1EROA 5EV0A 4LFUA 2ZC5B 3W4PA 2PD8A 4E3KA 1ZC2A 1E25A 2Y91A 5FQIA 4X56A 1DP6A 1K6RA 4B93A 4IVIA 3LFVA 2JKTM 4JBFA 1MWTA 4O7DA 3S7OA 5TBMB 3N4IA 2ZBBA 3MQ0A 3C7VA 4H6JA 4N9KA 5EVIB 5FAOA 4Q0IA 1XA1A 3R7WA 2EWWA 3FZCA 3L7HA 2EX6A 3BY8A 1SKOB 4CLCD 2VV7A 3OPPA 3IT9A 1OTAA 3IS2B 4P87A 4WZ5C 2XLNA 1FCMA 3MQQA 1WYCA 5A90A 4GKUA 3UB5P 2Y2JA 4GCZA 4MN5A 4OQGA 1K38A 3T4JA 4ZDXA 5EE8A 4HY8A 4EQ1A 4X55A 5FA7A 1NWZA 4NG2A 5J8XA 3NI9A 2VGLS 1FILA 4S2NA 1G5UA 1K57C 3MXRA 5EVID 2PYRA 2J80A 4KQQA 4RQ9A 5J4EA 4OQ0A 3CAXA 1TS0A 2K7SA 2L0WA 4IJGA 4NK3A 2EFXA 5IT5A 2WKRA 1E3UD 4UA7A 4LV0A 2EWVA 3P09A 2WGVA 1Z09A 4I39A 2VJWA 5G18A 1TS7A 5CX7A 1QMEA 4LRZE 3PAGA 3JYIA 4YWZA 4P6ZM 3ZYTA 1LL8A 2WKHA 1GA9A 4S2LA 1CEGA 4EEPA 2DMWA 2D02A 3W4OA 3T1RA 3HL9A 3UMEA 4IVKA 1CI9A 5CRFA 1FCOA 1F5MA 4L0LA 2UWXA 5EVEA 5GHZA 5CTMA 4MLLA 3W8KA 5IU1A 3N6IA 3ZQ5A 3C30A 1CI8A 3T1SA 4MEZA 1TD5A 2O0YA 2JE5A 3RFBA 5AQAA 1JWZA 3OC2A 1YSQA 2WADA 3BY9A 3A0SA 2KX6A 1JWVA 4LLOB 2HP5A 2OV5A 4P6ZS 3AGDA 3G31A 4N1HA 1RCJA 3MFDA 2VZWA 3VOYA 2JHEA 3ZG7B 4YOFA 3RXWA 4X1LA 1ES4A 2EX8A 3O86A 3S7PA 5TR7A
chains in the Genus database with same CATH topology
2D01A 4BBUA 4WUJA 2JN7A 1P9RA 3PR6A 5F69A 4F3LB 2W27A 4K08A 2VA0A 5DJTA 3UB8A 1XJ6A 4H6JB 4WELA 2PDRA 3FG8A 2M7VA 1BYWA 1NLZA 3UMDA 4KQOA 2B18A 3IBRA 3PYPA 5KIZA 4Y2FA 4HNBA 4G3WA 3TE8A 3BW6A 3RH8B 3F1OA 5F6AA 2K31A 3KSHA 5TJJA 3T4TA 1UGUA 4MCWA 2VGLM 2G7UA 1G28A 2HV1A 5DFXA 2OWJA 2PD7A 3UB9A 2VKSA 2V1BA 3FPVA 1LSXA 1IOUA 3T4SA 3LIBA 3T4LA 1OJ5A 1S66L 1YAXA 3H7WA 4CLCB 3EGXC 3HJKA 2KOIA 5G4ZA 3F1NA 4BBVA 1G6OA 3CI6A 4YNRA 3UB6A 1UWNX 3R4KA 2QKPA 2Y8HA 5EFWA 2W3HA 5HDSA 3A0RA 4I3IA 4G3VA 2WKPA 4Q0HA 2Z6DA 1S67L 1T1AA 4GW9A 4NXBA 3T4QA 1ZHHB 3E98A 2VLGA 2ZMVA 3D3OA 3EWKA 5HDDA 3VOLA 4BMWA 3IBJA 3P7NA 5AVEA 4WL9A 3MFXA 2XROA 3LR5A 1OPXA 3D72A 4Q0JA 4I5SA 5F68A 1LT0A 4G3KA 4II7A 5DJUA 1YSPA 2INWA 4EU0A 5MC7A 3H7WB 4CLCA 2ZOHA 3VE3A 2JKRM 2QYBA 1T1BA 3OOVA 4I3JA 2VEAA 1NRJA 4HQAA 3EEAA 3B42A 4JGRA 5J7EA 4WF0A 3PBRA 2VV8A 3EEHA 2HJ9C 3NHQA 1NLYA 1VHMA 1F98A 4IHQA 3KSFA 3LR3A 2XA7S 4F3LA 4ZRRA 4HOIA 2P08A 2XSSA 4JGPA 2PR6A 3H82B 3FPWA 4M4XA 2W1RA 3P01A 4LRYC 2GX5A 3NOTC 4HP4A 4ARZB 1W63Q 3GECA 3OCNA 4O0PA 1W63M 2JKTI 2GJ3A 2O9AA 3T50A 1S1ZA 1S4SA 2QWSA 2J3TC 3C2WA 5KSHA 1XFNA 2HJEA 3BQ8A 2FZ0A 1DRMA 2V9AA 4BJPA 1D7EA 4WEJA 1TF1A 5AVFA 2HF6A 3LR4A 3S7NA 4WLAA 1LSVA 5DKKA 5IS1A 1OTEA 2XRNA 4EUVA 3BJNA 3GDIA 3OCLA 3JVUA 2KLIA 1ODVA 1GSWA 2XA7M 3MF0A 3T4OA 4DJ3A 4ETXA 3MR0A 3MMHA 2M7UA 3LUQA 3PBNA 3LYXA 4E04A 3F1PA 1OTBA 2W3EA 3EQVA 3F1NB 3CITA 4UQIS 5HD3A 3TW8A 3U2AA 1JNUA 4KUKA 4Y5FA 3H82A 2OOLA 3O5YA 4GS9B 2W0NA 3OBFA 4NXGA 2FH5A 4MMNA 4LRXC 1H8MA 4HP9A 1OJGA 3E4QA 5F5YA 1V9ZA 2R78A 3F1OB 4UQIM 3TRCA 4MDZA 5HZHA 3KSIA 3PXPA 3HJIA 3CWFA 4Z1WA 3B47A 2QJ7A 3BWLA 2VX8A 2GZAA 2NUTC 3S7QA 5HWTA 3G6OA 1KOUA 4ARZA 1EW0A 3NOUC 4NXFA 5L8MA 1T1CA 4HJ4A 4ME4A 3KYZA 4HIAA 3VV4A 1V9YA 4MN7A 4IUHA 3MXQA 2V0WA 2I9VA 3OLOA 3W2ZA 3EGDC 4LPZA 4R70A 2W3DA 1P9WA 4HJ3A 3SW1A 4FOFA 5G4YA 2A2LA 3PBSA 2YKFA 4O8GA 4DN0A 2OAQ1 3TJZC 3T4KA 1H3QA 1MKMA 2L4RA 2ZMFA 4KQDA 4XT2B 1ZTUA 5A8BA 5TBMA 4NEED 3VE4A 4R6LA 3LICA 1OT9A 3ULFA 5HD5A 3LIAA 3LR0A 5HPFA 3CUEC 1TS8A 2PD8A 1Y28A 4PKYG 1DP6A 2MJ6A 3JVVA 4B93A 3DBAA 3LFVA 2JKTM 4HH3A 2LB9A 5DKLA 2K2NA 3LIEA 3S7OA 4EETB 5TBMB 2J3TD 4ETZA 3PBQA 2ZBBA 5HPIA 3MQ0A 2H28A 1DP8A 4O01A 4H6JA 3V67A 2L1MA 5LBRA 3KO6A 4EXOA 1N9OA 4Q0IA 3R7WA 2EWWA 3C38A 3K3CA 3BY8A 5FL3A 2EA9A 5DFYA 3R7WB 4CLCD 2VV7A 1T19A 1OTAA 3MQOA 4EW7A 2PHYA 3C8CA 3MJQA 3KSGA 3IS2B 2Y79A 3PBOA 4NKPA 1LSWA 3F1PB 2PYPA 4AFIA 1OTIA 1P97A 2PT7A 1F9IA 2O9CA 3MQQA 2Z6CA 2GNXA 1N9NA 1X0OA 4GCZA 2OWHA 4MN5A 2A24A 1DP9A 1GSVA 3IS2A 1VB6A 2NUPC 1XJ2A 3T4JA 4HY8A 1OTDA 4R3AA 4EQ1A 2BASA 4I38A 1NWZA 1MZUA 2PR5A 1S1YA 2VGLS 2P04A 4FSFA 4B9OA 3FC7A 4IUKA 4GHIB 1TS6A 3K2NA 1WA9A 2QHKA 5K5BA 3CUEA 3HCYA 4WN5A 2V0UA 4CQHA 2PYRA 2J80A 4OOMA 2P7JA 2LB5A 5HWVA 4RQ9A 3NOPC 5J4EA 3CAXA 4JGOA 1YKDA 4XT2A 4GJ4A 5AJGA 4CLCE 4L9FA 1TS0A 2K7SA 2L0WA 1N9LA 4IJGA 1OT6A 5IT5A 2WKRA 4HI4A 4QPRA 5C5KA 2O9BA 4PKYA 3K3DA 4PHTA 3E4OA 3LI8A 4GLQA 1XJ3A 3UE3A 2EWVA 4R38A 1T18A 4GS9A 4I39A 4WEKA 2VJWA 1GSXA 2W1TA 3EOIA 1TS7A 5CX7A 4JGQA 5HSQA 4I3AA 3UE6A 2JKRI 4LRZE 4OOLA 2W1TB 4BBTA 4YWZA 4P6ZM 3ZYTA 2OAP1 3LI9A 1LL8A 1P0ZA 2YKHA 4EEPA 4Y3IA 2B02A 2HGVA 2DMWA 1XJ4A 3BQAA 5HWWA 3KYQA 1MC0A 2D02A 3B33A 3CLOA 1UWPX 4KUOA 4UEYA 3UB7A 5I5LA 5J3WA 3UMEA 4BWIA 2CMNA 3LIDA 2VV6A 4DMZA 3NJAA 5HL6A 1F5MA 4L0LA 3LIFA 5DF9A 3PBTA 1XFQA 2V1AA 4HHDA 5IU1A 3ZQ5A 3C30A 2W3FA 3A0VA 5HDCA 2QJ5A 1TD5A 4MN6A 3ICYA 2O0YA 1STZA 4PAUA 3RFBA 1IFQA 4GHIA 3OC2A 4EERA 1YSQA 3BY9A 2KDKA 2O99A 3A0SA 2KX6A 1S4RA 4LLOB 3RTYA 2A24B 4NXEA 2W3GA 3EQUA 3KX0X 4P6ZS 4HJ6A 4L9GA 2J3WA 2IA2A 2ZOIA 3H9WA 4HH2A 4DJ2A 2VZWA 2JHEA 1D06A 4YOFA 3PHYA 4CLCC 4EESA 4EEUA 4L9EA 2WKQA 3E0YA 3E4PA 3S7PA 2M1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TS0 A;  2D01 A;  2L4R A;  4BBU A;  4KQD A;  4WUJ A;  4LRY C;  2K7S A;  2JN7 A;  2L0W A;  3NOT C;  4HP4 A;  4XT2 B;  1N9L A;  5A8B A;  1OT6 A;  5F69 A;  5TBM A;  3GEC A;  3VE4 A;  2WKR A;  4R6L A;  4HI4 A;  3LIC A;  4F3L B;  2GJ3 A;  3T50 A;  2W27 A;  1OT9 A;  1S1Z A;  3ULF A;  1S4S A;  4K08 A;  5DJT A;  4PKY A;  3UB8 A;  1XJ6 A;  2QWS A;  3C2W A;  3K3D A;  4H6J B;  2PDR A;  1XFN A;  3FG8 A;  1BYW A;  4M4X A;  5HD5 A;  3UMD A;  3IBR A;  3LIA A;  3E4O A;  1DRM A;  3PYP A;  3LI8 A;  5KIZ A;  2V9A A;  4HNB A;  1TS8 A;  1XJ3 A;  4R38 A;  3RH8 B;  1T18 A;  2PD8 A;  3F1O A;  1D7E A;  1Y28 A;  4GS9 A;  5F6A A;  4I39 A;  4PKY G;  1GSX A;  1UGU A;  1TS7 A;  5AVF A;  2HV1 A;  1DP6 A;  1G28 A;  4JGQ A;  5HSQ A;  4WLA A;  4I3A A;  1LSV A;  3UE6 A;  2OWJ A;  4LRZ E;  5DKK A;  5IS1 A;  2PD7 A;  4HH3 A;  3UB9 A;  5DKL A;  4BBT A;  2V1B A;  4YWZ A;  1OTE A;  1LSX A;  3LIE A;  3LI9 A;  1LL8 A;  1P0Z A;  2YKH A;  3GDI A;  3LIB A;  4EET B;  1ODV A;  1GSW A;  1OJ5 A;  5TBM B;  4EEP A;  1S66 L;  4DJ3 A;  2B02 A;  3H7W A;  1XJ4 A;  5HWW A;  3HJK A;  2ZBB A;  3MR0 A;  2D02 A;  2H28 A;  3B33 A;  1DP8 A;  1UWP X;  3CLO A;  3F1N A;  4H6J A;  3LUQ A;  4KUO A;  5G4Z A;  3UB7 A;  4BBV A;  3LYX A;  5I5L A;  5J3W A;  3UB6 A;  1UWN X;  2L1M A;  1OTB A;  3F1P A;  5HD3 A;  3F1N B;  2QKP A;  5EFW A;  2CMN A;  5HDS A;  3A0R A;  4I3I A;  3LID A;  2WKP A;  1JNU A;  2Z6D A;  2VV6 A;  4KUK A;  1N9O A;  1S67 L;  3H82 A;  1T1A A;  4GW9 A;  3NJA A;  4EXO A;  4NXB A;  2OOL A;  4GS9 B;  2W0N A;  4NXG A;  3K3C A;  2VLG A;  3EWK A;  3BY8 A;  5HDD A;  3VOL A;  2EA9 A;  3LIF A;  1XFQ A;  3P7N A;  5AVE A;  2V1A A;  2VV7 A;  4LRX C;  4WL9 A;  1T19 A;  1OTA A;  3MQO A;  3MFX A;  2PHY A;  4EW7 A;  3C8C A;  4HHD A;  3MJQ A;  5IU1 A;  3UME A;  3IS2 B;  3D72 A;  3ZQ5 A;  1LSW A;  3A0V A;  1OJG A;  3F1P B;  2PYP A;  3E4Q A;  1LT0 A;  4HP9 A;  4I5S A;  5F68 A;  2QJ5 A;  5DJU A;  5HDC A;  5F5Y A;  1OTI A;  1P97 A;  1V9Z A;  2R78 A;  3F1O B;  1F9I A;  4E04 A;  2INW A;  4MN6 A;  3ICY A;  3MQQ A;  3H7W B;  5HZH A;  4GHI A;  2Z6C A;  4EER A;  1N9N A;  1X0O A;  4GCZ A;  2OWH A;  2ZOH A;  3BY9 A;  3VE3 A;  2KDK A;  1T1B A;  3HJI A;  2A24 A;  4MN5 A;  3A0S A;  2KX6 A;  1S4R A;  1DP9 A;  3CWF A;  4I3J A;  4LLO B;  3RTY A;  2VEA A;  1GSV A;  4HQA A;  2A24 B;  2QJ7 A;  3BWL A;  3IS2 A;  4NXE A;  1VB6 A;  1XJ2 A;  4JGR A;  5J7E A;  3KX0 X;  4HY8 A;  1OTD A;  3G6O A;  1KOU A;  4WF0 A;  5HWT A;  1EW0 A;  4R3A A;  2BAS A;  4HJ6 A;  4EQ1 A;  4I38 A;  4L9G A;  3NOU C;  4NXF A;  2VV8 A;  1NWZ A;  1MZU A;  1T1C A;  2PR5 A;  1S1Y A;  3EEH A;  2ZOI A;  4HJ4 A;  3NHQ A;  4HIA A;  3H9W A;  4HH2 A;  4B9O A;  1V9Y A;  3FC7 A;  1F98 A;  4GHI B;  3MXQ A;  4DJ2 A;  2V0W A;  2I9V A;  3OLO A;  1TS6 A;  1WA9 A;  2JHE A;  2QHK A;  1D06 A;  4LPZ A;  4R70 A;  4HJ3 A;  4WN5 A;  3SW1 A;  2V0U A;  2PYR A;  2J80 A;  3PHY A;  4F3L A;  2P7J A;  4HOI A;  4EES A;  5HWV A;  4RQ9 A;  4EEU A;  3NOP C;  4L9E A;  2WKQ A;  5G4Y A;  4JGP A;  5J4E A;  3CAX A;  3E4P A;  4JGO A;  2YKF A;  2M1C A;  2PR6 A;  4XT2 A;  3H82 B;  4L9F A; 
#chains in the Genus database with same CATH topology
 4BBU A;  1P9R A;  1IYO A;  5F69 A;  3GTC A;  4E3I A;  1PZP A;  1CF0 A;  4NET A;  3GMW A;  2VA0 A;  3UB8 A;  4H6J B;  4KQO A;  2B18 A;  3QP5 A;  5F1F A;  1FQG A;  4UA6 A;  4HNB A;  3MKF A;  4G3W A;  3TE8 A;  5FI6 A;  1HTZ A;  5F6A A;  4HEF A;  4OVD A;  4R1G A;  2A49 A;  2VGL M;  1G28 A;  1WE4 A;  4ZJ2 A;  3TG9 A;  5GL9 A;  2OWJ A;  4QD4 A;  2HDS A;  1IOU A;  2ZM2 A;  1K57 A;  1OJ5 A;  1ESU A;  3WS5 A;  2KOI A;  5DF7 A;  3UB6 A;  2Q0O A;  3M2K A;  3R4K A;  1VEU B;  2Z6D A;  1S67 L;  2OSU A;  1T1A A;  4GW9 A;  4XXR A;  1ZHH B;  3E98 A;  3EWK A;  5HDD A;  4BMW A;  2XFT A;  1SDE A;  3MFX A;  1OPX A;  3GRJ A;  5F68 A;  4II7 A;  3T1Q B;  1YSP A;  4HBT A;  1YLY A;  3VE3 A;  4R3J A;  3VP0 A;  4HQA A;  1KGE A;  1K54 A;  2HJ9 C;  3NHQ A;  5I94 A;  2ZC7 A;  4GD6 A;  4IHQ A;  2EXB A;  3KSF A;  4JLF A;  3LR3 A;  4DE0 A;  4Y7P A;  4HOI A;  3HLC A;  2WK0 A;  3N7W A;  2EX9 A;  2QZ6 A;  4KZ7 A;  4LRY C;  4HP4 A;  4ARZ B;  1SDN A;  1L0E A;  2HP9 A;  1W63 Q;  1BLH A;  4ZBE A;  2JKT I;  1K55 C;  2EXA A;  2Y2M A;  2HJE A;  4EV4 A;  2E8I A;  1DRM A;  2H5S A;  4B4Z A;  1PNE A;  4PM7 A;  1KDW A;  4S2P A;  5TGF A;  1OTE A;  4C6Y A;  3BRM A;  3JVU A;  3OCL A;  2KLI A;  1GSW A;  4DJ3 A;  2B95 A;  2M7U A;  4E04 A;  3WRT A;  5FAP A;  1FR1 A;  3H82 A;  1HD8 A;  3WS0 A;  4OP5 A;  4NXG A;  2ZM8 A;  2HDU A;  2HPB A;  3WS2 A;  3E4Q A;  1W8Y A;  1CEF A;  5F5Y A;  3F1O B;  3IXH A;  4PM9 A;  4DE1 A;  3RJU A;  4MDZ A;  3AGE A;  5HZH A;  1TEM A;  1IKI A;  1XA7 A;  4Z1W A;  1DY6 A;  1LL5 A;  3G6O A;  1KOU A;  2DNS A;  3NOU C;  1T1C A;  4HJ4 A;  5A92 A;  4BD0 A;  1XKZ A;  3VV4 A;  1V9Y A;  4MN7 A;  2V0W A;  1ES2 A;  3W2Z A;  1ERQ A;  1O7E A;  3QP6 A;  4LPZ A;  2W3D A;  1JTG A;  2XFS A;  3UPP A;  5AQ7 A;  2VGK A;  3PBS A;  3TJZ C;  2Y2O A;  3GSG A;  4FTX A;  5A8B A;  4DKI A;  3N8S A;  3LIC A;  1OT9 A;  3N8R A;  4OPZ A;  2FFY A;  5HD5 A;  5TFQ A;  1L2S A;  5IHV A;  3HUO A;  3VMA A;  2XH9 A;  5EVL A;  1XGJ A;  2MJ6 A;  4HH3 A;  3IF6 A;  2K2N A;  3LIE A;  5FAS A;  2J3T D;  3UDX A;  3DTK A;  5FQQ A;  1DP8 A;  4O01 A;  4GDB A;  1IYP A;  4QB8 A;  3LY3 A;  2L1M A;  5LBR A;  2XD5 A;  3KO6 A;  3UPN A;  4EXO A;  5U47 A;  3K3C A;  4U3T A;  3R7W B;  3ZFZ A;  4KQR A;  1GHM A;  4HBU A;  2PHY A;  3MJQ A;  5GLB A;  4NKP A;  2PYP A;  3VP2 A;  4AFI A;  1OTI A;  4N1X A;  5GLD A;  5E2G A;  2Q9N A;  5JYO A;  3E2K A;  3BFG A;  2A24 A;  1DP9 A;  3QP1 A;  3A3F A;  1VB6 A;  3HUN A;  4JF5 A;  4R3A A;  4I38 A;  1S1Y A;  2J9O A;  4FSF A;  4IUK A;  3K2N A;  1WA9 A;  3IQA A;  2QHK A;  4GN2 A;  2IWB A;  3LO7 A;  4CQH A;  4OOM A;  1U60 A;  1H8Y A;  2P9V B;  4ESP A;  1YKD A;  5FI7 A;  5AJG A;  4DDS A;  4OON A;  3NCK A;  3IX8 A;  2XF3 A;  1N9L A;  3NIA A;  4WBG A;  1BLC A;  4QPR A;  5JYP A;  4GD8 A;  1L0F A;  2RL3 A;  3K3D A;  4PHT A;  5HAQ A;  3VSK A;  4FH4 A;  3LI8 A;  3UE3 A;  3ZHH A;  1XGI A;  1GSX A;  3CPT B;  3LGO A;  4E3L A;  1NY0 A;  2W1T B;  4KZ3 A;  3A3J A;  4UAA A;  1P0Z A;  3V3R A;  3DW0 A;  4Y3I A;  1EI5 A;  5HWW A;  3KYQ A;  4Y15 A;  1MC0 A;  3UY6 A;  3B33 A;  4KUO A;  4UEY A;  1AXB A;  1W79 A;  5J3W A;  3S22 A;  3LID A;  2VV6 A;  3M6H A;  1YLT A;  3D4F A;  1W5D A;  5HL6 A;  3LIF A;  5DF9 A;  2ACG A;  2V1A A;  2J9P A;  4OLG A;  4OPY A;  5HX9 A;  5HW3 A;  4GB7 A;  4GHI A;  4EER A;  4C75 A;  2KDK A;  4R3B A;  4NXE A;  4PPR A;  4MBF A;  2J3W A;  1NXY A;  2ZOI A;  5FQK A;  3BFD A;  5M19 A;  3WWX A;  4Z9Q A;  4ZJ1 A;  2HP6 A;  1OME A;  3PHY A;  3HRE A;  2ZMA A;  2WGI A;  3E4P A;  4E3N A;  1PI4 A;  3SS5 A;  2D01 A;  1TVF A;  1K56 A;  4WUJ A;  5EOO A;  4Y0T A;  3ZVT A;  4IBX A;  2DCF A;  1BSG A;  4WZ5 A;  5F82 A;  3MSH A;  4Y0O A;  4F3L B;  2W27 A;  4K08 A;  1XJ6 A;  4QY6 A;  3FG8 A;  1NLZ A;  3WRZ A;  3WS1 A;  4Y2F A;  5KIZ A;  3BW6 A;  2H0Y A;  1DJA A;  3KSH A;  1QMF A;  1UGU A;  2HV1 A;  3MKE A;  5FQJ A;  5CTN A;  4KEN B;  1NYY A;  1S66 L;  3EGX C;  4Y0U A;  3HJK A;  4HES A;  4DE3 A;  3F1N A;  1KE3 A;  4YNR A;  1D1J A;  3SH8 A;  1ZG4 A;  1H0M A;  4WMC D;  3VOL A;  3VP4 A;  3ITB A;  3P7N A;  1ES5 A;  2XRO A;  3LR5 A;  3D72 A;  4Q0J A;  3ZDJ A;  1S6R A;  5MC7 A;  3H7W B;  4CLC A;  1G68 A;  1SKF A;  2JKR M;  4JF6 A;  4I3J A;  2JCH A;  5EM1 A;  3MBZ A;  2VV8 A;  4A5R A;  3VSL A;  1NLY A;  1F98 A;  2Y2G A;  2ZM0 A;  1BLP A;  2Y2N A;  1J9M A;  5HAR A;  3SH9 A;  4ZRR A;  4JGP A;  5EEC A;  4M4X A;  1JTD A;  5AQB A;  2W1R A;  5HAI A;  3NOT C;  4K91 A;  3IXD A;  3T50 A;  1S1Z A;  3C2W A;  5KSH A;  1PYY A;  2QPN A;  3BQ8 A;  3HVF A;  4OQI A;  4KZA A;  4N9L A;  1D7E A;  4WEJ A;  3MZD A;  2HF6 A;  3S7N A;  2ZLY A;  3HLF A;  2V1Z A;  5A91 A;  3CHW P;  3BJN A;  3GDI A;  2EFU A;  3S4X A;  1W7F A;  3CZD A;  3T4O A;  2HDR A;  3SZT A;  4LV3 A;  2Y2H A;  1ALQ A;  3Q7V B;  4X25 A;  4Q8I A;  3LYX A;  4OKP A;  5BOH A;  3F1N B;  3FV7 A;  1JNU A;  1SCW A;  3OBF A;  4D60 A;  1I5Q A;  1H8M A;  2ZQ8 A;  4YIN A;  4HP9 A;  4EBN A;  5DVA A;  2ZJ9 A;  3UDF A;  4EBP A;  3VFF A;  3IXB A;  3TRC A;  4EQI A;  3PAE A;  5A93 A;  4OOY A;  3HJI A;  4MBH A;  4KZ4 A;  4LCM A;  2QJ7 A;  3BM6 A;  2X01 A;  4RVA A;  2ZC6 B;  2Y2I A;  4QU3 A;  1GCE A;  5FAQ A;  4HIA A;  1O07 A;  1YM1 A;  4IUH A;  1KGG A;  5F83 A;  2ZQ7 A;  4R70 A;  2H10 A;  4ZTK A;  1P9W A;  1SZV A;  3SW1 A;  1KVM A;  1NRF A;  1RGZ A;  3BYD A;  4FOF A;  5G4Y A;  4O8G A;  4DN0 A;  3T4K A;  2L4R A;  2WKI A;  1ERM A;  3VP3 A;  3LCE A;  4XT2 B;  1PW1 A;  1E3U A;  3ZGA B;  3ZNT A;  3ULF A;  5DTK A;  3HLE A;  4KZ5 A;  3V3S A;  2X02 A;  4OQH A;  5HPF A;  3LR0 A;  3CUE C;  3VOZ A;  1Y28 A;  3P98 A;  4KZ6 A;  4S2K A;  5EVI A;  3MS6 A;  3JVV A;  1AWI A;  5FQM A;  5DKL A;  2R9X A;  3IWO A;  3WS4 A;  3NDE A;  5CHJ A;  5HPI A;  2H28 A;  3V67 A;  3MXS A;  4R4R A;  3CG5 A;  3A3D A;  4DE2 A;  1K4F A;  5FL3 A;  2EA9 A;  5DFY A;  3Q07 A;  4DF6 A;  4EW7 A;  2JKF A;  3KSG A;  1LSW A;  3UN7 A;  3F1P B;  4JXW A;  1P97 A;  1F9I A;  5M1A A;  2OWH A;  3JPU A;  1LI9 A;  4P6B A;  4K0X A;  3FKV A;  3GV9 A;  1GSV A;  1NJ4 A;  5GLA A;  2NUP C;  1K6S A;  1LLB A;  1SKO A;  1MWR A;  3ZG0 A;  2Y2Q A;  4DXB A;  2ZC3 B;  4B9O A;  4DDY A;  3FC7 A;  1CK3 A;  4GHI B;  1TS6 A;  5E2F A;  5K5B A;  3C5A A;  3IHA A;  2J7V A;  3HCY A;  2V0U A;  2P7J A;  3VFH A;  4GDN A;  1ZKJ A;  3E2L A;  2XDM A;  4XT2 A;  5EVI C;  4GJ4 A;  1GA0 A;  4GNU A;  4CLC E;  1PWC A;  5CXW A;  1OT6 A;  4S2I A;  3HLW A;  2VGJ A;  5C5K A;  1CQA A;  3IX3 A;  4PKY A;  1NYM A;  3E4O A;  4E3O A;  1XJ3 A;  1XP4 A;  4B88 A;  1T18 A;  4GS9 A;  2W1T A;  3EOI A;  5HSQ A;  1JWP A;  2IWD A;  2XQZ A;  5L10 A;  1YT4 A;  2JKR I;  3BFE A;  3CPT A;  1J3W A;  1M6K A;  2OAP 1;  4LGW A;  4KZB A;  3Q82 A;  4U0X A;  2B02 A;  1XJ4 A;  3BQA A;  5CGW A;  3Q7Z A;  3UB7 A;  2ZQA A;  1YLP A;  3NJA A;  1NZU A;  1S0W A;  4X68 A;  1XFQ A;  4PMA A;  2Y59 A;  3SOI A;  3UE0 A;  4JF4 A;  4HHD A;  4S2N C;  2W3F A;  3A0V A;  5HDC A;  2QJ5 A;  2Z2L B;  4MN6 A;  3BFF A;  3MZE A;  2V20 A;  2O99 A;  4S2J A;  1HVB A;  2ZC4 B;  3LEZ A;  3RTY A;  4QWO A;  2W3G A;  3EQU A;  4N92 A;  3DAV A;  3O3V A;  4HJ6 A;  4L9G A;  2XR0 A;  2IA2 A;  3NDG A;  3H9W A;  4HH2 A;  4DJ2 A;  3Q81 A;  2Y2P A;  4FH2 A;  3IF5 A;  4ZJ3 A;  4CPK A;  2E8J A;  3IWI A;  1WYB A;  4CLC C;  4E6W A;  2WKQ A;  3E0Y A;  3Q1F A;  2UV0 E;  1ZG6 A;  1ONH A;  5FSR A;  2JN7 A;  3T12 B;  3PR6 A;  1Y54 A;  4P0M A;  4X69 A;  4WEL A;  2M7V A;  1VET B;  3UMD A;  1HZO A;  5CGX A;  3PYP A;  5FEG A;  1ONG A;  3RH8 B;  3S1Y A;  3F1O A;  5TJJ A;  4FD8 A;  4MCW A;  4LV1 A;  5FAT A;  2G7U A;  4OP8 A;  4ID4 A;  1FOF A;  5KMW A;  3UB9 A;  4K0W A;  3W4Q A;  1LSX A;  3HLD A;  4JXV A;  1VM1 A;  1L3L A;  2CC1 A;  4MNR A;  3DTI A;  3M6B A;  3UDI A;  3OPR A;  1UWN X;  5M18 A;  5EFW A;  5HDS A;  3A0R A;  4I3I A;  2WKP A;  5AQ9 A;  4KG6 A;  1MWS A;  2VLG A;  2ZMV A;  5AVE A;  3ITA A;  3FWL A;  2BTF P;  4FUW A;  4JXS A;  2WUQ A;  3N8L A;  4I5S A;  1LT0 A;  4OPR A;  2XD1 A;  1YLW A;  2Y2K A;  4EU0 A;  4R0Q A;  2ZOH A;  4OH0 A;  2QYB A;  1T1B A;  3OOV A;  5FDH A;  1YQS A;  1NRJ A;  2J8Y A;  3EEA A;  3B42 A;  4JGR A;  2G2U A;  5J7E A;  4WF0 A;  3RXX A;  1BTL A;  1I2S A;  3ISG A;  1H5X A;  1PI5 A;  3FYZ A;  1M40 A;  4Y17 A;  1VHM A;  5GHY A;  1XPB A;  3VP1 A;  4MBK A;  3SS4 A;  2P08 A;  3NBL A;  1XXM A;  2PR6 A;  3H82 B;  4YFM A;  3FPW A;  5E2H A;  3P01 A;  4OPQ A;  5DF8 A;  3OCN A;  1W63 M;  1FSW A;  4D2O A;  1S4S A;  2FZ0 A;  1L0D A;  1G6A A;  4WYY A;  2G2W A;  4BJP A;  1MBL A;  3HBR A;  4S2M A;  5E43 A;  4KG2 A;  1TF1 A;  1FCN A;  5DKK A;  5IS1 A;  4EUV A;  3TSG A;  1ODV A;  2XA7 M;  2R9W A;  5CHM A;  4ETX A;  3IHB A;  1IEL A;  2PU4 A;  3MR0 A;  1LHY A;  1PWD A;  3PBN A;  2DRW A;  2OLV A;  3F1P A;  1OTB A;  3CJM A;  3CIT A;  2PAV P;  2P9V A;  4KUK A;  4Y5F A;  3HUM A;  2OOL A;  2W0N A;  3HLB A;  1K25 A;  1K54 C;  2FH5 A;  2XGN A;  3NUL A;  4LRX C;  4BLM A;  1A0K A;  3QP2 A;  1YLJ A;  2V8C A;  1OJG A;  4QY5 A;  2R78 A;  3V39 A;  1KE0 A;  4UQI M;  4IED A;  3QP8 A;  3KSI A;  1F2K A;  2ZD8 A;  5HWT A;  4ARZ A;  1EW0 A;  1YLZ A;  1BUL A;  1BUE A;  5L8M A;  3QHY A;  2IWC A;  2QMI A;  3D9Y A;  2I9V A;  5DTS A;  3BLS A;  3G30 A;  4HJ3 A;  3OPH A;  2B5R A;  4R23 A;  1MPL A;  2JBF A;  4QJG A;  1BT5 A;  2A2L A;  1FR6 A;  2YKF A;  2ZMF A;  1IKG A;  4KQD A;  3A3I A;  4LV2 A;  4CJN A;  4DRT A;  3VE4 A;  3ZG9 B;  2WZZ A;  3Q7V A;  1LI0 A;  1BZA A;  3LIA A;  5EOE A;  4X6T A;  1TS8 A;  1VQQ A;  1PZO A;  4PKY G;  3C4P A;  3DBA A;  1H8Z A;  1GHI A;  2LB9 A;  4E6X A;  4EET B;  1RP5 A;  3A3E A;  4ETZ A;  3PBQ A;  1L0G A;  3OPL A;  1FIK A;  3DWK A;  2BLS A;  2ZQ9 A;  3I7J A;  1N9O A;  3C4O A;  3LEQ A;  1Q2Q A;  3C38 A;  4KZ8 A;  1ES3 A;  2Q9M A;  1DJC A;  1T19 A;  3MQO A;  3QNC A;  3C8C A;  4X53 A;  5L07 A;  2Y79 A;  3PBO A;  5F1G A;  4P85 A;  1N4O A;  3PTE A;  2PT7 A;  3ZVW A;  3ZG8 B;  2O9C A;  4BL2 A;  2Z6C A;  2GNX A;  1N9N A;  1X0O A;  3IH8 A;  4JPM A;  3IS2 A;  3IX4 A;  2OLU A;  1XJ2 A;  4F94 A;  4C3Q A;  1ESI A;  4OLD A;  1OTD A;  4E3J A;  2BAS A;  4BD1 A;  5CEC A;  3NY4 A;  1KGF A;  1MZU A;  2PR5 A;  2P04 A;  3BEB A;  1IYS A;  3CMZ A;  4R4S A;  3U4L P;  3UO9 A;  4WM9 A;  2V8F A;  1Z6F A;  3CUE A;  4WN5 A;  1Q2P A;  2LB5 A;  4FCF A;  5HWV A;  4X1M A;  3NOP C;  4JGO A;  2PBD P;  4L9F A;  2C5W B;  3QP4 A;  3V5M A;  3DWZ A;  3ZG5 A;  1PWG A;  4HI4 A;  2PU2 A;  2WYX A;  5L2F A;  2O9B A;  4S2O A;  1I2W A;  1IEM A;  1MXO A;  4GLQ A;  4WZ4 A;  3BEC A;  4EUZ A;  4R38 A;  4WEK A;  4BL3 A;  4JGQ A;  1XX2 A;  4I3A A;  3UE6 A;  5HFO A;  4OOL A;  4BBT A;  5CHU A;  5HL1 A;  3LI9 A;  2YKH A;  1K4E A;  4XUX A;  1JVJ A;  2HGV A;  4RX3 A;  2PRF A;  3CLO A;  1UWP X;  2Y55 A;  3FKW A;  5I5L A;  1KE4 A;  1YMX A;  3SS3 A;  4BWI A;  1YMS A;  2CMN A;  4DMZ A;  3T1X A;  4ZAM A;  3PBT A;  1MKI A;  3G34 A;  4JKT A;  1MY8 A;  3ICY A;  1STZ A;  4PAU A;  1IFQ A;  2I72 A;  2P74 A;  5DTT A;  1S4R A;  2Y4A A;  4IBR A;  2A24 B;  3SH7 A;  3KX0 X;  3IH9 A;  4LEN A;  1N9B A;  1D06 A;  1NZO A;  3HLG A;  2RCX A;  1EWZ A;  2C6W B;  4GOG A;  2Y2L A;  4EES A;  4EEU A;  4L9E A;  2Z2M B;  3TOI A;  1KDS A;  2M1C A;  3DTE A;  1PRQ A;  4U0T A;  4KG5 A;  5DJT A;  2FFF B;  2PDR A;  3GR2 A;  1BYW A;  2WAF A;  4B4X A;  3IBR A;  3QNB A;  1K56 D;  2HZ5 A;  2K31 A;  3T4T A;  3G35 A;  5CGS A;  2JC7 A;  1BLS A;  5DFX A;  2PD7 A;  2VKS A;  2V1B A;  5CED A;  3FPV A;  1FSY A;  3T4S A;  3LIB A;  3T4L A;  1YAX A;  3H7W A;  4CLC B;  5G4Z A;  3AGF A;  1G6O A;  3CI6 A;  4BBV A;  2ZL1 B;  4KZ9 A;  4RA7 A;  2QKP A;  2Y8H A;  3B3X A;  2W3H A;  4G3V A;  4Q0H A;  3NEC A;  5GHX A;  4NXB A;  1VEU A;  3T4Q A;  2WGW A;  4EBL A;  3D3O A;  5CEB A;  3IBJ A;  2A3U A;  4UHU A;  4H8R A;  4WL9 A;  2WAE A;  1TDG A;  2AVX A;  4G3K A;  5DJU A;  2INW A;  5GLC A;  3KYE A;  4JXG A;  3G2Y A;  1DJB A;  2HDQ A;  2WZX A;  1HLU P;  4EWF A;  4PM5 A;  5FDS A;  3UNW A;  1PW8 A;  2EX2 A;  3DTM A;  2VEA A;  3OZH A;  2V2F F;  2H0T A;  4BQM A;  2JKG A;  3IXG A;  3IWQ A;  3ZNY A;  3PBR A;  1KVL A;  3EEH A;  3LY4 A;  3UE1 A;  3L9K A;  3IF6 C;  4E3M A;  1PFL A;  2ZL1 A;  2XA7 S;  4F3L A;  4BEN A;  2XSS A;  5FQ9 A;  1W8Q A;  2GX5 A;  5KSC A;  4GZB A;  3GEC A;  4O0P A;  2GJ3 A;  2O9A A;  4PM6 A;  1TDL A;  2QWS A;  2J3T C;  2ZQD A;  3G4P A;  1XFN A;  5EPH A;  2V9A A;  1VET A;  2WKE A;  2XEP A;  3ZCZ A;  5AVF A;  1K0K A;  5D3O A;  3LR4 A;  4WLA A;  1LSV A;  2BG1 A;  1CJF A;  3GVB A;  2XRN A;  2WGW B;  3MF0 A;  5L09 A;  1GHP A;  3MMH A;  3LUQ A;  3GQZ A;  4DXC A;  3MZF A;  4RX2 A;  2W3E A;  3EQV A;  5FI2 A;  4UQI S;  5HD3 A;  3TW8 A;  3U2A A;  3O5Y A;  5HAP A;  4GS9 B;  2XK1 A;  4QHC A;  4MMN A;  1IYQ A;  5FEF A;  3G2Z A;  1Y4O A;  3NC8 A;  1V9Z A;  5CER A;  1C3B A;  4WMC A;  1ACF A;  4RYE A;  5EM0 A;  2PBY A;  3PXP A;  1YPR A;  3V50 A;  1E4D A;  3CWF A;  3IF6 B;  3B47 A;  2GDN A;  3BWL A;  5E2E A;  2VX8 A;  2GZA A;  2NUT C;  3M2J A;  3S7Q A;  4Y13 A;  1SHV A;  3O88 A;  4NXF A;  3BLM A;  3G32 A;  1K55 A;  2X71 A;  4ME4 A;  3KYZ A;  3MXQ A;  3UPO A;  3OLO A;  3EGD C;  1MWU A;  2VK3 A;  5KZH A;  3C7U A;  4XUZ A;  2OAQ 1;  1H3Q A;  3O87 A;  2ZQC A;  1MKM A;  4PM8 A;  4LCL A;  4M3K A;  1ZTU A;  1LL9 A;  5TBM A;  4NEE D;  4R6L A;  5EUA A;  4UA9 A;  3BFC A;  1RGY A;  1PIO A;  1ERO A;  5EV0 A;  4LFU A;  2ZC5 B;  3W4P A;  2PD8 A;  4E3K A;  1ZC2 A;  1E25 A;  2Y91 A;  5FQI A;  4X56 A;  1DP6 A;  1K6R A;  4B93 A;  4IVI A;  3LFV A;  2JKT M;  4JBF A;  1MWT A;  4O7D A;  3S7O A;  5TBM B;  3N4I A;  2ZBB A;  3MQ0 A;  3C7V A;  4H6J A;  4N9K A;  5EVI B;  5FAO A;  4Q0I A;  1XA1 A;  3R7W A;  2EWW A;  3FZC A;  3L7H A;  2EX6 A;  3BY8 A;  1SKO B;  4CLC D;  2VV7 A;  3OPP A;  3IT9 A;  1OTA A;  3IS2 B;  4P87 A;  4WZ5 C;  2XLN A;  1FCM A;  3MQQ A;  1WYC A;  5A90 A;  4GKU A;  3UB5 P;  2Y2J A;  4GCZ A;  4MN5 A;  4OQG A;  1K38 A;  3T4J A;  4ZDX A;  5EE8 A;  4HY8 A;  4EQ1 A;  4X55 A;  5FA7 A;  1NWZ A;  4NG2 A;  5J8X A;  3NI9 A;  2VGL S;  1FIL A;  4S2N A;  1G5U A;  1K57 C;  3MXR A;  5EVI D;  2PYR A;  2J80 A;  4KQQ A;  4RQ9 A;  5J4E A;  4OQ0 A;  3CAX A;  1TS0 A;  2K7S A;  2L0W A;  4IJG A;  4NK3 A;  2EFX A;  5IT5 A;  2WKR A;  1E3U D;  4UA7 A;  4LV0 A;  2EWV A;  3P09 A;  2WGV A;  1Z09 A;  4I39 A;  2VJW A;  5G18 A;  1TS7 A;  5CX7 A;  1QME A;  4LRZ E;  3PAG A;  3JYI A;  4YWZ A;  4P6Z M;  3ZYT A;  1LL8 A;  2WKH A;  1GA9 A;  4S2L A;  1CEG A;  4EEP A;  2DMW A;  2D02 A;  3W4O A;  3T1R A;  3HL9 A;  3UME A;  4IVK A;  1CI9 A;  5CRF A;  1FCO A;  1F5M A;  4L0L A;  2UWX A;  5EVE A;  5GHZ A;  5CTM A;  4MLL A;  3W8K A;  5IU1 A;  3N6I A;  3ZQ5 A;  3C30 A;  1CI8 A;  3T1S A;  4MEZ A;  1TD5 A;  2O0Y A;  2JE5 A;  3RFB A;  5AQA A;  1JWZ A;  3OC2 A;  1YSQ A;  2WAD A;  3BY9 A;  3A0S A;  2KX6 A;  1JWV A;  4LLO B;  2HP5 A;  2OV5 A;  4P6Z S;  3AGD A;  3G31 A;  4N1H A;  1RCJ A;  3MFD A;  2VZW A;  3VOY A;  2JHE A;  3ZG7 B;  4YOF A;  3RXW A;  4X1L A;  1ES4 A;  2EX8 A;  3O86 A;  3S7P A;  5TR7 A; 
#chains in the Genus database with same CATH homology
 2D01 A;  4BBU A;  4WUJ A;  2JN7 A;  1P9R A;  3PR6 A;  5F69 A;  4F3L B;  2W27 A;  4K08 A;  2VA0 A;  5DJT A;  3UB8 A;  1XJ6 A;  4H6J B;  4WEL A;  2PDR A;  3FG8 A;  2M7V A;  1BYW A;  1NLZ A;  3UMD A;  4KQO A;  2B18 A;  3IBR A;  3PYP A;  5KIZ A;  4Y2F A;  4HNB A;  4G3W A;  3TE8 A;  3BW6 A;  3RH8 B;  3F1O A;  5F6A A;  2K31 A;  3KSH A;  5TJJ A;  3T4T A;  1UGU A;  4MCW A;  2VGL M;  2G7U A;  1G28 A;  2HV1 A;  5DFX A;  2OWJ A;  2PD7 A;  3UB9 A;  2VKS A;  2V1B A;  3FPV A;  1LSX A;  1IOU A;  3T4S A;  3LIB A;  3T4L A;  1OJ5 A;  1S66 L;  1YAX A;  3H7W A;  4CLC B;  3EGX C;  3HJK A;  2KOI A;  5G4Z A;  3F1N A;  4BBV A;  1G6O A;  3CI6 A;  4YNR A;  3UB6 A;  1UWN X;  3R4K A;  2QKP A;  2Y8H A;  5EFW A;  2W3H A;  5HDS A;  3A0R A;  4I3I A;  4G3V A;  2WKP A;  4Q0H A;  2Z6D A;  1S67 L;  1T1A A;  4GW9 A;  4NXB A;  3T4Q A;  1ZHH B;  3E98 A;  2VLG A;  2ZMV A;  3D3O A;  3EWK A;  5HDD A;  3VOL A;  4BMW A;  3IBJ A;  3P7N A;  5AVE A;  4WL9 A;  3MFX A;  2XRO A;  3LR5 A;  1OPX A;  3D72 A;  4Q0J A;  4I5S A;  5F68 A;  1LT0 A;  4G3K A;  4II7 A;  5DJU A;  1YSP A;  2INW A;  4EU0 A;  5MC7 A;  3H7W B;  4CLC A;  2ZOH A;  3VE3 A;  2JKR M;  2QYB A;  1T1B A;  3OOV A;  4I3J A;  2VEA A;  1NRJ A;  4HQA A;  3EEA A;  3B42 A;  4JGR A;  5J7E A;  4WF0 A;  3PBR A;  2VV8 A;  3EEH A;  2HJ9 C;  3NHQ A;  1NLY A;  1VHM A;  1F98 A;  4IHQ A;  3KSF A;  3LR3 A;  2XA7 S;  4F3L A;  4ZRR A;  4HOI A;  2P08 A;  2XSS A;  4JGP A;  2PR6 A;  3H82 B;  3FPW A;  4M4X A;  2W1R A;  3P01 A;  4LRY C;  2GX5 A;  3NOT C;  4HP4 A;  4ARZ B;  1W63 Q;  3GEC A;  3OCN A;  4O0P A;  1W63 M;  2JKT I;  2GJ3 A;  2O9A A;  3T50 A;  1S1Z A;  1S4S A;  2QWS A;  2J3T C;  3C2W A;  5KSH A;  1XFN A;  2HJE A;  3BQ8 A;  2FZ0 A;  1DRM A;  2V9A A;  4BJP A;  1D7E A;  4WEJ A;  1TF1 A;  5AVF A;  2HF6 A;  3LR4 A;  3S7N A;  4WLA A;  1LSV A;  5DKK A;  5IS1 A;  1OTE A;  2XRN A;  4EUV A;  3BJN A;  3GDI A;  3OCL A;  3JVU A;  2KLI A;  1ODV A;  1GSW A;  2XA7 M;  3MF0 A;  3T4O A;  4DJ3 A;  4ETX A;  3MR0 A;  3MMH A;  2M7U A;  3LUQ A;  3PBN A;  3LYX A;  4E04 A;  3F1P A;  1OTB A;  2W3E A;  3EQV A;  3F1N B;  3CIT A;  4UQI S;  5HD3 A;  3TW8 A;  3U2A A;  1JNU A;  4KUK A;  4Y5F A;  3H82 A;  2OOL A;  3O5Y A;  4GS9 B;  2W0N A;  3OBF A;  4NXG A;  2FH5 A;  4MMN A;  4LRX C;  1H8M A;  4HP9 A;  1OJG A;  3E4Q A;  5F5Y A;  1V9Z A;  2R78 A;  3F1O B;  4UQI M;  3TRC A;  4MDZ A;  5HZH A;  3KSI A;  3PXP A;  3HJI A;  3CWF A;  4Z1W A;  3B47 A;  2QJ7 A;  3BWL A;  2VX8 A;  2GZA A;  2NUT C;  3S7Q A;  5HWT A;  3G6O A;  1KOU A;  4ARZ A;  1EW0 A;  3NOU C;  4NXF A;  5L8M A;  1T1C A;  4HJ4 A;  4ME4 A;  3KYZ A;  4HIA A;  3VV4 A;  1V9Y A;  4MN7 A;  4IUH A;  3MXQ A;  2V0W A;  2I9V A;  3OLO A;  3W2Z A;  3EGD C;  4LPZ A;  4R70 A;  2W3D A;  1P9W A;  4HJ3 A;  3SW1 A;  4FOF A;  5G4Y A;  2A2L A;  3PBS A;  2YKF A;  4O8G A;  4DN0 A;  2OAQ 1;  3TJZ C;  3T4K A;  1H3Q A;  1MKM A;  2L4R A;  2ZMF A;  4KQD A;  4XT2 B;  1ZTU A;  5A8B A;  5TBM A;  4NEE D;  3VE4 A;  4R6L A;  3LIC A;  1OT9 A;  3ULF A;  5HD5 A;  3LIA A;  3LR0 A;  5HPF A;  3CUE C;  1TS8 A;  2PD8 A;  1Y28 A;  4PKY G;  1DP6 A;  2MJ6 A;  3JVV A;  4B93 A;  3DBA A;  3LFV A;  2JKT M;  4HH3 A;  2LB9 A;  5DKL A;  2K2N A;  3LIE A;  3S7O A;  4EET B;  5TBM B;  2J3T D;  4ETZ A;  3PBQ A;  2ZBB A;  5HPI A;  3MQ0 A;  2H28 A;  1DP8 A;  4O01 A;  4H6J A;  3V67 A;  2L1M A;  5LBR A;  3KO6 A;  4EXO A;  1N9O A;  4Q0I A;  3R7W A;  2EWW A;  3C38 A;  3K3C A;  3BY8 A;  5FL3 A;  2EA9 A;  5DFY A;  3R7W B;  4CLC D;  2VV7 A;  1T19 A;  1OTA A;  3MQO A;  4EW7 A;  2PHY A;  3C8C A;  3MJQ A;  3KSG A;  3IS2 B;  2Y79 A;  3PBO A;  4NKP A;  1LSW A;  3F1P B;  2PYP A;  4AFI A;  1OTI A;  1P97 A;  2PT7 A;  1F9I A;  2O9C A;  3MQQ A;  2Z6C A;  2GNX A;  1N9N A;  1X0O A;  4GCZ A;  2OWH A;  4MN5 A;  2A24 A;  1DP9 A;  1GSV A;  3IS2 A;  1VB6 A;  2NUP C;  1XJ2 A;  3T4J A;  4HY8 A;  1OTD A;  4R3A A;  4EQ1 A;  2BAS A;  4I38 A;  1NWZ A;  1MZU A;  2PR5 A;  1S1Y A;  2VGL S;  2P04 A;  4FSF A;  4B9O A;  3FC7 A;  4IUK A;  4GHI B;  1TS6 A;  3K2N A;  1WA9 A;  2QHK A;  5K5B A;  3CUE A;  3HCY A;  4WN5 A;  2V0U A;  4CQH A;  2PYR A;  2J80 A;  4OOM A;  2P7J A;  2LB5 A;  5HWV A;  4RQ9 A;  3NOP C;  5J4E A;  3CAX A;  4JGO A;  1YKD A;  4XT2 A;  4GJ4 A;  5AJG A;  4CLC E;  4L9F A;  1TS0 A;  2K7S A;  2L0W A;  1N9L A;  4IJG A;  1OT6 A;  5IT5 A;  2WKR A;  4HI4 A;  4QPR A;  5C5K A;  2O9B A;  4PKY A;  3K3D A;  4PHT A;  3E4O A;  3LI8 A;  4GLQ A;  1XJ3 A;  3UE3 A;  2EWV A;  4R38 A;  1T18 A;  4GS9 A;  4I39 A;  4WEK A;  2VJW A;  1GSX A;  2W1T A;  3EOI A;  1TS7 A;  5CX7 A;  4JGQ A;  5HSQ A;  4I3A A;  3UE6 A;  2JKR I;  4LRZ E;  4OOL A;  2W1T B;  4BBT A;  4YWZ A;  4P6Z M;  3ZYT A;  2OAP 1;  3LI9 A;  1LL8 A;  1P0Z A;  2YKH A;  4EEP A;  4Y3I A;  2B02 A;  2HGV A;  2DMW A;  1XJ4 A;  3BQA A;  5HWW A;  3KYQ A;  1MC0 A;  2D02 A;  3B33 A;  3CLO A;  1UWP X;  4KUO A;  4UEY A;  3UB7 A;  5I5L A;  5J3W A;  3UME A;  4BWI A;  2CMN A;  3LID A;  2VV6 A;  4DMZ A;  3NJA A;  5HL6 A;  1F5M A;  4L0L A;  3LIF A;  5DF9 A;  3PBT A;  1XFQ A;  2V1A A;  4HHD A;  5IU1 A;  3ZQ5 A;  3C30 A;  2W3F A;  3A0V A;  5HDC A;  2QJ5 A;  1TD5 A;  4MN6 A;  3ICY A;  2O0Y A;  1STZ A;  4PAU A;  3RFB A;  1IFQ A;  4GHI A;  3OC2 A;  4EER A;  1YSQ A;  3BY9 A;  2KDK A;  2O99 A;  3A0S A;  2KX6 A;  1S4R A;  4LLO B;  3RTY A;  2A24 B;  4NXE A;  2W3G A;  3EQU A;  3KX0 X;  4P6Z S;  4HJ6 A;  4L9G A;  2J3W A;  2IA2 A;  2ZOI A;  3H9W A;  4HH2 A;  4DJ2 A;  2VZW A;  2JHE A;  1D06 A;  4YOF A;  3PHY A;  4CLC C;  4EES A;  4EEU A;  4L9E A;  2WKQ A;  3E0Y A;  3E4P A;  3S7P A;  2M1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...