4HJ6A

Crystal structure of rhodobacter sphaeroides lov protein
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
175
structure length
175
Chain Sequence
DQKQFEKIRAVFDRSGVALTLVDMSLPEQPLVLANPPFLRMTGYTEGQILGFNCRFLQRGDENAQARADIRDALKLGRELQVVLRNYRANDEPFDNLLFLHPVGGRPDAPDYFLGSQFELGRSGNSEEAAAAGHAGALTGELARIGTVAARLEMDSRRHLAQAAAALVRAWERRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords LOV protein
publication title Light-induced subunit dissociation by a light-oxygen-voltage domain photoreceptor from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 54
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hj6A00
2KDKA 4I3AA 3LIAA 1VB6A 3K3DA 3C8CA 5EFWA 4HY8A 4I3IA 1V9YA 1NWZA 4JGQA 3FC7A 3OLOA 4HHDA 3F1OA 3FG8A 3MFXA 2V1BA 3MQOA 1DP6A 2V0UA 3RH8B 2WKQA 1OTBA 3H9WA 5HDSA 4HP4A 4WL9A 5F69A 3H7WA 3F1PB 4JGOA 3GDIA 4WF0A 4GCZA 3NOUC 2L1MA 1LSXA 2PR6A 3LICA 1T19A 1LSVA 4I38A 1EW0A 2I9VA 4LRXC 4NXEA 1T1CA 3UB8A 3F1NA 1LL8A 3LI8A 3H82B 4KUKA 4R3AA 4HIAA 2CMNA 1S1YA 4HJ6A 3LIDA 2JN7A 2L0WA 3NHQA 5KIZA 4MN5A 2A24A 3IS2A 3EEHA 3E4PA 1D06A 4HNBA 4GS9B 4EEPA 3EWKA 4XT2B 1GSVA 2PHYA 2GJ3A 3GECA 1F98A 1OTAA 1JNUA 2R78A 2QJ5A 2YKHA 2VV8A 1S67L 1XJ4A 3C2WA 1OTEA 5J3WA 4EXOA 3CWFA 3ZQ5A 5TBMA 4WN5A 1XJ3A 1OTIA 2PYRA 2ZOIA 5DJTA 1MZUA 3SW1A 3A0RA 2QKPA 3HJKA 4NXGA 1UGUA 4JGPA 4EERA 2BASA 1OT9A 3CLOA 2OWHA 3MJQA 5HZHA 5DKLA 3K3CA 3BY9A 1BYWA 2PYPA 3VE4A 2QWSA 4H6JA 2VEAA 1F9IA 1LT0A 2PR5A 3E4QA 5HD5A 4WUJA 3ULFA 3ICYA 4LRZE 4M4XA 1TS0A 4I39A 1T1AA 4HJ4A 3MR0A 4R38A 2K7SA 1DP8A 2KX6A 2VLGA 5DKKA 3LI9A 5J4EA 2VV6A 4EEUA 3LIEA 4L9EA 1T18A 2OOLA 3BY8A 4HH3A 3A0VA 4GHIA 5HSQA 2PD7A 1XJ2A 3F1OB 4EW7A 3NOTC 2OWJA 2W0NA 3LYXA 2PD8A 2INWA 1XFNA 4DJ2A 4NXBA 1S1ZA 1N9NA 1GSXA 1LSWA 2W27A 3H7WB 3UMEA 2EA9A 3MQQA 4R6LA 1T1BA 1D7EA 2V9AA 1WA9A 2M1CA 5AVEA 1UWPX 1TS6A 4EETB 4HQAA 1GSWA 5G4ZA 3UB6A 3G6OA 1S4SA 2J80A 1S4RA 4B9OA 4R70A 2P7JA 3PYPA 4F3LA 3F1NB 5I5LA 2WKPA 4YWZA 4K08A 4RQ9A 4E04A 3UB9A 3UMDA 3LIBA 3HJIA 5J7EA 2L4RA 3P7NA 4LPZA 2A24B 3IS2B 4JGRA 3LUQA 2ZBBA 3F1PA 2QJ7A 4MN6A 5HDCA 4HOIA 1OT6A 1XFQA 3NOPC 5IU1A 4HH2A 4L9FA 3NJAA 5A8BA 5TBMB 3D72A 3B33A 4BBTA 4F3LB 1ODVA 4DJ3A 3CAXA 4I3JA 1KOUA 3E4OA 5F5YA 3H82A 1XJ6A 4GW9A 5HWVA 5G4YA 2VV7A 2H28A 4KQDA 4PKYA 2YKFA 5F6AA 5AVFA 2WKRA 4HP9A 4GS9A 3UB7A 1OJ5A 4XT2A 4NXFA 4H6JB 1OTDA 4HI4A 2JHEA 4EQ1A 5IS1A 1X0OA 1S66L 4PKYG 1P0ZA 3MXQA 1N9OA 1UWNX 3VOLA 2Z6DA 5HWWA 4KUOA 2Z6CA 5F68A 1N9LA 4L9GA 3LIFA 5HWTA 3PHYA 1G28A 4BBUA 1V9ZA 2V0WA 4BBVA 3IBRA 5DJUA 4GHIB 2D01A 2B02A 5HD3A 1Y28A 2QHKA 3UE6A 3KX0X 1TS7A 2D02A 1TS8A 2V1AA 4I5SA 4LLOB 1DRMA 3T50A 2ZOHA 2HV1A 3A0SA 1P97A 3VE3A 4LRYC 4HJ3A 3RTYA 1DP9A 2PDRA 4EESA 1OJGA 5HDDA 4WLAA 3BWLA
chains in the Genus database with same CATH superfamily
3IXDA 5CRFA 2O99A 3LIAA 2HP9A 5LBRA 1E4DA 2B18A 3I7JA 4QHCA 3CPTA 5GHXA 4Y3IA 1QMEA 3FC7A 2LB5A 3BYDA 1K56D 4HHDA 3N8RA 3PTEA 2ZMVA 3N4IA 1TD5A 3IWIA 1BTLA 2QPNA 4Y5FA 3MXSA 3MQOA 3P01A 3BJNA 1F2KA 5AQ9A 3HBRA 5HFOA 3D3OA 1OTBA 3PBNA 3TRCA 1H3QA 1N9BA 4WL9A 5F69A 3F1PB 5FA7A 2RL3A 3CJMA 3CUEC 2PR6A 2QMIA 4E3OA 1T19A 1LSVA 3DAVA 2B5RA 1EW0A 4LV1A 3LCEA 4LRXC 1T1CA 2WGWA 3UDXA 2JBFA 5K5BA 1K57C 3IX8A 2XEPA 4HJ6A 1S1YA 2E8JA 4PMAA 4GB7A 3W2ZA 1W5DA 3EGXC 4MN5A 1FR6A 1L0EA 2A24A 5CTMA 4OKPA 4O0PA 4IVIA 4UA6A 3V50A 3C4OA 1K55A 1GSVA 1ES3A 2ZL1B 2PBDP 4S2NA 3BQAA 5FEFA 5EVEA 1QMFA 4JPMA 5EVLA 5FAQA 2C5WB 2EX6A 3S22A 4IJGA 2YKHA 2VV8A 4IBRA 4EU0A 1S67L 4U0TA 1SDNA 4EXOA 4OPZA 3ZQ5A 1ERQA 4DF6A 1H8YA 3T4SA 1OTIA 3O86A 4S2KA 1C3BA 2VKSA 2Y2OA 5DF9A 3A0RA 4BL2A 5EOEA 1PZPA 3L9KA 3HJKA 1YMXA 2HP5A 2J9OA 4S2OA 1NLZA 2JKRI 4EUZA 3EEAA 3WS5A 2M7VA 2V8CA 4ME4A 5KMWA 2QWSA 5E2EA 1F9IA 5AQ7A 3E4QA 1S0WA 4WUJA 4KG5A 1EWZA 1Z09A 1W79A 4ARZB 2A49A 1T1AA 2O9BA 1Z6FA 1E3UD 3MR0A 1W8YA 1MPLA 1MBLA 4Z1WA 2K7SA 3WS1A 5DKKA 3LI9A 4ETXA 4UHUA 4DXBA 4EEUA 3CPTB 2M7UA 4OH0A 4R3BA 4HH3A 4WZ5C 3A0VA 3DTIA 4GHIA 5KZHA 1CEGA 2XROA 3N8SA 4BMWA 1ZG4A 2Y2JA 4K0WA 4GD8A 3A3FA 3S7OA 2XH9A 3U2AA 1N4OA 1VETA 1RGYA 2OWJA 1CJFA 2W0NA 4BLMA 2VZWA 2PD8A 1KDSA 2HP6A 4DJ2A 4NXBA 2FZ0A 4F94A 3PAGA 2Y2PA 3PBSA 4DE2A 3PBQA 1P9WA 1GSXA 1K0KA 3UMEA 3MBZA 3OC2A 4OVDA 1PNEA 4S2JA 2Y91A 1D7EA 4OPRA 4OOLA 1NLYA 2M1CA 1UWPX 3Q7ZA 3W4QA 2ZQ8A 1NZUA 5G4ZA 3UB6A 3ZYTA 1ES4A 4DDYA 3W8KA 2J8YA 2WGWB 4B9OA 5A92A 3VOYA 3PYPA 4F3LA 2J3WA 3VFFA 1OMEA 5JYOA 3UB9A 3UMDA 3N6IA 4UAAA 3ZDJA 1FR1A 2L4RA 5DFYA 3VP4A 4R1GA 2A24B 3ZG0A 1GA0A 4X6TA 1ZTUA 5FI7A 5FQJA 4BD0A 3ZVTA 2ZBBA 2WUQA 3Q7VA 4DKIA 5HPIA 3M6HA 4HOIA 2V8FA 5AQAA 3T4JA 3G2YA 3WRTA 3C4PA 4Q8IA 1KGFA 3NJAA 4C6YA 1H8ZA 3JYIA 1F5MA 4L0LA 4EQIA 4GOGA 4MN7A 4DJ3A 4I3JA 1K6RA 2HF6A 4X69A 2K2NA 2I72A 4R4SA 1ESUA 2OLUA 1PWGA 4GW9A 2FH5A 2ZQ7A 1BT5A 5FQMA 2VV7A 2Y2NA 2FFFB 2JKTI 4B88A 2XQZA 5FL3A 4PKYA 4H8RA 1ZKJA 1KE0A 3KSGA 2WKRA 4HP9A 1S6RA 2WADA 4NK3A 2WGIA 4JLFA 1Y54A 3BFEA 2VX8A 2EXAA 2JKGA 2QYBA 3LO7A 2Y2IA 4DRTA 5AJGA 5EM1A 3B42A 4Q0JA 5GLCA 5FQIA 3CHWP 5CGSA 4CLCA 4DN0A 1XX2A 1S66L 4PKYG 3MXQA 4KG2A 2XFTA 1N9OA 4Y0TA 2Z6DA 4QJGA 3GMWA 3QP2A 3G31A 1K6SA 2ZMFA 4LV3A 5F68A 5HWTA 3PHYA 1RP5A 3WS0A 1PI4A 3AGDA 5A90A 4GHIB 2D01A 4QD4A 3T4TA 2ZC6B 3UE6A 3EGDC 4XUXA 1TS7A 1VETB 4YFMA 1PI5A 4YOFA 4DMZA 3FYZA 3HLGA 2Y59A 4WYYA 5HW3A 1P97A 4GDBA 3VE3A 3TOIA 2PAVP 3C38A 4DXCA 5FATA 3G2ZA 1PWCA 2H10A 3C7VA 4I3AA 2BG1A 3RXWA 5CEBA 5FDSA 1FCOA 4WMCD 4YNRA 2W1RA 2ZM0A 5EFWA 1CF0A 4I3IA 1V9YA 1NWZA 4JGQA 1CQAA 3LEQA 5TGFA 5HAPA 2EFXA 1KDWA 4P0MA 5F1GA 3MFXA 4MCWA 1K54C 4O7DA 3E2KA 3VSLA 1DP6A 1HTZA 2V0UA 3RH8B 1VQQA 3S7NA 3H9WA 3ITAA 4S2MA 5HDSA 3VP0A 4HP4A 2Y55A 1XA7A 3Q7VB 5CHJA 3QP4A 5KSCA 4GCZA 3NOUC 5IT5A 4R4RA 3M2JA 3WS4A 3C5AA 2V1ZA 4Z9QA 3UB8A 3R7WA 2ZQ9A 3ZFZA 3F1NA 1MXOA 2X71A 1LL8A 1GA9A 4MBFA 1RGZA 3PBRA 4KUKA 3R4KA 1NJ4A 3FPVA 3LIDA 1MC0A 3E98A 3UB5P 3KO6A 2Y4AA 1XP4A 2L0WA 4ZJ3A 5KIZA 3IS2A 4NKPA 3E4PA 1D06A 3SH9A 3EWKA 3S7QA 2XGNA 3PBOA 1KE4A 3W4OA 4KZ5A 3KSHA 2PHYA 4IEDA 3VP1A 4E3NA 4A5RA 2GJ3A 1JNUA 1YSQA 3ZG5A 4N9KA 2W3HA 5KSHA 4S2PA 4CLCB 1GHMA 3C2WA 1OTEA 4Y2FA 4KQOA 3CWFA 5A93A 3DTEA 5TBMA 4WN5A 2XR0A 2VGJA 4ARZA 3S4XA 2O9CA 3G30A 5EPHA 3ZNTA 2VGLS 1AWIA 4OP5A 2B95A 1MZUA 1L0FA 3HVFA 4P6ZS 3SW1A 2EWWA 2QKPA 3S1YA 3FPWA 2H0TA 1NXYA 4S2NC 4PM6A 1IKIA 1TEMA 3MMHA 1OT9A 3RFBA 3MJQA 2OWHA 1PW1A 5DKLA 2VJWA 2BTFP 3K3CA 1JWPA 2GZAA 5CERA 3TSGA 4E3JA 2O9AA 3ITBA 1GHIA 1SKOB 2W1TA 4KZBA 1LT0A 2PR5A 4IUHA 2MJ6A 2J9PA 5DFXA 5E2GA 3TG9A 3MZDA 4QB8A 4OOMA 1ES2A 1YLPA 3B3XA 1TS0A 1IOUA 3BLMA 2W3EA 4I39A 1IEMA 4HJ4A 2EXBA 2HJ9C 2JC7A 4G3WA 1K4FA 4OLGA 3SOIA 1L3LA 3GTCA 3JPUA 4JXVA 4R0QA 1MKMA 3UY6A 1HD8A 5HSQA 2PD7A 2V20A 2ZC7A 1W8QA 3SH8A 1XJ2A 3UN7A 1IYQA 3ISGA 4Y13A 4EW7A 3MXRA 5TJJA 4ZJ2A 2INWA 1XFNA 3Q82A 3ZGAB 1S1ZA 2WK0A 1LSWA 2W27A 1YM1A 4ZJ1A 1DY6A 5GLDA 2V9AA 3T1XA 2ZC4B 1WA9A 5L10A 5AVEA 1TS6A 1FILA 3LR3A 4EETB 1GSWA 2ZD8A 3EOIA 2A3UA 3T1SA 2PU2A 2J80A 4Y15A 3ZG7B 5E43A 3R7WB 2PU4A 3F1NB 5I5LA 1H8MA 4YWZA 2K31A 4LENA 3UE1A 5IHVA 2Q9MA 3OBFA 4ETZA 5E2FA 3IS2B 3HUNA 4OLDA 1ESIA 4DDSA 2XLNA 2W3FA 5FDHA 3FV7A 3MFDA 5EUAA 3KYZA 2WKEA 5IU1A 3T4OA 3CUEA 2UV0E 2H0YA 5HL6A 3T1QB 5TBMB 3T4KA 1WYCA 1GCEA 2Z2MB 4ZTKA 1ODVA 2Y2MA 1KGGA 2W3DA 4O01A 3O5YA 2ZQAA 3H82A 1XJ6A 2GNXA 4Y7PA 3WRZA 2H28A 4EUVA 1TDLA 3UNWA 4GS9A 3UB7A 2IWBA 1OPXA 1IELA 4ZDXA 1J9MA 3IT9A 3JVUA 4FH2A 3ZCZA 2W1TB 5CGWA 1HLUP 4NEED 4X25A 4X68A 1NYYA 1IFQA 1MWTA 4UQIS 1UWNX 2QZ6A 3VOLA 4MMNA 4Q0HA 2KOIA 3T1RA 1XXMA 5J8XA 5EVIA 4L9GA 5L07A 2PRFA 4BBUA 1MWSA 5CXWA 4BBVA 4C3QA 3P98A 3MF0A 4G3KA 1G6AA 5HD3A 3IBJA 1TF1A 4YINA 1W63Q 5DTKA 1G6OA 3HLBA 4KZ3A 3DTKA 1Q2QA 4R3JA 1NZOA 5FQQA 3HLEA 2ZOHA 2XSSA 3A0SA 4HEFA 4MBKA 4QY5A 4LRYC 4HJ3A 4CLCD 4LV0A 3A3EA 2PDRA 4GKUA 3T4LA 1OJGA 5HDDA 2JE5A 1YT4A 4WLAA 3LFVA 4RYEA 2KDKA 3AGEA 4S2IA 1VEUB 1K25A 4HY8A 1MY8A 1SHVA 4JF4A 2P08A 1FQGA 3IQAA 3SS3A 3KSIA 3HUMA 3UE3A 1YKDA 1LL9A 4PAUA 1Q2PA 4N92A 4WEJA 3CI6A 2XA7S 3IXGA 2V1BA 5GL9A 3CITA 2DCFA 3ZG9B 4D60A 1MKIA 2ZJ9A 2XF3A 5L8MA 2WKQA 2DNSA 4ZAMA 4G3VA 1YLTA 4JGOA 3GDIA 4WF0A 4EWFA 3OOVA 4KZ9A 3HLFA 1LSXA 1FSYA 3MSHA 3HLCA 2Y2GA 4NXEA 3SZTA 5F1FA 1LI9A 4E6WA 2IWDA 5C5KA 1YPRA 2PT7A 2OAQ1 3LI8A 4JXSA 3Q1FA 4KG6A 2VGKA 2X01A 3H82B 3A3DA 3E2LA 1IYOA 2JN7A 4KZ4A 3NHQA 4R23A 3DWZA 4LCLA 3EEHA 2NUPC 4HNBA 4GS9B 4EEPA 3PAEA 1BLSA 3BQ8A 4KQQA 2R78A 3E0YA 2QJ5A 4JF6A 5AQBA 3VOZA 5F83A 1SKOA 1ONGA 1XJ4A 3VSKA 1BUEA 3TE8A 1D1JA 1HVBA 2J3TD 3V5MA 2BLSA 3LY3A 5FQKA 2XFSA 4BJPA 1BLPA 1BLCA 3N8LA 4E3MA 2PYRA 4ESPA 4Y17A 1JWZA 5EVIB 3ZVWA 3NIAA 4Y0UA 4EBLA 3IF6A 3UPPA 3GV9A 4U0XA 1MWUA 3UPNA 3BW6A 4JGPA 4MBHA 3ZG8B 5CHUA 2BASA 4X55A 1U60A 3CLOA 3IWOA 5HZHA 2ZMAA 1PWDA 4GN2A 3NCKA 3NDGA 2HDUA 1BYWA 2EWVA 4GZBA 3MZEA 4XXRA 2G2WA 2VEAA 3P09A 5G18A 5HD5A 1ONHA 3OPHA 4M4XA 1FCMA 1PRQA 3D9YA 1CI9A 3UDIA 3A3JA 3O88A 2WKIA 5DF7A 4LCMA 1CI8A 3FZCA 3QP6A 4WBGA 4WZ4A 4HBUA 5L09A 4HESA 4N1XA 1T18A 2OOLA 4E3IA 3RXXA 4CPKA 2VK3A 2OV5A 5FASA 4PM9A 1H5XA 4DE1A 1WYBA 2XD1A 3L7HA 5TR7A 4K0XA 1K38A 1ZC2A 4RVAA 4XUZA 5GLAA 1PFLA 4HBTA 4JXWA 4KZAA 1PIOA 3O3VA 3GVBA 3JVVA 1FCNA 5MC7A 3NI9A 1L0GA 3QP8A 4OP8A 3QNBA 2P74A 1J3WA 2LB9A 1I5QA 1TVFA 4HQAA 1JVJA 4GNUA 3UPOA 2HDRA 1S4RA 4LGWA 3IH8A 2W3GA 4WM9A 3OPRA 1YLYA 3DWKA 5FAPA 4K08A 4RQ9A 3Q07A 3LIBA 3HJIA 2CC1A 4P85A 4RA7A 4LPZA 1K54A 1W63M 5EOOA 1HZOA 1K55C 4CQHA 5HPFA 3SH7A 4ID4A 3T12B 2XRNA 3IHAA 4MN6A 4CJNA 5HDCA 5U47A 4NETA 3MS6A 1SKFA 4K91A 1IYSA 3OCLA 1SCWA 3D72A 1LL5A 2ZQDA 4IUKA 3CAXA 1TDGA 3OCNA 4B93A 1BZAA 5F5YA 1CEFA 2Y2HA 3QP5A 3IF6B 4OONA 5HARA 4QY6A 1MWRA 3CZDA 5F82A 3HCYA 5F6AA 3NDEA 5AVFA 3SS5A 1W7FA 4D2OA 1LLBA 3HUOA 3C30A 4XT2A 3LGOA 4NXFA 1ZHHB 1NYMA 4WEKA 3RJUA 4B4ZA 3PBTA 4PM8A 4BD1A 1KGEA 4UA7A 4UA9A 4EQ1A 5IS1A 1BLHA 1X0OA 4IHQA 1H0MA 1NRFA 4FD8A 4FCFA 1P0ZA 4ZRRA 5D3OA 5CX7A 4RX2A 5CGXA 3OZHA 2Y2QA 3G4PA 5HWWA 2PBYA 1STZA 2JCHA 1G28A 1JWVA 1VEUA 1V9ZA 2V0WA 3IBRA 4KQRA 2KLIA 1LHYA 4ZBEA 1ES5A 3HLDA 5DJUA 5JYPA 1KVMA 1Y28A 2EX9A 4GLQA 1K56A 4E3LA 1XPBA 3WWXA 2WGVA 1TS8A 4GJ4A 4LLOB 4FOFA 3C7UA 3D4FA 1DP9A 5I94A 4U3TA 5CHMA 5EVIC 4EESA 2A2LA 2XD5A 4O8GA 2OSUA 4AFIA 3QP1A 3CMZA 4JKTA 1VB6A 5EVID 3K3DA 3UE0A 3C8CA 3KSFA 2R9XA 1YLJA 4FTXA 3EQUA 3DW0A 3KYQA 3BFGA 3OLOA 3VFHA 3VP3A 1XGJA 1WE4A 3CG5A 3F1OA 2XDMA 3PXPA 3FG8A 4FUWA 5HX9A 2JKFA 5CECA 5DF8A 4MLLA 5HAQA 3SS4A 3BFFA 1K57A 1L2SA 5HAIA 1ZG6A 3OPPA 4OPQA 3TJZC 3H7WA 2OLVA 2ZQCA 3MKEA 2EX2A 2AVXA 2Q9NA 3NY4A 1E25A 2HPBA 4KZ8A 5M18A 2L1MA 5GHZA 1ERMA 1IYPA 4X1MA 2X02A 3LICA 3QHYA 1ACFA 4KZ7A 4I38A 3WS2A 2I9VA 4JXGA 2UWXA 2HZ5A 4LV2A 3HL9A 1NRJA 2G2UA 3BM6A 3FKVA 4WELA 1K4EA 1DJCA 3IXHA 3HREA 2ZM8A 3ZNYA 2Y79A 3B47A 4HIAA 4R3AA 2CMNA 3N7WA 1I2SA 2GDNA 5FAOA 4DE3A 4FSFA 1PYYA 4MNRA 3VMAA 2HGVA 3OPLA 2OAP1 2ZC3B 2VGLM 2HDQA 3IX3A 4E6XA 4XT2B 4N9LA 3LR0A 2WZZA 2ZM2A 4P6ZM 4UEYA 2ACGA 4LFUA 3BFDA 5FSRA 3GECA 1F98A 1OTAA 3V3RA 3MQ0A 4KENB 3LR5A 4CLCC 1VHMA 1SZVA 3UDFA 3IX4A 2RCXA 5J3WA 5A91A 3G35A 2E8IA 5E2HA 3DBAA 2ZC5B 1KVLA 4OQIA 4OQGA 4JBFA 1XJ3A 1E3UA 3NULA 2IA2A 2Y2KA 3ZHHA 2P04A 5FI6A 2G7UA 4DE0A 2ZOIA 5DJTA 3NC8A 1FIKA 2WAEA 1EROA 2J7VA 4NXGA 1UGUA 3BECA 2JKRM 4EERA 3BRMA 4EV4A 3LR4A 4WZ5A 1JTDA 2C6WB 4IVKA 3BY9A 1YLZA 1CK3A 4X56A 3FWLA 2PYPA 4Y0OA 4M3KA 3VE4A 2WAFA 4H6JA 3LEZA 1G5UA 3NBLA 3O87A 1M40A 1M6KA 2Y2LA 2FFYA 3ULFA 3ICYA 4LRZE 3T4QA 2Y8HA 4QPRA 4MDZA 1XA1A 3U4LP 2R9WA 4RX3A 1DJBA 4R38A 1KE3A 3IF6C 2EX8A 1A0KA 3VV4A 3QNCA 1DP8A 2KX6A 2VLGA 2WZXA 5M19A 5J4EA 2VV6A 3MZFA 3BEBA 5EM0A 2EFUA 4JF5A 1O07A 3LIEA 4QU3A 4L9EA 3BY8A 2DMWA 3PR6A 4GD6A 3V39A 1PZOA 1YAXA 4N1HA 3IXBA 1O7EA 4GDNA 3F1OB 1EI5A 2HJEA 1LI0A 3NOTC 1FOFA 5M1AA 3LYXA 2IWCA 4BWIA 3BFCA 5DVAA 4BENA 1N9NA 1YSPA 3H7WB 2V2FF 2EA9A 3MQQA 4R6LA 4C75A 4B4XA 1T1BA 2P9VA 1AXBA 5DTSA 3GRJA 3BLSA 4NG2A 3V3SA 3HLWA 3M2KA 4MEZA 3DTMA 4PHTA 3NECA 5BOHA 2J3TC 2WYXA 3G6OA 3FKWA 1S4SA 3UO9A 4X1LA 4R70A 4CLCE 2P7JA 3GR2A 3IH9A 5FQ9A 5FEGA 3Q81A 2WKPA 4E04A 4OPYA 5GLBA 5J7EA 2Q0OA 3P7NA 4BL3A 5L2FA 2Z2LB 1RCJA 4JGRA 3LUQA 5HL1A 3M6BA 4EBNA 1I2WA 4P87A 3F1PA 2QJ7A 4FH4A 5CTNA 1BULA 3G32A 1OT6A 1PW8A 2VA0A 1XFQA 3NOPC 3S7PA 3IF5A 1IKGA 4OQHA 1FSWA 4HH2A 2ZLYA 4L9FA 1YQSA 5GHYA 1P9RA 4PM7A 3AGFA 1BSGA 5A8BA 1L0DA 5CEDA 1GHPA 3B33A 2O0YA 4BBTA 4F3LB 2GX5A 5TFQA 1KOUA 3E4OA 3KYEA 2JKTM 5HWVA 5G4YA 4KQDA 4UQIM 1SDEA 3V67A 3IHBA 1Y4OA 2NUTC 2YKFA 5EECA 2XK1A 2H5SA 1OJ5A 3A3IA 5DTTA 2ZL1A 4QWOA 4Q0IA 3VP2A 2HDSA 4S2LA 3W4PA 4H6JB 3IWQA 1OTDA 4HI4A 2JHEA 3MKFA 1ALQA 5EE8A 1XKZA 4OOYA 5FI2A 4EBPA 4PM5A 3K2NA 4KUOA 2Z6CA 1N9LA 3LIFA 1YLWA 4WMCA 4BQMA 4OQ0A 3GSGA 4PPRA 2B02A 4KZ6A 2QHKA 1YMSA 3GQZA 3EQVA 2WKHA 3KX0X 4E3KA 2D02A 3G34A 4II7A 5EV0A 2V1AA 4I5SA 3LY4A 1DRMA 3T50A 4X53A 2HV1A 3TW8A 1JTGA 1G68A 3RTYA 4P6BA 4IBXA 1DJAA 1NY0A 2XA7M 2DRWA 1XGIA 1VM1A 2P9VB 3BWLA
chains in the Genus database with same CATH topology
2KDKA 2O99A 3LIAA 4I3AA 1VB6A 3K3DA 5LBRA 4YNRA 3C8CA 3KSFA 2W1RA 5EFWA 4HY8A 2B18A 4I3IA 1V9YA 3EQUA 1NWZA 4Y3IA 4JGQA 2P08A 3KYQA 3FC7A 3OLOA 3KSIA 2LB5A 4HHDA 3UE3A 1YKDA 3F1OA 2ZMVA 3PXPA 3FG8A 3MFXA 1TD5A 4PAUA 4WEJA 4MCWA 3CI6A 2XA7S 2V1BA 3CITA 4Y5FA 3MQOA 3P01A 1DP6A 3BJNA 2V0UA 5L8MA 3RH8B 2WKQA 3D3OA 1OTBA 3PBNA 3S7NA 3H9WA 3TRCA 1H3QA 5HDSA 3TJZC 4HP4A 4WL9A 5F69A 3H7WA 3F1PB 4G3VA 4JGOA 3GDIA 4WF0A 4GCZA 3OOVA 3NOUC 3CUEC 2L1MA 5IT5A 1LSXA 2PR6A 3LICA 1T19A 1LSVA 4I38A 1EW0A 2I9VA 4LRXC 4NXEA 1T1CA 1NRJA 3UB8A 3R7WA 4WELA 5C5KA 3F1NA 2PT7A 1LL8A 2OAQ1 3LI8A 5K5BA 3PBRA 3H82B 4KUKA 2Y79A 3B47A 4HIAA 4R3AA 2CMNA 1S1YA 4HJ6A 3R4KA 3LIDA 3FPVA 1MC0A 3E98A 3KO6A 2JN7A 2L0WA 3W2ZA 3EGXC 4FSFA 3NHQA 5KIZA 4MN5A 2A24A 3IS2A 4NKPA 3EEHA 3E4PA 2NUPC 2HGVA 1D06A 4O0PA 4HNBA 2OAP1 4GS9B 4EEPA 2VGLM 3EWKA 3S7QA 4XT2B 3PBOA 1GSVA 3LR0A 3KSHA 4P6ZM 4UEYA 2PHYA 3BQAA 3BQ8A 2GJ3A 3GECA 1F98A 1OTAA 1JNUA 2R78A 3MQ0A 3E0YA 3LR5A 4IJGA 1VHMA 2QJ5A 2YKHA 4CLCC 2VV8A 4EU0A 1YSQA 1S67L 2W3HA 1XJ4A 5KSHA 4CLCB 3C2WA 1OTEA 4Y2FA 4KQOA 5J3WA 3CWFA 3TE8A 4EXOA 3ZQ5A 2J3TD 3DBAA 5TBMA 4WN5A 1XJ3A 4ARZA 4BJPA 2IA2A 2O9CA 3T4SA 2P04A 1OTIA 2PYRA 2G7UA 2VGLS 2VKSA 2ZOIA 5DJTA 1MZUA 4P6ZS 3SW1A 5DF9A 3A0RA 2EWWA 2QKPA 3FPWA 3HJKA 4NXGA 1UGUA 3BW6A 2JKRM 4JGPA 4EERA 2BASA 3MMHA 1OT9A 3LR4A 3RFBA 1NLZA 3CLOA 2OWHA 3MJQA 5HZHA 5DKLA 2JKRI 2VJWA 3K3CA 3EEAA 2GZAA 3BY9A 2M7VA 2O9AA 4ME4A 1BYWA 2PYPA 2EWVA 3VE4A 2QWSA 4H6JA 2VEAA 1F9IA 2W1TA 1LT0A 2PR5A 3E4QA 5HD5A 4WUJA 4IUHA 2MJ6A 3ULFA 5DFXA 3ICYA 4LRZE 3T4QA 4M4XA 2Y8HA 4OOMA 1TS0A 4QPRA 4ARZB 1IOUA 2W3EA 4I39A 1T1AA 4MDZA 2O9BA 4HJ4A 3MR0A 4R38A 2HJ9C 3VV4A 4Z1WA 2K7SA 4G3WA 1DP8A 2KX6A 2VLGA 5DKKA 3LI9A 5J4EA 2VV6A 4ETXA 4EEUA 3LIEA 4L9EA 2M7UA 1T18A 2OOLA 2DMWA 3BY8A 4HH3A 1MKMA 3A0VA 3PR6A 4GHIA 5HSQA 2PD7A 2XROA 1YAXA 4BMWA 1XJ2A 3S7OA 3F1OB 3U2AA 4EW7A 2HJEA 3NOTC 2OWJA 5TJJA 2W0NA 3LYXA 2VZWA 2PD8A 2INWA 1XFNA 4DJ2A 4NXBA 2FZ0A 4BWIA 3PBSA 1S1ZA 1N9NA 3PBQA 3JVVA 1P9WA 1GSXA 1LSWA 5MC7A 1YSPA 2W27A 3H7WB 3UMEA 2EA9A 3MQQA 3OC2A 4R6LA 1T1BA 1D7EA 2V9AA 4OOLA 1NLYA 1WA9A 2M1CA 5AVEA 1UWPX 1TS6A 3LR3A 2LB9A 4EETB 4PHTA 4HQAA 1GSWA 2J3TC 5G4ZA 3UB6A 3EOIA 3G6OA 3ZYTA 1S4SA 2J80A 1S4RA 4B9OA 4R70A 4CLCE 2W3GA 2P7JA 3R7WB 3PYPA 4F3LA 3F1NB 5I5LA 1H8MA 2J3WA 2WKPA 4YWZA 4K08A 2K31A 4RQ9A 4E04A 3UB9A 3UMDA 3LIBA 3HJIA 5J7EA 2L4RA 3P7NA 3OBFA 5DFYA 4ETZA 4LPZA 1W63M 2A24B 3IS2B 4JGRA 3LUQA 4CQHA 5HPFA 1ZTUA 2XRNA 2ZBBA 3F1PA 2QJ7A 4MN6A 5HPIA 5HDCA 2W3FA 4HOIA 1OT6A 2VA0A 1XFQA 3NOPC 3S7PA 3T4JA 3KYZA 5IU1A 3T4OA 4HH2A 3CUEA 4L9FA 5HL6A 1P9RA 3NJAA 3OCLA 5A8BA 5TBMB 3D72A 3B33A 3T4KA 1F5MA 2O0YA 4IUKA 4BBTA 4F3LB 4L0LA 4MN7A 2GX5A 1ODVA 4DJ3A 3CAXA 4I3JA 2HF6A 3OCNA 2W3DA 1KOUA 4B93A 3E4OA 4O01A 5F5YA 3O5YA 2K2NA 2JKTM 3H82A 1XJ6A 4GW9A 2FH5A 5HWVA 5G4YA 2GNXA 2VV7A 2H28A 4KQDA 4UQIM 2JKTI 5FL3A 4PKYA 3V67A 4EUVA 3HCYA 2NUTC 2YKFA 5F6AA 3KSGA 5AVFA 2WKRA 4HP9A 4GS9A 3UB7A 1OJ5A 1OPXA 3C30A 4XT2A 4NXFA 1ZHHB 2VX8A 4WEKA 3JVUA 4Q0IA 2QYBA 3PBTA 4H6JB 5AJGA 1OTDA 2W1TB 4HI4A 4NEED 3B42A 2JHEA 4Q0JA 4EQ1A 5IS1A 1X0OA 4IHQA 4CLCA 4DN0A 1S66L 4PKYG 1P0ZA 4ZRRA 3MXQA 1IFQA 4UQIS 1N9OA 1UWNX 3VOLA 4MMNA 5CX7A 2Z6DA 4Q0HA 2KOIA 5HWWA 3K2NA 2ZMFA 4KUOA 2Z6CA 5F68A 1N9LA 4L9GA 3LIFA 1STZA 5HWTA 3PHYA 1G28A 4BBUA 1V9ZA 2V0WA 4BBVA 3IBRA 2KLIA 3MF0A 5DJUA 4GHIB 2D01A 2B02A 4G3KA 5HD3A 1Y28A 2QHKA 3T4TA 4GLQA 3EQVA 3UE6A 3IBJA 1TF1A 1W63Q 3EGDC 3KX0X 1TS7A 2D02A 1G6OA 4II7A 1TS8A 4YOFA 2V1AA 4DMZA 4I5SA 4GJ4A 4LLOB 1DRMA 4FOFA 3T50A 2ZOHA 2HV1A 2XSSA 3A0SA 1P97A 3TW8A 3VE3A 4LRYC 4HJ3A 4CLCD 3RTYA 1DP9A 2PDRA 3C38A 3T4LA 4EESA 1OJGA 5HDDA 2A2LA 4O8GA 2XA7M 4AFIA 4WLAA 3LFVA 3BWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDK A;  4I3A A;  3LIA A;  1VB6 A;  3K3D A;  3C8C A;  5EFW A;  4HY8 A;  4I3I A;  1V9Y A;  1NWZ A;  4JGQ A;  3FC7 A;  3OLO A;  4HHD A;  3F1O A;  3FG8 A;  3MFX A;  2V1B A;  3MQO A;  1DP6 A;  2V0U A;  3RH8 B;  2WKQ A;  1OTB A;  3H9W A;  5HDS A;  4HP4 A;  4WL9 A;  5F69 A;  3H7W A;  3F1P B;  4JGO A;  3GDI A;  4WF0 A;  4GCZ A;  3NOU C;  2L1M A;  1LSX A;  2PR6 A;  3LIC A;  1T19 A;  1LSV A;  4I38 A;  1EW0 A;  2I9V A;  4LRX C;  4NXE A;  1T1C A;  3UB8 A;  3F1N A;  1LL8 A;  3LI8 A;  3H82 B;  4KUK A;  4R3A A;  4HIA A;  2CMN A;  1S1Y A;  4HJ6 A;  3LID A;  2JN7 A;  2L0W A;  3NHQ A;  5KIZ A;  4MN5 A;  2A24 A;  3IS2 A;  3EEH A;  3E4P A;  1D06 A;  4HNB A;  4GS9 B;  4EEP A;  3EWK A;  4XT2 B;  1GSV A;  2PHY A;  2GJ3 A;  3GEC A;  1F98 A;  1OTA A;  1JNU A;  2R78 A;  2QJ5 A;  2YKH A;  2VV8 A;  1S67 L;  1XJ4 A;  3C2W A;  1OTE A;  5J3W A;  4EXO A;  3CWF A;  3ZQ5 A;  5TBM A;  4WN5 A;  1XJ3 A;  1OTI A;  2PYR A;  2ZOI A;  5DJT A;  1MZU A;  3SW1 A;  3A0R A;  2QKP A;  3HJK A;  4NXG A;  1UGU A;  4JGP A;  4EER A;  2BAS A;  1OT9 A;  3CLO A;  2OWH A;  3MJQ A;  5HZH A;  5DKL A;  3K3C A;  3BY9 A;  1BYW A;  2PYP A;  3VE4 A;  2QWS A;  4H6J A;  2VEA A;  1F9I A;  1LT0 A;  2PR5 A;  3E4Q A;  5HD5 A;  4WUJ A;  3ULF A;  3ICY A;  4LRZ E;  4M4X A;  1TS0 A;  4I39 A;  1T1A A;  4HJ4 A;  3MR0 A;  4R38 A;  2K7S A;  1DP8 A;  2KX6 A;  2VLG A;  5DKK A;  3LI9 A;  5J4E A;  2VV6 A;  4EEU A;  3LIE A;  4L9E A;  1T18 A;  2OOL A;  3BY8 A;  4HH3 A;  3A0V A;  4GHI A;  5HSQ A;  2PD7 A;  1XJ2 A;  3F1O B;  4EW7 A;  3NOT C;  2OWJ A;  2W0N A;  3LYX A;  2PD8 A;  2INW A;  1XFN A;  4DJ2 A;  4NXB A;  1S1Z A;  1N9N A;  1GSX A;  1LSW A;  2W27 A;  3H7W B;  3UME A;  2EA9 A;  3MQQ A;  4R6L A;  1T1B A;  1D7E A;  2V9A A;  1WA9 A;  2M1C A;  5AVE A;  1UWP X;  1TS6 A;  4EET B;  4HQA A;  1GSW A;  5G4Z A;  3UB6 A;  3G6O A;  1S4S A;  2J80 A;  1S4R A;  4B9O A;  4R70 A;  2P7J A;  3PYP A;  4F3L A;  3F1N B;  5I5L A;  2WKP A;  4YWZ A;  4K08 A;  4RQ9 A;  4E04 A;  3UB9 A;  3UMD A;  3LIB A;  3HJI A;  5J7E A;  2L4R A;  3P7N A;  4LPZ A;  2A24 B;  3IS2 B;  4JGR A;  3LUQ A;  2ZBB A;  3F1P A;  2QJ7 A;  4MN6 A;  5HDC A;  4HOI A;  1OT6 A;  1XFQ A;  3NOP C;  5IU1 A;  4HH2 A;  4L9F A;  3NJA A;  5A8B A;  5TBM B;  3D72 A;  3B33 A;  4BBT A;  4F3L B;  1ODV A;  4DJ3 A;  3CAX A;  4I3J A;  1KOU A;  3E4O A;  5F5Y A;  3H82 A;  1XJ6 A;  4GW9 A;  5HWV A;  5G4Y A;  2VV7 A;  2H28 A;  4KQD A;  4PKY A;  2YKF A;  5F6A A;  5AVF A;  2WKR A;  4HP9 A;  4GS9 A;  3UB7 A;  1OJ5 A;  4XT2 A;  4NXF A;  4H6J B;  1OTD A;  4HI4 A;  2JHE A;  4EQ1 A;  5IS1 A;  1X0O A;  1S66 L;  4PKY G;  1P0Z A;  3MXQ A;  1N9O A;  1UWN X;  3VOL A;  2Z6D A;  5HWW A;  4KUO A;  2Z6C A;  5F68 A;  1N9L A;  4L9G A;  3LIF A;  5HWT A;  3PHY A;  1G28 A;  4BBU A;  1V9Z A;  2V0W A;  4BBV A;  3IBR A;  5DJU A;  4GHI B;  2D01 A;  2B02 A;  5HD3 A;  1Y28 A;  2QHK A;  3UE6 A;  3KX0 X;  1TS7 A;  2D02 A;  1TS8 A;  2V1A A;  4I5S A;  4LLO B;  1DRM A;  3T50 A;  2ZOH A;  2HV1 A;  3A0S A;  1P97 A;  3VE3 A;  4LRY C;  4HJ3 A;  3RTY A;  1DP9 A;  2PDR A;  4EES A;  1OJG A;  5HDD A;  4WLA A;  3BWL A; 
#chains in the Genus database with same CATH topology
 3IXD A;  5CRF A;  2O99 A;  3LIA A;  2HP9 A;  5LBR A;  1E4D A;  2B18 A;  3I7J A;  4QHC A;  3CPT A;  5GHX A;  4Y3I A;  1QME A;  3FC7 A;  2LB5 A;  3BYD A;  1K56 D;  4HHD A;  3N8R A;  3PTE A;  2ZMV A;  3N4I A;  1TD5 A;  3IWI A;  1BTL A;  2QPN A;  4Y5F A;  3MXS A;  3MQO A;  3P01 A;  3BJN A;  1F2K A;  5AQ9 A;  3HBR A;  5HFO A;  3D3O A;  1OTB A;  3PBN A;  3TRC A;  1H3Q A;  1N9B A;  4WL9 A;  5F69 A;  3F1P B;  5FA7 A;  2RL3 A;  3CJM A;  3CUE C;  2PR6 A;  2QMI A;  4E3O A;  1T19 A;  1LSV A;  3DAV A;  2B5R A;  1EW0 A;  4LV1 A;  3LCE A;  4LRX C;  1T1C A;  2WGW A;  3UDX A;  2JBF A;  5K5B A;  1K57 C;  3IX8 A;  2XEP A;  4HJ6 A;  1S1Y A;  2E8J A;  4PMA A;  4GB7 A;  3W2Z A;  1W5D A;  3EGX C;  4MN5 A;  1FR6 A;  1L0E A;  2A24 A;  5CTM A;  4OKP A;  4O0P A;  4IVI A;  4UA6 A;  3V50 A;  3C4O A;  1K55 A;  1GSV A;  1ES3 A;  2ZL1 B;  2PBD P;  4S2N A;  3BQA A;  5FEF A;  5EVE A;  1QMF A;  4JPM A;  5EVL A;  5FAQ A;  2C5W B;  2EX6 A;  3S22 A;  4IJG A;  2YKH A;  2VV8 A;  4IBR A;  4EU0 A;  1S67 L;  4U0T A;  1SDN A;  4EXO A;  4OPZ A;  3ZQ5 A;  1ERQ A;  4DF6 A;  1H8Y A;  3T4S A;  1OTI A;  3O86 A;  4S2K A;  1C3B A;  2VKS A;  2Y2O A;  5DF9 A;  3A0R A;  4BL2 A;  5EOE A;  1PZP A;  3L9K A;  3HJK A;  1YMX A;  2HP5 A;  2J9O A;  4S2O A;  1NLZ A;  2JKR I;  4EUZ A;  3EEA A;  3WS5 A;  2M7V A;  2V8C A;  4ME4 A;  5KMW A;  2QWS A;  5E2E A;  1F9I A;  5AQ7 A;  3E4Q A;  1S0W A;  4WUJ A;  4KG5 A;  1EWZ A;  1Z09 A;  1W79 A;  4ARZ B;  2A49 A;  1T1A A;  2O9B A;  1Z6F A;  1E3U D;  3MR0 A;  1W8Y A;  1MPL A;  1MBL A;  4Z1W A;  2K7S A;  3WS1 A;  5DKK A;  3LI9 A;  4ETX A;  4UHU A;  4DXB A;  4EEU A;  3CPT B;  2M7U A;  4OH0 A;  4R3B A;  4HH3 A;  4WZ5 C;  3A0V A;  3DTI A;  4GHI A;  5KZH A;  1CEG A;  2XRO A;  3N8S A;  4BMW A;  1ZG4 A;  2Y2J A;  4K0W A;  4GD8 A;  3A3F A;  3S7O A;  2XH9 A;  3U2A A;  1N4O A;  1VET A;  1RGY A;  2OWJ A;  1CJF A;  2W0N A;  4BLM A;  2VZW A;  2PD8 A;  1KDS A;  2HP6 A;  4DJ2 A;  4NXB A;  2FZ0 A;  4F94 A;  3PAG A;  2Y2P A;  3PBS A;  4DE2 A;  3PBQ A;  1P9W A;  1GSX A;  1K0K A;  3UME A;  3MBZ A;  3OC2 A;  4OVD A;  1PNE A;  4S2J A;  2Y91 A;  1D7E A;  4OPR A;  4OOL A;  1NLY A;  2M1C A;  1UWP X;  3Q7Z A;  3W4Q A;  2ZQ8 A;  1NZU A;  5G4Z A;  3UB6 A;  3ZYT A;  1ES4 A;  4DDY A;  3W8K A;  2J8Y A;  2WGW B;  4B9O A;  5A92 A;  3VOY A;  3PYP A;  4F3L A;  2J3W A;  3VFF A;  1OME A;  5JYO A;  3UB9 A;  3UMD A;  3N6I A;  4UAA A;  3ZDJ A;  1FR1 A;  2L4R A;  5DFY A;  3VP4 A;  4R1G A;  2A24 B;  3ZG0 A;  1GA0 A;  4X6T A;  1ZTU A;  5FI7 A;  5FQJ A;  4BD0 A;  3ZVT A;  2ZBB A;  2WUQ A;  3Q7V A;  4DKI A;  5HPI A;  3M6H A;  4HOI A;  2V8F A;  5AQA A;  3T4J A;  3G2Y A;  3WRT A;  3C4P A;  4Q8I A;  1KGF A;  3NJA A;  4C6Y A;  1H8Z A;  3JYI A;  1F5M A;  4L0L A;  4EQI A;  4GOG A;  4MN7 A;  4DJ3 A;  4I3J A;  1K6R A;  2HF6 A;  4X69 A;  2K2N A;  2I72 A;  4R4S A;  1ESU A;  2OLU A;  1PWG A;  4GW9 A;  2FH5 A;  2ZQ7 A;  1BT5 A;  5FQM A;  2VV7 A;  2Y2N A;  2FFF B;  2JKT I;  4B88 A;  2XQZ A;  5FL3 A;  4PKY A;  4H8R A;  1ZKJ A;  1KE0 A;  3KSG A;  2WKR A;  4HP9 A;  1S6R A;  2WAD A;  4NK3 A;  2WGI A;  4JLF A;  1Y54 A;  3BFE A;  2VX8 A;  2EXA A;  2JKG A;  2QYB A;  3LO7 A;  2Y2I A;  4DRT A;  5AJG A;  5EM1 A;  3B42 A;  4Q0J A;  5GLC A;  5FQI A;  3CHW P;  5CGS A;  4CLC A;  4DN0 A;  1XX2 A;  1S66 L;  4PKY G;  3MXQ A;  4KG2 A;  2XFT A;  1N9O A;  4Y0T A;  2Z6D A;  4QJG A;  3GMW A;  3QP2 A;  3G31 A;  1K6S A;  2ZMF A;  4LV3 A;  5F68 A;  5HWT A;  3PHY A;  1RP5 A;  3WS0 A;  1PI4 A;  3AGD A;  5A90 A;  4GHI B;  2D01 A;  4QD4 A;  3T4T A;  2ZC6 B;  3UE6 A;  3EGD C;  4XUX A;  1TS7 A;  1VET B;  4YFM A;  1PI5 A;  4YOF A;  4DMZ A;  3FYZ A;  3HLG A;  2Y59 A;  4WYY A;  5HW3 A;  1P97 A;  4GDB A;  3VE3 A;  3TOI A;  2PAV P;  3C38 A;  4DXC A;  5FAT A;  3G2Z A;  1PWC A;  2H10 A;  3C7V A;  4I3A A;  2BG1 A;  3RXW A;  5CEB A;  5FDS A;  1FCO A;  4WMC D;  4YNR A;  2W1R A;  2ZM0 A;  5EFW A;  1CF0 A;  4I3I A;  1V9Y A;  1NWZ A;  4JGQ A;  1CQA A;  3LEQ A;  5TGF A;  5HAP A;  2EFX A;  1KDW A;  4P0M A;  5F1G A;  3MFX A;  4MCW A;  1K54 C;  4O7D A;  3E2K A;  3VSL A;  1DP6 A;  1HTZ A;  2V0U A;  3RH8 B;  1VQQ A;  3S7N A;  3H9W A;  3ITA A;  4S2M A;  5HDS A;  3VP0 A;  4HP4 A;  2Y55 A;  1XA7 A;  3Q7V B;  5CHJ A;  3QP4 A;  5KSC A;  4GCZ A;  3NOU C;  5IT5 A;  4R4R A;  3M2J A;  3WS4 A;  3C5A A;  2V1Z A;  4Z9Q A;  3UB8 A;  3R7W A;  2ZQ9 A;  3ZFZ A;  3F1N A;  1MXO A;  2X71 A;  1LL8 A;  1GA9 A;  4MBF A;  1RGZ A;  3PBR A;  4KUK A;  3R4K A;  1NJ4 A;  3FPV A;  3LID A;  1MC0 A;  3E98 A;  3UB5 P;  3KO6 A;  2Y4A A;  1XP4 A;  2L0W A;  4ZJ3 A;  5KIZ A;  3IS2 A;  4NKP A;  3E4P A;  1D06 A;  3SH9 A;  3EWK A;  3S7Q A;  2XGN A;  3PBO A;  1KE4 A;  3W4O A;  4KZ5 A;  3KSH A;  2PHY A;  4IED A;  3VP1 A;  4E3N A;  4A5R A;  2GJ3 A;  1JNU A;  1YSQ A;  3ZG5 A;  4N9K A;  2W3H A;  5KSH A;  4S2P A;  4CLC B;  1GHM A;  3C2W A;  1OTE A;  4Y2F A;  4KQO A;  3CWF A;  5A93 A;  3DTE A;  5TBM A;  4WN5 A;  2XR0 A;  2VGJ A;  4ARZ A;  3S4X A;  2O9C A;  3G30 A;  5EPH A;  3ZNT A;  2VGL S;  1AWI A;  4OP5 A;  2B95 A;  1MZU A;  1L0F A;  3HVF A;  4P6Z S;  3SW1 A;  2EWW A;  2QKP A;  3S1Y A;  3FPW A;  2H0T A;  1NXY A;  4S2N C;  4PM6 A;  1IKI A;  1TEM A;  3MMH A;  1OT9 A;  3RFB A;  3MJQ A;  2OWH A;  1PW1 A;  5DKL A;  2VJW A;  2BTF P;  3K3C A;  1JWP A;  2GZA A;  5CER A;  3TSG A;  4E3J A;  2O9A A;  3ITB A;  1GHI A;  1SKO B;  2W1T A;  4KZB A;  1LT0 A;  2PR5 A;  4IUH A;  2MJ6 A;  2J9P A;  5DFX A;  5E2G A;  3TG9 A;  3MZD A;  4QB8 A;  4OOM A;  1ES2 A;  1YLP A;  3B3X A;  1TS0 A;  1IOU A;  3BLM A;  2W3E A;  4I39 A;  1IEM A;  4HJ4 A;  2EXB A;  2HJ9 C;  2JC7 A;  4G3W A;  1K4F A;  4OLG A;  3SOI A;  1L3L A;  3GTC A;  3JPU A;  4JXV A;  4R0Q A;  1MKM A;  3UY6 A;  1HD8 A;  5HSQ A;  2PD7 A;  2V20 A;  2ZC7 A;  1W8Q A;  3SH8 A;  1XJ2 A;  3UN7 A;  1IYQ A;  3ISG A;  4Y13 A;  4EW7 A;  3MXR A;  5TJJ A;  4ZJ2 A;  2INW A;  1XFN A;  3Q82 A;  3ZGA B;  1S1Z A;  2WK0 A;  1LSW A;  2W27 A;  1YM1 A;  4ZJ1 A;  1DY6 A;  5GLD A;  2V9A A;  3T1X A;  2ZC4 B;  1WA9 A;  5L10 A;  5AVE A;  1TS6 A;  1FIL A;  3LR3 A;  4EET B;  1GSW A;  2ZD8 A;  3EOI A;  2A3U A;  3T1S A;  2PU2 A;  2J80 A;  4Y15 A;  3ZG7 B;  5E43 A;  3R7W B;  2PU4 A;  3F1N B;  5I5L A;  1H8M A;  4YWZ A;  2K31 A;  4LEN A;  3UE1 A;  5IHV A;  2Q9M A;  3OBF A;  4ETZ A;  5E2F A;  3IS2 B;  3HUN A;  4OLD A;  1ESI A;  4DDS A;  2XLN A;  2W3F A;  5FDH A;  3FV7 A;  3MFD A;  5EUA A;  3KYZ A;  2WKE A;  5IU1 A;  3T4O A;  3CUE A;  2UV0 E;  2H0Y A;  5HL6 A;  3T1Q B;  5TBM B;  3T4K A;  1WYC A;  1GCE A;  2Z2M B;  4ZTK A;  1ODV A;  2Y2M A;  1KGG A;  2W3D A;  4O01 A;  3O5Y A;  2ZQA A;  3H82 A;  1XJ6 A;  2GNX A;  4Y7P A;  3WRZ A;  2H28 A;  4EUV A;  1TDL A;  3UNW A;  4GS9 A;  3UB7 A;  2IWB A;  1OPX A;  1IEL A;  4ZDX A;  1J9M A;  3IT9 A;  3JVU A;  4FH2 A;  3ZCZ A;  2W1T B;  5CGW A;  1HLU P;  4NEE D;  4X25 A;  4X68 A;  1NYY A;  1IFQ A;  1MWT A;  4UQI S;  1UWN X;  2QZ6 A;  3VOL A;  4MMN A;  4Q0H A;  2KOI A;  3T1R A;  1XXM A;  5J8X A;  5EVI A;  4L9G A;  5L07 A;  2PRF A;  4BBU A;  1MWS A;  5CXW A;  4BBV A;  4C3Q A;  3P98 A;  3MF0 A;  4G3K A;  1G6A A;  5HD3 A;  3IBJ A;  1TF1 A;  4YIN A;  1W63 Q;  5DTK A;  1G6O A;  3HLB A;  4KZ3 A;  3DTK A;  1Q2Q A;  4R3J A;  1NZO A;  5FQQ A;  3HLE A;  2ZOH A;  2XSS A;  3A0S A;  4HEF A;  4MBK A;  4QY5 A;  4LRY C;  4HJ3 A;  4CLC D;  4LV0 A;  3A3E A;  2PDR A;  4GKU A;  3T4L A;  1OJG A;  5HDD A;  2JE5 A;  1YT4 A;  4WLA A;  3LFV A;  4RYE A;  2KDK A;  3AGE A;  4S2I A;  1VEU B;  1K25 A;  4HY8 A;  1MY8 A;  1SHV A;  4JF4 A;  2P08 A;  1FQG A;  3IQA A;  3SS3 A;  3KSI A;  3HUM A;  3UE3 A;  1YKD A;  1LL9 A;  4PAU A;  1Q2P A;  4N92 A;  4WEJ A;  3CI6 A;  2XA7 S;  3IXG A;  2V1B A;  5GL9 A;  3CIT A;  2DCF A;  3ZG9 B;  4D60 A;  1MKI A;  2ZJ9 A;  2XF3 A;  5L8M A;  2WKQ A;  2DNS A;  4ZAM A;  4G3V A;  1YLT A;  4JGO A;  3GDI A;  4WF0 A;  4EWF A;  3OOV A;  4KZ9 A;  3HLF A;  1LSX A;  1FSY A;  3MSH A;  3HLC A;  2Y2G A;  4NXE A;  3SZT A;  5F1F A;  1LI9 A;  4E6W A;  2IWD A;  5C5K A;  1YPR A;  2PT7 A;  2OAQ 1;  3LI8 A;  4JXS A;  3Q1F A;  4KG6 A;  2VGK A;  2X01 A;  3H82 B;  3A3D A;  3E2L A;  1IYO A;  2JN7 A;  4KZ4 A;  3NHQ A;  4R23 A;  3DWZ A;  4LCL A;  3EEH A;  2NUP C;  4HNB A;  4GS9 B;  4EEP A;  3PAE A;  1BLS A;  3BQ8 A;  4KQQ A;  2R78 A;  3E0Y A;  2QJ5 A;  4JF6 A;  5AQB A;  3VOZ A;  5F83 A;  1SKO A;  1ONG A;  1XJ4 A;  3VSK A;  1BUE A;  3TE8 A;  1D1J A;  1HVB A;  2J3T D;  3V5M A;  2BLS A;  3LY3 A;  5FQK A;  2XFS A;  4BJP A;  1BLP A;  1BLC A;  3N8L A;  4E3M A;  2PYR A;  4ESP A;  4Y17 A;  1JWZ A;  5EVI B;  3ZVW A;  3NIA A;  4Y0U A;  4EBL A;  3IF6 A;  3UPP A;  3GV9 A;  4U0X A;  1MWU A;  3UPN A;  3BW6 A;  4JGP A;  4MBH A;  3ZG8 B;  5CHU A;  2BAS A;  4X55 A;  1U60 A;  3CLO A;  3IWO A;  5HZH A;  2ZMA A;  1PWD A;  4GN2 A;  3NCK A;  3NDG A;  2HDU A;  1BYW A;  2EWV A;  4GZB A;  3MZE A;  4XXR A;  2G2W A;  2VEA A;  3P09 A;  5G18 A;  5HD5 A;  1ONH A;  3OPH A;  4M4X A;  1FCM A;  1PRQ A;  3D9Y A;  1CI9 A;  3UDI A;  3A3J A;  3O88 A;  2WKI A;  5DF7 A;  4LCM A;  1CI8 A;  3FZC A;  3QP6 A;  4WBG A;  4WZ4 A;  4HBU A;  5L09 A;  4HES A;  4N1X A;  1T18 A;  2OOL A;  4E3I A;  3RXX A;  4CPK A;  2VK3 A;  2OV5 A;  5FAS A;  4PM9 A;  1H5X A;  4DE1 A;  1WYB A;  2XD1 A;  3L7H A;  5TR7 A;  4K0X A;  1K38 A;  1ZC2 A;  4RVA A;  4XUZ A;  5GLA A;  1PFL A;  4HBT A;  4JXW A;  4KZA A;  1PIO A;  3O3V A;  3GVB A;  3JVV A;  1FCN A;  5MC7 A;  3NI9 A;  1L0G A;  3QP8 A;  4OP8 A;  3QNB A;  2P74 A;  1J3W A;  2LB9 A;  1I5Q A;  1TVF A;  4HQA A;  1JVJ A;  4GNU A;  3UPO A;  2HDR A;  1S4R A;  4LGW A;  3IH8 A;  2W3G A;  4WM9 A;  3OPR A;  1YLY A;  3DWK A;  5FAP A;  4K08 A;  4RQ9 A;  3Q07 A;  3LIB A;  3HJI A;  2CC1 A;  4P85 A;  4RA7 A;  4LPZ A;  1K54 A;  1W63 M;  5EOO A;  1HZO A;  1K55 C;  4CQH A;  5HPF A;  3SH7 A;  4ID4 A;  3T12 B;  2XRN A;  3IHA A;  4MN6 A;  4CJN A;  5HDC A;  5U47 A;  4NET A;  3MS6 A;  1SKF A;  4K91 A;  1IYS A;  3OCL A;  1SCW A;  3D72 A;  1LL5 A;  2ZQD A;  4IUK A;  3CAX A;  1TDG A;  3OCN A;  4B93 A;  1BZA A;  5F5Y A;  1CEF A;  2Y2H A;  3QP5 A;  3IF6 B;  4OON A;  5HAR A;  4QY6 A;  1MWR A;  3CZD A;  5F82 A;  3HCY A;  5F6A A;  3NDE A;  5AVF A;  3SS5 A;  1W7F A;  4D2O A;  1LLB A;  3HUO A;  3C30 A;  4XT2 A;  3LGO A;  4NXF A;  1ZHH B;  1NYM A;  4WEK A;  3RJU A;  4B4Z A;  3PBT A;  4PM8 A;  4BD1 A;  1KGE A;  4UA7 A;  4UA9 A;  4EQ1 A;  5IS1 A;  1BLH A;  1X0O A;  4IHQ A;  1H0M A;  1NRF A;  4FD8 A;  4FCF A;  1P0Z A;  4ZRR A;  5D3O A;  5CX7 A;  4RX2 A;  5CGX A;  3OZH A;  2Y2Q A;  3G4P A;  5HWW A;  2PBY A;  1STZ A;  2JCH A;  1G28 A;  1JWV A;  1VEU A;  1V9Z A;  2V0W A;  3IBR A;  4KQR A;  2KLI A;  1LHY A;  4ZBE A;  1ES5 A;  3HLD A;  5DJU A;  5JYP A;  1KVM A;  1Y28 A;  2EX9 A;  4GLQ A;  1K56 A;  4E3L A;  1XPB A;  3WWX A;  2WGV A;  1TS8 A;  4GJ4 A;  4LLO B;  4FOF A;  3C7U A;  3D4F A;  1DP9 A;  5I94 A;  4U3T A;  5CHM A;  5EVI C;  4EES A;  2A2L A;  2XD5 A;  4O8G A;  2OSU A;  4AFI A;  3QP1 A;  3CMZ A;  4JKT A;  1VB6 A;  5EVI D;  3K3D A;  3UE0 A;  3C8C A;  3KSF A;  2R9X A;  1YLJ A;  4FTX A;  3EQU A;  3DW0 A;  3KYQ A;  3BFG A;  3OLO A;  3VFH A;  3VP3 A;  1XGJ A;  1WE4 A;  3CG5 A;  3F1O A;  2XDM A;  3PXP A;  3FG8 A;  4FUW A;  5HX9 A;  2JKF A;  5CEC A;  5DF8 A;  4MLL A;  5HAQ A;  3SS4 A;  3BFF A;  1K57 A;  1L2S A;  5HAI A;  1ZG6 A;  3OPP A;  4OPQ A;  3TJZ C;  3H7W A;  2OLV A;  2ZQC A;  3MKE A;  2EX2 A;  2AVX A;  2Q9N A;  3NY4 A;  1E25 A;  2HPB A;  4KZ8 A;  5M18 A;  2L1M A;  5GHZ A;  1ERM A;  1IYP A;  4X1M A;  2X02 A;  3LIC A;  3QHY A;  1ACF A;  4KZ7 A;  4I38 A;  3WS2 A;  2I9V A;  4JXG A;  2UWX A;  2HZ5 A;  4LV2 A;  3HL9 A;  1NRJ A;  2G2U A;  3BM6 A;  3FKV A;  4WEL A;  1K4E A;  1DJC A;  3IXH A;  3HRE A;  2ZM8 A;  3ZNY A;  2Y79 A;  3B47 A;  4HIA A;  4R3A A;  2CMN A;  3N7W A;  1I2S A;  2GDN A;  5FAO A;  4DE3 A;  4FSF A;  1PYY A;  4MNR A;  3VMA A;  2HGV A;  3OPL A;  2OAP 1;  2ZC3 B;  2VGL M;  2HDQ A;  3IX3 A;  4E6X A;  4XT2 B;  4N9L A;  3LR0 A;  2WZZ A;  2ZM2 A;  4P6Z M;  4UEY A;  2ACG A;  4LFU A;  3BFD A;  5FSR A;  3GEC A;  1F98 A;  1OTA A;  3V3R A;  3MQ0 A;  4KEN B;  3LR5 A;  4CLC C;  1VHM A;  1SZV A;  3UDF A;  3IX4 A;  2RCX A;  5J3W A;  5A91 A;  3G35 A;  2E8I A;  5E2H A;  3DBA A;  2ZC5 B;  1KVL A;  4OQI A;  4OQG A;  4JBF A;  1XJ3 A;  1E3U A;  3NUL A;  2IA2 A;  2Y2K A;  3ZHH A;  2P04 A;  5FI6 A;  2G7U A;  4DE0 A;  2ZOI A;  5DJT A;  3NC8 A;  1FIK A;  2WAE A;  1ERO A;  2J7V A;  4NXG A;  1UGU A;  3BEC A;  2JKR M;  4EER A;  3BRM A;  4EV4 A;  3LR4 A;  4WZ5 A;  1JTD A;  2C6W B;  4IVK A;  3BY9 A;  1YLZ A;  1CK3 A;  4X56 A;  3FWL A;  2PYP A;  4Y0O A;  4M3K A;  3VE4 A;  2WAF A;  4H6J A;  3LEZ A;  1G5U A;  3NBL A;  3O87 A;  1M40 A;  1M6K A;  2Y2L A;  2FFY A;  3ULF A;  3ICY A;  4LRZ E;  3T4Q A;  2Y8H A;  4QPR A;  4MDZ A;  1XA1 A;  3U4L P;  2R9W A;  4RX3 A;  1DJB A;  4R38 A;  1KE3 A;  3IF6 C;  2EX8 A;  1A0K A;  3VV4 A;  3QNC A;  1DP8 A;  2KX6 A;  2VLG A;  2WZX A;  5M19 A;  5J4E A;  2VV6 A;  3MZF A;  3BEB A;  5EM0 A;  2EFU A;  4JF5 A;  1O07 A;  3LIE A;  4QU3 A;  4L9E A;  3BY8 A;  2DMW A;  3PR6 A;  4GD6 A;  3V39 A;  1PZO A;  1YAX A;  4N1H A;  3IXB A;  1O7E A;  4GDN A;  3F1O B;  1EI5 A;  2HJE A;  1LI0 A;  3NOT C;  1FOF A;  5M1A A;  3LYX A;  2IWC A;  4BWI A;  3BFC A;  5DVA A;  4BEN A;  1N9N A;  1YSP A;  3H7W B;  2V2F F;  2EA9 A;  3MQQ A;  4R6L A;  4C75 A;  4B4X A;  1T1B A;  2P9V A;  1AXB A;  5DTS A;  3GRJ A;  3BLS A;  4NG2 A;  3V3S A;  3HLW A;  3M2K A;  4MEZ A;  3DTM A;  4PHT A;  3NEC A;  5BOH A;  2J3T C;  2WYX A;  3G6O A;  3FKW A;  1S4S A;  3UO9 A;  4X1L A;  4R70 A;  4CLC E;  2P7J A;  3GR2 A;  3IH9 A;  5FQ9 A;  5FEG A;  3Q81 A;  2WKP A;  4E04 A;  4OPY A;  5GLB A;  5J7E A;  2Q0O A;  3P7N A;  4BL3 A;  5L2F A;  2Z2L B;  1RCJ A;  4JGR A;  3LUQ A;  5HL1 A;  3M6B A;  4EBN A;  1I2W A;  4P87 A;  3F1P A;  2QJ7 A;  4FH4 A;  5CTN A;  1BUL A;  3G32 A;  1OT6 A;  1PW8 A;  2VA0 A;  1XFQ A;  3NOP C;  3S7P A;  3IF5 A;  1IKG A;  4OQH A;  1FSW A;  4HH2 A;  2ZLY A;  4L9F A;  1YQS A;  5GHY A;  1P9R A;  4PM7 A;  3AGF A;  1BSG A;  5A8B A;  1L0D A;  5CED A;  1GHP A;  3B33 A;  2O0Y A;  4BBT A;  4F3L B;  2GX5 A;  5TFQ A;  1KOU A;  3E4O A;  3KYE A;  2JKT M;  5HWV A;  5G4Y A;  4KQD A;  4UQI M;  1SDE A;  3V67 A;  3IHB A;  1Y4O A;  2NUT C;  2YKF A;  5EEC A;  2XK1 A;  2H5S A;  1OJ5 A;  3A3I A;  5DTT A;  2ZL1 A;  4QWO A;  4Q0I A;  3VP2 A;  2HDS A;  4S2L A;  3W4P A;  4H6J B;  3IWQ A;  1OTD A;  4HI4 A;  2JHE A;  3MKF A;  1ALQ A;  5EE8 A;  1XKZ A;  4OOY A;  5FI2 A;  4EBP A;  4PM5 A;  3K2N A;  4KUO A;  2Z6C A;  1N9L A;  3LIF A;  1YLW A;  4WMC A;  4BQM A;  4OQ0 A;  3GSG A;  4PPR A;  2B02 A;  4KZ6 A;  2QHK A;  1YMS A;  3GQZ A;  3EQV A;  2WKH A;  3KX0 X;  4E3K A;  2D02 A;  3G34 A;  4II7 A;  5EV0 A;  2V1A A;  4I5S A;  3LY4 A;  1DRM A;  3T50 A;  4X53 A;  2HV1 A;  3TW8 A;  1JTG A;  1G68 A;  3RTY A;  4P6B A;  4IBX A;  1DJA A;  1NY0 A;  2XA7 M;  2DRW A;  1XGI A;  1VM1 A;  2P9V B;  3BWL A; 
#chains in the Genus database with same CATH homology
 2KDK A;  2O99 A;  3LIA A;  4I3A A;  1VB6 A;  3K3D A;  5LBR A;  4YNR A;  3C8C A;  3KSF A;  2W1R A;  5EFW A;  4HY8 A;  2B18 A;  4I3I A;  1V9Y A;  3EQU A;  1NWZ A;  4Y3I A;  4JGQ A;  2P08 A;  3KYQ A;  3FC7 A;  3OLO A;  3KSI A;  2LB5 A;  4HHD A;  3UE3 A;  1YKD A;  3F1O A;  2ZMV A;  3PXP A;  3FG8 A;  3MFX A;  1TD5 A;  4PAU A;  4WEJ A;  4MCW A;  3CI6 A;  2XA7 S;  2V1B A;  3CIT A;  4Y5F A;  3MQO A;  3P01 A;  1DP6 A;  3BJN A;  2V0U A;  5L8M A;  3RH8 B;  2WKQ A;  3D3O A;  1OTB A;  3PBN A;  3S7N A;  3H9W A;  3TRC A;  1H3Q A;  5HDS A;  3TJZ C;  4HP4 A;  4WL9 A;  5F69 A;  3H7W A;  3F1P B;  4G3V A;  4JGO A;  3GDI A;  4WF0 A;  4GCZ A;  3OOV A;  3NOU C;  3CUE C;  2L1M A;  5IT5 A;  1LSX A;  2PR6 A;  3LIC A;  1T19 A;  1LSV A;  4I38 A;  1EW0 A;  2I9V A;  4LRX C;  4NXE A;  1T1C A;  1NRJ A;  3UB8 A;  3R7W A;  4WEL A;  5C5K A;  3F1N A;  2PT7 A;  1LL8 A;  2OAQ 1;  3LI8 A;  5K5B A;  3PBR A;  3H82 B;  4KUK A;  2Y79 A;  3B47 A;  4HIA A;  4R3A A;  2CMN A;  1S1Y A;  4HJ6 A;  3R4K A;  3LID A;  3FPV A;  1MC0 A;  3E98 A;  3KO6 A;  2JN7 A;  2L0W A;  3W2Z A;  3EGX C;  4FSF A;  3NHQ A;  5KIZ A;  4MN5 A;  2A24 A;  3IS2 A;  4NKP A;  3EEH A;  3E4P A;  2NUP C;  2HGV A;  1D06 A;  4O0P A;  4HNB A;  2OAP 1;  4GS9 B;  4EEP A;  2VGL M;  3EWK A;  3S7Q A;  4XT2 B;  3PBO A;  1GSV A;  3LR0 A;  3KSH A;  4P6Z M;  4UEY A;  2PHY A;  3BQA A;  3BQ8 A;  2GJ3 A;  3GEC A;  1F98 A;  1OTA A;  1JNU A;  2R78 A;  3MQ0 A;  3E0Y A;  3LR5 A;  4IJG A;  1VHM A;  2QJ5 A;  2YKH A;  4CLC C;  2VV8 A;  4EU0 A;  1YSQ A;  1S67 L;  2W3H A;  1XJ4 A;  5KSH A;  4CLC B;  3C2W A;  1OTE A;  4Y2F A;  4KQO A;  5J3W A;  3CWF A;  3TE8 A;  4EXO A;  3ZQ5 A;  2J3T D;  3DBA A;  5TBM A;  4WN5 A;  1XJ3 A;  4ARZ A;  4BJP A;  2IA2 A;  2O9C A;  3T4S A;  2P04 A;  1OTI A;  2PYR A;  2G7U A;  2VGL S;  2VKS A;  2ZOI A;  5DJT A;  1MZU A;  4P6Z S;  3SW1 A;  5DF9 A;  3A0R A;  2EWW A;  2QKP A;  3FPW A;  3HJK A;  4NXG A;  1UGU A;  3BW6 A;  2JKR M;  4JGP A;  4EER A;  2BAS A;  3MMH A;  1OT9 A;  3LR4 A;  3RFB A;  1NLZ A;  3CLO A;  2OWH A;  3MJQ A;  5HZH A;  5DKL A;  2JKR I;  2VJW A;  3K3C A;  3EEA A;  2GZA A;  3BY9 A;  2M7V A;  2O9A A;  4ME4 A;  1BYW A;  2PYP A;  2EWV A;  3VE4 A;  2QWS A;  4H6J A;  2VEA A;  1F9I A;  2W1T A;  1LT0 A;  2PR5 A;  3E4Q A;  5HD5 A;  4WUJ A;  4IUH A;  2MJ6 A;  3ULF A;  5DFX A;  3ICY A;  4LRZ E;  3T4Q A;  4M4X A;  2Y8H A;  4OOM A;  1TS0 A;  4QPR A;  4ARZ B;  1IOU A;  2W3E A;  4I39 A;  1T1A A;  4MDZ A;  2O9B A;  4HJ4 A;  3MR0 A;  4R38 A;  2HJ9 C;  3VV4 A;  4Z1W A;  2K7S A;  4G3W A;  1DP8 A;  2KX6 A;  2VLG A;  5DKK A;  3LI9 A;  5J4E A;  2VV6 A;  4ETX A;  4EEU A;  3LIE A;  4L9E A;  2M7U A;  1T18 A;  2OOL A;  2DMW A;  3BY8 A;  4HH3 A;  1MKM A;  3A0V A;  3PR6 A;  4GHI A;  5HSQ A;  2PD7 A;  2XRO A;  1YAX A;  4BMW A;  1XJ2 A;  3S7O A;  3F1O B;  3U2A A;  4EW7 A;  2HJE A;  3NOT C;  2OWJ A;  5TJJ A;  2W0N A;  3LYX A;  2VZW A;  2PD8 A;  2INW A;  1XFN A;  4DJ2 A;  4NXB A;  2FZ0 A;  4BWI A;  3PBS A;  1S1Z A;  1N9N A;  3PBQ A;  3JVV A;  1P9W A;  1GSX A;  1LSW A;  5MC7 A;  1YSP A;  2W27 A;  3H7W B;  3UME A;  2EA9 A;  3MQQ A;  3OC2 A;  4R6L A;  1T1B A;  1D7E A;  2V9A A;  4OOL A;  1NLY A;  1WA9 A;  2M1C A;  5AVE A;  1UWP X;  1TS6 A;  3LR3 A;  2LB9 A;  4EET B;  4PHT A;  4HQA A;  1GSW A;  2J3T C;  5G4Z A;  3UB6 A;  3EOI A;  3G6O A;  3ZYT A;  1S4S A;  2J80 A;  1S4R A;  4B9O A;  4R70 A;  4CLC E;  2W3G A;  2P7J A;  3R7W B;  3PYP A;  4F3L A;  3F1N B;  5I5L A;  1H8M A;  2J3W A;  2WKP A;  4YWZ A;  4K08 A;  2K31 A;  4RQ9 A;  4E04 A;  3UB9 A;  3UMD A;  3LIB A;  3HJI A;  5J7E A;  2L4R A;  3P7N A;  3OBF A;  5DFY A;  4ETZ A;  4LPZ A;  1W63 M;  2A24 B;  3IS2 B;  4JGR A;  3LUQ A;  4CQH A;  5HPF A;  1ZTU A;  2XRN A;  2ZBB A;  3F1P A;  2QJ7 A;  4MN6 A;  5HPI A;  5HDC A;  2W3F A;  4HOI A;  1OT6 A;  2VA0 A;  1XFQ A;  3NOP C;  3S7P A;  3T4J A;  3KYZ A;  5IU1 A;  3T4O A;  4HH2 A;  3CUE A;  4L9F A;  5HL6 A;  1P9R A;  3NJA A;  3OCL A;  5A8B A;  5TBM B;  3D72 A;  3B33 A;  3T4K A;  1F5M A;  2O0Y A;  4IUK A;  4BBT A;  4F3L B;  4L0L A;  4MN7 A;  2GX5 A;  1ODV A;  4DJ3 A;  3CAX A;  4I3J A;  2HF6 A;  3OCN A;  2W3D A;  1KOU A;  4B93 A;  3E4O A;  4O01 A;  5F5Y A;  3O5Y A;  2K2N A;  2JKT M;  3H82 A;  1XJ6 A;  4GW9 A;  2FH5 A;  5HWV A;  5G4Y A;  2GNX A;  2VV7 A;  2H28 A;  4KQD A;  4UQI M;  2JKT I;  5FL3 A;  4PKY A;  3V67 A;  4EUV A;  3HCY A;  2NUT C;  2YKF A;  5F6A A;  3KSG A;  5AVF A;  2WKR A;  4HP9 A;  4GS9 A;  3UB7 A;  1OJ5 A;  1OPX A;  3C30 A;  4XT2 A;  4NXF A;  1ZHH B;  2VX8 A;  4WEK A;  3JVU A;  4Q0I A;  2QYB A;  3PBT A;  4H6J B;  5AJG A;  1OTD A;  2W1T B;  4HI4 A;  4NEE D;  3B42 A;  2JHE A;  4Q0J A;  4EQ1 A;  5IS1 A;  1X0O A;  4IHQ A;  4CLC A;  4DN0 A;  1S66 L;  4PKY G;  1P0Z A;  4ZRR A;  3MXQ A;  1IFQ A;  4UQI S;  1N9O A;  1UWN X;  3VOL A;  4MMN A;  5CX7 A;  2Z6D A;  4Q0H A;  2KOI A;  5HWW A;  3K2N A;  2ZMF A;  4KUO A;  2Z6C A;  5F68 A;  1N9L A;  4L9G A;  3LIF A;  1STZ A;  5HWT A;  3PHY A;  1G28 A;  4BBU A;  1V9Z A;  2V0W A;  4BBV A;  3IBR A;  2KLI A;  3MF0 A;  5DJU A;  4GHI B;  2D01 A;  2B02 A;  4G3K A;  5HD3 A;  1Y28 A;  2QHK A;  3T4T A;  4GLQ A;  3EQV A;  3UE6 A;  3IBJ A;  1TF1 A;  1W63 Q;  3EGD C;  3KX0 X;  1TS7 A;  2D02 A;  1G6O A;  4II7 A;  1TS8 A;  4YOF A;  2V1A A;  4DMZ A;  4I5S A;  4GJ4 A;  4LLO B;  1DRM A;  4FOF A;  3T50 A;  2ZOH A;  2HV1 A;  2XSS A;  3A0S A;  1P97 A;  3TW8 A;  3VE3 A;  4LRY C;  4HJ3 A;  4CLC D;  3RTY A;  1DP9 A;  2PDR A;  3C38 A;  3T4L A;  4EES A;  1OJG A;  5HDD A;  2A2L A;  4O8G A;  2XA7 M;  4AFI A;  4WLA A;  3LFV A;  3BWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...