4OKPA

Crystal structure of ampc beta-lactamase in complex with the product form of 7-amino-desacetoxycephalosporanic acid
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
358
structure length
351
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Substrate deconstruction and the nonadditivity of enzyme recognition.
pubmed doi rcsb
source organism Escherichia coli
total genus 121
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4okpA00
4HEFA 3LCEA 2XFSA 1XGJA 4OH0A 2IWBA 1QMFA 5CEDA 3V3RA 2J9OA 1BULA 1ONGA 3E2KA 5HL1A 4KZBA 4LCMA 4KZ6A 1YLYA 4KZ8A 4WEKA 5M1AA 5E2EA 2ZJ9A 2WGIA 5CGSA 3PTEA 1ERQA 4MLLA 2HP6A 5GLBA 2H0YA 3LY4A 4C6YA 2X01A 4YINA 4Y0OA 5CTNA 4WZ5A 4OQHA 2JC7A 2Y2NA 1RCJA 3NY4A 1HD8A 3MZEA 1I5QA 1KGEA 3C4OA 1CK3A 2UWXA 4FD8A 5FQMA 4U3TA 3CJMA 3O88A 5L2FA 4PMAA 3W4OA 5CHJA 4OQ0A 5GL9A 3RXWA 1SHVA 2WKIA 4N92A 1KVMA 4R3JA 1G68A 2ZQAA 2DNSA 2WYXA 3UPNA 1KGGA 5HX9A 4R4RA 1MPLA 1VQQA 5G18A 3SH9A 3I7JA 2ZM0A 3TOIA 4DE1A 1CI8A 1KDSA 1XA1A 3FZCA 3IF6B 4IEDA 3OZHA 3NIAA 4JLFA 3BRMA 1PWDA 5A90A 4R3BA 2WK0A 3DTMA 5AQBA 3WS0A 4Q8IA 1E3UA 1PIOA 5F82A 1MKIA 4LCLA 5FI2A 3VP1A 2WZXA 3FKVA 4DF6A 4P0MA 5CECA 2XFTA 3NC8A 3ZG5A 5A93A 3MBZA 1CI9A 1DJAA 2WZZA 2C6WB 4RYEA 2HDUA 4EQIA 3GV9A 4KZ5A 4E3NA 5EECA 1TEMA 4HBTA 1FQGA 3QNCA 4KENB 4UHUA 1K54A 3G4PA 1GHMA 3CMZA 5CHUA 2H0TA 3CZDA 3M2JA 3M2KA 3NCKA 1H8ZA 5F83A 1YM1A 5FSRA 3BLMA 2GDNA 2Y2OA 3ZG8B 3O86A 1E25A 3TSGA 3VSLA 1MBLA 3VOZA 1NY0A 3WRTA 3BFEA 2EX6A 3VP0A 3A3FA 2J8YA 3IF6A 1EROA 3N8LA 1PWCA 2WKHA 3C7UA 5HFOA 1PW1A 4OOLA 2QPNA 4N1HA 1IEMA 3NDEA 2FFFB 4YFMA 1IYPA 1LLBA 3UDIA 1L0FA 2HP9A 5E2GA 2CC1A 2EFUA 2P9VB 3IWQA 2OSUA 1FSYA 4OLDA 3IWOA 1ES5A 4RX2A 1NYYA 1NXYA 2Y2LA 4JXSA 4MBKA 4B88A 4R23A 3EQVA 1FSWA 1CEGA 5JYPA 1K56D 3AGEA 5GHYA 4WBGA 4MBHA 3UE3A 3AGDA 2EXAA 2B5RA 1Q2QA 1SCWA 3VMAA 2ZQDA 3QHYA 5GLCA 3RXXA 3QNBA 4IBXA 2QMIA 1GCEA 2RL3A 5KZHA 2EX8A 4OQGA 5DF9A 5DTSA 3C4PA 5F1FA 3ZVTA 5M18A 4JPMA 1H5XA 1M40A 3BLSA 3PBNA 1EWZA 1PZPA 5EE8A 4B4ZA 2JE5A 4PM6A 5D3OA 5E2FA 2ZD8A 1DY6A 4X69A 1JVJA 4E3IA 3G31A 1RP5A 2G2UA 4EV4A 1ZG4A 2EX2A 3PBSA 5CGXA 1JWPA 2JCHA 3GRJA 4X6TA 2HDQA 2V2FF 4JXVA 3WS5A 1GA9A 4LENA 4E6XA 1Z6FA 4N1XA 4HESA 3HUNA 1IYSA 5EPHA 5TFQA 3N8RA 3ITBA 1HTZA 3IXGA 3PBRA 4IBRA 1RGYA 3Q81A 3OPPA 5EUAA 1WYCA 1YLJA 1S6RA 3BYDA 3HL9A 3LY3A 3HLFA 4BD1A 4QU3A 4GZBA 4ZDXA 4P85A 1W7FA 1FR1A 4OKPA 3W4QA 3G2YA 3PBTA 5GHXA 2ZC5B 3IXHA 5JYOA 5FQ9A 1MWRA 4DE2A 3IXBA 3Q82A 4NETA 4QY6A 3VOYA 4BQMA 5KSCA 4DE3A 3WWXA 3FKWA 3OCNA 2Y91A 3HBRA 1L2SA 1JWZA 4M3KA 3FWLA 1LL9A 3HLCA 4GDBA 5FATA 5EVIA 1K38A 2Y2IA 4WM9A 2ZM2A 3ZNYA 2OLVA 4KQQA 4E3MA 3M6BA 1YQSA 3HUMA 3JYIA 4QB8A 1BLHA 4XUZA 1E3UD 3BECA 3ZFZA 2ZQCA 3ITAA 4OOYA 5AQAA 4S2NA 3NDGA 1XPBA 4ZJ2A 3A3IA 3IXDA 3UE1A 2A49A 3FYZA 4S2KA 2C5WB 4N9KA 1BT5A 1K55A 4S2MA 3UO9A 4XUXA 1ESUA 3FV7A 3ZDJA 5EOOA 3IHBA 5E43A 3O3VA 1KDWA 2P9VA 1OMEA 2OLUA 4GD6A 4K0WA 1NZOA 4RA7A 4WMCD 3BFFA 4GOGA 3VP3A 1KGFA 3MKFA 4OOMA 1ONHA 1W5DA 1K57A 1FCMA 2I72A 2JBFA 4GKUA 3ISGA 5CRFA 3ZG7B 3IH9A 4EBNA 1KE3A 3N8SA 3ZHHA 2WUQA 5I94A 4FH2A 3ZG0A 4C3QA 5FASA 4Z9QA 5FAQA 5EVIB 3Q7VB 1PI5A 4OPZA 5CXWA 3RJUA 3BFDA 1MWTA 2Y2QA 1VM1A 2A3UA 1L0EA 2WGVA 3BM6A 1N9BA 1SDEA 5FQIA 4B4XA 2HDSA 2EXBA 4UA7A 4X56A 4S2OA 1XA7A 2H10A 2ZQ7A 1M6KA 1K25A 4BD0A 4ZJ3A 4JF5A 4L0LA 3HUOA 4OPYA 1J9MA 3HLWA 3IT9A 3UPPA 4X68A 1CEFA 2Y2PA 3OPLA 3P98A 4BL2A 1IYOA 3LO7A 1BLCA 1S0WA 4U0XA 2J7VA 5CERA 5CEBA 1QMEA 2HPBA 3GQZA 1TDLA 2ZC7A 5GLAA 2XF3A 4R4SA 2BLSA 2V20A 1SDNA 2XGNA 1BZAA 3S1YA 1XGIA 2WGWA 4JKTA 4E6WA 1Q2PA 3GR2A 3GSGA 3MXSA 4ZJ1A 3IF6C 2XLNA 4F94A 3VFFA 4DE0A 1K4FA 3OPRA 1ERMA 4FSFA 4KQOA 3UNWA 1PZOA 3ZNTA 1G6AA 5FAPA 2WAEA 2IWDA 1IKIA 1AXBA 5TGFA 1KE4A 4LV1A 1GHPA 2Y2KA 4WELA 5A91A 4DXCA 1TDGA 4PM8A 3VSKA 3OCLA 4WZ5C 3WRZA 2DRWA 1GHIA 4JXGA 2Y59A 1E4DA 3ZCZA 3V3SA 4JF6A 3WS1A 2Z2LB 2Q9NA 4OP8A 3W4PA 5DF7A 3GMWA 4GDNA 3UY6A 4KQRA 3OC2A 3DWKA 1YMXA 4KZ3A 4PM7A 2WGWB 4LV0A 2ZMAA 5DF8A 1JWVA 1LI0A 3MZDA 1W8YA 5FAOA 2BG1A 4CJNA 1WE4A 5F1GA 1FOFA 2EX9A 2ZC6B 4QY5A 4QJGA 1ES4A 4ID4A 4K0XA 3W8KA 3IWIA 1W8QA 2QZ6A 4OQIA 1LI9A 2HP5A 4KG5A 4QD4A 1FCOA 3A3EA 4S2LA 5HAQA 4Y0UA 3ZGAB 1L0DA 4P6BA 1IKGA 1ALQA 3B3XA 4FH4A 3SOIA 4GD8A 4O7DA 4WMCA 2Y2GA 3DWZA 5EVID 3S4XA 2H5SA 4R1GA 4OLGA 2J9PA 5DTKA 4OPRA 5DTTA 4FCFA 4DRTA 2WKEA 5M19A 5FQJA 3IH8A 3E2LA 3PAEA 3Q7VA 1DJCA 1KE0A 1K54C 4WZ4A 3TG9A 3UN7A 3V39A 4K91A 3IQAA 3UPOA 1PI4A 4X55A 3V50A 1SKFA 3VP2A 1ES2A 5U47A 3S22A 3O87A 2Y2JA 4N9LA 4KZ4A 4E3OA 1O07A 4IVIA 4BLMA 1ZG6A 1FCNA 3G30A 2PU2A 1YLTA 2P74A 3PBQA 2XD5A 1DJBA 4KG2A 3LEZA 3MFDA 1L0GA 2VGKA 2XD1A 3SH7A 3WS2A 4GNUA 1K4EA 1MXOA 3NBLA 1MY8A 3SS4A 2RCXA 4RVAA 3C7VA 3UE0A 1BSGA 1TVFA 3HLEA 3PAGA 3GVBA 3G34A 2EFXA 3BFCA 3BFGA 4BENA 4OPQA 2XEPA 5FQKA 4ZAMA 3N4IA 4RX3A 2Y55A 4ZTKA 3EQUA 1K6RA 3WS4A 3V5MA 4DKIA 3Q7ZA 2PU4A 3NI9A 4E3KA 4JXWA 1W79A 4P87A 2V1ZA 4H8RA 3IF5A 3OPHA 4BJPA 1O7EA 2XK1A 5E2HA 1NJ4A 4R0QA 4LV2A 3G2ZA 2R9XA 4BL3A 2XH9A 4EUZA 5A92A 5HW3A 1BUEA 4E3LA 3HVFA 4UA6A 4A5RA 4EWFA 3N7WA 3Q1FA 4LV3A 1Y54A 1ES3A 4S2JA 5GLDA 1JTDA 3SH8A 4E3JA 4XXRA 3VP4A 1BLPA 5BOHA 5GHZA 1IELA 1MWUA 1XXMA 4EBLA 1XP4A 1PW8A 3GTCA 1JTGA 1I2SA 1ZC2A 2Y4AA 5HAIA 5HARA 1H8YA 3C5AA 4KG6A 5IHVA 5KMWA 1BTLA 4WYYA 3M6HA 3N6IA 2FFYA 4NK3A 5HAPA 1NYMA 5CTMA 4CPKA 4ZBEA 4MBFA 4PM9A 2XR0A 3AGFA 5FDHA 5FI6A 2G2WA 5KSHA 2ZC3B 1YLWA 3HREA 3UDXA 3G32A 4EBPA 4OP5A 5EOEA 2ZQ8A 1YT4A 5EVLA 3D4FA 4DXBA 4Y7PA 2VGJA 5FI7A 1EI5A 3CG5A 1C3BA 1U60A 3Q07A 4PM5A 4QHCA 4C75A 1ESIA 4GN2A 1PWGA 5AQ7A 3MKEA 5TR7A 4Y0TA 1N4OA 1IYQA 3VFHA 3PBOA 3MZFA 4S2PA 4UAAA 4GB7A 1K6SA 1BLSA 1HZOA 4DDYA 3UDFA 1NRFA 4X53A 4JF4A 3HLGA 1HVBA 4IVKA 1RGZA 5CHMA 4OONA 3ZG9B 5EVIC 2PBYA 3A3DA 2ZQ9A 4KZ9A 4S2IA 2ZC4B 5FA7A 5FQQA 3ZVWA 1K56A 2XQZA 3BEBA 4KZAA 1YLPA 1GA0A 3HLDA 1YMSA 3A3JA 4OVDA 4U0TA 4HBUA 5DVAA 2X71A 5AQ9A 1I2WA 4DDSA 1MWSA 1PYYA 4S2NC 3G35A 1LL5A 2OV5A 1KVLA 1XX2A 3SS3A 4MNRA 1FR6A 3IHAA 3P09A 5CGWA 2R9WA 1YLZA 1NZUA 2ZM8A 4KZ7A 1WYBA 2DCFA 2Q9MA 2Y2MA 4MEZA 4UA9A 4WEJA 1K55C 3SS5A 2WADA 3HLBA 3DW0A 3MXRA 2IWCA 4JBFA 1XKZA 1ZKJA 2XDMA 2HDRA 2Y2HA 2ZLYA 5J8XA 4PPRA 1LHYA 2E8IA 2WAFA 4D2OA 2Z2MB 2X02A 1K57C
chains in the Genus database with same CATH superfamily
4HEFA 5CEDA 4WL9A 4Y17A 3EGXC 4KZBA 2JKTM 4KZ6A 1YLYA 4WEKA 1KOUA 3PTEA 4MLLA 2H0YA 2X01A 4YINA 5CTNA 2Y2NA 3NY4A 4BQMA 5FQMA 1CK3A 2W3FA 3W4OA 5CHJA 5GL9A 4I39A 4R3JA 3C38A 3UPNA 1Y28A 2V1BA 4R4RA 1UGUA 3SH9A 3TOIA 4DE1A 1CI8A 2GNXA 4IEDA 1ACFA 4R3BA 5HWWA 3VP1A 4M4XA 3FKVA 4DF6A 4P0MA 5A93A 1LT0A 1CI9A 1XFQA 1LSWA 3BY9A 4KZ5A 4QPRA 5EECA 1TEMA 4KENB 1K54A 5CHUA 3M2JA 3P7NA 3BLMA 3ZG8B 4BBVA 4BBTA 2FH5A 3BFEA 1OTAA 3C7UA 2PRFA 1PW1A 2QPNA 4H6JB 1YSPA 3ICYA 3NDEA 2FFFB 4L9EA 4YFMA 2I9VA 3UDIA 4AFIA 5F69A 1VEUA 2EWWA 2HP9A 5E2GA 5KIZA 2P08A 2OSUA 1FSYA 3NHQA 4OLDA 3EOIA 4EUVA 4LPZA 2Y2LA 3EQVA 1FSWA 5JYPA 5G4ZA 5AVFA 4CLCC 1ZTUA 5GLCA 4UQIM 4JPMA 1F2KA 3F1PA 1H5XA 4QWOA 1OTBA 4PM6A 5E2FA 2O9AA 3G31A 2G2UA 1W63M 2VA0A 4Q0IA 2HDQA 4JXVA 1OT6A 4N1XA 1STZA 4HESA 4I3JA 3IBRA 3Q81A 1WYCA 4BD1A 4ZDXA 4QU3A 3MR0A 3G2YA 5GHXA 5JYOA 1ZHHB 2PR5A 4FOFA 3VOYA 3B47A 4I3AA 3S7PA 3FKWA 5MC7A 2Y2IA 5I5LA 2OLVA 2UV0E 4E3MA 3M6BA 3HUMA 1T1BA 2G7UA 3ZFZA 3ITAA 1PFLA 4S2NA 4ZJ2A 3A3IA 3GDIA 3UE1A 2A49A 4S2MA 4R3AA 2W3GA 3T4TA 3O3VA 1KDWA 3QP8A 5HDDA 2OLUA 4GD6A 4K0WA 4YOFA 3BFFA 3K2NA 1W5DA 1K57A 2I72A 4EBNA 3N8SA 3ZHHA 4FH2A 3ZG0A 5FASA 1IFQA 3RJUA 3BFDA 2A3UA 3VV4A 1NRJA 3BM6A 4B4XA 4X56A 1S1ZA 2H10A 1T1CA 1K25A 4JF5A 3HUOA 5DJUA 3IT9A 4FUWA 3OPLA 5CERA 3MS6A 4LRXC 2XGNA 3S1YA 1XGIA 4JKTA 4KQDA 3GR2A 4ARZB 4Q0JA 2ZMFA 2OWHA 3LR3A 3ZNTA 3T4QA 2IWDA 2JKRM 5TGFA 4WELA 5A91A 4EEPA 5L8MA 1F5MA 3OCLA 3WRZA 1LL8A 3UE6A 2Y59A 1E4DA 3UMDA 3R4KA 2Q9NA 4OP8A 2VJWA 1D7EA 3IX8A 3OC2A 3DWKA 1VETB 4PM7A 4LV0A 2ZMAA 3VE4A 1LI0A 1W8YA 4RQ9A 4DJ3A 2BG1A 2L4RA 1FOFA 3H7WB 4ID4A 4X25A 4MN6A 3W8KA 2QZ6A 4OQIA 3QP2A 1LI9A 3NJAA 1IKGA 3B3XA 4FH4A 4GD8A 2Y2GA 5DTKA 4OPRA 4F3LB 4DRTA 5FQJA 3PAEA 3E2LA 3TG9A 1GSXA 3UPOA 3IQAA 4X55A 1SKFA 2QJ5A 5U47A 3O87A 2R78A 1FCNA 3HJIA 3FG8A 2PU2A 1YLTA 2P74A 3PBQA 2XD5A 1N9OA 1X0OA 1EW0A 1MXOA 3NBLA 5G4YA 3SS4A 5J4EA 3UE0A 3HLEA 3GVBA 3G34A 3LI8A 2WKRA 3QP4A 4BENA 4OPQA 5FQKA 3ZQ5A 3B42A 3WS4A 4ZTKA 4B93A 2VLGA 4HY8A 2V0UA 4JXWA 1W79A 4P6ZM 2DMWA 4H8RA 3IF5A 3OPHA 1O7EA 5HWTA 1NJ4A 2VK3A 4R0QA 2R9XA 2XH9A 5IU1A 4EU0A 2J3TC 2QKPA 4LV3A 4HH2A 1JTDA 3IX3A 1MWUA 1XP4A 3GTCA 1JTGA 1ZC2A 1P9RA 5IHVA 3RH8B 5HZHA 3M6HA 2XA7M 3DTEA 3AGFA 5FDHA 2ZC3B 4WN5A 3G32A 1A0KA 2FZ0A 1EI5A 3C8CA 1U60A 2JKTI 1DP6A 5AQ7A 4Y0TA 3MZFA 4S2PA 4GB7A 1K6SA 2V8FA 3CI6A 1HVBA 4IVKA 1RGZA 4OONA 3KYZA 2ZBBA 2PBYA 1P9WA 4GW9A 2XQZA 3UB7A 3KO6A 3D9YA 1PYYA 1KVLA 4MNRA 1FR6A 3IHAA 3P09A 5CGWA 2R9WA 5EM1A 2ZM8A 3H82B 4KZ7A 4MEZA 2Q9MA 4UA9A 5FATA 3CWFA 3DW0A 2ACGA 2IWCA 1N9LA 4HI4A 1XKZA 2XDMA 2HDRA 1LHYA 2E8IA 2WAFA 2ZMVA 3LUQA 3Q07A 3LCEA 3KSIA 1QMFA 3V3RA 3E2KA 4KZ8A 5M1AA 2ZJ9A 1ERQA 4C6YA 4WZ5A 4OQHA 2JC7A 1RCJA 1KGEA 4I38A 2UWXA 1OJGA 4U3TA 4PMAA 2WKIA 1KVMA 1G68A 4O8GA 1KGGA 1VQQA 2ZM0A 1XA1A 3IF6B 2ZL1B 3UB9A 5A90A 2Y79A 3DTMA 3WS0A 4DN0A 4Q8IA 1E3UA 5F82A 2CMNA 4LCLA 4H6JA 1Z09A 5CECA 2XFTA 3NC8A 2WZZA 5CX7A 4RYEA 5HPIA 1N9NA 2KX6A 5F6AA 3GV9A 4UHUA 2W27A 1GHMA 3CMZA 3G4PA 3CZDA 2P04A 3NCKA 5FSRA 4IJGA 2Y2OA 3VE3A 1SKOB 1XFNA 4O0PA 2V8CA 1E25A 3VSLA 1EROA 1PWCA 2LB9A 1H0MA 2CC1A 4ETXA 3IWQA 2O9CA 3H9WA 3MQQA 4RX2A 4GLQA 5F68A 4JXSA 4B88A 2W1TA 1CEGA 5GHYA 3AGEA 4X1LA 1AWIA 3AGDA 2EXAA 1Q2QA 5KZHA 2EX8A 5F1FA 3ZVTA 5M18A 3F1NB 2GJ3A 1DY6A 4EV4A 1JWPA 2JCHA 3GRJA 4X6TA 2V2FF 1H3QA 2JN7A 2M1CA 4LENA 1Z6FA 4Z1WA 3V67A 1IYSA 1HTZA 4IBRA 3PBRA 1RGYA 4I5SA 4LLOB 3KYQA 1S6RA 3OOVA 3BYDA 3HLFA 4ZRRA 4GZBA 4P85A 1FR1A 5HDSA 2OWJA 4OKPA 5L07A 4D60A 3W4QA 2YKFA 5KSCA 3OCNA 3HBRA 1L2SA 1CQAA 4GS9A 1LL9A 2VV6A 2ZM2A 4WUJA 3OLOA 4LGWA 1BLHA 3T1RA 3A0SA 1E3UD 4GHIA 1TS6A 4Y3IA 5FL3A 3NDGA 2VX8A 2YKHA 3UB8A 2D01A 2O0YA 1TF1A 1BT5A 4DJ2A 3KYEA 1ESUA 3ZDJA 3T4KA 3IHBA 2P9VA 3VP3A 4GOGA 3ZG7B 2JBFA 5CRFA 3ISGA 4C3QA 4I3IA 5EVIB 4ARZA 2JKRI 5CXWA 2LB5A 2WGVA 2EXBA 1XJ4A 3IS2B 4L0LA 3S7NA 2QJ7A 3ULFA 4OPYA 2H28A 1CEFA 3P98A 4EW7A 2A2LA 1BLCA 4U0XA 2J7VA 5CEBA 3GQZA 1TDLA 2ZC7A 5GLAA 2XF3A 4R4SA 1DRMA 3A0RA 4X1MA 2V20A 1VETA 2KLIA 1T18A 3BW6A 1XJ3A 3H7WA 4ZJ1A 2XLNA 3EGDC 3VFFA 4F94A 4PKYA 3T1SA 4ETZA 3P01A 4FSFA 2QYBA 1ERMA 3OPRA 4KQOA 3D72A 4ESPA 1XJ6A 1PZOA 5FAPA 2JKGA 3CUEA 4HP9A 2DRWA 3ZCZA 3LIBA 2VZWA 3W4PA 3GMWA 1ODVA 3E4OA 2VGLS 5DF8A 5FAOA 3T4LA 1JWVA 5J7EA 1OJ5A 2EX9A 2XA7S 1W8QA 2HP5A 5HAQA 3A3EA 4S2LA 4Y0UA 3ZGAB 5EVEA 2O99A 4MN7A 4P6BA 1ALQA 1H8MA 3SOIA 3DWZA 4CLCD 4OLGA 4FCFA 3Q7VA 1DJCA 1K54C 4WZ4A 3UN7A 3LR4A 2NUPC 3VP2A 2OOLA 4E3OA 4BLMA 3G30A 1TD5A 1JNUA 4KG2A 4GNUA 1K4EA 2Q0OA 2L0WA 3T1QB 3PAGA 2EFXA 2M7VA 2OAP1 4ZAMA 3LYXA 3B33A 3TRCA 1K6RA 3V5MA 4DKIA 4CLCB 2PU4A 3NI9A 1NWZA 3A0VA 3MQOA 4BJPA 2XK1A 3UB6A 3W2ZA 4BL3A 5HW3A 5A92A 1F98A 3HVFA 1ES3A 4S2JA 1BLPA 5GHZA 1IELA 3T4JA 1XXMA 1I2SA 4LRZE 3T50A 4KG6A 4WYYA 1NYMA 4CPKA 3FPVA 5FI6A 5IS1A 3F1OB 5KSHA 2QHKA 1OPXA 1YLWA 3H82A 2VEAA 3D4FA 4Y7PA 5FI7A 4QHCA 3E98A 4GN2A 1SZVA 2NUTC 3MKEA 3VFHA 3PBOA 3LR5A 3R7WA 3T1XA 4DDYA 3UDFA 1NRFA 3SW1A 3A3DA 2ZQ9A 4S2IA 2ZC4B 1K56A 1YMSA 3A3JA 5DVAA 3ZYTA 1I2WA 5HWVA 4S2NC 1LL5A 1XX2A 5HPFA 4R70A 1YLZA 1WYBA 1VEUB 3SS5A 2WADA 3MXRA 4JBFA 4MN5A 1MC0A 2Y2HA 5J8XA 1VB6A 3IF6A 2ZL1A 1K57C 4OH0A 2XFSA 2J9OA 1BULA 1ONGA 3MFXA 3CPTB 4MDZA 5CGSA 1YAXA 4NXBA 3EEHA 3MZEA 3C4OA 5L2FA 3F1PB 3RXWA 1SHVA 5HD5A 2ZQAA 3EEAA 1MPLA 5G18A 3I7JA 1KDSA 3FZCA 3NIAA 2V1AA 3BRMA 3E4QA 2WK0A 5L10A 1PIOA 3PR6A 1MKIA 1VHMA 5FI2A 5DFXA 1P97A 3ZG5A 3MBZA 1DJAA 2L1MA 2C6WB 4EQIA 2EWVA 4HBTA 1FQGA 1LSXA 3QNCA 1T19A 3M2KA 1H8ZA 5DKLA 5F83A 1YM1A 2GDNA 3T4SA 1DP8A 3JVVA 3TSGA 5DKKA 1MBLA 4LFUA 3U4LP 2J8YA 3N8LA 5HFOA 4OOLA 3LEQA 3JVUA 1OTDA 1DP9A 1IYPA 1ES5A 4R23A 2QWSA 1K56D 4MBHA 2J3TD 4BBUA 2B5RA 1SCWA 2ZQDA 1GCEA 2RL3A 5DF9A 2PDRA 3C4PA 3BLSA 4B4ZA 3PBNA 1EWZA 1PZPA 3E0YA 1K0KA 2JE5A 2INWA 5D3OA 2ZD8A 4E3IA 1JVJA 1RP5A 4HHDA 3LIFA 1ZG4A 5CGXA 3WS5A 5J3WA 4E6XA 3HUNA 5EPHA 3CHWP 5TFQA 3ITBA 1Y4OA 4K08A 3OPPA 2W1RA 5EUAA 1YLJA 3HL9A 1IOUA 4KUOA 4Y15A 3NECA 5FQ9A 1MWRA 4DE2A 4YNRA 5IT5A 4M3KA 3HLCA 2IA2A 4GDBA 4UQIS 4ME4A 5EVIA 4WM9A 1T1AA 4KQQA 1YQSA 4QB8A 4BMWA 4XUZA 2K7SA 1XJ2A 3NOPC 4OOYA 5AQAA 3IS2A 1XPBA 3IXDA 3FYZA 4S2KA 2C5WB 5HD3A 1NLYA 4N9KA 4WF0A 1K55A 1L3LA 3UO9A 4XUXA 3FV7A 2B02A 5EOOA 4RA7A 1OMEA 1KGFA 3MKFA 1ONHA 4UEYA 1FCMA 3BWLA 3IH9A 5I94A 2PYPA 4DMZA 1PI5A 4OPZA 1MWTA 4G3VA 1P0ZA 1SDEA 2HDSA 4BWIA 1M6KA 4BD0A 2K31A 2JKFA 1J9MA 3HLWA 4X68A 3GECA 5TBMB 4BL2A 1D06A 1IYOA 3HJKA 3E4PA 1S0WA 5HSQA 1QMEA 2HPBA 3MJQA 4YWZA 2BLSA 1BZAA 4GJ4A 2HV1A 1Q2PA 1K4FA 3UNWA 4EXOA 3RTYA 1G6AA 2PYRA 2AVXA 1TS8A 1IKIA 1KE4A 3KX0X 2Y2KA 3EWKA 4WZ5C 4IUHA 4JXGA 3LIEA 2HJEA 3V3SA 4PKYG 3WS1A 3T12B 3LFVA 2V9AA 4GDNA 3UY6A 3TJZC 3C30A 4KZ3A 2WGWB 3MZDA 1GSWA 1WE4A 5F1GA 4QJGA 4QD4A 2VKSA 1L0DA 4HJ4A 4WMCA 5EVID 4HOIA 3CITA 5DTTA 5EM0A 2WKEA 4CLCA 1YPRA 1KE0A 3KSFA 4K91A 1PI4A 1OTIA 1ES2A 3S22A 2Y2JA 4IVIA 1ZG6A 3MFDA 1L0GA 2VGKA 2XD1A 3SH7A 3WS2A 4II7A 5FEFA 1MY8A 1PNEA 4RVAA 1S1YA 1TVFA 1D1JA 3RFBA 3BFCA 3BFGA 2XRNA 2XEPA 4G3KA 3N4IA 4RX3A 3LI9A 4E3KA 1S66L 5HL6A 4P87A 3F1OA 1YKDA 4IUKA 3KSGA 4LV2A 4EUZA 1BUEA 4E3LA 4UA6A 3IBJA 3Q1FA 3UB5P 2A24B 1UWNX 5GLDA 3IX4A 3K3CA 4HP4A 3SH8A 4XXRA 3VP4A 5BOHA 2JHEA 2W3HA 3S7QA 1YSQA 2PR6A 4EBLA 1PW8A 2K2NA 3TE8A 3MXQA 5HAIA 1H8YA 4XT2B 4HH3A 5KMWA 2FFYA 4NK3A 5HAPA 4MCWA 5CTMA 4ZBEA 4MBFA 2G2WA 3HREA 3UDXA 4OP5A 4P6ZS 2ZQ8A 1YT4A 5EVLA 4WLAA 2HGVA 3OBFA 4DXBA 3NOTC 4C75A 3C2WA 4F3LA 4UAAA 1BLSA 1HZOA 3QP1A 3HLGA 4PAUA 1F9IA 3ZG9B 2PT7A 5FQQA 3CPTA 3ZVWA 3BEBA 4KZAA 1FILA 1GA0A 1S67L 4HBUA 5AVEA 4R38A 2X71A 3VOLA 4WMCD 2DCFA 2Y2MA 4WEJA 2BASA 2ZLYA 2BTFP 4D2OA 2Z2MB 4L9GA 2X02A 1XGJA 4EEUA 2W1TB 2IWBA 5HL1A 3KSHA 4LCMA 3LICA 5E2EA 1BYWA 5K5BA 2KDKA 2HF6A 2O9BA 2WGIA 2HP6A 5GLBA 3LY4A 4Y0OA 3MQ0A 1HD8A 1I5QA 4FD8A 3CJMA 3O88A 5F5YA 4GCZA 4OQ0A 4N92A 2ZOIA 2DNSA 2WYXA 5HX9A 3LGOA 4JGOA 4HQAA 3QP5A 3OZHA 4JLFA 1PWDA 2GZAA 5AQBA 5EV0A 2WZXA 3BJNA 2HDUA 4E3NA 3O5YA 3CUEC 4GS9B 3U2AA 2H0TA 2E8JA 2D02A 3DTIA 3K3DA 1OTEA 3O86A 3BQAA 2W3EA 4GHIB 3VOZA 1NY0A 3WRTA 2EX6A 4LRYC 3VP0A 3A3FA 2WKHA 2HJ9C 3LR0A 4N1HA 1IEMA 1G5UA 1LLBA 1L0FA 4HJ3A 2P9VB 2EFUA 4NEED 3IWOA 1W63Q 1NYYA 1NXYA 4MBKA 4WBGA 3UE3A 3CAXA 3VMAA 4CLCE 3QHYA 3RXXA 2P7JA 3QNBA 4IBXA 2QMIA 3L9KA 4OQGA 5DTSA 4R6LA 3DBAA 5A8BA 1M40A 5EE8A 3MMHA 3HCYA 4NXGA 1HLUP 4X69A 3NOUC 5HDCA 1TS7A 2EX2A 3PBSA 5AJGA 3DTKA 1GA9A 2OAQ1 1S4RA 3N8RA 3IXGA 4NKPA 3JPUA 3MSHA 3LY3A 2PBDP 4NXFA 1W7FA 1WA9A 4B9OA 3PBTA 4EQ1A 2ZC5B 3IXHA 3IXBA 3Q82A 4NETA 4QY6A 4DE3A 1MKMA 3WWXA 2Y91A 4O01A 1JWZA 3FWLA 1K38A 1PRQA 3ZNYA 4EESA 3JYIA 1SKOA 1FIKA 3BECA 3DAVA 2ZQCA 3SZTA 2B18A 2Z6DA 4L9FA 1TS0A 1UWPX 1LSVA 5TBMA 5LBRA 5E43A 1NZOA 2Y8HA 3BY8A 4OOMA 2WKPA 4GKUA 1CJFA 5C5KA 1NLZA 1KE3A 4EERA 2WUQA 3PYPA 4Z9QA 5FAQA 3Q7VB 1V9ZA 2Y2QA 1VM1A 1L0EA 1N9BA 5FQIA 4UA7A 4S2OA 1XA7A 3G6OA 2ZQ7A 4ZJ3A 2M7UA 3UPPA 4NXEA 3F1NA 2Y2PA 3LO7A 4FTXA 2W3DA 2VGLM 3T4OA 4Y13A 4JGQA 2Z6CA 1SDNA 2WGWA 4E6WA 4CQHA 3GSGA 3MXSA 2V0WA 3IF6C 5L09A 4Y5FA 4DE0A 2WAEA 3BQ8A 2VV8A 2J80A 1AXBA 4LV1A 1GHPA 4DXCA 1TDGA 4PM8A 5DFYA 3VSKA 2EA9A 3LIAA 1GHIA 2J3WA 2PHYA 4JF6A 2Z2LB 5DJTA 5DF7A 2PAVP 2GX5A 4KQRA 1YMXA 4EETB 3PXPA 1G6OA 4CJNA 4QY5A 2ZC6B 1ES4A 4K0XA 4HIAA 3IWIA 4KG5A 1FCOA 2ZOHA 1J3WA 4O7DA 3S4XA 2H5SA 4R1GA 2J9PA 4Y2FA 3R7WB 5M19A 3IH8A 3LIDA 4JGRA 3V39A 3V50A 4N9LA 3FC7A 5FEGA 4KZ4A 1O07A 4HJ6A 1DJBA 3LEZA 2A24A 4NG2A 2RCXA 3C7VA 4JGPA 2HZ5A 1BSGA 5TJJA 3NULA 4XT2A 4HNBA 2Y55A 4Q0HA 3EQUA 4MMNA 3Q7ZA 4KUKA 3QP6A 3TW8A 2V1ZA 5E2HA 3G2ZA 1G28A 3S7OA 3PHYA 3UMEA 4A5RA 4EWFA 3FPWA 3N7WA 2XSSA 1OT9A 1Y54A 4E3JA 3MF0A 4G3WA 4PHTA 1CF0A 2Y4AA 5HARA 1GSVA 3C5AA 1BTLA 3N6IA 4PM9A 2XR0A 2PD7A 3D3OA 4EBPA 5EOEA 4IHQA 2VGJA 3CG5A 1C3BA 4PM5A 1ESIA 1PWGA 5TR7A 1N4OA 1IYQA 2MJ6A 1V9YA 4X53A 2XROA 4JF4A 5CHMA 5EVIC 2W0NA 4KZ9A 2KOIA 5FA7A 2VV7A 5EFWA 1YLPA 3HLDA 5FDSA 4OVDA 4U0TA 5AQ9A 4DDSA 1MWSA 2PD8A 3G35A 2OV5A 3SS3A 4E04A 2B95A 1NZUA 1K55C 2WKQA 3HLBA 1MZUA 1ZKJA 4PPRA 3CLOA 1S4SA 3L7HA
chains in the Genus database with same CATH topology
4HEFA 3LCEA 2XFSA 1XGJA 4OH0A 2IWBA 1QMFA 5CEDA 3V3RA 2J9OA 1BULA 1ONGA 3E2KA 5HL1A 4KZBA 4LCMA 4KZ6A 1YLYA 4KZ8A 4WEKA 5M1AA 5E2EA 2ZJ9A 2WGIA 5CGSA 3PTEA 1ERQA 4MLLA 2HP6A 5GLBA 2H0YA 3LY4A 4C6YA 2X01A 4YINA 4Y0OA 5CTNA 4WZ5A 4OQHA 2JC7A 2Y2NA 1RCJA 3NY4A 1HD8A 3MZEA 1I5QA 1KGEA 3C4OA 1CK3A 2UWXA 4FD8A 5FQMA 4U3TA 3CJMA 3O88A 5L2FA 4PMAA 3W4OA 5CHJA 4OQ0A 5GL9A 3RXWA 1SHVA 2WKIA 4N92A 1KVMA 4R3JA 1G68A 2ZQAA 2DNSA 2WYXA 3UPNA 1KGGA 5HX9A 4R4RA 1MPLA 1VQQA 5G18A 3SH9A 3I7JA 2ZM0A 3TOIA 4DE1A 1CI8A 1KDSA 1XA1A 3FZCA 3IF6B 4IEDA 3OZHA 3NIAA 4JLFA 3BRMA 1PWDA 5A90A 4R3BA 2WK0A 3DTMA 5AQBA 3WS0A 4Q8IA 1E3UA 1PIOA 5F82A 1MKIA 4LCLA 5FI2A 3VP1A 2WZXA 3FKVA 4DF6A 4P0MA 5CECA 2XFTA 3NC8A 3ZG5A 5A93A 3MBZA 1CI9A 1DJAA 2WZZA 2C6WB 4RYEA 2HDUA 4EQIA 3GV9A 4KZ5A 4E3NA 5EECA 1TEMA 4HBTA 1FQGA 3QNCA 4KENB 4UHUA 1K54A 3G4PA 1GHMA 3CMZA 5CHUA 2H0TA 3CZDA 3M2JA 3M2KA 3NCKA 1H8ZA 5F83A 1YM1A 5FSRA 3BLMA 2GDNA 2Y2OA 3ZG8B 3O86A 1E25A 3TSGA 3VSLA 1MBLA 3VOZA 1NY0A 3WRTA 3BFEA 2EX6A 3VP0A 3A3FA 2J8YA 3IF6A 1EROA 3N8LA 1PWCA 2WKHA 3C7UA 5HFOA 1PW1A 4OOLA 2QPNA 4N1HA 1IEMA 3NDEA 2FFFB 4YFMA 1IYPA 1LLBA 3UDIA 1L0FA 2HP9A 5E2GA 2CC1A 2EFUA 2P9VB 3IWQA 2OSUA 1FSYA 4OLDA 3IWOA 1ES5A 4RX2A 1NYYA 1NXYA 2Y2LA 4JXSA 4MBKA 4B88A 4R23A 3EQVA 1FSWA 1CEGA 5JYPA 1K56D 3AGEA 5GHYA 4WBGA 4MBHA 3UE3A 3AGDA 2EXAA 2B5RA 1Q2QA 1SCWA 3VMAA 2ZQDA 3QHYA 5GLCA 3RXXA 3QNBA 4IBXA 2QMIA 1GCEA 2RL3A 5KZHA 2EX8A 4OQGA 5DF9A 5DTSA 3C4PA 5F1FA 3ZVTA 5M18A 4JPMA 1H5XA 1M40A 3BLSA 3PBNA 1EWZA 1PZPA 5EE8A 4B4ZA 2JE5A 4PM6A 5D3OA 5E2FA 2ZD8A 1DY6A 4X69A 1JVJA 4E3IA 3G31A 1RP5A 2G2UA 4EV4A 1ZG4A 2EX2A 3PBSA 5CGXA 1JWPA 2JCHA 3GRJA 4X6TA 2HDQA 2V2FF 4JXVA 3WS5A 1GA9A 4LENA 4E6XA 1Z6FA 4N1XA 4HESA 3HUNA 1IYSA 5EPHA 5TFQA 3N8RA 3ITBA 1HTZA 3IXGA 3PBRA 4IBRA 1RGYA 3Q81A 3OPPA 5EUAA 1WYCA 1YLJA 1S6RA 3BYDA 3HL9A 3LY3A 3HLFA 4BD1A 4QU3A 4GZBA 4ZDXA 4P85A 1W7FA 1FR1A 4OKPA 3W4QA 3G2YA 3PBTA 5GHXA 2ZC5B 3IXHA 5JYOA 5FQ9A 1MWRA 4DE2A 3IXBA 3Q82A 4NETA 4QY6A 3VOYA 4BQMA 5KSCA 4DE3A 3WWXA 3FKWA 3OCNA 2Y91A 3HBRA 1L2SA 1JWZA 4M3KA 3FWLA 1LL9A 3HLCA 4GDBA 5FATA 5EVIA 1K38A 2Y2IA 4WM9A 2ZM2A 3ZNYA 2OLVA 4KQQA 4E3MA 3M6BA 1YQSA 3HUMA 3JYIA 4QB8A 1BLHA 4XUZA 1E3UD 3BECA 3ZFZA 2ZQCA 3ITAA 4OOYA 5AQAA 4S2NA 3NDGA 1XPBA 4ZJ2A 3A3IA 3IXDA 3UE1A 2A49A 3FYZA 4S2KA 2C5WB 4N9KA 1BT5A 1K55A 4S2MA 3UO9A 4XUXA 1ESUA 3FV7A 3ZDJA 5EOOA 3IHBA 5E43A 3O3VA 1KDWA 2P9VA 1OMEA 2OLUA 4GD6A 4K0WA 1NZOA 4RA7A 4WMCD 3BFFA 4GOGA 3VP3A 1KGFA 3MKFA 4OOMA 1ONHA 1W5DA 1K57A 1FCMA 2I72A 2JBFA 4GKUA 3ISGA 5CRFA 3ZG7B 3IH9A 4EBNA 1KE3A 3N8SA 3ZHHA 2WUQA 5I94A 4FH2A 3ZG0A 4C3QA 5FASA 4Z9QA 5FAQA 5EVIB 3Q7VB 1PI5A 4OPZA 5CXWA 3RJUA 3BFDA 1MWTA 2Y2QA 1VM1A 2A3UA 1L0EA 2WGVA 3BM6A 1N9BA 1SDEA 5FQIA 4B4XA 2HDSA 2EXBA 4UA7A 4X56A 4S2OA 1XA7A 2H10A 2ZQ7A 1M6KA 1K25A 4BD0A 4ZJ3A 4JF5A 4L0LA 3HUOA 4OPYA 1J9MA 3HLWA 3IT9A 3UPPA 4X68A 1CEFA 2Y2PA 3OPLA 3P98A 4BL2A 1IYOA 3LO7A 1BLCA 1S0WA 4U0XA 2J7VA 5CERA 5CEBA 1QMEA 2HPBA 3GQZA 1TDLA 2ZC7A 5GLAA 2XF3A 4R4SA 2BLSA 2V20A 1SDNA 2XGNA 1BZAA 3S1YA 1XGIA 2WGWA 4JKTA 4E6WA 1Q2PA 3GR2A 3GSGA 3MXSA 4ZJ1A 3IF6C 2XLNA 4F94A 3VFFA 4DE0A 1K4FA 3OPRA 1ERMA 4FSFA 4KQOA 3UNWA 1PZOA 3ZNTA 1G6AA 5FAPA 2WAEA 2IWDA 1IKIA 1AXBA 5TGFA 1KE4A 4LV1A 1GHPA 2Y2KA 4WELA 5A91A 4DXCA 1TDGA 4PM8A 3VSKA 3OCLA 4WZ5C 3WRZA 2DRWA 1GHIA 4JXGA 2Y59A 1E4DA 3ZCZA 3V3SA 4JF6A 3WS1A 2Z2LB 2Q9NA 4OP8A 3W4PA 5DF7A 3GMWA 4GDNA 3UY6A 4KQRA 3OC2A 3DWKA 1YMXA 4KZ3A 4PM7A 2WGWB 4LV0A 2ZMAA 5DF8A 1JWVA 1LI0A 3MZDA 1W8YA 5FAOA 2BG1A 4CJNA 1WE4A 5F1GA 1FOFA 2EX9A 2ZC6B 4QY5A 4QJGA 1ES4A 4ID4A 4K0XA 3W8KA 3IWIA 1W8QA 2QZ6A 4OQIA 1LI9A 2HP5A 4KG5A 4QD4A 1FCOA 3A3EA 4S2LA 5HAQA 4Y0UA 3ZGAB 1L0DA 4P6BA 1IKGA 1ALQA 3B3XA 4FH4A 3SOIA 4GD8A 4O7DA 4WMCA 2Y2GA 3DWZA 5EVID 3S4XA 2H5SA 4R1GA 4OLGA 2J9PA 5DTKA 4OPRA 5DTTA 4FCFA 4DRTA 2WKEA 5M19A 5FQJA 3IH8A 3E2LA 3PAEA 3Q7VA 1DJCA 1KE0A 1K54C 4WZ4A 3TG9A 3UN7A 3V39A 4K91A 3IQAA 3UPOA 1PI4A 4X55A 3V50A 1SKFA 3VP2A 1ES2A 5U47A 3S22A 3O87A 2Y2JA 4N9LA 4KZ4A 4E3OA 1O07A 4IVIA 4BLMA 1ZG6A 1FCNA 3G30A 2PU2A 1YLTA 2P74A 3PBQA 2XD5A 1DJBA 4KG2A 3LEZA 3MFDA 1L0GA 2VGKA 2XD1A 3SH7A 3WS2A 4GNUA 1K4EA 1MXOA 3NBLA 1MY8A 3SS4A 2RCXA 4RVAA 3C7VA 3UE0A 1BSGA 1TVFA 3HLEA 3PAGA 3GVBA 3G34A 2EFXA 3BFCA 3BFGA 4BENA 4OPQA 2XEPA 5FQKA 4ZAMA 3N4IA 4RX3A 2Y55A 4ZTKA 3EQUA 1K6RA 3WS4A 3V5MA 4DKIA 3Q7ZA 2PU4A 3NI9A 4E3KA 4JXWA 1W79A 4P87A 2V1ZA 4H8RA 3IF5A 3OPHA 4BJPA 1O7EA 2XK1A 5E2HA 1NJ4A 4R0QA 4LV2A 3G2ZA 2R9XA 4BL3A 2XH9A 4EUZA 5A92A 5HW3A 1BUEA 4E3LA 3HVFA 4UA6A 4A5RA 4EWFA 3N7WA 3Q1FA 4LV3A 1Y54A 1ES3A 4S2JA 5GLDA 1JTDA 3SH8A 4E3JA 4XXRA 3VP4A 1BLPA 5BOHA 5GHZA 1IELA 1MWUA 1XXMA 4EBLA 1XP4A 1PW8A 3GTCA 1JTGA 1I2SA 1ZC2A 2Y4AA 5HAIA 5HARA 1H8YA 3C5AA 4KG6A 5IHVA 5KMWA 1BTLA 4WYYA 3M6HA 3N6IA 2FFYA 4NK3A 5HAPA 1NYMA 5CTMA 4CPKA 4ZBEA 4MBFA 4PM9A 2XR0A 3AGFA 5FDHA 5FI6A 2G2WA 5KSHA 2ZC3B 1YLWA 3HREA 3UDXA 3G32A 4EBPA 4OP5A 5EOEA 2ZQ8A 1YT4A 5EVLA 3D4FA 4DXBA 4Y7PA 2VGJA 5FI7A 1EI5A 3CG5A 1C3BA 1U60A 3Q07A 4PM5A 4QHCA 4C75A 1ESIA 4GN2A 1PWGA 5AQ7A 3MKEA 5TR7A 4Y0TA 1N4OA 1IYQA 3VFHA 3PBOA 3MZFA 4S2PA 4UAAA 4GB7A 1K6SA 1BLSA 1HZOA 4DDYA 3UDFA 1NRFA 4X53A 4JF4A 3HLGA 1HVBA 4IVKA 1RGZA 5CHMA 4OONA 3ZG9B 5EVIC 2PBYA 3A3DA 2ZQ9A 4KZ9A 4S2IA 2ZC4B 5FA7A 5FQQA 3ZVWA 1K56A 2XQZA 3BEBA 4KZAA 1YLPA 1GA0A 3HLDA 1YMSA 3A3JA 4OVDA 4U0TA 4HBUA 5DVAA 2X71A 5AQ9A 1I2WA 4DDSA 1MWSA 1PYYA 4S2NC 3G35A 1LL5A 2OV5A 1KVLA 1XX2A 3SS3A 4MNRA 1FR6A 3IHAA 3P09A 5CGWA 2R9WA 1YLZA 1NZUA 2ZM8A 4KZ7A 1WYBA 2DCFA 2Q9MA 2Y2MA 4MEZA 4UA9A 4WEJA 1K55C 3SS5A 2WADA 3HLBA 3DW0A 3MXRA 2IWCA 4JBFA 1XKZA 1ZKJA 2XDMA 2HDRA 2Y2HA 2ZLYA 5J8XA 4PPRA 1LHYA 2E8IA 2WAFA 4D2OA 2Z2MB 2X02A 1K57C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HEF A;  3LCE A;  2XFS A;  1XGJ A;  4OH0 A;  2IWB A;  1QMF A;  5CED A;  3V3R A;  2J9O A;  1BUL A;  1ONG A;  3E2K A;  5HL1 A;  4KZB A;  4LCM A;  4KZ6 A;  1YLY A;  4KZ8 A;  4WEK A;  5M1A A;  5E2E A;  2ZJ9 A;  2WGI A;  5CGS A;  3PTE A;  1ERQ A;  4MLL A;  2HP6 A;  5GLB A;  2H0Y A;  3LY4 A;  4C6Y A;  2X01 A;  4YIN A;  4Y0O A;  5CTN A;  4WZ5 A;  4OQH A;  2JC7 A;  2Y2N A;  1RCJ A;  3NY4 A;  1HD8 A;  3MZE A;  1I5Q A;  1KGE A;  3C4O A;  1CK3 A;  2UWX A;  4FD8 A;  5FQM A;  4U3T A;  3CJM A;  3O88 A;  5L2F A;  4PMA A;  3W4O A;  5CHJ A;  4OQ0 A;  5GL9 A;  3RXW A;  1SHV A;  2WKI A;  4N92 A;  1KVM A;  4R3J A;  1G68 A;  2ZQA A;  2DNS A;  2WYX A;  3UPN A;  1KGG A;  5HX9 A;  4R4R A;  1MPL A;  1VQQ A;  5G18 A;  3SH9 A;  3I7J A;  2ZM0 A;  3TOI A;  4DE1 A;  1CI8 A;  1KDS A;  1XA1 A;  3FZC A;  3IF6 B;  4IED A;  3OZH A;  3NIA A;  4JLF A;  3BRM A;  1PWD A;  5A90 A;  4R3B A;  2WK0 A;  3DTM A;  5AQB A;  3WS0 A;  4Q8I A;  1E3U A;  1PIO A;  5F82 A;  1MKI A;  4LCL A;  5FI2 A;  3VP1 A;  2WZX A;  3FKV A;  4DF6 A;  4P0M A;  5CEC A;  2XFT A;  3NC8 A;  3ZG5 A;  5A93 A;  3MBZ A;  1CI9 A;  1DJA A;  2WZZ A;  2C6W B;  4RYE A;  2HDU A;  4EQI A;  3GV9 A;  4KZ5 A;  4E3N A;  5EEC A;  1TEM A;  4HBT A;  1FQG A;  3QNC A;  4KEN B;  4UHU A;  1K54 A;  3G4P A;  1GHM A;  3CMZ A;  5CHU A;  2H0T A;  3CZD A;  3M2J A;  3M2K A;  3NCK A;  1H8Z A;  5F83 A;  1YM1 A;  5FSR A;  3BLM A;  2GDN A;  2Y2O A;  3ZG8 B;  3O86 A;  1E25 A;  3TSG A;  3VSL A;  1MBL A;  3VOZ A;  1NY0 A;  3WRT A;  3BFE A;  2EX6 A;  3VP0 A;  3A3F A;  2J8Y A;  3IF6 A;  1ERO A;  3N8L A;  1PWC A;  2WKH A;  3C7U A;  5HFO A;  1PW1 A;  4OOL A;  2QPN A;  4N1H A;  1IEM A;  3NDE A;  2FFF B;  4YFM A;  1IYP A;  1LLB A;  3UDI A;  1L0F A;  2HP9 A;  5E2G A;  2CC1 A;  2EFU A;  2P9V B;  3IWQ A;  2OSU A;  1FSY A;  4OLD A;  3IWO A;  1ES5 A;  4RX2 A;  1NYY A;  1NXY A;  2Y2L A;  4JXS A;  4MBK A;  4B88 A;  4R23 A;  3EQV A;  1FSW A;  1CEG A;  5JYP A;  1K56 D;  3AGE A;  5GHY A;  4WBG A;  4MBH A;  3UE3 A;  3AGD A;  2EXA A;  2B5R A;  1Q2Q A;  1SCW A;  3VMA A;  2ZQD A;  3QHY A;  5GLC A;  3RXX A;  3QNB A;  4IBX A;  2QMI A;  1GCE A;  2RL3 A;  5KZH A;  2EX8 A;  4OQG A;  5DF9 A;  5DTS A;  3C4P A;  5F1F A;  3ZVT A;  5M18 A;  4JPM A;  1H5X A;  1M40 A;  3BLS A;  3PBN A;  1EWZ A;  1PZP A;  5EE8 A;  4B4Z A;  2JE5 A;  4PM6 A;  5D3O A;  5E2F A;  2ZD8 A;  1DY6 A;  4X69 A;  1JVJ A;  4E3I A;  3G31 A;  1RP5 A;  2G2U A;  4EV4 A;  1ZG4 A;  2EX2 A;  3PBS A;  5CGX A;  1JWP A;  2JCH A;  3GRJ A;  4X6T A;  2HDQ A;  2V2F F;  4JXV A;  3WS5 A;  1GA9 A;  4LEN A;  4E6X A;  1Z6F A;  4N1X A;  4HES A;  3HUN A;  1IYS A;  5EPH A;  5TFQ A;  3N8R A;  3ITB A;  1HTZ A;  3IXG A;  3PBR A;  4IBR A;  1RGY A;  3Q81 A;  3OPP A;  5EUA A;  1WYC A;  1YLJ A;  1S6R A;  3BYD A;  3HL9 A;  3LY3 A;  3HLF A;  4BD1 A;  4QU3 A;  4GZB A;  4ZDX A;  4P85 A;  1W7F A;  1FR1 A;  4OKP A;  3W4Q A;  3G2Y A;  3PBT A;  5GHX A;  2ZC5 B;  3IXH A;  5JYO A;  5FQ9 A;  1MWR A;  4DE2 A;  3IXB A;  3Q82 A;  4NET A;  4QY6 A;  3VOY A;  4BQM A;  5KSC A;  4DE3 A;  3WWX A;  3FKW A;  3OCN A;  2Y91 A;  3HBR A;  1L2S A;  1JWZ A;  4M3K A;  3FWL A;  1LL9 A;  3HLC A;  4GDB A;  5FAT A;  5EVI A;  1K38 A;  2Y2I A;  4WM9 A;  2ZM2 A;  3ZNY A;  2OLV A;  4KQQ A;  4E3M A;  3M6B A;  1YQS A;  3HUM A;  3JYI A;  4QB8 A;  1BLH A;  4XUZ A;  1E3U D;  3BEC A;  3ZFZ A;  2ZQC A;  3ITA A;  4OOY A;  5AQA A;  4S2N A;  3NDG A;  1XPB A;  4ZJ2 A;  3A3I A;  3IXD A;  3UE1 A;  2A49 A;  3FYZ A;  4S2K A;  2C5W B;  4N9K A;  1BT5 A;  1K55 A;  4S2M A;  3UO9 A;  4XUX A;  1ESU A;  3FV7 A;  3ZDJ A;  5EOO A;  3IHB A;  5E43 A;  3O3V A;  1KDW A;  2P9V A;  1OME A;  2OLU A;  4GD6 A;  4K0W A;  1NZO A;  4RA7 A;  4WMC D;  3BFF A;  4GOG A;  3VP3 A;  1KGF A;  3MKF A;  4OOM A;  1ONH A;  1W5D A;  1K57 A;  1FCM A;  2I72 A;  2JBF A;  4GKU A;  3ISG A;  5CRF A;  3ZG7 B;  3IH9 A;  4EBN A;  1KE3 A;  3N8S A;  3ZHH A;  2WUQ A;  5I94 A;  4FH2 A;  3ZG0 A;  4C3Q A;  5FAS A;  4Z9Q A;  5FAQ A;  5EVI B;  3Q7V B;  1PI5 A;  4OPZ A;  5CXW A;  3RJU A;  3BFD A;  1MWT A;  2Y2Q A;  1VM1 A;  2A3U A;  1L0E A;  2WGV A;  3BM6 A;  1N9B A;  1SDE A;  5FQI A;  4B4X A;  2HDS A;  2EXB A;  4UA7 A;  4X56 A;  4S2O A;  1XA7 A;  2H10 A;  2ZQ7 A;  1M6K A;  1K25 A;  4BD0 A;  4ZJ3 A;  4JF5 A;  4L0L A;  3HUO A;  4OPY A;  1J9M A;  3HLW A;  3IT9 A;  3UPP A;  4X68 A;  1CEF A;  2Y2P A;  3OPL A;  3P98 A;  4BL2 A;  1IYO A;  3LO7 A;  1BLC A;  1S0W A;  4U0X A;  2J7V A;  5CER A;  5CEB A;  1QME A;  2HPB A;  3GQZ A;  1TDL A;  2ZC7 A;  5GLA A;  2XF3 A;  4R4S A;  2BLS A;  2V20 A;  1SDN A;  2XGN A;  1BZA A;  3S1Y A;  1XGI A;  2WGW A;  4JKT A;  4E6W A;  1Q2P A;  3GR2 A;  3GSG A;  3MXS A;  4ZJ1 A;  3IF6 C;  2XLN A;  4F94 A;  3VFF A;  4DE0 A;  1K4F A;  3OPR A;  1ERM A;  4FSF A;  4KQO A;  3UNW A;  1PZO A;  3ZNT A;  1G6A A;  5FAP A;  2WAE A;  2IWD A;  1IKI A;  1AXB A;  5TGF A;  1KE4 A;  4LV1 A;  1GHP A;  2Y2K A;  4WEL A;  5A91 A;  4DXC A;  1TDG A;  4PM8 A;  3VSK A;  3OCL A;  4WZ5 C;  3WRZ A;  2DRW A;  1GHI A;  4JXG A;  2Y59 A;  1E4D A;  3ZCZ A;  3V3S A;  4JF6 A;  3WS1 A;  2Z2L B;  2Q9N A;  4OP8 A;  3W4P A;  5DF7 A;  3GMW A;  4GDN A;  3UY6 A;  4KQR A;  3OC2 A;  3DWK A;  1YMX A;  4KZ3 A;  4PM7 A;  2WGW B;  4LV0 A;  2ZMA A;  5DF8 A;  1JWV A;  1LI0 A;  3MZD A;  1W8Y A;  5FAO A;  2BG1 A;  4CJN A;  1WE4 A;  5F1G A;  1FOF A;  2EX9 A;  2ZC6 B;  4QY5 A;  4QJG A;  1ES4 A;  4ID4 A;  4K0X A;  3W8K A;  3IWI A;  1W8Q A;  2QZ6 A;  4OQI A;  1LI9 A;  2HP5 A;  4KG5 A;  4QD4 A;  1FCO A;  3A3E A;  4S2L A;  5HAQ A;  4Y0U A;  3ZGA B;  1L0D A;  4P6B A;  1IKG A;  1ALQ A;  3B3X A;  4FH4 A;  3SOI A;  4GD8 A;  4O7D A;  4WMC A;  2Y2G A;  3DWZ A;  5EVI D;  3S4X A;  2H5S A;  4R1G A;  4OLG A;  2J9P A;  5DTK A;  4OPR A;  5DTT A;  4FCF A;  4DRT A;  2WKE A;  5M19 A;  5FQJ A;  3IH8 A;  3E2L A;  3PAE A;  3Q7V A;  1DJC A;  1KE0 A;  1K54 C;  4WZ4 A;  3TG9 A;  3UN7 A;  3V39 A;  4K91 A;  3IQA A;  3UPO A;  1PI4 A;  4X55 A;  3V50 A;  1SKF A;  3VP2 A;  1ES2 A;  5U47 A;  3S22 A;  3O87 A;  2Y2J A;  4N9L A;  4KZ4 A;  4E3O A;  1O07 A;  4IVI A;  4BLM A;  1ZG6 A;  1FCN A;  3G30 A;  2PU2 A;  1YLT A;  2P74 A;  3PBQ A;  2XD5 A;  1DJB A;  4KG2 A;  3LEZ A;  3MFD A;  1L0G A;  2VGK A;  2XD1 A;  3SH7 A;  3WS2 A;  4GNU A;  1K4E A;  1MXO A;  3NBL A;  1MY8 A;  3SS4 A;  2RCX A;  4RVA A;  3C7V A;  3UE0 A;  1BSG A;  1TVF A;  3HLE A;  3PAG A;  3GVB A;  3G34 A;  2EFX A;  3BFC A;  3BFG A;  4BEN A;  4OPQ A;  2XEP A;  5FQK A;  4ZAM A;  3N4I A;  4RX3 A;  2Y55 A;  4ZTK A;  3EQU A;  1K6R A;  3WS4 A;  3V5M A;  4DKI A;  3Q7Z A;  2PU4 A;  3NI9 A;  4E3K A;  4JXW A;  1W79 A;  4P87 A;  2V1Z A;  4H8R A;  3IF5 A;  3OPH A;  4BJP A;  1O7E A;  2XK1 A;  5E2H A;  1NJ4 A;  4R0Q A;  4LV2 A;  3G2Z A;  2R9X A;  4BL3 A;  2XH9 A;  4EUZ A;  5A92 A;  5HW3 A;  1BUE A;  4E3L A;  3HVF A;  4UA6 A;  4A5R A;  4EWF A;  3N7W A;  3Q1F A;  4LV3 A;  1Y54 A;  1ES3 A;  4S2J A;  5GLD A;  1JTD A;  3SH8 A;  4E3J A;  4XXR A;  3VP4 A;  1BLP A;  5BOH A;  5GHZ A;  1IEL A;  1MWU A;  1XXM A;  4EBL A;  1XP4 A;  1PW8 A;  3GTC A;  1JTG A;  1I2S A;  1ZC2 A;  2Y4A A;  5HAI A;  5HAR A;  1H8Y A;  3C5A A;  4KG6 A;  5IHV A;  5KMW A;  1BTL A;  4WYY A;  3M6H A;  3N6I A;  2FFY A;  4NK3 A;  5HAP A;  1NYM A;  5CTM A;  4CPK A;  4ZBE A;  4MBF A;  4PM9 A;  2XR0 A;  3AGF A;  5FDH A;  5FI6 A;  2G2W A;  5KSH A;  2ZC3 B;  1YLW A;  3HRE A;  3UDX A;  3G32 A;  4EBP A;  4OP5 A;  5EOE A;  2ZQ8 A;  1YT4 A;  5EVL A;  3D4F A;  4DXB A;  4Y7P A;  2VGJ A;  5FI7 A;  1EI5 A;  3CG5 A;  1C3B A;  1U60 A;  3Q07 A;  4PM5 A;  4QHC A;  4C75 A;  1ESI A;  4GN2 A;  1PWG A;  5AQ7 A;  3MKE A;  5TR7 A;  4Y0T A;  1N4O A;  1IYQ A;  3VFH A;  3PBO A;  3MZF A;  4S2P A;  4UAA A;  4GB7 A;  1K6S A;  1BLS A;  1HZO A;  4DDY A;  3UDF A;  1NRF A;  4X53 A;  4JF4 A;  3HLG A;  1HVB A;  4IVK A;  1RGZ A;  5CHM A;  4OON A;  3ZG9 B;  5EVI C;  2PBY A;  3A3D A;  2ZQ9 A;  4KZ9 A;  4S2I A;  2ZC4 B;  5FA7 A;  5FQQ A;  3ZVW A;  1K56 A;  2XQZ A;  3BEB A;  4KZA A;  1YLP A;  1GA0 A;  3HLD A;  1YMS A;  3A3J A;  4OVD A;  4U0T A;  4HBU A;  5DVA A;  2X71 A;  5AQ9 A;  1I2W A;  4DDS A;  1MWS A;  1PYY A;  4S2N C;  3G35 A;  1LL5 A;  2OV5 A;  1KVL A;  1XX2 A;  3SS3 A;  4MNR A;  1FR6 A;  3IHA A;  3P09 A;  5CGW A;  2R9W A;  1YLZ A;  1NZU A;  2ZM8 A;  4KZ7 A;  1WYB A;  2DCF A;  2Q9M A;  2Y2M A;  4MEZ A;  4UA9 A;  4WEJ A;  1K55 C;  3SS5 A;  2WAD A;  3HLB A;  3DW0 A;  3MXR A;  2IWC A;  4JBF A;  1XKZ A;  1ZKJ A;  2XDM A;  2HDR A;  2Y2H A;  2ZLY A;  5J8X A;  4PPR A;  1LHY A;  2E8I A;  2WAF A;  4D2O A;  2Z2M B;  2X02 A;  1K57 C; 
#chains in the Genus database with same CATH topology
 4HEF A;  5CED A;  4WL9 A;  4Y17 A;  3EGX C;  4KZB A;  2JKT M;  4KZ6 A;  1YLY A;  4WEK A;  1KOU A;  3PTE A;  4MLL A;  2H0Y A;  2X01 A;  4YIN A;  5CTN A;  2Y2N A;  3NY4 A;  4BQM A;  5FQM A;  1CK3 A;  2W3F A;  3W4O A;  5CHJ A;  5GL9 A;  4I39 A;  4R3J A;  3C38 A;  3UPN A;  1Y28 A;  2V1B A;  4R4R A;  1UGU A;  3SH9 A;  3TOI A;  4DE1 A;  1CI8 A;  2GNX A;  4IED A;  1ACF A;  4R3B A;  5HWW A;  3VP1 A;  4M4X A;  3FKV A;  4DF6 A;  4P0M A;  5A93 A;  1LT0 A;  1CI9 A;  1XFQ A;  1LSW A;  3BY9 A;  4KZ5 A;  4QPR A;  5EEC A;  1TEM A;  4KEN B;  1K54 A;  5CHU A;  3M2J A;  3P7N A;  3BLM A;  3ZG8 B;  4BBV A;  4BBT A;  2FH5 A;  3BFE A;  1OTA A;  3C7U A;  2PRF A;  1PW1 A;  2QPN A;  4H6J B;  1YSP A;  3ICY A;  3NDE A;  2FFF B;  4L9E A;  4YFM A;  2I9V A;  3UDI A;  4AFI A;  5F69 A;  1VEU A;  2EWW A;  2HP9 A;  5E2G A;  5KIZ A;  2P08 A;  2OSU A;  1FSY A;  3NHQ A;  4OLD A;  3EOI A;  4EUV A;  4LPZ A;  2Y2L A;  3EQV A;  1FSW A;  5JYP A;  5G4Z A;  5AVF A;  4CLC C;  1ZTU A;  5GLC A;  4UQI M;  4JPM A;  1F2K A;  3F1P A;  1H5X A;  4QWO A;  1OTB A;  4PM6 A;  5E2F A;  2O9A A;  3G31 A;  2G2U A;  1W63 M;  2VA0 A;  4Q0I A;  2HDQ A;  4JXV A;  1OT6 A;  4N1X A;  1STZ A;  4HES A;  4I3J A;  3IBR A;  3Q81 A;  1WYC A;  4BD1 A;  4ZDX A;  4QU3 A;  3MR0 A;  3G2Y A;  5GHX A;  5JYO A;  1ZHH B;  2PR5 A;  4FOF A;  3VOY A;  3B47 A;  4I3A A;  3S7P A;  3FKW A;  5MC7 A;  2Y2I A;  5I5L A;  2OLV A;  2UV0 E;  4E3M A;  3M6B A;  3HUM A;  1T1B A;  2G7U A;  3ZFZ A;  3ITA A;  1PFL A;  4S2N A;  4ZJ2 A;  3A3I A;  3GDI A;  3UE1 A;  2A49 A;  4S2M A;  4R3A A;  2W3G A;  3T4T A;  3O3V A;  1KDW A;  3QP8 A;  5HDD A;  2OLU A;  4GD6 A;  4K0W A;  4YOF A;  3BFF A;  3K2N A;  1W5D A;  1K57 A;  2I72 A;  4EBN A;  3N8S A;  3ZHH A;  4FH2 A;  3ZG0 A;  5FAS A;  1IFQ A;  3RJU A;  3BFD A;  2A3U A;  3VV4 A;  1NRJ A;  3BM6 A;  4B4X A;  4X56 A;  1S1Z A;  2H10 A;  1T1C A;  1K25 A;  4JF5 A;  3HUO A;  5DJU A;  3IT9 A;  4FUW A;  3OPL A;  5CER A;  3MS6 A;  4LRX C;  2XGN A;  3S1Y A;  1XGI A;  4JKT A;  4KQD A;  3GR2 A;  4ARZ B;  4Q0J A;  2ZMF A;  2OWH A;  3LR3 A;  3ZNT A;  3T4Q A;  2IWD A;  2JKR M;  5TGF A;  4WEL A;  5A91 A;  4EEP A;  5L8M A;  1F5M A;  3OCL A;  3WRZ A;  1LL8 A;  3UE6 A;  2Y59 A;  1E4D A;  3UMD A;  3R4K A;  2Q9N A;  4OP8 A;  2VJW A;  1D7E A;  3IX8 A;  3OC2 A;  3DWK A;  1VET B;  4PM7 A;  4LV0 A;  2ZMA A;  3VE4 A;  1LI0 A;  1W8Y A;  4RQ9 A;  4DJ3 A;  2BG1 A;  2L4R A;  1FOF A;  3H7W B;  4ID4 A;  4X25 A;  4MN6 A;  3W8K A;  2QZ6 A;  4OQI A;  3QP2 A;  1LI9 A;  3NJA A;  1IKG A;  3B3X A;  4FH4 A;  4GD8 A;  2Y2G A;  5DTK A;  4OPR A;  4F3L B;  4DRT A;  5FQJ A;  3PAE A;  3E2L A;  3TG9 A;  1GSX A;  3UPO A;  3IQA A;  4X55 A;  1SKF A;  2QJ5 A;  5U47 A;  3O87 A;  2R78 A;  1FCN A;  3HJI A;  3FG8 A;  2PU2 A;  1YLT A;  2P74 A;  3PBQ A;  2XD5 A;  1N9O A;  1X0O A;  1EW0 A;  1MXO A;  3NBL A;  5G4Y A;  3SS4 A;  5J4E A;  3UE0 A;  3HLE A;  3GVB A;  3G34 A;  3LI8 A;  2WKR A;  3QP4 A;  4BEN A;  4OPQ A;  5FQK A;  3ZQ5 A;  3B42 A;  3WS4 A;  4ZTK A;  4B93 A;  2VLG A;  4HY8 A;  2V0U A;  4JXW A;  1W79 A;  4P6Z M;  2DMW A;  4H8R A;  3IF5 A;  3OPH A;  1O7E A;  5HWT A;  1NJ4 A;  2VK3 A;  4R0Q A;  2R9X A;  2XH9 A;  5IU1 A;  4EU0 A;  2J3T C;  2QKP A;  4LV3 A;  4HH2 A;  1JTD A;  3IX3 A;  1MWU A;  1XP4 A;  3GTC A;  1JTG A;  1ZC2 A;  1P9R A;  5IHV A;  3RH8 B;  5HZH A;  3M6H A;  2XA7 M;  3DTE A;  3AGF A;  5FDH A;  2ZC3 B;  4WN5 A;  3G32 A;  1A0K A;  2FZ0 A;  1EI5 A;  3C8C A;  1U60 A;  2JKT I;  1DP6 A;  5AQ7 A;  4Y0T A;  3MZF A;  4S2P A;  4GB7 A;  1K6S A;  2V8F A;  3CI6 A;  1HVB A;  4IVK A;  1RGZ A;  4OON A;  3KYZ A;  2ZBB A;  2PBY A;  1P9W A;  4GW9 A;  2XQZ A;  3UB7 A;  3KO6 A;  3D9Y A;  1PYY A;  1KVL A;  4MNR A;  1FR6 A;  3IHA A;  3P09 A;  5CGW A;  2R9W A;  5EM1 A;  2ZM8 A;  3H82 B;  4KZ7 A;  4MEZ A;  2Q9M A;  4UA9 A;  5FAT A;  3CWF A;  3DW0 A;  2ACG A;  2IWC A;  1N9L A;  4HI4 A;  1XKZ A;  2XDM A;  2HDR A;  1LHY A;  2E8I A;  2WAF A;  2ZMV A;  3LUQ A;  3Q07 A;  3LCE A;  3KSI A;  1QMF A;  3V3R A;  3E2K A;  4KZ8 A;  5M1A A;  2ZJ9 A;  1ERQ A;  4C6Y A;  4WZ5 A;  4OQH A;  2JC7 A;  1RCJ A;  1KGE A;  4I38 A;  2UWX A;  1OJG A;  4U3T A;  4PMA A;  2WKI A;  1KVM A;  1G68 A;  4O8G A;  1KGG A;  1VQQ A;  2ZM0 A;  1XA1 A;  3IF6 B;  2ZL1 B;  3UB9 A;  5A90 A;  2Y79 A;  3DTM A;  3WS0 A;  4DN0 A;  4Q8I A;  1E3U A;  5F82 A;  2CMN A;  4LCL A;  4H6J A;  1Z09 A;  5CEC A;  2XFT A;  3NC8 A;  2WZZ A;  5CX7 A;  4RYE A;  5HPI A;  1N9N A;  2KX6 A;  5F6A A;  3GV9 A;  4UHU A;  2W27 A;  1GHM A;  3CMZ A;  3G4P A;  3CZD A;  2P04 A;  3NCK A;  5FSR A;  4IJG A;  2Y2O A;  3VE3 A;  1SKO B;  1XFN A;  4O0P A;  2V8C A;  1E25 A;  3VSL A;  1ERO A;  1PWC A;  2LB9 A;  1H0M A;  2CC1 A;  4ETX A;  3IWQ A;  2O9C A;  3H9W A;  3MQQ A;  4RX2 A;  4GLQ A;  5F68 A;  4JXS A;  4B88 A;  2W1T A;  1CEG A;  5GHY A;  3AGE A;  4X1L A;  1AWI A;  3AGD A;  2EXA A;  1Q2Q A;  5KZH A;  2EX8 A;  5F1F A;  3ZVT A;  5M18 A;  3F1N B;  2GJ3 A;  1DY6 A;  4EV4 A;  1JWP A;  2JCH A;  3GRJ A;  4X6T A;  2V2F F;  1H3Q A;  2JN7 A;  2M1C A;  4LEN A;  1Z6F A;  4Z1W A;  3V67 A;  1IYS A;  1HTZ A;  4IBR A;  3PBR A;  1RGY A;  4I5S A;  4LLO B;  3KYQ A;  1S6R A;  3OOV A;  3BYD A;  3HLF A;  4ZRR A;  4GZB A;  4P85 A;  1FR1 A;  5HDS A;  2OWJ A;  4OKP A;  5L07 A;  4D60 A;  3W4Q A;  2YKF A;  5KSC A;  3OCN A;  3HBR A;  1L2S A;  1CQA A;  4GS9 A;  1LL9 A;  2VV6 A;  2ZM2 A;  4WUJ A;  3OLO A;  4LGW A;  1BLH A;  3T1R A;  3A0S A;  1E3U D;  4GHI A;  1TS6 A;  4Y3I A;  5FL3 A;  3NDG A;  2VX8 A;  2YKH A;  3UB8 A;  2D01 A;  2O0Y A;  1TF1 A;  1BT5 A;  4DJ2 A;  3KYE A;  1ESU A;  3ZDJ A;  3T4K A;  3IHB A;  2P9V A;  3VP3 A;  4GOG A;  3ZG7 B;  2JBF A;  5CRF A;  3ISG A;  4C3Q A;  4I3I A;  5EVI B;  4ARZ A;  2JKR I;  5CXW A;  2LB5 A;  2WGV A;  2EXB A;  1XJ4 A;  3IS2 B;  4L0L A;  3S7N A;  2QJ7 A;  3ULF A;  4OPY A;  2H28 A;  1CEF A;  3P98 A;  4EW7 A;  2A2L A;  1BLC A;  4U0X A;  2J7V A;  5CEB A;  3GQZ A;  1TDL A;  2ZC7 A;  5GLA A;  2XF3 A;  4R4S A;  1DRM A;  3A0R A;  4X1M A;  2V20 A;  1VET A;  2KLI A;  1T18 A;  3BW6 A;  1XJ3 A;  3H7W A;  4ZJ1 A;  2XLN A;  3EGD C;  3VFF A;  4F94 A;  4PKY A;  3T1S A;  4ETZ A;  3P01 A;  4FSF A;  2QYB A;  1ERM A;  3OPR A;  4KQO A;  3D72 A;  4ESP A;  1XJ6 A;  1PZO A;  5FAP A;  2JKG A;  3CUE A;  4HP9 A;  2DRW A;  3ZCZ A;  3LIB A;  2VZW A;  3W4P A;  3GMW A;  1ODV A;  3E4O A;  2VGL S;  5DF8 A;  5FAO A;  3T4L A;  1JWV A;  5J7E A;  1OJ5 A;  2EX9 A;  2XA7 S;  1W8Q A;  2HP5 A;  5HAQ A;  3A3E A;  4S2L A;  4Y0U A;  3ZGA B;  5EVE A;  2O99 A;  4MN7 A;  4P6B A;  1ALQ A;  1H8M A;  3SOI A;  3DWZ A;  4CLC D;  4OLG A;  4FCF A;  3Q7V A;  1DJC A;  1K54 C;  4WZ4 A;  3UN7 A;  3LR4 A;  2NUP C;  3VP2 A;  2OOL A;  4E3O A;  4BLM A;  3G30 A;  1TD5 A;  1JNU A;  4KG2 A;  4GNU A;  1K4E A;  2Q0O A;  2L0W A;  3T1Q B;  3PAG A;  2EFX A;  2M7V A;  2OAP 1;  4ZAM A;  3LYX A;  3B33 A;  3TRC A;  1K6R A;  3V5M A;  4DKI A;  4CLC B;  2PU4 A;  3NI9 A;  1NWZ A;  3A0V A;  3MQO A;  4BJP A;  2XK1 A;  3UB6 A;  3W2Z A;  4BL3 A;  5HW3 A;  5A92 A;  1F98 A;  3HVF A;  1ES3 A;  4S2J A;  1BLP A;  5GHZ A;  1IEL A;  3T4J A;  1XXM A;  1I2S A;  4LRZ E;  3T50 A;  4KG6 A;  4WYY A;  1NYM A;  4CPK A;  3FPV A;  5FI6 A;  5IS1 A;  3F1O B;  5KSH A;  2QHK A;  1OPX A;  1YLW A;  3H82 A;  2VEA A;  3D4F A;  4Y7P A;  5FI7 A;  4QHC A;  3E98 A;  4GN2 A;  1SZV A;  2NUT C;  3MKE A;  3VFH A;  3PBO A;  3LR5 A;  3R7W A;  3T1X A;  4DDY A;  3UDF A;  1NRF A;  3SW1 A;  3A3D A;  2ZQ9 A;  4S2I A;  2ZC4 B;  1K56 A;  1YMS A;  3A3J A;  5DVA A;  3ZYT A;  1I2W A;  5HWV A;  4S2N C;  1LL5 A;  1XX2 A;  5HPF A;  4R70 A;  1YLZ A;  1WYB A;  1VEU B;  3SS5 A;  2WAD A;  3MXR A;  4JBF A;  4MN5 A;  1MC0 A;  2Y2H A;  5J8X A;  1VB6 A;  3IF6 A;  2ZL1 A;  1K57 C;  4OH0 A;  2XFS A;  2J9O A;  1BUL A;  1ONG A;  3MFX A;  3CPT B;  4MDZ A;  5CGS A;  1YAX A;  4NXB A;  3EEH A;  3MZE A;  3C4O A;  5L2F A;  3F1P B;  3RXW A;  1SHV A;  5HD5 A;  2ZQA A;  3EEA A;  1MPL A;  5G18 A;  3I7J A;  1KDS A;  3FZC A;  3NIA A;  2V1A A;  3BRM A;  3E4Q A;  2WK0 A;  5L10 A;  1PIO A;  3PR6 A;  1MKI A;  1VHM A;  5FI2 A;  5DFX A;  1P97 A;  3ZG5 A;  3MBZ A;  1DJA A;  2L1M A;  2C6W B;  4EQI A;  2EWV A;  4HBT A;  1FQG A;  1LSX A;  3QNC A;  1T19 A;  3M2K A;  1H8Z A;  5DKL A;  5F83 A;  1YM1 A;  2GDN A;  3T4S A;  1DP8 A;  3JVV A;  3TSG A;  5DKK A;  1MBL A;  4LFU A;  3U4L P;  2J8Y A;  3N8L A;  5HFO A;  4OOL A;  3LEQ A;  3JVU A;  1OTD A;  1DP9 A;  1IYP A;  1ES5 A;  4R23 A;  2QWS A;  1K56 D;  4MBH A;  2J3T D;  4BBU A;  2B5R A;  1SCW A;  2ZQD A;  1GCE A;  2RL3 A;  5DF9 A;  2PDR A;  3C4P A;  3BLS A;  4B4Z A;  3PBN A;  1EWZ A;  1PZP A;  3E0Y A;  1K0K A;  2JE5 A;  2INW A;  5D3O A;  2ZD8 A;  4E3I A;  1JVJ A;  1RP5 A;  4HHD A;  3LIF A;  1ZG4 A;  5CGX A;  3WS5 A;  5J3W A;  4E6X A;  3HUN A;  5EPH A;  3CHW P;  5TFQ A;  3ITB A;  1Y4O A;  4K08 A;  3OPP A;  2W1R A;  5EUA A;  1YLJ A;  3HL9 A;  1IOU A;  4KUO A;  4Y15 A;  3NEC A;  5FQ9 A;  1MWR A;  4DE2 A;  4YNR A;  5IT5 A;  4M3K A;  3HLC A;  2IA2 A;  4GDB A;  4UQI S;  4ME4 A;  5EVI A;  4WM9 A;  1T1A A;  4KQQ A;  1YQS A;  4QB8 A;  4BMW A;  4XUZ A;  2K7S A;  1XJ2 A;  3NOP C;  4OOY A;  5AQA A;  3IS2 A;  1XPB A;  3IXD A;  3FYZ A;  4S2K A;  2C5W B;  5HD3 A;  1NLY A;  4N9K A;  4WF0 A;  1K55 A;  1L3L A;  3UO9 A;  4XUX A;  3FV7 A;  2B02 A;  5EOO A;  4RA7 A;  1OME A;  1KGF A;  3MKF A;  1ONH A;  4UEY A;  1FCM A;  3BWL A;  3IH9 A;  5I94 A;  2PYP A;  4DMZ A;  1PI5 A;  4OPZ A;  1MWT A;  4G3V A;  1P0Z A;  1SDE A;  2HDS A;  4BWI A;  1M6K A;  4BD0 A;  2K31 A;  2JKF A;  1J9M A;  3HLW A;  4X68 A;  3GEC A;  5TBM B;  4BL2 A;  1D06 A;  1IYO A;  3HJK A;  3E4P A;  1S0W A;  5HSQ A;  1QME A;  2HPB A;  3MJQ A;  4YWZ A;  2BLS A;  1BZA A;  4GJ4 A;  2HV1 A;  1Q2P A;  1K4F A;  3UNW A;  4EXO A;  3RTY A;  1G6A A;  2PYR A;  2AVX A;  1TS8 A;  1IKI A;  1KE4 A;  3KX0 X;  2Y2K A;  3EWK A;  4WZ5 C;  4IUH A;  4JXG A;  3LIE A;  2HJE A;  3V3S A;  4PKY G;  3WS1 A;  3T12 B;  3LFV A;  2V9A A;  4GDN A;  3UY6 A;  3TJZ C;  3C30 A;  4KZ3 A;  2WGW B;  3MZD A;  1GSW A;  1WE4 A;  5F1G A;  4QJG A;  4QD4 A;  2VKS A;  1L0D A;  4HJ4 A;  4WMC A;  5EVI D;  4HOI A;  3CIT A;  5DTT A;  5EM0 A;  2WKE A;  4CLC A;  1YPR A;  1KE0 A;  3KSF A;  4K91 A;  1PI4 A;  1OTI A;  1ES2 A;  3S22 A;  2Y2J A;  4IVI A;  1ZG6 A;  3MFD A;  1L0G A;  2VGK A;  2XD1 A;  3SH7 A;  3WS2 A;  4II7 A;  5FEF A;  1MY8 A;  1PNE A;  4RVA A;  1S1Y A;  1TVF A;  1D1J A;  3RFB A;  3BFC A;  3BFG A;  2XRN A;  2XEP A;  4G3K A;  3N4I A;  4RX3 A;  3LI9 A;  4E3K A;  1S66 L;  5HL6 A;  4P87 A;  3F1O A;  1YKD A;  4IUK A;  3KSG A;  4LV2 A;  4EUZ A;  1BUE A;  4E3L A;  4UA6 A;  3IBJ A;  3Q1F A;  3UB5 P;  2A24 B;  1UWN X;  5GLD A;  3IX4 A;  3K3C A;  4HP4 A;  3SH8 A;  4XXR A;  3VP4 A;  5BOH A;  2JHE A;  2W3H A;  3S7Q A;  1YSQ A;  2PR6 A;  4EBL A;  1PW8 A;  2K2N A;  3TE8 A;  3MXQ A;  5HAI A;  1H8Y A;  4XT2 B;  4HH3 A;  5KMW A;  2FFY A;  4NK3 A;  5HAP A;  4MCW A;  5CTM A;  4ZBE A;  4MBF A;  2G2W A;  3HRE A;  3UDX A;  4OP5 A;  4P6Z S;  2ZQ8 A;  1YT4 A;  5EVL A;  4WLA A;  2HGV A;  3OBF A;  4DXB A;  3NOT C;  4C75 A;  3C2W A;  4F3L A;  4UAA A;  1BLS A;  1HZO A;  3QP1 A;  3HLG A;  4PAU A;  1F9I A;  3ZG9 B;  2PT7 A;  5FQQ A;  3CPT A;  3ZVW A;  3BEB A;  4KZA A;  1FIL A;  1GA0 A;  1S67 L;  4HBU A;  5AVE A;  4R38 A;  2X71 A;  3VOL A;  4WMC D;  2DCF A;  2Y2M A;  4WEJ A;  2BAS A;  2ZLY A;  2BTF P;  4D2O A;  2Z2M B;  4L9G A;  2X02 A;  1XGJ A;  4EEU A;  2W1T B;  2IWB A;  5HL1 A;  3KSH A;  4LCM A;  3LIC A;  5E2E A;  1BYW A;  5K5B A;  2KDK A;  2HF6 A;  2O9B A;  2WGI A;  2HP6 A;  5GLB A;  3LY4 A;  4Y0O A;  3MQ0 A;  1HD8 A;  1I5Q A;  4FD8 A;  3CJM A;  3O88 A;  5F5Y A;  4GCZ A;  4OQ0 A;  4N92 A;  2ZOI A;  2DNS A;  2WYX A;  5HX9 A;  3LGO A;  4JGO A;  4HQA A;  3QP5 A;  3OZH A;  4JLF A;  1PWD A;  2GZA A;  5AQB A;  5EV0 A;  2WZX A;  3BJN A;  2HDU A;  4E3N A;  3O5Y A;  3CUE C;  4GS9 B;  3U2A A;  2H0T A;  2E8J A;  2D02 A;  3DTI A;  3K3D A;  1OTE A;  3O86 A;  3BQA A;  2W3E A;  4GHI B;  3VOZ A;  1NY0 A;  3WRT A;  2EX6 A;  4LRY C;  3VP0 A;  3A3F A;  2WKH A;  2HJ9 C;  3LR0 A;  4N1H A;  1IEM A;  1G5U A;  1LLB A;  1L0F A;  4HJ3 A;  2P9V B;  2EFU A;  4NEE D;  3IWO A;  1W63 Q;  1NYY A;  1NXY A;  4MBK A;  4WBG A;  3UE3 A;  3CAX A;  3VMA A;  4CLC E;  3QHY A;  3RXX A;  2P7J A;  3QNB A;  4IBX A;  2QMI A;  3L9K A;  4OQG A;  5DTS A;  4R6L A;  3DBA A;  5A8B A;  1M40 A;  5EE8 A;  3MMH A;  3HCY A;  4NXG A;  1HLU P;  4X69 A;  3NOU C;  5HDC A;  1TS7 A;  2EX2 A;  3PBS A;  5AJG A;  3DTK A;  1GA9 A;  2OAQ 1;  1S4R A;  3N8R A;  3IXG A;  4NKP A;  3JPU A;  3MSH A;  3LY3 A;  2PBD P;  4NXF A;  1W7F A;  1WA9 A;  4B9O A;  3PBT A;  4EQ1 A;  2ZC5 B;  3IXH A;  3IXB A;  3Q82 A;  4NET A;  4QY6 A;  4DE3 A;  1MKM A;  3WWX A;  2Y91 A;  4O01 A;  1JWZ A;  3FWL A;  1K38 A;  1PRQ A;  3ZNY A;  4EES A;  3JYI A;  1SKO A;  1FIK A;  3BEC A;  3DAV A;  2ZQC A;  3SZT A;  2B18 A;  2Z6D A;  4L9F A;  1TS0 A;  1UWP X;  1LSV A;  5TBM A;  5LBR A;  5E43 A;  1NZO A;  2Y8H A;  3BY8 A;  4OOM A;  2WKP A;  4GKU A;  1CJF A;  5C5K A;  1NLZ A;  1KE3 A;  4EER A;  2WUQ A;  3PYP A;  4Z9Q A;  5FAQ A;  3Q7V B;  1V9Z A;  2Y2Q A;  1VM1 A;  1L0E A;  1N9B A;  5FQI A;  4UA7 A;  4S2O A;  1XA7 A;  3G6O A;  2ZQ7 A;  4ZJ3 A;  2M7U A;  3UPP A;  4NXE A;  3F1N A;  2Y2P A;  3LO7 A;  4FTX A;  2W3D A;  2VGL M;  3T4O A;  4Y13 A;  4JGQ A;  2Z6C A;  1SDN A;  2WGW A;  4E6W A;  4CQH A;  3GSG A;  3MXS A;  2V0W A;  3IF6 C;  5L09 A;  4Y5F A;  4DE0 A;  2WAE A;  3BQ8 A;  2VV8 A;  2J80 A;  1AXB A;  4LV1 A;  1GHP A;  4DXC A;  1TDG A;  4PM8 A;  5DFY A;  3VSK A;  2EA9 A;  3LIA A;  1GHI A;  2J3W A;  2PHY A;  4JF6 A;  2Z2L B;  5DJT A;  5DF7 A;  2PAV P;  2GX5 A;  4KQR A;  1YMX A;  4EET B;  3PXP A;  1G6O A;  4CJN A;  4QY5 A;  2ZC6 B;  1ES4 A;  4K0X A;  4HIA A;  3IWI A;  4KG5 A;  1FCO A;  2ZOH A;  1J3W A;  4O7D A;  3S4X A;  2H5S A;  4R1G A;  2J9P A;  4Y2F A;  3R7W B;  5M19 A;  3IH8 A;  3LID A;  4JGR A;  3V39 A;  3V50 A;  4N9L A;  3FC7 A;  5FEG A;  4KZ4 A;  1O07 A;  4HJ6 A;  1DJB A;  3LEZ A;  2A24 A;  4NG2 A;  2RCX A;  3C7V A;  4JGP A;  2HZ5 A;  1BSG A;  5TJJ A;  3NUL A;  4XT2 A;  4HNB A;  2Y55 A;  4Q0H A;  3EQU A;  4MMN A;  3Q7Z A;  4KUK A;  3QP6 A;  3TW8 A;  2V1Z A;  5E2H A;  3G2Z A;  1G28 A;  3S7O A;  3PHY A;  3UME A;  4A5R A;  4EWF A;  3FPW A;  3N7W A;  2XSS A;  1OT9 A;  1Y54 A;  4E3J A;  3MF0 A;  4G3W A;  4PHT A;  1CF0 A;  2Y4A A;  5HAR A;  1GSV A;  3C5A A;  1BTL A;  3N6I A;  4PM9 A;  2XR0 A;  2PD7 A;  3D3O A;  4EBP A;  5EOE A;  4IHQ A;  2VGJ A;  3CG5 A;  1C3B A;  4PM5 A;  1ESI A;  1PWG A;  5TR7 A;  1N4O A;  1IYQ A;  2MJ6 A;  1V9Y A;  4X53 A;  2XRO A;  4JF4 A;  5CHM A;  5EVI C;  2W0N A;  4KZ9 A;  2KOI A;  5FA7 A;  2VV7 A;  5EFW A;  1YLP A;  3HLD A;  5FDS A;  4OVD A;  4U0T A;  5AQ9 A;  4DDS A;  1MWS A;  2PD8 A;  3G35 A;  2OV5 A;  3SS3 A;  4E04 A;  2B95 A;  1NZU A;  1K55 C;  2WKQ A;  3HLB A;  1MZU A;  1ZKJ A;  4PPR A;  3CLO A;  1S4S A;  3L7H A; 
#chains in the Genus database with same CATH homology
 4HEF A;  3LCE A;  2XFS A;  1XGJ A;  4OH0 A;  2IWB A;  1QMF A;  5CED A;  3V3R A;  2J9O A;  1BUL A;  1ONG A;  3E2K A;  5HL1 A;  4KZB A;  4LCM A;  4KZ6 A;  1YLY A;  4KZ8 A;  4WEK A;  5M1A A;  5E2E A;  2ZJ9 A;  2WGI A;  5CGS A;  3PTE A;  1ERQ A;  4MLL A;  2HP6 A;  5GLB A;  2H0Y A;  3LY4 A;  4C6Y A;  2X01 A;  4YIN A;  4Y0O A;  5CTN A;  4WZ5 A;  4OQH A;  2JC7 A;  2Y2N A;  1RCJ A;  3NY4 A;  1HD8 A;  3MZE A;  1I5Q A;  1KGE A;  3C4O A;  1CK3 A;  2UWX A;  4FD8 A;  5FQM A;  4U3T A;  3CJM A;  3O88 A;  5L2F A;  4PMA A;  3W4O A;  5CHJ A;  4OQ0 A;  5GL9 A;  3RXW A;  1SHV A;  2WKI A;  4N92 A;  1KVM A;  4R3J A;  1G68 A;  2ZQA A;  2DNS A;  2WYX A;  3UPN A;  1KGG A;  5HX9 A;  4R4R A;  1MPL A;  1VQQ A;  5G18 A;  3SH9 A;  3I7J A;  2ZM0 A;  3TOI A;  4DE1 A;  1CI8 A;  1KDS A;  1XA1 A;  3FZC A;  3IF6 B;  4IED A;  3OZH A;  3NIA A;  4JLF A;  3BRM A;  1PWD A;  5A90 A;  4R3B A;  2WK0 A;  3DTM A;  5AQB A;  3WS0 A;  4Q8I A;  1E3U A;  1PIO A;  5F82 A;  1MKI A;  4LCL A;  5FI2 A;  3VP1 A;  2WZX A;  3FKV A;  4DF6 A;  4P0M A;  5CEC A;  2XFT A;  3NC8 A;  3ZG5 A;  5A93 A;  3MBZ A;  1CI9 A;  1DJA A;  2WZZ A;  2C6W B;  4RYE A;  2HDU A;  4EQI A;  3GV9 A;  4KZ5 A;  4E3N A;  5EEC A;  1TEM A;  4HBT A;  1FQG A;  3QNC A;  4KEN B;  4UHU A;  1K54 A;  3G4P A;  1GHM A;  3CMZ A;  5CHU A;  2H0T A;  3CZD A;  3M2J A;  3M2K A;  3NCK A;  1H8Z A;  5F83 A;  1YM1 A;  5FSR A;  3BLM A;  2GDN A;  2Y2O A;  3ZG8 B;  3O86 A;  1E25 A;  3TSG A;  3VSL A;  1MBL A;  3VOZ A;  1NY0 A;  3WRT A;  3BFE A;  2EX6 A;  3VP0 A;  3A3F A;  2J8Y A;  3IF6 A;  1ERO A;  3N8L A;  1PWC A;  2WKH A;  3C7U A;  5HFO A;  1PW1 A;  4OOL A;  2QPN A;  4N1H A;  1IEM A;  3NDE A;  2FFF B;  4YFM A;  1IYP A;  1LLB A;  3UDI A;  1L0F A;  2HP9 A;  5E2G A;  2CC1 A;  2EFU A;  2P9V B;  3IWQ A;  2OSU A;  1FSY A;  4OLD A;  3IWO A;  1ES5 A;  4RX2 A;  1NYY A;  1NXY A;  2Y2L A;  4JXS A;  4MBK A;  4B88 A;  4R23 A;  3EQV A;  1FSW A;  1CEG A;  5JYP A;  1K56 D;  3AGE A;  5GHY A;  4WBG A;  4MBH A;  3UE3 A;  3AGD A;  2EXA A;  2B5R A;  1Q2Q A;  1SCW A;  3VMA A;  2ZQD A;  3QHY A;  5GLC A;  3RXX A;  3QNB A;  4IBX A;  2QMI A;  1GCE A;  2RL3 A;  5KZH A;  2EX8 A;  4OQG A;  5DF9 A;  5DTS A;  3C4P A;  5F1F A;  3ZVT A;  5M18 A;  4JPM A;  1H5X A;  1M40 A;  3BLS A;  3PBN A;  1EWZ A;  1PZP A;  5EE8 A;  4B4Z A;  2JE5 A;  4PM6 A;  5D3O A;  5E2F A;  2ZD8 A;  1DY6 A;  4X69 A;  1JVJ A;  4E3I A;  3G31 A;  1RP5 A;  2G2U A;  4EV4 A;  1ZG4 A;  2EX2 A;  3PBS A;  5CGX A;  1JWP A;  2JCH A;  3GRJ A;  4X6T A;  2HDQ A;  2V2F F;  4JXV A;  3WS5 A;  1GA9 A;  4LEN A;  4E6X A;  1Z6F A;  4N1X A;  4HES A;  3HUN A;  1IYS A;  5EPH A;  5TFQ A;  3N8R A;  3ITB A;  1HTZ A;  3IXG A;  3PBR A;  4IBR A;  1RGY A;  3Q81 A;  3OPP A;  5EUA A;  1WYC A;  1YLJ A;  1S6R A;  3BYD A;  3HL9 A;  3LY3 A;  3HLF A;  4BD1 A;  4QU3 A;  4GZB A;  4ZDX A;  4P85 A;  1W7F A;  1FR1 A;  4OKP A;  3W4Q A;  3G2Y A;  3PBT A;  5GHX A;  2ZC5 B;  3IXH A;  5JYO A;  5FQ9 A;  1MWR A;  4DE2 A;  3IXB A;  3Q82 A;  4NET A;  4QY6 A;  3VOY A;  4BQM A;  5KSC A;  4DE3 A;  3WWX A;  3FKW A;  3OCN A;  2Y91 A;  3HBR A;  1L2S A;  1JWZ A;  4M3K A;  3FWL A;  1LL9 A;  3HLC A;  4GDB A;  5FAT A;  5EVI A;  1K38 A;  2Y2I A;  4WM9 A;  2ZM2 A;  3ZNY A;  2OLV A;  4KQQ A;  4E3M A;  3M6B A;  1YQS A;  3HUM A;  3JYI A;  4QB8 A;  1BLH A;  4XUZ A;  1E3U D;  3BEC A;  3ZFZ A;  2ZQC A;  3ITA A;  4OOY A;  5AQA A;  4S2N A;  3NDG A;  1XPB A;  4ZJ2 A;  3A3I A;  3IXD A;  3UE1 A;  2A49 A;  3FYZ A;  4S2K A;  2C5W B;  4N9K A;  1BT5 A;  1K55 A;  4S2M A;  3UO9 A;  4XUX A;  1ESU A;  3FV7 A;  3ZDJ A;  5EOO A;  3IHB A;  5E43 A;  3O3V A;  1KDW A;  2P9V A;  1OME A;  2OLU A;  4GD6 A;  4K0W A;  1NZO A;  4RA7 A;  4WMC D;  3BFF A;  4GOG A;  3VP3 A;  1KGF A;  3MKF A;  4OOM A;  1ONH A;  1W5D A;  1K57 A;  1FCM A;  2I72 A;  2JBF A;  4GKU A;  3ISG A;  5CRF A;  3ZG7 B;  3IH9 A;  4EBN A;  1KE3 A;  3N8S A;  3ZHH A;  2WUQ A;  5I94 A;  4FH2 A;  3ZG0 A;  4C3Q A;  5FAS A;  4Z9Q A;  5FAQ A;  5EVI B;  3Q7V B;  1PI5 A;  4OPZ A;  5CXW A;  3RJU A;  3BFD A;  1MWT A;  2Y2Q A;  1VM1 A;  2A3U A;  1L0E A;  2WGV A;  3BM6 A;  1N9B A;  1SDE A;  5FQI A;  4B4X A;  2HDS A;  2EXB A;  4UA7 A;  4X56 A;  4S2O A;  1XA7 A;  2H10 A;  2ZQ7 A;  1M6K A;  1K25 A;  4BD0 A;  4ZJ3 A;  4JF5 A;  4L0L A;  3HUO A;  4OPY A;  1J9M A;  3HLW A;  3IT9 A;  3UPP A;  4X68 A;  1CEF A;  2Y2P A;  3OPL A;  3P98 A;  4BL2 A;  1IYO A;  3LO7 A;  1BLC A;  1S0W A;  4U0X A;  2J7V A;  5CER A;  5CEB A;  1QME A;  2HPB A;  3GQZ A;  1TDL A;  2ZC7 A;  5GLA A;  2XF3 A;  4R4S A;  2BLS A;  2V20 A;  1SDN A;  2XGN A;  1BZA A;  3S1Y A;  1XGI A;  2WGW A;  4JKT A;  4E6W A;  1Q2P A;  3GR2 A;  3GSG A;  3MXS A;  4ZJ1 A;  3IF6 C;  2XLN A;  4F94 A;  3VFF A;  4DE0 A;  1K4F A;  3OPR A;  1ERM A;  4FSF A;  4KQO A;  3UNW A;  1PZO A;  3ZNT A;  1G6A A;  5FAP A;  2WAE A;  2IWD A;  1IKI A;  1AXB A;  5TGF A;  1KE4 A;  4LV1 A;  1GHP A;  2Y2K A;  4WEL A;  5A91 A;  4DXC A;  1TDG A;  4PM8 A;  3VSK A;  3OCL A;  4WZ5 C;  3WRZ A;  2DRW A;  1GHI A;  4JXG A;  2Y59 A;  1E4D A;  3ZCZ A;  3V3S A;  4JF6 A;  3WS1 A;  2Z2L B;  2Q9N A;  4OP8 A;  3W4P A;  5DF7 A;  3GMW A;  4GDN A;  3UY6 A;  4KQR A;  3OC2 A;  3DWK A;  1YMX A;  4KZ3 A;  4PM7 A;  2WGW B;  4LV0 A;  2ZMA A;  5DF8 A;  1JWV A;  1LI0 A;  3MZD A;  1W8Y A;  5FAO A;  2BG1 A;  4CJN A;  1WE4 A;  5F1G A;  1FOF A;  2EX9 A;  2ZC6 B;  4QY5 A;  4QJG A;  1ES4 A;  4ID4 A;  4K0X A;  3W8K A;  3IWI A;  1W8Q A;  2QZ6 A;  4OQI A;  1LI9 A;  2HP5 A;  4KG5 A;  4QD4 A;  1FCO A;  3A3E A;  4S2L A;  5HAQ A;  4Y0U A;  3ZGA B;  1L0D A;  4P6B A;  1IKG A;  1ALQ A;  3B3X A;  4FH4 A;  3SOI A;  4GD8 A;  4O7D A;  4WMC A;  2Y2G A;  3DWZ A;  5EVI D;  3S4X A;  2H5S A;  4R1G A;  4OLG A;  2J9P A;  5DTK A;  4OPR A;  5DTT A;  4FCF A;  4DRT A;  2WKE A;  5M19 A;  5FQJ A;  3IH8 A;  3E2L A;  3PAE A;  3Q7V A;  1DJC A;  1KE0 A;  1K54 C;  4WZ4 A;  3TG9 A;  3UN7 A;  3V39 A;  4K91 A;  3IQA A;  3UPO A;  1PI4 A;  4X55 A;  3V50 A;  1SKF A;  3VP2 A;  1ES2 A;  5U47 A;  3S22 A;  3O87 A;  2Y2J A;  4N9L A;  4KZ4 A;  4E3O A;  1O07 A;  4IVI A;  4BLM A;  1ZG6 A;  1FCN A;  3G30 A;  2PU2 A;  1YLT A;  2P74 A;  3PBQ A;  2XD5 A;  1DJB A;  4KG2 A;  3LEZ A;  3MFD A;  1L0G A;  2VGK A;  2XD1 A;  3SH7 A;  3WS2 A;  4GNU A;  1K4E A;  1MXO A;  3NBL A;  1MY8 A;  3SS4 A;  2RCX A;  4RVA A;  3C7V A;  3UE0 A;  1BSG A;  1TVF A;  3HLE A;  3PAG A;  3GVB A;  3G34 A;  2EFX A;  3BFC A;  3BFG A;  4BEN A;  4OPQ A;  2XEP A;  5FQK A;  4ZAM A;  3N4I A;  4RX3 A;  2Y55 A;  4ZTK A;  3EQU A;  1K6R A;  3WS4 A;  3V5M A;  4DKI A;  3Q7Z A;  2PU4 A;  3NI9 A;  4E3K A;  4JXW A;  1W79 A;  4P87 A;  2V1Z A;  4H8R A;  3IF5 A;  3OPH A;  4BJP A;  1O7E A;  2XK1 A;  5E2H A;  1NJ4 A;  4R0Q A;  4LV2 A;  3G2Z A;  2R9X A;  4BL3 A;  2XH9 A;  4EUZ A;  5A92 A;  5HW3 A;  1BUE A;  4E3L A;  3HVF A;  4UA6 A;  4A5R A;  4EWF A;  3N7W A;  3Q1F A;  4LV3 A;  1Y54 A;  1ES3 A;  4S2J A;  5GLD A;  1JTD A;  3SH8 A;  4E3J A;  4XXR A;  3VP4 A;  1BLP A;  5BOH A;  5GHZ A;  1IEL A;  1MWU A;  1XXM A;  4EBL A;  1XP4 A;  1PW8 A;  3GTC A;  1JTG A;  1I2S A;  1ZC2 A;  2Y4A A;  5HAI A;  5HAR A;  1H8Y A;  3C5A A;  4KG6 A;  5IHV A;  5KMW A;  1BTL A;  4WYY A;  3M6H A;  3N6I A;  2FFY A;  4NK3 A;  5HAP A;  1NYM A;  5CTM A;  4CPK A;  4ZBE A;  4MBF A;  4PM9 A;  2XR0 A;  3AGF A;  5FDH A;  5FI6 A;  2G2W A;  5KSH A;  2ZC3 B;  1YLW A;  3HRE A;  3UDX A;  3G32 A;  4EBP A;  4OP5 A;  5EOE A;  2ZQ8 A;  1YT4 A;  5EVL A;  3D4F A;  4DXB A;  4Y7P A;  2VGJ A;  5FI7 A;  1EI5 A;  3CG5 A;  1C3B A;  1U60 A;  3Q07 A;  4PM5 A;  4QHC A;  4C75 A;  1ESI A;  4GN2 A;  1PWG A;  5AQ7 A;  3MKE A;  5TR7 A;  4Y0T A;  1N4O A;  1IYQ A;  3VFH A;  3PBO A;  3MZF A;  4S2P A;  4UAA A;  4GB7 A;  1K6S A;  1BLS A;  1HZO A;  4DDY A;  3UDF A;  1NRF A;  4X53 A;  4JF4 A;  3HLG A;  1HVB A;  4IVK A;  1RGZ A;  5CHM A;  4OON A;  3ZG9 B;  5EVI C;  2PBY A;  3A3D A;  2ZQ9 A;  4KZ9 A;  4S2I A;  2ZC4 B;  5FA7 A;  5FQQ A;  3ZVW A;  1K56 A;  2XQZ A;  3BEB A;  4KZA A;  1YLP A;  1GA0 A;  3HLD A;  1YMS A;  3A3J A;  4OVD A;  4U0T A;  4HBU A;  5DVA A;  2X71 A;  5AQ9 A;  1I2W A;  4DDS A;  1MWS A;  1PYY A;  4S2N C;  3G35 A;  1LL5 A;  2OV5 A;  1KVL A;  1XX2 A;  3SS3 A;  4MNR A;  1FR6 A;  3IHA A;  3P09 A;  5CGW A;  2R9W A;  1YLZ A;  1NZU A;  2ZM8 A;  4KZ7 A;  1WYB A;  2DCF A;  2Q9M A;  2Y2M A;  4MEZ A;  4UA9 A;  4WEJ A;  1K55 C;  3SS5 A;  2WAD A;  3HLB A;  3DW0 A;  3MXR A;  2IWC A;  4JBF A;  1XKZ A;  1ZKJ A;  2XDM A;  2HDR A;  2Y2H A;  2ZLY A;  5J8X A;  4PPR A;  1LHY A;  2E8I A;  2WAF A;  4D2O A;  2Z2M B;  2X02 A;  1K57 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...