4HJ6A

Crystal structure of rhodobacter sphaeroides lov protein
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
175
structure length
175
Chain Sequence
DQKQFEKIRAVFDRSGVALTLVDMSLPEQPLVLANPPFLRMTGYTEGQILGFNCRFLQRGDENAQARADIRDALKLGRELQVVLRNYRANDEPFDNLLFLHPVGGRPDAPDYFLGSQFELGRSGNSEEAAAAGHAGALTGELARIGTVAARLEMDSRRHLAQAAAALVRAWERRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LOV protein
publication title Light-induced subunit dissociation by a light-oxygen-voltage domain photoreceptor from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Signaling protein
total genus 54
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4hj6A00
4F3LB 3HJIA 3F1OB 2V1BA 4EERA 2VV6A 2PHYA 2Z6CA 3A0VA 2KX6A 4EW7A 2PD7A 3FC7A 2ZOHA 3NJAA 5HSQA 4EEPA 4R3AA 4I5SA 1T19A 2V1AA 3EEHA 2BASA 1TS8A 2KDKA 5DKLA 3CWFA 2VV7A 4L9EA 3LICA 1DP6A 4HOIA 5DJTA 2L0WA 5HWVA 4EQ1A 3H7WA 1OJ5A 4RQ9A 1OJGA 1BYWA 3IBRA 4NXEA 2OWHA 3PYPA 1OTAA 4NXBA 2YKHA 2D01A 2JN7A 2CMNA 4NXGA 4GS9A 2VLGA 3A0SA 4HH3A 1GSXA 5A8BA 5G4ZA 3MFXA 4F3LA 3F1OA 3LIEA 4WN5A 1EW0A 3HJKA 1D06A 4XT2B 3BY9A 5AVFA 4B9OA 4I3AA 5F5YA 3C2WA 1DP9A 2H28A 5TBMB 4R6LA 4LRYC 3D72A 4KQDA 3BWLA 3IS2B 1GSVA 5HD5A 2V0WA 4JGPA 4GCZA 3CAXA 5IU1A 3NHQA 1T1CA 4R38A 5DKKA 3MQOA 1UWNX 2L1MA 2PYRA 2QJ5A 3LYXA 1XJ6A 1OTIA 1T1AA 3LIAA 1DRMA 1T18A 3F1NB 1Y28A 1P97A 4XT2A 4I3IA 3F1PB 2QKPA 3LIFA 3CLOA 1KOUA 5HD3A 3PHYA 4NXFA 5TBMA 2HV1A 1OT6A 3UB8A 5F69A 3ULFA 1LT0A 3IS2A 1JNUA 1LL8A 4EESA 5HDCA 4YWZA 3GECA 4BBUA 5EFWA 2QWSA 2B02A 3VE4A 3LI8A 3BY8A 1NWZA 3UMEA 1G28A 5F68A 4EETB 1TS7A 4R70A 3K3CA 2PR6A 3MR0A 2W0NA 1T1BA 4HH2A 3H82B 4LRZE 3F1NA 2INWA 2OWJA 3VE3A 4L9FA 4DJ2A 4HQAA 2QHKA 5DJUA 1S66L 4KUOA 4PKYG 4BBTA 3F1PA 4HJ6A 2PDRA 1V9ZA 4WLAA 2M1CA 5I5LA 1DP8A 1S4SA 4MN5A 1MZUA 4GHIB 4WF0A 3FG8A 4I3JA 2VV8A 3ZQ5A 4H6JA 3VOLA 3H9WA 4GW9A 3MQQA 3E4PA 5J3WA 4WL9A 1V9YA 5HDSA 2ZOIA 2PR5A 4HHDA 4JGRA 2EA9A 2QJ7A 1OT9A 4DJ3A 2R78A 3H82A 3A0RA 2A24B 1XJ2A 1UWPX 1P0ZA 5IS1A 3UB6A 2I9VA 5J4EA 3E4QA 1N9LA 4JGQA 4GHIA 3NOPC 3C8CA 5J7EA 4HP4A 1S4RA 1GSWA 2OOLA 4K08A 1WA9A 2WKRA 1N9OA 1VB6A 4HY8A 3UMDA 3LIBA 4H6JB 4E04A 1S1ZA 2Z6DA 2PD8A 2A24A 3LIDA 1LSXA 3T50A 3K3DA 3E4OA 2L4RA 1LSVA 4HNBA 5F6AA 3ICYA 2WKQA 5HDDA 5KIZA 1F9IA 4WUJA 4LPZA 5G4YA 2ZBBA 3UB9A 4HJ3A 1LSWA 3G6OA 2W27A 1X0OA 5HWTA 3SW1A 2YKFA 2GJ3A 2V9AA 4M4XA 4EXOA 3LI9A 1S67L 3B33A 1ODVA 4MN6A 2JHEA 3P7NA 4HI4A 4BBVA 3UB7A 2WKPA 3KX0X 3OLOA 3MJQA 1XJ3A 4I39A 2J80A 1TS0A 3MXQA 1XFNA 3LUQA 5HZHA 3UE6A 4HP9A 4LLOB 4EEUA 3EWKA 1XJ4A 2K7SA 1OTEA 4JGOA 2D02A 1F98A 1D7EA 2P7JA 1S1YA 5AVEA 3GDIA 4HJ4A 4HIAA 3NOTC 2PYPA 1OTBA 1TS6A 5HWWA 1OTDA 3H7WB 4L9GA 3RTYA 4LRXC 4KUKA 1N9NA 1UGUA 2V0UA 4PKYA 3RH8B 2VEAA 3NOUC 1XFQA 4GS9B 4I38A
chains in the Genus database with same CATH superfamily
5EPHA 4F3LB 1BLHA 3HJIA 4U3TA 4KZ9A 4KG2A 1G5UA 5GHZA 5DTSA 3MXSA 1OMEA 3EGXC 3G2YA 4EERA 3VV4A 4YINA 1HZOA 1YLTA 1ZTUA 2Z6CA 4ETXA 4EW7A 4N92A 4JPMA 4BLMA 3G35A 3IBJA 3FPWA 4I5SA 4S2LA 2XGNA 1YLZA 1TS8A 2KDKA 3CWFA 5DF9A 3OCLA 4L9EA 3LICA 4HOIA 4JLFA 4EQ1A 3H7WA 5FI6A 3LR0A 1OJGA 4KENB 5HL1A 5DVAA 4BD0A 3UDXA 2HDRA 3C4OA 2VX8A 2WUQA 3PYPA 1K55A 1VEUA 2YKHA 1F2KA 4LCLA 2VLGA 1GSXA 3BQ8A 3IWOA 5G4ZA 3MFXA 3PBNA 4WN5A 1LI0A 4XT2B 2KOIA 2Y2HA 2VJWA 1Q2PA 4B9OA 3O87A 4DXCA 3QP1A 1FCNA 1DP9A 2J3TD 2H28A 4QY5A 3M2KA 4DKIA 3Q7VA 3M6HA 3HVFA 3GRJA 4KQDA 1MXOA 2J7VA 1ERMA 2V0WA 3DW0A 4KZ4A 1CI9A 4HEFA 1NZOA 5DFYA 3TOIA 4DRTA 2JC7A 1IOUA 4CPKA 3MKEA 1ESIA 2PRFA 3NY4A 2ZMFA 3RXXA 4DXBA 2XEPA 1PZOA 4S2KA 5HPIA 3PBSA 2RCXA 1XA1A 1T18A 3IXBA 3QP5A 4S2NC 3BLSA 1XKZA 4GD6A 5L8MA 3D3OA 3ZG0A 1VHMA 2K2NA 2ZC6B 3UPPA 2WGWB 5AJGA 2XSSA 4NK3A 3C30A 2QKPA 2EX6A 5HD3A 3ZHHA 2FFFB 4WZ4A 3IF5A 3IS2A 4IBXA 1DJCA 4X6TA 3JYIA 4G3VA 2W3GA 2C6WB 4E3IA 4EESA 1L0DA 5DTKA 5EFWA 3EQVA 2QWSA 5FQJA 4Y0TA 1H3QA 4O7DA 3UMEA 1YT4A 1G28A 3Q7ZA 3R4KA 5F68A 4IVIA 3B47A 4Q0IA 5KSCA 4R70A 5AQBA 2PR6A 4MDZA 1FCMA 1N4OA 4LRZE 2JCHA 3QP8A 5AQ7A 4DJ2A 2O0YA 5DJUA 3JVUA 4S2OA 2VGKA 4KUOA 3F1PA 3BFGA 2PAVP 3BJNA 4WLAA 4ZJ3A 5E2FA 1ZC2A 1CEGA 2M1CA 2V8CA 1DP8A 4MN5A 4GHIB 4WF0A 3VSKA 3FG8A 4IUHA 2EFUA 4H8RA 3ZQ5A 1F5MA 4XXRA 4KG6A 2HDQA 4FD8A 2QZ6A 3ITBA 4QJGA 3H9WA 3BLMA 1P9RA 3ZFZA 4WL9A 1GA9A 4OH0A 5HDSA 3LO7A 2EA9A 4O01A 1DJAA 1SKOB 2M7VA 2WK0A 3NBLA 4P6ZS 3H82A 2V2FF 3HUMA 1VETB 1SZVA 2DNSA 1E25A 3WS4A 2H5SA 5FA7A 5I94A 4GLQA 3VSLA 1W63Q 2ZD8A 4WMCD 4KZ5A 2JKRM 4JBFA 1H5XA 3NOPC 2Y91A 4YFMA 3IXDA 1OPXA 3M2JA 5EM0A 3S4XA 4WZ5A 3MF0A 3MKFA 2OOLA 3SH7A 1G6OA 2WKRA 4KG5A 1VB6A 4UA7A 4WEJA 1TVFA 3UE0A 1CQAA 3TW8A 1KGEA 5E2EA 3PAGA 3NDEA 1WE4A 2A24A 1KDSA 1LSXA 1WYCA 3G30A 2XLNA 3K3DA 3G31A 4LENA 2H0YA 2P9VB 1K54C 1MPLA 1YPRA 3AGDA 3PBOA 4X69A 3KYZA 4U0XA 3ICYA 4EV4A 4DE2A 1AWIA 4P6ZM 2IWBA 4S2PA 3TRCA 1IYQA 3UO9A 5HDDA 5KIZA 2NUTC 5EOEA 5G4YA 3KSFA 3VP1A 4EUVA 4XUZA 2Y2OA 3SH8A 1PI4A 4K0WA 1FIKA 4OOLA 3G6OA 1X0OA 4DF6A 3IQAA 3A3IA 3N7WA 1W5DA 3KSGA 4YOFA 2JHEA 4S2JA 5EVIB 2EX9A 4OLDA 5CXWA 2ZM0A 4BBVA 4E3KA 2WKPA 3KX0X 3OLOA 2RL3A 3DTIA 3QP4A 5TFQA 2ZL1B 3OZHA 4N9LA 1YM1A 5EVIC 2AVXA 4KZ7A 5FAQA 1PW1A 3TJZC 2V20A 5E2HA 5DF8A 1M6KA 1YLWA 3MXQA 1XFNA 4CLCA 1L2SA 4QY6A 3TE8A 4OPQA 3U4LP 4WM9A 2I72A 3D4FA 1EROA 4RA7A 3EGDC 3EWKA 2C5WB 1XJ4A 3HLWA 4P87A 2OV5A 4B4ZA 2D02A 1F98A 1D7EA 3CI6A 3GSGA 1N9BA 3IF6A 1S1YA 5BOHA 3FKVA 2HPBA 1ZHHB 3GDIA 3S7NA 4HIAA 1JWVA 1RGYA 2WAEA 2WKEA 1J9MA 1OTBA 4R4RA 1LLBA 3T4QA 2Y2GA 4KUKA 5GLDA 1N9NA 4BL3A 4ARZB 2WAFA 3E98A 4GS9B 1TEMA 5HPFA 1I5QA 2OAQ1 3F1OB 1C3BA 2QPNA 2EXAA 4MEZA 5E43A 2UV0E 1YLJA 2PHYA 3A0VA 1K0KA 2KX6A 2PD7A 4O8GA 5CGSA 4ZJ2A 1MC0A 3S7QA 1KVLA 1ES2A 1BZAA 3W8KA 1HD8A 5HWVA 4N9KA 3PR6A 4KZBA 2FFYA 2IWDA 2JKTM 1W63M 3DTKA 3IX4A 3OC2A 2HP9A 4NXEA 3N4IA 3T4JA 1YLYA 1TF1A 1HVBA 4NXBA 3BFDA 2ZQAA 3HUNA 2D01A 3ZNTA 2CMNA 2X01A 3P09A 4HH3A 2IA2A 2J9OA 2J9PA 4F3LA 5L09A 1IYOA 1EW0A 3HJKA 4K91A 4UEYA 3T4TA 4GZBA 3BY9A 4PM5A 3WS1A 5FQMA 4I3AA 4K0XA 3QNBA 5F5YA 3ZG7B 3RJUA 4G3KA 1H8MA 4R6LA 4ETZA 3HUOA 4GB7A 5CGWA 1GSVA 2XA7S 1ONHA 4IBRA 4BWIA 1CF0A 4HBTA 1K56D 4ZBEA 1FR6A 3KSIA 1CI8A 4OOMA 1MKMA 3KYEA 1K25A 1HLUP 1AXBA 3NHQA 3PXPA 1T1CA 1WYBA 2EXBA 4ME4A 2VA0A 3E2KA 4X25A 3LR3A 3CG5A 3MQOA 2L1MA 2PYRA 1GHIA 2QJ5A 3KSHA 1T1AA 2J3TC 2ZC3B 4Z1WA 2ZQ8A 4Z9QA 3F1NB 5FEFA 1VM1A 3C7VA 1Y28A 4Y0UA 4XT2A 4Y15A 5HAQA 2XR0A 3UPNA 4UQIS 3UPOA 1MKIA 5TGFA 3PHYA 1K4FA 4MMNA 1A0KA 5F69A 3MSHA 5CEDA 5L2FA 1FR1A 1LL8A 4Y0OA 4P0MA 3DTEA 4WELA 3W4QA 5HDCA 4YWZA 4OQ0A 3OPHA 4BBUA 1Z6FA 3K2NA 4S2NA 3LI8A 1NWZA 3OCNA 2VKSA 3K3CA 4LV3A 1K57C 2Q9NA 1K6SA 2QMIA 4HH2A 4DDYA 3SZTA 2HZ5A 2OWJA 3VE3A 3CUEA 4FOFA 3SS4A 2HDSA 2ZM2A 2WGWA 4UA6A 2Y59A 4HESA 1KGGA 1NY0A 3M6BA 2HF6A 3S22A 4BMWA 3FZCA 4LV2A 4PM9A 5HFOA 5CGXA 5I5LA 1S4SA 1MZUA 3DAVA 3DBAA 3T1QB 3G34A 3VOYA 1FQGA 4FUWA 5DFXA 2EFXA 3LR4A 4LCMA 2ZM8A 3VP4A 3E4PA 1V9YA 4U0TA 4JXVA 3MZDA 2PR5A 1XA7A 5U47A 4N1XA 2ZMVA 4QD4A 4DJ3A 3S7PA 1MBLA 2VK3A 3A0RA 2XRNA 3FV7A 2O9BA 1UWPX 3SS3A 3PBTA 5IS1A 1JTDA 2OSUA 4PAUA 3UB6A 2R9XA 2I9VA 1E3UA 5FL3A 3T1RA 3MZFA 2B5RA 3MS6A 4LGWA 4GHIA 4OQGA 4JF5A 3C7UA 2OAP1 4GKUA 3CPTB 4HP4A 2JKFA 1CK3A 1S4RA 1ZKJA 4MN7A 3BECA 1ES3A 5HX9A 1FCOA 1SKOA 2OLVA 1S1ZA 3O88A 5FATA 1VETA 3T50A 1XP4A 1PIOA 2L4RA 3UN7A 4HNBA 3CJMA 2EX2A 4GD8A 1JWZA 3A3JA 2WKQA 1ES5A 5EE8A 5GLBA 2ZQCA 4ID4A 4PM7A 4WUJA 1PRQA 3B42A 3E0YA 3UB9A 2EWVA 4HJ3A 1ESUA 1LSWA 5FDSA 4OP5A 3NECA 5FQQA 3FWLA 5HWTA 2YKFA 2V9AA 2K31A 3SH9A 2ZC7A 1E4DA 4JXSA 3LI9A 1O07A 1S67L 1MWUA 1SKFA 4X53A 3P7NA 2E8JA 3A3EA 3ISGA 5KMWA 1FILA 2WKIA 1RGZA 3ZGAB 3NI9A 3LY4A 5FQIA 2P9VA 1G68A 1GA0A 4C3QA 3BFEA 3HCYA 3MJQA 1XJ3A 2JKRI 1TS0A 5TR7A 5HARA 3AGEA 3UE6A 4HP9A 4BD1A 3V3RA 5GLAA 3Q81A 4BENA 3OBFA 1J3WA 3R7WB 4EEUA 4MCWA 1TD5A 3BRMA 3MMHA 3C38A 4E3MA 5CX7A 4OQHA 4DN0A 1ONGA 2Z2MB 4S2IA 4GOGA 5AVEA 1PW8A 2B95A 5CHJA 2Y8HA 2GZAA 4HJ4A 3CHWP 5EVIA 3QHYA 4L9GA 5A93A 5A90A 1YSQA 4X1LA 3OPLA 3NDGA 4NEED 5D3OA 5GL9A 4P6BA 2ZL1A 4PKYA 2XD1A 3RH8B 3W2ZA 4FSFA 2PT7A 1ACFA 1SDEA 3V3SA 5J8XA 2CC1A 4RVAA 4Y5FA 3T4OA 1XPBA 4KZ3A 3IXHA 3CZDA 5EOOA 3WS5A 3BW6A 2VV6A 1XXMA 2W3EA 2DMWA 4LV0A 4BJPA 2Y2JA 1PFLA 2P04A 2ZOHA 3NCKA 1XGJA 3HLBA 3IWQA 3LCEA 3IWIA 4GN2A 4R3AA 5GLCA 3C5AA 5KSHA 4NKPA 2XQZA 5EVLA 4Y7PA 3EEHA 2BASA 3ZDJA 1IFQA 2ZC4B 5DKLA 1VQQA 2L0WA 5DJTA 2MJ6A 3LGOA 4EBNA 1PZPA 4BL2A 4RQ9A 1LI9A 4E3NA 4X1MA 5M19A 3LR5A 2ZQ7A 2GX5A 1BULA 1BYWA 1NLYA 3IBRA 2HDUA 4CQHA 4R3JA 1OTAA 3JVVA 4ARZA 5DF7A 3SOIA 4GS9A 4FH4A 4UA9A 3IX8A 5A8BA 3F1OA 1EWZA 5TJJA 4A5RA 2UWXA 4PPRA 4R3BA 1KE3A 2Y2PA 4L0LA 5FI7A 2XDMA 4WEKA 5TBMB 4LRYC 3D72A 1DJBA 4EU0A 3IH8A 4JF4A 1H8ZA 3BWLA 4Y13A 5KZHA 3EOIA 4MLLA 4B88A 3HLDA 4E6WA 1IYPA 4JGPA 5JYOA 2IWCA 4EBLA 4GCZA 3CAXA 5IU1A 1YQSA 4R38A 3P98A 4KZ8A 5CTNA 3VFFA 5DKKA 3WS2A 4GNUA 4QPRA 3VP2A 1XJ6A 1OTIA 5K5BA 3HLEA 1I2SA 3NC8A 3FKWA 3G2ZA 1KE4A 1MWTA 1P97A 1L0FA 3T1SA 2ZMAA 4GDBA 3O5YA 5AQ9A 4I3IA 5M18A 2O9AA 4NG2A 2HJEA 3LIFA 3CLOA 5FI2A 2HV1A 5A91A 3EEAA 2B18A 1LT0A 3ULFA 4BQMA 1JNUA 1IKIA 5FAOA 4E3LA 3GECA 4R0QA 2J3WA 2WYXA 3N8RA 2DRWA 3UDIA 3WWXA 3WRZA 2JKTI 3MQ0A 1EI5A 3BY8A 3G4PA 5EUAA 2WGIA 4R1GA 4EETB 3GR2A 3V67A 3MR0A 1BTLA 2W0NA 1W8YA 3A3FA 3F1NA 5AQAA 1PNEA 1FSYA 1JTGA 2HGVA 4D2OA 2G2WA 4KQQA 3UB5P 2HP5A 4HQAA 3L7HA 2Y2IA 3V50A 2ZLYA 1S66L 4PKYG 2PU4A 3HLCA 2PDRA 3T4SA 1V9ZA 3LEQA 2LB5A 1IYSA 3N6IA 3B3XA 4NETA 5LBRA 3IX3A 2VV8A 4FCFA 1BSGA 4H6JA 1TDGA 4C6YA 4B93A 4MBHA 3AGFA 3D9YA 1YLPA 3QP6A 4JGRA 4UAAA 3VP0A 2QJ7A 5DTTA 1OT9A 1LL9A 5IHVA 3O3VA 3FPVA 2GNXA 3PBRA 1XJ2A 5FASA 3I7JA 1W79A 4Q0JA 4X56A 1O7EA 1FSWA 4N1HA 4OOYA 2WZXA 5J4EA 1N9LA 2WGVA 3DWZA 4JGQA 2ZQ9A 3CITA 1NRFA 4EQIA 3BEBA 4R4SA 1NLZA 5J7EA 3UE1A 2QYBA 2Y2NA 3QNCA 4K08A 1WA9A 3ZG8B 1N9OA 3HLGA 4QHCA 4HY8A 3UMDA 1NZUA 2BLSA 3VFHA 4OPRA 1BLCA 1JWPA 1XX2A 4H6JB 4II7A 4R23A 4E04A 4ESPA 4OVDA 4DDSA 3DWKA 4CJNA 2Z6DA 1ERQA 5F1GA 2PD8A 2PBYA 1Y54A 4RX2A 4CLCD 2XA7M 1LSVA 4OP8A 3DTMA 5A92A 5CECA 1NJ4A 4LV1A 4OPYA 1F9IA 2Y2LA 3CPTA 2ZJ9A 4WMCA 2X71A 4IJGA 2W1RA 4M4XA 5EECA 2BG1A 4EXOA 3UNWA 2H0TA 1PYYA 4JF6A 3PBQA 1NRJA 4UQIM 5MC7A 3JPUA 1IKGA 4HI4A 1GCEA 4JKTA 4B4XA 1PI5A 3MXRA 5CHMA 1PWCA 2W1TB 2V1ZA 1Z09A 3OOVA 1RCJA 1W7FA 4UHUA 2XFSA 5FQKA 3ZG9B 5HZHA 5HW3A 1JVJA 4LLOB 3WS0A 1PWGA 3KO6A 2XH9A 3HLFA 1BLPA 2XF3A 2P7JA 2A49A 1QMEA 4OQIA 1YMXA 3NOTC 1TS6A 5HWWA 1OTDA 3H7WB 5FSRA 3U2AA 1I2WA 3IXGA 2XK1A 4LRXC 3S1YA 3CMZA 3MZEA 3V39A 1CJFA 1KE0A 3RFBA 1TDLA 1VEUB 2VEAA 1XFQA 1M40A 4I38A 2VGLS 5JYPA 2PBDP 3CUEC 4WYYA 2ACGA 2V1BA 2A3UA 3ZNYA 3A3DA 1K55C 3R7WA 3BFFA 2W3HA 3GTCA 4O0PA 3PAEA 3S7OA 3NIAA 2PU2A 3OPRA 3FC7A 3SS5A 3NJAA 5HSQA 4EEPA 3T4KA 1T19A 4DE0A 3Q7VB 2V1AA 5G18A 1ZG6A 4IUKA 3O86A 4KZAA 2VV7A 1DP6A 2Z2LB 2ZQDA 3ZCZA 1OJ5A 2E8IA 2JE5A 1PWDA 1YKDA 2OWHA 1K54A 1HTZA 2JN7A 4NXGA 3A0SA 2G7UA 4ZAMA 5C5KA 3IH9A 4PHTA 4QU3A 3LIEA 4KQOA 3GV9A 1SDNA 1D06A 1SHVA 2Y2MA 2GDNA 3P01A 5AVFA 5F83A 4X55A 1MY8A 3C2WA 2A2LA 2VGLM 2VZWA 1STZA 3IS2B 5F1FA 3Q07A 5HD5A 1RP5A 3VP3A 5IT5A 5EVEA 1YSPA 4G3WA 4Y2FA 5FAPA 1QMFA 4EWFA 3Q82A 4MBKA 1UWNX 3LYXA 1L0EA 1ALQA 3LIAA 3EQUA 1DRMA 3N8LA 2W3FA 2Y2KA 2XROA 5F82A 2LB9A 4YNRA 2Q9MA 1L3LA 4WBGA 5CERA 4S2MA 3F1PB 3IHAA 4Q0HA 5HAPA 1KOUA 4NXFA 1BUEA 5TBMA 3HL9A 3ZG5A 1OT6A 3UB8A 3IT9A 1H8YA 3GQZA 1MWSA 5M1AA 3LEZA 3W4OA 2VGJA 1YMSA 5EM1A 3UY6A 4HBUA 3RXWA 1Y4OA 2WZZA 2G2UA 4F94A 2P08A 1G6AA 2B02A 3VE4A 2NUPC 4IEDA 1K56A 1BLSA 1TS7A 3ZVTA 3KYQA 1E3UD 2Y79A 1T1BA 3H82B 2INWA 4RX3A 2X02A 4L9FA 2QHKA 4PM8A 4MNRA 4PMAA 4BBTA 4HJ6A 4KQRA 3WRTA 3ZVWA 3LY3A 3GVBA 4Y17A 1XGIA 1KDWA 4JXWA 4EBPA 2Q0OA 4GJ4A 4I3JA 3ITAA 5HL6A 2M7UA 1GHMA 3Q1FA 2FH5A 4ZRRA 2WKHA 3UE3A 4E3OA 3VOLA 4FH2A 3MQQA 4GW9A 4OONA 5J3WA 3IHBA 1LHYA 2ZOIA 3TG9A 4HHDA 5GHYA 4Y3IA 3HREA 4WZ5C 3TSGA 2R78A 4PM6A 3BM6A 2A24B 3MBZA 4DE1A 5CTMA 1P0ZA 3VOZA 2FZ0A 1D1JA 3GMWA 1S6RA 1IEMA 3E4QA 4D60A 1KGFA 1YAXA 4GDNA 4XUXA 1U60A 1K4EA 2Y4AA 2P74A 2W3DA 3C8CA 5CHUA 3W4PA 4FTXA 4E3JA 1ZG4A 3MFDA 4JXGA 2EWWA 1GSWA 1IELA 3V5MA 3ZYTA 1L0GA 3LIBA 5L10A 4LFUA 3G32A 5EV0A 3NULA 4E6XA 3LIDA 1CEFA 3UDFA 3PTEA 3HBRA 1Q2QA 3E4OA 5HAIA 5F6AA 2HJ9C 2Y2QA 3VMAA 5GHXA 3N8SA 4RYEA 1KVMA 1NYMA 3L9KA 2O9CA 2WADA 5FEGA 4CLCB 2JBFA 4LPZA 2ZBBA 3BYDA 1SCWA 4ZDXA 4IVKA 4OKPA 3BQAA 2XD5A 5CRFA 3C4PA 1DY6A 5E2GA 5EVID 2W27A 4DMZA 4DE3A 4CLCC 3SW1A 3IF6B 2GJ3A 4QWOA 4Q8IA 4ZJ1A 1P9WA 4C75A 5CEBA 2DCFA 2H10A 3B33A 1ODVA 3T1XA 1S0WA 4MN6A 1K57A 3BFCA 3QP2A 1BT5A 3IF6C 2KLIA 4IHQA 3UB7A 2ZC5B 3T4LA 3OPPA 4M3KA 1ES4A 5FDHA 3E2LA 1GHPA 4CLCE 2Y55A 3T12B 2O99A 1K38A 4I39A 2J80A 5FQ9A 2EX8A 4ZTKA 1H0MA 3LUQA 1FOFA 1NYYA 4OLGA 2K7SA 1OTEA 1K6RA 4JGOA 4KZ6A 3FYZA 2BTFP 2J8YA 3LFVA 4QB8A 4AFIA 5L07A 2HP6A 2PYPA 2OLUA 3RTYA 1NXYA 4MBFA 4OPZA 4EUZA 1UGUA 2V0UA 2JKGA 1LL5A 4X68A 2XFTA 2V8FA 2W1TA 4P85A 2R9WA 3NOUC 1W8QA 1MWRA
chains in the Genus database with same CATH topology
2VGLS 2OAQ1 3HJIA 4F3LB 3F1OB 3CUEC 4Y5FA 3T4OA 2V1BA 3EGXC 4EERA 3R7WA 3VV4A 3BW6A 1ZTUA 2VV6A 2W3EA 2W3HA 2PHYA 2Z6CA 3A0VA 4ETXA 2KX6A 2DMWA 4EW7A 4O0PA 3S7OA 2PD7A 4BJPA 4O8GA 2P04A 2ZOHA 3FC7A 3NJAA 4EEPA 5HSQA 1MC0A 3IBJA 4R3AA 3T4KA 3FPWA 4I5SA 5KSHA 1T19A 4NKPA 2V1AA 3EEHA 2BASA 1IFQA 1TS8A 4IUKA 2KDKA 3S7QA 5DKLA 3CWFA 5DF9A 2VV7A 3OCLA 4L9EA 3LICA 1DP6A 4HOIA 5DJTA 2L0WA 2MJ6A 5HWVA 4EQ1A 3H7WA 1OJ5A 3LR0A 3PR6A 4RQ9A 1OJGA 3LR5A 2JKTM 1W63M 2GX5A 1BYWA 1NLYA 3IBRA 3OC2A 2VX8A 1YKDA 4NXEA 3T4JA 4CQHA 2OWHA 3PYPA 1OTAA 1TF1A 3JVVA 4NXBA 2YKHA 4ARZA 2D01A 2JN7A 2CMNA 4NXGA 4GS9A 2VLGA 3A0SA 4HH3A 2G7UA 1GSXA 3BQ8A 5C5KA 2IA2A 4PHTA 5A8BA 5G4ZA 3MFXA 3PBNA 3F1OA 4F3LA 3LIEA 4WN5A 4KQOA 1EW0A 3HJKA 1D06A 4UEYA 5TJJA 4XT2B 2KOIA 3P01A 2VJWA 3T4TA 3BY9A 5AVFA 4B9OA 4I3AA 5F5YA 4L0LA 3C2WA 1DP9A 2J3TD 4G3KA 4WEKA 1H8MA 2H28A 5TBMB 4R6LA 2A2LA 2VGLM 4LRYC 3D72A 4ETZA 2VZWA 4KQDA 4EU0A 1STZA 3BWLA 3IS2B 1GSVA 2XA7S 4BWIA 3EOIA 5HD5A 2V0WA 3KSIA 4OOMA 1MKMA 5DFYA 4JGPA 5IT5A 1IOUA 1YSPA 4G3WA 2ZMFA 3CAXA 4GCZA 4Y2FA 5IU1A 3NHQA 3PXPA 1T1CA 4ME4A 4R38A 2VA0A 3LR3A 5DKKA 4QPRA 3MQOA 1UWNX 2L1MA 2PYRA 2QJ5A 3KSHA 3LYXA 1XJ6A 5HPIA 1OTIA 3PBSA 1T1AA 2J3TC 5K5BA 3LIAA 3EQUA 1DRMA 1T18A 4Z1WA 2W3FA 3F1NB 2XROA 1Y28A 1P97A 5L8MA 4XT2A 3D3OA 1VHMA 2K2NA 2LB9A 4YNRA 3O5YA 5AJGA 4I3IA 2XSSA 3F1PB 2O9AA 2HJEA 4Q0HA 3C30A 2QKPA 3LIFA 3CLOA 1KOUA 4UQIS 5HD3A 3PHYA 4NXFA 4MMNA 5TBMA 2HV1A 1OT6A 3UB8A 3EEAA 2B18A 1LT0A 5F69A 3IS2A 3ULFA 1JNUA 1LL8A 4G3VA 2W3GA 4WELA 4EESA 5HDCA 4YWZA 3GECA 4BBUA 2J3WA 5EFWA 3EQVA 2QWSA 2P08A 1H3QA 2B02A 3K2NA 2JKTI 3VE4A 3LI8A 3MQ0A 2NUPC 3BY8A 1NWZA 3UMEA 3OCNA 1G28A 3R4KA 5F68A 4EETB 2VKSA 3B47A 4Q0IA 1TS7A 4R70A 3K3CA 3KYQA 2PR6A 3V67A 3MR0A 2Y79A 4MDZA 2W0NA 1T1BA 4HH2A 3H82B 4LRZE 3F1NA 2INWA 2OWJA 2HGVA 3VE3A 3CUEA 4FOFA 4L9FA 4DJ2A 4HQAA 2QHKA 2O0YA 5DJUA 3JVUA 1S66L 4KUOA 4PKYG 4BBTA 3F1PA 4HJ6A 2PDRA 3T4SA 1V9ZA 3BJNA 4WLAA 2LB5A 2HF6A 4BMWA 5LBRA 2M1CA 5I5LA 1DP8A 1S4SA 4MN5A 1MZUA 4GHIB 4WF0A 3FG8A 3DBAA 4GJ4A 4I3JA 4IUHA 2VV8A 5HL6A 2M7UA 3ZQ5A 5DFXA 1F5MA 2FH5A 4H6JA 4ZRRA 3UE3A 3LR4A 3VOLA 3H9WA 3MQQA 1P9RA 4GW9A 4B93A 3E4PA 5J3WA 4WL9A 1V9YA 5HDSA 2ZOIA 2PR5A 4HHDA 4JGRA 2EA9A 4Y3IA 2QJ7A 4O01A 1OT9A 2M7VA 2ZMVA 4P6ZS 4DJ3A 2R78A 3S7PA 3H82A 3FPVA 3A0RA 2XRNA 2A24B 2GNXA 3PBRA 2O9BA 1XJ2A 1UWPX 1P0ZA 3PBTA 5IS1A 4Q0JA 4PAUA 3UB6A 2FZ0A 2I9VA 4GLQA 5FL3A 1W63Q 5J4EA 3E4QA 1N9LA 2JKRM 1YAXA 4JGQA 3CITA 4GHIA 2W3DA 3NOPC 3C8CA 1NLZA 5J7EA 2OAP1 2QYBA 4HP4A 1OPXA 1S4RA 2EWWA 1GSWA 3MF0A 4MN7A 2OOLA 4K08A 1G6OA 1WA9A 2WKRA 1N9OA 1VB6A 4HY8A 3ZYTA 4WEJA 3UMDA 3LIBA 3TW8A 4H6JB 4II7A 4E04A 1S1ZA 2Z6DA 2PD8A 2A24A 3LIDA 1LSXA 3T50A 3K3DA 3E4OA 2L4RA 4CLCD 2XA7M 1LSVA 4HNBA 5F6AA 2HJ9C 3PBOA 3KYZA 3ICYA 2WKQA 4P6ZM 3TRCA 2O9CA 5HDDA 5KIZA 1F9IA 2NUTC 4WUJA 3B42A 4CLCB 4LPZA 5G4YA 2ZBBA 3KSFA 4EUVA 3E0YA 3UB9A 2EWVA 3BQAA 4HJ3A 1LSWA 4OOLA 3G6OA 4IJGA 2W27A 4DMZA 1X0OA 4CLCC 5HWTA 3SW1A 2YKFA 2GJ3A 2V9AA 2K31A 2W1RA 4M4XA 4EXOA 1P9WA 3KSGA 3LI9A 1S67L 3B33A 4YOFA 1ODVA 4MN6A 2JHEA 3P7NA 3PBQA 1NRJA 4UQIM 5MC7A 4HI4A 2KLIA 4BBVA 4IHQA 3UB7A 2WKPA 3KX0X 3T4LA 3OLOA 4CLCE 3HCYA 3MJQA 2W1TB 2O99A 1XJ3A 4I39A 2JKRI 3TJZC 3OOVA 2J80A 1TS0A 3MXQA 1XFNA 4CLCA 3LUQA 5HZHA 3UE6A 3TE8A 4HP9A 4LLOB 3OBFA 3EGDC 3R7WB 3EWKA 4MCWA 4EEUA 1XJ4A 1TD5A 3MMHA 2K7SA 3C38A 1OTEA 3KO6A 5CX7A 4JGOA 4DN0A 2D02A 1F98A 1D7EA 3CI6A 2P7JA 1S1YA 5AVEA 1ZHHB 3GDIA 3LFVA 3S7NA 2Y8HA 2GZAA 4HJ4A 4HIAA 3NOTC 4AFIA 2PYPA 1OTBA 1TS6A 5HWWA 1OTDA 3H7WB 4L9GA 3U2AA 3RTYA 1YSQA 3T4QA 4LRXC 4KUKA 1N9NA 4NEED 1UGUA 2V0UA 4PKYA 3RFBA 3RH8B 3W2ZA 2VEAA 4FSFA 4ARZB 2W1TA 3E98A 2PT7A 3NOUC 1XFQA 4GS9B 5HPFA 4I38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F3L B;  3HJI A;  3F1O B;  2V1B A;  4EER A;  2VV6 A;  2PHY A;  2Z6C A;  3A0V A;  2KX6 A;  4EW7 A;  2PD7 A;  3FC7 A;  2ZOH A;  3NJA A;  5HSQ A;  4EEP A;  4R3A A;  4I5S A;  1T19 A;  2V1A A;  3EEH A;  2BAS A;  1TS8 A;  2KDK A;  5DKL A;  3CWF A;  2VV7 A;  4L9E A;  3LIC A;  1DP6 A;  4HOI A;  5DJT A;  2L0W A;  5HWV A;  4EQ1 A;  3H7W A;  1OJ5 A;  4RQ9 A;  1OJG A;  1BYW A;  3IBR A;  4NXE A;  2OWH A;  3PYP A;  1OTA A;  4NXB A;  2YKH A;  2D01 A;  2JN7 A;  2CMN A;  4NXG A;  4GS9 A;  2VLG A;  3A0S A;  4HH3 A;  1GSX A;  5A8B A;  5G4Z A;  3MFX A;  4F3L A;  3F1O A;  3LIE A;  4WN5 A;  1EW0 A;  3HJK A;  1D06 A;  4XT2 B;  3BY9 A;  5AVF A;  4B9O A;  4I3A A;  5F5Y A;  3C2W A;  1DP9 A;  2H28 A;  5TBM B;  4R6L A;  4LRY C;  3D72 A;  4KQD A;  3BWL A;  3IS2 B;  1GSV A;  5HD5 A;  2V0W A;  4JGP A;  4GCZ A;  3CAX A;  5IU1 A;  3NHQ A;  1T1C A;  4R38 A;  5DKK A;  3MQO A;  1UWN X;  2L1M A;  2PYR A;  2QJ5 A;  3LYX A;  1XJ6 A;  1OTI A;  1T1A A;  3LIA A;  1DRM A;  1T18 A;  3F1N B;  1Y28 A;  1P97 A;  4XT2 A;  4I3I A;  3F1P B;  2QKP A;  3LIF A;  3CLO A;  1KOU A;  5HD3 A;  3PHY A;  4NXF A;  5TBM A;  2HV1 A;  1OT6 A;  3UB8 A;  5F69 A;  3ULF A;  1LT0 A;  3IS2 A;  1JNU A;  1LL8 A;  4EES A;  5HDC A;  4YWZ A;  3GEC A;  4BBU A;  5EFW A;  2QWS A;  2B02 A;  3VE4 A;  3LI8 A;  3BY8 A;  1NWZ A;  3UME A;  1G28 A;  5F68 A;  4EET B;  1TS7 A;  4R70 A;  3K3C A;  2PR6 A;  3MR0 A;  2W0N A;  1T1B A;  4HH2 A;  3H82 B;  4LRZ E;  3F1N A;  2INW A;  2OWJ A;  3VE3 A;  4L9F A;  4DJ2 A;  4HQA A;  2QHK A;  5DJU A;  1S66 L;  4KUO A;  4PKY G;  4BBT A;  3F1P A;  4HJ6 A;  2PDR A;  1V9Z A;  4WLA A;  2M1C A;  5I5L A;  1DP8 A;  1S4S A;  4MN5 A;  1MZU A;  4GHI B;  4WF0 A;  3FG8 A;  4I3J A;  2VV8 A;  3ZQ5 A;  4H6J A;  3VOL A;  3H9W A;  4GW9 A;  3MQQ A;  3E4P A;  5J3W A;  4WL9 A;  1V9Y A;  5HDS A;  2ZOI A;  2PR5 A;  4HHD A;  4JGR A;  2EA9 A;  2QJ7 A;  1OT9 A;  4DJ3 A;  2R78 A;  3H82 A;  3A0R A;  2A24 B;  1XJ2 A;  1UWP X;  1P0Z A;  5IS1 A;  3UB6 A;  2I9V A;  5J4E A;  3E4Q A;  1N9L A;  4JGQ A;  4GHI A;  3NOP C;  3C8C A;  5J7E A;  4HP4 A;  1S4R A;  1GSW A;  2OOL A;  4K08 A;  1WA9 A;  2WKR A;  1N9O A;  1VB6 A;  4HY8 A;  3UMD A;  3LIB A;  4H6J B;  4E04 A;  1S1Z A;  2Z6D A;  2PD8 A;  2A24 A;  3LID A;  1LSX A;  3T50 A;  3K3D A;  3E4O A;  2L4R A;  1LSV A;  4HNB A;  5F6A A;  3ICY A;  2WKQ A;  5HDD A;  5KIZ A;  1F9I A;  4WUJ A;  4LPZ A;  5G4Y A;  2ZBB A;  3UB9 A;  4HJ3 A;  1LSW A;  3G6O A;  2W27 A;  1X0O A;  5HWT A;  3SW1 A;  2YKF A;  2GJ3 A;  2V9A A;  4M4X A;  4EXO A;  3LI9 A;  1S67 L;  3B33 A;  1ODV A;  4MN6 A;  2JHE A;  3P7N A;  4HI4 A;  4BBV A;  3UB7 A;  2WKP A;  3KX0 X;  3OLO A;  3MJQ A;  1XJ3 A;  4I39 A;  2J80 A;  1TS0 A;  3MXQ A;  1XFN A;  3LUQ A;  5HZH A;  3UE6 A;  4HP9 A;  4LLO B;  4EEU A;  3EWK A;  1XJ4 A;  2K7S A;  1OTE A;  4JGO A;  2D02 A;  1F98 A;  1D7E A;  2P7J A;  1S1Y A;  5AVE A;  3GDI A;  4HJ4 A;  4HIA A;  3NOT C;  2PYP A;  1OTB A;  1TS6 A;  5HWW A;  1OTD A;  3H7W B;  4L9G A;  3RTY A;  4LRX C;  4KUK A;  1N9N A;  1UGU A;  2V0U A;  4PKY A;  3RH8 B;  2VEA A;  3NOU C;  1XFQ A;  4GS9 B;  4I38 A; 
#chains in the Genus database with same CATH topology
 5EPH A;  4F3L B;  1BLH A;  3HJI A;  4U3T A;  4KZ9 A;  4KG2 A;  1G5U A;  5GHZ A;  5DTS A;  3MXS A;  1OME A;  3EGX C;  3G2Y A;  4EER A;  3VV4 A;  4YIN A;  1HZO A;  1YLT A;  1ZTU A;  2Z6C A;  4ETX A;  4EW7 A;  4N92 A;  4JPM A;  4BLM A;  3G35 A;  3IBJ A;  3FPW A;  4I5S A;  4S2L A;  2XGN A;  1YLZ A;  1TS8 A;  2KDK A;  3CWF A;  5DF9 A;  3OCL A;  4L9E A;  3LIC A;  4HOI A;  4JLF A;  4EQ1 A;  3H7W A;  5FI6 A;  3LR0 A;  1OJG A;  4KEN B;  5HL1 A;  5DVA A;  4BD0 A;  3UDX A;  2HDR A;  3C4O A;  2VX8 A;  2WUQ A;  3PYP A;  1K55 A;  1VEU A;  2YKH A;  1F2K A;  4LCL A;  2VLG A;  1GSX A;  3BQ8 A;  3IWO A;  5G4Z A;  3MFX A;  3PBN A;  4WN5 A;  1LI0 A;  4XT2 B;  2KOI A;  2Y2H A;  2VJW A;  1Q2P A;  4B9O A;  3O87 A;  4DXC A;  3QP1 A;  1FCN A;  1DP9 A;  2J3T D;  2H28 A;  4QY5 A;  3M2K A;  4DKI A;  3Q7V A;  3M6H A;  3HVF A;  3GRJ A;  4KQD A;  1MXO A;  2J7V A;  1ERM A;  2V0W A;  3DW0 A;  4KZ4 A;  1CI9 A;  4HEF A;  1NZO A;  5DFY A;  3TOI A;  4DRT A;  2JC7 A;  1IOU A;  4CPK A;  3MKE A;  1ESI A;  2PRF A;  3NY4 A;  2ZMF A;  3RXX A;  4DXB A;  2XEP A;  1PZO A;  4S2K A;  5HPI A;  3PBS A;  2RCX A;  1XA1 A;  1T18 A;  3IXB A;  3QP5 A;  4S2N C;  3BLS A;  1XKZ A;  4GD6 A;  5L8M A;  3D3O A;  3ZG0 A;  1VHM A;  2K2N A;  2ZC6 B;  3UPP A;  2WGW B;  5AJG A;  2XSS A;  4NK3 A;  3C30 A;  2QKP A;  2EX6 A;  5HD3 A;  3ZHH A;  2FFF B;  4WZ4 A;  3IF5 A;  3IS2 A;  4IBX A;  1DJC A;  4X6T A;  3JYI A;  4G3V A;  2W3G A;  2C6W B;  4E3I A;  4EES A;  1L0D A;  5DTK A;  5EFW A;  3EQV A;  2QWS A;  5FQJ A;  4Y0T A;  1H3Q A;  4O7D A;  3UME A;  1YT4 A;  1G28 A;  3Q7Z A;  3R4K A;  5F68 A;  4IVI A;  3B47 A;  4Q0I A;  5KSC A;  4R70 A;  5AQB A;  2PR6 A;  4MDZ A;  1FCM A;  1N4O A;  4LRZ E;  2JCH A;  3QP8 A;  5AQ7 A;  4DJ2 A;  2O0Y A;  5DJU A;  3JVU A;  4S2O A;  2VGK A;  4KUO A;  3F1P A;  3BFG A;  2PAV P;  3BJN A;  4WLA A;  4ZJ3 A;  5E2F A;  1ZC2 A;  1CEG A;  2M1C A;  2V8C A;  1DP8 A;  4MN5 A;  4GHI B;  4WF0 A;  3VSK A;  3FG8 A;  4IUH A;  2EFU A;  4H8R A;  3ZQ5 A;  1F5M A;  4XXR A;  4KG6 A;  2HDQ A;  4FD8 A;  2QZ6 A;  3ITB A;  4QJG A;  3H9W A;  3BLM A;  1P9R A;  3ZFZ A;  4WL9 A;  1GA9 A;  4OH0 A;  5HDS A;  3LO7 A;  2EA9 A;  4O01 A;  1DJA A;  1SKO B;  2M7V A;  2WK0 A;  3NBL A;  4P6Z S;  3H82 A;  2V2F F;  3HUM A;  1VET B;  1SZV A;  2DNS A;  1E25 A;  3WS4 A;  2H5S A;  5FA7 A;  5I94 A;  4GLQ A;  3VSL A;  1W63 Q;  2ZD8 A;  4WMC D;  4KZ5 A;  2JKR M;  4JBF A;  1H5X A;  3NOP C;  2Y91 A;  4YFM A;  3IXD A;  1OPX A;  3M2J A;  5EM0 A;  3S4X A;  4WZ5 A;  3MF0 A;  3MKF A;  2OOL A;  3SH7 A;  1G6O A;  2WKR A;  4KG5 A;  1VB6 A;  4UA7 A;  4WEJ A;  1TVF A;  3UE0 A;  1CQA A;  3TW8 A;  1KGE A;  5E2E A;  3PAG A;  3NDE A;  1WE4 A;  2A24 A;  1KDS A;  1LSX A;  1WYC A;  3G30 A;  2XLN A;  3K3D A;  3G31 A;  4LEN A;  2H0Y A;  2P9V B;  1K54 C;  1MPL A;  1YPR A;  3AGD A;  3PBO A;  4X69 A;  3KYZ A;  4U0X A;  3ICY A;  4EV4 A;  4DE2 A;  1AWI A;  4P6Z M;  2IWB A;  4S2P A;  3TRC A;  1IYQ A;  3UO9 A;  5HDD A;  5KIZ A;  2NUT C;  5EOE A;  5G4Y A;  3KSF A;  3VP1 A;  4EUV A;  4XUZ A;  2Y2O A;  3SH8 A;  1PI4 A;  4K0W A;  1FIK A;  4OOL A;  3G6O A;  1X0O A;  4DF6 A;  3IQA A;  3A3I A;  3N7W A;  1W5D A;  3KSG A;  4YOF A;  2JHE A;  4S2J A;  5EVI B;  2EX9 A;  4OLD A;  5CXW A;  2ZM0 A;  4BBV A;  4E3K A;  2WKP A;  3KX0 X;  3OLO A;  2RL3 A;  3DTI A;  3QP4 A;  5TFQ A;  2ZL1 B;  3OZH A;  4N9L A;  1YM1 A;  5EVI C;  2AVX A;  4KZ7 A;  5FAQ A;  1PW1 A;  3TJZ C;  2V20 A;  5E2H A;  5DF8 A;  1M6K A;  1YLW A;  3MXQ A;  1XFN A;  4CLC A;  1L2S A;  4QY6 A;  3TE8 A;  4OPQ A;  3U4L P;  4WM9 A;  2I72 A;  3D4F A;  1ERO A;  4RA7 A;  3EGD C;  3EWK A;  2C5W B;  1XJ4 A;  3HLW A;  4P87 A;  2OV5 A;  4B4Z A;  2D02 A;  1F98 A;  1D7E A;  3CI6 A;  3GSG A;  1N9B A;  3IF6 A;  1S1Y A;  5BOH A;  3FKV A;  2HPB A;  1ZHH B;  3GDI A;  3S7N A;  4HIA A;  1JWV A;  1RGY A;  2WAE A;  2WKE A;  1J9M A;  1OTB A;  4R4R A;  1LLB A;  3T4Q A;  2Y2G A;  4KUK A;  5GLD A;  1N9N A;  4BL3 A;  4ARZ B;  2WAF A;  3E98 A;  4GS9 B;  1TEM A;  5HPF A;  1I5Q A;  2OAQ 1;  3F1O B;  1C3B A;  2QPN A;  2EXA A;  4MEZ A;  5E43 A;  2UV0 E;  1YLJ A;  2PHY A;  3A0V A;  1K0K A;  2KX6 A;  2PD7 A;  4O8G A;  5CGS A;  4ZJ2 A;  1MC0 A;  3S7Q A;  1KVL A;  1ES2 A;  1BZA A;  3W8K A;  1HD8 A;  5HWV A;  4N9K A;  3PR6 A;  4KZB A;  2FFY A;  2IWD A;  2JKT M;  1W63 M;  3DTK A;  3IX4 A;  3OC2 A;  2HP9 A;  4NXE A;  3N4I A;  3T4J A;  1YLY A;  1TF1 A;  1HVB A;  4NXB A;  3BFD A;  2ZQA A;  3HUN A;  2D01 A;  3ZNT A;  2CMN A;  2X01 A;  3P09 A;  4HH3 A;  2IA2 A;  2J9O A;  2J9P A;  4F3L A;  5L09 A;  1IYO A;  1EW0 A;  3HJK A;  4K91 A;  4UEY A;  3T4T A;  4GZB A;  3BY9 A;  4PM5 A;  3WS1 A;  5FQM A;  4I3A A;  4K0X A;  3QNB A;  5F5Y A;  3ZG7 B;  3RJU A;  4G3K A;  1H8M A;  4R6L A;  4ETZ A;  3HUO A;  4GB7 A;  5CGW A;  1GSV A;  2XA7 S;  1ONH A;  4IBR A;  4BWI A;  1CF0 A;  4HBT A;  1K56 D;  4ZBE A;  1FR6 A;  3KSI A;  1CI8 A;  4OOM A;  1MKM A;  3KYE A;  1K25 A;  1HLU P;  1AXB A;  3NHQ A;  3PXP A;  1T1C A;  1WYB A;  2EXB A;  4ME4 A;  2VA0 A;  3E2K A;  4X25 A;  3LR3 A;  3CG5 A;  3MQO A;  2L1M A;  2PYR A;  1GHI A;  2QJ5 A;  3KSH A;  1T1A A;  2J3T C;  2ZC3 B;  4Z1W A;  2ZQ8 A;  4Z9Q A;  3F1N B;  5FEF A;  1VM1 A;  3C7V A;  1Y28 A;  4Y0U A;  4XT2 A;  4Y15 A;  5HAQ A;  2XR0 A;  3UPN A;  4UQI S;  3UPO A;  1MKI A;  5TGF A;  3PHY A;  1K4F A;  4MMN A;  1A0K A;  5F69 A;  3MSH A;  5CED A;  5L2F A;  1FR1 A;  1LL8 A;  4Y0O A;  4P0M A;  3DTE A;  4WEL A;  3W4Q A;  5HDC A;  4YWZ A;  4OQ0 A;  3OPH A;  4BBU A;  1Z6F A;  3K2N A;  4S2N A;  3LI8 A;  1NWZ A;  3OCN A;  2VKS A;  3K3C A;  4LV3 A;  1K57 C;  2Q9N A;  1K6S A;  2QMI A;  4HH2 A;  4DDY A;  3SZT A;  2HZ5 A;  2OWJ A;  3VE3 A;  3CUE A;  4FOF A;  3SS4 A;  2HDS A;  2ZM2 A;  2WGW A;  4UA6 A;  2Y59 A;  4HES A;  1KGG A;  1NY0 A;  3M6B A;  2HF6 A;  3S22 A;  4BMW A;  3FZC A;  4LV2 A;  4PM9 A;  5HFO A;  5CGX A;  5I5L A;  1S4S A;  1MZU A;  3DAV A;  3DBA A;  3T1Q B;  3G34 A;  3VOY A;  1FQG A;  4FUW A;  5DFX A;  2EFX A;  3LR4 A;  4LCM A;  2ZM8 A;  3VP4 A;  3E4P A;  1V9Y A;  4U0T A;  4JXV A;  3MZD A;  2PR5 A;  1XA7 A;  5U47 A;  4N1X A;  2ZMV A;  4QD4 A;  4DJ3 A;  3S7P A;  1MBL A;  2VK3 A;  3A0R A;  2XRN A;  3FV7 A;  2O9B A;  1UWP X;  3SS3 A;  3PBT A;  5IS1 A;  1JTD A;  2OSU A;  4PAU A;  3UB6 A;  2R9X A;  2I9V A;  1E3U A;  5FL3 A;  3T1R A;  3MZF A;  2B5R A;  3MS6 A;  4LGW A;  4GHI A;  4OQG A;  4JF5 A;  3C7U A;  2OAP 1;  4GKU A;  3CPT B;  4HP4 A;  2JKF A;  1CK3 A;  1S4R A;  1ZKJ A;  4MN7 A;  3BEC A;  1ES3 A;  5HX9 A;  1FCO A;  1SKO A;  2OLV A;  1S1Z A;  3O88 A;  5FAT A;  1VET A;  3T50 A;  1XP4 A;  1PIO A;  2L4R A;  3UN7 A;  4HNB A;  3CJM A;  2EX2 A;  4GD8 A;  1JWZ A;  3A3J A;  2WKQ A;  1ES5 A;  5EE8 A;  5GLB A;  2ZQC A;  4ID4 A;  4PM7 A;  4WUJ A;  1PRQ A;  3B42 A;  3E0Y A;  3UB9 A;  2EWV A;  4HJ3 A;  1ESU A;  1LSW A;  5FDS A;  4OP5 A;  3NEC A;  5FQQ A;  3FWL A;  5HWT A;  2YKF A;  2V9A A;  2K31 A;  3SH9 A;  2ZC7 A;  1E4D A;  4JXS A;  3LI9 A;  1O07 A;  1S67 L;  1MWU A;  1SKF A;  4X53 A;  3P7N A;  2E8J A;  3A3E A;  3ISG A;  5KMW A;  1FIL A;  2WKI A;  1RGZ A;  3ZGA B;  3NI9 A;  3LY4 A;  5FQI A;  2P9V A;  1G68 A;  1GA0 A;  4C3Q A;  3BFE A;  3HCY A;  3MJQ A;  1XJ3 A;  2JKR I;  1TS0 A;  5TR7 A;  5HAR A;  3AGE A;  3UE6 A;  4HP9 A;  4BD1 A;  3V3R A;  5GLA A;  3Q81 A;  4BEN A;  3OBF A;  1J3W A;  3R7W B;  4EEU A;  4MCW A;  1TD5 A;  3BRM A;  3MMH A;  3C38 A;  4E3M A;  5CX7 A;  4OQH A;  4DN0 A;  1ONG A;  2Z2M B;  4S2I A;  4GOG A;  5AVE A;  1PW8 A;  2B95 A;  5CHJ A;  2Y8H A;  2GZA A;  4HJ4 A;  3CHW P;  5EVI A;  3QHY A;  4L9G A;  5A93 A;  5A90 A;  1YSQ A;  4X1L A;  3OPL A;  3NDG A;  4NEE D;  5D3O A;  5GL9 A;  4P6B A;  2ZL1 A;  4PKY A;  2XD1 A;  3RH8 B;  3W2Z A;  4FSF A;  2PT7 A;  1ACF A;  1SDE A;  3V3S A;  5J8X A;  2CC1 A;  4RVA A;  4Y5F A;  3T4O A;  1XPB A;  4KZ3 A;  3IXH A;  3CZD A;  5EOO A;  3WS5 A;  3BW6 A;  2VV6 A;  1XXM A;  2W3E A;  2DMW A;  4LV0 A;  4BJP A;  2Y2J A;  1PFL A;  2P04 A;  2ZOH A;  3NCK A;  1XGJ A;  3HLB A;  3IWQ A;  3LCE A;  3IWI A;  4GN2 A;  4R3A A;  5GLC A;  3C5A A;  5KSH A;  4NKP A;  2XQZ A;  5EVL A;  4Y7P A;  3EEH A;  2BAS A;  3ZDJ A;  1IFQ A;  2ZC4 B;  5DKL A;  1VQQ A;  2L0W A;  5DJT A;  2MJ6 A;  3LGO A;  4EBN A;  1PZP A;  4BL2 A;  4RQ9 A;  1LI9 A;  4E3N A;  4X1M A;  5M19 A;  3LR5 A;  2ZQ7 A;  2GX5 A;  1BUL A;  1BYW A;  1NLY A;  3IBR A;  2HDU A;  4CQH A;  4R3J A;  1OTA A;  3JVV A;  4ARZ A;  5DF7 A;  3SOI A;  4GS9 A;  4FH4 A;  4UA9 A;  3IX8 A;  5A8B A;  3F1O A;  1EWZ A;  5TJJ A;  4A5R A;  2UWX A;  4PPR A;  4R3B A;  1KE3 A;  2Y2P A;  4L0L A;  5FI7 A;  2XDM A;  4WEK A;  5TBM B;  4LRY C;  3D72 A;  1DJB A;  4EU0 A;  3IH8 A;  4JF4 A;  1H8Z A;  3BWL A;  4Y13 A;  5KZH A;  3EOI A;  4MLL A;  4B88 A;  3HLD A;  4E6W A;  1IYP A;  4JGP A;  5JYO A;  2IWC A;  4EBL A;  4GCZ A;  3CAX A;  5IU1 A;  1YQS A;  4R38 A;  3P98 A;  4KZ8 A;  5CTN A;  3VFF A;  5DKK A;  3WS2 A;  4GNU A;  4QPR A;  3VP2 A;  1XJ6 A;  1OTI A;  5K5B A;  3HLE A;  1I2S A;  3NC8 A;  3FKW A;  3G2Z A;  1KE4 A;  1MWT A;  1P97 A;  1L0F A;  3T1S A;  2ZMA A;  4GDB A;  3O5Y A;  5AQ9 A;  4I3I A;  5M18 A;  2O9A A;  4NG2 A;  2HJE A;  3LIF A;  3CLO A;  5FI2 A;  2HV1 A;  5A91 A;  3EEA A;  2B18 A;  1LT0 A;  3ULF A;  4BQM A;  1JNU A;  1IKI A;  5FAO A;  4E3L A;  3GEC A;  4R0Q A;  2J3W A;  2WYX A;  3N8R A;  2DRW A;  3UDI A;  3WWX A;  3WRZ A;  2JKT I;  3MQ0 A;  1EI5 A;  3BY8 A;  3G4P A;  5EUA A;  2WGI A;  4R1G A;  4EET B;  3GR2 A;  3V67 A;  3MR0 A;  1BTL A;  2W0N A;  1W8Y A;  3A3F A;  3F1N A;  5AQA A;  1PNE A;  1FSY A;  1JTG A;  2HGV A;  4D2O A;  2G2W A;  4KQQ A;  3UB5 P;  2HP5 A;  4HQA A;  3L7H A;  2Y2I A;  3V50 A;  2ZLY A;  1S66 L;  4PKY G;  2PU4 A;  3HLC A;  2PDR A;  3T4S A;  1V9Z A;  3LEQ A;  2LB5 A;  1IYS A;  3N6I A;  3B3X A;  4NET A;  5LBR A;  3IX3 A;  2VV8 A;  4FCF A;  1BSG A;  4H6J A;  1TDG A;  4C6Y A;  4B93 A;  4MBH A;  3AGF A;  3D9Y A;  1YLP A;  3QP6 A;  4JGR A;  4UAA A;  3VP0 A;  2QJ7 A;  5DTT A;  1OT9 A;  1LL9 A;  5IHV A;  3O3V A;  3FPV A;  2GNX A;  3PBR A;  1XJ2 A;  5FAS A;  3I7J A;  1W79 A;  4Q0J A;  4X56 A;  1O7E A;  1FSW A;  4N1H A;  4OOY A;  2WZX A;  5J4E A;  1N9L A;  2WGV A;  3DWZ A;  4JGQ A;  2ZQ9 A;  3CIT A;  1NRF A;  4EQI A;  3BEB A;  4R4S A;  1NLZ A;  5J7E A;  3UE1 A;  2QYB A;  2Y2N A;  3QNC A;  4K08 A;  1WA9 A;  3ZG8 B;  1N9O A;  3HLG A;  4QHC A;  4HY8 A;  3UMD A;  1NZU A;  2BLS A;  3VFH A;  4OPR A;  1BLC A;  1JWP A;  1XX2 A;  4H6J B;  4II7 A;  4R23 A;  4E04 A;  4ESP A;  4OVD A;  4DDS A;  3DWK A;  4CJN A;  2Z6D A;  1ERQ A;  5F1G A;  2PD8 A;  2PBY A;  1Y54 A;  4RX2 A;  4CLC D;  2XA7 M;  1LSV A;  4OP8 A;  3DTM A;  5A92 A;  5CEC A;  1NJ4 A;  4LV1 A;  4OPY A;  1F9I A;  2Y2L A;  3CPT A;  2ZJ9 A;  4WMC A;  2X71 A;  4IJG A;  2W1R A;  4M4X A;  5EEC A;  2BG1 A;  4EXO A;  3UNW A;  2H0T A;  1PYY A;  4JF6 A;  3PBQ A;  1NRJ A;  4UQI M;  5MC7 A;  3JPU A;  1IKG A;  4HI4 A;  1GCE A;  4JKT A;  4B4X A;  1PI5 A;  3MXR A;  5CHM A;  1PWC A;  2W1T B;  2V1Z A;  1Z09 A;  3OOV A;  1RCJ A;  1W7F A;  4UHU A;  2XFS A;  5FQK A;  3ZG9 B;  5HZH A;  5HW3 A;  1JVJ A;  4LLO B;  3WS0 A;  1PWG A;  3KO6 A;  2XH9 A;  3HLF A;  1BLP A;  2XF3 A;  2P7J A;  2A49 A;  1QME A;  4OQI A;  1YMX A;  3NOT C;  1TS6 A;  5HWW A;  1OTD A;  3H7W B;  5FSR A;  3U2A A;  1I2W A;  3IXG A;  2XK1 A;  4LRX C;  3S1Y A;  3CMZ A;  3MZE A;  3V39 A;  1CJF A;  1KE0 A;  3RFB A;  1TDL A;  1VEU B;  2VEA A;  1XFQ A;  1M40 A;  4I38 A;  2VGL S;  5JYP A;  2PBD P;  3CUE C;  4WYY A;  2ACG A;  2V1B A;  2A3U A;  3ZNY A;  3A3D A;  1K55 C;  3R7W A;  3BFF A;  2W3H A;  3GTC A;  4O0P A;  3PAE A;  3S7O A;  3NIA A;  2PU2 A;  3OPR A;  3FC7 A;  3SS5 A;  3NJA A;  5HSQ A;  4EEP A;  3T4K A;  1T19 A;  4DE0 A;  3Q7V B;  2V1A A;  5G18 A;  1ZG6 A;  4IUK A;  3O86 A;  4KZA A;  2VV7 A;  1DP6 A;  2Z2L B;  2ZQD A;  3ZCZ A;  1OJ5 A;  2E8I A;  2JE5 A;  1PWD A;  1YKD A;  2OWH A;  1K54 A;  1HTZ A;  2JN7 A;  4NXG A;  3A0S A;  2G7U A;  4ZAM A;  5C5K A;  3IH9 A;  4PHT A;  4QU3 A;  3LIE A;  4KQO A;  3GV9 A;  1SDN A;  1D06 A;  1SHV A;  2Y2M A;  2GDN A;  3P01 A;  5AVF A;  5F83 A;  4X55 A;  1MY8 A;  3C2W A;  2A2L A;  2VGL M;  2VZW A;  1STZ A;  3IS2 B;  5F1F A;  3Q07 A;  5HD5 A;  1RP5 A;  3VP3 A;  5IT5 A;  5EVE A;  1YSP A;  4G3W A;  4Y2F A;  5FAP A;  1QMF A;  4EWF A;  3Q82 A;  4MBK A;  1UWN X;  3LYX A;  1L0E A;  1ALQ A;  3LIA A;  3EQU A;  1DRM A;  3N8L A;  2W3F A;  2Y2K A;  2XRO A;  5F82 A;  2LB9 A;  4YNR A;  2Q9M A;  1L3L A;  4WBG A;  5CER A;  4S2M A;  3F1P B;  3IHA A;  4Q0H A;  5HAP A;  1KOU A;  4NXF A;  1BUE A;  5TBM A;  3HL9 A;  3ZG5 A;  1OT6 A;  3UB8 A;  3IT9 A;  1H8Y A;  3GQZ A;  1MWS A;  5M1A A;  3LEZ A;  3W4O A;  2VGJ A;  1YMS A;  5EM1 A;  3UY6 A;  4HBU A;  3RXW A;  1Y4O A;  2WZZ A;  2G2U A;  4F94 A;  2P08 A;  1G6A A;  2B02 A;  3VE4 A;  2NUP C;  4IED A;  1K56 A;  1BLS A;  1TS7 A;  3ZVT A;  3KYQ A;  1E3U D;  2Y79 A;  1T1B A;  3H82 B;  2INW A;  4RX3 A;  2X02 A;  4L9F A;  2QHK A;  4PM8 A;  4MNR A;  4PMA A;  4BBT A;  4HJ6 A;  4KQR A;  3WRT A;  3ZVW A;  3LY3 A;  3GVB A;  4Y17 A;  1XGI A;  1KDW A;  4JXW A;  4EBP A;  2Q0O A;  4GJ4 A;  4I3J A;  3ITA A;  5HL6 A;  2M7U A;  1GHM A;  3Q1F A;  2FH5 A;  4ZRR A;  2WKH A;  3UE3 A;  4E3O A;  3VOL A;  4FH2 A;  3MQQ A;  4GW9 A;  4OON A;  5J3W A;  3IHB A;  1LHY A;  2ZOI A;  3TG9 A;  4HHD A;  5GHY A;  4Y3I A;  3HRE A;  4WZ5 C;  3TSG A;  2R78 A;  4PM6 A;  3BM6 A;  2A24 B;  3MBZ A;  4DE1 A;  5CTM A;  1P0Z A;  3VOZ A;  2FZ0 A;  1D1J A;  3GMW A;  1S6R A;  1IEM A;  3E4Q A;  4D60 A;  1KGF A;  1YAX A;  4GDN A;  4XUX A;  1U60 A;  1K4E A;  2Y4A A;  2P74 A;  2W3D A;  3C8C A;  5CHU A;  3W4P A;  4FTX A;  4E3J A;  1ZG4 A;  3MFD A;  4JXG A;  2EWW A;  1GSW A;  1IEL A;  3V5M A;  3ZYT A;  1L0G A;  3LIB A;  5L10 A;  4LFU A;  3G32 A;  5EV0 A;  3NUL A;  4E6X A;  3LID A;  1CEF A;  3UDF A;  3PTE A;  3HBR A;  1Q2Q A;  3E4O A;  5HAI A;  5F6A A;  2HJ9 C;  2Y2Q A;  3VMA A;  5GHX A;  3N8S A;  4RYE A;  1KVM A;  1NYM A;  3L9K A;  2O9C A;  2WAD A;  5FEG A;  4CLC B;  2JBF A;  4LPZ A;  2ZBB A;  3BYD A;  1SCW A;  4ZDX A;  4IVK A;  4OKP A;  3BQA A;  2XD5 A;  5CRF A;  3C4P A;  1DY6 A;  5E2G A;  5EVI D;  2W27 A;  4DMZ A;  4DE3 A;  4CLC C;  3SW1 A;  3IF6 B;  2GJ3 A;  4QWO A;  4Q8I A;  4ZJ1 A;  1P9W A;  4C75 A;  5CEB A;  2DCF A;  2H10 A;  3B33 A;  1ODV A;  3T1X A;  1S0W A;  4MN6 A;  1K57 A;  3BFC A;  3QP2 A;  1BT5 A;  3IF6 C;  2KLI A;  4IHQ A;  3UB7 A;  2ZC5 B;  3T4L A;  3OPP A;  4M3K A;  1ES4 A;  5FDH A;  3E2L A;  1GHP A;  4CLC E;  2Y55 A;  3T12 B;  2O99 A;  1K38 A;  4I39 A;  2J80 A;  5FQ9 A;  2EX8 A;  4ZTK A;  1H0M A;  3LUQ A;  1FOF A;  1NYY A;  4OLG A;  2K7S A;  1OTE A;  1K6R A;  4JGO A;  4KZ6 A;  3FYZ A;  2BTF P;  2J8Y A;  3LFV A;  4QB8 A;  4AFI A;  5L07 A;  2HP6 A;  2PYP A;  2OLU A;  3RTY A;  1NXY A;  4MBF A;  4OPZ A;  4EUZ A;  1UGU A;  2V0U A;  2JKG A;  1LL5 A;  4X68 A;  2XFT A;  2V8F A;  2W1T A;  4P85 A;  2R9W A;  3NOU C;  1W8Q A;  1MWR A; 
#chains in the Genus database with same CATH homology
 2VGL S;  2OAQ 1;  3HJI A;  4F3L B;  3F1O B;  3CUE C;  4Y5F A;  3T4O A;  2V1B A;  3EGX C;  4EER A;  3R7W A;  3VV4 A;  3BW6 A;  1ZTU A;  2VV6 A;  2W3E A;  2W3H A;  2PHY A;  2Z6C A;  3A0V A;  4ETX A;  2KX6 A;  2DMW A;  4EW7 A;  4O0P A;  3S7O A;  2PD7 A;  4BJP A;  4O8G A;  2P04 A;  2ZOH A;  3FC7 A;  3NJA A;  4EEP A;  5HSQ A;  1MC0 A;  3IBJ A;  4R3A A;  3T4K A;  3FPW A;  4I5S A;  5KSH A;  1T19 A;  4NKP A;  2V1A A;  3EEH A;  2BAS A;  1IFQ A;  1TS8 A;  4IUK A;  2KDK A;  3S7Q A;  5DKL A;  3CWF A;  5DF9 A;  2VV7 A;  3OCL A;  4L9E A;  3LIC A;  1DP6 A;  4HOI A;  5DJT A;  2L0W A;  2MJ6 A;  5HWV A;  4EQ1 A;  3H7W A;  1OJ5 A;  3LR0 A;  3PR6 A;  4RQ9 A;  1OJG A;  3LR5 A;  2JKT M;  1W63 M;  2GX5 A;  1BYW A;  1NLY A;  3IBR A;  3OC2 A;  2VX8 A;  1YKD A;  4NXE A;  3T4J A;  4CQH A;  2OWH A;  3PYP A;  1OTA A;  1TF1 A;  3JVV A;  4NXB A;  2YKH A;  4ARZ A;  2D01 A;  2JN7 A;  2CMN A;  4NXG A;  4GS9 A;  2VLG A;  3A0S A;  4HH3 A;  2G7U A;  1GSX A;  3BQ8 A;  5C5K A;  2IA2 A;  4PHT A;  5A8B A;  5G4Z A;  3MFX A;  3PBN A;  3F1O A;  4F3L A;  3LIE A;  4WN5 A;  4KQO A;  1EW0 A;  3HJK A;  1D06 A;  4UEY A;  5TJJ A;  4XT2 B;  2KOI A;  3P01 A;  2VJW A;  3T4T A;  3BY9 A;  5AVF A;  4B9O A;  4I3A A;  5F5Y A;  4L0L A;  3C2W A;  1DP9 A;  2J3T D;  4G3K A;  4WEK A;  1H8M A;  2H28 A;  5TBM B;  4R6L A;  2A2L A;  2VGL M;  4LRY C;  3D72 A;  4ETZ A;  2VZW A;  4KQD A;  4EU0 A;  1STZ A;  3BWL A;  3IS2 B;  1GSV A;  2XA7 S;  4BWI A;  3EOI A;  5HD5 A;  2V0W A;  3KSI A;  4OOM A;  1MKM A;  5DFY A;  4JGP A;  5IT5 A;  1IOU A;  1YSP A;  4G3W A;  2ZMF A;  3CAX A;  4GCZ A;  4Y2F A;  5IU1 A;  3NHQ A;  3PXP A;  1T1C A;  4ME4 A;  4R38 A;  2VA0 A;  3LR3 A;  5DKK A;  4QPR A;  3MQO A;  1UWN X;  2L1M A;  2PYR A;  2QJ5 A;  3KSH A;  3LYX A;  1XJ6 A;  5HPI A;  1OTI A;  3PBS A;  1T1A A;  2J3T C;  5K5B A;  3LIA A;  3EQU A;  1DRM A;  1T18 A;  4Z1W A;  2W3F A;  3F1N B;  2XRO A;  1Y28 A;  1P97 A;  5L8M A;  4XT2 A;  3D3O A;  1VHM A;  2K2N A;  2LB9 A;  4YNR A;  3O5Y A;  5AJG A;  4I3I A;  2XSS A;  3F1P B;  2O9A A;  2HJE A;  4Q0H A;  3C30 A;  2QKP A;  3LIF A;  3CLO A;  1KOU A;  4UQI S;  5HD3 A;  3PHY A;  4NXF A;  4MMN A;  5TBM A;  2HV1 A;  1OT6 A;  3UB8 A;  3EEA A;  2B18 A;  1LT0 A;  5F69 A;  3IS2 A;  3ULF A;  1JNU A;  1LL8 A;  4G3V A;  2W3G A;  4WEL A;  4EES A;  5HDC A;  4YWZ A;  3GEC A;  4BBU A;  2J3W A;  5EFW A;  3EQV A;  2QWS A;  2P08 A;  1H3Q A;  2B02 A;  3K2N A;  2JKT I;  3VE4 A;  3LI8 A;  3MQ0 A;  2NUP C;  3BY8 A;  1NWZ A;  3UME A;  3OCN A;  1G28 A;  3R4K A;  5F68 A;  4EET B;  2VKS A;  3B47 A;  4Q0I A;  1TS7 A;  4R70 A;  3K3C A;  3KYQ A;  2PR6 A;  3V67 A;  3MR0 A;  2Y79 A;  4MDZ A;  2W0N A;  1T1B A;  4HH2 A;  3H82 B;  4LRZ E;  3F1N A;  2INW A;  2OWJ A;  2HGV A;  3VE3 A;  3CUE A;  4FOF A;  4L9F A;  4DJ2 A;  4HQA A;  2QHK A;  2O0Y A;  5DJU A;  3JVU A;  1S66 L;  4KUO A;  4PKY G;  4BBT A;  3F1P A;  4HJ6 A;  2PDR A;  3T4S A;  1V9Z A;  3BJN A;  4WLA A;  2LB5 A;  2HF6 A;  4BMW A;  5LBR A;  2M1C A;  5I5L A;  1DP8 A;  1S4S A;  4MN5 A;  1MZU A;  4GHI B;  4WF0 A;  3FG8 A;  3DBA A;  4GJ4 A;  4I3J A;  4IUH A;  2VV8 A;  5HL6 A;  2M7U A;  3ZQ5 A;  5DFX A;  1F5M A;  2FH5 A;  4H6J A;  4ZRR A;  3UE3 A;  3LR4 A;  3VOL A;  3H9W A;  3MQQ A;  1P9R A;  4GW9 A;  4B93 A;  3E4P A;  5J3W A;  4WL9 A;  1V9Y A;  5HDS A;  2ZOI A;  2PR5 A;  4HHD A;  4JGR A;  2EA9 A;  4Y3I A;  2QJ7 A;  4O01 A;  1OT9 A;  2M7V A;  2ZMV A;  4P6Z S;  4DJ3 A;  2R78 A;  3S7P A;  3H82 A;  3FPV A;  3A0R A;  2XRN A;  2A24 B;  2GNX A;  3PBR A;  2O9B A;  1XJ2 A;  1UWP X;  1P0Z A;  3PBT A;  5IS1 A;  4Q0J A;  4PAU A;  3UB6 A;  2FZ0 A;  2I9V A;  4GLQ A;  5FL3 A;  1W63 Q;  5J4E A;  3E4Q A;  1N9L A;  2JKR M;  1YAX A;  4JGQ A;  3CIT A;  4GHI A;  2W3D A;  3NOP C;  3C8C A;  1NLZ A;  5J7E A;  2OAP 1;  2QYB A;  4HP4 A;  1OPX A;  1S4R A;  2EWW A;  1GSW A;  3MF0 A;  4MN7 A;  2OOL A;  4K08 A;  1G6O A;  1WA9 A;  2WKR A;  1N9O A;  1VB6 A;  4HY8 A;  3ZYT A;  4WEJ A;  3UMD A;  3LIB A;  3TW8 A;  4H6J B;  4II7 A;  4E04 A;  1S1Z A;  2Z6D A;  2PD8 A;  2A24 A;  3LID A;  1LSX A;  3T50 A;  3K3D A;  3E4O A;  2L4R A;  4CLC D;  2XA7 M;  1LSV A;  4HNB A;  5F6A A;  2HJ9 C;  3PBO A;  3KYZ A;  3ICY A;  2WKQ A;  4P6Z M;  3TRC A;  2O9C A;  5HDD A;  5KIZ A;  1F9I A;  2NUT C;  4WUJ A;  3B42 A;  4CLC B;  4LPZ A;  5G4Y A;  2ZBB A;  3KSF A;  4EUV A;  3E0Y A;  3UB9 A;  2EWV A;  3BQA A;  4HJ3 A;  1LSW A;  4OOL A;  3G6O A;  4IJG A;  2W27 A;  4DMZ A;  1X0O A;  4CLC C;  5HWT A;  3SW1 A;  2YKF A;  2GJ3 A;  2V9A A;  2K31 A;  2W1R A;  4M4X A;  4EXO A;  1P9W A;  3KSG A;  3LI9 A;  1S67 L;  3B33 A;  4YOF A;  1ODV A;  4MN6 A;  2JHE A;  3P7N A;  3PBQ A;  1NRJ A;  4UQI M;  5MC7 A;  4HI4 A;  2KLI A;  4BBV A;  4IHQ A;  3UB7 A;  2WKP A;  3KX0 X;  3T4L A;  3OLO A;  4CLC E;  3HCY A;  3MJQ A;  2W1T B;  2O99 A;  1XJ3 A;  4I39 A;  2JKR I;  3TJZ C;  3OOV A;  2J80 A;  1TS0 A;  3MXQ A;  1XFN A;  4CLC A;  3LUQ A;  5HZH A;  3UE6 A;  3TE8 A;  4HP9 A;  4LLO B;  3OBF A;  3EGD C;  3R7W B;  3EWK A;  4MCW A;  4EEU A;  1XJ4 A;  1TD5 A;  3MMH A;  2K7S A;  3C38 A;  1OTE A;  3KO6 A;  5CX7 A;  4JGO A;  4DN0 A;  2D02 A;  1F98 A;  1D7E A;  3CI6 A;  2P7J A;  1S1Y A;  5AVE A;  1ZHH B;  3GDI A;  3LFV A;  3S7N A;  2Y8H A;  2GZA A;  4HJ4 A;  4HIA A;  3NOT C;  4AFI A;  2PYP A;  1OTB A;  1TS6 A;  5HWW A;  1OTD A;  3H7W B;  4L9G A;  3U2A A;  3RTY A;  1YSQ A;  3T4Q A;  4LRX C;  4KUK A;  1N9N A;  4NEE D;  1UGU A;  2V0U A;  4PKY A;  3RFB A;  3RH8 B;  3W2Z A;  2VEA A;  4FSF A;  4ARZ B;  2W1T A;  3E98 A;  2PT7 A;  3NOU C;  1XFQ A;  4GS9 B;  5HPF A;  4I38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...