3UB6A

Periplasmic portion of the helicobacter pylori chemoreceptor tlpb with urea bound
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
164
structure length
164
Chain Sequence
LAQLMEHLETGQYKKREKTLAYMTKILEQGIHEYYKSFDNDTARKMALDYFKRINDDKGMIYMVVVDKNGVVLFDPVNPKTVGQSGLDAQSVDGVYYVRGYLEAAKKGGGYTYYKMPKYDGGVPEKKFAYSHYDEVSQMVIAATSYYTDINTENKAIKEGVNKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords chemoreceptor TlpB
publication title Structure and proposed mechanism for the pH-sensing Helicobacter pylori chemoreceptor TlpB.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 56
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17200 sCache_2 Single Cache domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ub6A00
1S1ZA 3H7WB 1OJGA 4EEPA 4MN6A 2PDRA 4NXFA 1GSVA 3LIBA 4R38A 2ZOHA 3UMDA 3PYPA 4I3JA 2D02A 1OT6A 2D01A 2KX6A 2ZBBA 2B02A 5HWWA 2JN7A 4DJ3A 3A0SA 1XJ4A 4LRZE 3MFXA 2J80A 4HJ4A 4F3LB 4HH3A 3NHQA 2VV7A 4M4XA 4LRYC 2VEAA 3GECA 2JHEA 1T1AA 5AVFA 3F1NA 4WL9A 1LSWA 3GDIA 2V0WA 1D06A 3BY8A 4EW7A 2PD7A 5F68A 3MR0A 2QJ5A 3MXQA 2W0NA 5DJUA 5HSQA 1OTEA 3EEHA 2V0UA 1N9NA 3NJAA 1WA9A 4L9EA 4HI4A 3FC7A 3HJIA 1OTBA 4JGPA 2PD8A 2BASA 2A24B 4HY8A 4EERA 2OOLA 4I39A 3LIDA 4MN5A 3E4OA 4BBTA 3UB8A 5HDSA 1MZUA 4HJ6A 4GHIA 4GCZA 4EESA 2PHYA 4HH2A 3E4QA 4DJ2A 3LUQA 5IS1A 5HD5A 2V1AA 5I5LA 1LT0A 3CAXA 5DJTA 1Y28A 5HDDA 2V9AA 4LPZA 4LRXC 5G4ZA 3KX0X 3NOUC 4H6JA 4GS9A 1T18A 2HV1A 1UGUA 3LI8A 4R70A 1KOUA 1BYWA 4L9GA 1TS8A 3F1PB 1S4SA 3NOPC 1T19A 2L1MA 1OTAA 4HOIA 4HQAA 2EA9A 4XT2A 3C2WA 4BBVA 1X0OA 3UMEA 1OTIA 2I9VA 4HHDA 1NWZA 2VV8A 3IS2B 4BBUA 1DP8A 3H82B 3CWFA 1T1BA 2VV6A 2ZOIA 3LIEA 3LIFA 2OWJA 3G6OA 1N9OA 2PYRA 3F1OA 4JGRA 2H28A 1F98A 2PYPA 2L0WA 5J3WA 3H7WA 1D7EA 3H9WA 3ZQ5A 3MJQA 2KDKA 4KUKA 3LIAA 1DP9A 3LI9A 2L4RA 4KUOA 2YKFA 1UWPX 4WUJA 2QHKA 1GSWA 4EETB 3NOTC 3LICA 4KQDA 1XFQA 3IBRA 4WLAA 2QWSA 4F3LA 1XFNA 4L9FA 1VB6A 3SW1A 1LL8A 1XJ3A 3E4PA 2PR5A 1JNUA 5F6AA 2P7JA 5A8BA 2WKRA 5EFWA 5AVEA 1S67L 4NXBA 4HJ3A 1N9LA 3F1NB 1XJ2A 1LSVA 3ULFA 2WKQA 1OTDA 2QKPA 1XJ6A 1DRMA 3UB6A 2GJ3A 3T50A 2A24A 2Z6DA 1P0ZA 3B33A 1TS0A 5HZHA 5F5YA 3BY9A 4HIAA 4PKYG 2YKHA 1TS7A 4EQ1A 5TBMA 2V1BA 1ODVA 4R3AA 4HNBA 1OJ5A 4LLOB 4NXGA 3VE3A 4GHIB 1DP6A 3P7NA 5G4YA 3RTYA 1S1YA 2WKPA 1F9IA 1UWNX 1V9YA 4I5SA 1P97A 2OWHA 1OT9A 4R6LA 5HD3A 2QJ7A 2K7SA 3VOLA 4PKYA 4H6JB 4GS9B 4K08A 3MQQA 2W27A 3K3DA 4I3AA 4EXOA 5HWTA 3F1PA 2VLGA 4NXEA 4I3IA 5J4EA 1LSXA 3A0VA 3PHYA 1T1CA 1S4RA 3ICYA 3OLOA 5DKKA 2R78A 4WN5A 3RH8B 2INWA 1EW0A 2CMNA 3FG8A 3LYXA 1GSXA 3EWKA 4EEUA 1S66L 4XT2B 5HWVA 4YWZA 3UB7A 2M1CA 3D72A 3K3CA 4I38A 3IS2A 2Z6CA 4HP9A 5TBMB 3BWLA 3HJKA 3H82A 5KIZA 3UB9A 5F69A 4B9OA 4E04A 4HP4A 5J7EA 5DKLA 3MQOA 1G28A 5HDCA 3A0RA 4RQ9A 3VE4A 4GW9A 2PR6A 4WF0A 5IU1A 3C8CA 3CLOA 3F1OB 4JGOA 1TS6A 4JGQA 3UE6A 1V9ZA
chains in the Genus database with same CATH superfamily
1S1ZA 3EOIA 3OPLA 4EEPA 3BFDA 1CF0A 1LL5A 3UMDA 5L07A 4QD4A 3L7HA 3OBFA 3IWQA 1IFQA 2WGIA 1TDLA 4PM6A 2GDNA 4I3JA 2D02A 3OOVA 1OT6A 1KGEA 3T4JA 3O3VA 2JN7A 3FZCA 2Y2HA 3A0SA 4LRZE 3MFXA 2Y2GA 3GV9A 4HH3A 3TJZC 4QWOA 1PFLA 3A3FA 2JHEA 1T1AA 5DF8A 5EVID 4GDNA 2HDUA 3QNBA 4S2NC 4EW7A 3LY3A 1U60A 2PD7A 2HDRA 4E3LA 3TRCA 4M3KA 4Y0OA 3MR0A 2XROA 4N1HA 5HSQA 4P6BA 2EX6A 2V0UA 2ZQAA 2W3EA 1TVFA 3CUEA 3HJIA 1OTBA 4JGPA 2H5SA 5TJJA 4R4SA 4EERA 4FOFA 2CC1A 1TF1A 3LO7A 3Q82A 2GNXA 4E6WA 1YLTA 1MWSA 5E2HA 4MN5A 5CGSA 2E8IA 1MKMA 2WAEA 4OPQA 5DF7A 5F82A 5FATA 3VP2A 4HJ6A 2Y2MA 4PAUA 1K54C 5L09A 1ESIA 4EESA 2PHYA 1K0KA 2ZQ7A 3CZDA 3E4QA 5EOOA 4DJ2A 3LUQA 2O99A 5IS1A 3IXHA 1XA7A 4B4ZA 2V1AA 5I5LA 3IQAA 2V8FA 1J9MA 5E2EA 5KSCA 4EUVA 4CJNA 1CI8A 1W5DA 3MZFA 2ZC5B 4MNRA 5E2GA 4GNUA 3KX0X 4H6JA 3HREA 3B47A 4O7DA 1K56D 2GX5A 1LHYA 3LR5A 4P6ZS 1UGUA 3M2JA 3HLBA 4NEED 1BYWA 4DMZA 1YSPA 4L9GA 4E3NA 3G34A 3NOPC 5M18A 3QP5A 4HBTA 2L1MA 2PRFA 4HQAA 1XX2A 1CJFA 3P01A 4R23A 3HLWA 3JVVA 3ZG0A 1HZOA 2G2UA 5CERA 3PBTA 4DE0A 2W3HA 3TG9A 1OTIA 3OC2A 4QHCA 3GVBA 4ZDXA 3IS2B 1E3UA 1DP8A 5EVEA 3Q07A 3H82B 1HVBA 2VV6A 3LIEA 4YFMA 2PYRA 4OOLA 3BFCA 2ZQ8A 3PBRA 2PYPA 1E25A 2L0WA 3H9WA 1XGJA 4X68A 5IT5A 4IUKA 3B3XA 3N8RA 4KUKA 4QU3A 3G2YA 5FSRA 1AXBA 4ID4A 3A3EA 3LI9A 3FWLA 4ZRRA 2Q9MA 5E43A 3SZTA 2L4RA 3CG5A 5FQQA 3HCYA 2VGKA 2X71A 2WKHA 4HESA 3N8LA 2VJWA 3LCEA 3JVUA 4X69A 1KVMA 5A91A 3NOTC 1N4OA 3LICA 4KQDA 2DCFA 1HLUP 3SOIA 1VB6A 1LL8A 1K4EA 1K38A 1MWTA 3ZYTA 3IF6C 4LV0A 1YLPA 5F6AA 1FCNA 2QZ6A 4C3QA 5AVEA 5HPFA 1S67L 2Y79A 4HJ3A 1LSVA 2XRNA 5TFQA 1SDEA 1ES4A 3T12B 1MY8A 4G3VA 2QKPA 2XA7S 1PYYA 1W63M 1XJ6A 1YMXA 3QNCA 1DRMA 1TDGA 4N9LA 3UNWA 3T50A 3VMAA 2W3DA 4E3MA 3OCNA 3S22A 1NYYA 2V2FF 3N4IA 5GHZA 1ERQA 5IHVA 1TS0A 5HZHA 5F5YA 4MBKA 3M2KA 2WKEA 1BLCA 3BY9A 4PKYG 1QMFA 4EBLA 2YKHA 1MWUA 3ITAA 1TS7A 3KYEA 5TBMA 5AQ9A 1M40A 1JVJA 4R3AA 1OJ5A 1G68A 1PW8A 4LLOB 4UEYA 4NXGA 1XA1A 1RCJA 3NDEA 4X25A 3P7NA 3DBAA 1GCEA 3ZG7B 2WGVA 1IYQA 1V9YA 1PRQA 1G6OA 2JCHA 2FFFB 1GHPA 4I5SA 2H0TA 4MN7A 1P97A 3NC8A 1OT9A 1PW1A 4OP8A 4ZJ3A 1MXOA 4PKYA 3QP1A 1K6SA 2K2NA 5F1GA 4GS9B 4EWFA 4B93A 2PT7A 2J9OA 2MJ6A 4WMCA 3GTCA 3JPUA 5EV0A 3WS2A 3BRMA 4I3IA 5J4EA 2OLVA 4OOYA 4S2NA 4PM7A 5HFOA 3IXGA 1T1CA 2Y8HA 1Q2QA 3U4LP 4WN5A 3RH8B 2INWA 1LI0A 3UDFA 1EW0A 2XEPA 3Q7VA 5D3OA 1JTDA 4BENA 3DTIA 2DNSA 2WAFA 2Y4AA 3K3CA 1ES3A 4BL2A 3IS2A 3H82A 5KIZA 2PBYA 2FH5A 2UWXA 4LCLA 5CRFA 4CLCE 2E8JA 1K54A 2Y2QA 2W1TB 5EVIC 3MQOA 5FAOA 1NZUA 4RQ9A 3VE4A 4GW9A 4N92A 5IU1A 2VA0A 3CLOA 3F1OB 4JGOA 2Y2LA 1TS6A 3Q81A 3UE0A 3SS5A 3HUNA 2JC7A 4BD1A 3H7WB 2O9BA 4ETZA 4X6TA 2A2LA 3V50A 3C7VA 2PDRA 3RJUA 2PAVP 3GR2A 1GSVA 3R7WA 3MS6A 2XH9A 4BJPA 4WBGA 3OPPA 4Y0UA 2XD1A 4JXSA 4OPZA 4OPYA 1L3LA 3HLGA 4R3BA 3EEAA 3PYPA 1W8QA 3MXRA 2KX6A 2ZBBA 4CQHA 5M19A 1H8ZA 3IH9A 3VP4A 4HJ4A 3KO6A 4UA6A 1STZA 2VV7A 3C38A 1BSGA 4LRYC 2H10A 4GJ4A 4LENA 5AVFA 1H8YA 2XFSA 5F68A 2WADA 1KE3A 2QJ5A 3BQ8A 2FZ0A 4U3TA 2W0NA 5DJUA 1OTEA 1ZG6A 3NJAA 1VEUB 3MFDA 3IX4A 3NY4A 3V3SA 5FQJA 5U47A 3K2NA 4X56A 4I39A 5EVIB 1JWVA 4BBTA 3UB8A 4EU0A 1XGIA 3BLMA 5L8MA 4KQRA 2HDSA 1FSYA 5DTKA 4O01A 4GCZA 1IOUA 3L9KA 3C30A 2HGVA 4X55A 4HH2A 3E2LA 4IEDA 1CQAA 1WYBA 1K4FA 5HD5A 1LT0A 4LGWA 3HLFA 5TR7A 4AFIA 1Y28A 5HDDA 2V9AA 4LPZA 3WRTA 1YLZA 3CITA 5G4ZA 4K0WA 4X1MA 3U2AA 2HPBA 3SH7A 4EBNA 1FQGA 2EXAA 3T4LA 4GS9A 4HEFA 4WELA 5HL6A 3QP6A 5FI7A 3IF6A 4OLDA 4HBUA 5AQ7A 3WS5A 1F5MA 5L2FA 3E98A 1MKIA 1FOFA 1I2SA 1S0WA 3S1YA 2ZC7A 4PMAA 2K31A 4YINA 5DF9A 2RL3A 4HOIA 2HP9A 1RGYA 3BW6A 3C7UA 2KLIA 2BG1A 5CTMA 2EA9A 4N1XA 3C2WA 1PWDA 2J8YA 2XQZA 3FV7A 1GHMA 4BBVA 4EQIA 5KSHA 3GRJA 1X0OA 3UE3A 1W7FA 4BMWA 1YPRA 3W4PA 1QMEA 3CWFA 1T1BA 5GLBA 2OWJA 3G6OA 3F1OA 2HP6A 1O7EA 3UDXA 4E3KA 4UHUA 2NUTC 4JGRA 4BLMA 2H28A 4JXVA 4L0LA 3H7WA 1VETB 3DWZA 3ZQ5A 1H8MA 1SKOB 1WE4A 2HDQA 2JKFA 1Z6FA 1LI9A 3DW0A 2JBFA 2GZAA 4OLGA 4OONA 3UPPA 1CK3A 5EPHA 2X01A 4ZBEA 1IKGA 5AQBA 4OQGA 5FA7A 4EETB 4MCWA 1G5UA 3MZDA 4WLAA 2QWSA 1EI5A 4RX2A 4IJGA 5GL9A 3FPWA 1K6RA 3CHWP 2Y2KA 4MBFA 2P7JA 5FDSA 5EUAA 5A8BA 2WKRA 2IWCA 5FEFA 3IWOA 2O9CA 3IHAA 1ESUA 4JBFA 1L0DA 2IWDA 3G4PA 3A3DA 5CTNA 3E0YA 1N9LA 3F1NB 1XJ2A 5EVLA 5CHJA 4KZ7A 5L10A 4NETA 5FI2A 1A0KA 2J9PA 4GB7A 2EFUA 3UB6A 4DE1A 4IBXA 4MEZA 3NIAA 5EVIA 2X02A 4WZ5C 4ZJ1A 3KYZA 2HP5A 4GN2A 3ZNYA 4EQ1A 1P9WA 2V1BA 3ITBA 5FAQA 3VE3A 2VKSA 1BLSA 1DP6A 4Q8IA 1IKIA 4KZAA 1F9IA 1UWNX 4YOFA 3PXPA 3QP8A 1MWRA 4Q0IA 3KYQA 3MXSA 4DDYA 2OWHA 4R1GA 4XXRA 2QJ7A 5TGFA 4R3JA 4GZBA 3WS0A 4QY6A 3VOLA 1YAXA 5BOHA 2IWBA 1NRFA 2VK3A 4I3AA 3BYDA 3EGXC 1YMSA 2XDMA 3KSHA 3LFVA 3PHYA 3G31A 3V3RA 5FL3A 1K56A 3OLOA 3HVFA 2C6WB 3ZVWA 2R78A 3W4QA 3FG8A 1O07A 1GSXA 1JWZA 4E6XA 4LV3A 3EWKA 1ES5A 4XT2B 5EE8A 4KQQA 2XFTA 4FD8A 1KGGA 4YWZA 4WEJA 4GOGA 4I38A 1Y54A 4HP9A 5E2FA 3UO9A 1DY6A 4OQ0A 3UB5P 3WWXA 4B9OA 5I94A 4HP4A 1K57C 5FQKA 5J7EA 4KG2A 3BFGA 5KZHA 3DAVA 4DXBA 2NUPC 1ACFA 1VHMA 2PR6A 1D1JA 4WF0A 1VETA 2O0YA 5DVAA 2LB9A 3NBLA 4JGQA 2ZL1B 3UE6A 2ZD8A 2EFXA 2WZXA 2OAP1 1PWCA 4KENB 1OJGA 5AJGA 3C4OA 1NJ4A 3NDGA 3IX8A 4JF6A 4MN6A 1KDWA 3VP3A 1PI5A 3BFFA 4R38A 2ZOHA 4OQHA 3UE1A 4MMNA 4QB8A 3IX3A 4KZ3A 1MPLA 5A92A 3HUMA 3HL9A 1HTZA 3VP0A 4B88A 5CECA 1XXMA 1SHVA 1KE0A 4RX3A 1JWPA 2ZC6B 1LL9A 2J80A 4ZJ2A 1H5XA 3S4XA 3NHQA 4S2KA 4CLCB 4M4XA 4JLFA 3GECA 1IYOA 4PM9A 1Q2PA 3F1NA 2ACGA 2V0WA 4OQIA 3BY8A 1M6KA 2Y2NA 1SZVA 2Y2IA 1YQSA 2ZQDA 3LY4A 3TSGA 3EEHA 4RA7A 5GHYA 3AGEA 3LEZA 2ZM0A 1YLWA 4HI4A 4L9EA 3NULA 1KVLA 5FEGA 2BASA 2A24B 4HY8A 3G30A 5C5KA 3S7QA 2WKIA 2QYBA 3LIDA 1RP5A 5F1FA 3E4OA 3FPVA 2EWWA 2XD5A 1MZUA 5FQMA 3IBJA 2ZC4B 3V39A 4DRTA 2FFYA 3VOZA 2ZM8A 3CAXA 5DTTA 1ZKJA 1I5QA 3O5YA 4P87A 2P08A 3UPOA 2EX9A 3NOUC 1T18A 4X53A 3WRZA 1AWIA 1VQQA 3LI8A 1NLZA 4QPRA 2XK1A 3AGFA 1WYCA 4R70A 1KOUA 2G2WA 4CLCD 3NECA 3GSGA 1JTGA 1IELA 3OCLA 3BQAA 4FSFA 1TS8A 4OVDA 1EROA 4O0PA 4IBRA 3TOIA 4XT2A 5CGXA 5HX9A 2ZC3B 1W8YA 3P09A 2ZM2A 1L0FA 2V8CA 4GD8A 4WZ5A 3A3JA 3TW8A 1NWZA 3ZG9B 2VV8A 3RXXA 3T4KA 4GD6A 2OAQ1 3I7JA 2XSSA 3MMHA 2ZOIA 3FYZA 3EQVA 4PM5A 4BWIA 1FCOA 4RVAA 4D2OA 4Q0JA 1N9OA 4C6YA 5K5BA 3QP4A 3EGDC 3P98A 4DE2A 5HAIA 1FSWA 1P9RA 3NCKA 3MJQA 2KDKA 3CI6A 3VFFA 1OPXA 1DP9A 4Y13A 3G2ZA 3O87A 2XF3A 3OPHA 3MKFA 3JYIA 2IA2A 2YKFA 1UWPX 4WUJA 2QHKA 5EECA 2Q9NA 1ZC2A 3MZEA 4XUXA 3ZG8B 3MBZA 4Y3IA 5M1AA 4PPRA 5G18A 3IT9A 1XFQA 2O9AA 3IBRA 4OPRA 4L9FA 1MC0A 3MSHA 1L0EA 2WGWB 3PBNA 3SW1A 4Z9QA 1XJ3A 3AGDA 2PR5A 4E3OA 1FILA 3BFEA 4IUHA 4S2IA 1KGFA 3VSLA 5EFWA 4NXBA 4GLQA 4KZ8A 4DF6A 3BM6A 3CJMA 3PBSA 4EV4A 2DRWA 1K25A 1OTDA 1NY0A 3CPTB 2HJEA 5CGWA 2M7UA 2QPNA 3V67A 1K57A 3S7NA 2A24A 2Z6DA 4II7A 1P0ZA 2Y2JA 4WEKA 2HF6A 5CX7A 1YT4A 4JXWA 5DTSA 4JXGA 4HIAA 4BD0A 1S6RA 4S2LA 3N6IA 2V20A 3LR3A 3SH8A 5FI6A 4BL3A 5DFYA 3PAEA 3VOYA 4HNBA 5CHMA 4GHIB 4OOMA 3ZHHA 5G4YA 1KDSA 1PI4A 3BEBA 3RTYA 5KMWA 1YLYA 2WKPA 2W1TA 4EBPA 3GQZA 3LGOA 3UDIA 2JKGA 1BZAA 3C5AA 3B42A 4UA7A 2K7SA 1BLPA 3D4FA 4DKIA 1CI9A 1GA9A 3PAGA 2W27A 3V5MA 3K3DA 2ZMFA 4WYYA 5HWTA 4MBHA 4FTXA 3GMWA 1BUEA 4S2MA 1ES2A 4NXEA 1S4RA 4ME4A 3ICYA 2EWVA 1E3UD 5DKKA 2WYXA 1L0GA 2VGJA 4JKTA 2CMNA 3LYXA 4OH0A 4D60A 3BLSA 3DTMA 1W63Q 4KG6A 1S66L 4XUZA 4EEUA 3S7PA 5HPIA 3Q1FA 2M1CA 1SCWA 3D72A 2Z6CA 1DJAA 5TBMB 3BWLA 3HJKA 2JE5A 3O86A 2ZMVA 3UB9A 4BQMA 1MBLA 5F69A 1XPBA 5DFXA 4NKPA 3DTKA 1NXYA 3A0RA 2J3WA 2PBDP 5EM0A 2JKRM 1ONGA 3C8CA 1VEUA 4Q0HA 1EWZA 1V9ZA 4KZ5A 4NG2A 1YM1A 4A5RA 4UQIM 2KOIA 4NXFA 5JYPA 2EX8A 1K55C 3LIBA 1FCMA 3N8SA 5MC7A 5A93A 4S2JA 4PM8A 1ZG4A 5FASA 4WM9A 4QJGA 2RCXA 5HAPA 2D01A 1SDNA 2WGWA 4S2OA 2B02A 5HWWA 1L2SA 4DJ3A 2DMWA 1XJ4A 1F2KA 1H0MA 3Q7VB 4F3LB 4FH4A 4CPKA 1PZPA 2JKTM 3ZDJA 4O8GA 5EM1A 3VV4A 1NRJA 2VEAA 1YKDA 2J3TD 2OSUA 4WL9A 1LSWA 3GDIA 1D06A 3ZCZA 5GLCA 3CPTA 3N7WA 3T4SA 4LV2A 5FQ9A 4QY5A 3G32A 4JF4A 4R0QA 5CEBA 1BTLA 1C3BA 3M6HA 3MXQA 2I72A 4IHQA 5GLDA 3UN7A 1N9NA 1WA9A 3PBOA 3FC7A 4CLCC 2PD8A 2OV5A 3RXWA 3ZGAB 2OOLA 4F94A 3ZVTA 1XP4A 2WK0A 2Y2OA 3W2ZA 3A3IA 5HAQA 3VP1A 4FH2A 3TE8A 5HDSA 3R4KA 5FDHA 3WS4A 2W3FA 3R7WB 4GHIA 3MKEA 5LBRA 4KZ4A 3SS3A 3FKVA 2OLUA 4Y7PA 2P04A 1SKFA 3KSGA 5DJTA 1FR6A 1YSQA 4LV1A 4LRXC 4WMCD 2WZZA 5F83A 4Z1WA 3QP2A 2ZQCA 4U0XA 2P9VB 1ONHA 4KG5A 2B5RA 4UAAA 1SKOA 1PIOA 2HV1A 2C5WB 3UPNA 4P85A 4KQOA 4KZ6A 4MLLA 3ZG5A 1FIKA 1PNEA 3IXDA 2A49A 3F1PB 1S4SA 4YNRA 4ARZB 4DE3A 1BULA 1T19A 3WS1A 4DXCA 3LR0A 1OTAA 2Y55A 4RYEA 2XGNA 1PZOA 2HZ5A 1IEMA 4E3JA 3UY6A 2J7VA 1OMEA 2VGLS 4DDSA 3UMEA 1ALQA 4GDBA 4LFUA 2I9VA 3BECA 4HHDA 4ZTKA 5EOEA 4BBUA 5CXWA 2W1RA 1HD8A 3CUEC 3SS4A 2H0YA 4G3KA 3LIFA 3EQUA 2ZQ9A 4ZAMA 1NLYA 1Z09A 4C75A 3DTEA 1BLHA 1F98A 4OKPA 4Y15A 5J3WA 1D7EA 1DJCA 3HBRA 1N9BA 5FQIA 3LIAA 1Y4OA 4PHTA 1W79A 3NI9A 3IF6B 4R4RA 3DWKA 1G6AA 4KUOA 5CHUA 4K91A 4G3WA 3HLEA 4P6ZM 1IYPA 1TD5A 1GSWA 2EX2A 2VX8A 1VM1A 3FKWA 4NK3A 4ETXA 1KE4A 3KSIA 4F3LA 4N9KA 1XFNA 1H3QA 3OZHA 2W3GA 2JKRI 4Y5FA 3E4PA 1JNUA 2AVXA 3D3OA 2Q0OA 2Y59A 2Y2PA 1XKZA 1E4DA 3VFHA 4Y2FA 3ULFA 2EXBA 2V1ZA 2ZJ9A 2WKQA 3PR6A 1GHIA 3O88A 2UV0E 2BLSA 3HLCA 2GJ3A 3IXBA 2PU4A 4MDZA 3IWIA 3S7OA 1NZOA 3C4PA 3B33A 4JF5A 4DN0A 2BTFP 4JPMA 1J3WA 1ZHHB 2P74A 4GKUA 4IVIA 2XR0A 2A3UA 4KZBA 2XLNA 3T4OA 4H8RA 4IVKA 3E2KA 2JKTI 3ZNTA 2HJ9C 4ESPA 1ODVA 5J8XA 4OP5A 1NYMA 4FCFA 3T4TA 3VSKA 1K55A 1S1YA 2M7VA 1PWGA 4U0TA 4WZ4A 3PBQA 3RFBA 2WUQA 2R9WA 2P9VA 3IHBA 2VZWA 1BT5A 5HL1A 2ZL1A 1ZTUA 4UQIS 4Y0TA 4R6LA 5HD3A 3T1QB 1IYSA 3W8KA 1YLJA 2B18A 3M6BA 4P0MA 2Z2LB 5CEDA 1FR1A 3BJNA 4H6JB 5HW3A 2G7UA 4K08A 1CEFA 2Z2MB 3MQQA 3T1RA 4B4XA 2PU2A 3T4QA 4EXOA 5A90A 3T1XA 1GA0A 5FAPA 3F1PA 3HUOA 4ARZA 2VLGA 1DJBA 3MF0A 1LSXA 2ZLYA 3A0VA 2ZMAA 3T1SA 5HARA 1RGZA 3G35A 2QMIA 3OPRA 3ISGA 2XA7M 3HLDA 2Y91A 4E3IA 4FUWA 3LEQA 1CEGA 4UA9A 5AQAA 5GHXA 4LCMA 3QHYA 2R9XA 4CLCA 5HWVA 3UB7A 3W4OA 4KZ9A 2B95A 1TEMA 2LB5A 3Q7ZA 4K0XA 2VGLM 4E04A 5JYOA 4X1LA 3IF5A 1ERMA 4Y17A 3D9YA 2J3TC 1I2WA 5DKLA 1G28A 5HDCA 3IH8A 3SH9A 3CMZA 1LLBA 3ZFZA 5GLAA 3PTEA 3KSFA 3LR4A 3MQ0A 4EUZA 4S2PA
chains in the Genus database with same CATH topology
1S1ZA 2OAP1 3EOIA 3H7WB 1OJGA 2O9BA 5AJGA 4ETZA 4UQIM 2A2LA 4EEPA 4MN6A 2KOIA 2PDRA 4NXFA 1GSVA 3LIBA 3R7WA 4BJPA 4R38A 5MC7A 2ZOHA 4MMNA 3UMDA 3OBFA 3EEAA 3PYPA 1IFQA 4I3JA 2D02A 3OOVA 1OT6A 2D01A 2KX6A 2ZBBA 3T4JA 2B02A 5HWWA 4CQHA 2JN7A 4DJ3A 2DMWA 3A0SA 1XJ4A 4LRZE 3MFXA 2J80A 4HJ4A 4F3LB 3KO6A 4HH3A 3TJZC 2JKTM 3NHQA 1STZA 2VV7A 4CLCB 4O8GA 3C38A 4M4XA 4LRYC 3VV4A 1NRJA 2VEAA 3GECA 2JHEA 1T1AA 4GJ4A 1YKDA 5AVFA 3F1NA 2J3TD 4WL9A 1LSWA 3GDIA 2V0WA 1D06A 3BY8A 4EW7A 2PD7A 5F68A 3T4SA 3TRCA 3MR0A 2QJ5A 3BQ8A 2FZ0A 2XROA 3MXQA 2W0NA 5DJUA 5HSQA 4IHQA 1OTEA 3EEHA 2V0UA 1N9NA 3NJAA 1WA9A 3PBOA 2W3EA 4HI4A 4L9EA 3FC7A 3CUEA 3HJIA 1OTBA 4CLCC 4JGPA 2PD8A 2BASA 2A24B 5TJJA 4HY8A 5C5KA 4EERA 2OOLA 3K2NA 4FOFA 3S7QA 4I39A 1TF1A 2QYBA 3LIDA 2GNXA 4MN5A 3W2ZA 1MKMA 3E4OA 3FPVA 4BBTA 3UB8A 4EU0A 3TE8A 2EWWA 5HDSA 3R4KA 5L8MA 1MZUA 4HJ6A 2W3FA 4PAUA 3R7WB 3IBJA 4GHIA 4O01A 4GCZA 4EESA 1IOUA 2PHYA 2HGVA 3C30A 4HH2A 3E4QA 4DJ2A 3LUQA 5LBRA 2O99A 5IS1A 5HD5A 2V1AA 5I5LA 1LT0A 3CAXA 2P04A 3KSGA 4AFIA 5DJTA 1Y28A 4EUVA 5HDDA 1YSQA 2V9AA 4LPZA 4LRXC 4Z1WA 3CITA 5G4ZA 3U2AA 3O5YA 2P08A 3KX0X 3NOUC 4H6JA 3B47A 3T4LA 4GS9A 1T18A 2GX5A 4WELA 5HL6A 3LR5A 2HV1A 4P6ZS 1UGUA 3LI8A 1NLZA 4QPRA 4NEED 4R70A 1KOUA 4KQOA 1BYWA 1F5MA 3E98A 4CLCD 4DMZA 1YSPA 4L9GA 3OCLA 3BQAA 4FSFA 1TS8A 3F1PB 1S4SA 4YNRA 3NOPC 4ARZB 2K31A 1T19A 2L1MA 5DF9A 3LR0A 4O0PA 1OTAA 4HOIA 4HQAA 3BW6A 2KLIA 2EA9A 3P01A 4XT2A 3C2WA 3JVVA 2VGLS 4BBVA 5KSHA 3PBTA 1X0OA 2W3HA 3UE3A 3UMEA 1OTIA 3OC2A 3TW8A 2I9VA 4HHDA 1NWZA 2VV8A 3IS2B 4BMWA 3T4KA 4BBUA 1DP8A 2OAQ1 2XSSA 3MMHA 3H82B 3CWFA 1T1BA 2VV6A 2ZOIA 3LIEA 2W1RA 3EQVA 3CUEC 4BWIA 4G3KA 3LIFA 4Q0JA 3EQUA 2OWJA 3G6OA 1N9OA 2PYRA 3F1OA 4OOLA 1NLYA 5K5BA 2NUTC 4JGRA 2H28A 1F98A 3PBRA 2PYPA 4L0LA 2L0WA 3EGDC 5J3WA 3H7WA 1D7EA 3H9WA 3ZQ5A 5IT5A 4IUKA 1H8MA 1P9RA 3MJQA 2KDKA 3CI6A 4KUKA 3LIAA 1OPXA 1DP9A 4PHTA 3LI9A 4ZRRA 2L4RA 2GZAA 4KUOA 2IA2A 2YKFA 1UWPX 3HCYA 4G3WA 4WUJA 4P6ZM 2QHKA 1TD5A 1GSWA 2VJWA 4Y3IA 2VX8A 3JVUA 4EETB 4ETXA 3NOTC 3LICA 4MCWA 3KSIA 4KQDA 1XFQA 2O9AA 3IBRA 4WLAA 2QWSA 4F3LA 1XFNA 4L9FA 1H3QA 1MC0A 4IJGA 1VB6A 3PBNA 3SW1A 1LL8A 2W3GA 3FPWA 1XJ3A 2JKRI 3E4PA 4Y5FA 3ZYTA 2PR5A 1JNUA 5F6AA 2P7JA 3D3OA 5A8BA 2WKRA 4IUHA 2O9CA 5EFWA 5AVEA 5HPFA 1S67L 2Y79A 4NXBA 4HJ3A 4GLQA 3E0YA 1N9LA 3F1NB 1XJ2A 1LSVA 2XRNA 4Y2FA 3PBSA 3ULFA 2WKQA 3PR6A 1OTDA 4G3VA 2QKPA 2XA7S 1W63M 1XJ6A 2HJEA 1DRMA 3UB6A 2M7UA 3V67A 2GJ3A 3T50A 3S7NA 2A24A 4MDZA 2W3DA 3S7OA 2Z6DA 3OCNA 4II7A 1P0ZA 3B33A 4WEKA 2HF6A 5CX7A 1TS0A 4DN0A 5HZHA 5F5YA 3BY9A 1ZHHB 4HIAA 3KYZA 4PKYG 2YKHA 3LR3A 3T4OA 1TS7A 4EQ1A 5TBMA 1P9WA 2JKTI 2HJ9C 2V1BA 5DFYA 1ODVA 4R3AA 4HNBA 1OJ5A 4UEYA 4LLOB 4NXGA 3T4TA 3VE3A 4GHIB 4OOMA 2VKSA 1DP6A 3P7NA 3DBAA 5G4YA 3RTYA 1S1YA 2M7VA 2WKPA 2W1TA 1F9IA 1UWNX 3PBQA 3RFBA 4YOFA 3PXPA 1V9YA 1G6OA 2VZWA 4I5SA 4Q0IA 1ZTUA 3KYQA 4MN7A 4UQIS 1P97A 2OWHA 1OT9A 3B42A 4R6LA 5HD3A 2QJ7A 2K7SA 2B18A 3VOLA 1YAXA 4PKYA 3BJNA 4H6JB 2K2NA 4GS9B 2G7UA 4K08A 3MQQA 2W27A 2PT7A 4B93A 3T4QA 3K3DA 2ZMFA 4I3AA 4EXOA 2MJ6A 5HWTA 3EGXC 3F1PA 3KSHA 4ARZA 2VLGA 4NXEA 3LFVA 3MF0A 4I3IA 1LSXA 5J4EA 3A0VA 3PHYA 1T1CA 2Y8HA 1S4RA 5FL3A 4ME4A 3ICYA 3OLOA 2EWVA 2XA7M 5DKKA 2R78A 4WN5A 3RH8B 2INWA 1EW0A 2CMNA 3FG8A 3LYXA 1GSXA 3EWKA 1W63Q 4EEUA 1S66L 4XT2B 3S7PA 5HPIA 4CLCA 5HWVA 4YWZA 3UB7A 2M1CA 4WEJA 3D72A 3K3CA 4I38A 3IS2A 2LB5A 2Z6CA 4HP9A 5TBMB 3BWLA 3HJKA 3H82A 5KIZA 2ZMVA 3UB9A 2FH5A 5F69A 4B9OA 2VGLM 4E04A 4HP4A 4CLCE 5DFXA 5J7EA 4NKPA 2W1TB 2J3TC 5DKLA 3MQOA 2NUPC 1G28A 5HDCA 1VHMA 2J3WA 3A0RA 4RQ9A 3VE4A 2JKRM 4GW9A 2PR6A 4WF0A 5IU1A 3C8CA 2VA0A 4Q0HA 3CLOA 2O0YA 3F1OB 4JGOA 2LB9A 1TS6A 4JGQA 3KSFA 3LR4A 3MQ0A 3UE6A 1V9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S1Z A;  3H7W B;  1OJG A;  4EEP A;  4MN6 A;  2PDR A;  4NXF A;  1GSV A;  3LIB A;  4R38 A;  2ZOH A;  3UMD A;  3PYP A;  4I3J A;  2D02 A;  1OT6 A;  2D01 A;  2KX6 A;  2ZBB A;  2B02 A;  5HWW A;  2JN7 A;  4DJ3 A;  3A0S A;  1XJ4 A;  4LRZ E;  3MFX A;  2J80 A;  4HJ4 A;  4F3L B;  4HH3 A;  3NHQ A;  2VV7 A;  4M4X A;  4LRY C;  2VEA A;  3GEC A;  2JHE A;  1T1A A;  5AVF A;  3F1N A;  4WL9 A;  1LSW A;  3GDI A;  2V0W A;  1D06 A;  3BY8 A;  4EW7 A;  2PD7 A;  5F68 A;  3MR0 A;  2QJ5 A;  3MXQ A;  2W0N A;  5DJU A;  5HSQ A;  1OTE A;  3EEH A;  2V0U A;  1N9N A;  3NJA A;  1WA9 A;  4L9E A;  4HI4 A;  3FC7 A;  3HJI A;  1OTB A;  4JGP A;  2PD8 A;  2BAS A;  2A24 B;  4HY8 A;  4EER A;  2OOL A;  4I39 A;  3LID A;  4MN5 A;  3E4O A;  4BBT A;  3UB8 A;  5HDS A;  1MZU A;  4HJ6 A;  4GHI A;  4GCZ A;  4EES A;  2PHY A;  4HH2 A;  3E4Q A;  4DJ2 A;  3LUQ A;  5IS1 A;  5HD5 A;  2V1A A;  5I5L A;  1LT0 A;  3CAX A;  5DJT A;  1Y28 A;  5HDD A;  2V9A A;  4LPZ A;  4LRX C;  5G4Z A;  3KX0 X;  3NOU C;  4H6J A;  4GS9 A;  1T18 A;  2HV1 A;  1UGU A;  3LI8 A;  4R70 A;  1KOU A;  1BYW A;  4L9G A;  1TS8 A;  3F1P B;  1S4S A;  3NOP C;  1T19 A;  2L1M A;  1OTA A;  4HOI A;  4HQA A;  2EA9 A;  4XT2 A;  3C2W A;  4BBV A;  1X0O A;  3UME A;  1OTI A;  2I9V A;  4HHD A;  1NWZ A;  2VV8 A;  3IS2 B;  4BBU A;  1DP8 A;  3H82 B;  3CWF A;  1T1B A;  2VV6 A;  2ZOI A;  3LIE A;  3LIF A;  2OWJ A;  3G6O A;  1N9O A;  2PYR A;  3F1O A;  4JGR A;  2H28 A;  1F98 A;  2PYP A;  2L0W A;  5J3W A;  3H7W A;  1D7E A;  3H9W A;  3ZQ5 A;  3MJQ A;  2KDK A;  4KUK A;  3LIA A;  1DP9 A;  3LI9 A;  2L4R A;  4KUO A;  2YKF A;  1UWP X;  4WUJ A;  2QHK A;  1GSW A;  4EET B;  3NOT C;  3LIC A;  4KQD A;  1XFQ A;  3IBR A;  4WLA A;  2QWS A;  4F3L A;  1XFN A;  4L9F A;  1VB6 A;  3SW1 A;  1LL8 A;  1XJ3 A;  3E4P A;  2PR5 A;  1JNU A;  5F6A A;  2P7J A;  5A8B A;  2WKR A;  5EFW A;  5AVE A;  1S67 L;  4NXB A;  4HJ3 A;  1N9L A;  3F1N B;  1XJ2 A;  1LSV A;  3ULF A;  2WKQ A;  1OTD A;  2QKP A;  1XJ6 A;  1DRM A;  3UB6 A;  2GJ3 A;  3T50 A;  2A24 A;  2Z6D A;  1P0Z A;  3B33 A;  1TS0 A;  5HZH A;  5F5Y A;  3BY9 A;  4HIA A;  4PKY G;  2YKH A;  1TS7 A;  4EQ1 A;  5TBM A;  2V1B A;  1ODV A;  4R3A A;  4HNB A;  1OJ5 A;  4LLO B;  4NXG A;  3VE3 A;  4GHI B;  1DP6 A;  3P7N A;  5G4Y A;  3RTY A;  1S1Y A;  2WKP A;  1F9I A;  1UWN X;  1V9Y A;  4I5S A;  1P97 A;  2OWH A;  1OT9 A;  4R6L A;  5HD3 A;  2QJ7 A;  2K7S A;  3VOL A;  4PKY A;  4H6J B;  4GS9 B;  4K08 A;  3MQQ A;  2W27 A;  3K3D A;  4I3A A;  4EXO A;  5HWT A;  3F1P A;  2VLG A;  4NXE A;  4I3I A;  5J4E A;  1LSX A;  3A0V A;  3PHY A;  1T1C A;  1S4R A;  3ICY A;  3OLO A;  5DKK A;  2R78 A;  4WN5 A;  3RH8 B;  2INW A;  1EW0 A;  2CMN A;  3FG8 A;  3LYX A;  1GSX A;  3EWK A;  4EEU A;  1S66 L;  4XT2 B;  5HWV A;  4YWZ A;  3UB7 A;  2M1C A;  3D72 A;  3K3C A;  4I38 A;  3IS2 A;  2Z6C A;  4HP9 A;  5TBM B;  3BWL A;  3HJK A;  3H82 A;  5KIZ A;  3UB9 A;  5F69 A;  4B9O A;  4E04 A;  4HP4 A;  5J7E A;  5DKL A;  3MQO A;  1G28 A;  5HDC A;  3A0R A;  4RQ9 A;  3VE4 A;  4GW9 A;  2PR6 A;  4WF0 A;  5IU1 A;  3C8C A;  3CLO A;  3F1O B;  4JGO A;  1TS6 A;  4JGQ A;  3UE6 A;  1V9Z A; 
#chains in the Genus database with same CATH topology
 1S1Z A;  3EOI A;  3OPL A;  4EEP A;  3BFD A;  1CF0 A;  1LL5 A;  3UMD A;  5L07 A;  4QD4 A;  3L7H A;  3OBF A;  3IWQ A;  1IFQ A;  2WGI A;  1TDL A;  4PM6 A;  2GDN A;  4I3J A;  2D02 A;  3OOV A;  1OT6 A;  1KGE A;  3T4J A;  3O3V A;  2JN7 A;  3FZC A;  2Y2H A;  3A0S A;  4LRZ E;  3MFX A;  2Y2G A;  3GV9 A;  4HH3 A;  3TJZ C;  4QWO A;  1PFL A;  3A3F A;  2JHE A;  1T1A A;  5DF8 A;  5EVI D;  4GDN A;  2HDU A;  3QNB A;  4S2N C;  4EW7 A;  3LY3 A;  1U60 A;  2PD7 A;  2HDR A;  4E3L A;  3TRC A;  4M3K A;  4Y0O A;  3MR0 A;  2XRO A;  4N1H A;  5HSQ A;  4P6B A;  2EX6 A;  2V0U A;  2ZQA A;  2W3E A;  1TVF A;  3CUE A;  3HJI A;  1OTB A;  4JGP A;  2H5S A;  5TJJ A;  4R4S A;  4EER A;  4FOF A;  2CC1 A;  1TF1 A;  3LO7 A;  3Q82 A;  2GNX A;  4E6W A;  1YLT A;  1MWS A;  5E2H A;  4MN5 A;  5CGS A;  2E8I A;  1MKM A;  2WAE A;  4OPQ A;  5DF7 A;  5F82 A;  5FAT A;  3VP2 A;  4HJ6 A;  2Y2M A;  4PAU A;  1K54 C;  5L09 A;  1ESI A;  4EES A;  2PHY A;  1K0K A;  2ZQ7 A;  3CZD A;  3E4Q A;  5EOO A;  4DJ2 A;  3LUQ A;  2O99 A;  5IS1 A;  3IXH A;  1XA7 A;  4B4Z A;  2V1A A;  5I5L A;  3IQA A;  2V8F A;  1J9M A;  5E2E A;  5KSC A;  4EUV A;  4CJN A;  1CI8 A;  1W5D A;  3MZF A;  2ZC5 B;  4MNR A;  5E2G A;  4GNU A;  3KX0 X;  4H6J A;  3HRE A;  3B47 A;  4O7D A;  1K56 D;  2GX5 A;  1LHY A;  3LR5 A;  4P6Z S;  1UGU A;  3M2J A;  3HLB A;  4NEE D;  1BYW A;  4DMZ A;  1YSP A;  4L9G A;  4E3N A;  3G34 A;  3NOP C;  5M18 A;  3QP5 A;  4HBT A;  2L1M A;  2PRF A;  4HQA A;  1XX2 A;  1CJF A;  3P01 A;  4R23 A;  3HLW A;  3JVV A;  3ZG0 A;  1HZO A;  2G2U A;  5CER A;  3PBT A;  4DE0 A;  2W3H A;  3TG9 A;  1OTI A;  3OC2 A;  4QHC A;  3GVB A;  4ZDX A;  3IS2 B;  1E3U A;  1DP8 A;  5EVE A;  3Q07 A;  3H82 B;  1HVB A;  2VV6 A;  3LIE A;  4YFM A;  2PYR A;  4OOL A;  3BFC A;  2ZQ8 A;  3PBR A;  2PYP A;  1E25 A;  2L0W A;  3H9W A;  1XGJ A;  4X68 A;  5IT5 A;  4IUK A;  3B3X A;  3N8R A;  4KUK A;  4QU3 A;  3G2Y A;  5FSR A;  1AXB A;  4ID4 A;  3A3E A;  3LI9 A;  3FWL A;  4ZRR A;  2Q9M A;  5E43 A;  3SZT A;  2L4R A;  3CG5 A;  5FQQ A;  3HCY A;  2VGK A;  2X71 A;  2WKH A;  4HES A;  3N8L A;  2VJW A;  3LCE A;  3JVU A;  4X69 A;  1KVM A;  5A91 A;  3NOT C;  1N4O A;  3LIC A;  4KQD A;  2DCF A;  1HLU P;  3SOI A;  1VB6 A;  1LL8 A;  1K4E A;  1K38 A;  1MWT A;  3ZYT A;  3IF6 C;  4LV0 A;  1YLP A;  5F6A A;  1FCN A;  2QZ6 A;  4C3Q A;  5AVE A;  5HPF A;  1S67 L;  2Y79 A;  4HJ3 A;  1LSV A;  2XRN A;  5TFQ A;  1SDE A;  1ES4 A;  3T12 B;  1MY8 A;  4G3V A;  2QKP A;  2XA7 S;  1PYY A;  1W63 M;  1XJ6 A;  1YMX A;  3QNC A;  1DRM A;  1TDG A;  4N9L A;  3UNW A;  3T50 A;  3VMA A;  2W3D A;  4E3M A;  3OCN A;  3S22 A;  1NYY A;  2V2F F;  3N4I A;  5GHZ A;  1ERQ A;  5IHV A;  1TS0 A;  5HZH A;  5F5Y A;  4MBK A;  3M2K A;  2WKE A;  1BLC A;  3BY9 A;  4PKY G;  1QMF A;  4EBL A;  2YKH A;  1MWU A;  3ITA A;  1TS7 A;  3KYE A;  5TBM A;  5AQ9 A;  1M40 A;  1JVJ A;  4R3A A;  1OJ5 A;  1G68 A;  1PW8 A;  4LLO B;  4UEY A;  4NXG A;  1XA1 A;  1RCJ A;  3NDE A;  4X25 A;  3P7N A;  3DBA A;  1GCE A;  3ZG7 B;  2WGV A;  1IYQ A;  1V9Y A;  1PRQ A;  1G6O A;  2JCH A;  2FFF B;  1GHP A;  4I5S A;  2H0T A;  4MN7 A;  1P97 A;  3NC8 A;  1OT9 A;  1PW1 A;  4OP8 A;  4ZJ3 A;  1MXO A;  4PKY A;  3QP1 A;  1K6S A;  2K2N A;  5F1G A;  4GS9 B;  4EWF A;  4B93 A;  2PT7 A;  2J9O A;  2MJ6 A;  4WMC A;  3GTC A;  3JPU A;  5EV0 A;  3WS2 A;  3BRM A;  4I3I A;  5J4E A;  2OLV A;  4OOY A;  4S2N A;  4PM7 A;  5HFO A;  3IXG A;  1T1C A;  2Y8H A;  1Q2Q A;  3U4L P;  4WN5 A;  3RH8 B;  2INW A;  1LI0 A;  3UDF A;  1EW0 A;  2XEP A;  3Q7V A;  5D3O A;  1JTD A;  4BEN A;  3DTI A;  2DNS A;  2WAF A;  2Y4A A;  3K3C A;  1ES3 A;  4BL2 A;  3IS2 A;  3H82 A;  5KIZ A;  2PBY A;  2FH5 A;  2UWX A;  4LCL A;  5CRF A;  4CLC E;  2E8J A;  1K54 A;  2Y2Q A;  2W1T B;  5EVI C;  3MQO A;  5FAO A;  1NZU A;  4RQ9 A;  3VE4 A;  4GW9 A;  4N92 A;  5IU1 A;  2VA0 A;  3CLO A;  3F1O B;  4JGO A;  2Y2L A;  1TS6 A;  3Q81 A;  3UE0 A;  3SS5 A;  3HUN A;  2JC7 A;  4BD1 A;  3H7W B;  2O9B A;  4ETZ A;  4X6T A;  2A2L A;  3V50 A;  3C7V A;  2PDR A;  3RJU A;  2PAV P;  3GR2 A;  1GSV A;  3R7W A;  3MS6 A;  2XH9 A;  4BJP A;  4WBG A;  3OPP A;  4Y0U A;  2XD1 A;  4JXS A;  4OPZ A;  4OPY A;  1L3L A;  3HLG A;  4R3B A;  3EEA A;  3PYP A;  1W8Q A;  3MXR A;  2KX6 A;  2ZBB A;  4CQH A;  5M19 A;  1H8Z A;  3IH9 A;  3VP4 A;  4HJ4 A;  3KO6 A;  4UA6 A;  1STZ A;  2VV7 A;  3C38 A;  1BSG A;  4LRY C;  2H10 A;  4GJ4 A;  4LEN A;  5AVF A;  1H8Y A;  2XFS A;  5F68 A;  2WAD A;  1KE3 A;  2QJ5 A;  3BQ8 A;  2FZ0 A;  4U3T A;  2W0N A;  5DJU A;  1OTE A;  1ZG6 A;  3NJA A;  1VEU B;  3MFD A;  3IX4 A;  3NY4 A;  3V3S A;  5FQJ A;  5U47 A;  3K2N A;  4X56 A;  4I39 A;  5EVI B;  1JWV A;  4BBT A;  3UB8 A;  4EU0 A;  1XGI A;  3BLM A;  5L8M A;  4KQR A;  2HDS A;  1FSY A;  5DTK A;  4O01 A;  4GCZ A;  1IOU A;  3L9K A;  3C30 A;  2HGV A;  4X55 A;  4HH2 A;  3E2L A;  4IED A;  1CQA A;  1WYB A;  1K4F A;  5HD5 A;  1LT0 A;  4LGW A;  3HLF A;  5TR7 A;  4AFI A;  1Y28 A;  5HDD A;  2V9A A;  4LPZ A;  3WRT A;  1YLZ A;  3CIT A;  5G4Z A;  4K0W A;  4X1M A;  3U2A A;  2HPB A;  3SH7 A;  4EBN A;  1FQG A;  2EXA A;  3T4L A;  4GS9 A;  4HEF A;  4WEL A;  5HL6 A;  3QP6 A;  5FI7 A;  3IF6 A;  4OLD A;  4HBU A;  5AQ7 A;  3WS5 A;  1F5M A;  5L2F A;  3E98 A;  1MKI A;  1FOF A;  1I2S A;  1S0W A;  3S1Y A;  2ZC7 A;  4PMA A;  2K31 A;  4YIN A;  5DF9 A;  2RL3 A;  4HOI A;  2HP9 A;  1RGY A;  3BW6 A;  3C7U A;  2KLI A;  2BG1 A;  5CTM A;  2EA9 A;  4N1X A;  3C2W A;  1PWD A;  2J8Y A;  2XQZ A;  3FV7 A;  1GHM A;  4BBV A;  4EQI A;  5KSH A;  3GRJ A;  1X0O A;  3UE3 A;  1W7F A;  4BMW A;  1YPR A;  3W4P A;  1QME A;  3CWF A;  1T1B A;  5GLB A;  2OWJ A;  3G6O A;  3F1O A;  2HP6 A;  1O7E A;  3UDX A;  4E3K A;  4UHU A;  2NUT C;  4JGR A;  4BLM A;  2H28 A;  4JXV A;  4L0L A;  3H7W A;  1VET B;  3DWZ A;  3ZQ5 A;  1H8M A;  1SKO B;  1WE4 A;  2HDQ A;  2JKF A;  1Z6F A;  1LI9 A;  3DW0 A;  2JBF A;  2GZA A;  4OLG A;  4OON A;  3UPP A;  1CK3 A;  5EPH A;  2X01 A;  4ZBE A;  1IKG A;  5AQB A;  4OQG A;  5FA7 A;  4EET B;  4MCW A;  1G5U A;  3MZD A;  4WLA A;  2QWS A;  1EI5 A;  4RX2 A;  4IJG A;  5GL9 A;  3FPW A;  1K6R A;  3CHW P;  2Y2K A;  4MBF A;  2P7J A;  5FDS A;  5EUA A;  5A8B A;  2WKR A;  2IWC A;  5FEF A;  3IWO A;  2O9C A;  3IHA A;  1ESU A;  4JBF A;  1L0D A;  2IWD A;  3G4P A;  3A3D A;  5CTN A;  3E0Y A;  1N9L A;  3F1N B;  1XJ2 A;  5EVL A;  5CHJ A;  4KZ7 A;  5L10 A;  4NET A;  5FI2 A;  1A0K A;  2J9P A;  4GB7 A;  2EFU A;  3UB6 A;  4DE1 A;  4IBX A;  4MEZ A;  3NIA A;  5EVI A;  2X02 A;  4WZ5 C;  4ZJ1 A;  3KYZ A;  2HP5 A;  4GN2 A;  3ZNY A;  4EQ1 A;  1P9W A;  2V1B A;  3ITB A;  5FAQ A;  3VE3 A;  2VKS A;  1BLS A;  1DP6 A;  4Q8I A;  1IKI A;  4KZA A;  1F9I A;  1UWN X;  4YOF A;  3PXP A;  3QP8 A;  1MWR A;  4Q0I A;  3KYQ A;  3MXS A;  4DDY A;  2OWH A;  4R1G A;  4XXR A;  2QJ7 A;  5TGF A;  4R3J A;  4GZB A;  3WS0 A;  4QY6 A;  3VOL A;  1YAX A;  5BOH A;  2IWB A;  1NRF A;  2VK3 A;  4I3A A;  3BYD A;  3EGX C;  1YMS A;  2XDM A;  3KSH A;  3LFV A;  3PHY A;  3G31 A;  3V3R A;  5FL3 A;  1K56 A;  3OLO A;  3HVF A;  2C6W B;  3ZVW A;  2R78 A;  3W4Q A;  3FG8 A;  1O07 A;  1GSX A;  1JWZ A;  4E6X A;  4LV3 A;  3EWK A;  1ES5 A;  4XT2 B;  5EE8 A;  4KQQ A;  2XFT A;  4FD8 A;  1KGG A;  4YWZ A;  4WEJ A;  4GOG A;  4I38 A;  1Y54 A;  4HP9 A;  5E2F A;  3UO9 A;  1DY6 A;  4OQ0 A;  3UB5 P;  3WWX A;  4B9O A;  5I94 A;  4HP4 A;  1K57 C;  5FQK A;  5J7E A;  4KG2 A;  3BFG A;  5KZH A;  3DAV A;  4DXB A;  2NUP C;  1ACF A;  1VHM A;  2PR6 A;  1D1J A;  4WF0 A;  1VET A;  2O0Y A;  5DVA A;  2LB9 A;  3NBL A;  4JGQ A;  2ZL1 B;  3UE6 A;  2ZD8 A;  2EFX A;  2WZX A;  2OAP 1;  1PWC A;  4KEN B;  1OJG A;  5AJG A;  3C4O A;  1NJ4 A;  3NDG A;  3IX8 A;  4JF6 A;  4MN6 A;  1KDW A;  3VP3 A;  1PI5 A;  3BFF A;  4R38 A;  2ZOH A;  4OQH A;  3UE1 A;  4MMN A;  4QB8 A;  3IX3 A;  4KZ3 A;  1MPL A;  5A92 A;  3HUM A;  3HL9 A;  1HTZ A;  3VP0 A;  4B88 A;  5CEC A;  1XXM A;  1SHV A;  1KE0 A;  4RX3 A;  1JWP A;  2ZC6 B;  1LL9 A;  2J80 A;  4ZJ2 A;  1H5X A;  3S4X A;  3NHQ A;  4S2K A;  4CLC B;  4M4X A;  4JLF A;  3GEC A;  1IYO A;  4PM9 A;  1Q2P A;  3F1N A;  2ACG A;  2V0W A;  4OQI A;  3BY8 A;  1M6K A;  2Y2N A;  1SZV A;  2Y2I A;  1YQS A;  2ZQD A;  3LY4 A;  3TSG A;  3EEH A;  4RA7 A;  5GHY A;  3AGE A;  3LEZ A;  2ZM0 A;  1YLW A;  4HI4 A;  4L9E A;  3NUL A;  1KVL A;  5FEG A;  2BAS A;  2A24 B;  4HY8 A;  3G30 A;  5C5K A;  3S7Q A;  2WKI A;  2QYB A;  3LID A;  1RP5 A;  5F1F A;  3E4O A;  3FPV A;  2EWW A;  2XD5 A;  1MZU A;  5FQM A;  3IBJ A;  2ZC4 B;  3V39 A;  4DRT A;  2FFY A;  3VOZ A;  2ZM8 A;  3CAX A;  5DTT A;  1ZKJ A;  1I5Q A;  3O5Y A;  4P87 A;  2P08 A;  3UPO A;  2EX9 A;  3NOU C;  1T18 A;  4X53 A;  3WRZ A;  1AWI A;  1VQQ A;  3LI8 A;  1NLZ A;  4QPR A;  2XK1 A;  3AGF A;  1WYC A;  4R70 A;  1KOU A;  2G2W A;  4CLC D;  3NEC A;  3GSG A;  1JTG A;  1IEL A;  3OCL A;  3BQA A;  4FSF A;  1TS8 A;  4OVD A;  1ERO A;  4O0P A;  4IBR A;  3TOI A;  4XT2 A;  5CGX A;  5HX9 A;  2ZC3 B;  1W8Y A;  3P09 A;  2ZM2 A;  1L0F A;  2V8C A;  4GD8 A;  4WZ5 A;  3A3J A;  3TW8 A;  1NWZ A;  3ZG9 B;  2VV8 A;  3RXX A;  3T4K A;  4GD6 A;  2OAQ 1;  3I7J A;  2XSS A;  3MMH A;  2ZOI A;  3FYZ A;  3EQV A;  4PM5 A;  4BWI A;  1FCO A;  4RVA A;  4D2O A;  4Q0J A;  1N9O A;  4C6Y A;  5K5B A;  3QP4 A;  3EGD C;  3P98 A;  4DE2 A;  5HAI A;  1FSW A;  1P9R A;  3NCK A;  3MJQ A;  2KDK A;  3CI6 A;  3VFF A;  1OPX A;  1DP9 A;  4Y13 A;  3G2Z A;  3O87 A;  2XF3 A;  3OPH A;  3MKF A;  3JYI A;  2IA2 A;  2YKF A;  1UWP X;  4WUJ A;  2QHK A;  5EEC A;  2Q9N A;  1ZC2 A;  3MZE A;  4XUX A;  3ZG8 B;  3MBZ A;  4Y3I A;  5M1A A;  4PPR A;  5G18 A;  3IT9 A;  1XFQ A;  2O9A A;  3IBR A;  4OPR A;  4L9F A;  1MC0 A;  3MSH A;  1L0E A;  2WGW B;  3PBN A;  3SW1 A;  4Z9Q A;  1XJ3 A;  3AGD A;  2PR5 A;  4E3O A;  1FIL A;  3BFE A;  4IUH A;  4S2I A;  1KGF A;  3VSL A;  5EFW A;  4NXB A;  4GLQ A;  4KZ8 A;  4DF6 A;  3BM6 A;  3CJM A;  3PBS A;  4EV4 A;  2DRW A;  1K25 A;  1OTD A;  1NY0 A;  3CPT B;  2HJE A;  5CGW A;  2M7U A;  2QPN A;  3V67 A;  1K57 A;  3S7N A;  2A24 A;  2Z6D A;  4II7 A;  1P0Z A;  2Y2J A;  4WEK A;  2HF6 A;  5CX7 A;  1YT4 A;  4JXW A;  5DTS A;  4JXG A;  4HIA A;  4BD0 A;  1S6R A;  4S2L A;  3N6I A;  2V20 A;  3LR3 A;  3SH8 A;  5FI6 A;  4BL3 A;  5DFY A;  3PAE A;  3VOY A;  4HNB A;  5CHM A;  4GHI B;  4OOM A;  3ZHH A;  5G4Y A;  1KDS A;  1PI4 A;  3BEB A;  3RTY A;  5KMW A;  1YLY A;  2WKP A;  2W1T A;  4EBP A;  3GQZ A;  3LGO A;  3UDI A;  2JKG A;  1BZA A;  3C5A A;  3B42 A;  4UA7 A;  2K7S A;  1BLP A;  3D4F A;  4DKI A;  1CI9 A;  1GA9 A;  3PAG A;  2W27 A;  3V5M A;  3K3D A;  2ZMF A;  4WYY A;  5HWT A;  4MBH A;  4FTX A;  3GMW A;  1BUE A;  4S2M A;  1ES2 A;  4NXE A;  1S4R A;  4ME4 A;  3ICY A;  2EWV A;  1E3U D;  5DKK A;  2WYX A;  1L0G A;  2VGJ A;  4JKT A;  2CMN A;  3LYX A;  4OH0 A;  4D60 A;  3BLS A;  3DTM A;  1W63 Q;  4KG6 A;  1S66 L;  4XUZ A;  4EEU A;  3S7P A;  5HPI A;  3Q1F A;  2M1C A;  1SCW A;  3D72 A;  2Z6C A;  1DJA A;  5TBM B;  3BWL A;  3HJK A;  2JE5 A;  3O86 A;  2ZMV A;  3UB9 A;  4BQM A;  1MBL A;  5F69 A;  1XPB A;  5DFX A;  4NKP A;  3DTK A;  1NXY A;  3A0R A;  2J3W A;  2PBD P;  5EM0 A;  2JKR M;  1ONG A;  3C8C A;  1VEU A;  4Q0H A;  1EWZ A;  1V9Z A;  4KZ5 A;  4NG2 A;  1YM1 A;  4A5R A;  4UQI M;  2KOI A;  4NXF A;  5JYP A;  2EX8 A;  1K55 C;  3LIB A;  1FCM A;  3N8S A;  5MC7 A;  5A93 A;  4S2J A;  4PM8 A;  1ZG4 A;  5FAS A;  4WM9 A;  4QJG A;  2RCX A;  5HAP A;  2D01 A;  1SDN A;  2WGW A;  4S2O A;  2B02 A;  5HWW A;  1L2S A;  4DJ3 A;  2DMW A;  1XJ4 A;  1F2K A;  1H0M A;  3Q7V B;  4F3L B;  4FH4 A;  4CPK A;  1PZP A;  2JKT M;  3ZDJ A;  4O8G A;  5EM1 A;  3VV4 A;  1NRJ A;  2VEA A;  1YKD A;  2J3T D;  2OSU A;  4WL9 A;  1LSW A;  3GDI A;  1D06 A;  3ZCZ A;  5GLC A;  3CPT A;  3N7W A;  3T4S A;  4LV2 A;  5FQ9 A;  4QY5 A;  3G32 A;  4JF4 A;  4R0Q A;  5CEB A;  1BTL A;  1C3B A;  3M6H A;  3MXQ A;  2I72 A;  4IHQ A;  5GLD A;  3UN7 A;  1N9N A;  1WA9 A;  3PBO A;  3FC7 A;  4CLC C;  2PD8 A;  2OV5 A;  3RXW A;  3ZGA B;  2OOL A;  4F94 A;  3ZVT A;  1XP4 A;  2WK0 A;  2Y2O A;  3W2Z A;  3A3I A;  5HAQ A;  3VP1 A;  4FH2 A;  3TE8 A;  5HDS A;  3R4K A;  5FDH A;  3WS4 A;  2W3F A;  3R7W B;  4GHI A;  3MKE A;  5LBR A;  4KZ4 A;  3SS3 A;  3FKV A;  2OLU A;  4Y7P A;  2P04 A;  1SKF A;  3KSG A;  5DJT A;  1FR6 A;  1YSQ A;  4LV1 A;  4LRX C;  4WMC D;  2WZZ A;  5F83 A;  4Z1W A;  3QP2 A;  2ZQC A;  4U0X A;  2P9V B;  1ONH A;  4KG5 A;  2B5R A;  4UAA A;  1SKO A;  1PIO A;  2HV1 A;  2C5W B;  3UPN A;  4P85 A;  4KQO A;  4KZ6 A;  4MLL A;  3ZG5 A;  1FIK A;  1PNE A;  3IXD A;  2A49 A;  3F1P B;  1S4S A;  4YNR A;  4ARZ B;  4DE3 A;  1BUL A;  1T19 A;  3WS1 A;  4DXC A;  3LR0 A;  1OTA A;  2Y55 A;  4RYE A;  2XGN A;  1PZO A;  2HZ5 A;  1IEM A;  4E3J A;  3UY6 A;  2J7V A;  1OME A;  2VGL S;  4DDS A;  3UME A;  1ALQ A;  4GDB A;  4LFU A;  2I9V A;  3BEC A;  4HHD A;  4ZTK A;  5EOE A;  4BBU A;  5CXW A;  2W1R A;  1HD8 A;  3CUE C;  3SS4 A;  2H0Y A;  4G3K A;  3LIF A;  3EQU A;  2ZQ9 A;  4ZAM A;  1NLY A;  1Z09 A;  4C75 A;  3DTE A;  1BLH A;  1F98 A;  4OKP A;  4Y15 A;  5J3W A;  1D7E A;  1DJC A;  3HBR A;  1N9B A;  5FQI A;  3LIA A;  1Y4O A;  4PHT A;  1W79 A;  3NI9 A;  3IF6 B;  4R4R A;  3DWK A;  1G6A A;  4KUO A;  5CHU A;  4K91 A;  4G3W A;  3HLE A;  4P6Z M;  1IYP A;  1TD5 A;  1GSW A;  2EX2 A;  2VX8 A;  1VM1 A;  3FKW A;  4NK3 A;  4ETX A;  1KE4 A;  3KSI A;  4F3L A;  4N9K A;  1XFN A;  1H3Q A;  3OZH A;  2W3G A;  2JKR I;  4Y5F A;  3E4P A;  1JNU A;  2AVX A;  3D3O A;  2Q0O A;  2Y59 A;  2Y2P A;  1XKZ A;  1E4D A;  3VFH A;  4Y2F A;  3ULF A;  2EXB A;  2V1Z A;  2ZJ9 A;  2WKQ A;  3PR6 A;  1GHI A;  3O88 A;  2UV0 E;  2BLS A;  3HLC A;  2GJ3 A;  3IXB A;  2PU4 A;  4MDZ A;  3IWI A;  3S7O A;  1NZO A;  3C4P A;  3B33 A;  4JF5 A;  4DN0 A;  2BTF P;  4JPM A;  1J3W A;  1ZHH B;  2P74 A;  4GKU A;  4IVI A;  2XR0 A;  2A3U A;  4KZB A;  2XLN A;  3T4O A;  4H8R A;  4IVK A;  3E2K A;  2JKT I;  3ZNT A;  2HJ9 C;  4ESP A;  1ODV A;  5J8X A;  4OP5 A;  1NYM A;  4FCF A;  3T4T A;  3VSK A;  1K55 A;  1S1Y A;  2M7V A;  1PWG A;  4U0T A;  4WZ4 A;  3PBQ A;  3RFB A;  2WUQ A;  2R9W A;  2P9V A;  3IHB A;  2VZW A;  1BT5 A;  5HL1 A;  2ZL1 A;  1ZTU A;  4UQI S;  4Y0T A;  4R6L A;  5HD3 A;  3T1Q B;  1IYS A;  3W8K A;  1YLJ A;  2B18 A;  3M6B A;  4P0M A;  2Z2L B;  5CED A;  1FR1 A;  3BJN A;  4H6J B;  5HW3 A;  2G7U A;  4K08 A;  1CEF A;  2Z2M B;  3MQQ A;  3T1R A;  4B4X A;  2PU2 A;  3T4Q A;  4EXO A;  5A90 A;  3T1X A;  1GA0 A;  5FAP A;  3F1P A;  3HUO A;  4ARZ A;  2VLG A;  1DJB A;  3MF0 A;  1LSX A;  2ZLY A;  3A0V A;  2ZMA A;  3T1S A;  5HAR A;  1RGZ A;  3G35 A;  2QMI A;  3OPR A;  3ISG A;  2XA7 M;  3HLD A;  2Y91 A;  4E3I A;  4FUW A;  3LEQ A;  1CEG A;  4UA9 A;  5AQA A;  5GHX A;  4LCM A;  3QHY A;  2R9X A;  4CLC A;  5HWV A;  3UB7 A;  3W4O A;  4KZ9 A;  2B95 A;  1TEM A;  2LB5 A;  3Q7Z A;  4K0X A;  2VGL M;  4E04 A;  5JYO A;  4X1L A;  3IF5 A;  1ERM A;  4Y17 A;  3D9Y A;  2J3T C;  1I2W A;  5DKL A;  1G28 A;  5HDC A;  3IH8 A;  3SH9 A;  3CMZ A;  1LLB A;  3ZFZ A;  5GLA A;  3PTE A;  3KSF A;  3LR4 A;  3MQ0 A;  4EUZ A;  4S2P A; 
#chains in the Genus database with same CATH homology
 1S1Z A;  2OAP 1;  3EOI A;  3H7W B;  1OJG A;  2O9B A;  5AJG A;  4ETZ A;  4UQI M;  2A2L A;  4EEP A;  4MN6 A;  2KOI A;  2PDR A;  4NXF A;  1GSV A;  3LIB A;  3R7W A;  4BJP A;  4R38 A;  5MC7 A;  2ZOH A;  4MMN A;  3UMD A;  3OBF A;  3EEA A;  3PYP A;  1IFQ A;  4I3J A;  2D02 A;  3OOV A;  1OT6 A;  2D01 A;  2KX6 A;  2ZBB A;  3T4J A;  2B02 A;  5HWW A;  4CQH A;  2JN7 A;  4DJ3 A;  2DMW A;  3A0S A;  1XJ4 A;  4LRZ E;  3MFX A;  2J80 A;  4HJ4 A;  4F3L B;  3KO6 A;  4HH3 A;  3TJZ C;  2JKT M;  3NHQ A;  1STZ A;  2VV7 A;  4CLC B;  4O8G A;  3C38 A;  4M4X A;  4LRY C;  3VV4 A;  1NRJ A;  2VEA A;  3GEC A;  2JHE A;  1T1A A;  4GJ4 A;  1YKD A;  5AVF A;  3F1N A;  2J3T D;  4WL9 A;  1LSW A;  3GDI A;  2V0W A;  1D06 A;  3BY8 A;  4EW7 A;  2PD7 A;  5F68 A;  3T4S A;  3TRC A;  3MR0 A;  2QJ5 A;  3BQ8 A;  2FZ0 A;  2XRO A;  3MXQ A;  2W0N A;  5DJU A;  5HSQ A;  4IHQ A;  1OTE A;  3EEH A;  2V0U A;  1N9N A;  3NJA A;  1WA9 A;  3PBO A;  2W3E A;  4HI4 A;  4L9E A;  3FC7 A;  3CUE A;  3HJI A;  1OTB A;  4CLC C;  4JGP A;  2PD8 A;  2BAS A;  2A24 B;  5TJJ A;  4HY8 A;  5C5K A;  4EER A;  2OOL A;  3K2N A;  4FOF A;  3S7Q A;  4I39 A;  1TF1 A;  2QYB A;  3LID A;  2GNX A;  4MN5 A;  3W2Z A;  1MKM A;  3E4O A;  3FPV A;  4BBT A;  3UB8 A;  4EU0 A;  3TE8 A;  2EWW A;  5HDS A;  3R4K A;  5L8M A;  1MZU A;  4HJ6 A;  2W3F A;  4PAU A;  3R7W B;  3IBJ A;  4GHI A;  4O01 A;  4GCZ A;  4EES A;  1IOU A;  2PHY A;  2HGV A;  3C30 A;  4HH2 A;  3E4Q A;  4DJ2 A;  3LUQ A;  5LBR A;  2O99 A;  5IS1 A;  5HD5 A;  2V1A A;  5I5L A;  1LT0 A;  3CAX A;  2P04 A;  3KSG A;  4AFI A;  5DJT A;  1Y28 A;  4EUV A;  5HDD A;  1YSQ A;  2V9A A;  4LPZ A;  4LRX C;  4Z1W A;  3CIT A;  5G4Z A;  3U2A A;  3O5Y A;  2P08 A;  3KX0 X;  3NOU C;  4H6J A;  3B47 A;  3T4L A;  4GS9 A;  1T18 A;  2GX5 A;  4WEL A;  5HL6 A;  3LR5 A;  2HV1 A;  4P6Z S;  1UGU A;  3LI8 A;  1NLZ A;  4QPR A;  4NEE D;  4R70 A;  1KOU A;  4KQO A;  1BYW A;  1F5M A;  3E98 A;  4CLC D;  4DMZ A;  1YSP A;  4L9G A;  3OCL A;  3BQA A;  4FSF A;  1TS8 A;  3F1P B;  1S4S A;  4YNR A;  3NOP C;  4ARZ B;  2K31 A;  1T19 A;  2L1M A;  5DF9 A;  3LR0 A;  4O0P A;  1OTA A;  4HOI A;  4HQA A;  3BW6 A;  2KLI A;  2EA9 A;  3P01 A;  4XT2 A;  3C2W A;  3JVV A;  2VGL S;  4BBV A;  5KSH A;  3PBT A;  1X0O A;  2W3H A;  3UE3 A;  3UME A;  1OTI A;  3OC2 A;  3TW8 A;  2I9V A;  4HHD A;  1NWZ A;  2VV8 A;  3IS2 B;  4BMW A;  3T4K A;  4BBU A;  1DP8 A;  2OAQ 1;  2XSS A;  3MMH A;  3H82 B;  3CWF A;  1T1B A;  2VV6 A;  2ZOI A;  3LIE A;  2W1R A;  3EQV A;  3CUE C;  4BWI A;  4G3K A;  3LIF A;  4Q0J A;  3EQU A;  2OWJ A;  3G6O A;  1N9O A;  2PYR A;  3F1O A;  4OOL A;  1NLY A;  5K5B A;  2NUT C;  4JGR A;  2H28 A;  1F98 A;  3PBR A;  2PYP A;  4L0L A;  2L0W A;  3EGD C;  5J3W A;  3H7W A;  1D7E A;  3H9W A;  3ZQ5 A;  5IT5 A;  4IUK A;  1H8M A;  1P9R A;  3MJQ A;  2KDK A;  3CI6 A;  4KUK A;  3LIA A;  1OPX A;  1DP9 A;  4PHT A;  3LI9 A;  4ZRR A;  2L4R A;  2GZA A;  4KUO A;  2IA2 A;  2YKF A;  1UWP X;  3HCY A;  4G3W A;  4WUJ A;  4P6Z M;  2QHK A;  1TD5 A;  1GSW A;  2VJW A;  4Y3I A;  2VX8 A;  3JVU A;  4EET B;  4ETX A;  3NOT C;  3LIC A;  4MCW A;  3KSI A;  4KQD A;  1XFQ A;  2O9A A;  3IBR A;  4WLA A;  2QWS A;  4F3L A;  1XFN A;  4L9F A;  1H3Q A;  1MC0 A;  4IJG A;  1VB6 A;  3PBN A;  3SW1 A;  1LL8 A;  2W3G A;  3FPW A;  1XJ3 A;  2JKR I;  3E4P A;  4Y5F A;  3ZYT A;  2PR5 A;  1JNU A;  5F6A A;  2P7J A;  3D3O A;  5A8B A;  2WKR A;  4IUH A;  2O9C A;  5EFW A;  5AVE A;  5HPF A;  1S67 L;  2Y79 A;  4NXB A;  4HJ3 A;  4GLQ A;  3E0Y A;  1N9L A;  3F1N B;  1XJ2 A;  1LSV A;  2XRN A;  4Y2F A;  3PBS A;  3ULF A;  2WKQ A;  3PR6 A;  1OTD A;  4G3V A;  2QKP A;  2XA7 S;  1W63 M;  1XJ6 A;  2HJE A;  1DRM A;  3UB6 A;  2M7U A;  3V67 A;  2GJ3 A;  3T50 A;  3S7N A;  2A24 A;  4MDZ A;  2W3D A;  3S7O A;  2Z6D A;  3OCN A;  4II7 A;  1P0Z A;  3B33 A;  4WEK A;  2HF6 A;  5CX7 A;  1TS0 A;  4DN0 A;  5HZH A;  5F5Y A;  3BY9 A;  1ZHH B;  4HIA A;  3KYZ A;  4PKY G;  2YKH A;  3LR3 A;  3T4O A;  1TS7 A;  4EQ1 A;  5TBM A;  1P9W A;  2JKT I;  2HJ9 C;  2V1B A;  5DFY A;  1ODV A;  4R3A A;  4HNB A;  1OJ5 A;  4UEY A;  4LLO B;  4NXG A;  3T4T A;  3VE3 A;  4GHI B;  4OOM A;  2VKS A;  1DP6 A;  3P7N A;  3DBA A;  5G4Y A;  3RTY A;  1S1Y A;  2M7V A;  2WKP A;  2W1T A;  1F9I A;  1UWN X;  3PBQ A;  3RFB A;  4YOF A;  3PXP A;  1V9Y A;  1G6O A;  2VZW A;  4I5S A;  4Q0I A;  1ZTU A;  3KYQ A;  4MN7 A;  4UQI S;  1P97 A;  2OWH A;  1OT9 A;  3B42 A;  4R6L A;  5HD3 A;  2QJ7 A;  2K7S A;  2B18 A;  3VOL A;  1YAX A;  4PKY A;  3BJN A;  4H6J B;  2K2N A;  4GS9 B;  2G7U A;  4K08 A;  3MQQ A;  2W27 A;  2PT7 A;  4B93 A;  3T4Q A;  3K3D A;  2ZMF A;  4I3A A;  4EXO A;  2MJ6 A;  5HWT A;  3EGX C;  3F1P A;  3KSH A;  4ARZ A;  2VLG A;  4NXE A;  3LFV A;  3MF0 A;  4I3I A;  1LSX A;  5J4E A;  3A0V A;  3PHY A;  1T1C A;  2Y8H A;  1S4R A;  5FL3 A;  4ME4 A;  3ICY A;  3OLO A;  2EWV A;  2XA7 M;  5DKK A;  2R78 A;  4WN5 A;  3RH8 B;  2INW A;  1EW0 A;  2CMN A;  3FG8 A;  3LYX A;  1GSX A;  3EWK A;  1W63 Q;  4EEU A;  1S66 L;  4XT2 B;  3S7P A;  5HPI A;  4CLC A;  5HWV A;  4YWZ A;  3UB7 A;  2M1C A;  4WEJ A;  3D72 A;  3K3C A;  4I38 A;  3IS2 A;  2LB5 A;  2Z6C A;  4HP9 A;  5TBM B;  3BWL A;  3HJK A;  3H82 A;  5KIZ A;  2ZMV A;  3UB9 A;  2FH5 A;  5F69 A;  4B9O A;  2VGL M;  4E04 A;  4HP4 A;  4CLC E;  5DFX A;  5J7E A;  4NKP A;  2W1T B;  2J3T C;  5DKL A;  3MQO A;  2NUP C;  1G28 A;  5HDC A;  1VHM A;  2J3W A;  3A0R A;  4RQ9 A;  3VE4 A;  2JKR M;  4GW9 A;  2PR6 A;  4WF0 A;  5IU1 A;  3C8C A;  2VA0 A;  4Q0H A;  3CLO A;  2O0Y A;  3F1O B;  4JGO A;  2LB9 A;  1TS6 A;  4JGQ A;  3KSF A;  3LR4 A;  3MQ0 A;  3UE6 A;  1V9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...