4HJ6A

Crystal structure of rhodobacter sphaeroides lov protein
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
175
structure length
175
Chain Sequence
b'DQKQFEKIRAVFDRSGVALTLVDMSLPEQPLVLANPPFLRMTGYTEGQILGFNCRFLQRGDENAQARADIRDALKLGRELQVVLRNYRANDEPFDNLLFLHPVGGRPDAPDYFLGSQFELGRSGNSEEAAAAGHAGALTGELARIGTVAARLEMDSRRHLAQAAAALVRAWERRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LOV protein
publication title Light-induced subunit dissociation by a light-oxygen-voltage domain photoreceptor from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Signaling protein
total genus 54
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hj6A00
3H82B 1LSVA 2J80A 3UMEA 2ZOHA 4HNBA 4JGQA 1OT6A 2QJ7A 1OT9A 4B9OA 3IBRA 3D72A 4EXOA 4BBUA 1Y28A 3LIEA 3NJAA 4JGRA 4EEPA 3A0SA 4I39A 2V1AA 2ZBBA 3F1PA 4LRZE 2L0WA 4E04A 1DP8A 1DRMA 3UB9A 2WKPA 2A24A 4JGPA 3BY8A 1XJ2A 2Z6CA 5HSQA 1GSXA 1TS6A 3MFXA 4WL9A 3UMDA 1WA9A 1MZUA 2PD7A 3LIBA 3HJKA 4GHIA 4JGOA 4I3AA 4PKYG 2B02A 3UB6A 4L9FA 4GS9B 2PR6A 4HOIA 4WUJA 4I3JA 3EEHA 1OTBA 1DP6A 4GCZA 4XT2A 1N9NA 1V9ZA 5DKLA 1OTEA 3PYPA 3F1PB 4LPZA 2VEAA 4H6JA 3LIDA 4KUOA 2A24B 4NXEA 1T18A 1D7EA 3SW1A 1T1CA 4HH3A 5J3WA 2PYRA 4MN5A 2D02A 4NXGA 3VOLA 3MJQA 1JNUA 3IS2B 1OTAA 2W0NA 3FG8A 1TS8A 4NXFA 3ZQ5A 4YWZA 3T50A 1UWPX 2P7JA 2JN7A 5DJUA 1OJ5A 4WF0A 1T1AA 5DJTA 1D06A 1XJ6A 2YKHA 3C8CA 3F1NA 1VB6A 4NXBA 2INWA 2OOLA 4HIAA 4DJ3A 4XT2B 4R38A 5HWTA 5IS1A 1UWNX 5HDSA 3PHYA 3NOPC 5HDCA 4WN5A 1LSXA 1T1BA 1N9OA 4LRXC 2PD8A 4HJ3A 5HZHA 2CMNA 4BBVA 4I5SA 4HY8A 5AVEA 3ICYA 3OLOA 2OWJA 1F9IA 5G4ZA 2PYPA 5DKKA 2V0UA 3LYXA 3E4OA 2D01A 4EEUA 4EERA 3H9WA 3LICA 3LI9A 4LLOB 3CLOA 3H82A 3B33A 1LL8A 3VE3A 5J4EA 2YKFA 4M4XA 4EQ1A 1S4SA 1OTIA 1G28A 3CAXA 3MQQA 3A0VA 3FC7A 3H7WA 1X0OA 4HHDA 5HD3A 2QWSA 5F5YA 2EA9A 5F69A 2L1MA 5KIZA 3UB8A 4F3LA 2I9VA 4HQAA 3CWFA 2V9AA 3NOTC 2W27A 2VLGA 1XFQA 5EFWA 2R78A 2HV1A 5A8BA 1OJGA 5HDDA 1XFNA 2VV7A 4GHIB 2QHKA 4R70A 4BBTA 3P7NA 1NWZA 3NOUC 2KX6A 5HWVA 1TS0A 3GDIA 1LSWA 2V1BA 4GS9A 4KUKA 1N9LA 5TBMA 3RH8B 5HD5A 2K7SA 4I3IA 3LI8A 4PKYA 1ODVA 3K3CA 4I38A 1GSVA 1EW0A 5AVFA 4MN6A 3LIFA 1GSWA 4GW9A 4LRYC 2PHYA 3E4PA 3F1OA 3H7WB 1OTDA 5I5LA 3BWLA 3LUQA 4EETB 2QJ5A 2OWHA 1S1YA 5G4YA 1F98A 3HJIA 4H6JB 3LIAA 4L9GA 4F3LB 1S66L 5F6AA 1P97A 5HWWA 2WKRA 3RTYA 2L4RA 4DJ2A 3G6OA 2BASA 1XJ4A 3IS2A 2M1CA 3EWKA 2QKPA 4HP9A 1S67L 2JHEA 4L9EA 4HI4A 1TS7A 3K3DA 4RQ9A 2KDKA 3A0RA 2VV6A 3F1NB 5TBMB 4HH2A 4R3AA 5J7EA 2GJ3A 3MQOA 1S4RA 4K08A 3UE6A 4KQDA 1LT0A 3MR0A 1V9YA 2PDRA 3F1OB 2PR5A 5IU1A 3UB7A 3VE4A 4EESA 3MXQA 4WLAA 4HP4A 4R6LA 1S1ZA 3ULFA 2H28A 3KX0X 4HJ4A 4EW7A 1P0ZA 3E4QA 5F68A 1T19A 1BYWA 2WKQA 2VV8A 3GECA 3NHQA 1XJ3A 2ZOIA 4HJ6A 1KOUA 2V0WA 1UGUA 1DP9A 2Z6DA 3C2WA 3BY9A
chains in the Genus database with same CATH superfamily
2Y2GA 3AGFA 4JGQA 1PWDA 1OT6A 4KQRA 1XKZA 5HL6A 4DE2A 5FATA 4XUXA 3A3DA 4OP5A 3TOIA 4EXOA 1Y28A 3G31A 2EFXA 4EEPA 3A0SA 1RCJA 3UPOA 4GDNA 1NRFA 4PM9A 3BW6A 3V39A 4L0LA 1DRMA 3R7WA 2NUPC 2A24A 4KZBA 4Y3IA 2K31A 4ETZA 3O5YA 4OLGA 2GZAA 3BFDA 2Z6CA 3BM6A 3UE3A 3T4LA 4LGWA 1GSXA 1BSGA 4WL9A 4GZBA 3BEBA 2PBDP 3BECA 3ZDJA 3HJKA 3VSLA 2ZL1B 2P08A 3E2KA 1KE0A 5EVLA 3HUMA 5M1AA 3G2YA 3S4XA 3OC2A 3KSIA 3CUEA 3UB6A 1YSQA 2HP5A 4PM7A 1W63M 2EWVA 3AGEA 4RYEA 4IBRA 2JKTI 3T4QA 1JWVA 4LFUA 4Y5FA 4GCZA 4C3QA 5HAIA 3GR2A 1HZOA 1KE3A 1V9ZA 3G32A 3GMWA 5DKLA 3W4PA 5A93A 4KZ5A 1CI9A 4PM8A 1IYOA 2W3FA 4RX3A 3DBAA 3UDIA 1EROA 2VEAA 4Z9QA 3LIDA 3QP2A 1T18A 1D7EA 4ZJ1A 1T1CA 2DMWA 5J3WA 4NXGA 2EFUA 3BFFA 2OSUA 3IH9A 3GSGA 1K38A 2W0NA 3RXXA 4O0PA 5FAOA 2RL3A 4YWZA 3ZG8B 5JYOA 3T50A 5DJUA 3HLFA 2ZLYA 3MBZA 3VOZA 1CI8A 2H0YA 1XJ6A 3F1NA 3E2LA 2VKSA 2IWCA 4X6TA 1A0KA 3FV7A 2WADA 5CXWA 4HIAA 2Z2LB 3EOIA 2HGVA 3HCYA 4R38A 3W4QA 3WS0A 5GLAA 4X1MA 5FEFA 3OPHA 1QMFA 3CI6A 1YKDA 3NOPC 3NDGA 4WN5A 1T1BA 3OBFA 4HJ3A 4I5SA 1Q2QA 4CLCA 5AVEA 3KSHA 1W79A 3OLOA 3NBLA 3C7UA 3IT9A 4E6WA 1F9IA 4WZ4A 2O9BA 3UN7A 1H8MA 5DKKA 1MWRA 1CK3A 2V0UA 1VHMA 2X71A 4P0MA 3LYXA 1NRJA 4R0QA 4UEYA 1PYYA 4XUZA 4LLOB 3H82A 3B33A 1J9MA 5DF7A 1SKFA 2YKFA 3IX8A 1SHVA 3MFDA 4EWFA 4OH0A 3NC8A 1S4SA 1H8YA 3LGOA 2FFFB 4LCLA 1G6AA 4YFMA 4KENB 3MF0A 3H7WA 2VGLS 2ZM0A 3O3VA 4HHDA 5EV0A 1PRQA 3IF6C 3A3FA 1LLBA 3B3XA 5F5YA 1M40A 5FQKA 2WK0A 3C5AA 4K0WA 5TJJA 2L1MA 3UDFA 4F3LA 1YLPA 4OOMA 4QY5A 3NOTC 4IBXA 1E3UA 2PT7A 5EFWA 1PWGA 2R78A 2RCXA 3WRTA 3T4KA 3WS2A 4S2PA 5HDDA 1XFNA 2VV7A 2Z2MB 3ZG7B 4FSFA 1G68A 3P7NA 1CEGA 4C6YA 4ZBEA 5HWVA 2ZM2A 3FKWA 1YPRA 3B47A 1JWPA 2ZQ9A 3FKVA 4EBPA 1YM1A 1ZKJA 1N9LA 4R4RA 5TBMA 1FR1A 3A3IA 5IT5A 2JKRM 4PKYA 1ODVA 3M6HA 3CMZA 3E0YA 3DWKA 3N4IA 1H0MA 3T4OA 4LRYC 3E4PA 4KZ3A 5I5LA 1MPLA 1W63Q 1Y54A 2A2LA 4Y13A 1XA7A 2QMIA 3VV4A 3KO6A 4BENA 1K25A 4DE1A 4O8GA 1ZG4A 3EEAA 4JF5A 1NZUA 4OQHA 3BLSA 3Q7VA 2H0TA 2XK1A 4NEED 3RTYA 1K6RA 2W1RA 4DDYA 1GCEA 2OV5A 3FZCA 4HP9A 4FH4A 4X56A 3DTMA 1K57C 3ZVWA 2A3UA 4DF6A 3K3DA 3M2JA 1PWCA 4RQ9A 2J3TC 5MC7A 3EGXC 4QWOA 2VV6A 3F1NB 2J7VA 4S2IA 3FPVA 4R3AA 3GQZA 3G35A 3ZVTA 2HP6A 5EUAA 3WRZA 1L0FA 4WMCD 5A90A 2PU2A 4BLMA 2PDRA 3CZDA 5EVIC 2JKGA 5CX7A 4P6ZS 3UB7A 4R23A 1IFQA 2HP9A 2NUTC 4HP4A 2JCHA 2A49A 5AJGA 1P0ZA 2BTFP 1GA9A 3NHQA 1XJ3A 5M18A 3ZGAB 1FCMA 4S2JA 1KVMA 1UGUA 1DP9A 1ERQA 2Z6DA 3C2WA 4NG2A 3H82B 3ZFZA 2J80A 3UMEA 2ZOHA 4DKIA 1LL9A 3P98A 4KZ6A 4WYYA 3EQUA 4BBUA 3LIEA 5FQ9A 1NXYA 3NJAA 2P74A 2WGIA 2OLVA 3UB9A 3W8KA 4D2OA 4LV3A 2LB5A 2WZZA 4JGPA 3MZFA 1IOUA 3BY8A 3G34A 4EUZA 4PMAA 5HSQA 3ISGA 4IEDA 4G3WA 1IKGA 3MFXA 3UMDA 4OP8A 2Y2MA 2ACGA 5DTSA 1MZUA 1PZPA 2WZXA 4BL3A 2Y2LA 3A3JA 4JGOA 4KQOA 3NDEA 5C5KA 2G2UA 1IELA 2W3HA 2EXAA 2OLUA 2XH9A 1HLUP 4O7DA 3DW0A 4JF4A 3VMAA 1DJBA 1STZA 2XFSA 4ID4A 2HDSA 3IXHA 5F1GA 2O9AA 3EEHA 4JXWA 1DP6A 4OQ0A 1N9NA 2X01A 2J3TD 4WELA 1XGJA 4N9LA 5F82A 2Q9MA 2C6WB 5L07A 1L3LA 3T4SA 3SS5A 2PAVP 1G5UA 1F2KA 1RP5A 2DNSA 1IEMA 5D3OA 3HUOA 3F1PB 5EVEA 4JXGA 1U60A 1LL5A 4IHQA 4LPZA 4UA6A 4Z1WA 5HAPA 1CEFA 4H6JA 4M3KA 4KUOA 4NXEA 4OOLA 2O99A 5M19A 3SW1A 4E3IA 4HH3A 1MWTA 2Q9NA 5EVID 3Q7VB 2ZMVA 4MN5A 2D02A 4OVDA 2JKTM 3VOLA 3O88A 3PBTA 5BOHA 1L0DA 2Y59A 3NECA 3GTCA 1WYCA 1K54A 3G30A 3U4LP 4YINA 1S0WA 2JE5A 3PBNA 4EV4A 2YKHA 1VB6A 4NXBA 2OOLA 5FAQA 1NYMA 2VGJA 3QP5A 3ITBA 3LR0A 4X68A 4DJ3A 1MWUA 3GVBA 1RGYA 1FOFA 4A5RA 4GKUA 1K4FA 2O0YA 4Y0OA 5IS1A 4HEFA 2EWWA 5HFOA 5HARA 3IX4A 3VOYA 2XSSA 5HDSA 2XFTA 3PHYA 1Z6FA 1ZHHB 1ERMA 5CTMA 5CHUA 1L0GA 4LRXC 2PD8A 3D4FA 2G7UA 5HZHA 2FZ0A 3QP6A 3WS5A 5AQ9A 4OQIA 2OWJA 2ZC5B 4GB7A 3LO7A 4E3NA 3E4OA 3HLEA 1YT4A 2Y2JA 4MDZA 4N1HA 3KYZA 1P9WA 1EWZA 3LI9A 1BLCA 1BUEA 4OPYA 5L10A 3VP3A 4QB8A 4H8RA 4M4XA 4EQ1A 1DY6A 1G28A 3MQQA 4QJGA 5HPIA 4EU0A 1SKOA 4DXBA 3A0VA 3FC7A 1PZOA 1Z09A 5FQJA 4KZAA 4ZJ2A 1MC0A 5CGSA 3VP2A 3UB8A 4HQAA 2V9AA 2W27A 5E2FA 3UB5P 4BMWA 1ES2A 4EQIA 2XF3A 2WKEA 1JVJA 4OONA 4Y17A 3N7WA 2Y4AA 1IYQA 1C3BA 3GV9A 4LV1A 3S7NA 2KX6A 5EECA 4MBKA 3GDIA 1LSWA 4OPQA 3FPWA 5F1FA 2UV0E 2J9PA 2V1BA 4GS9A 3CUEC 3JVVA 5HD5A 5KZHA 3KYQA 2JKFA 2H5SA 4KZ9A 2J3WA 4GJ4A 2VX8A 1YAXA 3GRJA 3N8SA 1TEMA 4GW9A 2EX9A 4WM9A 2XLNA 4MLLA 4WZ5A 2AVXA 3BWLA 1XX2A 3MS6A 4S2LA 4N1XA 2OWHA 2XA7M 3FYZA 5AQAA 4E3JA 4H6JB 1ONGA 3LIAA 1K56A 4L9GA 3G2ZA 1KGFA 4MBFA 1OPXA 1S66L 2IWDA 1JWZA 2WKRA 5CGWA 2L4RA 1JTDA 3ZHHA 3OZHA 1MKIA 4C75A 1XJ4A 3Q07A 4DE0A 5FI7A 4S2NA 2GNXA 2J8YA 2PBYA 2JHEA 2XRNA 1FR6A 1YLYA 4EBLA 4ZAMA 2GDNA 3A0RA 3D3OA 4ZDXA 2Y2NA 1E4DA 1ZC2A 1SDNA 3WS1A 1S6RA 4R3BA 4K08A 3UE6A 4GD6A 2ZMAA 3RFBA 2DRWA 2HDRA 1LT0A 3OPPA 3IWIA 1G6OA 3IWOA 2I72A 3VFFA 5GHXA 2PR5A 2XD5A 4P87A 5FI6A 3UO9A 3VE4A 3MXQA 1J3WA 2P9VB 2R9WA 3DTKA 3ULFA 2H28A 3KX0X 2XROA 4CLCC 2WKQA 1IKIA 3IXGA 4X1LA 2XQZA 2ZOIA 5LBRA 2WGVA 1K55C 2V1ZA 3BLMA 1ALQA 1BT5A 4EUVA 3BY9A 3LY3A 3KSFA 3MKEA 3CJMA 4HNBA 2OAQ1 3S7PA 2E8IA 2QJ7A 1KDSA 4B9OA 3IBRA 3DTEA 3D72A 1SKOB 2XD1A 4G3VA 4UQIM 4BD1A 4JGRA 5I94A 4KG5A 4P85A 3B42A 4S2KA 3QP8A 4I39A 2V1AA 3F1PA 3P09A 1K6SA 2V20A 1DJCA 5GL9A 2WKPA 5DTKA 4LENA 3U2AA 4Y0TA 5EVIA 1BZAA 2V8CA 4CLCE 1ONHA 1XJ2A 4MBHA 3OCLA 4OOYA 4Q8IA 4FOFA 1O07A 3NIAA 3S7OA 1MKMA 3O86A 1WA9A 1TF1A 3V3SA 4U0XA 3T1RA 4I3AA 4PKYG 3HLBA 1VQQA 3UE1A 2QYBA 4OPZA 1QMEA 4ZTKA 4F94A 3CPTA 2B02A 4OKPA 5KMWA 4E6XA 4Y15A 5K5BA 4GS9B 4CQHA 5CHJA 1XXMA 2PR6A 4HOIA 3LEQA 3VSKA 3W4OA 1OTBA 1W8QA 3KYEA 3BQAA 5CERA 4WEJA 1NJ4A 1M6KA 4KG6A 5FDSA 1BLSA 3IF6B 4S2MA 4PAUA 2M7VA 2V2FF 3PYPA 1E25A 1KDWA 2ZC4B 3ZYTA 4U3TA 2BLSA 3DAVA 1HTZA 2W1TB 4FTXA 3TW8A 2J9OA 1SCWA 4WBGA 2PYRA 2WGWA 1PFLA 5A92A 3BJNA 1KGEA 3RJUA 4GLQA 5FI2A 1VM1A 2VGKA 1JNUA 1OTAA 4B88A 1TS8A 5GHZA 4NXFA 4GNUA 4FUWA 4CLCD 4RVAA 1YMXA 2BG1A 1F5MA 2W3GA 4DMZA 1OJ5A 3HUNA 1T1AA 1ZG6A 3PAEA 1LHYA 5EE8A 4B93A 4UA7A 2INWA 4MMNA 4AFIA 4DRTA 1P9RA 5HAQA 1CF0A 2B18A 4XT2B 2R9XA 2VZWA 4NK3A 5HWTA 4K0XA 2P04A 2UWXA 1UWNX 5HDCA 1YSPA 2M7UA 1LSXA 4MEZA 1XP4A 2CMNA 5EOOA 2Y2PA 4OPRA 1D1JA 3SH9A 1GA0A 4PM6A 5G4ZA 3T4TA 1I2SA 3OPRA 4DE3A 2D01A 2Q0OA 2ZQCA 4EEUA 4EERA 4HBTA 3LICA 4X69A 1TVFA 1LL8A 5J4EA 3QNCA 2ZQDA 1EI5A 3N8LA 1FSYA 1VETB 2HZ5A 3QP4A 1DJAA 4LV2A 5CEBA 3R4KA 3BFEA 2ZD8A 1X0OA 4YNRA 1PI4A 4FCFA 2ZM8A 5HD3A 5L8MA 3OCNA 1LI9A 1YQSA 4X53A 2EA9A 3HLDA 5EVIB 5DTTA 5A91A 5KIZA 3TJZC 2I9VA 1CQAA 1Q2PA 4JLFA 1W5DA 2EXBA 1XFQA 5TR7A 1FQGA 2QZ6A 2HV1A 2VA0A 1FILA 2Y91A 1NY0A 3S7QA 2QHKA 4R70A 3L7HA 3VP4A 1NWZA 5EOEA 4WEKA 1TS0A 3CPTB 2HJ9C 2EX2A 5FSRA 3IX3A 1L0EA 2XGNA 3HLGA 4CJNA 2ZQ7A 3T4JA 3HLCA 3BYDA 3LI8A 1NZOA 4KZ8A 4IJGA 1EW0A 3LR5A 3V50A 2XEPA 3LIFA 2ZQ8A 2PHYA 3LFVA 3UE0A 1OTDA 2X02A 2WUQA 3LUQA 3KSGA 4EETB 2QJ5A 3NCKA 3ZNYA 5L2FA 2P9VA 4BL2A 4MN7A 2EX6A 5G4YA 1H5XA 3CG5A 1F98A 1FCOA 1PI5A 2MJ6A 2QPNA 4UAAA 3ZG5A 4QD4A 5F6AA 3PXPA 5HWWA 3NULA 2WGWB 2WAFA 4DJ2A 1OMEA 3G6OA 5J8XA 2BASA 3IS2A 1PNEA 4LCMA 4OQGA 2M1CA 3JYIA 3QNBA 2ZC7A 3HLWA 2IWBA 3PBQA 3LY4A 4L9EA 4HI4A 4KZ4A 3NY4A 1JTGA 2LB9A 1FCNA 4ESPA 1K54C 1BULA 3UPPA 2KDKA 4Q0HA 4II7A 5E2EA 3AGDA 3N8RA 3Q82A 3T12B 4ARZA 1I5QA 1VEUA 3TE8A 5J7EA 5GLCA 1TD5A 2H10A 2C5WB 2GJ3A 4Q0JA 3V67A 3TSGA 3JPUA 4KQDA 1GHMA 3C4PA 4HBUA 4IVKA 1LI0A 3F1OB 4IUHA 2B5RA 1RGZA 5DF9A 4E3OA 3Q1FA 3VP1A 4WLAA 1BLHA 1PW8A 5KSHA 3ZCZA 4R6LA 2K2NA 4R4SA 4RA7A 3E4QA 5F68A 4Q0IA 1T19A 1BYWA 1K0KA 3FWLA 1KVLA 3MZDA 2WKIA 1YLJA 3NI9A 2KLIA 2OAP1 1NLZA 3JVUA 1KOUA 1YLTA 3IQAA 2CC1A 1LSVA 4WMCA 2VK3A 2FFYA 4KZ7A 3QP1A 2XA7S 5CRFA 3G4PA 5IHVA 1OT9A 2Y2QA 3BFGA 4G3KA 4ME4A 4B4ZA 4MCWA 3IF6A 3ITAA 4ZJ3A 2ZBBA 4LRZE 2L0WA 4E04A 1DP8A 5FA7A 3A3EA 3V3RA 5AQ7A 2W1TA 5E2GA 4QU3A 2JC7A 4DDSA 2XR0A 3LR4A 1HD8A 4GOGA 1TS6A 4YOFA 1GHPA 2PD7A 1ES5A 3LIBA 4JF6A 3MXSA 4GHIA 4PHTA 5DFYA 5HW3A 3IXDA 3UDXA 1TDGA 1PIOA 5FASA 5CEDA 4R1GA 1SDEA 5EPHA 1K55A 1Y4OA 4KG2A 4L9FA 2E8JA 4JPMA 1ES4A 3N6IA 4WUJA 3MSHA 4I3JA 3D9YA 4PM5A 4XT2A 2W3DA 1NLYA 1YLWA 3PBSA 1XGIA 3K2NA 4QPRA 1OTEA 2GX5A 3CITA 3Q7ZA 4WZ5C 3MKFA 1MY8A 5AQBA 3IF5A 2ZC3B 3R7WB 4K91A 5U47A 2A24B 1W7FA 4UA9A 2PU4A 1ACFA 3RXWA 2Y2OA 5G18A 2VGLM 4S2OA 3S1YA 4ETXA 2JBFA 4MNRA 2HDUA 4UQIS 3MJQA 5CHMA 1K57A 1N4OA 3IS2B 4D60A 1N9BA 3FG8A 4BJPA 1SZVA 3SH7A 1K4EA 3MXRA 5JYPA 5CGXA 3MZEA 4S2NC 2Y2IA 3OPLA 5TGFA 3ZQ5A 3O87A 1AXBA 1XPBA 1UWPX 1VETA 2P7JA 3S22A 4O01A 2JN7A 4WF0A 5DJTA 1D06A 1AWIA 3C8CA 5FQQA 5DFXA 4U0TA 4N92A 4E3KA 4ARZB 1VEUB 2Y2KA 1MBLA 3C7VA 3ZG9B 3V5MA 1GHIA 5KSCA 3T1QB 5FQIA 1BTLA 4FH2A 3L9KA 4Y7PA 5TFQA 4R3JA 4JBFA 2B95A 5HX9A 3HL9A 1N9OA 1KGGA 4E3MA 1WE4A 3PR6A 4RX2A 3VFHA 4BBVA 3UNWA 2HJEA 4HY8A 3ICYA 3ZNTA 1BLPA 2PYPA 3LCEA 2DCFA 5E2HA 1YLZA 4UHUA 3UPNA 2IA2A 1IYPA 3H9WA 3CLOA 3VE3A 3MMHA 1ZTUA 2ZC6B 3T1SA 1IYSA 5GHYA 3IBJA 3UY6A 1OTIA 3LEZA 3CAXA 3W2ZA 4P6BA 2FH5A 1HVBA 5FQMA 2Y2HA 3LR3A 2V8FA 2QWSA 1ESIA 1L2SA 3IH8A 4OLDA 5E43A 5F69A 2JKRI 1PW1A 3E98A 3IWQA 3CWFA 1ES3A 1XA1A 5GLDA 3QHYA 2VLGA 1KE4A 3CHWP 3PTEA 1YMSA 2ZMFA 4IUKA 5A8BA 1WYBA 1H3QA 1OJGA 4LV0A 3PBOA 4NKPA 4ZRRA 2ZL1A 3VP0A 4DN0A 2W3EA 4GHIB 4JXSA 4GD8A 4CLCB 4BBTA 5CECA 4B4XA 1K56D 3NOUC 2VJWA 3SZTA 3HBRA 4P6ZM 3SOIA 3M2KA 3IHAA 3DTIA 4NETA 3P01A 4KUKA 3DWZA 2WYXA 3PBRA 3RH8B 1W8YA 4JKTA 5DF8A 2K7SA 4I3IA 2HPBA 4DXCA 3ZG0A 3SH8A 5GLBA 4HESA 2KOIA 3K3CA 4I38A 2EX8A 1GSVA 4FD8A 4GDBA 3Q81A 5FDHA 5AVFA 4MN6A 1GSWA 3HREA 3F1OA 3H7WB 2XDMA 5HPFA 3PAGA 5L09A 2PRFA 1MXOA 3BQ8A 4X25A 1MWSA 1S1YA 4QHCA 1FIKA 1TDLA 3HJIA 3WS4A 3C30A 2HF6A 3T1XA 3BRMA 4CPKA 4F3LB 5FEGA 3EQVA 1P97A 5F83A 2WKHA 1H8ZA 2HDQA 1E3UD 3MQ0A 3C38A 3TG9A 3EWKA 2QKPA 1S67L 3HVFA 4IVIA 1NYYA 5DVAA 2Y55A 2ZQAA 4X55A 1TS7A 1FSWA 3WWXA 4KQQA 3IXBA 3I7JA 5TBMB 4HH2A 3SS3A 4PPRA 4Y2FA 4BD0A 1I2WA 3MQOA 1S4RA 4QY6A 2G2WA 4N9KA 2Y79A 3MR0A 1V9YA 4Y0UA 3IHBA 4XXRA 3EGDC 5FAPA 5FL3A 3TRCA 5EM0A 5CTNA 5IU1A 4BQMA 3M6BA 4EESA 4EBNA 5HL1A 1S1ZA 4GN2A 3C4OA 1CJFA 4HJ4A 4EW7A 4JXVA 3SS4A 2VV8A 3OOVA 4E3LA 3GECA 3BFCA 4HJ6A 5EM1A 2Y8HA 2V0WA 2O9CA 2ZJ9A 2WAEA 4BWIA 1ESUA 1O7EA
chains in the Genus database with same CATH topology
3H82B 1LSVA 2J80A 3KSFA 2XA7S 3UMEA 2ZOHA 4HNBA 2OAQ1 4JGQA 1OT6A 3S7PA 5HL6A 2QJ7A 1OT9A 4B9OA 3IBRA 3EQUA 4G3KA 3D72A 4EXOA 4BBUA 1Y28A 4G3VA 4UQIM 3LIEA 4ME4A 3NJAA 4JGRA 4MCWA 4EEPA 3A0SA 3B42A 4I39A 2V1AA 2ZBBA 3BW6A 3F1PA 4LRZE 4L0LA 2L0WA 4E04A 1DP8A 1DRMA 3UB9A 3R7WA 2WKPA 3U2AA 2NUPC 2A24A 2LB5A 4Y3IA 2K31A 4ETZA 2W1TA 3O5YA 4JGPA 1IOUA 4CLCE 3BY8A 1XJ2A 2GZAA 2Z6CA 3UE3A 3OCLA 3T4LA 5HSQA 3LR4A 1GSXA 4FOFA 4G3WA 1TS6A 3MFXA 4WL9A 3UMDA 3S7OA 1MKMA 4YOFA 1MZUA 1WA9A 2PD7A 1TF1A 3LIBA 3HJKA 4GHIA 4PHTA 5DFYA 2P08A 4JGOA 4KQOA 4I3AA 4PKYG 5C5KA 2QYBA 2W3HA 3OC2A 3KSIA 3CUEA 2B02A 1YSQA 3UB6A 1W63M 5K5BA 4L9FA 2EWVA 4GS9B 4CQHA 1STZA 2PR6A 2JKTI 4HOIA 3T4QA 4WUJA 2O9AA 4I3JA 3EEHA 1OTBA 1DP6A 4Y5FA 4GCZA 4XT2A 2W3DA 1N9NA 1NLYA 3BQAA 2J3TD 4WELA 4WEJA 1V9ZA 5DKLA 3PBSA 3K2NA 4QPRA 3T4SA 1OTEA 2GX5A 2W3FA 3CITA 4PAUA 2M7VA 3PYPA 3F1PB 3DBAA 4IHQA 4Z1WA 4LPZA 2VEAA 4H6JA 3R7WB 3ZYTA 3LIDA 4KUOA 2A24B 4NXEA 1T18A 1D7EA 4OOLA 2O99A 2W1TB 3TW8A 3SW1A 1T1CA 4HH3A 2DMWA 5J3WA 2VGLM 2ZMVA 2PYRA 4MN5A 2D02A 3BJNA 4ETXA 4NXGA 4GLQA 2JKTM 3VOLA 3PBTA 4UQIS 3MJQA 1JNUA 3IS2B 1OTAA 2W0NA 3FG8A 4O0PA 4BJPA 1TS8A 4NXFA 3ZQ5A 4YWZA 4CLCD 3T50A 1UWPX 2P7JA 4O01A 2JN7A 5DJUA 1F5MA 2W3GA 4DMZA 1OJ5A 4WF0A 3PBNA 1T1AA 5DJTA 1D06A 1XJ6A 2YKHA 3C8CA 4B93A 3F1NA 5DFXA 1VB6A 2VKSA 4NXBA 2INWA 2OOLA 4MMNA 4ARZB 4HIAA 4AFIA 3LR0A 1P9RA 3EOIA 4DJ3A 2HGVA 3HCYA 2B18A 4XT2B 2VZWA 4R38A 2O0YA 5HWTA 5IS1A 2P04A 2EWWA 1UWNX 2XSSA 3CI6A 1YKDA 5HDSA 3PHYA 3NOPC 5HDCA 1YSPA 1ZHHB 2M7UA 4WN5A 1LSXA 1T1BA 1N9OA 3OBFA 4LRXC 2PD8A 4HJ3A 2G7UA 5HZHA 2CMNA 3PR6A 2FZ0A 4BBVA 2HJEA 4I5SA 4CLCA 4HY8A 5AVEA 3KSHA 3ICYA 3OLOA 2OWJA 1F9IA 5G4ZA 2O9BA 2PYPA 1H8MA 5DKKA 3T4TA 2V0UA 1VHMA 3LYXA 3E4OA 1NRJA 2D01A 2IA2A 4EEUA 4MDZA 4EERA 3KYZA 3H9WA 1P9WA 4UEYA 3LICA 3LI9A 4LLOB 3CLOA 3H82A 3B33A 1LL8A 3VE3A 5J4EA 2YKFA 3MMHA 1ZTUA 4M4XA 4EQ1A 1S4SA 3IBJA 1OTIA 1G28A 3CAXA 3MQQA 3W2ZA 5HPIA 4EU0A 3R4KA 2FH5A 3A0VA 3FC7A 3MF0A 3H7WA 2VGLS 1X0OA 4YNRA 4HHDA 5HD3A 3LR3A 2QWSA 5L8MA 3OCNA 1MC0A 5F5YA 2EA9A 5F69A 2JKRI 5TJJA 2L1MA 5KIZA 3UB8A 4F3LA 3E98A 3TJZC 2I9VA 4HQAA 4OOMA 3CWFA 2V9AA 3NOTC 2W27A 2VLGA 1XFQA 2PT7A 5EFWA 2R78A 2ZMFA 2HV1A 4IUKA 4BMWA 5A8BA 3T4KA 2VA0A 1H3QA 1OJGA 3PBOA 5HDDA 4NKPA 1XFNA 2VV7A 4ZRRA 3S7QA 4DN0A 2W3EA 4GHIB 4FSFA 2QHKA 4R70A 4CLCB 4BBTA 3P7NA 1NWZA 3S7NA 3NOUC 2KX6A 5HWVA 4WEKA 2VJWA 1TS0A 3GDIA 1LSWA 4P6ZM 2HJ9C 3B47A 3FPWA 3P01A 2V1BA 4GS9A 3CUEC 4KUKA 1N9LA 5TBMA 3JVVA 3PBRA 3RH8B 3T4JA 5HD5A 5IT5A 2K7SA 2JKRM 3KYQA 4I3IA 3LI8A 2J3WA 4PKYA 4IJGA 4GJ4A 2VX8A 1ODVA 2KOIA 3K3CA 4I38A 1YAXA 3E0YA 1GSVA 1EW0A 3LR5A 5AVFA 4MN6A 3LIFA 1GSWA 4GW9A 3T4OA 4LRYC 2PHYA 3LFVA 3E4PA 3F1OA 3H7WB 1OTDA 5I5LA 3BWLA 1W63Q 5HPFA 3LUQA 3KSGA 2A2LA 4EETB 2QJ5A 3VV4A 3BQ8A 3KO6A 2OWHA 2XA7M 1S1YA 4MN7A 5G4YA 1F98A 3HJIA 4H6JB 2MJ6A 3LIAA 3C30A 2HF6A 4L9GA 4O8GA 3EEAA 1OPXA 4F3LB 1S66L 5F6AA 3EQVA 1P97A 3PXPA 5HWWA 2WKRA 4NEED 3RTYA 2L4RA 4DJ2A 2W1RA 3G6OA 2BASA 1XJ4A 3IS2A 3MQ0A 3C38A 2M1CA 3EWKA 2GNXA 2QKPA 4HP9A 1S67L 3PBQA 2JHEA 2XRNA 4L9EA 4HI4A 2LB9A 1TS7A 3K3DA 4RQ9A 2J3TC 2KDKA 4Q0HA 4II7A 5MC7A 3EGXC 3A0RA 2VV6A 3F1NB 5TBMB 4HH2A 3FPVA 4R3AA 4ARZA 3D3OA 5J7EA 3TE8A 4Y2FA 1TD5A 2GJ3A 4Q0JA 3MQOA 3V67A 1S4RA 4K08A 3UE6A 4KQDA 3RFBA 2Y79A 1LT0A 3MR0A 1V9YA 2PDRA 1G6OA 3EGDC 3F1OB 5FL3A 3TRCA 5CX7A 2PR5A 4IUHA 4P6ZS 5IU1A 3UB7A 5DF9A 3VE4A 1IFQA 4EESA 3MXQA 4WLAA 5KSHA 2NUTC 4HP4A 4R6LA 1S1ZA 3ULFA 2H28A 2K2NA 3KX0X 2XROA 4HJ4A 5AJGA 4EW7A 1P0ZA 3E4QA 5F68A 4Q0IA 1T19A 1BYWA 4CLCC 2WKQA 2VV8A 3OOVA 3GECA 2KLIA 3NHQA 1XJ3A 2ZOIA 2OAP1 4HJ6A 1NLZA 3JVUA 5LBRA 2Y8HA 1KOUA 2O9CA 2V0WA 4BWIA 1UGUA 1DP9A 2Z6DA 3C2WA 4EUVA 3BY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H82 B;  1LSV A;  2J80 A;  3UME A;  2ZOH A;  4HNB A;  4JGQ A;  1OT6 A;  2QJ7 A;  1OT9 A;  4B9O A;  3IBR A;  3D72 A;  4EXO A;  4BBU A;  1Y28 A;  3LIE A;  3NJA A;  4JGR A;  4EEP A;  3A0S A;  4I39 A;  2V1A A;  2ZBB A;  3F1P A;  4LRZ E;  2L0W A;  4E04 A;  1DP8 A;  1DRM A;  3UB9 A;  2WKP A;  2A24 A;  4JGP A;  3BY8 A;  1XJ2 A;  2Z6C A;  5HSQ A;  1GSX A;  1TS6 A;  3MFX A;  4WL9 A;  3UMD A;  1WA9 A;  1MZU A;  2PD7 A;  3LIB A;  3HJK A;  4GHI A;  4JGO A;  4I3A A;  4PKY G;  2B02 A;  3UB6 A;  4L9F A;  4GS9 B;  2PR6 A;  4HOI A;  4WUJ A;  4I3J A;  3EEH A;  1OTB A;  1DP6 A;  4GCZ A;  4XT2 A;  1N9N A;  1V9Z A;  5DKL A;  1OTE A;  3PYP A;  3F1P B;  4LPZ A;  2VEA A;  4H6J A;  3LID A;  4KUO A;  2A24 B;  4NXE A;  1T18 A;  1D7E A;  3SW1 A;  1T1C A;  4HH3 A;  5J3W A;  2PYR A;  4MN5 A;  2D02 A;  4NXG A;  3VOL A;  3MJQ A;  1JNU A;  3IS2 B;  1OTA A;  2W0N A;  3FG8 A;  1TS8 A;  4NXF A;  3ZQ5 A;  4YWZ A;  3T50 A;  1UWP X;  2P7J A;  2JN7 A;  5DJU A;  1OJ5 A;  4WF0 A;  1T1A A;  5DJT A;  1D06 A;  1XJ6 A;  2YKH A;  3C8C A;  3F1N A;  1VB6 A;  4NXB A;  2INW A;  2OOL A;  4HIA A;  4DJ3 A;  4XT2 B;  4R38 A;  5HWT A;  5IS1 A;  1UWN X;  5HDS A;  3PHY A;  3NOP C;  5HDC A;  4WN5 A;  1LSX A;  1T1B A;  1N9O A;  4LRX C;  2PD8 A;  4HJ3 A;  5HZH A;  2CMN A;  4BBV A;  4I5S A;  4HY8 A;  5AVE A;  3ICY A;  3OLO A;  2OWJ A;  1F9I A;  5G4Z A;  2PYP A;  5DKK A;  2V0U A;  3LYX A;  3E4O A;  2D01 A;  4EEU A;  4EER A;  3H9W A;  3LIC A;  3LI9 A;  4LLO B;  3CLO A;  3H82 A;  3B33 A;  1LL8 A;  3VE3 A;  5J4E A;  2YKF A;  4M4X A;  4EQ1 A;  1S4S A;  1OTI A;  1G28 A;  3CAX A;  3MQQ A;  3A0V A;  3FC7 A;  3H7W A;  1X0O A;  4HHD A;  5HD3 A;  2QWS A;  5F5Y A;  2EA9 A;  5F69 A;  2L1M A;  5KIZ A;  3UB8 A;  4F3L A;  2I9V A;  4HQA A;  3CWF A;  2V9A A;  3NOT C;  2W27 A;  2VLG A;  1XFQ A;  5EFW A;  2R78 A;  2HV1 A;  5A8B A;  1OJG A;  5HDD A;  1XFN A;  2VV7 A;  4GHI B;  2QHK A;  4R70 A;  4BBT A;  3P7N A;  1NWZ A;  3NOU C;  2KX6 A;  5HWV A;  1TS0 A;  3GDI A;  1LSW A;  2V1B A;  4GS9 A;  4KUK A;  1N9L A;  5TBM A;  3RH8 B;  5HD5 A;  2K7S A;  4I3I A;  3LI8 A;  4PKY A;  1ODV A;  3K3C A;  4I38 A;  1GSV A;  1EW0 A;  5AVF A;  4MN6 A;  3LIF A;  1GSW A;  4GW9 A;  4LRY C;  2PHY A;  3E4P A;  3F1O A;  3H7W B;  1OTD A;  5I5L A;  3BWL A;  3LUQ A;  4EET B;  2QJ5 A;  2OWH A;  1S1Y A;  5G4Y A;  1F98 A;  3HJI A;  4H6J B;  3LIA A;  4L9G A;  4F3L B;  1S66 L;  5F6A A;  1P97 A;  5HWW A;  2WKR A;  3RTY A;  2L4R A;  4DJ2 A;  3G6O A;  2BAS A;  1XJ4 A;  3IS2 A;  2M1C A;  3EWK A;  2QKP A;  4HP9 A;  1S67 L;  2JHE A;  4L9E A;  4HI4 A;  1TS7 A;  3K3D A;  4RQ9 A;  2KDK A;  3A0R A;  2VV6 A;  3F1N B;  5TBM B;  4HH2 A;  4R3A A;  5J7E A;  2GJ3 A;  3MQO A;  1S4R A;  4K08 A;  3UE6 A;  4KQD A;  1LT0 A;  3MR0 A;  1V9Y A;  2PDR A;  3F1O B;  2PR5 A;  5IU1 A;  3UB7 A;  3VE4 A;  4EES A;  3MXQ A;  4WLA A;  4HP4 A;  4R6L A;  1S1Z A;  3ULF A;  2H28 A;  3KX0 X;  4HJ4 A;  4EW7 A;  1P0Z A;  3E4Q A;  5F68 A;  1T19 A;  1BYW A;  2WKQ A;  2VV8 A;  3GEC A;  3NHQ A;  1XJ3 A;  2ZOI A;  4HJ6 A;  1KOU A;  2V0W A;  1UGU A;  1DP9 A;  2Z6D A;  3C2W A;  3BY9 A; 
#chains in the Genus database with same CATH topology
 2Y2G A;  3AGF A;  4JGQ A;  1PWD A;  1OT6 A;  4KQR A;  1XKZ A;  5HL6 A;  4DE2 A;  5FAT A;  4XUX A;  3A3D A;  4OP5 A;  3TOI A;  4EXO A;  1Y28 A;  3G31 A;  2EFX A;  4EEP A;  3A0S A;  1RCJ A;  3UPO A;  4GDN A;  1NRF A;  4PM9 A;  3BW6 A;  3V39 A;  4L0L A;  1DRM A;  3R7W A;  2NUP C;  2A24 A;  4KZB A;  4Y3I A;  2K31 A;  4ETZ A;  3O5Y A;  4OLG A;  2GZA A;  3BFD A;  2Z6C A;  3BM6 A;  3UE3 A;  3T4L A;  4LGW A;  1GSX A;  1BSG A;  4WL9 A;  4GZB A;  3BEB A;  2PBD P;  3BEC A;  3ZDJ A;  3HJK A;  3VSL A;  2ZL1 B;  2P08 A;  3E2K A;  1KE0 A;  5EVL A;  3HUM A;  5M1A A;  3G2Y A;  3S4X A;  3OC2 A;  3KSI A;  3CUE A;  3UB6 A;  1YSQ A;  2HP5 A;  4PM7 A;  1W63 M;  2EWV A;  3AGE A;  4RYE A;  4IBR A;  2JKT I;  3T4Q A;  1JWV A;  4LFU A;  4Y5F A;  4GCZ A;  4C3Q A;  5HAI A;  3GR2 A;  1HZO A;  1KE3 A;  1V9Z A;  3G32 A;  3GMW A;  5DKL A;  3W4P A;  5A93 A;  4KZ5 A;  1CI9 A;  4PM8 A;  1IYO A;  2W3F A;  4RX3 A;  3DBA A;  3UDI A;  1ERO A;  2VEA A;  4Z9Q A;  3LID A;  3QP2 A;  1T18 A;  1D7E A;  4ZJ1 A;  1T1C A;  2DMW A;  5J3W A;  4NXG A;  2EFU A;  3BFF A;  2OSU A;  3IH9 A;  3GSG A;  1K38 A;  2W0N A;  3RXX A;  4O0P A;  5FAO A;  2RL3 A;  4YWZ A;  3ZG8 B;  5JYO A;  3T50 A;  5DJU A;  3HLF A;  2ZLY A;  3MBZ A;  3VOZ A;  1CI8 A;  2H0Y A;  1XJ6 A;  3F1N A;  3E2L A;  2VKS A;  2IWC A;  4X6T A;  1A0K A;  3FV7 A;  2WAD A;  5CXW A;  4HIA A;  2Z2L B;  3EOI A;  2HGV A;  3HCY A;  4R38 A;  3W4Q A;  3WS0 A;  5GLA A;  4X1M A;  5FEF A;  3OPH A;  1QMF A;  3CI6 A;  1YKD A;  3NOP C;  3NDG A;  4WN5 A;  1T1B A;  3OBF A;  4HJ3 A;  4I5S A;  1Q2Q A;  4CLC A;  5AVE A;  3KSH A;  1W79 A;  3OLO A;  3NBL A;  3C7U A;  3IT9 A;  4E6W A;  1F9I A;  4WZ4 A;  2O9B A;  3UN7 A;  1H8M A;  5DKK A;  1MWR A;  1CK3 A;  2V0U A;  1VHM A;  2X71 A;  4P0M A;  3LYX A;  1NRJ A;  4R0Q A;  4UEY A;  1PYY A;  4XUZ A;  4LLO B;  3H82 A;  3B33 A;  1J9M A;  5DF7 A;  1SKF A;  2YKF A;  3IX8 A;  1SHV A;  3MFD A;  4EWF A;  4OH0 A;  3NC8 A;  1S4S A;  1H8Y A;  3LGO A;  2FFF B;  4LCL A;  1G6A A;  4YFM A;  4KEN B;  3MF0 A;  3H7W A;  2VGL S;  2ZM0 A;  3O3V A;  4HHD A;  5EV0 A;  1PRQ A;  3IF6 C;  3A3F A;  1LLB A;  3B3X A;  5F5Y A;  1M40 A;  5FQK A;  2WK0 A;  3C5A A;  4K0W A;  5TJJ A;  2L1M A;  3UDF A;  4F3L A;  1YLP A;  4OOM A;  4QY5 A;  3NOT C;  4IBX A;  1E3U A;  2PT7 A;  5EFW A;  1PWG A;  2R78 A;  2RCX A;  3WRT A;  3T4K A;  3WS2 A;  4S2P A;  5HDD A;  1XFN A;  2VV7 A;  2Z2M B;  3ZG7 B;  4FSF A;  1G68 A;  3P7N A;  1CEG A;  4C6Y A;  4ZBE A;  5HWV A;  2ZM2 A;  3FKW A;  1YPR A;  3B47 A;  1JWP A;  2ZQ9 A;  3FKV A;  4EBP A;  1YM1 A;  1ZKJ A;  1N9L A;  4R4R A;  5TBM A;  1FR1 A;  3A3I A;  5IT5 A;  2JKR M;  4PKY A;  1ODV A;  3M6H A;  3CMZ A;  3E0Y A;  3DWK A;  3N4I A;  1H0M A;  3T4O A;  4LRY C;  3E4P A;  4KZ3 A;  5I5L A;  1MPL A;  1W63 Q;  1Y54 A;  2A2L A;  4Y13 A;  1XA7 A;  2QMI A;  3VV4 A;  3KO6 A;  4BEN A;  1K25 A;  4DE1 A;  4O8G A;  1ZG4 A;  3EEA A;  4JF5 A;  1NZU A;  4OQH A;  3BLS A;  3Q7V A;  2H0T A;  2XK1 A;  4NEE D;  3RTY A;  1K6R A;  2W1R A;  4DDY A;  1GCE A;  2OV5 A;  3FZC A;  4HP9 A;  4FH4 A;  4X56 A;  3DTM A;  1K57 C;  3ZVW A;  2A3U A;  4DF6 A;  3K3D A;  3M2J A;  1PWC A;  4RQ9 A;  2J3T C;  5MC7 A;  3EGX C;  4QWO A;  2VV6 A;  3F1N B;  2J7V A;  4S2I A;  3FPV A;  4R3A A;  3GQZ A;  3G35 A;  3ZVT A;  2HP6 A;  5EUA A;  3WRZ A;  1L0F A;  4WMC D;  5A90 A;  2PU2 A;  4BLM A;  2PDR A;  3CZD A;  5EVI C;  2JKG A;  5CX7 A;  4P6Z S;  3UB7 A;  4R23 A;  1IFQ A;  2HP9 A;  2NUT C;  4HP4 A;  2JCH A;  2A49 A;  5AJG A;  1P0Z A;  2BTF P;  1GA9 A;  3NHQ A;  1XJ3 A;  5M18 A;  3ZGA B;  1FCM A;  4S2J A;  1KVM A;  1UGU A;  1DP9 A;  1ERQ A;  2Z6D A;  3C2W A;  4NG2 A;  3H82 B;  3ZFZ A;  2J80 A;  3UME A;  2ZOH A;  4DKI A;  1LL9 A;  3P98 A;  4KZ6 A;  4WYY A;  3EQU A;  4BBU A;  3LIE A;  5FQ9 A;  1NXY A;  3NJA A;  2P74 A;  2WGI A;  2OLV A;  3UB9 A;  3W8K A;  4D2O A;  4LV3 A;  2LB5 A;  2WZZ A;  4JGP A;  3MZF A;  1IOU A;  3BY8 A;  3G34 A;  4EUZ A;  4PMA A;  5HSQ A;  3ISG A;  4IED A;  4G3W A;  1IKG A;  3MFX A;  3UMD A;  4OP8 A;  2Y2M A;  2ACG A;  5DTS A;  1MZU A;  1PZP A;  2WZX A;  4BL3 A;  2Y2L A;  3A3J A;  4JGO A;  4KQO A;  3NDE A;  5C5K A;  2G2U A;  1IEL A;  2W3H A;  2EXA A;  2OLU A;  2XH9 A;  1HLU P;  4O7D A;  3DW0 A;  4JF4 A;  3VMA A;  1DJB A;  1STZ A;  2XFS A;  4ID4 A;  2HDS A;  3IXH A;  5F1G A;  2O9A A;  3EEH A;  4JXW A;  1DP6 A;  4OQ0 A;  1N9N A;  2X01 A;  2J3T D;  4WEL A;  1XGJ A;  4N9L A;  5F82 A;  2Q9M A;  2C6W B;  5L07 A;  1L3L A;  3T4S A;  3SS5 A;  2PAV P;  1G5U A;  1F2K A;  1RP5 A;  2DNS A;  1IEM A;  5D3O A;  3HUO A;  3F1P B;  5EVE A;  4JXG A;  1U60 A;  1LL5 A;  4IHQ A;  4LPZ A;  4UA6 A;  4Z1W A;  5HAP A;  1CEF A;  4H6J A;  4M3K A;  4KUO A;  4NXE A;  4OOL A;  2O99 A;  5M19 A;  3SW1 A;  4E3I A;  4HH3 A;  1MWT A;  2Q9N A;  5EVI D;  3Q7V B;  2ZMV A;  4MN5 A;  2D02 A;  4OVD A;  2JKT M;  3VOL A;  3O88 A;  3PBT A;  5BOH A;  1L0D A;  2Y59 A;  3NEC A;  3GTC A;  1WYC A;  1K54 A;  3G30 A;  3U4L P;  4YIN A;  1S0W A;  2JE5 A;  3PBN A;  4EV4 A;  2YKH A;  1VB6 A;  4NXB A;  2OOL A;  5FAQ A;  1NYM A;  2VGJ A;  3QP5 A;  3ITB A;  3LR0 A;  4X68 A;  4DJ3 A;  1MWU A;  3GVB A;  1RGY A;  1FOF A;  4A5R A;  4GKU A;  1K4F A;  2O0Y A;  4Y0O A;  5IS1 A;  4HEF A;  2EWW A;  5HFO A;  5HAR A;  3IX4 A;  3VOY A;  2XSS A;  5HDS A;  2XFT A;  3PHY A;  1Z6F A;  1ZHH B;  1ERM A;  5CTM A;  5CHU A;  1L0G A;  4LRX C;  2PD8 A;  3D4F A;  2G7U A;  5HZH A;  2FZ0 A;  3QP6 A;  3WS5 A;  5AQ9 A;  4OQI A;  2OWJ A;  2ZC5 B;  4GB7 A;  3LO7 A;  4E3N A;  3E4O A;  3HLE A;  1YT4 A;  2Y2J A;  4MDZ A;  4N1H A;  3KYZ A;  1P9W A;  1EWZ A;  3LI9 A;  1BLC A;  1BUE A;  4OPY A;  5L10 A;  3VP3 A;  4QB8 A;  4H8R A;  4M4X A;  4EQ1 A;  1DY6 A;  1G28 A;  3MQQ A;  4QJG A;  5HPI A;  4EU0 A;  1SKO A;  4DXB A;  3A0V A;  3FC7 A;  1PZO A;  1Z09 A;  5FQJ A;  4KZA A;  4ZJ2 A;  1MC0 A;  5CGS A;  3VP2 A;  3UB8 A;  4HQA A;  2V9A A;  2W27 A;  5E2F A;  3UB5 P;  4BMW A;  1ES2 A;  4EQI A;  2XF3 A;  2WKE A;  1JVJ A;  4OON A;  4Y17 A;  3N7W A;  2Y4A A;  1IYQ A;  1C3B A;  3GV9 A;  4LV1 A;  3S7N A;  2KX6 A;  5EEC A;  4MBK A;  3GDI A;  1LSW A;  4OPQ A;  3FPW A;  5F1F A;  2UV0 E;  2J9P A;  2V1B A;  4GS9 A;  3CUE C;  3JVV A;  5HD5 A;  5KZH A;  3KYQ A;  2JKF A;  2H5S A;  4KZ9 A;  2J3W A;  4GJ4 A;  2VX8 A;  1YAX A;  3GRJ A;  3N8S A;  1TEM A;  4GW9 A;  2EX9 A;  4WM9 A;  2XLN A;  4MLL A;  4WZ5 A;  2AVX A;  3BWL A;  1XX2 A;  3MS6 A;  4S2L A;  4N1X A;  2OWH A;  2XA7 M;  3FYZ A;  5AQA A;  4E3J A;  4H6J B;  1ONG A;  3LIA A;  1K56 A;  4L9G A;  3G2Z A;  1KGF A;  4MBF A;  1OPX A;  1S66 L;  2IWD A;  1JWZ A;  2WKR A;  5CGW A;  2L4R A;  1JTD A;  3ZHH A;  3OZH A;  1MKI A;  4C75 A;  1XJ4 A;  3Q07 A;  4DE0 A;  5FI7 A;  4S2N A;  2GNX A;  2J8Y A;  2PBY A;  2JHE A;  2XRN A;  1FR6 A;  1YLY A;  4EBL A;  4ZAM A;  2GDN A;  3A0R A;  3D3O A;  4ZDX A;  2Y2N A;  1E4D A;  1ZC2 A;  1SDN A;  3WS1 A;  1S6R A;  4R3B A;  4K08 A;  3UE6 A;  4GD6 A;  2ZMA A;  3RFB A;  2DRW A;  2HDR A;  1LT0 A;  3OPP A;  3IWI A;  1G6O A;  3IWO A;  2I72 A;  3VFF A;  5GHX A;  2PR5 A;  2XD5 A;  4P87 A;  5FI6 A;  3UO9 A;  3VE4 A;  3MXQ A;  1J3W A;  2P9V B;  2R9W A;  3DTK A;  3ULF A;  2H28 A;  3KX0 X;  2XRO A;  4CLC C;  2WKQ A;  1IKI A;  3IXG A;  4X1L A;  2XQZ A;  2ZOI A;  5LBR A;  2WGV A;  1K55 C;  2V1Z A;  3BLM A;  1ALQ A;  1BT5 A;  4EUV A;  3BY9 A;  3LY3 A;  3KSF A;  3MKE A;  3CJM A;  4HNB A;  2OAQ 1;  3S7P A;  2E8I A;  2QJ7 A;  1KDS A;  4B9O A;  3IBR A;  3DTE A;  3D72 A;  1SKO B;  2XD1 A;  4G3V A;  4UQI M;  4BD1 A;  4JGR A;  5I94 A;  4KG5 A;  4P85 A;  3B42 A;  4S2K A;  3QP8 A;  4I39 A;  2V1A A;  3F1P A;  3P09 A;  1K6S A;  2V20 A;  1DJC A;  5GL9 A;  2WKP A;  5DTK A;  4LEN A;  3U2A A;  4Y0T A;  5EVI A;  1BZA A;  2V8C A;  4CLC E;  1ONH A;  1XJ2 A;  4MBH A;  3OCL A;  4OOY A;  4Q8I A;  4FOF A;  1O07 A;  3NIA A;  3S7O A;  1MKM A;  3O86 A;  1WA9 A;  1TF1 A;  3V3S A;  4U0X A;  3T1R A;  4I3A A;  4PKY G;  3HLB A;  1VQQ A;  3UE1 A;  2QYB A;  4OPZ A;  1QME A;  4ZTK A;  4F94 A;  3CPT A;  2B02 A;  4OKP A;  5KMW A;  4E6X A;  4Y15 A;  5K5B A;  4GS9 B;  4CQH A;  5CHJ A;  1XXM A;  2PR6 A;  4HOI A;  3LEQ A;  3VSK A;  3W4O A;  1OTB A;  1W8Q A;  3KYE A;  3BQA A;  5CER A;  4WEJ A;  1NJ4 A;  1M6K A;  4KG6 A;  5FDS A;  1BLS A;  3IF6 B;  4S2M A;  4PAU A;  2M7V A;  2V2F F;  3PYP A;  1E25 A;  1KDW A;  2ZC4 B;  3ZYT A;  4U3T A;  2BLS A;  3DAV A;  1HTZ A;  2W1T B;  4FTX A;  3TW8 A;  2J9O A;  1SCW A;  4WBG A;  2PYR A;  2WGW A;  1PFL A;  5A92 A;  3BJN A;  1KGE A;  3RJU A;  4GLQ A;  5FI2 A;  1VM1 A;  2VGK A;  1JNU A;  1OTA A;  4B88 A;  1TS8 A;  5GHZ A;  4NXF A;  4GNU A;  4FUW A;  4CLC D;  4RVA A;  1YMX A;  2BG1 A;  1F5M A;  2W3G A;  4DMZ A;  1OJ5 A;  3HUN A;  1T1A A;  1ZG6 A;  3PAE A;  1LHY A;  5EE8 A;  4B93 A;  4UA7 A;  2INW A;  4MMN A;  4AFI A;  4DRT A;  1P9R A;  5HAQ A;  1CF0 A;  2B18 A;  4XT2 B;  2R9X A;  2VZW A;  4NK3 A;  5HWT A;  4K0X A;  2P04 A;  2UWX A;  1UWN X;  5HDC A;  1YSP A;  2M7U A;  1LSX A;  4MEZ A;  1XP4 A;  2CMN A;  5EOO A;  2Y2P A;  4OPR A;  1D1J A;  3SH9 A;  1GA0 A;  4PM6 A;  5G4Z A;  3T4T A;  1I2S A;  3OPR A;  4DE3 A;  2D01 A;  2Q0O A;  2ZQC A;  4EEU A;  4EER A;  4HBT A;  3LIC A;  4X69 A;  1TVF A;  1LL8 A;  5J4E A;  3QNC A;  2ZQD A;  1EI5 A;  3N8L A;  1FSY A;  1VET B;  2HZ5 A;  3QP4 A;  1DJA A;  4LV2 A;  5CEB A;  3R4K A;  3BFE A;  2ZD8 A;  1X0O A;  4YNR A;  1PI4 A;  4FCF A;  2ZM8 A;  5HD3 A;  5L8M A;  3OCN A;  1LI9 A;  1YQS A;  4X53 A;  2EA9 A;  3HLD A;  5EVI B;  5DTT A;  5A91 A;  5KIZ A;  3TJZ C;  2I9V A;  1CQA A;  1Q2P A;  4JLF A;  1W5D A;  2EXB A;  1XFQ A;  5TR7 A;  1FQG A;  2QZ6 A;  2HV1 A;  2VA0 A;  1FIL A;  2Y91 A;  1NY0 A;  3S7Q A;  2QHK A;  4R70 A;  3L7H A;  3VP4 A;  1NWZ A;  5EOE A;  4WEK A;  1TS0 A;  3CPT B;  2HJ9 C;  2EX2 A;  5FSR A;  3IX3 A;  1L0E A;  2XGN A;  3HLG A;  4CJN A;  2ZQ7 A;  3T4J A;  3HLC A;  3BYD A;  3LI8 A;  1NZO A;  4KZ8 A;  4IJG A;  1EW0 A;  3LR5 A;  3V50 A;  2XEP A;  3LIF A;  2ZQ8 A;  2PHY A;  3LFV A;  3UE0 A;  1OTD A;  2X02 A;  2WUQ A;  3LUQ A;  3KSG A;  4EET B;  2QJ5 A;  3NCK A;  3ZNY A;  5L2F A;  2P9V A;  4BL2 A;  4MN7 A;  2EX6 A;  5G4Y A;  1H5X A;  3CG5 A;  1F98 A;  1FCO A;  1PI5 A;  2MJ6 A;  2QPN A;  4UAA A;  3ZG5 A;  4QD4 A;  5F6A A;  3PXP A;  5HWW A;  3NUL A;  2WGW B;  2WAF A;  4DJ2 A;  1OME A;  3G6O A;  5J8X A;  2BAS A;  3IS2 A;  1PNE A;  4LCM A;  4OQG A;  2M1C A;  3JYI A;  3QNB A;  2ZC7 A;  3HLW A;  2IWB A;  3PBQ A;  3LY4 A;  4L9E A;  4HI4 A;  4KZ4 A;  3NY4 A;  1JTG A;  2LB9 A;  1FCN A;  4ESP A;  1K54 C;  1BUL A;  3UPP A;  2KDK A;  4Q0H A;  4II7 A;  5E2E A;  3AGD A;  3N8R A;  3Q82 A;  3T12 B;  4ARZ A;  1I5Q A;  1VEU A;  3TE8 A;  5J7E A;  5GLC A;  1TD5 A;  2H10 A;  2C5W B;  2GJ3 A;  4Q0J A;  3V67 A;  3TSG A;  3JPU A;  4KQD A;  1GHM A;  3C4P A;  4HBU A;  4IVK A;  1LI0 A;  3F1O B;  4IUH A;  2B5R A;  1RGZ A;  5DF9 A;  4E3O A;  3Q1F A;  3VP1 A;  4WLA A;  1BLH A;  1PW8 A;  5KSH A;  3ZCZ A;  4R6L A;  2K2N A;  4R4S A;  4RA7 A;  3E4Q A;  5F68 A;  4Q0I A;  1T19 A;  1BYW A;  1K0K A;  3FWL A;  1KVL A;  3MZD A;  2WKI A;  1YLJ A;  3NI9 A;  2KLI A;  2OAP 1;  1NLZ A;  3JVU A;  1KOU A;  1YLT A;  3IQA A;  2CC1 A;  1LSV A;  4WMC A;  2VK3 A;  2FFY A;  4KZ7 A;  3QP1 A;  2XA7 S;  5CRF A;  3G4P A;  5IHV A;  1OT9 A;  2Y2Q A;  3BFG A;  4G3K A;  4ME4 A;  4B4Z A;  4MCW A;  3IF6 A;  3ITA A;  4ZJ3 A;  2ZBB A;  4LRZ E;  2L0W A;  4E04 A;  1DP8 A;  5FA7 A;  3A3E A;  3V3R A;  5AQ7 A;  2W1T A;  5E2G A;  4QU3 A;  2JC7 A;  4DDS A;  2XR0 A;  3LR4 A;  1HD8 A;  4GOG A;  1TS6 A;  4YOF A;  1GHP A;  2PD7 A;  1ES5 A;  3LIB A;  4JF6 A;  3MXS A;  4GHI A;  4PHT A;  5DFY A;  5HW3 A;  3IXD A;  3UDX A;  1TDG A;  1PIO A;  5FAS A;  5CED A;  4R1G A;  1SDE A;  5EPH A;  1K55 A;  1Y4O A;  4KG2 A;  4L9F A;  2E8J A;  4JPM A;  1ES4 A;  3N6I A;  4WUJ A;  3MSH A;  4I3J A;  3D9Y A;  4PM5 A;  4XT2 A;  2W3D A;  1NLY A;  1YLW A;  3PBS A;  1XGI A;  3K2N A;  4QPR A;  1OTE A;  2GX5 A;  3CIT A;  3Q7Z A;  4WZ5 C;  3MKF A;  1MY8 A;  5AQB A;  3IF5 A;  2ZC3 B;  3R7W B;  4K91 A;  5U47 A;  2A24 B;  1W7F A;  4UA9 A;  2PU4 A;  1ACF A;  3RXW A;  2Y2O A;  5G18 A;  2VGL M;  4S2O A;  3S1Y A;  4ETX A;  2JBF A;  4MNR A;  2HDU A;  4UQI S;  3MJQ A;  5CHM A;  1K57 A;  1N4O A;  3IS2 B;  4D60 A;  1N9B A;  3FG8 A;  4BJP A;  1SZV A;  3SH7 A;  1K4E A;  3MXR A;  5JYP A;  5CGX A;  3MZE A;  4S2N C;  2Y2I A;  3OPL A;  5TGF A;  3ZQ5 A;  3O87 A;  1AXB A;  1XPB A;  1UWP X;  1VET A;  2P7J A;  3S22 A;  4O01 A;  2JN7 A;  4WF0 A;  5DJT A;  1D06 A;  1AWI A;  3C8C A;  5FQQ A;  5DFX A;  4U0T A;  4N92 A;  4E3K A;  4ARZ B;  1VEU B;  2Y2K A;  1MBL A;  3C7V A;  3ZG9 B;  3V5M A;  1GHI A;  5KSC A;  3T1Q B;  5FQI A;  1BTL A;  4FH2 A;  3L9K A;  4Y7P A;  5TFQ A;  4R3J A;  4JBF A;  2B95 A;  5HX9 A;  3HL9 A;  1N9O A;  1KGG A;  4E3M A;  1WE4 A;  3PR6 A;  4RX2 A;  3VFH A;  4BBV A;  3UNW A;  2HJE A;  4HY8 A;  3ICY A;  3ZNT A;  1BLP A;  2PYP A;  3LCE A;  2DCF A;  5E2H A;  1YLZ A;  4UHU A;  3UPN A;  2IA2 A;  1IYP A;  3H9W A;  3CLO A;  3VE3 A;  3MMH A;  1ZTU A;  2ZC6 B;  3T1S A;  1IYS A;  5GHY A;  3IBJ A;  3UY6 A;  1OTI A;  3LEZ A;  3CAX A;  3W2Z A;  4P6B A;  2FH5 A;  1HVB A;  5FQM A;  2Y2H A;  3LR3 A;  2V8F A;  2QWS A;  1ESI A;  1L2S A;  3IH8 A;  4OLD A;  5E43 A;  5F69 A;  2JKR I;  1PW1 A;  3E98 A;  3IWQ A;  3CWF A;  1ES3 A;  1XA1 A;  5GLD A;  3QHY A;  2VLG A;  1KE4 A;  3CHW P;  3PTE A;  1YMS A;  2ZMF A;  4IUK A;  5A8B A;  1WYB A;  1H3Q A;  1OJG A;  4LV0 A;  3PBO A;  4NKP A;  4ZRR A;  2ZL1 A;  3VP0 A;  4DN0 A;  2W3E A;  4GHI B;  4JXS A;  4GD8 A;  4CLC B;  4BBT A;  5CEC A;  4B4X A;  1K56 D;  3NOU C;  2VJW A;  3SZT A;  3HBR A;  4P6Z M;  3SOI A;  3M2K A;  3IHA A;  3DTI A;  4NET A;  3P01 A;  4KUK A;  3DWZ A;  2WYX A;  3PBR A;  3RH8 B;  1W8Y A;  4JKT A;  5DF8 A;  2K7S A;  4I3I A;  2HPB A;  4DXC A;  3ZG0 A;  3SH8 A;  5GLB A;  4HES A;  2KOI A;  3K3C A;  4I38 A;  2EX8 A;  1GSV A;  4FD8 A;  4GDB A;  3Q81 A;  5FDH A;  5AVF A;  4MN6 A;  1GSW A;  3HRE A;  3F1O A;  3H7W B;  2XDM A;  5HPF A;  3PAG A;  5L09 A;  2PRF A;  1MXO A;  3BQ8 A;  4X25 A;  1MWS A;  1S1Y A;  4QHC A;  1FIK A;  1TDL A;  3HJI A;  3WS4 A;  3C30 A;  2HF6 A;  3T1X A;  3BRM A;  4CPK A;  4F3L B;  5FEG A;  3EQV A;  1P97 A;  5F83 A;  2WKH A;  1H8Z A;  2HDQ A;  1E3U D;  3MQ0 A;  3C38 A;  3TG9 A;  3EWK A;  2QKP A;  1S67 L;  3HVF A;  4IVI A;  1NYY A;  5DVA A;  2Y55 A;  2ZQA A;  4X55 A;  1TS7 A;  1FSW A;  3WWX A;  4KQQ A;  3IXB A;  3I7J A;  5TBM B;  4HH2 A;  3SS3 A;  4PPR A;  4Y2F A;  4BD0 A;  1I2W A;  3MQO A;  1S4R A;  4QY6 A;  2G2W A;  4N9K A;  2Y79 A;  3MR0 A;  1V9Y A;  4Y0U A;  3IHB A;  4XXR A;  3EGD C;  5FAP A;  5FL3 A;  3TRC A;  5EM0 A;  5CTN A;  5IU1 A;  4BQM A;  3M6B A;  4EES A;  4EBN A;  5HL1 A;  1S1Z A;  4GN2 A;  3C4O A;  1CJF A;  4HJ4 A;  4EW7 A;  4JXV A;  3SS4 A;  2VV8 A;  3OOV A;  4E3L A;  3GEC A;  3BFC A;  4HJ6 A;  5EM1 A;  2Y8H A;  2V0W A;  2O9C A;  2ZJ9 A;  2WAE A;  4BWI A;  1ESU A;  1O7E A; 
#chains in the Genus database with same CATH homology
 3H82 B;  1LSV A;  2J80 A;  3KSF A;  2XA7 S;  3UME A;  2ZOH A;  4HNB A;  2OAQ 1;  4JGQ A;  1OT6 A;  3S7P A;  5HL6 A;  2QJ7 A;  1OT9 A;  4B9O A;  3IBR A;  3EQU A;  4G3K A;  3D72 A;  4EXO A;  4BBU A;  1Y28 A;  4G3V A;  4UQI M;  3LIE A;  4ME4 A;  3NJA A;  4JGR A;  4MCW A;  4EEP A;  3A0S A;  3B42 A;  4I39 A;  2V1A A;  2ZBB A;  3BW6 A;  3F1P A;  4LRZ E;  4L0L A;  2L0W A;  4E04 A;  1DP8 A;  1DRM A;  3UB9 A;  3R7W A;  2WKP A;  3U2A A;  2NUP C;  2A24 A;  2LB5 A;  4Y3I A;  2K31 A;  4ETZ A;  2W1T A;  3O5Y A;  4JGP A;  1IOU A;  4CLC E;  3BY8 A;  1XJ2 A;  2GZA A;  2Z6C A;  3UE3 A;  3OCL A;  3T4L A;  5HSQ A;  3LR4 A;  1GSX A;  4FOF A;  4G3W A;  1TS6 A;  3MFX A;  4WL9 A;  3UMD A;  3S7O A;  1MKM A;  4YOF A;  1MZU A;  1WA9 A;  2PD7 A;  1TF1 A;  3LIB A;  3HJK A;  4GHI A;  4PHT A;  5DFY A;  2P08 A;  4JGO A;  4KQO A;  4I3A A;  4PKY G;  5C5K A;  2QYB A;  2W3H A;  3OC2 A;  3KSI A;  3CUE A;  2B02 A;  1YSQ A;  3UB6 A;  1W63 M;  5K5B A;  4L9F A;  2EWV A;  4GS9 B;  4CQH A;  1STZ A;  2PR6 A;  2JKT I;  4HOI A;  3T4Q A;  4WUJ A;  2O9A A;  4I3J A;  3EEH A;  1OTB A;  1DP6 A;  4Y5F A;  4GCZ A;  4XT2 A;  2W3D A;  1N9N A;  1NLY A;  3BQA A;  2J3T D;  4WEL A;  4WEJ A;  1V9Z A;  5DKL A;  3PBS A;  3K2N A;  4QPR A;  3T4S A;  1OTE A;  2GX5 A;  2W3F A;  3CIT A;  4PAU A;  2M7V A;  3PYP A;  3F1P B;  3DBA A;  4IHQ A;  4Z1W A;  4LPZ A;  2VEA A;  4H6J A;  3R7W B;  3ZYT A;  3LID A;  4KUO A;  2A24 B;  4NXE A;  1T18 A;  1D7E A;  4OOL A;  2O99 A;  2W1T B;  3TW8 A;  3SW1 A;  1T1C A;  4HH3 A;  2DMW A;  5J3W A;  2VGL M;  2ZMV A;  2PYR A;  4MN5 A;  2D02 A;  3BJN A;  4ETX A;  4NXG A;  4GLQ A;  2JKT M;  3VOL A;  3PBT A;  4UQI S;  3MJQ A;  1JNU A;  3IS2 B;  1OTA A;  2W0N A;  3FG8 A;  4O0P A;  4BJP A;  1TS8 A;  4NXF A;  3ZQ5 A;  4YWZ A;  4CLC D;  3T50 A;  1UWP X;  2P7J A;  4O01 A;  2JN7 A;  5DJU A;  1F5M A;  2W3G A;  4DMZ A;  1OJ5 A;  4WF0 A;  3PBN A;  1T1A A;  5DJT A;  1D06 A;  1XJ6 A;  2YKH A;  3C8C A;  4B93 A;  3F1N A;  5DFX A;  1VB6 A;  2VKS A;  4NXB A;  2INW A;  2OOL A;  4MMN A;  4ARZ B;  4HIA A;  4AFI A;  3LR0 A;  1P9R A;  3EOI A;  4DJ3 A;  2HGV A;  3HCY A;  2B18 A;  4XT2 B;  2VZW A;  4R38 A;  2O0Y A;  5HWT A;  5IS1 A;  2P04 A;  2EWW A;  1UWN X;  2XSS A;  3CI6 A;  1YKD A;  5HDS A;  3PHY A;  3NOP C;  5HDC A;  1YSP A;  1ZHH B;  2M7U A;  4WN5 A;  1LSX A;  1T1B A;  1N9O A;  3OBF A;  4LRX C;  2PD8 A;  4HJ3 A;  2G7U A;  5HZH A;  2CMN A;  3PR6 A;  2FZ0 A;  4BBV A;  2HJE A;  4I5S A;  4CLC A;  4HY8 A;  5AVE A;  3KSH A;  3ICY A;  3OLO A;  2OWJ A;  1F9I A;  5G4Z A;  2O9B A;  2PYP A;  1H8M A;  5DKK A;  3T4T A;  2V0U A;  1VHM A;  3LYX A;  3E4O A;  1NRJ A;  2D01 A;  2IA2 A;  4EEU A;  4MDZ A;  4EER A;  3KYZ A;  3H9W A;  1P9W A;  4UEY A;  3LIC A;  3LI9 A;  4LLO B;  3CLO A;  3H82 A;  3B33 A;  1LL8 A;  3VE3 A;  5J4E A;  2YKF A;  3MMH A;  1ZTU A;  4M4X A;  4EQ1 A;  1S4S A;  3IBJ A;  1OTI A;  1G28 A;  3CAX A;  3MQQ A;  3W2Z A;  5HPI A;  4EU0 A;  3R4K A;  2FH5 A;  3A0V A;  3FC7 A;  3MF0 A;  3H7W A;  2VGL S;  1X0O A;  4YNR A;  4HHD A;  5HD3 A;  3LR3 A;  2QWS A;  5L8M A;  3OCN A;  1MC0 A;  5F5Y A;  2EA9 A;  5F69 A;  2JKR I;  5TJJ A;  2L1M A;  5KIZ A;  3UB8 A;  4F3L A;  3E98 A;  3TJZ C;  2I9V A;  4HQA A;  4OOM A;  3CWF A;  2V9A A;  3NOT C;  2W27 A;  2VLG A;  1XFQ A;  2PT7 A;  5EFW A;  2R78 A;  2ZMF A;  2HV1 A;  4IUK A;  4BMW A;  5A8B A;  3T4K A;  2VA0 A;  1H3Q A;  1OJG A;  3PBO A;  5HDD A;  4NKP A;  1XFN A;  2VV7 A;  4ZRR A;  3S7Q A;  4DN0 A;  2W3E A;  4GHI B;  4FSF A;  2QHK A;  4R70 A;  4CLC B;  4BBT A;  3P7N A;  1NWZ A;  3S7N A;  3NOU C;  2KX6 A;  5HWV A;  4WEK A;  2VJW A;  1TS0 A;  3GDI A;  1LSW A;  4P6Z M;  2HJ9 C;  3B47 A;  3FPW A;  3P01 A;  2V1B A;  4GS9 A;  3CUE C;  4KUK A;  1N9L A;  5TBM A;  3JVV A;  3PBR A;  3RH8 B;  3T4J A;  5HD5 A;  5IT5 A;  2K7S A;  2JKR M;  3KYQ A;  4I3I A;  3LI8 A;  2J3W A;  4PKY A;  4IJG A;  4GJ4 A;  2VX8 A;  1ODV A;  2KOI A;  3K3C A;  4I38 A;  1YAX A;  3E0Y A;  1GSV A;  1EW0 A;  3LR5 A;  5AVF A;  4MN6 A;  3LIF A;  1GSW A;  4GW9 A;  3T4O A;  4LRY C;  2PHY A;  3LFV A;  3E4P A;  3F1O A;  3H7W B;  1OTD A;  5I5L A;  3BWL A;  1W63 Q;  5HPF A;  3LUQ A;  3KSG A;  2A2L A;  4EET B;  2QJ5 A;  3VV4 A;  3BQ8 A;  3KO6 A;  2OWH A;  2XA7 M;  1S1Y A;  4MN7 A;  5G4Y A;  1F98 A;  3HJI A;  4H6J B;  2MJ6 A;  3LIA A;  3C30 A;  2HF6 A;  4L9G A;  4O8G A;  3EEA A;  1OPX A;  4F3L B;  1S66 L;  5F6A A;  3EQV A;  1P97 A;  3PXP A;  5HWW A;  2WKR A;  4NEE D;  3RTY A;  2L4R A;  4DJ2 A;  2W1R A;  3G6O A;  2BAS A;  1XJ4 A;  3IS2 A;  3MQ0 A;  3C38 A;  2M1C A;  3EWK A;  2GNX A;  2QKP A;  4HP9 A;  1S67 L;  3PBQ A;  2JHE A;  2XRN A;  4L9E A;  4HI4 A;  2LB9 A;  1TS7 A;  3K3D A;  4RQ9 A;  2J3T C;  2KDK A;  4Q0H A;  4II7 A;  5MC7 A;  3EGX C;  3A0R A;  2VV6 A;  3F1N B;  5TBM B;  4HH2 A;  3FPV A;  4R3A A;  4ARZ A;  3D3O A;  5J7E A;  3TE8 A;  4Y2F A;  1TD5 A;  2GJ3 A;  4Q0J A;  3MQO A;  3V67 A;  1S4R A;  4K08 A;  3UE6 A;  4KQD A;  3RFB A;  2Y79 A;  1LT0 A;  3MR0 A;  1V9Y A;  2PDR A;  1G6O A;  3EGD C;  3F1O B;  5FL3 A;  3TRC A;  5CX7 A;  2PR5 A;  4IUH A;  4P6Z S;  5IU1 A;  3UB7 A;  5DF9 A;  3VE4 A;  1IFQ A;  4EES A;  3MXQ A;  4WLA A;  5KSH A;  2NUT C;  4HP4 A;  4R6L A;  1S1Z A;  3ULF A;  2H28 A;  2K2N A;  3KX0 X;  2XRO A;  4HJ4 A;  5AJG A;  4EW7 A;  1P0Z A;  3E4Q A;  5F68 A;  4Q0I A;  1T19 A;  1BYW A;  4CLC C;  2WKQ A;  2VV8 A;  3OOV A;  3GEC A;  2KLI A;  3NHQ A;  1XJ3 A;  2ZOI A;  2OAP 1;  4HJ6 A;  1NLZ A;  3JVU A;  5LBR A;  2Y8H A;  1KOU A;  2O9C A;  2V0W A;  4BWI A;  1UGU A;  1DP9 A;  2Z6D A;  3C2W A;  4EUV A;  3BY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...