3UB6A

Periplasmic portion of the helicobacter pylori chemoreceptor tlpb with urea bound
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
164
structure length
164
Chain Sequence
b'LAQLMEHLETGQYKKREKTLAYMTKILEQGIHEYYKSFDNDTARKMALDYFKRINDDKGMIYMVVVDKNGVVLFDPVNPKTVGQSGLDAQSVDGVYYVRGYLEAAKKGGGYTYYKMPKYDGGVPEKKFAYSHYDEVSQMVIAATSYYTDINTENKAIKEGVNKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chemoreceptor TlpB
publication title Structure and proposed mechanism for the pH-sensing Helicobacter pylori chemoreceptor TlpB.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Membrane protein
total genus 56
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17200 sCache_2 Single Cache domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ub6A00
1T18A 1TS0A 4L9GA 3UE6A 1XJ2A 3MJQA 2ZOIA 4EESA 3LIDA 2L0WA 1XFQA 1DP8A 3IBRA 1XJ3A 5F69A 4EEPA 2W0NA 1LSXA 1GSWA 1OT9A 3UB7A 4GS9A 1OTIA 4NXEA 4HP4A 3C2WA 3UMEA 1N9NA 2H28A 2I9VA 2V0UA 2Z6CA 1P0ZA 1ODVA 5EFWA 3GDIA 1LSWA 5IS1A 1S4SA 4I3AA 2ZOHA 1P97A 4PKYG 4H6JA 4EETB 1T1AA 4WUJA 3VOLA 3LIEA 2L1MA 3HJKA 2VLGA 4WL9A 3LYXA 1VB6A 4GW9A 3T50A 5DKLA 4HH2A 3UB8A 3IS2A 3UB6A 5F5YA 5HD5A 2INWA 1XFNA 5HDDA 4LRZE 2PHYA 3VE4A 1TS6A 1UGUA 4HIAA 1T19A 4RQ9A 1DP6A 4K08A 4GCZA 1D7EA 2Z6DA 4MN6A 3MQQA 4WF0A 2M1CA 5F6AA 3C8CA 2VV6A 2VEAA 4BBTA 1GSVA 5HDCA 1S67L 4R3AA 3H82B 3B33A 3MR0A 1NWZA 3F1OA 3H9WA 4NXFA 3BY9A 1EW0A 4E04A 4XT2B 3H7WB 5HWVA 1OTEA 3RH8B 2PD7A 3E4OA 3BY8A 1D06A 3P7NA 3ICYA 4WN5A 3LUQA 3F1NB 3ULFA 3NOPC 4F3LB 1F9IA 4GHIA 4LRYC 4I3IA 2JN7A 5DKKA 1OTBA 2B02A 4JGOA 3D72A 2WKQA 3OLOA 2BASA 2A24B 5TBMB 1T1BA 4EEUA 3PHYA 4HJ6A 5I5LA 3EEHA 4I5SA 2KDKA 2EA9A 3RTYA 1S4RA 1G28A 3BWLA 2WKPA 2R78A 5J7EA 1OTAA 4EQ1A 1OTDA 4WLAA 2PYRA 1N9OA 2V1BA 5A8BA 2QJ7A 1DRMA 2HV1A 3LIFA 5KIZA 3SW1A 4GS9B 1X0OA 3FC7A 3CAXA 1BYWA 4BBVA 4LRXC 1LL8A 4KQDA 3H7WA 4HY8A 5DJTA 2ZBBA 4NXBA 3MFXA 4EERA 2QWSA 4HNBA 2D01A 4H6JB 1S1YA 1LT0A 4HQAA 3HJIA 3CWFA 2PYPA 3NOTC 4PKYA 1S66L 4B9OA 4L9FA 5F68A 3MQOA 3E4PA 2J80A 2OWJA 4NXGA 3NOUC 1TS7A 5G4ZA 4I3JA 3ZQ5A 2QHKA 4R38A 1OJ5A 3FG8A 4MN5A 5AVFA 3K3DA 3VE3A 1OT6A 2A24A 5IU1A 5TBMA 3NHQA 3IS2B 1V9ZA 4LLOB 3GECA 4HH3A 3LIBA 2VV8A 4YWZA 3F1PB 5HWWA 4EW7A 1XJ4A 1N9LA 3EWKA 5DJUA 4I39A 2QKPA 2P7JA 5HSQA 2K7SA 4R6LA 2KX6A 2OOLA 1DP9A 3LICA 3UMDA 3UB9A 5J4EA 1V9YA 4LPZA 2GJ3A 2V9AA 5AVEA 4HI4A 1OJGA 4DJ3A 1JNUA 2VV7A 2CMNA 5HZHA 3LIAA 5HWTA 3F1OB 5G4YA 4KUOA 3NJAA 3KX0X 3LI9A 1GSXA 4JGQA 3H82A 2D02A 2W27A 4HOIA 4EXOA 5J3WA 2QJ5A 2PD8A 1S1ZA 2PR5A 1Y28A 1MZUA 1KOUA 2PR6A 3A0SA 4DJ2A 3PYPA 4HP9A 2JHEA 5HDSA 1TS8A 2YKFA 4XT2A 5HD3A 2OWHA 2YKHA 3F1PA 4BBUA 3E4QA 4GHIB 3A0RA 1LSVA 4I38A 1XJ6A 1T1CA 2V0WA 3F1NA 1UWPX 4HHDA 4HJ4A 4JGRA 3LI8A 4JGPA 4F3LA 2PDRA 3K3CA 2V1AA 4L9EA 4HJ3A 3CLOA 3MXQA 1F98A 3G6OA 4R70A 4KUKA 1UWNX 1WA9A 2L4RA 4M4XA 2WKRA 3A0VA
chains in the Genus database with same CATH superfamily
1TD5A 4C6YA 1SCWA 4L9GA 4BLMA 3UE6A 2O9BA 1NJ4A 2RL3A 2ZOIA 3MS6A 4XUZA 2EXAA 4D2OA 1XFQA 3D4FA 1BLSA 3HUOA 3NBLA 1L3LA 1K54C 3VSKA 1IELA 1GSWA 4P6BA 1ZG4A 4OPQA 3SS3A 2NUPC 4Y0UA 3IF5A 4HP4A 3UMEA 2V0UA 2Z6CA 1P0ZA 2FH5A 1LSWA 1S4SA 3M2KA 3ZVWA 3QP5A 2WKIA 4EETB 2XQZA 4S2LA 4BL3A 3FKWA 4OOMA 4PM8A 1ES3A 1ERQA 2J9OA 5CERA 4UQIS 3BQAA 3S7PA 3T4KA 5EOOA 4E6XA 4HH2A 3IXGA 4OQHA 2HGVA 5JYPA 4IHQA 4Y3IA 5HX9A 3IXHA 1W7FA 5M19A 1BLPA 4K91A 2Y2JA 3MKFA 4EBLA 2BG1A 4B4XA 4U0TA 4EQIA 2WZXA 1XFNA 5HAPA 3UDFA 3DWKA 1NRFA 5L09A 2H5SA 5CGWA 4ME4A 1DP6A 5J8XA 3BQ8A 3PBQA 2Z6DA 3UDIA 4H8RA 3N7WA 4EU0A 5EVIB 3C38A 5CX7A 2V8CA 3C8CA 5D3OA 3CITA 4CLCA 4BBTA 4JF5A 5A93A 4KZ5A 5HDCA 3LR0A 3C30A 3B33A 5A90A 2J7VA 4WZ5C 4QHCA 3G35A 4NXFA 3SH9A 3BJNA 4S2MA 1FCNA 4QJGA 4KQQA 1J9MA 4ZTKA 5L8MA 4XT2B 4EUVA 1K57C 1XA1A 3IXDA 1H8ZA 4MCWA 4IUHA 1HVBA 4R1GA 4MBFA 4Y13A 2GNXA 1BZAA 2PBDP 2UWXA 3IXBA 1K4EA 4E3KA 3MXRA 3LUQA 3F1NB 2ZM0A 1ESUA 4F3LB 1F9IA 5GLAA 3BFEA 2JN7A 4S2JA 5DKKA 1XKZA 3T1XA 4GJ4A 3D72A 1KVMA 4R0QA 1ZC2A 3OLOA 1OPXA 2A24B 4Y7PA 3T4LA 2ZMVA 3T4OA 4UHUA 2XDMA 2HF6A 5EVID 2ZL1A 5I5LA 3EEHA 1H5XA 2PU2A 4MMNA 1G28A 2JKRM 4NKPA 1NZUA 2W3DA 2R78A 5J7EA 3QHYA 5FQ9A 1N9OA 4DN0A 3I7JA 3UPNA 3E2LA 4QWOA 2P74A 1PRQA 3LIFA 5KIZA 4OH0A 4WMCA 1ZKJA 2Y55A 3OPHA 4GS9B 4Y2FA 3RXXA 5L2FA 1MWUA 3VOZA 1BYWA 3GQZA 4LRXC 1LL8A 1NYYA 2A49A 4IJGA 1XGIA 3A3JA 4N92A 2ZBBA 1K55C 3Q81A 4NXBA 1Q2QA 4LV2A 2QWSA 3JVUA 3R7WB 1GHPA 1HZOA 4HQAA 1CI9A 2FFFB 3HJIA 2PYPA 4B9OA 3MQOA 1Z09A 4O8GA 3BEBA 3PBOA 3CZDA 2ZC7A 3EEAA 4I3JA 1OMEA 3BYDA 2ZQDA 1OJ5A 3FG8A 5AVFA 3K3DA 1E25A 5KSCA 3G34A 2XK1A 2AVXA 5IU1A 3V5MA 3IS2B 1V9ZA 1YLZA 4OQIA 1ALQA 1JWVA 1KDSA 1WE4A 2PAVP 1W63Q 2VV8A 2LB9A 3S7QA 4YWZA 3HVFA 5HWWA 2WGWB 3BM6A 3ZDJA 1H8YA 3EWKA 3PBTA 4ZRRA 5DJUA 1MXOA 2P7JA 4DDSA 3EGDC 3O88A 3C4OA 3NCKA 3MBZA 2KLIA 1ZG6A 1IKIA 2OAQ1 3TE8A 4LPZA 2XROA 5KZHA 1PFLA 4KG6A 2PRFA 3FWLA 4ZJ1A 3L9KA 3BRMA 2QZ6A 4N1HA 3QP4A 5AVEA 4QPRA 1OJGA 4DJ3A 4MLLA 2CMNA 5HZHA 2JC7A 4NETA 2EX2A 3W4OA 2JCHA 3LIAA 3FV7A 3N8SA 1CK3A 1G68A 3LI9A 5EVLA 1GSXA 2XF3A 1GHMA 3P01A 4O01A 4S2NC 2QJ5A 1ES4A 1VQQA 2ZC3B 1CF0A 1Y28A 1MZUA 3LFVA 4DJ2A 3PYPA 1F5MA 4HP9A 2JHEA 3U4LP 4XT2A 1DJCA 1PI4A 1MBLA 1FSWA 3IH8A 4X56A 5CHMA 2H10A 4DE3A 1NYMA 5IT5A 1LSVA 2HP9A 3SH7A 4X68A 2W3EA 2Y79A 3TG9A 3UPOA 3F1NA 1FQGA 1UWPX 2B18A 4F3LA 2C5WB 1KVLA 5DTSA 2ZM2A 2Y2GA 1G5UA 1BSGA 4X69A 2G2WA 1JWZA 2OV5A 1IYSA 3Q7VA 4IBRA 3UE3A 5DF8A 1Y54A 2E8JA 3AGDA 4KZ7A 4UAAA 5TGFA 3MXQA 1F98A 3G6OA 4KUKA 4OP5A 3WS0A 3G32A 5G18A 2L4RA 2M7VA 2V20A 4OP8A 3A0VA 2I72A 5K5BA 3C7UA 5GHXA 2JE5A 1M6KA 3TSGA 1XJ2A 3M6HA 4UEYA 3MJQA 4WYYA 1I2WA 5IHVA 1XX2A 4WBGA 3GVBA 2PBYA 4BD1A 1PW8A 4QD4A 3ISGA 1LSXA 5HPFA 4FSFA 5FI7A 1TF1A 3PXPA 2H0TA 4GS9A 1NXYA 4OPZA 2XFTA 3W2ZA 2H28A 2DRWA 1D1JA 1ODVA 3NC8A 4CLCE 2Y2QA 3NECA 2ZOHA 4Y15A 5GLCA 4MN7A 4PKYG 3R7WA 3Q1FA 5FQMA 1T1AA 4JXGA 2W3FA 3VOLA 4BL2A 2HZ5A 4HBTA 1YMXA 4KZ8A 3HCYA 1HD8A 1YLYA 2L1MA 3IX8A 2EX6A 3G4PA 4FH2A 4X53A 3MZDA 4CQHA 4PMAA 3T50A 1WYBA 4S2PA 2X02A 3IS2A 2Q9MA 4KZ4A 4KZ6A 5KMWA 2QPNA 3PTEA 2XRNA 3UB6A 2O9CA 1K56A 3KSFA 1HTZA 5F5YA 2Q9NA 4AFIA 3VOYA 1ES5A 1QMEA 4GD8A 4ETXA 1PIOA 5A92A 3IQAA 3S7NA 4KZ9A 4GB7A 4P85A 4JXWA 3W8KA 4PM9A 2PHYA 3VE4A 4MNRA 4GLQA 4DE1A 1YPRA 1F2KA 3VFFA 4PM5A 1D7EA 5EECA 5FQQA 4PPRA 4KZAA 3D3OA 4CLCD 1P9RA 1JWPA 2ZD8A 2VEAA 1AWIA 1VHMA 3O5YA 1AXBA 3T1SA 1IYPA 4UA9A 3MR0A 3WS5A 2EX8A 3UE0A 3S7OA 4IUKA 3VV4A 4HEFA 3N4IA 5AQ7A 4ARZA 5EVEA 1E3UA 5JYOA 4X1MA 3KYZA 1EWZA 1FOFA 2ZQ9A 4OONA 4OLGA 4UQIM 4DE0A 5CHUA 1XPBA 3BLMA 4OLDA 2PD7A 3E4OA 4FD8A 1MWSA 3WWXA 1D06A 3P7NA 3ICYA 5EPHA 4WN5A 5L07A 3E2KA 3VP1A 2Y2OA 3UY6A 2R9WA 3P09A 4CJNA 1OTBA 2B02A 3LO7A 2WKQA 2BASA 1KE4A 1T1BA 2EXBA 4C75A 5M1AA 3KO6A 4PAUA 4G3WA 4I5SA 2KDKA 3PBNA 4Y17A 4ZBEA 3HLCA 3BWLA 4WLAA 2PYRA 4S2IA 5A8BA 1K57A 5MC7A 4WMCD 3IF6C 3GRJA 3W4QA 1XA7A 2Y2LA 1PZPA 2X01A 4BBVA 4KQDA 5GHYA 3H7WA 4MEZA 4Q0HA 5GLBA 5FEGA 3CMZA 3M2JA 5U47A 3MFXA 2D01A 4LV0A 1LT0A 4F94A 3NOTC 4PKYA 4UA6A 5FL3A 1N9BA 4L9FA 1PWDA 2XR0A 3E4PA 5HPIA 2J80A 2OWJA 3NOUC 5G4ZA 3ZQ5A 5CECA 4YINA 3PR6A 1CQAA 3DTEA 3C4PA 3EQUA 4G3VA 3R4KA 1MC0A 2DCFA 4Z1WA 1GA9A 2W1RA 4IEDA 2P9VB 1RCJA 3L7HA 3LR5A 1XJ4A 2H0YA 2J3TD 4R4SA 3MZFA 3QNBA 2LB5A 1PWGA 5HARA 4WEJA 2NUTC 4JXSA 1K55A 2OOLA 1DP9A 3LICA 4BD0A 3UMDA 1PNEA 5CEBA 4GNUA 3DTMA 3Q7VB 2GJ3A 4GOGA 2V9AA 2Z2LB 3QP2A 3S22A 1JNUA 2VV7A 3Q7ZA 2ZQCA 5E2EA 3G30A 2O0YA 4FUWA 3VP2A 2HDSA 3F1OB 2Y2HA 1SZVA 1YSQA 4G3KA 4ZAMA 5G4YA 3NJAA 3CJMA 1MPLA 1CEGA 4YOFA 2VGLS 2XFSA 2W27A 4EXOA 3CHWP 5CXWA 1S1ZA 4OPRA 3TW8A 3MZEA 4ESPA 4JF6A 4OKPA 3KSIA 2YKFA 3M6BA 4D60A 3F1PA 4NK3A 1ESIA 3HLEA 5C5KA 1MY8A 3A0RA 2VGJA 1L0EA 1L0DA 3OCLA 3PAEA 1PI5A 4DRTA 3UNWA 1PZOA 2O99A 2PDRA 3TOIA 3ZG8B 4BWIA 4O7DA 2MJ6A 3PAGA 1VEUB 3FYZA 3CLOA 3SS5A 2ZMAA 2HP6A 1KGEA 1IEMA 4OQ0A 3ZFZA 4OOYA 4R70A 1UWNX 1ZTUA 2X71A 2WYXA 2EWWA 3IWOA 4E3OA 1BLHA 4M4XA 1DJBA 5I94A 3QP1A 3FKVA 1TS0A 3B42A 1YLTA 4S2NA 1BUEA 4UA7A 4EESA 2HP5A 3CUEC 1FIKA 1DP8A 4EEPA 4WM9A 4X25A 5FI6A 3HLWA 1OT9A 3T4JA 1OTIA 2Y2NA 3T12B 2UV0E 5EM0A 2WKHA 5FSRA 2I9VA 4QY5A 2CC1A 2HJEA 5EFWA 1YMSA 3GDIA 5CTMA 3WS1A 4I3AA 3B3XA 3T4SA 3GR2A 1P97A 3ZG0A 1O07A 3BLSA 1J3WA 3AGEA 3OC2A 4X1LA 3MFDA 4ARZB 3HUMA 2IWDA 1H8MA 2VLGA 2Y2KA 4DXCA 4WL9A 3RFBA 1YT4A 4N9LA 1VB6A 4GW9A 1GA0A 3BW6A 1MWRA 3IF6B 2ZC6B 5DTKA 3UB8A 5F82A 2HJ9C 1K56D 4GZBA 3V3SA 2ZC4B 1KGFA 5FI2A 3FZCA 2P9VA 1EI5A 1SHVA 2V8FA 4Q0JA 2VK3A 2EX9A 3KYEA 2INWA 2WGVA 3TRCA 1LL9A 5EUAA 4LRZE 3ZNYA 2A2LA 1TS6A 1TEMA 4HIAA 1W8YA 4KG5A 1G6OA 5M18A 1YLPA 5GHZA 3BECA 4K08A 4GCZA 1A0KA 1EROA 4E3JA 2J8YA 5HW3A 3JYIA 3MQQA 4WF0A 3ZG7B 5F6AA 5GLDA 2VV6A 5EOEA 4EV4A 1GSVA 2R9XA 3HREA 3GTCA 4KQOA 1S67L 4MBHA 1FILA 2EFUA 3F1OA 3IX3A 4LFUA 3MF0A 5EVIC 1E3UD 3NULA 1FR1A 3BY9A 3MXSA 1IOUA 1EW0A 1S6RA 3HLFA 3H7WB 4E3MA 1OTEA 1KGGA 4EBNA 5DFXA 1S0WA 1GHIA 3RH8B 3V3RA 2Y91A 1L2SA 3CI6A 4GKUA 4FTXA 3HLDA 3OPLA 3ITBA 2VKSA 4BMWA 3OOVA 3DWZA 4GN2A 2OLUA 1C3BA 2XEPA 2QYBA 1PYYA 2WGIA 4I3IA 3T1RA 5FASA 5EM1A 5DF9A 3WRZA 4LENA 3VMAA 4JGOA 1IKGA 5HAQA 2WUQA 4P87A 5DF7A 3V67A 3C5AA 1VEUA 1H0MA 3PHYA 3DW0A 4HJ6A 4R23A 1S4RA 3RTYA 3T1QB 4MDZA 5DTTA 4B88A 5AQ9A 3NIAA 1K38A 1M40A 3IHAA 1OTDA 4NG2A 3OZHA 1K54A 4XXRA 2V1BA 4P6ZS 5AJGA 5FEFA 2QJ7A 1DRMA 3NDGA 1YSPA 2HV1A 3VP0A 1YKDA 1X0OA 2Y2PA 2JKRI 4WZ4A 1K0KA 3HBRA 1NLZA 1L0FA 3BFDA 5DJTA 4E3LA 5E2FA 3S4XA 2ZJ9A 4H6JB 1S1YA 4JKTA 3O3VA 3CWFA 3UPPA 4Y0TA 3ZVTA 5F68A 4EBPA 3A3DA 1BULA 1MWTA 1TDLA 3OPPA 1LI0A 4K0XA 3VE3A 1ONHA 5TBMA 4X6TA 5FATA 3GECA 2Y8HA 4HH3A 3DBAA 4OOLA 3IF6A 2P08A 3F1PB 2BLSA 2K31A 1N9LA 4IVKA 4RA7A 3UB5P 5KSHA 1K6SA 5CGSA 1STZA 4Z9QA 3N6IA 4RYEA 2K7SA 2PU4A 2WK0A 2JKTM 4MBKA 4OQGA 5TR7A 4JPMA 4KZ3A 4LGWA 5J4EA 1V9YA 3FPWA 4LV1A 1IYQA 2ZM8A 3KSGA 4ZJ3A 4DKIA 1MKMA 4EWFA 1LLBA 1IYOA 1BTLA 4WZ5A 5AQBA 3UN7A 5HL1A 2ZQ8A 5FQIA 3IH9A 5TFQA 4KUOA 3O86A 3KX0X 3DAVA 2HDQA 2E8IA 2D02A 4HOIA 5F1GA 3VFHA 1VETB 3C7VA 2DMWA 4NEED 2PD8A 4DF6A 3A0SA 1KE0A 5EE8A 1KDWA 1XGJA 5E43A 4HBUA 4ID4A 5HDSA 1TS8A 3RJUA 3NY4A 1P9WA 2Y59A 5HD3A 1Q2PA 2G7UA 2OWHA 3G2ZA 4BBUA 2XD1A 3WRTA 4GHIB 2V2FF 5CTNA 1LI9A 3T4QA 3TJZC 1T1CA 2V0WA 4HHDA 4JGRA 1I5QA 3LI8A 3E0YA 4JGPA 4X55A 3K3CA 2V1AA 3ZGAB 3UDXA 1W8QA 4HJ3A 5FQJA 3JVVA 2VX8A 1L0GA 1N4OA 3QNCA 3OPRA 4Y5FA 5CEDA 1Y4OA 1YLJA 1WA9A 3LEZA 3ZG9B 2WKRA 3MQ0A 1YM1A 3ZNTA 1T18A 3BFFA 4N9KA 2O9AA 1NY0A 3S1YA 3NI9A 3OBFA 4S2OA 3LIDA 2L0WA 1G6AA 3UE1A 3IBRA 1XJ3A 5F69A 3LY4A 2W0NA 3SH8A 4PHTA 1SKFA 4GDBA 3UB7A 2VGLM 3N8LA 4NXEA 1Z6FA 4YNRA 3C2WA 1KE3A 1N9NA 3IWIA 2ZC5B 1HLUP 4BENA 1BLCA 1WYCA 2W3HA 2V1ZA 3V39A 3EQVA 3MSHA 5IS1A 1RP5A 4H6JA 1RGZA 2Q0OA 1LHYA 4GD6A 2IWCA 4WUJA 4Q8IA 1JVJA 2ZQ7A 3LIEA 2OAP1 4CLCC 2K2NA 3AGFA 5FAQA 2RCXA 3HJKA 3LGOA 4M3KA 4Y0OA 2XLNA 1ES2A 3MMHA 2J9PA 5FA7A 3LYXA 1XXMA 2XA7M 4GDNA 2KOIA 2WZZA 5LBRA 5HAIA 5DKLA 1K25A 3VP3A 3BFCA 3CPTB 2JKFA 3CUEA 5E2HA 4A5RA 1QMFA 4PM7A 4JF4A 5HFOA 1GCEA 4JLFA 3KSHA 5TJJA 1CI8A 1FSYA 3SOIA 2Z2MB 5HD5A 1IFQA 4FH4A 5BOHA 2QMIA 5HDDA 4LV3A 3UO9A 3WS2A 4DMZA 1UGUA 2XA7S 3ZCZA 1T19A 4JBFA 4HESA 4RQ9A 3LR3A 3ITAA 1SKOB 2W1TB 1I2SA 4LCMA 4BJPA 4MN6A 4II7A 2M1CA 2WADA 1JTDA 2WKEA 5CRFA 5AQAA 4PM6A 2P04A 3BFGA 4IVIA 4R3AA 3H82B 4R3BA 2IA2A 1NWZA 3H9WA 1SDEA 2XH9A 5CGXA 5DFYA 2ZQAA 3DTKA 2GZAA 2HDUA 4E04A 1VETA 1K6RA 2HPBA 2GX5A 1U60A 5HWVA 1W5DA 3JPUA 1DJAA 2JKGA 3HLBA 4B93A 3G2YA 3OCNA 3BY8A 1LL5A 2XSSA 2VGKA 1CEFA 2C6WB 1O7EA 4YFMA 3T4TA 4QB8A 3RXWA 4FOFA 3ULFA 3V50A 4ZJ2A 5F1FA 3NOPC 2ZLYA 4GHIA 4E3NA 3FPVA 3W4PA 4LRYC 4U0XA 4KG2A 1W79A 3SZTA 2OLVA 3VP4A 3ZG5A 2VJWA 3IX4A 5TBMB 3N8RA 2JKTI 4EEUA 5FAOA 5EVIA 2EA9A 3O87A 4EUZA 5F83A 1YAXA 2WKPA 1OTAA 4EQ1A 2M7UA 3GV9A 5L10A 4E3IA 4QU3A 3P98A 3SW1A 4OVDA 4K0WA 3FC7A 1TVFA 2J3TC 3CAXA 1YLWA 4JXVA 4WELA 3Q82A 4XUXA 4HY8A 1RGYA 1H3QA 3LCEA 2VA0A 4P0MA 4N1XA 3NDEA 3GSGA 4EERA 4ETZA 4HNBA 3HL9A 1S66L 5FAPA 1SDNA 4DE2A 3KYQA 2WAFA 3LEQA 3QP8A 4O0PA 4CPKA 4LCLA 1E4DA 3ZYTA 4L0LA 4NXGA 3SS4A 1MKIA 1CJFA 1TS7A 1ERMA 5HL6A 2QHKA 4R38A 5EV0A 1K4FA 1PWCA 4MN5A 1PW1A 3WS4A 1OT6A 3PBRA 1ACFA 2A24A 3B47A 3EGXC 3NHQA 4LLOB 1JTGA 2ACGA 2WAEA 3GMWA 3LIBA 2EWVA 4KQRA 2GDNA 2J3WA 4BQMA 2IWBA 5FQKA 4EW7A 3CPTA 2A3UA 2B5RA 3E98A 2XGNA 3IHBA 4I39A 3PBSA 2DNSA 2QKPA 2OSUA 5GL9A 5HSQA 4R6LA 2FFYA 5FDSA 2FZ0A 5DVAA 2KX6A 4FCFA 4P6ZM 4RX2A 2Y2IA 3UB9A 1VM1A 3LY3A 4RX3A 2EFXA 3K2NA 2G2UA 4HI4A 4CLCB 1SKOA 2W1TA 3HLGA 4DXBA 4DDYA 1NLYA 1ZHHB 1W63M 5HWTA 2ZMFA 2Y4AA 2PT7A 3QP6A 4RVAA 5CHJA 4JGQA 3H82A 2VZWA 5A91A 5J3WA 5FDHA 4WEKA 2BTFP 2PR5A 1KOUA 2PR6A 2HDRA 4B4ZA 3G31A 3EOIA 4IBXA 3LR4A 3DTIA 1BT5A 4R4RA 2YKHA 3IBJA 3MKEA 2WGWA 3U2AA 3IWQA 4KENB 1NZOA 2W3GA 3E4QA 2JBFA 4I38A 3A3FA 4C3QA 2Y2MA 1XJ6A 3D9YA 2B95A 3Q07A 4S2KA 4HJ4A 3IT9A 1FCMA 1XP4A 5E2GA 4ZDXA 3VSLA 4OPYA 4Q0IA 4L9EA 1YQSA 3A3IA 1TDGA 1DY6A 1FCOA 1FR6A 3CG5A 4E6WA 2ZL1B 4QY6A 3ZHHA 4R3JA 1ONGA 3A3EA 4KZBA 2XD5A 1NRJA 3HUNA 4U3TA
chains in the Genus database with same CATH topology
1TD5A 1T18A 1TS0A 3B42A 4L9GA 2O9AA 2O9BA 3UE6A 1XJ2A 4UEYA 3MJQA 3OBFA 2ZOIA 4EESA 3LIDA 2L0WA 3CUEC 1XFQA 1DP8A 3IBRA 1XJ3A 5F69A 4EEPA 2W0NA 1LSXA 4PHTA 4FSFA 1GSWA 5HPFA 1TF1A 1OT9A 3UB7A 3T4JA 2VGLM 3PXPA 4GS9A 1OTIA 4NXEA 2NUPC 4YNRA 4HP4A 3C2WA 3UMEA 1N9NA 3W2ZA 2H28A 2I9VA 2V0UA 2Z6CA 2W3HA 2HJEA 1P0ZA 1ODVA 2FH5A 3EQVA 5EFWA 4CLCE 3GDIA 1LSWA 5IS1A 1S4SA 4I3AA 2ZOHA 3T4SA 1P97A 4MN7A 4PKYG 3R7WA 4H6JA 4EETB 1T1AA 4WUJA 2W3FA 3VOLA 4OOMA 3OC2A 3HCYA 2OAP1 3LIEA 2L1MA 4CLCC 2K2NA 3HJKA 4ARZB 1H8MA 2VLGA 4UQIS 3MMHA 4WL9A 3LYXA 3BQAA 3S7PA 3RFBA 3T4KA 2XA7M 1VB6A 2KOIA 4GW9A 5LBRA 4CQHA 3T50A 3BW6A 5DKLA 4HH2A 3UB8A 2HJ9C 2HGVA 3CUEA 3IS2A 4IHQA 4Y3IA 2XRNA 3UB6A 2O9CA 3KSFA 3KSHA 5F5YA 5TJJA 4AFIA 4Q0JA 4ETXA 5HD5A 1IFQA 3S7NA 3TRCA 2INWA 1XFNA 5HDDA 4LRZE 2A2LA 2PHYA 4DMZA 3VE4A 1TS6A 1UGUA 4GLQA 2XA7S 4HIAA 1G6OA 1T19A 4ME4A 4RQ9A 1DP6A 3LR3A 4K08A 4GCZA 3BQ8A 2W1TB 1D7EA 2Z6DA 3PBQA 4BJPA 4MN6A 3MQQA 4II7A 4WF0A 4EU0A 2M1CA 3C38A 3D3OA 5F6AA 5CX7A 4CLCD 3C8CA 1P9RA 3CITA 2VV6A 2VEAA 4CLCA 1VHMA 2P04A 3O5YA 4BBTA 1GSVA 4KQOA 5HDCA 1S67L 3LR0A 4R3AA 3H82B 3C30A 3B33A 3MR0A 2IA2A 1NWZA 3F1OA 3H9WA 3MF0A 3S7OA 4IUKA 3VV4A 4ARZA 5DFYA 4NXFA 3BJNA 3BY9A 1IOUA 1EW0A 5L8MA 3KYZA 2GZAA 4E04A 4XT2B 4EUVA 2GX5A 3H7WB 5HWVA 1OTEA 4UQIM 5DFXA 3RH8B 4MCWA 4IUHA 4B93A 2PD7A 3E4OA 3OCNA 2GNXA 3BY8A 3CI6A 2XSSA 1D06A 3P7NA 3ICYA 2VKSA 3T4TA 4BMWA 4WN5A 3LUQA 3F1NB 4FOFA 3ULFA 3OOVA 3NOPC 4F3LB 1F9IA 4GHIA 3FPVA 2QYBA 4LRYC 4I3IA 2JN7A 5DF9A 5DKKA 4GJ4A 1OTBA 2B02A 4JGOA 3D72A 2VJWA 2WKQA 3OLOA 1OPXA 2BASA 2A24B 3V67A 5TBMB 3T4LA 2ZMVA 3T4OA 1T1BA 2HF6A 2JKTI 4EEUA 3KO6A 3PHYA 4HJ6A 4PAUA 5I5LA 3EEHA 4G3WA 4I5SA 2KDKA 2EA9A 1S4RA 4MMNA 3RTYA 1G28A 4MDZA 3PBNA 2JKRM 4NKPA 1YAXA 3BWLA 2WKPA 2W3DA 2R78A 5J7EA 1OTAA 4EQ1A 1OTDA 4WLAA 2PYRA 1N9OA 2M7UA 4DN0A 2V1BA 5A8BA 5MC7A 4P6ZS 5AJGA 2QJ7A 1DRMA 1YSPA 2HV1A 3LIFA 5KIZA 3SW1A 4Y2FA 4GS9B 1YKDA 1X0OA 3FC7A 2JKRI 2J3TC 3CAXA 1BYWA 4BBVA 4LRXC 1NLZA 1LL8A 4KQDA 3H7WA 4WELA 4IJGA 4HY8A 4Q0HA 5DJTA 1H3QA 2VA0A 2ZBBA 4NXBA 3MFXA 4EERA 2QWSA 3JVUA 4ETZA 4HNBA 2D01A 4H6JB 3R7WB 1S1YA 1LT0A 4HQAA 3HJIA 3CWFA 2PYPA 3NOTC 4PKYA 1S66L 5FL3A 4B9OA 4L9FA 5F68A 3MQOA 3KYQA 4O8GA 4O0PA 3E4PA 3ZYTA 2J80A 2OWJA 4L0LA 4NXGA 5HPIA 3PBOA 3NOUC 1TS7A 5G4ZA 4I3JA 3EEAA 5HL6A 2QHKA 3ZQ5A 4R38A 1OJ5A 3FG8A 3PR6A 4MN5A 5AVFA 3K3DA 3VE3A 1OT6A 3PBRA 2A24A 3B47A 3EQUA 5IU1A 5TBMA 4G3VA 3R4KA 3EGXC 1MC0A 3NHQA 3IS2B 1V9ZA 4LLOB 3GECA 2Y8HA 4HH3A 3LIBA 3DBAA 2EWVA 1W63Q 2J3WA 4Z1WA 2VV8A 2LB9A 4OOLA 2W1RA 3S7QA 4YWZA 2P08A 3F1PB 5HWWA 4EW7A 2K31A 3LR5A 1XJ4A 2J3TD 1N9LA 3E98A 3EWKA 3PBTA 4ZRRA 5KSHA 5DJUA 2LB5A 3PBSA 4I39A 1STZA 2QKPA 2P7JA 4WEJA 5HSQA 2K7SA 3EGDC 4R6LA 2JKTM 2NUTC 2FZ0A 2KX6A 2OOLA 1DP9A 3LICA 2KLIA 3UMDA 4P6ZM 2OAQ1 3UB9A 3TE8A 5J4EA 1V9YA 3FPWA 4LPZA 2XROA 2GJ3A 2V9AA 3KSGA 3K2NA 5AVEA 1MKMA 4HI4A 4QPRA 1OJGA 4CLCB 4DJ3A 1JNUA 2VV7A 2W1TA 2CMNA 5HZHA 2O0YA 1NLYA 1ZHHB 1W63M 3LIAA 5HWTA 3F1OB 1YSQA 2ZMFA 4G3KA 5G4YA 4KUOA 3NJAA 2PT7A 3KX0X 3LI9A 4YOFA 1GSXA 4JGQA 3H82A 2D02A 2VGLS 2W27A 2VZWA 4HOIA 4EXOA 3P01A 5J3WA 4O01A 2QJ5A 2DMWA 4NEED 2PD8A 4WEKA 1S1ZA 2PR5A 3TW8A 1Y28A 1MZUA 1KOUA 2PR6A 3A0SA 3LFVA 4DJ2A 3PYPA 3EOIA 1F5MA 4HP9A 2JHEA 3KSIA 5HDSA 1TS8A 2YKFA 3LR4A 4XT2A 1P9WA 5HD3A 2G7UA 2OWHA 2YKHA 3IBJA 3F1PA 3U2AA 4BBUA 2W3GA 5IT5A 5C5KA 3E4QA 4GHIB 3A0RA 1LSVA 4I38A 3OCLA 2W3EA 2Y79A 3T4QA 1XJ6A 3TJZC 1T1CA 2V0WA 3F1NA 1UWPX 4HHDA 4HJ4A 4JGRA 3LI8A 2B18A 2O99A 3E0YA 4JGPA 4F3LA 2PDRA 3MQ0A 3K3CA 2V1AA 4BWIA 4Q0IA 4L9EA 2MJ6A 4HJ3A 3JVVA 2VX8A 3CLOA 3UE3A 3MXQA 4Y5FA 1F98A 3G6OA 4R70A 4KUKA 1UWNX 1ZTUA 1WA9A 2EWWA 2L4RA 2M7VA 1NRJA 4M4XA 2WKRA 3A0VA 5K5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T18 A;  1TS0 A;  4L9G A;  3UE6 A;  1XJ2 A;  3MJQ A;  2ZOI A;  4EES A;  3LID A;  2L0W A;  1XFQ A;  1DP8 A;  3IBR A;  1XJ3 A;  5F69 A;  4EEP A;  2W0N A;  1LSX A;  1GSW A;  1OT9 A;  3UB7 A;  4GS9 A;  1OTI A;  4NXE A;  4HP4 A;  3C2W A;  3UME A;  1N9N A;  2H28 A;  2I9V A;  2V0U A;  2Z6C A;  1P0Z A;  1ODV A;  5EFW A;  3GDI A;  1LSW A;  5IS1 A;  1S4S A;  4I3A A;  2ZOH A;  1P97 A;  4PKY G;  4H6J A;  4EET B;  1T1A A;  4WUJ A;  3VOL A;  3LIE A;  2L1M A;  3HJK A;  2VLG A;  4WL9 A;  3LYX A;  1VB6 A;  4GW9 A;  3T50 A;  5DKL A;  4HH2 A;  3UB8 A;  3IS2 A;  3UB6 A;  5F5Y A;  5HD5 A;  2INW A;  1XFN A;  5HDD A;  4LRZ E;  2PHY A;  3VE4 A;  1TS6 A;  1UGU A;  4HIA A;  1T19 A;  4RQ9 A;  1DP6 A;  4K08 A;  4GCZ A;  1D7E A;  2Z6D A;  4MN6 A;  3MQQ A;  4WF0 A;  2M1C A;  5F6A A;  3C8C A;  2VV6 A;  2VEA A;  4BBT A;  1GSV A;  5HDC A;  1S67 L;  4R3A A;  3H82 B;  3B33 A;  3MR0 A;  1NWZ A;  3F1O A;  3H9W A;  4NXF A;  3BY9 A;  1EW0 A;  4E04 A;  4XT2 B;  3H7W B;  5HWV A;  1OTE A;  3RH8 B;  2PD7 A;  3E4O A;  3BY8 A;  1D06 A;  3P7N A;  3ICY A;  4WN5 A;  3LUQ A;  3F1N B;  3ULF A;  3NOP C;  4F3L B;  1F9I A;  4GHI A;  4LRY C;  4I3I A;  2JN7 A;  5DKK A;  1OTB A;  2B02 A;  4JGO A;  3D72 A;  2WKQ A;  3OLO A;  2BAS A;  2A24 B;  5TBM B;  1T1B A;  4EEU A;  3PHY A;  4HJ6 A;  5I5L A;  3EEH A;  4I5S A;  2KDK A;  2EA9 A;  3RTY A;  1S4R A;  1G28 A;  3BWL A;  2WKP A;  2R78 A;  5J7E A;  1OTA A;  4EQ1 A;  1OTD A;  4WLA A;  2PYR A;  1N9O A;  2V1B A;  5A8B A;  2QJ7 A;  1DRM A;  2HV1 A;  3LIF A;  5KIZ A;  3SW1 A;  4GS9 B;  1X0O A;  3FC7 A;  3CAX A;  1BYW A;  4BBV A;  4LRX C;  1LL8 A;  4KQD A;  3H7W A;  4HY8 A;  5DJT A;  2ZBB A;  4NXB A;  3MFX A;  4EER A;  2QWS A;  4HNB A;  2D01 A;  4H6J B;  1S1Y A;  1LT0 A;  4HQA A;  3HJI A;  3CWF A;  2PYP A;  3NOT C;  4PKY A;  1S66 L;  4B9O A;  4L9F A;  5F68 A;  3MQO A;  3E4P A;  2J80 A;  2OWJ A;  4NXG A;  3NOU C;  1TS7 A;  5G4Z A;  4I3J A;  3ZQ5 A;  2QHK A;  4R38 A;  1OJ5 A;  3FG8 A;  4MN5 A;  5AVF A;  3K3D A;  3VE3 A;  1OT6 A;  2A24 A;  5IU1 A;  5TBM A;  3NHQ A;  3IS2 B;  1V9Z A;  4LLO B;  3GEC A;  4HH3 A;  3LIB A;  2VV8 A;  4YWZ A;  3F1P B;  5HWW A;  4EW7 A;  1XJ4 A;  1N9L A;  3EWK A;  5DJU A;  4I39 A;  2QKP A;  2P7J A;  5HSQ A;  2K7S A;  4R6L A;  2KX6 A;  2OOL A;  1DP9 A;  3LIC A;  3UMD A;  3UB9 A;  5J4E A;  1V9Y A;  4LPZ A;  2GJ3 A;  2V9A A;  5AVE A;  4HI4 A;  1OJG A;  4DJ3 A;  1JNU A;  2VV7 A;  2CMN A;  5HZH A;  3LIA A;  5HWT A;  3F1O B;  5G4Y A;  4KUO A;  3NJA A;  3KX0 X;  3LI9 A;  1GSX A;  4JGQ A;  3H82 A;  2D02 A;  2W27 A;  4HOI A;  4EXO A;  5J3W A;  2QJ5 A;  2PD8 A;  1S1Z A;  2PR5 A;  1Y28 A;  1MZU A;  1KOU A;  2PR6 A;  3A0S A;  4DJ2 A;  3PYP A;  4HP9 A;  2JHE A;  5HDS A;  1TS8 A;  2YKF A;  4XT2 A;  5HD3 A;  2OWH A;  2YKH A;  3F1P A;  4BBU A;  3E4Q A;  4GHI B;  3A0R A;  1LSV A;  4I38 A;  1XJ6 A;  1T1C A;  2V0W A;  3F1N A;  1UWP X;  4HHD A;  4HJ4 A;  4JGR A;  3LI8 A;  4JGP A;  4F3L A;  2PDR A;  3K3C A;  2V1A A;  4L9E A;  4HJ3 A;  3CLO A;  3MXQ A;  1F98 A;  3G6O A;  4R70 A;  4KUK A;  1UWN X;  1WA9 A;  2L4R A;  4M4X A;  2WKR A;  3A0V A; 
#chains in the Genus database with same CATH topology
 1TD5 A;  4C6Y A;  1SCW A;  4L9G A;  4BLM A;  3UE6 A;  2O9B A;  1NJ4 A;  2RL3 A;  2ZOI A;  3MS6 A;  4XUZ A;  2EXA A;  4D2O A;  1XFQ A;  3D4F A;  1BLS A;  3HUO A;  3NBL A;  1L3L A;  1K54 C;  3VSK A;  1IEL A;  1GSW A;  4P6B A;  1ZG4 A;  4OPQ A;  3SS3 A;  2NUP C;  4Y0U A;  3IF5 A;  4HP4 A;  3UME A;  2V0U A;  2Z6C A;  1P0Z A;  2FH5 A;  1LSW A;  1S4S A;  3M2K A;  3ZVW A;  3QP5 A;  2WKI A;  4EET B;  2XQZ A;  4S2L A;  4BL3 A;  3FKW A;  4OOM A;  4PM8 A;  1ES3 A;  1ERQ A;  2J9O A;  5CER A;  4UQI S;  3BQA A;  3S7P A;  3T4K A;  5EOO A;  4E6X A;  4HH2 A;  3IXG A;  4OQH A;  2HGV A;  5JYP A;  4IHQ A;  4Y3I A;  5HX9 A;  3IXH A;  1W7F A;  5M19 A;  1BLP A;  4K91 A;  2Y2J A;  3MKF A;  4EBL A;  2BG1 A;  4B4X A;  4U0T A;  4EQI A;  2WZX A;  1XFN A;  5HAP A;  3UDF A;  3DWK A;  1NRF A;  5L09 A;  2H5S A;  5CGW A;  4ME4 A;  1DP6 A;  5J8X A;  3BQ8 A;  3PBQ A;  2Z6D A;  3UDI A;  4H8R A;  3N7W A;  4EU0 A;  5EVI B;  3C38 A;  5CX7 A;  2V8C A;  3C8C A;  5D3O A;  3CIT A;  4CLC A;  4BBT A;  4JF5 A;  5A93 A;  4KZ5 A;  5HDC A;  3LR0 A;  3C30 A;  3B33 A;  5A90 A;  2J7V A;  4WZ5 C;  4QHC A;  3G35 A;  4NXF A;  3SH9 A;  3BJN A;  4S2M A;  1FCN A;  4QJG A;  4KQQ A;  1J9M A;  4ZTK A;  5L8M A;  4XT2 B;  4EUV A;  1K57 C;  1XA1 A;  3IXD A;  1H8Z A;  4MCW A;  4IUH A;  1HVB A;  4R1G A;  4MBF A;  4Y13 A;  2GNX A;  1BZA A;  2PBD P;  2UWX A;  3IXB A;  1K4E A;  4E3K A;  3MXR A;  3LUQ A;  3F1N B;  2ZM0 A;  1ESU A;  4F3L B;  1F9I A;  5GLA A;  3BFE A;  2JN7 A;  4S2J A;  5DKK A;  1XKZ A;  3T1X A;  4GJ4 A;  3D72 A;  1KVM A;  4R0Q A;  1ZC2 A;  3OLO A;  1OPX A;  2A24 B;  4Y7P A;  3T4L A;  2ZMV A;  3T4O A;  4UHU A;  2XDM A;  2HF6 A;  5EVI D;  2ZL1 A;  5I5L A;  3EEH A;  1H5X A;  2PU2 A;  4MMN A;  1G28 A;  2JKR M;  4NKP A;  1NZU A;  2W3D A;  2R78 A;  5J7E A;  3QHY A;  5FQ9 A;  1N9O A;  4DN0 A;  3I7J A;  3UPN A;  3E2L A;  4QWO A;  2P74 A;  1PRQ A;  3LIF A;  5KIZ A;  4OH0 A;  4WMC A;  1ZKJ A;  2Y55 A;  3OPH A;  4GS9 B;  4Y2F A;  3RXX A;  5L2F A;  1MWU A;  3VOZ A;  1BYW A;  3GQZ A;  4LRX C;  1LL8 A;  1NYY A;  2A49 A;  4IJG A;  1XGI A;  3A3J A;  4N92 A;  2ZBB A;  1K55 C;  3Q81 A;  4NXB A;  1Q2Q A;  4LV2 A;  2QWS A;  3JVU A;  3R7W B;  1GHP A;  1HZO A;  4HQA A;  1CI9 A;  2FFF B;  3HJI A;  2PYP A;  4B9O A;  3MQO A;  1Z09 A;  4O8G A;  3BEB A;  3PBO A;  3CZD A;  2ZC7 A;  3EEA A;  4I3J A;  1OME A;  3BYD A;  2ZQD A;  1OJ5 A;  3FG8 A;  5AVF A;  3K3D A;  1E25 A;  5KSC A;  3G34 A;  2XK1 A;  2AVX A;  5IU1 A;  3V5M A;  3IS2 B;  1V9Z A;  1YLZ A;  4OQI A;  1ALQ A;  1JWV A;  1KDS A;  1WE4 A;  2PAV P;  1W63 Q;  2VV8 A;  2LB9 A;  3S7Q A;  4YWZ A;  3HVF A;  5HWW A;  2WGW B;  3BM6 A;  3ZDJ A;  1H8Y A;  3EWK A;  3PBT A;  4ZRR A;  5DJU A;  1MXO A;  2P7J A;  4DDS A;  3EGD C;  3O88 A;  3C4O A;  3NCK A;  3MBZ A;  2KLI A;  1ZG6 A;  1IKI A;  2OAQ 1;  3TE8 A;  4LPZ A;  2XRO A;  5KZH A;  1PFL A;  4KG6 A;  2PRF A;  3FWL A;  4ZJ1 A;  3L9K A;  3BRM A;  2QZ6 A;  4N1H A;  3QP4 A;  5AVE A;  4QPR A;  1OJG A;  4DJ3 A;  4MLL A;  2CMN A;  5HZH A;  2JC7 A;  4NET A;  2EX2 A;  3W4O A;  2JCH A;  3LIA A;  3FV7 A;  3N8S A;  1CK3 A;  1G68 A;  3LI9 A;  5EVL A;  1GSX A;  2XF3 A;  1GHM A;  3P01 A;  4O01 A;  4S2N C;  2QJ5 A;  1ES4 A;  1VQQ A;  2ZC3 B;  1CF0 A;  1Y28 A;  1MZU A;  3LFV A;  4DJ2 A;  3PYP A;  1F5M A;  4HP9 A;  2JHE A;  3U4L P;  4XT2 A;  1DJC A;  1PI4 A;  1MBL A;  1FSW A;  3IH8 A;  4X56 A;  5CHM A;  2H10 A;  4DE3 A;  1NYM A;  5IT5 A;  1LSV A;  2HP9 A;  3SH7 A;  4X68 A;  2W3E A;  2Y79 A;  3TG9 A;  3UPO A;  3F1N A;  1FQG A;  1UWP X;  2B18 A;  4F3L A;  2C5W B;  1KVL A;  5DTS A;  2ZM2 A;  2Y2G A;  1G5U A;  1BSG A;  4X69 A;  2G2W A;  1JWZ A;  2OV5 A;  1IYS A;  3Q7V A;  4IBR A;  3UE3 A;  5DF8 A;  1Y54 A;  2E8J A;  3AGD A;  4KZ7 A;  4UAA A;  5TGF A;  3MXQ A;  1F98 A;  3G6O A;  4KUK A;  4OP5 A;  3WS0 A;  3G32 A;  5G18 A;  2L4R A;  2M7V A;  2V20 A;  4OP8 A;  3A0V A;  2I72 A;  5K5B A;  3C7U A;  5GHX A;  2JE5 A;  1M6K A;  3TSG A;  1XJ2 A;  3M6H A;  4UEY A;  3MJQ A;  4WYY A;  1I2W A;  5IHV A;  1XX2 A;  4WBG A;  3GVB A;  2PBY A;  4BD1 A;  1PW8 A;  4QD4 A;  3ISG A;  1LSX A;  5HPF A;  4FSF A;  5FI7 A;  1TF1 A;  3PXP A;  2H0T A;  4GS9 A;  1NXY A;  4OPZ A;  2XFT A;  3W2Z A;  2H28 A;  2DRW A;  1D1J A;  1ODV A;  3NC8 A;  4CLC E;  2Y2Q A;  3NEC A;  2ZOH A;  4Y15 A;  5GLC A;  4MN7 A;  4PKY G;  3R7W A;  3Q1F A;  5FQM A;  1T1A A;  4JXG A;  2W3F A;  3VOL A;  4BL2 A;  2HZ5 A;  4HBT A;  1YMX A;  4KZ8 A;  3HCY A;  1HD8 A;  1YLY A;  2L1M A;  3IX8 A;  2EX6 A;  3G4P A;  4FH2 A;  4X53 A;  3MZD A;  4CQH A;  4PMA A;  3T50 A;  1WYB A;  4S2P A;  2X02 A;  3IS2 A;  2Q9M A;  4KZ4 A;  4KZ6 A;  5KMW A;  2QPN A;  3PTE A;  2XRN A;  3UB6 A;  2O9C A;  1K56 A;  3KSF A;  1HTZ A;  5F5Y A;  2Q9N A;  4AFI A;  3VOY A;  1ES5 A;  1QME A;  4GD8 A;  4ETX A;  1PIO A;  5A92 A;  3IQA A;  3S7N A;  4KZ9 A;  4GB7 A;  4P85 A;  4JXW A;  3W8K A;  4PM9 A;  2PHY A;  3VE4 A;  4MNR A;  4GLQ A;  4DE1 A;  1YPR A;  1F2K A;  3VFF A;  4PM5 A;  1D7E A;  5EEC A;  5FQQ A;  4PPR A;  4KZA A;  3D3O A;  4CLC D;  1P9R A;  1JWP A;  2ZD8 A;  2VEA A;  1AWI A;  1VHM A;  3O5Y A;  1AXB A;  3T1S A;  1IYP A;  4UA9 A;  3MR0 A;  3WS5 A;  2EX8 A;  3UE0 A;  3S7O A;  4IUK A;  3VV4 A;  4HEF A;  3N4I A;  5AQ7 A;  4ARZ A;  5EVE A;  1E3U A;  5JYO A;  4X1M A;  3KYZ A;  1EWZ A;  1FOF A;  2ZQ9 A;  4OON A;  4OLG A;  4UQI M;  4DE0 A;  5CHU A;  1XPB A;  3BLM A;  4OLD A;  2PD7 A;  3E4O A;  4FD8 A;  1MWS A;  3WWX A;  1D06 A;  3P7N A;  3ICY A;  5EPH A;  4WN5 A;  5L07 A;  3E2K A;  3VP1 A;  2Y2O A;  3UY6 A;  2R9W A;  3P09 A;  4CJN A;  1OTB A;  2B02 A;  3LO7 A;  2WKQ A;  2BAS A;  1KE4 A;  1T1B A;  2EXB A;  4C75 A;  5M1A A;  3KO6 A;  4PAU A;  4G3W A;  4I5S A;  2KDK A;  3PBN A;  4Y17 A;  4ZBE A;  3HLC A;  3BWL A;  4WLA A;  2PYR A;  4S2I A;  5A8B A;  1K57 A;  5MC7 A;  4WMC D;  3IF6 C;  3GRJ A;  3W4Q A;  1XA7 A;  2Y2L A;  1PZP A;  2X01 A;  4BBV A;  4KQD A;  5GHY A;  3H7W A;  4MEZ A;  4Q0H A;  5GLB A;  5FEG A;  3CMZ A;  3M2J A;  5U47 A;  3MFX A;  2D01 A;  4LV0 A;  1LT0 A;  4F94 A;  3NOT C;  4PKY A;  4UA6 A;  5FL3 A;  1N9B A;  4L9F A;  1PWD A;  2XR0 A;  3E4P A;  5HPI A;  2J80 A;  2OWJ A;  3NOU C;  5G4Z A;  3ZQ5 A;  5CEC A;  4YIN A;  3PR6 A;  1CQA A;  3DTE A;  3C4P A;  3EQU A;  4G3V A;  3R4K A;  1MC0 A;  2DCF A;  4Z1W A;  1GA9 A;  2W1R A;  4IED A;  2P9V B;  1RCJ A;  3L7H A;  3LR5 A;  1XJ4 A;  2H0Y A;  2J3T D;  4R4S A;  3MZF A;  3QNB A;  2LB5 A;  1PWG A;  5HAR A;  4WEJ A;  2NUT C;  4JXS A;  1K55 A;  2OOL A;  1DP9 A;  3LIC A;  4BD0 A;  3UMD A;  1PNE A;  5CEB A;  4GNU A;  3DTM A;  3Q7V B;  2GJ3 A;  4GOG A;  2V9A A;  2Z2L B;  3QP2 A;  3S22 A;  1JNU A;  2VV7 A;  3Q7Z A;  2ZQC A;  5E2E A;  3G30 A;  2O0Y A;  4FUW A;  3VP2 A;  2HDS A;  3F1O B;  2Y2H A;  1SZV A;  1YSQ A;  4G3K A;  4ZAM A;  5G4Y A;  3NJA A;  3CJM A;  1MPL A;  1CEG A;  4YOF A;  2VGL S;  2XFS A;  2W27 A;  4EXO A;  3CHW P;  5CXW A;  1S1Z A;  4OPR A;  3TW8 A;  3MZE A;  4ESP A;  4JF6 A;  4OKP A;  3KSI A;  2YKF A;  3M6B A;  4D60 A;  3F1P A;  4NK3 A;  1ESI A;  3HLE A;  5C5K A;  1MY8 A;  3A0R A;  2VGJ A;  1L0E A;  1L0D A;  3OCL A;  3PAE A;  1PI5 A;  4DRT A;  3UNW A;  1PZO A;  2O99 A;  2PDR A;  3TOI A;  3ZG8 B;  4BWI A;  4O7D A;  2MJ6 A;  3PAG A;  1VEU B;  3FYZ A;  3CLO A;  3SS5 A;  2ZMA A;  2HP6 A;  1KGE A;  1IEM A;  4OQ0 A;  3ZFZ A;  4OOY A;  4R70 A;  1UWN X;  1ZTU A;  2X71 A;  2WYX A;  2EWW A;  3IWO A;  4E3O A;  1BLH A;  4M4X A;  1DJB A;  5I94 A;  3QP1 A;  3FKV A;  1TS0 A;  3B42 A;  1YLT A;  4S2N A;  1BUE A;  4UA7 A;  4EES A;  2HP5 A;  3CUE C;  1FIK A;  1DP8 A;  4EEP A;  4WM9 A;  4X25 A;  5FI6 A;  3HLW A;  1OT9 A;  3T4J A;  1OTI A;  2Y2N A;  3T12 B;  2UV0 E;  5EM0 A;  2WKH A;  5FSR A;  2I9V A;  4QY5 A;  2CC1 A;  2HJE A;  5EFW A;  1YMS A;  3GDI A;  5CTM A;  3WS1 A;  4I3A A;  3B3X A;  3T4S A;  3GR2 A;  1P97 A;  3ZG0 A;  1O07 A;  3BLS A;  1J3W A;  3AGE A;  3OC2 A;  4X1L A;  3MFD A;  4ARZ B;  3HUM A;  2IWD A;  1H8M A;  2VLG A;  2Y2K A;  4DXC A;  4WL9 A;  3RFB A;  1YT4 A;  4N9L A;  1VB6 A;  4GW9 A;  1GA0 A;  3BW6 A;  1MWR A;  3IF6 B;  2ZC6 B;  5DTK A;  3UB8 A;  5F82 A;  2HJ9 C;  1K56 D;  4GZB A;  3V3S A;  2ZC4 B;  1KGF A;  5FI2 A;  3FZC A;  2P9V A;  1EI5 A;  1SHV A;  2V8F A;  4Q0J A;  2VK3 A;  2EX9 A;  3KYE A;  2INW A;  2WGV A;  3TRC A;  1LL9 A;  5EUA A;  4LRZ E;  3ZNY A;  2A2L A;  1TS6 A;  1TEM A;  4HIA A;  1W8Y A;  4KG5 A;  1G6O A;  5M18 A;  1YLP A;  5GHZ A;  3BEC A;  4K08 A;  4GCZ A;  1A0K A;  1ERO A;  4E3J A;  2J8Y A;  5HW3 A;  3JYI A;  3MQQ A;  4WF0 A;  3ZG7 B;  5F6A A;  5GLD A;  2VV6 A;  5EOE A;  4EV4 A;  1GSV A;  2R9X A;  3HRE A;  3GTC A;  4KQO A;  1S67 L;  4MBH A;  1FIL A;  2EFU A;  3F1O A;  3IX3 A;  4LFU A;  3MF0 A;  5EVI C;  1E3U D;  3NUL A;  1FR1 A;  3BY9 A;  3MXS A;  1IOU A;  1EW0 A;  1S6R A;  3HLF A;  3H7W B;  4E3M A;  1OTE A;  1KGG A;  4EBN A;  5DFX A;  1S0W A;  1GHI A;  3RH8 B;  3V3R A;  2Y91 A;  1L2S A;  3CI6 A;  4GKU A;  4FTX A;  3HLD A;  3OPL A;  3ITB A;  2VKS A;  4BMW A;  3OOV A;  3DWZ A;  4GN2 A;  2OLU A;  1C3B A;  2XEP A;  2QYB A;  1PYY A;  2WGI A;  4I3I A;  3T1R A;  5FAS A;  5EM1 A;  5DF9 A;  3WRZ A;  4LEN A;  3VMA A;  4JGO A;  1IKG A;  5HAQ A;  2WUQ A;  4P87 A;  5DF7 A;  3V67 A;  3C5A A;  1VEU A;  1H0M A;  3PHY A;  3DW0 A;  4HJ6 A;  4R23 A;  1S4R A;  3RTY A;  3T1Q B;  4MDZ A;  5DTT A;  4B88 A;  5AQ9 A;  3NIA A;  1K38 A;  1M40 A;  3IHA A;  1OTD A;  4NG2 A;  3OZH A;  1K54 A;  4XXR A;  2V1B A;  4P6Z S;  5AJG A;  5FEF A;  2QJ7 A;  1DRM A;  3NDG A;  1YSP A;  2HV1 A;  3VP0 A;  1YKD A;  1X0O A;  2Y2P A;  2JKR I;  4WZ4 A;  1K0K A;  3HBR A;  1NLZ A;  1L0F A;  3BFD A;  5DJT A;  4E3L A;  5E2F A;  3S4X A;  2ZJ9 A;  4H6J B;  1S1Y A;  4JKT A;  3O3V A;  3CWF A;  3UPP A;  4Y0T A;  3ZVT A;  5F68 A;  4EBP A;  3A3D A;  1BUL A;  1MWT A;  1TDL A;  3OPP A;  1LI0 A;  4K0X A;  3VE3 A;  1ONH A;  5TBM A;  4X6T A;  5FAT A;  3GEC A;  2Y8H A;  4HH3 A;  3DBA A;  4OOL A;  3IF6 A;  2P08 A;  3F1P B;  2BLS A;  2K31 A;  1N9L A;  4IVK A;  4RA7 A;  3UB5 P;  5KSH A;  1K6S A;  5CGS A;  1STZ A;  4Z9Q A;  3N6I A;  4RYE A;  2K7S A;  2PU4 A;  2WK0 A;  2JKT M;  4MBK A;  4OQG A;  5TR7 A;  4JPM A;  4KZ3 A;  4LGW A;  5J4E A;  1V9Y A;  3FPW A;  4LV1 A;  1IYQ A;  2ZM8 A;  3KSG A;  4ZJ3 A;  4DKI A;  1MKM A;  4EWF A;  1LLB A;  1IYO A;  1BTL A;  4WZ5 A;  5AQB A;  3UN7 A;  5HL1 A;  2ZQ8 A;  5FQI A;  3IH9 A;  5TFQ A;  4KUO A;  3O86 A;  3KX0 X;  3DAV A;  2HDQ A;  2E8I A;  2D02 A;  4HOI A;  5F1G A;  3VFH A;  1VET B;  3C7V A;  2DMW A;  4NEE D;  2PD8 A;  4DF6 A;  3A0S A;  1KE0 A;  5EE8 A;  1KDW A;  1XGJ A;  5E43 A;  4HBU A;  4ID4 A;  5HDS A;  1TS8 A;  3RJU A;  3NY4 A;  1P9W A;  2Y59 A;  5HD3 A;  1Q2P A;  2G7U A;  2OWH A;  3G2Z A;  4BBU A;  2XD1 A;  3WRT A;  4GHI B;  2V2F F;  5CTN A;  1LI9 A;  3T4Q A;  3TJZ C;  1T1C A;  2V0W A;  4HHD A;  4JGR A;  1I5Q A;  3LI8 A;  3E0Y A;  4JGP A;  4X55 A;  3K3C A;  2V1A A;  3ZGA B;  3UDX A;  1W8Q A;  4HJ3 A;  5FQJ A;  3JVV A;  2VX8 A;  1L0G A;  1N4O A;  3QNC A;  3OPR A;  4Y5F A;  5CED A;  1Y4O A;  1YLJ A;  1WA9 A;  3LEZ A;  3ZG9 B;  2WKR A;  3MQ0 A;  1YM1 A;  3ZNT A;  1T18 A;  3BFF A;  4N9K A;  2O9A A;  1NY0 A;  3S1Y A;  3NI9 A;  3OBF A;  4S2O A;  3LID A;  2L0W A;  1G6A A;  3UE1 A;  3IBR A;  1XJ3 A;  5F69 A;  3LY4 A;  2W0N A;  3SH8 A;  4PHT A;  1SKF A;  4GDB A;  3UB7 A;  2VGL M;  3N8L A;  4NXE A;  1Z6F A;  4YNR A;  3C2W A;  1KE3 A;  1N9N A;  3IWI A;  2ZC5 B;  1HLU P;  4BEN A;  1BLC A;  1WYC A;  2W3H A;  2V1Z A;  3V39 A;  3EQV A;  3MSH A;  5IS1 A;  1RP5 A;  4H6J A;  1RGZ A;  2Q0O A;  1LHY A;  4GD6 A;  2IWC A;  4WUJ A;  4Q8I A;  1JVJ A;  2ZQ7 A;  3LIE A;  2OAP 1;  4CLC C;  2K2N A;  3AGF A;  5FAQ A;  2RCX A;  3HJK A;  3LGO A;  4M3K A;  4Y0O A;  2XLN A;  1ES2 A;  3MMH A;  2J9P A;  5FA7 A;  3LYX A;  1XXM A;  2XA7 M;  4GDN A;  2KOI A;  2WZZ A;  5LBR A;  5HAI A;  5DKL A;  1K25 A;  3VP3 A;  3BFC A;  3CPT B;  2JKF A;  3CUE A;  5E2H A;  4A5R A;  1QMF A;  4PM7 A;  4JF4 A;  5HFO A;  1GCE A;  4JLF A;  3KSH A;  5TJJ A;  1CI8 A;  1FSY A;  3SOI A;  2Z2M B;  5HD5 A;  1IFQ A;  4FH4 A;  5BOH A;  2QMI A;  5HDD A;  4LV3 A;  3UO9 A;  3WS2 A;  4DMZ A;  1UGU A;  2XA7 S;  3ZCZ A;  1T19 A;  4JBF A;  4HES A;  4RQ9 A;  3LR3 A;  3ITA A;  1SKO B;  2W1T B;  1I2S A;  4LCM A;  4BJP A;  4MN6 A;  4II7 A;  2M1C A;  2WAD A;  1JTD A;  2WKE A;  5CRF A;  5AQA A;  4PM6 A;  2P04 A;  3BFG A;  4IVI A;  4R3A A;  3H82 B;  4R3B A;  2IA2 A;  1NWZ A;  3H9W A;  1SDE A;  2XH9 A;  5CGX A;  5DFY A;  2ZQA A;  3DTK A;  2GZA A;  2HDU A;  4E04 A;  1VET A;  1K6R A;  2HPB A;  2GX5 A;  1U60 A;  5HWV A;  1W5D A;  3JPU A;  1DJA A;  2JKG A;  3HLB A;  4B93 A;  3G2Y A;  3OCN A;  3BY8 A;  1LL5 A;  2XSS A;  2VGK A;  1CEF A;  2C6W B;  1O7E A;  4YFM A;  3T4T A;  4QB8 A;  3RXW A;  4FOF A;  3ULF A;  3V50 A;  4ZJ2 A;  5F1F A;  3NOP C;  2ZLY A;  4GHI A;  4E3N A;  3FPV A;  3W4P A;  4LRY C;  4U0X A;  4KG2 A;  1W79 A;  3SZT A;  2OLV A;  3VP4 A;  3ZG5 A;  2VJW A;  3IX4 A;  5TBM B;  3N8R A;  2JKT I;  4EEU A;  5FAO A;  5EVI A;  2EA9 A;  3O87 A;  4EUZ A;  5F83 A;  1YAX A;  2WKP A;  1OTA A;  4EQ1 A;  2M7U A;  3GV9 A;  5L10 A;  4E3I A;  4QU3 A;  3P98 A;  3SW1 A;  4OVD A;  4K0W A;  3FC7 A;  1TVF A;  2J3T C;  3CAX A;  1YLW A;  4JXV A;  4WEL A;  3Q82 A;  4XUX A;  4HY8 A;  1RGY A;  1H3Q A;  3LCE A;  2VA0 A;  4P0M A;  4N1X A;  3NDE A;  3GSG A;  4EER A;  4ETZ A;  4HNB A;  3HL9 A;  1S66 L;  5FAP A;  1SDN A;  4DE2 A;  3KYQ A;  2WAF A;  3LEQ A;  3QP8 A;  4O0P A;  4CPK A;  4LCL A;  1E4D A;  3ZYT A;  4L0L A;  4NXG A;  3SS4 A;  1MKI A;  1CJF A;  1TS7 A;  1ERM A;  5HL6 A;  2QHK A;  4R38 A;  5EV0 A;  1K4F A;  1PWC A;  4MN5 A;  1PW1 A;  3WS4 A;  1OT6 A;  3PBR A;  1ACF A;  2A24 A;  3B47 A;  3EGX C;  3NHQ A;  4LLO B;  1JTG A;  2ACG A;  2WAE A;  3GMW A;  3LIB A;  2EWV A;  4KQR A;  2GDN A;  2J3W A;  4BQM A;  2IWB A;  5FQK A;  4EW7 A;  3CPT A;  2A3U A;  2B5R A;  3E98 A;  2XGN A;  3IHB A;  4I39 A;  3PBS A;  2DNS A;  2QKP A;  2OSU A;  5GL9 A;  5HSQ A;  4R6L A;  2FFY A;  5FDS A;  2FZ0 A;  5DVA A;  2KX6 A;  4FCF A;  4P6Z M;  4RX2 A;  2Y2I A;  3UB9 A;  1VM1 A;  3LY3 A;  4RX3 A;  2EFX A;  3K2N A;  2G2U A;  4HI4 A;  4CLC B;  1SKO A;  2W1T A;  3HLG A;  4DXB A;  4DDY A;  1NLY A;  1ZHH B;  1W63 M;  5HWT A;  2ZMF A;  2Y4A A;  2PT7 A;  3QP6 A;  4RVA A;  5CHJ A;  4JGQ A;  3H82 A;  2VZW A;  5A91 A;  5J3W A;  5FDH A;  4WEK A;  2BTF P;  2PR5 A;  1KOU A;  2PR6 A;  2HDR A;  4B4Z A;  3G31 A;  3EOI A;  4IBX A;  3LR4 A;  3DTI A;  1BT5 A;  4R4R A;  2YKH A;  3IBJ A;  3MKE A;  2WGW A;  3U2A A;  3IWQ A;  4KEN B;  1NZO A;  2W3G A;  3E4Q A;  2JBF A;  4I38 A;  3A3F A;  4C3Q A;  2Y2M A;  1XJ6 A;  3D9Y A;  2B95 A;  3Q07 A;  4S2K A;  4HJ4 A;  3IT9 A;  1FCM A;  1XP4 A;  5E2G A;  4ZDX A;  3VSL A;  4OPY A;  4Q0I A;  4L9E A;  1YQS A;  3A3I A;  1TDG A;  1DY6 A;  1FCO A;  1FR6 A;  3CG5 A;  4E6W A;  2ZL1 B;  4QY6 A;  3ZHH A;  4R3J A;  1ONG A;  3A3E A;  4KZB A;  2XD5 A;  1NRJ A;  3HUN A;  4U3T A; 
#chains in the Genus database with same CATH homology
 1TD5 A;  1T18 A;  1TS0 A;  3B42 A;  4L9G A;  2O9A A;  2O9B A;  3UE6 A;  1XJ2 A;  4UEY A;  3MJQ A;  3OBF A;  2ZOI A;  4EES A;  3LID A;  2L0W A;  3CUE C;  1XFQ A;  1DP8 A;  3IBR A;  1XJ3 A;  5F69 A;  4EEP A;  2W0N A;  1LSX A;  4PHT A;  4FSF A;  1GSW A;  5HPF A;  1TF1 A;  1OT9 A;  3UB7 A;  3T4J A;  2VGL M;  3PXP A;  4GS9 A;  1OTI A;  4NXE A;  2NUP C;  4YNR A;  4HP4 A;  3C2W A;  3UME A;  1N9N A;  3W2Z A;  2H28 A;  2I9V A;  2V0U A;  2Z6C A;  2W3H A;  2HJE A;  1P0Z A;  1ODV A;  2FH5 A;  3EQV A;  5EFW A;  4CLC E;  3GDI A;  1LSW A;  5IS1 A;  1S4S A;  4I3A A;  2ZOH A;  3T4S A;  1P97 A;  4MN7 A;  4PKY G;  3R7W A;  4H6J A;  4EET B;  1T1A A;  4WUJ A;  2W3F A;  3VOL A;  4OOM A;  3OC2 A;  3HCY A;  2OAP 1;  3LIE A;  2L1M A;  4CLC C;  2K2N A;  3HJK A;  4ARZ B;  1H8M A;  2VLG A;  4UQI S;  3MMH A;  4WL9 A;  3LYX A;  3BQA A;  3S7P A;  3RFB A;  3T4K A;  2XA7 M;  1VB6 A;  2KOI A;  4GW9 A;  5LBR A;  4CQH A;  3T50 A;  3BW6 A;  5DKL A;  4HH2 A;  3UB8 A;  2HJ9 C;  2HGV A;  3CUE A;  3IS2 A;  4IHQ A;  4Y3I A;  2XRN A;  3UB6 A;  2O9C A;  3KSF A;  3KSH A;  5F5Y A;  5TJJ A;  4AFI A;  4Q0J A;  4ETX A;  5HD5 A;  1IFQ A;  3S7N A;  3TRC A;  2INW A;  1XFN A;  5HDD A;  4LRZ E;  2A2L A;  2PHY A;  4DMZ A;  3VE4 A;  1TS6 A;  1UGU A;  4GLQ A;  2XA7 S;  4HIA A;  1G6O A;  1T19 A;  4ME4 A;  4RQ9 A;  1DP6 A;  3LR3 A;  4K08 A;  4GCZ A;  3BQ8 A;  2W1T B;  1D7E A;  2Z6D A;  3PBQ A;  4BJP A;  4MN6 A;  3MQQ A;  4II7 A;  4WF0 A;  4EU0 A;  2M1C A;  3C38 A;  3D3O A;  5F6A A;  5CX7 A;  4CLC D;  3C8C A;  1P9R A;  3CIT A;  2VV6 A;  2VEA A;  4CLC A;  1VHM A;  2P04 A;  3O5Y A;  4BBT A;  1GSV A;  4KQO A;  5HDC A;  1S67 L;  3LR0 A;  4R3A A;  3H82 B;  3C30 A;  3B33 A;  3MR0 A;  2IA2 A;  1NWZ A;  3F1O A;  3H9W A;  3MF0 A;  3S7O A;  4IUK A;  3VV4 A;  4ARZ A;  5DFY A;  4NXF A;  3BJN A;  3BY9 A;  1IOU A;  1EW0 A;  5L8M A;  3KYZ A;  2GZA A;  4E04 A;  4XT2 B;  4EUV A;  2GX5 A;  3H7W B;  5HWV A;  1OTE A;  4UQI M;  5DFX A;  3RH8 B;  4MCW A;  4IUH A;  4B93 A;  2PD7 A;  3E4O A;  3OCN A;  2GNX A;  3BY8 A;  3CI6 A;  2XSS A;  1D06 A;  3P7N A;  3ICY A;  2VKS A;  3T4T A;  4BMW A;  4WN5 A;  3LUQ A;  3F1N B;  4FOF A;  3ULF A;  3OOV A;  3NOP C;  4F3L B;  1F9I A;  4GHI A;  3FPV A;  2QYB A;  4LRY C;  4I3I A;  2JN7 A;  5DF9 A;  5DKK A;  4GJ4 A;  1OTB A;  2B02 A;  4JGO A;  3D72 A;  2VJW A;  2WKQ A;  3OLO A;  1OPX A;  2BAS A;  2A24 B;  3V67 A;  5TBM B;  3T4L A;  2ZMV A;  3T4O A;  1T1B A;  2HF6 A;  2JKT I;  4EEU A;  3KO6 A;  3PHY A;  4HJ6 A;  4PAU A;  5I5L A;  3EEH A;  4G3W A;  4I5S A;  2KDK A;  2EA9 A;  1S4R A;  4MMN A;  3RTY A;  1G28 A;  4MDZ A;  3PBN A;  2JKR M;  4NKP A;  1YAX A;  3BWL A;  2WKP A;  2W3D A;  2R78 A;  5J7E A;  1OTA A;  4EQ1 A;  1OTD A;  4WLA A;  2PYR A;  1N9O A;  2M7U A;  4DN0 A;  2V1B A;  5A8B A;  5MC7 A;  4P6Z S;  5AJG A;  2QJ7 A;  1DRM A;  1YSP A;  2HV1 A;  3LIF A;  5KIZ A;  3SW1 A;  4Y2F A;  4GS9 B;  1YKD A;  1X0O A;  3FC7 A;  2JKR I;  2J3T C;  3CAX A;  1BYW A;  4BBV A;  4LRX C;  1NLZ A;  1LL8 A;  4KQD A;  3H7W A;  4WEL A;  4IJG A;  4HY8 A;  4Q0H A;  5DJT A;  1H3Q A;  2VA0 A;  2ZBB A;  4NXB A;  3MFX A;  4EER A;  2QWS A;  3JVU A;  4ETZ A;  4HNB A;  2D01 A;  4H6J B;  3R7W B;  1S1Y A;  1LT0 A;  4HQA A;  3HJI A;  3CWF A;  2PYP A;  3NOT C;  4PKY A;  1S66 L;  5FL3 A;  4B9O A;  4L9F A;  5F68 A;  3MQO A;  3KYQ A;  4O8G A;  4O0P A;  3E4P A;  3ZYT A;  2J80 A;  2OWJ A;  4L0L A;  4NXG A;  5HPI A;  3PBO A;  3NOU C;  1TS7 A;  5G4Z A;  4I3J A;  3EEA A;  5HL6 A;  2QHK A;  3ZQ5 A;  4R38 A;  1OJ5 A;  3FG8 A;  3PR6 A;  4MN5 A;  5AVF A;  3K3D A;  3VE3 A;  1OT6 A;  3PBR A;  2A24 A;  3B47 A;  3EQU A;  5IU1 A;  5TBM A;  4G3V A;  3R4K A;  3EGX C;  1MC0 A;  3NHQ A;  3IS2 B;  1V9Z A;  4LLO B;  3GEC A;  2Y8H A;  4HH3 A;  3LIB A;  3DBA A;  2EWV A;  1W63 Q;  2J3W A;  4Z1W A;  2VV8 A;  2LB9 A;  4OOL A;  2W1R A;  3S7Q A;  4YWZ A;  2P08 A;  3F1P B;  5HWW A;  4EW7 A;  2K31 A;  3LR5 A;  1XJ4 A;  2J3T D;  1N9L A;  3E98 A;  3EWK A;  3PBT A;  4ZRR A;  5KSH A;  5DJU A;  2LB5 A;  3PBS A;  4I39 A;  1STZ A;  2QKP A;  2P7J A;  4WEJ A;  5HSQ A;  2K7S A;  3EGD C;  4R6L A;  2JKT M;  2NUT C;  2FZ0 A;  2KX6 A;  2OOL A;  1DP9 A;  3LIC A;  2KLI A;  3UMD A;  4P6Z M;  2OAQ 1;  3UB9 A;  3TE8 A;  5J4E A;  1V9Y A;  3FPW A;  4LPZ A;  2XRO A;  2GJ3 A;  2V9A A;  3KSG A;  3K2N A;  5AVE A;  1MKM A;  4HI4 A;  4QPR A;  1OJG A;  4CLC B;  4DJ3 A;  1JNU A;  2VV7 A;  2W1T A;  2CMN A;  5HZH A;  2O0Y A;  1NLY A;  1ZHH B;  1W63 M;  3LIA A;  5HWT A;  3F1O B;  1YSQ A;  2ZMF A;  4G3K A;  5G4Y A;  4KUO A;  3NJA A;  2PT7 A;  3KX0 X;  3LI9 A;  4YOF A;  1GSX A;  4JGQ A;  3H82 A;  2D02 A;  2VGL S;  2W27 A;  2VZW A;  4HOI A;  4EXO A;  3P01 A;  5J3W A;  4O01 A;  2QJ5 A;  2DMW A;  4NEE D;  2PD8 A;  4WEK A;  1S1Z A;  2PR5 A;  3TW8 A;  1Y28 A;  1MZU A;  1KOU A;  2PR6 A;  3A0S A;  3LFV A;  4DJ2 A;  3PYP A;  3EOI A;  1F5M A;  4HP9 A;  2JHE A;  3KSI A;  5HDS A;  1TS8 A;  2YKF A;  3LR4 A;  4XT2 A;  1P9W A;  5HD3 A;  2G7U A;  2OWH A;  2YKH A;  3IBJ A;  3F1P A;  3U2A A;  4BBU A;  2W3G A;  5IT5 A;  5C5K A;  3E4Q A;  4GHI B;  3A0R A;  1LSV A;  4I38 A;  3OCL A;  2W3E A;  2Y79 A;  3T4Q A;  1XJ6 A;  3TJZ C;  1T1C A;  2V0W A;  3F1N A;  1UWP X;  4HHD A;  4HJ4 A;  4JGR A;  3LI8 A;  2B18 A;  2O99 A;  3E0Y A;  4JGP A;  4F3L A;  2PDR A;  3MQ0 A;  3K3C A;  2V1A A;  4BWI A;  4Q0I A;  4L9E A;  2MJ6 A;  4HJ3 A;  3JVV A;  2VX8 A;  3CLO A;  3UE3 A;  3MXQ A;  4Y5F A;  1F98 A;  3G6O A;  4R70 A;  4KUK A;  1UWN X;  1ZTU A;  1WA9 A;  2EWW A;  2L4R A;  2M7V A;  1NRJ A;  4M4X A;  2WKR A;  3A0V A;  5K5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...