5J3WA

Crystal structures reveal signaling states of a short blue light photoreceptor protein ppsb1-lov (dark state)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
133
structure length
133
Chain Sequence
MINAQLLQSMVDASNDGIVVAEKEGDDTILIYVNAAFEYLTGYSRDEILYQDCRFLQGDDRDQLGRARIRKAMAEGRPCREVLRNYRKDGSAFWNELSITPVKSDFDQRTYFIGIQKDVSRQVELERELAELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Sensory box protein
publication title Signaling States of a Short Blue-Light Photoreceptor Protein PpSB1-LOV Revealed from Crystal Structures and Solution NMR Spectroscopy.
pubmed doi rcsb
source organism Pseudomonas putida (strain kt2440)
total genus 39
structure length 133
sequence length 133
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5j3wA00
1LSXA 4LLOB 4WUJA 4BBUA 4HJ4A 2WKQA 1OTDA 3MFXA 5G4YA 1LT0A 5EFWA 2QKPA 1V9YA 5F5YA 4L9EA 1TS0A 4NXGA 1F98A 2KX6A 2OOLA 3C8CA 2KDKA 4EQ1A 3LUQA 4F3LA 4HNBA 3H7WB 3LIDA 1D06A 1S4SA 1JNUA 3CWFA 1NWZA 2L0WA 3G6OA 5HDDA 3K3DA 1OT6A 3MR0A 1Y28A 4M4XA 5HD5A 5TBMB 2J80A 1X0OA 3BY9A 2YKHA 3IBRA 4HH3A 2V9AA 3P7NA 4EERA 3UB7A 2JN7A 4GS9A 1GSXA 4LPZA 3H82B 4R70A 5F69A 1XJ3A 4EEUA 3KX0X 3MQOA 4GW9A 3UMDA 3UMEA 1DP9A 5HDCA 1OTEA 2WKRA 2QHKA 3NOTC 4EETB 3UB6A 3F1OA 1GSWA 4RQ9A 5DKKA 2Z6DA 4NXFA 1S4RA 3NOPC 1OTIA 1TS8A 3LIFA 1T1AA 4DJ2A 2VV8A 2Z6CA 3LYXA 2W27A 1TS6A 3LIEA 5AVEA 4MN5A 3B33A 2D02A 2V1AA 2QWSA 1GSVA 2R78A 2JHEA 1G28A 3EWKA 1UGUA 3K3CA 4MN6A 3VOLA 3CLOA 2VV6A 3E4PA 3F1NB 3RTYA 2A24B 3LIAA 1OTAA 2CMNA 4JGRA 1DRMA 1UWPX 4PKYA 1LSVA 4HHDA 5HD3A 2OWJA 4WLAA 3NJAA 4H6JA 1N9OA 3HJIA 5G4ZA 2B02A 3EEHA 4HH2A 1BYWA 4BBTA 5DKLA 3BWLA 5I5LA 1T1BA 3IS2A 3OLOA 4R6LA 5J4EA 4XT2A 2V0UA 2M1CA 5DJUA 2GJ3A 2PD7A 3CAXA 3LIBA 4L9GA 3SW1A 1KOUA 1LL8A 4LRXC 2QJ7A 2VV7A 2VEAA 2K7SA 2OWHA 5A8BA 1N9LA 3HJKA 1V9ZA 4HQAA 1P0ZA 4E04A 4EEPA 5HZHA 3PHYA 3BY8A 1OTBA 5HSQA 3NOUC 1OJ5A 1P97A 2BASA 3VE4A 4HP4A 3PYPA 3F1PA 4R3AA 5F6AA 5KIZA 1D7EA 1S1YA 2PR5A 1XJ6A 4KUKA 3H7WA 3MQQA 4GCZA 3E4OA 1UWNX 5HWTA 4WF0A 1WA9A 5HWVA 2ZOHA 2L4RA 3ICYA 5TBMA 5J3WA 4F3LB 1VB6A 4KQDA 3UB9A 4LRZE 4I38A 5HWWA 4XT2B 3H82A 4I39A 4JGPA 1XJ2A 2D01A 4WN5A 3GDIA 4GS9B 5J7EA 3MJQA 3LI9A 2W0NA 3ZQ5A 4I3AA 4GHIA 4HI4A 1XFQA 1OJGA 2PYPA 2PDRA 4EXOA 1XFNA 1XJ4A 1F9IA 4L9FA 3UB8A 5IU1A 4HJ3A 2PR6A 4HP9A 1LSWA 3UE6A 3F1OB 4EW7A 4NXEA 3FG8A 3F1PB 4LRYC 4B9OA 5AVFA 4I3IA 3T50A 2ZOIA 4KUOA 4HY8A 2WKPA 1EW0A 1T19A 3F1NA 3VE3A 2V0WA 3D72A 1OT9A 4JGQA 2A24A 4K08A 1S66L 1S67L 3A0RA 3C2WA 1MZUA 4HOIA 3ULFA 2EA9A 5DJTA 2QJ5A 2H28A 2ZBBA 3GECA 3LICA 4JGOA 3MXQA 3FC7A 1T1CA 2PD8A 1DP8A 1S1ZA 2PYRA 4EESA 3H9WA 4H6JB 2YKFA 4GHIB 4NXBA 5IS1A 2HV1A 1DP6A 2PHYA 4DJ3A 1T18A 2L1MA 3E4QA 4PKYG 5HDSA 4WL9A 4BBVA 3A0SA 4HIAA 4I5SA 3A0VA 3IS2B 3NHQA 2I9VA 2P7JA 4R38A 3LI8A 4YWZA 2VLGA 1ODVA 4I3JA 1N9NA 2V1BA 1TS7A 2INWA 5F68A 4HJ6A 3RH8B
chains in the Genus database with same CATH superfamily
4CLCA 3FKWA 4BBUA 2WKQA 3MFXA 5BOHA 1P9WA 5GLDA 1H8ZA 5F83A 3BLMA 1IYOA 4KENB 3EQUA 2Q0OA 4B4ZA 3UN7A 3PR6A 5HPFA 1FOFA 4II7A 2KX6A 3NIAA 4LGWA 4M3KA 3QP5A 3I7JA 5AQ9A 3C7VA 5CGWA 3GRJA 5GLCA 2W3GA 3LUQA 1L0DA 3NULA 4HNBA 1BUEA 1XXMA 3HREA 2ZMAA 4HBUA 3G6OA 4WZ4A 5HDDA 1YT4A 3B3XA 2IWBA 2X71A 1CI9A 2CC1A 4UQIS 2HDRA 4FCFA 4DDYA 2YKHA 1KDWA 2BG1A 2V9AA 4PAUA 3P7NA 3DAVA 4EERA 4OKPA 2JN7A 3ITAA 2C6WB 4KZAA 4GDNA 3HLEA 4JPMA 1EWZA 4GNUA 3MQOA 4GW9A 1K4FA 4FTXA 3IBJA 3UMEA 1O7EA 2IA2A 2WKRA 5J8XA 2QHKA 1BLCA 3RXWA 3F1OA 1GSWA 3NDGA 4R23A 3Q1FA 4FH4A 1AXBA 1CF0A 1H5XA 4WZ5C 5TFQA 3NOPC 1OTIA 5DF9A 3NC8A 2XK1A 1T1AA 2Z2MB 3V50A 2Z6CA 3LR4A 3LYXA 1XP4A 5L2FA 4PMAA 2OAP1 2HPBA 4WEJA 5AVEA 1PNEA 4DF6A 2DRWA 4E3KA 1QMFA 2R78A 5E2FA 2E8IA 5DFXA 3IXHA 1SHVA 3PBRA 3E4PA 5CECA 3F1NB 3RTYA 3GQZA 1KGGA 2A2LA 4EBNA 2WAEA 2KLIA 1OTAA 4WMCD 3TW8A 4B93A 5CHMA 3NI9A 4IBRA 3UO9A 4NEED 5HAIA 1UWPX 4PKYA 4WLAA 3NJAA 5HL6A 2VZWA 3ZVWA 1GHIA 5GHYA 5CXWA 3EEHA 4HH2A 4D60A 3MMHA 4BENA 3ZNYA 5AQAA 2WZZA 1FILA 3WRZA 2WUQA 3IXBA 4XT2A 3C7UA 1MXOA 5TJJA 2DNSA 2PD7A 1IYQA 3CAXA 3S7PA 4DMZA 2J3WA 1JTDA 3OCLA 4GN2A 4P87A 3FYZA 4GZBA 4LRXC 2J8YA 2A3UA 4S2PA 2QJ7A 4IUHA 4UA7A 1S0WA 4DE2A 2FFYA 3DTMA 2UWXA 4HQAA 4EEPA 3W4OA 5HZHA 3HUMA 4MBFA 2XLNA 3GV9A 4F94A 1ONHA 2M7UA 2OSUA 3C30A 1GCEA 1BULA 4UAAA 2VK3A 1KGFA 1IYPA 5CEDA 1S1YA 3OPRA 3MQQA 4ZBEA 3T4LA 3E4OA 5EOOA 4JXSA 3AGFA 3T4SA 4WF0A 1WA9A 3ZDJA 4EUVA 3Q07A 1L0EA 4D2OA 2ZLYA 4F3LB 4KQDA 1NYYA 4JXGA 4ETZA 4I38A 3GMWA 3MXSA 1ZKJA 2HJ9C 3HLDA 2H5SA 4JXVA 4GD6A 5HWWA 2FH5A 2HDQA 5HFOA 1YQSA 5KMWA 3N8LA 3T1XA 1Z09A 3N8RA 3V3RA 5A92A 4GKUA 3IF6B 3GDIA 2K31A 4GS9B 1PI4A 5J7EA 3LI9A 2W0NA 4R1GA 3BYDA 3IWIA 2ZJ9A 3GVBA 1FSWA 5GLBA 2VGKA 4GJ4A 1Y54A 4RVAA 4DE0A 2PYPA 2J3TC 5KSCA 2PDRA 2QYBA 1I5QA 1XJ4A 4H8RA 4BL2A 1F9IA 1EI5A 1MPLA 2PU4A 1H0MA 3IWQA 4HP9A 2XFTA 1YKDA 3M2JA 2Y2NA 1EROA 2JKFA 2H0TA 2V1ZA 4LRYC 1FSYA 1SKOB 1YLZA 2OLUA 4CLCD 1IEMA 5HAQA 2XH9A 4YFMA 5CTNA 1VQQA 4HY8A 1LL9A 2V20A 1OMEA 1YLWA 3LO7A 3F1NA 5DTSA 4K0WA 3GSGA 2JKTM 4PM5A 3LFVA 4Q0IA 3A0RA 3IF6C 5FDHA 1JWZA 1IELA 4R4SA 1MZUA 1RP5A 2QJ5A 2ZC5B 2ZBBA 1K38A 1F2KA 2Y2MA 4ZAMA 1VHMA 3MXQA 4EV4A 3HUOA 3SS4A 3DTKA 4WMCA 5GHXA 1T1CA 1BZAA 1RCJA 1NLZA 3FKVA 4H6JB 2WZXA 1TVFA 3OOVA 4X1MA 1TEMA 3O3VA 1BLSA 3UPPA 1LHYA 1M40A 1T18A 3P09A 2XF3A 1W8QA 4LV1A 4HIAA 3QP6A 4P6ZS 4X1LA 3ZCZA 1ES2A 2ACGA 2I9VA 2AVXA 1ALQA 2NUPC 3SS5A 4MBKA 5GL9A 3ISGA 4LLOB 2Y2LA 4S2NC 3G32A 5EV0A 1JTGA 1PWCA 5E43A 1H8MA 3BFFA 2P04A 3C4OA 4L9EA 3EEAA 1HZOA 1PW8A 2O9AA 1DY6A 1E3UA 2EWVA 2Y2QA 2KDKA 3GTCA 1IOUA 1PWDA 3LR5A 4F3LA 4HEFA 2EWWA 3H7WB 5FAPA 2HZ5A 3P01A 1CI8A 4AFIA 1S4SA 1JNUA 1NWZA 4LV0A 2ZQ7A 3K3DA 1OT6A 3MR0A 1Y28A 4M4XA 4JXWA 4U0TA 3DWZA 5DF8A 4MDZA 4E3NA 4EUZA 1N4OA 4HH3A 3CHWP 1XPBA 2ZC7A 3IF6A 2Y2GA 2JE5A 4GS9A 3M6HA 2JKTI 3CUEC 1CEGA 4MMNA 4R70A 3HLGA 3VP1A 3SH7A 3EGDC 3KSFA 4X6TA 3VP2A 1MKIA 3BEBA 5FAOA 5HDCA 4NG2A 4N1HA 1XKZA 5FI6A 3UB6A 5GLAA 2ZC6B 2A49A 3QP4A 1SKOA 4ID4A 1PIOA 4DJ2A 1YMSA 2VV8A 1O07A 4OOYA 4XUXA 1TS6A 3PBSA 3OPPA 3TSGA 2ZQDA 4GOGA 1GHMA 4OPZA 2D02A 2JCHA 2JHEA 3EWKA 1YLPA 3T4QA 3UDIA 2XROA 4DE3A 4MN6A 3Q82A 1YPRA 1ES5A 1VETB 3CLOA 3U4LP 4ETXA 2A24B 5FEFA 2Y2PA 3OBFA 3OCNA 3PAGA 4P6ZM 5FQJA 4MEZA 3ZFZA 4HHDA 2OWJA 4H6JA 2XR0A 1N9OA 3HJIA 2OLVA 1PWGA 1HVBA 2ZM0A 3UE3A 5DKLA 2Q9NA 3ZG8B 3UY6A 3MBZA 2DMWA 3BWLA 3WRTA 2GNXA 4KG6A 4S2MA 2XA7S 2EX2A 3CG5A 2H0YA 4X68A 2GJ3A 3LR0A 4PM6A 3WS5A 3ZHHA 4L9GA 5EVIB 3SW1A 1PW1A 1ONGA 4QPRA 1FCMA 3ZG5A 3TOIA 2BTFP 3MZDA 5A8BA 4JF5A 3MF0A 1P0ZA 3PTEA 3PHYA 3BY8A 3IX3A 4L0LA 3BQ8A 3VOYA 1OTBA 3NOUC 2BASA 4N9KA 4Z9QA 4PM9A 5CGSA 3DW0A 3F1PA 1E25A 4U0XA 5HW3A 4WELA 2PBYA 5MC7A 4JBFA 3H7WA 3VV4A 4X69A 3O87A 1XGJA 3DTEA 3G30A 3VOZA 2ZOHA 4ZDXA 4A5RA 3ICYA 4LV3A 4Y0TA 3UB9A 5K5BA 4U3TA 5EVIC 3G31A 3O88A 1KE3A 4LRZE 1JWVA 5KZHA 3BJNA 5L07A 1G6AA 2EX9A 1I2WA 1PRQA 4Y5FA 3Q7VB 3QP1A 5FI7A 4QJGA 2W3EA 4KZ5A 1XJ2A 4WN5A 4P0MA 2O9CA 3LCEA 3MJQA 4FSFA 3IX8A 3Q7ZA 4I3AA 1W8YA 4GHIA 2I72A 1JWPA 3W2ZA 3GR2A 4R3JA 1XFNA 1FR6A 5EUAA 4WEKA 4OOLA 1FIKA 2ZD8A 5IU1A 4WM9A 2PR6A 3IX4A 4RYEA 5FAQA 4X56A 1G68A 3LY4A 3ZVTA 4I3IA 2IWDA 2G2UA 3SH9A 2WKPA 1KE4A 1VETA 2ZM2A 4DN0A 5AQ7A 1EW0A 2OV5A 4YINA 2V0WA 2Z2LB 4E6WA 2A24A 2J3TD 3QNBA 5EVLA 4JF4A 4BD0A 3C2WA 1MKMA 4OOMA 4QY6A 4LV2A 1E3UD 3ULFA 4O7DA 4KQQA 2WKHA 5FATA 3IH8A 2H28A 5EE8A 4UQIM 3GECA 4DXCA 3LICA 5U47A 5A90A 1U60A 1W63M 2GX5A 3A3EA 1YM1A 4R4RA 1HD8A 3TG9A 3FV7A 4MLLA 1YLJA 4WZ5A 4OLGA 3W8KA 2PD8A 1DP8A 1S1ZA 3HUNA 3M6BA 4NETA 4IHQA 3IHAA 2W3HA 1H8YA 4YNRA 2YKFA 5G18A 5A91A 3E98A 2HV1A 1DP6A 1YSQA 3NBLA 1BSGA 3OC2A 4O0PA 2L1MA 4WL9A 5FDSA 1J9MA 5EVIA 2V2FF 3IS2B 1M6KA 2WKEA 1L0FA 3BM6A 2ZL1B 2G2WA 4YWZA 1TF1A 4I3JA 1DJAA 1TS7A 4QB8A 2LB9A 1K6RA 1Z6FA 2B5RA 1MWRA 4JKTA 3CZDA 3ZNTA 2ZMFA 4O01A 4HJ4A 1J3WA 5G4YA 1PYYA 1LT0A 4Y3IA 2ZQCA 3A3FA 5EFWA 5DVAA 4BJPA 1V9YA 2VKSA 1CEFA 2BLSA 3HVFA 1TS0A 3UPNA 2B95A 4P85A 2HP9A 1F98A 4S2LA 3T1RA 5EPHA 2X01A 3WWXA 2Y91A 5A93A 3C8CA 2HP6A 4Q0HA 4KG2A 2O9BA 1PI5A 4CPKA 3T4OA 1D06A 3TJZC 2Y79A 3FPWA 1FCNA 2JKGA 5L10A 3CWFA 1STZA 2O0YA 4BD1A 4PHTA 4ZJ1A 3Q7VA 2QMIA 3W4QA 3IBRA 1NLYA 4MBHA 5EM1A 5EVEA 3UB7A 1W7FA 4HESA 1TDLA 4EWFA 1GSXA 3OPHA 1WE4A 3UDXA 1K25A 4JF6A 3H82B 1ZG4A 5F69A 5FA7A 4OPRA 3PBTA 4EEUA 3KX0X 2X02A 2XD1A 4R0QA 4RA7A 2KOIA 4B4XA 2PAVP 2ZQAA 3RJUA 4Y0UA 4CJNA 4UA9A 2HDUA 1ES3A 3NOTC 3LGOA 4EETB 4RQ9A 3QP2A 2Z6DA 5C5KA 4NXFA 2VGLS 3LIFA 3WS0A 5E2EA 3UDFA 3T1QB 5E2GA 3LEQA 4ZJ2A 2G7UA 3B33A 5CTMA 4GB7A 2V1AA 2QWSA 2EFXA 2WADA 4G3KA 1G28A 1VM1A 3TE8A 1RGYA 1UGUA 2Y55A 4MN7A 3K3CA 3TRCA 1E4DA 3VOLA 4MCWA 2VV6A 1BTLA 3AGDA 4ARZB 3WS4A 3NY4A 4KZBA 5M1AA 4JGRA 3VP4A 1YAXA 1IKIA 1YSPA 2Y2JA 1K6SA 4ZTKA 2H10A 3S7QA 3RXXA 4OH0A 5HD3A 1C3BA 2EX6A 4OPYA 1MWSA 3MKEA 3T12B 1FR1A 4NKPA 3CITA 1BYWA 3WS2A 2WGIA 4FOFA 2Y8HA 4QY5A 1MY8A 3UE1A 3VSKA 3UPOA 1T1BA 3IS2A 2IWCA 1ZTUA 3OLOA 4R6LA 2ZL1A 2V0UA 3SS3A 5HAPA 3JYIA 2M1CA 5DJUA 4KG5A 3LIBA 1YLYA 1ES4A 5FASA 3A3IA 4XXRA 1KOUA 3G2YA 4QD4A 4JLFA 4BLMA 5M18A 3HLWA 2VEAA 2K2NA 1DJCA 3VFFA 1PZOA 1CQAA 1SDEA 1ERQA 4E04A 3G34A 3VSLA 5HSQA 1A0KA 3IH9A 1OJ5A 3R4KA 5I94A 1P97A 3FWLA 3MSHA 4GD8A 2XQZA 3EOIA 1IYSA 4R3AA 2HDSA 5TR7A 2W3DA 5EECA 3B42A 4Z1WA 3C4PA 4GCZA 4LENA 5CHUA 3BFGA 1I2SA 3HL9A 3SZTA 3S4XA 4ME4A 4EQIA 1KGEA 4OQIA 5J3WA 3A3JA 3PXPA 2HP5A 1VEUB 2Y2KA 3R7WB 4K91A 5F1GA 3ZG0A 4C3QA 4S2NA 3E0YA 4IJGA 4XT2B 4PPRA 3H82A 4BL3A 5HX9A 3BW6A 5AQBA 3CJMA 5CGXA 1JVJA 2V8CA 1K54C 3KYEA 4QU3A 5L8MA 3N7WA 3FPVA 3IF5A 2XEPA 4E3MA 1XFQA 4N92A 3JVUA 2QZ6A 4EXOA 1CJFA 3O86A 5EVID 1DJBA 1GA0A 5HPIA 4EBLA 1W5DA 3OPLA 3UB8A 2VGJA 2WGVA 4HJ3A 2Q9MA 4KZ4A 3T4JA 3G2ZA 5CHJA 3HCYA 4EW7A 4NXEA 3IT9A 3K2NA 3VFHA 1YLTA 4OQ0A 5AVFA 3MZEA 3KYQA 2W1TB 4C75A 3UB5P 2ZOIA 4KUOA 1NXYA 2B18A 1T19A 3T4TA 4E6XA 1PFLA 5FQQA 3CUEA 3DBAA 5AJGA 4ARZA 1XGIA 4JGQA 4Y13A 1S66L 5DFYA 4K0XA 2MJ6A 4Y7PA 4IVIA 2C5WB 1WYBA 2OAQ1 1K4EA 5L09A 1KVMA 1MWUA 4OQGA 2JKRM 4G3VA 3L9KA 1FCOA 1BLHA 1LI9A 3JVVA 1L0GA 4MNRA 2EFUA 2P08A 5LBRA 4KZ7A 4EESA 2QPNA 3H9WA 4HBTA 4RX3A 2P9VB 2PHYA 4DJ3A 4P6BA 3C38A 3E4QA 5EOEA 4PKYG 3MXRA 4BBVA 2J9OA 4X55A 3NHQA 2P7JA 4O8GA 3HLFA 3LI8A 3SH8A 1ODVA 1G6OA 4C6YA 5F68A 3LR3A 2Y2HA 4HJ6A 3RH8B 1LSXA 3S7OA 1NRFA 4WUJA 5GHZA 1K54A 4EU0A 1OTDA 1GA9A 3S1YA 5JYOA 2J9PA 1IKGA 2QKPA 3EGXC 5FQ9A 4PM8A 5CEBA 5F5YA 4G3WA 1Q2QA 2WKIA 5FI2A 3BFDA 5FQMA 5IHVA 4NK3A 1PZPA 3CMZA 2WYXA 1K56A 4Q8IA 3N8SA 4NXGA 4OLDA 3UNWA 2OOLA 4ESPA 2W3FA 3V67A 3BFEA 2VJWA 5DTKA 4BMWA 3V3SA 4KQRA 4EQ1A 5CX7A 2O99A 4Q0JA 3ZGAB 3G35A 3PBNA 3LIDA 1OPXA 3IXDA 1VEUA 2LB5A 3R7WA 3HLBA 1QMEA 3CI6A 5DTTA 2L0WA 4E3LA 2PT7A 5HL1A 3V39A 1MC0A 5HD5A 5TBMB 2J80A 3RFBA 3BRMA 2RCXA 1X0OA 3BY9A 4GLQA 4KZ8A 4Y2FA 2GZAA 4UHUA 1N9BA 1NZUA 2XA7M 3E2LA 4LPZA 1KVLA 3NECA 4OQHA 1ERMA 1XX2A 2XDMA 3PBOA 3PAEA 1XJ3A 2HGVA 3E2KA 3S7NA 2JBFA 3UMDA 1NY0A 2JKRI 2GDNA 4FD8A 3QHYA 1DP9A 1FQGA 1TDGA 4KZ3A 2WAFA 2XRNA 1OTEA 3CPTB 3ITBA 3OZHA 4S2OA 3MS6A 4UEYA 1MBLA 3IWOA 4WBGA 2ZC4B 1W79A 4OVDA 5DKKA 2JC7A 2ZC3B 1S4RA 4B88A 3HLCA 1TS8A 5FEGA 2ZM8A 3C5AA 1SDNA 5E2HA 2M7VA 4E3JA 5JYPA 2W1TA 2W27A 1HLUP 5CRFA 4X25A 3LIEA 4KQOA 3KYZA 4MN5A 3LEZA 5FQKA 1GSVA 4FUWA 1MWTA 5IT5A 5D3OA 1L3LA 3IHBA 3ZG9B 2DCFA 5FQIA 1HTZA 4OP8A 3LIAA 2WGWB 2ZQ9A 4FH2A 2CMNA 4BWIA 4ZJ3A 1DRMA 4CLCE 1LSVA 5TGFA 1KE0A 3MKFA 4WYYA 2P9VA 5G4ZA 2B02A 2EXBA 1G5UA 3Q81A 3G4PA 4BQMA 1ZHHB 4BBTA 3MZFA 3DTIA 5KSHA 2R9XA 3L7HA 1XA1A 2EXAA 3A3DA 4R3BA 1BT5A 5I5LA 1D1JA 3HBRA 5J4EA 2E8JA 1LLBA 1K57C 2Y2OA 3BFCA 1Q2PA 3T4KA 1P9RA 1K55C 3B47A 1LL8A 3W4PA 3LY3A 2ZQ8A 4DE1A 4OPQA 4E3OA 3BQAA 2VV7A 2K7SA 5CERA 4KZ9A 2OWHA 1N9LA 4Y17A 3HJKA 1V9ZA 4CLCB 2EX8A 2W1RA 3PBQA 2RL3A 3BECA 2PRFA 1NZOA 1F5MA 3P98A 3U2AA 3IXGA 3M2KA 4IUKA 4OONA 2Y4AA 4QWOA 4N9LA 3KSHA 2VX8A 3VE4A 4HP4A 2XSSA 3PYPA 1W63Q 2HF6A 4PM7A 1NYMA 2WK0A 5F6AA 5KIZA 1D7EA 5EM0A 2PR5A 1XJ6A 2UV0E 4KUKA 1LI0A 4DRTA 1UWNX 5HWTA 3D4FA 5HWVA 2L4RA 4QHCA 3AGEA 5TBMA 2NUTC 1VB6A 1WYCA 2PU2A 5FL3A 2XD5A 3VP3A 4OP5A 1BLPA 3EQVA 3KSGA 4IVKA 3T1SA 4I39A 2HJEA 4E3IA 4GDBA 2XFSA 4JGPA 4CLCC 2D01A 4S2KA 5DF7A 1YMXA 4RX2A 3BLSA 1LL5A 1ESIA 4Y0OA 3IQAA 3ZQ5A 3JPUA 3NCKA 3CPTA 4Y15A 4ZRRA 4HI4A 1OJGA 1Y4OA 5F1FA 3NDEA 4L9FA 1SKFA 1LSWA 3FZCA 3UE6A 3ZG7B 3F1OB 1KDSA 3ZYTA 3DWKA 3FG8A 3F1PB 5HARA 1K57A 4B9OA 1S6RA 3S22A 5M19A 1SZVA 3KSIA 5FSRA 3T50A 2R9WA 2V8FA 1K55A 4DXBA 1CK3A 4YOFA 1XA7A 3VE3A 1RGZA 1SCWA 3D72A 1OT9A 3WS1A 2ZMVA 2WGWA 4K08A 1ZG6A 1K56D 1S67L 3QP8A 2XGNA 2PBDP 3SOIA 2FFFB 4UA6A 4HOIA 3MFDA 2P74A 2EA9A 5DJTA 4N1XA 5F82A 1GHPA 4IEDA 1ESUA 4S2JA 4JGOA 3O5YA 1L2SA 3FC7A 2FZ0A 1IFQA 1NRJA 2PYRA 4DDSA 3QNCA 4LCLA 3D9YA 4GHIB 3V5MA 4NXBA 5IS1A 4LCMA 4LFUA 3VMAA 2Y2IA 1NJ4A 1K0KA 1TD5A 4EBPA 5HDSA 1ZC2A 3N6IA 3A0SA 4I5SA 2Y59A 3A0VA 3VP0A 3UE0A 4R38A 3KO6A 3MQ0A 4X53A 2VLGA 2J7VA 1AWIA 1ACFA 2VGLM 2VA0A 1N9NA 2V1BA 4KZ6A 4S2IA 4CQHA 2INWA 1H3QA 4IBXA 3D3OA 4XUZA 4DKIA 3N4IA
chains in the Genus database with same CATH topology
4CLCA 1LSXA 4LLOB 3S7OA 2ZMFA 4O01A 4WUJA 4HJ4A 5G4YA 2WKQA 1OTDA 3MFXA 4BBUA 1P9WA 4EU0A 1LT0A 4Y3IA 5EFWA 1H8MA 2QKPA 4BJPA 3EGXC 1V9YA 5F5YA 2VKSA 3EQUA 4G3WA 2P04A 4L9EA 3EEAA 1TS0A 2O9AA 3PR6A 5HPFA 4NXGA 4II7A 1F98A 2KX6A 2EWVA 2OOLA 2W3FA 3V67A 3C8CA 2KDKA 2VJWA 1IOUA 4Q0HA 4BMWA 2O9BA 3LR5A 2W3GA 4EQ1A 3LUQA 5CX7A 4F3LA 2O99A 4Q0JA 4HNBA 2EWWA 3H7WB 3PBNA 3LIDA 1OPXA 3T4OA 1D06A 3TJZC 3P01A 2LB5A 2Y79A 3FPWA 3R7WA 4AFIA 3CI6A 1S4SA 1JNUA 3CWFA 1NWZA 2L0WA 3G6OA 1STZA 2O0YA 5HDDA 3K3DA 1OT6A 4PHTA 3MR0A 1Y28A 4M4XA 2PT7A 1MC0A 4UQIS 5HD5A 2J80A 4MDZA 5TBMB 3RFBA 1X0OA 3BY9A 2YKHA 3IBRA 4GLQA 4HH3A 1NLYA 4Y2FA 2V9AA 4PAUA 2GZAA 3P7NA 4EERA 3UB7A 2JN7A 4GS9A 2XA7M 1GSXA 2JKTI 4LPZA 3CUEC 4MMNA 3H82B 4R70A 5F69A 3PBOA 3PBTA 1XJ3A 4EEUA 3KX0X 2HGVA 3EGDC 3MQOA 3S7NA 4GW9A 3UMDA 3KSFA 3IBJA 2JKRI 3UMEA 2KOIA 1DP9A 2IA2A 2XRNA 5HDCA 1OTEA 2WKRA 2QHKA 4UEYA 3NOTC 4EETB 3UB6A 3F1OA 1GSWA 4RQ9A 5DKKA 2Z6DA 5C5KA 4NXFA 1S4RA 3NOPC 2VGLS 1OTIA 1TS8A 3LIFA 5DF9A 2M7VA 1T1AA 4DJ2A 2VV8A 2Z6CA 2W1TA 3LR4A 3LYXA 2W27A 1TS6A 3LIEA 3PBSA 4KQOA 2OAP1 3KYZA 4WEJA 5AVEA 4MN5A 2G7UA 3B33A 2D02A 2V1AA 2QWSA 1GSVA 4G3KA 2R78A 2JHEA 1G28A 3TE8A 5IT5A 3EWKA 3T4QA 5DFXA 2XROA 1UGUA 4MN7A 3TRCA 3K3CA 4MN6A 3VOLA 3CLOA 3PBRA 4MCWA 2VV6A 3E4PA 3F1NB 4ETXA 4ARZB 3RTYA 2A24B 2A2LA 3LIAA 2KLIA 1OTAA 3TW8A 4B93A 3OBFA 2CMNA 3OCNA 4JGRA 4BWIA 4NEED 1YAXA 1YSPA 4P6ZM 1DRMA 1UWPX 4PKYA 4CLCE 3S7QA 1LSVA 4HHDA 5HD3A 2OWJA 4WLAA 3NJAA 4H6JA 5HL6A 2VZWA 1N9OA 3HJIA 5G4ZA 2B02A 4NKPA 3CITA 3EEHA 4HH2A 1BYWA 1ZHHB 4BBTA 5KSHA 3UE3A 3MMHA 5DKLA 4FOFA 2Y8HA 2DMWA 3BWLA 2GNXA 5I5LA 3IS2A 1T1BA 2XA7S 1ZTUA 3OLOA 4R6LA 5J4EA 4XT2A 2V0UA 5TJJA 2M1CA 2GJ3A 5DJUA 2PD7A 3CAXA 3LR0A 3LIBA 3S7PA 4DMZA 3T4KA 4L9GA 1P9RA 2J3WA 3B47A 3OCLA 3SW1A 1KOUA 1LL8A 4LRXC 4QPRA 2QJ7A 3BQAA 4IUHA 2VV7A 2VEAA 2K2NA 2K7SA 2OWHA 5A8BA 1N9LA 3HJKA 1V9ZA 4HQAA 3MF0A 1P0ZA 4CLCB 4E04A 2W1RA 3PBQA 4EEPA 5HZHA 3PHYA 3BY8A 4L0LA 3BQ8A 1F5MA 1OTBA 5HSQA 3U2AA 4IUKA 3NOUC 2M7UA 1OJ5A 3R4KA 1P97A 2BASA 3KSHA 3C30A 2VX8A 3VE4A 4HP4A 2XSSA 3PYPA 1W63Q 2HF6A 3EOIA 3F1PA 4R3AA 5F6AA 5KIZA 1D7EA 2W3DA 1S1YA 4WELA 2PR5A 1XJ6A 3B42A 5MC7A 4KUKA 3H7WA 3MQQA 4GCZA 4Z1WA 3VV4A 3T4LA 3E4OA 1UWNX 5HWTA 3T4SA 4WF0A 1WA9A 5HWVA 4EUVA 2ZOHA 2L4RA 3ICYA 4ME4A 5TBMA 2NUTC 5J3WA 4F3LB 1VB6A 4KQDA 3UB9A 3PXPA 5K5BA 5FL3A 4LRZE 3R7WB 4ETZA 3BJNA 4I38A 2HJ9C 3E0YA 3EQVA 4Y5FA 3KSGA 5HWWA 4IJGA 2FH5A 4XT2B 3H82A 4I39A 2HJEA 3BW6A 4JGPA 4CLCC 2W3EA 1XJ2A 2D01A 4WN5A 3GDIA 2K31A 4GS9B 2O9CA 5J7EA 3MJQA 5L8MA 4FSFA 3LI9A 2W0NA 3ZQ5A 3FPVA 4ZRRA 4I3AA 4GJ4A 4GHIA 4HI4A 1XFQA 1OJGA 3JVUA 2PYPA 3W2ZA 2J3TC 2PDRA 2QYBA 4EXOA 1XFNA 1XJ4A 4WEKA 1F9IA 4OOLA 5HPIA 4L9FA 3UB8A 5IU1A 4HJ3A 2PR6A 4HP9A 3T4JA 1LSWA 1YKDA 3UE6A 3F1OB 3ZYTA 3HCYA 4EW7A 4NXEA 3FG8A 3F1PB 4LRYC 3K2NA 4CLCD 4B9OA 5AVFA 3KYQA 4I3IA 2W1TB 3KSIA 3T50A 2ZOIA 4KUOA 4HY8A 2B18A 2WKPA 4DN0A 4YOFA 1EW0A 1T19A 3T4TA 3F1NA 3CUEA 3DBAA 2V0WA 3VE3A 3D72A 1OT9A 5AJGA 4ARZA 4JGQA 2ZMVA 2A24A 2J3TD 2JKTM 4K08A 1S66L 5DFYA 3LFVA 1S67L 4Q0IA 2MJ6A 3A0RA 3C2WA 1MKMA 4OOMA 1MZUA 2OAQ1 4HOIA 3ULFA 2EA9A 5DJTA 2QJ5A 2JKRM 4G3VA 2H28A 4UQIM 2ZBBA 3GECA 3JVVA 3LICA 1W63M 2GX5A 3O5YA 4JGOA 1VHMA 3MXQA 3FC7A 2FZ0A 2P08A 1IFQA 1T1CA 2PD8A 1NRJA 1DP8A 1S1ZA 2PYRA 5LBRA 1NLZA 4IHQA 4EESA 3H9WA 2W3HA 4H6JB 4YNRA 2YKFA 4GHIB 4NXBA 3OOVA 5IS1A 3E98A 2HV1A 1DP6A 1YSQA 2PHYA 4DJ3A 3OC2A 1TD5A 1T18A 4O0PA 3C38A 2L1MA 3E4QA 4PKYG 5HDSA 4WL9A 4BBVA 3A0SA 4HIAA 4I5SA 4P6ZS 3A0VA 3IS2B 3NHQA 2I9VA 2P7JA 4O8GA 4R38A 3LI8A 3KO6A 3MQ0A 4YWZA 2VLGA 1TF1A 1ODVA 2VGLM 4I3JA 2VA0A 2NUPC 1G6OA 1N9NA 2V1BA 1TS7A 4CQHA 2INWA 5F68A 2LB9A 3LR3A 1H3QA 4HJ6A 3D3OA 3RH8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LSX A;  4LLO B;  4WUJ A;  4BBU A;  4HJ4 A;  2WKQ A;  1OTD A;  3MFX A;  5G4Y A;  1LT0 A;  5EFW A;  2QKP A;  1V9Y A;  5F5Y A;  4L9E A;  1TS0 A;  4NXG A;  1F98 A;  2KX6 A;  2OOL A;  3C8C A;  2KDK A;  4EQ1 A;  3LUQ A;  4F3L A;  4HNB A;  3H7W B;  3LID A;  1D06 A;  1S4S A;  1JNU A;  3CWF A;  1NWZ A;  2L0W A;  3G6O A;  5HDD A;  3K3D A;  1OT6 A;  3MR0 A;  1Y28 A;  4M4X A;  5HD5 A;  5TBM B;  2J80 A;  1X0O A;  3BY9 A;  2YKH A;  3IBR A;  4HH3 A;  2V9A A;  3P7N A;  4EER A;  3UB7 A;  2JN7 A;  4GS9 A;  1GSX A;  4LPZ A;  3H82 B;  4R70 A;  5F69 A;  1XJ3 A;  4EEU A;  3KX0 X;  3MQO A;  4GW9 A;  3UMD A;  3UME A;  1DP9 A;  5HDC A;  1OTE A;  2WKR A;  2QHK A;  3NOT C;  4EET B;  3UB6 A;  3F1O A;  1GSW A;  4RQ9 A;  5DKK A;  2Z6D A;  4NXF A;  1S4R A;  3NOP C;  1OTI A;  1TS8 A;  3LIF A;  1T1A A;  4DJ2 A;  2VV8 A;  2Z6C A;  3LYX A;  2W27 A;  1TS6 A;  3LIE A;  5AVE A;  4MN5 A;  3B33 A;  2D02 A;  2V1A A;  2QWS A;  1GSV A;  2R78 A;  2JHE A;  1G28 A;  3EWK A;  1UGU A;  3K3C A;  4MN6 A;  3VOL A;  3CLO A;  2VV6 A;  3E4P A;  3F1N B;  3RTY A;  2A24 B;  3LIA A;  1OTA A;  2CMN A;  4JGR A;  1DRM A;  1UWP X;  4PKY A;  1LSV A;  4HHD A;  5HD3 A;  2OWJ A;  4WLA A;  3NJA A;  4H6J A;  1N9O A;  3HJI A;  5G4Z A;  2B02 A;  3EEH A;  4HH2 A;  1BYW A;  4BBT A;  5DKL A;  3BWL A;  5I5L A;  1T1B A;  3IS2 A;  3OLO A;  4R6L A;  5J4E A;  4XT2 A;  2V0U A;  2M1C A;  5DJU A;  2GJ3 A;  2PD7 A;  3CAX A;  3LIB A;  4L9G A;  3SW1 A;  1KOU A;  1LL8 A;  4LRX C;  2QJ7 A;  2VV7 A;  2VEA A;  2K7S A;  2OWH A;  5A8B A;  1N9L A;  3HJK A;  1V9Z A;  4HQA A;  1P0Z A;  4E04 A;  4EEP A;  5HZH A;  3PHY A;  3BY8 A;  1OTB A;  5HSQ A;  3NOU C;  1OJ5 A;  1P97 A;  2BAS A;  3VE4 A;  4HP4 A;  3PYP A;  3F1P A;  4R3A A;  5F6A A;  5KIZ A;  1D7E A;  1S1Y A;  2PR5 A;  1XJ6 A;  4KUK A;  3H7W A;  3MQQ A;  4GCZ A;  3E4O A;  1UWN X;  5HWT A;  4WF0 A;  1WA9 A;  5HWV A;  2ZOH A;  2L4R A;  3ICY A;  5TBM A;  5J3W A;  4F3L B;  1VB6 A;  4KQD A;  3UB9 A;  4LRZ E;  4I38 A;  5HWW A;  4XT2 B;  3H82 A;  4I39 A;  4JGP A;  1XJ2 A;  2D01 A;  4WN5 A;  3GDI A;  4GS9 B;  5J7E A;  3MJQ A;  3LI9 A;  2W0N A;  3ZQ5 A;  4I3A A;  4GHI A;  4HI4 A;  1XFQ A;  1OJG A;  2PYP A;  2PDR A;  4EXO A;  1XFN A;  1XJ4 A;  1F9I A;  4L9F A;  3UB8 A;  5IU1 A;  4HJ3 A;  2PR6 A;  4HP9 A;  1LSW A;  3UE6 A;  3F1O B;  4EW7 A;  4NXE A;  3FG8 A;  3F1P B;  4LRY C;  4B9O A;  5AVF A;  4I3I A;  3T50 A;  2ZOI A;  4KUO A;  4HY8 A;  2WKP A;  1EW0 A;  1T19 A;  3F1N A;  3VE3 A;  2V0W A;  3D72 A;  1OT9 A;  4JGQ A;  2A24 A;  4K08 A;  1S66 L;  1S67 L;  3A0R A;  3C2W A;  1MZU A;  4HOI A;  3ULF A;  2EA9 A;  5DJT A;  2QJ5 A;  2H28 A;  2ZBB A;  3GEC A;  3LIC A;  4JGO A;  3MXQ A;  3FC7 A;  1T1C A;  2PD8 A;  1DP8 A;  1S1Z A;  2PYR A;  4EES A;  3H9W A;  4H6J B;  2YKF A;  4GHI B;  4NXB A;  5IS1 A;  2HV1 A;  1DP6 A;  2PHY A;  4DJ3 A;  1T18 A;  2L1M A;  3E4Q A;  4PKY G;  5HDS A;  4WL9 A;  4BBV A;  3A0S A;  4HIA A;  4I5S A;  3A0V A;  3IS2 B;  3NHQ A;  2I9V A;  2P7J A;  4R38 A;  3LI8 A;  4YWZ A;  2VLG A;  1ODV A;  4I3J A;  1N9N A;  2V1B A;  1TS7 A;  2INW A;  5F68 A;  4HJ6 A;  3RH8 B; 
#chains in the Genus database with same CATH topology
 4CLC A;  3FKW A;  4BBU A;  2WKQ A;  3MFX A;  5BOH A;  1P9W A;  5GLD A;  1H8Z A;  5F83 A;  3BLM A;  1IYO A;  4KEN B;  3EQU A;  2Q0O A;  4B4Z A;  3UN7 A;  3PR6 A;  5HPF A;  1FOF A;  4II7 A;  2KX6 A;  3NIA A;  4LGW A;  4M3K A;  3QP5 A;  3I7J A;  5AQ9 A;  3C7V A;  5CGW A;  3GRJ A;  5GLC A;  2W3G A;  3LUQ A;  1L0D A;  3NUL A;  4HNB A;  1BUE A;  1XXM A;  3HRE A;  2ZMA A;  4HBU A;  3G6O A;  4WZ4 A;  5HDD A;  1YT4 A;  3B3X A;  2IWB A;  2X71 A;  1CI9 A;  2CC1 A;  4UQI S;  2HDR A;  4FCF A;  4DDY A;  2YKH A;  1KDW A;  2BG1 A;  2V9A A;  4PAU A;  3P7N A;  3DAV A;  4EER A;  4OKP A;  2JN7 A;  3ITA A;  2C6W B;  4KZA A;  4GDN A;  3HLE A;  4JPM A;  1EWZ A;  4GNU A;  3MQO A;  4GW9 A;  1K4F A;  4FTX A;  3IBJ A;  3UME A;  1O7E A;  2IA2 A;  2WKR A;  5J8X A;  2QHK A;  1BLC A;  3RXW A;  3F1O A;  1GSW A;  3NDG A;  4R23 A;  3Q1F A;  4FH4 A;  1AXB A;  1CF0 A;  1H5X A;  4WZ5 C;  5TFQ A;  3NOP C;  1OTI A;  5DF9 A;  3NC8 A;  2XK1 A;  1T1A A;  2Z2M B;  3V50 A;  2Z6C A;  3LR4 A;  3LYX A;  1XP4 A;  5L2F A;  4PMA A;  2OAP 1;  2HPB A;  4WEJ A;  5AVE A;  1PNE A;  4DF6 A;  2DRW A;  4E3K A;  1QMF A;  2R78 A;  5E2F A;  2E8I A;  5DFX A;  3IXH A;  1SHV A;  3PBR A;  3E4P A;  5CEC A;  3F1N B;  3RTY A;  3GQZ A;  1KGG A;  2A2L A;  4EBN A;  2WAE A;  2KLI A;  1OTA A;  4WMC D;  3TW8 A;  4B93 A;  5CHM A;  3NI9 A;  4IBR A;  3UO9 A;  4NEE D;  5HAI A;  1UWP X;  4PKY A;  4WLA A;  3NJA A;  5HL6 A;  2VZW A;  3ZVW A;  1GHI A;  5GHY A;  5CXW A;  3EEH A;  4HH2 A;  4D60 A;  3MMH A;  4BEN A;  3ZNY A;  5AQA A;  2WZZ A;  1FIL A;  3WRZ A;  2WUQ A;  3IXB A;  4XT2 A;  3C7U A;  1MXO A;  5TJJ A;  2DNS A;  2PD7 A;  1IYQ A;  3CAX A;  3S7P A;  4DMZ A;  2J3W A;  1JTD A;  3OCL A;  4GN2 A;  4P87 A;  3FYZ A;  4GZB A;  4LRX C;  2J8Y A;  2A3U A;  4S2P A;  2QJ7 A;  4IUH A;  4UA7 A;  1S0W A;  4DE2 A;  2FFY A;  3DTM A;  2UWX A;  4HQA A;  4EEP A;  3W4O A;  5HZH A;  3HUM A;  4MBF A;  2XLN A;  3GV9 A;  4F94 A;  1ONH A;  2M7U A;  2OSU A;  3C30 A;  1GCE A;  1BUL A;  4UAA A;  2VK3 A;  1KGF A;  1IYP A;  5CED A;  1S1Y A;  3OPR A;  3MQQ A;  4ZBE A;  3T4L A;  3E4O A;  5EOO A;  4JXS A;  3AGF A;  3T4S A;  4WF0 A;  1WA9 A;  3ZDJ A;  4EUV A;  3Q07 A;  1L0E A;  4D2O A;  2ZLY A;  4F3L B;  4KQD A;  1NYY A;  4JXG A;  4ETZ A;  4I38 A;  3GMW A;  3MXS A;  1ZKJ A;  2HJ9 C;  3HLD A;  2H5S A;  4JXV A;  4GD6 A;  5HWW A;  2FH5 A;  2HDQ A;  5HFO A;  1YQS A;  5KMW A;  3N8L A;  3T1X A;  1Z09 A;  3N8R A;  3V3R A;  5A92 A;  4GKU A;  3IF6 B;  3GDI A;  2K31 A;  4GS9 B;  1PI4 A;  5J7E A;  3LI9 A;  2W0N A;  4R1G A;  3BYD A;  3IWI A;  2ZJ9 A;  3GVB A;  1FSW A;  5GLB A;  2VGK A;  4GJ4 A;  1Y54 A;  4RVA A;  4DE0 A;  2PYP A;  2J3T C;  5KSC A;  2PDR A;  2QYB A;  1I5Q A;  1XJ4 A;  4H8R A;  4BL2 A;  1F9I A;  1EI5 A;  1MPL A;  2PU4 A;  1H0M A;  3IWQ A;  4HP9 A;  2XFT A;  1YKD A;  3M2J A;  2Y2N A;  1ERO A;  2JKF A;  2H0T A;  2V1Z A;  4LRY C;  1FSY A;  1SKO B;  1YLZ A;  2OLU A;  4CLC D;  1IEM A;  5HAQ A;  2XH9 A;  4YFM A;  5CTN A;  1VQQ A;  4HY8 A;  1LL9 A;  2V20 A;  1OME A;  1YLW A;  3LO7 A;  3F1N A;  5DTS A;  4K0W A;  3GSG A;  2JKT M;  4PM5 A;  3LFV A;  4Q0I A;  3A0R A;  3IF6 C;  5FDH A;  1JWZ A;  1IEL A;  4R4S A;  1MZU A;  1RP5 A;  2QJ5 A;  2ZC5 B;  2ZBB A;  1K38 A;  1F2K A;  2Y2M A;  4ZAM A;  1VHM A;  3MXQ A;  4EV4 A;  3HUO A;  3SS4 A;  3DTK A;  4WMC A;  5GHX A;  1T1C A;  1BZA A;  1RCJ A;  1NLZ A;  3FKV A;  4H6J B;  2WZX A;  1TVF A;  3OOV A;  4X1M A;  1TEM A;  3O3V A;  1BLS A;  3UPP A;  1LHY A;  1M40 A;  1T18 A;  3P09 A;  2XF3 A;  1W8Q A;  4LV1 A;  4HIA A;  3QP6 A;  4P6Z S;  4X1L A;  3ZCZ A;  1ES2 A;  2ACG A;  2I9V A;  2AVX A;  1ALQ A;  2NUP C;  3SS5 A;  4MBK A;  5GL9 A;  3ISG A;  4LLO B;  2Y2L A;  4S2N C;  3G32 A;  5EV0 A;  1JTG A;  1PWC A;  5E43 A;  1H8M A;  3BFF A;  2P04 A;  3C4O A;  4L9E A;  3EEA A;  1HZO A;  1PW8 A;  2O9A A;  1DY6 A;  1E3U A;  2EWV A;  2Y2Q A;  2KDK A;  3GTC A;  1IOU A;  1PWD A;  3LR5 A;  4F3L A;  4HEF A;  2EWW A;  3H7W B;  5FAP A;  2HZ5 A;  3P01 A;  1CI8 A;  4AFI A;  1S4S A;  1JNU A;  1NWZ A;  4LV0 A;  2ZQ7 A;  3K3D A;  1OT6 A;  3MR0 A;  1Y28 A;  4M4X A;  4JXW A;  4U0T A;  3DWZ A;  5DF8 A;  4MDZ A;  4E3N A;  4EUZ A;  1N4O A;  4HH3 A;  3CHW P;  1XPB A;  2ZC7 A;  3IF6 A;  2Y2G A;  2JE5 A;  4GS9 A;  3M6H A;  2JKT I;  3CUE C;  1CEG A;  4MMN A;  4R70 A;  3HLG A;  3VP1 A;  3SH7 A;  3EGD C;  3KSF A;  4X6T A;  3VP2 A;  1MKI A;  3BEB A;  5FAO A;  5HDC A;  4NG2 A;  4N1H A;  1XKZ A;  5FI6 A;  3UB6 A;  5GLA A;  2ZC6 B;  2A49 A;  3QP4 A;  1SKO A;  4ID4 A;  1PIO A;  4DJ2 A;  1YMS A;  2VV8 A;  1O07 A;  4OOY A;  4XUX A;  1TS6 A;  3PBS A;  3OPP A;  3TSG A;  2ZQD A;  4GOG A;  1GHM A;  4OPZ A;  2D02 A;  2JCH A;  2JHE A;  3EWK A;  1YLP A;  3T4Q A;  3UDI A;  2XRO A;  4DE3 A;  4MN6 A;  3Q82 A;  1YPR A;  1ES5 A;  1VET B;  3CLO A;  3U4L P;  4ETX A;  2A24 B;  5FEF A;  2Y2P A;  3OBF A;  3OCN A;  3PAG A;  4P6Z M;  5FQJ A;  4MEZ A;  3ZFZ A;  4HHD A;  2OWJ A;  4H6J A;  2XR0 A;  1N9O A;  3HJI A;  2OLV A;  1PWG A;  1HVB A;  2ZM0 A;  3UE3 A;  5DKL A;  2Q9N A;  3ZG8 B;  3UY6 A;  3MBZ A;  2DMW A;  3BWL A;  3WRT A;  2GNX A;  4KG6 A;  4S2M A;  2XA7 S;  2EX2 A;  3CG5 A;  2H0Y A;  4X68 A;  2GJ3 A;  3LR0 A;  4PM6 A;  3WS5 A;  3ZHH A;  4L9G A;  5EVI B;  3SW1 A;  1PW1 A;  1ONG A;  4QPR A;  1FCM A;  3ZG5 A;  3TOI A;  2BTF P;  3MZD A;  5A8B A;  4JF5 A;  3MF0 A;  1P0Z A;  3PTE A;  3PHY A;  3BY8 A;  3IX3 A;  4L0L A;  3BQ8 A;  3VOY A;  1OTB A;  3NOU C;  2BAS A;  4N9K A;  4Z9Q A;  4PM9 A;  5CGS A;  3DW0 A;  3F1P A;  1E25 A;  4U0X A;  5HW3 A;  4WEL A;  2PBY A;  5MC7 A;  4JBF A;  3H7W A;  3VV4 A;  4X69 A;  3O87 A;  1XGJ A;  3DTE A;  3G30 A;  3VOZ A;  2ZOH A;  4ZDX A;  4A5R A;  3ICY A;  4LV3 A;  4Y0T A;  3UB9 A;  5K5B A;  4U3T A;  5EVI C;  3G31 A;  3O88 A;  1KE3 A;  4LRZ E;  1JWV A;  5KZH A;  3BJN A;  5L07 A;  1G6A A;  2EX9 A;  1I2W A;  1PRQ A;  4Y5F A;  3Q7V B;  3QP1 A;  5FI7 A;  4QJG A;  2W3E A;  4KZ5 A;  1XJ2 A;  4WN5 A;  4P0M A;  2O9C A;  3LCE A;  3MJQ A;  4FSF A;  3IX8 A;  3Q7Z A;  4I3A A;  1W8Y A;  4GHI A;  2I72 A;  1JWP A;  3W2Z A;  3GR2 A;  4R3J A;  1XFN A;  1FR6 A;  5EUA A;  4WEK A;  4OOL A;  1FIK A;  2ZD8 A;  5IU1 A;  4WM9 A;  2PR6 A;  3IX4 A;  4RYE A;  5FAQ A;  4X56 A;  1G68 A;  3LY4 A;  3ZVT A;  4I3I A;  2IWD A;  2G2U A;  3SH9 A;  2WKP A;  1KE4 A;  1VET A;  2ZM2 A;  4DN0 A;  5AQ7 A;  1EW0 A;  2OV5 A;  4YIN A;  2V0W A;  2Z2L B;  4E6W A;  2A24 A;  2J3T D;  3QNB A;  5EVL A;  4JF4 A;  4BD0 A;  3C2W A;  1MKM A;  4OOM A;  4QY6 A;  4LV2 A;  1E3U D;  3ULF A;  4O7D A;  4KQQ A;  2WKH A;  5FAT A;  3IH8 A;  2H28 A;  5EE8 A;  4UQI M;  3GEC A;  4DXC A;  3LIC A;  5U47 A;  5A90 A;  1U60 A;  1W63 M;  2GX5 A;  3A3E A;  1YM1 A;  4R4R A;  1HD8 A;  3TG9 A;  3FV7 A;  4MLL A;  1YLJ A;  4WZ5 A;  4OLG A;  3W8K A;  2PD8 A;  1DP8 A;  1S1Z A;  3HUN A;  3M6B A;  4NET A;  4IHQ A;  3IHA A;  2W3H A;  1H8Y A;  4YNR A;  2YKF A;  5G18 A;  5A91 A;  3E98 A;  2HV1 A;  1DP6 A;  1YSQ A;  3NBL A;  1BSG A;  3OC2 A;  4O0P A;  2L1M A;  4WL9 A;  5FDS A;  1J9M A;  5EVI A;  2V2F F;  3IS2 B;  1M6K A;  2WKE A;  1L0F A;  3BM6 A;  2ZL1 B;  2G2W A;  4YWZ A;  1TF1 A;  4I3J A;  1DJA A;  1TS7 A;  4QB8 A;  2LB9 A;  1K6R A;  1Z6F A;  2B5R A;  1MWR A;  4JKT A;  3CZD A;  3ZNT A;  2ZMF A;  4O01 A;  4HJ4 A;  1J3W A;  5G4Y A;  1PYY A;  1LT0 A;  4Y3I A;  2ZQC A;  3A3F A;  5EFW A;  5DVA A;  4BJP A;  1V9Y A;  2VKS A;  1CEF A;  2BLS A;  3HVF A;  1TS0 A;  3UPN A;  2B95 A;  4P85 A;  2HP9 A;  1F98 A;  4S2L A;  3T1R A;  5EPH A;  2X01 A;  3WWX A;  2Y91 A;  5A93 A;  3C8C A;  2HP6 A;  4Q0H A;  4KG2 A;  2O9B A;  1PI5 A;  4CPK A;  3T4O A;  1D06 A;  3TJZ C;  2Y79 A;  3FPW A;  1FCN A;  2JKG A;  5L10 A;  3CWF A;  1STZ A;  2O0Y A;  4BD1 A;  4PHT A;  4ZJ1 A;  3Q7V A;  2QMI A;  3W4Q A;  3IBR A;  1NLY A;  4MBH A;  5EM1 A;  5EVE A;  3UB7 A;  1W7F A;  4HES A;  1TDL A;  4EWF A;  1GSX A;  3OPH A;  1WE4 A;  3UDX A;  1K25 A;  4JF6 A;  3H82 B;  1ZG4 A;  5F69 A;  5FA7 A;  4OPR A;  3PBT A;  4EEU A;  3KX0 X;  2X02 A;  2XD1 A;  4R0Q A;  4RA7 A;  2KOI A;  4B4X A;  2PAV P;  2ZQA A;  3RJU A;  4Y0U A;  4CJN A;  4UA9 A;  2HDU A;  1ES3 A;  3NOT C;  3LGO A;  4EET B;  4RQ9 A;  3QP2 A;  2Z6D A;  5C5K A;  4NXF A;  2VGL S;  3LIF A;  3WS0 A;  5E2E A;  3UDF A;  3T1Q B;  5E2G A;  3LEQ A;  4ZJ2 A;  2G7U A;  3B33 A;  5CTM A;  4GB7 A;  2V1A A;  2QWS A;  2EFX A;  2WAD A;  4G3K A;  1G28 A;  1VM1 A;  3TE8 A;  1RGY A;  1UGU A;  2Y55 A;  4MN7 A;  3K3C A;  3TRC A;  1E4D A;  3VOL A;  4MCW A;  2VV6 A;  1BTL A;  3AGD A;  4ARZ B;  3WS4 A;  3NY4 A;  4KZB A;  5M1A A;  4JGR A;  3VP4 A;  1YAX A;  1IKI A;  1YSP A;  2Y2J A;  1K6S A;  4ZTK A;  2H10 A;  3S7Q A;  3RXX A;  4OH0 A;  5HD3 A;  1C3B A;  2EX6 A;  4OPY A;  1MWS A;  3MKE A;  3T12 B;  1FR1 A;  4NKP A;  3CIT A;  1BYW A;  3WS2 A;  2WGI A;  4FOF A;  2Y8H A;  4QY5 A;  1MY8 A;  3UE1 A;  3VSK A;  3UPO A;  1T1B A;  3IS2 A;  2IWC A;  1ZTU A;  3OLO A;  4R6L A;  2ZL1 A;  2V0U A;  3SS3 A;  5HAP A;  3JYI A;  2M1C A;  5DJU A;  4KG5 A;  3LIB A;  1YLY A;  1ES4 A;  5FAS A;  3A3I A;  4XXR A;  1KOU A;  3G2Y A;  4QD4 A;  4JLF A;  4BLM A;  5M18 A;  3HLW A;  2VEA A;  2K2N A;  1DJC A;  3VFF A;  1PZO A;  1CQA A;  1SDE A;  1ERQ A;  4E04 A;  3G34 A;  3VSL A;  5HSQ A;  1A0K A;  3IH9 A;  1OJ5 A;  3R4K A;  5I94 A;  1P97 A;  3FWL A;  3MSH A;  4GD8 A;  2XQZ A;  3EOI A;  1IYS A;  4R3A A;  2HDS A;  5TR7 A;  2W3D A;  5EEC A;  3B42 A;  4Z1W A;  3C4P A;  4GCZ A;  4LEN A;  5CHU A;  3BFG A;  1I2S A;  3HL9 A;  3SZT A;  3S4X A;  4ME4 A;  4EQI A;  1KGE A;  4OQI A;  5J3W A;  3A3J A;  3PXP A;  2HP5 A;  1VEU B;  2Y2K A;  3R7W B;  4K91 A;  5F1G A;  3ZG0 A;  4C3Q A;  4S2N A;  3E0Y A;  4IJG A;  4XT2 B;  4PPR A;  3H82 A;  4BL3 A;  5HX9 A;  3BW6 A;  5AQB A;  3CJM A;  5CGX A;  1JVJ A;  2V8C A;  1K54 C;  3KYE A;  4QU3 A;  5L8M A;  3N7W A;  3FPV A;  3IF5 A;  2XEP A;  4E3M A;  1XFQ A;  4N92 A;  3JVU A;  2QZ6 A;  4EXO A;  1CJF A;  3O86 A;  5EVI D;  1DJB A;  1GA0 A;  5HPI A;  4EBL A;  1W5D A;  3OPL A;  3UB8 A;  2VGJ A;  2WGV A;  4HJ3 A;  2Q9M A;  4KZ4 A;  3T4J A;  3G2Z A;  5CHJ A;  3HCY A;  4EW7 A;  4NXE A;  3IT9 A;  3K2N A;  3VFH A;  1YLT A;  4OQ0 A;  5AVF A;  3MZE A;  3KYQ A;  2W1T B;  4C75 A;  3UB5 P;  2ZOI A;  4KUO A;  1NXY A;  2B18 A;  1T19 A;  3T4T A;  4E6X A;  1PFL A;  5FQQ A;  3CUE A;  3DBA A;  5AJG A;  4ARZ A;  1XGI A;  4JGQ A;  4Y13 A;  1S66 L;  5DFY A;  4K0X A;  2MJ6 A;  4Y7P A;  4IVI A;  2C5W B;  1WYB A;  2OAQ 1;  1K4E A;  5L09 A;  1KVM A;  1MWU A;  4OQG A;  2JKR M;  4G3V A;  3L9K A;  1FCO A;  1BLH A;  1LI9 A;  3JVV A;  1L0G A;  4MNR A;  2EFU A;  2P08 A;  5LBR A;  4KZ7 A;  4EES A;  2QPN A;  3H9W A;  4HBT A;  4RX3 A;  2P9V B;  2PHY A;  4DJ3 A;  4P6B A;  3C38 A;  3E4Q A;  5EOE A;  4PKY G;  3MXR A;  4BBV A;  2J9O A;  4X55 A;  3NHQ A;  2P7J A;  4O8G A;  3HLF A;  3LI8 A;  3SH8 A;  1ODV A;  1G6O A;  4C6Y A;  5F68 A;  3LR3 A;  2Y2H A;  4HJ6 A;  3RH8 B;  1LSX A;  3S7O A;  1NRF A;  4WUJ A;  5GHZ A;  1K54 A;  4EU0 A;  1OTD A;  1GA9 A;  3S1Y A;  5JYO A;  2J9P A;  1IKG A;  2QKP A;  3EGX C;  5FQ9 A;  4PM8 A;  5CEB A;  5F5Y A;  4G3W A;  1Q2Q A;  2WKI A;  5FI2 A;  3BFD A;  5FQM A;  5IHV A;  4NK3 A;  1PZP A;  3CMZ A;  2WYX A;  1K56 A;  4Q8I A;  3N8S A;  4NXG A;  4OLD A;  3UNW A;  2OOL A;  4ESP A;  2W3F A;  3V67 A;  3BFE A;  2VJW A;  5DTK A;  4BMW A;  3V3S A;  4KQR A;  4EQ1 A;  5CX7 A;  2O99 A;  4Q0J A;  3ZGA B;  3G35 A;  3PBN A;  3LID A;  1OPX A;  3IXD A;  1VEU A;  2LB5 A;  3R7W A;  3HLB A;  1QME A;  3CI6 A;  5DTT A;  2L0W A;  4E3L A;  2PT7 A;  5HL1 A;  3V39 A;  1MC0 A;  5HD5 A;  5TBM B;  2J80 A;  3RFB A;  3BRM A;  2RCX A;  1X0O A;  3BY9 A;  4GLQ A;  4KZ8 A;  4Y2F A;  2GZA A;  4UHU A;  1N9B A;  1NZU A;  2XA7 M;  3E2L A;  4LPZ A;  1KVL A;  3NEC A;  4OQH A;  1ERM A;  1XX2 A;  2XDM A;  3PBO A;  3PAE A;  1XJ3 A;  2HGV A;  3E2K A;  3S7N A;  2JBF A;  3UMD A;  1NY0 A;  2JKR I;  2GDN A;  4FD8 A;  3QHY A;  1DP9 A;  1FQG A;  1TDG A;  4KZ3 A;  2WAF A;  2XRN A;  1OTE A;  3CPT B;  3ITB A;  3OZH A;  4S2O A;  3MS6 A;  4UEY A;  1MBL A;  3IWO A;  4WBG A;  2ZC4 B;  1W79 A;  4OVD A;  5DKK A;  2JC7 A;  2ZC3 B;  1S4R A;  4B88 A;  3HLC A;  1TS8 A;  5FEG A;  2ZM8 A;  3C5A A;  1SDN A;  5E2H A;  2M7V A;  4E3J A;  5JYP A;  2W1T A;  2W27 A;  1HLU P;  5CRF A;  4X25 A;  3LIE A;  4KQO A;  3KYZ A;  4MN5 A;  3LEZ A;  5FQK A;  1GSV A;  4FUW A;  1MWT A;  5IT5 A;  5D3O A;  1L3L A;  3IHB A;  3ZG9 B;  2DCF A;  5FQI A;  1HTZ A;  4OP8 A;  3LIA A;  2WGW B;  2ZQ9 A;  4FH2 A;  2CMN A;  4BWI A;  4ZJ3 A;  1DRM A;  4CLC E;  1LSV A;  5TGF A;  1KE0 A;  3MKF A;  4WYY A;  2P9V A;  5G4Z A;  2B02 A;  2EXB A;  1G5U A;  3Q81 A;  3G4P A;  4BQM A;  1ZHH B;  4BBT A;  3MZF A;  3DTI A;  5KSH A;  2R9X A;  3L7H A;  1XA1 A;  2EXA A;  3A3D A;  4R3B A;  1BT5 A;  5I5L A;  1D1J A;  3HBR A;  5J4E A;  2E8J A;  1LLB A;  1K57 C;  2Y2O A;  3BFC A;  1Q2P A;  3T4K A;  1P9R A;  1K55 C;  3B47 A;  1LL8 A;  3W4P A;  3LY3 A;  2ZQ8 A;  4DE1 A;  4OPQ A;  4E3O A;  3BQA A;  2VV7 A;  2K7S A;  5CER A;  4KZ9 A;  2OWH A;  1N9L A;  4Y17 A;  3HJK A;  1V9Z A;  4CLC B;  2EX8 A;  2W1R A;  3PBQ A;  2RL3 A;  3BEC A;  2PRF A;  1NZO A;  1F5M A;  3P98 A;  3U2A A;  3IXG A;  3M2K A;  4IUK A;  4OON A;  2Y4A A;  4QWO A;  4N9L A;  3KSH A;  2VX8 A;  3VE4 A;  4HP4 A;  2XSS A;  3PYP A;  1W63 Q;  2HF6 A;  4PM7 A;  1NYM A;  2WK0 A;  5F6A A;  5KIZ A;  1D7E A;  5EM0 A;  2PR5 A;  1XJ6 A;  2UV0 E;  4KUK A;  1LI0 A;  4DRT A;  1UWN X;  5HWT A;  3D4F A;  5HWV A;  2L4R A;  4QHC A;  3AGE A;  5TBM A;  2NUT C;  1VB6 A;  1WYC A;  2PU2 A;  5FL3 A;  2XD5 A;  3VP3 A;  4OP5 A;  1BLP A;  3EQV A;  3KSG A;  4IVK A;  3T1S A;  4I39 A;  2HJE A;  4E3I A;  4GDB A;  2XFS A;  4JGP A;  4CLC C;  2D01 A;  4S2K A;  5DF7 A;  1YMX A;  4RX2 A;  3BLS A;  1LL5 A;  1ESI A;  4Y0O A;  3IQA A;  3ZQ5 A;  3JPU A;  3NCK A;  3CPT A;  4Y15 A;  4ZRR A;  4HI4 A;  1OJG A;  1Y4O A;  5F1F A;  3NDE A;  4L9F A;  1SKF A;  1LSW A;  3FZC A;  3UE6 A;  3ZG7 B;  3F1O B;  1KDS A;  3ZYT A;  3DWK A;  3FG8 A;  3F1P B;  5HAR A;  1K57 A;  4B9O A;  1S6R A;  3S22 A;  5M19 A;  1SZV A;  3KSI A;  5FSR A;  3T50 A;  2R9W A;  2V8F A;  1K55 A;  4DXB A;  1CK3 A;  4YOF A;  1XA7 A;  3VE3 A;  1RGZ A;  1SCW A;  3D72 A;  1OT9 A;  3WS1 A;  2ZMV A;  2WGW A;  4K08 A;  1ZG6 A;  1K56 D;  1S67 L;  3QP8 A;  2XGN A;  2PBD P;  3SOI A;  2FFF B;  4UA6 A;  4HOI A;  3MFD A;  2P74 A;  2EA9 A;  5DJT A;  4N1X A;  5F82 A;  1GHP A;  4IED A;  1ESU A;  4S2J A;  4JGO A;  3O5Y A;  1L2S A;  3FC7 A;  2FZ0 A;  1IFQ A;  1NRJ A;  2PYR A;  4DDS A;  3QNC A;  4LCL A;  3D9Y A;  4GHI B;  3V5M A;  4NXB A;  5IS1 A;  4LCM A;  4LFU A;  3VMA A;  2Y2I A;  1NJ4 A;  1K0K A;  1TD5 A;  4EBP A;  5HDS A;  1ZC2 A;  3N6I A;  3A0S A;  4I5S A;  2Y59 A;  3A0V A;  3VP0 A;  3UE0 A;  4R38 A;  3KO6 A;  3MQ0 A;  4X53 A;  2VLG A;  2J7V A;  1AWI A;  1ACF A;  2VGL M;  2VA0 A;  1N9N A;  2V1B A;  4KZ6 A;  4S2I A;  4CQH A;  2INW A;  1H3Q A;  4IBX A;  3D3O A;  4XUZ A;  4DKI A;  3N4I A; 
#chains in the Genus database with same CATH homology
 4CLC A;  1LSX A;  4LLO B;  3S7O A;  2ZMF A;  4O01 A;  4WUJ A;  4HJ4 A;  5G4Y A;  2WKQ A;  1OTD A;  3MFX A;  4BBU A;  1P9W A;  4EU0 A;  1LT0 A;  4Y3I A;  5EFW A;  1H8M A;  2QKP A;  4BJP A;  3EGX C;  1V9Y A;  5F5Y A;  2VKS A;  3EQU A;  4G3W A;  2P04 A;  4L9E A;  3EEA A;  1TS0 A;  2O9A A;  3PR6 A;  5HPF A;  4NXG A;  4II7 A;  1F98 A;  2KX6 A;  2EWV A;  2OOL A;  2W3F A;  3V67 A;  3C8C A;  2KDK A;  2VJW A;  1IOU A;  4Q0H A;  4BMW A;  2O9B A;  3LR5 A;  2W3G A;  4EQ1 A;  3LUQ A;  5CX7 A;  4F3L A;  2O99 A;  4Q0J A;  4HNB A;  2EWW A;  3H7W B;  3PBN A;  3LID A;  1OPX A;  3T4O A;  1D06 A;  3TJZ C;  3P01 A;  2LB5 A;  2Y79 A;  3FPW A;  3R7W A;  4AFI A;  3CI6 A;  1S4S A;  1JNU A;  3CWF A;  1NWZ A;  2L0W A;  3G6O A;  1STZ A;  2O0Y A;  5HDD A;  3K3D A;  1OT6 A;  4PHT A;  3MR0 A;  1Y28 A;  4M4X A;  2PT7 A;  1MC0 A;  4UQI S;  5HD5 A;  2J80 A;  4MDZ A;  5TBM B;  3RFB A;  1X0O A;  3BY9 A;  2YKH A;  3IBR A;  4GLQ A;  4HH3 A;  1NLY A;  4Y2F A;  2V9A A;  4PAU A;  2GZA A;  3P7N A;  4EER A;  3UB7 A;  2JN7 A;  4GS9 A;  2XA7 M;  1GSX A;  2JKT I;  4LPZ A;  3CUE C;  4MMN A;  3H82 B;  4R70 A;  5F69 A;  3PBO A;  3PBT A;  1XJ3 A;  4EEU A;  3KX0 X;  2HGV A;  3EGD C;  3MQO A;  3S7N A;  4GW9 A;  3UMD A;  3KSF A;  3IBJ A;  2JKR I;  3UME A;  2KOI A;  1DP9 A;  2IA2 A;  2XRN A;  5HDC A;  1OTE A;  2WKR A;  2QHK A;  4UEY A;  3NOT C;  4EET B;  3UB6 A;  3F1O A;  1GSW A;  4RQ9 A;  5DKK A;  2Z6D A;  5C5K A;  4NXF A;  1S4R A;  3NOP C;  2VGL S;  1OTI A;  1TS8 A;  3LIF A;  5DF9 A;  2M7V A;  1T1A A;  4DJ2 A;  2VV8 A;  2Z6C A;  2W1T A;  3LR4 A;  3LYX A;  2W27 A;  1TS6 A;  3LIE A;  3PBS A;  4KQO A;  2OAP 1;  3KYZ A;  4WEJ A;  5AVE A;  4MN5 A;  2G7U A;  3B33 A;  2D02 A;  2V1A A;  2QWS A;  1GSV A;  4G3K A;  2R78 A;  2JHE A;  1G28 A;  3TE8 A;  5IT5 A;  3EWK A;  3T4Q A;  5DFX A;  2XRO A;  1UGU A;  4MN7 A;  3TRC A;  3K3C A;  4MN6 A;  3VOL A;  3CLO A;  3PBR A;  4MCW A;  2VV6 A;  3E4P A;  3F1N B;  4ETX A;  4ARZ B;  3RTY A;  2A24 B;  2A2L A;  3LIA A;  2KLI A;  1OTA A;  3TW8 A;  4B93 A;  3OBF A;  2CMN A;  3OCN A;  4JGR A;  4BWI A;  4NEE D;  1YAX A;  1YSP A;  4P6Z M;  1DRM A;  1UWP X;  4PKY A;  4CLC E;  3S7Q A;  1LSV A;  4HHD A;  5HD3 A;  2OWJ A;  4WLA A;  3NJA A;  4H6J A;  5HL6 A;  2VZW A;  1N9O A;  3HJI A;  5G4Z A;  2B02 A;  4NKP A;  3CIT A;  3EEH A;  4HH2 A;  1BYW A;  1ZHH B;  4BBT A;  5KSH A;  3UE3 A;  3MMH A;  5DKL A;  4FOF A;  2Y8H A;  2DMW A;  3BWL A;  2GNX A;  5I5L A;  3IS2 A;  1T1B A;  2XA7 S;  1ZTU A;  3OLO A;  4R6L A;  5J4E A;  4XT2 A;  2V0U A;  5TJJ A;  2M1C A;  2GJ3 A;  5DJU A;  2PD7 A;  3CAX A;  3LR0 A;  3LIB A;  3S7P A;  4DMZ A;  3T4K A;  4L9G A;  1P9R A;  2J3W A;  3B47 A;  3OCL A;  3SW1 A;  1KOU A;  1LL8 A;  4LRX C;  4QPR A;  2QJ7 A;  3BQA A;  4IUH A;  2VV7 A;  2VEA A;  2K2N A;  2K7S A;  2OWH A;  5A8B A;  1N9L A;  3HJK A;  1V9Z A;  4HQA A;  3MF0 A;  1P0Z A;  4CLC B;  4E04 A;  2W1R A;  3PBQ A;  4EEP A;  5HZH A;  3PHY A;  3BY8 A;  4L0L A;  3BQ8 A;  1F5M A;  1OTB A;  5HSQ A;  3U2A A;  4IUK A;  3NOU C;  2M7U A;  1OJ5 A;  3R4K A;  1P97 A;  2BAS A;  3KSH A;  3C30 A;  2VX8 A;  3VE4 A;  4HP4 A;  2XSS A;  3PYP A;  1W63 Q;  2HF6 A;  3EOI A;  3F1P A;  4R3A A;  5F6A A;  5KIZ A;  1D7E A;  2W3D A;  1S1Y A;  4WEL A;  2PR5 A;  1XJ6 A;  3B42 A;  5MC7 A;  4KUK A;  3H7W A;  3MQQ A;  4GCZ A;  4Z1W A;  3VV4 A;  3T4L A;  3E4O A;  1UWN X;  5HWT A;  3T4S A;  4WF0 A;  1WA9 A;  5HWV A;  4EUV A;  2ZOH A;  2L4R A;  3ICY A;  4ME4 A;  5TBM A;  2NUT C;  5J3W A;  4F3L B;  1VB6 A;  4KQD A;  3UB9 A;  3PXP A;  5K5B A;  5FL3 A;  4LRZ E;  3R7W B;  4ETZ A;  3BJN A;  4I38 A;  2HJ9 C;  3E0Y A;  3EQV A;  4Y5F A;  3KSG A;  5HWW A;  4IJG A;  2FH5 A;  4XT2 B;  3H82 A;  4I39 A;  2HJE A;  3BW6 A;  4JGP A;  4CLC C;  2W3E A;  1XJ2 A;  2D01 A;  4WN5 A;  3GDI A;  2K31 A;  4GS9 B;  2O9C A;  5J7E A;  3MJQ A;  5L8M A;  4FSF A;  3LI9 A;  2W0N A;  3ZQ5 A;  3FPV A;  4ZRR A;  4I3A A;  4GJ4 A;  4GHI A;  4HI4 A;  1XFQ A;  1OJG A;  3JVU A;  2PYP A;  3W2Z A;  2J3T C;  2PDR A;  2QYB A;  4EXO A;  1XFN A;  1XJ4 A;  4WEK A;  1F9I A;  4OOL A;  5HPI A;  4L9F A;  3UB8 A;  5IU1 A;  4HJ3 A;  2PR6 A;  4HP9 A;  3T4J A;  1LSW A;  1YKD A;  3UE6 A;  3F1O B;  3ZYT A;  3HCY A;  4EW7 A;  4NXE A;  3FG8 A;  3F1P B;  4LRY C;  3K2N A;  4CLC D;  4B9O A;  5AVF A;  3KYQ A;  4I3I A;  2W1T B;  3KSI A;  3T50 A;  2ZOI A;  4KUO A;  4HY8 A;  2B18 A;  2WKP A;  4DN0 A;  4YOF A;  1EW0 A;  1T19 A;  3T4T A;  3F1N A;  3CUE A;  3DBA A;  2V0W A;  3VE3 A;  3D72 A;  1OT9 A;  5AJG A;  4ARZ A;  4JGQ A;  2ZMV A;  2A24 A;  2J3T D;  2JKT M;  4K08 A;  1S66 L;  5DFY A;  3LFV A;  1S67 L;  4Q0I A;  2MJ6 A;  3A0R A;  3C2W A;  1MKM A;  4OOM A;  1MZU A;  2OAQ 1;  4HOI A;  3ULF A;  2EA9 A;  5DJT A;  2QJ5 A;  2JKR M;  4G3V A;  2H28 A;  4UQI M;  2ZBB A;  3GEC A;  3JVV A;  3LIC A;  1W63 M;  2GX5 A;  3O5Y A;  4JGO A;  1VHM A;  3MXQ A;  3FC7 A;  2FZ0 A;  2P08 A;  1IFQ A;  1T1C A;  2PD8 A;  1NRJ A;  1DP8 A;  1S1Z A;  2PYR A;  5LBR A;  1NLZ A;  4IHQ A;  4EES A;  3H9W A;  2W3H A;  4H6J B;  4YNR A;  2YKF A;  4GHI B;  4NXB A;  3OOV A;  5IS1 A;  3E98 A;  2HV1 A;  1DP6 A;  1YSQ A;  2PHY A;  4DJ3 A;  3OC2 A;  1TD5 A;  1T18 A;  4O0P A;  3C38 A;  2L1M A;  3E4Q A;  4PKY G;  5HDS A;  4WL9 A;  4BBV A;  3A0S A;  4HIA A;  4I5S A;  4P6Z S;  3A0V A;  3IS2 B;  3NHQ A;  2I9V A;  2P7J A;  4O8G A;  4R38 A;  3LI8 A;  3KO6 A;  3MQ0 A;  4YWZ A;  2VLG A;  1TF1 A;  1ODV A;  2VGL M;  4I3J A;  2VA0 A;  2NUP C;  1G6O A;  1N9N A;  2V1B A;  1TS7 A;  4CQH A;  2INW A;  5F68 A;  2LB9 A;  3LR3 A;  1H3Q A;  4HJ6 A;  3D3O A;  3RH8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...