2JC7A

The crystal structure of the carbapenemase oxa-24 reveals new insights into the mechanism of carbapenem-hydrolysis
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
244
structure length
244
Chain Sequence
HISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFKMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE OXA-24
publication title Crystal Structure of the Carbapenemase Oxa-24 Reveals Insights Into the Mechanism of Carbapenem Hydrolysis.
pubmed doi rcsb
source organism Acinetobacter baumannii
total genus 81
structure length 244
sequence length 244
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2006-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2jc7A00
1EI5A 5HW3A 4B4XA 1TVFA 3E2KA 4GKUA 4ZDXA 3IH8A 2Y2NA 2J9PA 1KE0A 5JYPA 5FQKA 1ALQA 5FAPA 3SH7A 3ZG9B 1K56A 2EXAA 1RGZA 3QNBA 2XQZA 1OMEA 2XFSA 4IVKA 4K0WA 3DTMA 5CGSA 4X6TA 1BZAA 3MZFA 2Y2KA 4PM8A 5AQ7A 3SS5A 4FH4A 4ZJ2A 2HP5A 2JCHA 4N1XA 3UE0A 4WELA 3IXDA 4Y0OA 1JWVA 5CHJA 3ZGAB 3M6HA 2ZM2A 3N8LA 2VGKA 4XXRA 4UAAA 5FI6A 5M18A 3ZVWA 1HTZA 2A3UA 3Q7VA 4OLDA 5EVIB 3OPRA 2H5SA 3GV9A 3HUNA 4X53A 3BFFA 4NK3A 4C6YA 1MWSA 4BENA 1ES3A 3EQVA 4N9LA 4IBXA 1FQGA 4A5RA 5KSHA 2XLNA 3Q81A 4LENA 1MPLA 1JTDA 3FWLA 3HUMA 5DTKA 1RGYA 1MWTA 4ZAMA 4OP5A 3ZDJA 1YMSA 5L2FA 4C75A 1Z6FA 1SDEA 3ZG8B 1CI9A 4KG5A 5CHUA 3VOZA 2ZQ9A 5AQBA 1YQSA 3VP3A 5I94A 1NYYA 5DF7A 5FA7A 2XK1A 3O87A 1IEMA 3G31A 3UY6A 3GTCA 2UWXA 5DVAA 1CI8A 3FYZA 2I72A 3UDIA 2Y2HA 1ONGA 1NXYA 4RX2A 3NY4A 3FKWA 3BRMA 2Y2GA 4FH2A 5FAOA 2FFYA 4JXSA 1E3UA 3W4QA 1O07A 3N8SA 3ISGA 5E2EA 1ESIA 5E2FA 4B88A 3M6BA 3ZG0A 2BG1A 2WADA 2IWDA 4N1HA 4R23A 2WK0A 4DDSA 5M19A 2Y2OA 3NC8A 4EBLA 4X55A 4S2NC 4B4ZA 3BEBA 2EXBA 5HFOA 5HAPA 1GHMA 1IYSA 1MWRA 1S6RA 5KMWA 4KG2A 4N92A 3A3DA 2WYXA 4ZTKA 3IF6C 3M2KA 4Y0UA 1MKIA 1CEGA 1M6KA 1YM1A 4PPRA 3MZDA 4PM6A 4EV4A 1QMFA 1K38A 4Z9QA 3WWXA 2JBFA 3TOIA 4S2LA 1C3BA 1MXOA 3ZCZA 4ZJ1A 4CPKA 2Y55A 2H0TA 4F94A 1GA9A 4QY5A 4P87A 3IHAA 4R3BA 3M2JA 3LY3A 1FCOA 4KENB 1PZOA 5HX9A 4OPYA 4P0MA 4LCLA 2XF3A 1U60A 3FKVA 4U0TA 4S2MA 1K6SA 5FI2A 2XD5A 1H5XA 4HBUA 3O3VA 4D2OA 1W7FA 4YINA 1S0WA 4WYYA 4E3JA 5F82A 4WM9A 3IWOA 3IXBA 1BLHA 2Q9MA 3CZDA 1H8YA 5M1AA 4E6XA 1IYPA 2Z2LB 4K0XA 2XDMA 2WGWB 1K4EA 4KG6A 2DCFA 3MKEA 2E8IA 1Q2QA 2Y59A 4S2NA 4MBFA 4DXBA 4HEFA 1L0EA 1PW1A 4QU3A 1JWPA 5FDHA 3CMZA 1BULA 2XGNA 1FSWA 3AGFA 3N4IA 3PBRA 4KZ8A 2HDQA 1GHIA 1K55A 3DWKA 5EVIA 5A93A 5CECA 1JVJA 4DE1A 3LCEA 1ZC2A 1WYBA 4IEDA 4E3IA 3BM6A 3A3EA 2IWBA 3A3JA 2J8YA 5BOHA 1YLPA 1IKIA 2XR0A 3Q82A 1VQQA 3HUOA 4RX3A 1BT5A 3JYIA 3PAEA 3D4FA 2ZD8A 3HLBA 3PTEA 3RXWA 3ZNTA 4FD8A 3MXRA 5D3OA 3B3XA 3QNCA 3G2YA 4EWFA 4UHUA 4OP8A 4E3NA 3IQAA 3OPHA 3S1YA 1PYYA 1ERMA 3GQZA 3HREA 5DTTA 3WS4A 2GDNA 4FSFA 4RYEA 5EPHA 2PBYA 5F83A 3DW0A 3GR2A 4OOYA 2CC1A 3C7VA 4OQIA 4KZ5A 4OVDA 1N4OA 4XUXA 5FQIA 4GN2A 2A49A 2WZZA 3WS2A 5G18A 4GOGA 1KE3A 3HLCA 4N9KA 5KSCA 1YLWA 4OQGA 3ZVTA 3UNWA 5J8XA 4OKPA 3UE1A 1LLBA 1EWZA 2EX2A 3GSGA 4P6BA 3ZFZA 5GLDA 4DXCA 4PMAA 3V3RA 5DTSA 2EFUA 3HLFA 4LV2A 2DRWA 1KVLA 2WAEA 5A90A 2C6WB 1K6RA 4CJNA 5CHMA 3OC2A 4JKTA 4WMCD 5GLCA 2X01A 1ONHA 4RA7A 3ITAA 2Y2MA 2V2FF 4P85A 4KZBA 2Y2PA 2ZMAA 2RL3A 1Y54A 5TGFA 3BFEA 1ES5A 4R1GA 5FQMA 5GL9A 3EQUA 1K4FA 2OLUA 2Z2MB 2Y2LA 1BUEA 2R9XA 2H10A 3A3FA 4X56A 4ZJ3A 3I7JA 3GRJA 5CGWA 1PW8A 4LV1A 3HLGA 3UO9A 4S2OA 2R9WA 2IWCA 5IHVA 3IXHA 4OH0A 5EECA 3OPPA 4BLMA 4JLFA 2P74A 1ESUA 4QY6A 2HDSA 2EX6A 1ZG6A 4ZBEA 2HP6A 1MBLA 3UPPA 1G68A 1HVBA 4S2JA 4WZ4A 1ES2A 4R0QA 3ZG5A 5AQAA 4BL2A 3TSGA 3VP0A 4YFMA 4S2PA 4R3JA 4GDNA 5E2GA 1SDNA 1HD8A 3HLDA 3NDGA 1BLSA 3S4XA 3NI9A 2HP9A 2ZC3B 4JPMA 2PU2A 1K55C 1LL9A 5EVIC 2XFTA 3ZG7B 3NCKA 1XGJA 1PZPA 1M40A 3Q7VB 2BLSA 2WKHA 5A91A 1LHYA 4KZ7A 2Y2QA 4GD8A 1LL5A 1YT4A 1DJBA 1YLZA 3UDFA 4L0LA 2ZQ8A 2XD1A 5E2HA 4GD6A 3VMAA 1L0DA 1PWGA 2Q9NA 3CJMA 3S22A 1PI4A 3W8KA 1HZOA 4S2IA 5CXWA 4OPQA 3ZHHA 5CTNA 4R4SA 1LI9A 3WS1A 3ZNYA 3MXSA 4WEJA 4K91A 1NJ4A 1WE4A 1ES4A 2HPBA 5F1GA 2EX8A 4MEZA 4OQ0A 3G4PA 5U47A 4E3MA 4E3LA 1KVMA 2P9VB 4OPRA 2J7VA 1FR1A 2G2WA 3VSLA 4UA9A 3PBSA 1SHVA 1VM1A 4Y0TA 4BL3A 4DRTA 1O7EA 1K25A 5CERA 4C3QA 2OV5A 1YLJA 1SKFA 1W5DA 1CK3A 3G34A 4UA6A 1Q2PA 1PWDA 2HDRA 4DKIA 1LI0A 1NZOA 5KZHA 4JF4A 2ZM0A 2WGVA 1W79A 4LV0A 3MBZA 3CG5A 4M3KA 2DNSA 5HAQA 2Y91A 2V20A 3Q07A 4PM7A 3WS0A 3C5AA 1YMXA 3IXGA 3BLSA 1QMEA 1MY8A 5CRFA 3VFFA 3N6IA 3GMWA 4KZ6A 4KQQA 1I5QA 5JYOA 5GHXA 2XH9A 3BFGA 2ZC5B 4E3KA 5DF9A 1FOFA 1NZUA 3IWIA 1ZG4A 4OONA 3WRZA 2Y2JA 1IYOA 1BTLA 2ZC7A 1L0GA 3IF5A 4Q8IA 1FCMA 3UE3A 3RXXA 4QD4A 3Q1FA 5TR7A 1XA7A 1KGEA 2OLVA 3MKFA 3PBTA 3SOIA 1K57C 3V3SA 1ZKJA 2EX9A 4GZBA 4OPZA 1SCWA 2QPNA 4JBFA 5FQQA 1XX2A 4BQMA 3PBOA 3WRTA 1XP4A 1XPBA 3PBQA 3QHYA 1PIOA 4MNRA 3W4OA 3AGEA 3N7WA 1KE4A 2Y4AA 1H8ZA 2RCXA 3GVBA 1K56D 2H0YA 4GDBA 5EOEA 5FAQA 1GCEA 4GNUA 1BLPA 2OSUA 4X68A 3SH8A 4KZ4A 3HLWA 2JC7A 2QZ6A 4OOMA 5TFQA 1KDSA 3OZHA 3SS3A 1TDLA 4E3OA 1XA1A 3P98A 4OOLA 3OCLA 3PBNA 2JE5A 4OLGA 4WMCA 4H8RA 2WKEA 2ZQ7A 4GB7A 1JWZA 3NDEA 1L2SA 1YLTA 2V1ZA 3IF6B 3NBLA 1BSGA 4JXWA 4QHCA 4WBGA 1FSYA 4KQOA 1DJCA 2PU4A 1KGFA 5A92A 3P09A 4ID4A 2WUQA 3N8RA 1KDWA 5FQ9A 3LO7A 4Y7PA 3Q7ZA 5FSRA 4X69A 2Y2IA 1K57A 5F1FA 4XUZA 3MFDA 2WKIA 1K54A 2VGJA 3AGDA 2XEPA 4BD0A 2WZXA 1PI5A 1IYQA 1XGIA 4R4RA 5E43A 5EUAA 4DE0A 1E25A 4E6WA 5FQJA 3IH9A 4WZ5C 3VP2A 4DDYA 4LCMA 5FI7A 3V39A 5HL1A 3V5MA 2ZC6B 3BLMA 2WAFA 1MWUA 4EQIA 2WGWA 3HL9A 3SH9A 5EE8A 1N9BA 2P9VA 2J9OA 3G30A 1I2SA 1E4DA 1NY0A 3NIAA 2ZQDA 3VSKA 3LEZA 3WS5A 3DWZA 2EFXA 3IT9A 1FCNA 4HESA 2FFFB 5AQ9A 4WEKA 1KGGA 5FATA 1RP5A 3VP4A 1XXMA 3BFCA 4FCFA 4OQHA 3W4PA 2HDUA 4LV3A 3C7UA 3VP1A 4IVIA 5CEDA 1E3UD 1DJAA 3TG9A 3O88A 4JF6A 3UPOA 3RJUA 4PM9A 1ERQA 1GA0A 3C4OA 1NRFA 4JF5A 1EROA 4EBNA 2ZJ9A 3E2LA 3VOYA 4DE3A 4IBRA 5GHZA 4PM5A 5HARA 1WYCA 1FR6A 4U3TA 4DE2A 3C4PA 4UA7A 2B5RA 5GLBA 1XKZA 2X71A 3V50A 5FASA 3FV7A 1BLCA 4WZ5A 5EOOA 3HBRA 4EBPA 4S2KA 3ITBA 3MZEA 5HAIA 3UPNA 4JXVA 3SS4A 1YLYA 4NETA 5CEBA 5DF8A 1TEMA 5CTMA 3UDXA 1W8YA 2WGIA 3G35A 2ZM8A 1AXBA 1NYMA 4JXGA 1L0FA 4U0XA 5GHYA 3IWQA 2ZC4B 1G6AA 3FZCA 3G32A 2C5WB 3IHBA 4O7DA 1JTGA 4KZ3A 1J9MA 4MBHA 4BJPA 3VFHA 3HVFA 4KQRA 4QB8A 5GLAA 2ZQAA 2ZQCA 3OPLA 2QMIA 3G2ZA 3BFDA 3A3IA 1I2WA 1CEFA 3LY4A 1IKGA 2ZLYA 4HBTA 3PAGA 5EVLA 1RCJA 1GHPA 4MLLA 3BYDA 1W8QA 1TDGA 4EUZA 4KZAA 3IF6A 1IELA 4RVAA 3O86A 4BD1A 3HLEA 4DF6A 5CGXA 5EVID 1DY6A 4QJGA 3OCNA 4KZ9A 2X02A 3UN7A 3BECA 1K54C 4MBKA 1PWCA 2G2UA
chains in the Genus database with same CATH superfamily
5TBMB 4X25A 4B4XA 4ZDXA 3IH8A 2L0WA 4LPZA 2ZMVA 3ZG9B 1K56A 3K3CA 2XFSA 3CUEA 3DTMA 5CGSA 2V8CA 2Y2KA 4PM8A 2W0NA 3UB7A 4FH4A 4N1XA 4BBTA 4NXBA 1G5UA 4WELA 4Y0OA 4MCWA 5CHJA 3ZGAB 3M6HA 2VGKA 1CQAA 1ZHHB 4UAAA 3ZVWA 1HTZA 3S7NA 5EVIB 5EFWA 3GV9A 4X53A 5HZHA 4BENA 3MJQA 5EVEA 1MPLA 3HUMA 2E8JA 1RGYA 3ZDJA 5L2FA 1YAXA 3LR5A 3ZG8B 3VOZA 1YQSA 5I94A 1S4SA 3O87A 3UY6A 1OT9A 2UWXA 3TW8A 2Y2HA 3NY4A 3FKWA 3QP6A 3S7PA 1STZA 2CMNA 2FFYA 4WUJA 2BG1A 4R23A 2Y2OA 4YNRA 1EW0A 5HAPA 3DTIA 3BWLA 1MWRA 1S6RA 2JHEA 4KG2A 5KMWA 2WYXA 4ZTKA 2P04A 2VV6A 4HJ3A 3C8CA 1J3WA 1K38A 3IX4A 4Z9QA 3WWXA 1PNEA 4S2LA 1C3BA 5FEFA 5J7EA 3NOUC 2H0TA 3LY3A 2XF3A 4I5SA 1GSXA 4LFUA 1K6SA 4S2MA 1H5XA 3O3VA 3UMEA 3BJNA 4WM9A 3IWOA 3F1OA 2OOLA 1H8YA 3RFBA 1IYPA 3MKEA 4MBFA 1PW1A 3B42A 1JWPA 3CMZA 2XGNA 1Y28A 2W1RA 3ULFA 4DE1A 2PT7A 3A3EA 3BM6A 2IWBA 5BOHA 4K08A 3NOPC 1IKIA 5EM1A 2PDRA 3R7WA 4P6ZM 1BT5A 3JYIA 4WF0A 3HLBA 4O0PA 3F1PA 4LLOB 3MXRA 3B3XA 3QNCA 4UHUA 4OP8A 4IHQA 4E3NA 3OPHA 1XFNA 1PYYA 3WS4A 3T4OA 4RYEA 5EPHA 4BBUA 2J80A 5F83A 3DW0A 3GR2A 3D9YA 3UE6A 4OQIA 5FQIA 2A49A 4GOGA 3HLCA 5KSCA 1SKOA 2OWJA 4OKPA 2EX2A 4NG2A 4PMAA 5G4YA 3V3RA 3ZYTA 3QP4A 3HLFA 4HOIA 4LV2A 3LFVA 4Y5FA 1K6RA 4WMCD 4JKTA 1ONHA 3MS6A 5IU1A 4KZBA 5AVFA 2ZMAA 5TGFA 1ES5A 2Z2MB 2Y2LA 3HCYA 5DFXA 3UO9A 2R9WA 5EECA 4JLFA 2P74A 1ESUA 4WZ4A 4DJ3A 4HH2A 3ZG5A 3PR6A 4R6LA 4GDNA 3S4XA 1JNUA 3RH8B 1XGJA 1PZPA 2BLSA 4F3LA 5DJUA 2Y2QA 4GD8A 1DJBA 2ZQ8A 3NJAA 2FH5A 3VMAA 2Q9NA 3LEQA 4O8GA 5CXWA 4R4SA 1LI9A 4KQDA 3WS1A 2QHKA 1NJ4A 3DBAA 2EX8A 2P08A 4OQ0A 1KVMA 4Y15A 4OPRA 2J7VA 1H3QA 4BL3A 1YLJA 1DRMA 4UA6A 1NZOA 4PAUA 2ZM0A 2WGVA 1W79A 4LV0A 4M3KA 2DNSA 3S7OA 2ZOHA 3BLSA 4KZ6A 2V8FA 4CLCE 3LI8A 1NZUA 1OPXA 4YOFA 1L0GA 3IF5A 2W3GA 2JKTM 1FCMA 3Q1FA 1XA7A 2PAVP 4OPZA 2AVXA 3PBQA 1PIOA 4MNRA 3W4OA 1VEUB 1KE4A 2Y4AA 2H0YA 4GDBA 5FAQA 3MFXA 1GCEA 2OSUA 3HLWA 2QZ6A 3SS3A 2V1AA 3T4JA 3PBNA 4WMCA 2FZ0A 3MQQA 2OAP1 3H7WB 3K3DA 3NBLA 1FSYA 1HLUP 5A92A 5L09A 1KDWA 4Y7PA 4EEUA 5L8MA 4NEED 2WZXA 1XGIA 4CLCC 3VP2A 3S7QA 4BMWA 5HL1A 3EWKA 1MWUA 1OTDA 3EEAA 2P9VA 1NY0A 3NIAA 5FATA 1UGUA 1NRJA 1XJ6A 4IVIA 5CEDA 1E3UD 2JKFA 1SZVA 2VX8A 4EBNA 2ZJ9A 1D1JA 5GHZA 1H0MA 3CITA 4DE2A 5GLBA 1XKZA 5FASA 4UQIM 3FV7A 4I38A 4EBPA 3KYQA 5HAIA 4JXVA 1YLYA 4NETA 5DF8A 1TEMA 3UDXA 1W8YA 2WGIA 3NECA 4ZRRA 2O0YA 3SW1A 2ZC4B 3CUEC 1VETB 3EOIA 3IHBA 4O7DA 4MBHA 3GDIA 4KQRA 5GLAA 3OPLA 2JKRM 1I2WA 5F68A 3PAGA 4H6JA 5EVLA 4MMNA 3LIEA 4EUZA 4KZAA 3IF6A 3CPTB 3HLEA 5EVID 2I9VA 4NXEA 4MBKA 5GHXA 1EI5A 5HW3A 1GSWA 2VK3A 3CI6A 2J9PA 5FQKA 1ALQA 5FAPA 3SH7A 1RGZA 3PYPA 2XQZA 1OMEA 1ACFA 3QP8A 4GS9B 4X6TA 2J3TC 2VLGA 4ZJ2A 4NXFA 3IXDA 1JWVA 1F2KA 3N8LA 3HJIA 3Q7VA 4OLDA 4NK3A 4LRYC 4N9LA 5KSHA 3Q81A 1MWTA 4ZAMA 5A8BA 2GNXA 1Z6FA 3TE8A 3MQOA 4KG5A 1YSQA 1V9YA 4BWIA 2XK1A 3H82A 4LRXC 3GTCA 3QP1A 5DVAA 2YKFA 4RX2A 4ARZA 2XRNA 3LIAA 3KO6A 1E3UA 3ISGA 5E2EA 3M6BA 1MC0A 2WADA 2IWDA 1H8MA 4EBLA 4X55A 4Z1WA 5CX7A 1GHMA 1MKIA 1CEGA 3LI9A 4GLQA 3MR0A 4R3BA 4P87A 3VV4A 4B9OA 2W3EA 1FCOA 4KENB 1PZOA 5HX9A 4LCLA 3GECA 5FI2A 2XD5A 4HBUA 3F1NA 4PKYA 4D2OA 1W7FA 3IX8A 4HH3A 1S0WA 4WYYA 3IXBA 1BLHA 2Q9MA 2O9BA 1K4EA 2DCFA 3FG8A 1Q2QA 3A0VA 5HL6A 2O9CA 1L0EA 4MN6A 4WLAA 4HY8A 4KZ8A 1GHIA 1K55A 5EVIA 1JVJA 4IEDA 1WYBA 3UB6A 3HUOA 2ACGA 4YWZA 2ZD8A 2K7SA 3U4LP 2Z6CA 3D3OA 4CLCB 1ERMA 5DTTA 2GDNA 2CC1A 4OVDA 4KZ5A 4XUXA 1S66L 1W63M 3KX0X 1YLWA 4OQGA 5J8XA 2QJ5A 1OJ5A 5DKKA 2W3HA 4DXCA 4E04A 1XJ3A 1T1BA 1KVLA 2WAEA 4EEPA 5CHMA 5GLCA 4RA7A 2Y2MA 5DKLA 2Y2PA 4R1GA 5F69A 2HF6A 3EQUA 1K4FA 1OTBA 3MSHA 3KSFA 1LL8A 2O9AA 1YPRA 4X56A 5CGWA 5HDSA 1TS6A 1TS0A 2IWCA 3OPPA 4XT2B 4EUVA 1MBLA 1HVBA 4R0QA 3VP0A 1SDNA 3NDGA 3NI9A 1P0ZA 2ZC3B 4JPMA 2XFTA 5FEGA 5A91A 1PFLA 4X1LA 5K5BA 1LL5A 3UDFA 4EW7A 2XD1A 5HWVA 4GD6A 1PI4A 5HWTA 1S1YA 4S2IA 4OPQA 5CTNA 2JKRI 3MXSA 3DTKA 1ES4A 2HPBA 4KUKA 4MEZA 5U47A 4E3MA 2INWA 2XA7S 5HD5A 1FR1A 2G2WA 4HJ6A 1VM1A 1W5DA 1MKMA 2PRFA 1PWDA 2HDRA 4LGWA 3MBZA 3CG5A 4UEYA 1MZUA 5CRFA 3N6IA 3LR3A 2P7JA 3A0RA 3IWIA 4OONA 2Y2JA 2ZC7A 1BTLA 5C5KA 3VE3A 3PBTA 3SOIA 3LGOA 1TF1A 3BY9A 1VB6A 1ZKJA 1SCWA 3T1SA 2UV0E 3GVBA 4X68A 3SH8A 3F1OB 2L4RA 4KZ4A 5TFQA 4OOMA 1KDSA 2HJ9C 3OZHA 4E3OA 1LSVA 3IBJA 3SZTA 4H8RA 2WKEA 3VE4A 1JWZA 3NDEA 5F6AA 2EWVA 2Y79A 2NUTC 3H9WA 2XSSA 4L9EA 5IS1A 2PU4A 3P09A 5FQ9A 3LO7A 5FSRA 4BBVA 3DAVA 4XUZA 2VGJA 2HV1A 4BD0A 3F1PB 1Z09A 1E25A 3IH9A 1ZTUA 2VGLS 4G3WA 1WA9A 2WGWA 4G3KA 3HL9A 3SH9A 2J9OA 1I2SA 4ETXA 3LEZA 3DWZA 2EFXA 5AQ9A 3VP4A 1RP5A 3W4PA 4OQHA 1SKOB 2HDUA 3C7UA 4MDZA 1DJAA 3O88A 3RJUA 1GA0A 3C4OA 1EROA 3E2LA 4DE3A 5HARA 2BASA 2KOIA 3CWFA 3TJZC 1BLCA 4WZ5A 2W1TB 3HBRA 4S2KA 2JN7A 3ITBA 3MZEA 3UPNA 5CEBA 5CTMA 2ZBBA 1NYMA 4JXGA 5EV0A 1L0FA 4U0XA 5GHYA 1VEUA 1G6AA 3FZCA 3G32A 4EESA 2C5WB 3JVUA 1JTGA 4BJPA 5I5LA 2Z6DA 2ZQAA 2QMIA 5EM0A 3A3IA 3UB8A 3LY4A 2ZLYA 1RCJA 1GHPA 2D02A 3OOVA 4F3LB 2ZL1A 2KLIA 2VZWA 3BECA 1K54C 1TVFA 3E2KA 4GKUA 2IA2A 5TJJA 5JYPA 3CHWP 3E4OA 4CQHA 4IVKA 3LUQA 4GHIA 4K0WA 1S1ZA 3MZFA 3ICYA 5AQ7A 2VV8A 4PKYG 3FPVA 3UE0A 3LR4A 5FI6A 2ZM2A 5M18A 4ESPA 1N9NA 5AVEA 3LR0A 2H5SA 3HUNA 3BFFA 4C6YA 1MWSA 3NOTC 1ES3A 3IS2A 4IBXA 1FQGA 4LENA 2W3FA 1JTDA 3FWLA 4C75A 4JGOA 1SDEA 3E98A 1CI9A 5CHUA 5AQBA 1NYYA 1IEMA 1TD5A 2I72A 3UDIA 4IJGA 1TS7A 5KIZA 2W3DA 4FH2A 4Y2FA 4JXSA 3W4QA 1O07A 3N8SA 1ESIA 5E2FA 3ZG0A 4DDSA 4N1HA 2QYBA 5M19A 1W63Q 3NC8A 4B4ZA 3BEBA 5J3WA 5HPFA 5HFOA 1IYSA 3M2KA 3R4KA 1T1CA 4PPRA 4EV4A 3MZDA 4PM6A 1T18A 2QWSA 5DJTA 2JBFA 3TOIA 2OAQ1 4F94A 1GA9A 1DP8A 4QY5A 2H28A 2B18A 4OPYA 4P0MA 4U0TA 1U60A 5HD3A 4YINA 5F82A 2W27A 3CZDA 5M1AA 2A24A 2ZMFA 4K0XA 2XDMA 1P9WA 2YKHA 4R38A 3LIDA 2Y59A 4S2NA 4DXBA 4HEFA 1BULA 1FSWA 3PBRA 2MJ6A 4R70A 2M7UA 3T4KA 5CECA 3LCEA 1ZC2A 4RQ9A 1LSWA 3PAEA 1X0OA 2NUPC 4EWFA 3G2YA 4MN7A 3IQAA 3W2ZA 2Q0OA 5J4EA 4QPRA 3IX3A 2WKPA 4FSFA 2PBYA 4OOYA 3C7VA 1N4OA 2B02A 3WS2A 1KE3A 2PD8A 3ZVTA 3UE1A 1LLBA 3GSGA 4P6BA 3ZFZA 5GLDA 5DTSA 2EFUA 2Y8HA 2PD7A 2L1MA 4EERA 3OC2A 4H6JB 4WN5A 2PYRA 4I39A 1Y54A 5FQMA 2K2NA 4NXGA 4EQ1A 2R9XA 2H10A 3A3FA 3CAXA 1PW8A 3HLGA 5IHVA 4QY6A 4ZBEA 1ZG6A 2HP6A 3T1QB 3K2NA 1ES2A 2M1CA 3UB5P 5AQAA 4BL2A 3TSGA 3NULA 4S2PA 4R3JA 1BLSA 3T50A 2PU2A 1LL9A 1DP9A 3Q7VB 1M40A 2WKHA 1LHYA 4KZ7A 2V0UA 4L0LA 5TBMA 3E4PA 1UWNX 1L0DA 1PWGA 3CJMA 3W8KA 3ZHHA 1G6OA 3H82B 2VV7A 4K91A 1WE4A 4B93A 5F1GA 4E3LA 2LB9A 4ARZB 3QP5A 2JKTI 4UA9A 3PBSA 1O7EA 1K25A 5CERA 4C3QA 2OV5A 1SKFA 4DKIA 1CK3A 3E4QA 1XJ4A 1Q2PA 4GCZA 1LI0A 4JF4A 4EETB 2HGVA 4AFIA 5MC7A 2V20A 3WS0A 3C5AA 1YMXA 3BQAA 1VHMA 5JYOA 2GZAA 2XH9A 4JGPA 1GSVA 2ZC5B 5DF9A 2DMWA 1ZG4A 4QD4A 5TR7A 3MKFA 3V3SA 2GX5A 3T4QA 2EX9A 2LB5A 2QPNA 3MQ0A 2PR6A 1XX2A 3PBOA 1XP4A 1XPBA 3AGEA 3F1NB 3N7WA 4Q0IA 5L10A 5EOEA 4XT2A 2JC7A 4MN5A 1TDLA 3L7HA 2V1BA 1XA1A 3P98A 4OOLA 3OCLA 4OLGA 3T1RA 3V67A 3BQ8A 4QWOA 4WBGA 4QHCA 1BSGA 4JXWA 3T1XA 1KGFA 2EA9A 2WUQA 1T19A 2ZOIA 4Y3IA 3Q7ZA 4X69A 1K57A 4I3IA 2XA7M 3MFDA 2WKIA 4R3AA 4R4RA 2GJ3A 3HJKA 4DE0A 4E6WA 5FQJA 4WZ5C 4LCMA 5IT5A 3TRCA 5FI7A 1PRQA 3V39A 3BLMA 2WAFA 2QKPA 4EQIA 1N9BA 3NHQA 3WS5A 1E4DA 2ZQDA 3VSKA 3IT9A 1FCNA 1KGGA 2WKRA 3BFCA 4FCFA 4HJ4A 3VP1A 3TG9A 2BTFP 1K0KA 4JF6A 4Q0JA 4PM9A 4ME4A 2VEAA 1NRFA 3FC7A 1WYCA 1FR6A 4U3TA 2HJEA 1NWZA 2X71A 4EXOA 2KDKA 5EOOA 3LIFA 1NLYA 3SS4A 3G35A 1AXBA 1S4RA 4IUKA 3UMDA 1XJ2A 3KYZA 4HI4A 2G7UA 1P9RA 3T4TA 3U2AA 3VFHA 3HVFA 4QB8A 3KSIA 2ZQCA 3BFDA 1CEFA 4HBTA 3BYDA 1TDGA 1D7EA 1YSPA 4RVAA 2VGLM 3OCNA 3UN7A 3G2ZA 3ZNTA 1PWCA 2G2UA 4HP4A 3C38A 3IBRA 3PHYA 2Y2NA 1KE0A 1CF0A 2EXAA 3QNBA 1BYWA 4FUWA 4WL9A 1BZAA 2JKGA 4Y17A 3SS5A 2HP5A 2JCHA 4PHTA 4EU0A 4XXRA 2QJ7A 4FOFA 2A3UA 4L9GA 3OPRA 5DFYA 4LRZE 3EQVA 1OJGA 3R7WB 4A5RA 2XLNA 5DTKA 4OP5A 1YMSA 1F5MA 1IOUA 3B33A 2ZQ9A 4D60A 3VP3A 5G4ZA 5DF7A 5FA7A 3G31A 2W1TA 1CI8A 3FYZA 4P6ZS 5HPIA 1F9IA 4ETZA 1ONGA 1NXYA 3BRMA 3ZQ5A 2Y2GA 5FAOA 4B88A 3C2WA 2WK0A 1S67L 4S2NC 2EXBA 5F5YA 4N92A 3A3DA 4HHDA 1UWPX 3IF6C 4Y0UA 2O99A 3T4SA 1M6KA 1YM1A 1QMFA 3JPUA 3ZCZA 1MXOA 4FTXA 4ZJ1A 4CPKA 2Y55A 3EEHA 3IHAA 3M2JA 3MXQA 4I3AA 3MMHA 3FKVA 2HZ5A 4E3JA 5HWWA 4HQAA 1LSXA 4E6XA 2Z2LB 1OTIA 2WGWB 4KG6A 5L07A 2B95A 2E8IA 2R78A 2VKSA 3A0SA 3P7NA 1LT0A 4QU3A 1Y4OA 5FDHA 3H7WA 3AGFA 3N4IA 2HDQA 5A93A 3DWKA 1ODVA 4E3IA 3A3JA 2J8YA 1YLPA 2XR0A 3Q82A 1VQQA 4X1MA 4RX3A 3D4FA 3PTEA 3RXWA 4FD8A 5D3OA 4G3VA 2XROA 3S1YA 3GQZA 3HREA 1N9LA 4GN2A 2WZZA 5G18A 4HP9A 1T1AA 4N9KA 5HDCA 4HIAA 3UNWA 1EWZA 1F98A 3BY8A 1G28A 1IFQA 1OTAA 2DRWA 1DP6A 1YKDA 2C6WB 5A90A 4CJNA 2X01A 3ITAA 3PXPA 1CJFA 2V2FF 4P85A 2PYPA 2RL3A 2J3WA 3LICA 3BFEA 2ZL1B 5GL9A 2OLUA 3OLOA 1BUEA 3CLOA 4ZJ3A 3I7JA 3GRJA 4LV1A 3BW6A 4S2OA 3IXHA 4OH0A 4Q0HA 4BLMA 2VA0A 2HDSA 2EX6A 1VETA 4GHIB 3UPPA 1G68A 4S2JA 3KSHA 4YFMA 3MF0A 5E2GA 1HD8A 3HLDA 2EWWA 2HP9A 3E0YA 1K55C 3ZG7B 5EVIC 3NCKA 3CPTA 1YT4A 3IS2B 1YLZA 4GW9A 5E2HA 2K31A 1P97A 5HDDA 3S22A 1HZOA 3P01A 3ZNYA 4WEJA 4GS9A 4CLCD 2A2LA 5FDSA 1N9OA 3G4PA 2P9VB 3DTEA 4O01A 3LIBA 3VSLA 3B47A 1SHVA 4Y0TA 4KUOA 4DRTA 3RTYA 3G34A 5KZHA 3EGXC 5HAQA 2Y91A 3T4LA 3Q07A 4PM7A 3IXGA 1QMEA 1MY8A 3KYEA 2VJWA 3VFFA 3GMWA 4KQQA 1I5QA 4L9FA 3BFGA 4E3KA 4II7A 1FOFA 3QP2A 4JGRA 3WRZA 4DMZA 1IYOA 4Q8IA 3UE3A 3RXXA 1KGEA 2OLVA 1K57C 3C30A 4GZBA 4JBFA 5FQQA 4BQMA 3WRTA 3QHYA 1H8ZA 4UQIS 2RCXA 1K56D 4GNUA 1BLPA 1AWIA 2WKQA 2A24B 2OWHA 2PR5A 2JE5A 2ZQ7A 4HNBA 4GB7A 3EGDC 1YLTA 2V1ZA 3IF6B 4KQOA 3UB9A 1DJCA 4ID4A 3N8RA 3KSGA 2Y2IA 3VOLA 2PHYA 5F1FA 1K54A 3AGDA 2XEPA 1PI5A 1IYQA 5E43A 5EUAA 3FPWA 4DDYA 1FILA 3JVVA 3O5YA 1V9ZA 3V5MA 2ZC6B 4GJ4A 4Y13A 2PBDP 5EE8A 3T12B 3G30A 2J3TD 3G6OA 4HESA 1FIKA 2FFFB 1L3LA 4WEKA 1XXMA 1OTEA 4LV3A 4IUHA 3UPOA 1ERQA 4JF5A 4M4XA 5FL3A 1OT6A 5AJGA 3VOYA 4IBRA 4PM5A 4JGQA 1XFQA 5LBRA 1D06A 3C4PA 4UA7A 2B5RA 3V50A 1KOUA 4CLCA 2D01A 3L9KA 2V9AA 2ZM8A 3D72A 2M7VA 4I3JA 3IWQA 4DN0A 4NKPA 1NLZA 1A0KA 4KZ3A 1J9MA 3LYXA 4DJ2A 1IKGA 2V0WA 1TS8A 4MLLA 1W8QA 1IELA 3OBFA 5HSQA 3O86A 4BD1A 4DF6A 5CGXA 1DY6A 4QJGA 2KX6A 4KZ9A 2X02A 1L2SA
chains in the Genus database with same CATH topology
1EI5A 5HW3A 4B4XA 1TVFA 3E2KA 4GKUA 4ZDXA 3IH8A 2Y2NA 2J9PA 1KE0A 5JYPA 5FQKA 1ALQA 5FAPA 3SH7A 3ZG9B 1K56A 2EXAA 1RGZA 3QNBA 2XQZA 1OMEA 2XFSA 4IVKA 4K0WA 3DTMA 5CGSA 4X6TA 1BZAA 3MZFA 2Y2KA 4PM8A 5AQ7A 3SS5A 4FH4A 4ZJ2A 2HP5A 2JCHA 4N1XA 3UE0A 4WELA 3IXDA 4Y0OA 1JWVA 5CHJA 3ZGAB 3M6HA 2ZM2A 3N8LA 2VGKA 4XXRA 4UAAA 5FI6A 5M18A 3ZVWA 1HTZA 2A3UA 3Q7VA 4OLDA 5EVIB 3OPRA 2H5SA 3GV9A 3HUNA 4X53A 3BFFA 4NK3A 4C6YA 1MWSA 4BENA 1ES3A 3EQVA 4N9LA 4IBXA 1FQGA 4A5RA 5KSHA 2XLNA 3Q81A 4LENA 1MPLA 1JTDA 3FWLA 3HUMA 5DTKA 1RGYA 1MWTA 4ZAMA 4OP5A 3ZDJA 1YMSA 5L2FA 4C75A 1Z6FA 1SDEA 3ZG8B 1CI9A 4KG5A 5CHUA 3VOZA 2ZQ9A 5AQBA 1YQSA 3VP3A 5I94A 1NYYA 5DF7A 5FA7A 2XK1A 3O87A 1IEMA 3G31A 3UY6A 3GTCA 2UWXA 5DVAA 1CI8A 3FYZA 2I72A 3UDIA 2Y2HA 1ONGA 1NXYA 4RX2A 3NY4A 3FKWA 3BRMA 2Y2GA 4FH2A 5FAOA 2FFYA 4JXSA 1E3UA 3W4QA 1O07A 3N8SA 3ISGA 5E2EA 1ESIA 5E2FA 4B88A 3M6BA 3ZG0A 2BG1A 2WADA 2IWDA 4N1HA 4R23A 2WK0A 4DDSA 5M19A 2Y2OA 3NC8A 4EBLA 4X55A 4S2NC 4B4ZA 3BEBA 2EXBA 5HFOA 5HAPA 1GHMA 1IYSA 1MWRA 1S6RA 5KMWA 4KG2A 4N92A 3A3DA 2WYXA 4ZTKA 3IF6C 3M2KA 4Y0UA 1MKIA 1CEGA 1M6KA 1YM1A 4PPRA 3MZDA 4PM6A 4EV4A 1QMFA 1K38A 4Z9QA 3WWXA 2JBFA 3TOIA 4S2LA 1C3BA 1MXOA 3ZCZA 4ZJ1A 4CPKA 2Y55A 2H0TA 4F94A 1GA9A 4QY5A 4P87A 3IHAA 4R3BA 3M2JA 3LY3A 1FCOA 4KENB 1PZOA 5HX9A 4OPYA 4P0MA 4LCLA 2XF3A 1U60A 3FKVA 4U0TA 4S2MA 1K6SA 5FI2A 2XD5A 1H5XA 4HBUA 3O3VA 4D2OA 1W7FA 4YINA 1S0WA 4WYYA 4E3JA 5F82A 4WM9A 3IWOA 3IXBA 1BLHA 2Q9MA 3CZDA 1H8YA 5M1AA 4E6XA 1IYPA 2Z2LB 4K0XA 2XDMA 2WGWB 1K4EA 4KG6A 2DCFA 3MKEA 2E8IA 1Q2QA 2Y59A 4S2NA 4MBFA 4DXBA 4HEFA 1L0EA 1PW1A 4QU3A 1JWPA 5FDHA 3CMZA 1BULA 2XGNA 1FSWA 3AGFA 3N4IA 3PBRA 4KZ8A 2HDQA 1GHIA 1K55A 3DWKA 5EVIA 5A93A 5CECA 1JVJA 4DE1A 3LCEA 1ZC2A 1WYBA 4IEDA 4E3IA 3BM6A 3A3EA 2IWBA 3A3JA 2J8YA 5BOHA 1YLPA 1IKIA 2XR0A 3Q82A 1VQQA 3HUOA 4RX3A 1BT5A 3JYIA 3PAEA 3D4FA 2ZD8A 3HLBA 3PTEA 3RXWA 3ZNTA 4FD8A 3MXRA 5D3OA 3B3XA 3QNCA 3G2YA 4EWFA 4UHUA 4OP8A 4E3NA 3IQAA 3OPHA 3S1YA 1PYYA 1ERMA 3GQZA 3HREA 5DTTA 3WS4A 2GDNA 4FSFA 4RYEA 5EPHA 2PBYA 5F83A 3DW0A 3GR2A 4OOYA 2CC1A 3C7VA 4OQIA 4KZ5A 4OVDA 1N4OA 4XUXA 5FQIA 4GN2A 2A49A 2WZZA 3WS2A 5G18A 4GOGA 1KE3A 3HLCA 4N9KA 5KSCA 1YLWA 4OQGA 3ZVTA 3UNWA 5J8XA 4OKPA 3UE1A 1LLBA 1EWZA 2EX2A 3GSGA 4P6BA 3ZFZA 5GLDA 4DXCA 4PMAA 3V3RA 5DTSA 2EFUA 3HLFA 4LV2A 2DRWA 1KVLA 2WAEA 5A90A 2C6WB 1K6RA 4CJNA 5CHMA 3OC2A 4JKTA 4WMCD 5GLCA 2X01A 1ONHA 4RA7A 3ITAA 2Y2MA 2V2FF 4P85A 4KZBA 2Y2PA 2ZMAA 2RL3A 1Y54A 5TGFA 3BFEA 1ES5A 4R1GA 5FQMA 5GL9A 3EQUA 1K4FA 2OLUA 2Z2MB 2Y2LA 1BUEA 2R9XA 2H10A 3A3FA 4X56A 4ZJ3A 3I7JA 3GRJA 5CGWA 1PW8A 4LV1A 3HLGA 3UO9A 4S2OA 2R9WA 2IWCA 5IHVA 3IXHA 4OH0A 5EECA 3OPPA 4BLMA 4JLFA 2P74A 1ESUA 4QY6A 2HDSA 2EX6A 1ZG6A 4ZBEA 2HP6A 1MBLA 3UPPA 1G68A 1HVBA 4S2JA 4WZ4A 1ES2A 4R0QA 3ZG5A 5AQAA 4BL2A 3TSGA 3VP0A 4YFMA 4S2PA 4R3JA 4GDNA 5E2GA 1SDNA 1HD8A 3HLDA 3NDGA 1BLSA 3S4XA 3NI9A 2HP9A 2ZC3B 4JPMA 2PU2A 1K55C 1LL9A 5EVIC 2XFTA 3ZG7B 3NCKA 1XGJA 1PZPA 1M40A 3Q7VB 2BLSA 2WKHA 5A91A 1LHYA 4KZ7A 2Y2QA 4GD8A 1LL5A 1YT4A 1DJBA 1YLZA 3UDFA 4L0LA 2ZQ8A 2XD1A 5E2HA 4GD6A 3VMAA 1L0DA 1PWGA 2Q9NA 3CJMA 3S22A 1PI4A 3W8KA 1HZOA 4S2IA 5CXWA 4OPQA 3ZHHA 5CTNA 4R4SA 1LI9A 3WS1A 3ZNYA 3MXSA 4WEJA 4K91A 1NJ4A 1WE4A 1ES4A 2HPBA 5F1GA 2EX8A 4MEZA 4OQ0A 3G4PA 5U47A 4E3MA 4E3LA 1KVMA 2P9VB 4OPRA 2J7VA 1FR1A 2G2WA 3VSLA 4UA9A 3PBSA 1SHVA 1VM1A 4Y0TA 4BL3A 4DRTA 1O7EA 1K25A 5CERA 4C3QA 2OV5A 1YLJA 1SKFA 1W5DA 1CK3A 3G34A 4UA6A 1Q2PA 1PWDA 2HDRA 4DKIA 1LI0A 1NZOA 5KZHA 4JF4A 2ZM0A 2WGVA 1W79A 4LV0A 3MBZA 3CG5A 4M3KA 2DNSA 5HAQA 2Y91A 2V20A 3Q07A 4PM7A 3WS0A 3C5AA 1YMXA 3IXGA 3BLSA 1QMEA 1MY8A 5CRFA 3VFFA 3N6IA 3GMWA 4KZ6A 4KQQA 1I5QA 5JYOA 5GHXA 2XH9A 3BFGA 2ZC5B 4E3KA 5DF9A 1FOFA 1NZUA 3IWIA 1ZG4A 4OONA 3WRZA 2Y2JA 1IYOA 1BTLA 2ZC7A 1L0GA 3IF5A 4Q8IA 1FCMA 3UE3A 3RXXA 4QD4A 3Q1FA 5TR7A 1XA7A 1KGEA 2OLVA 3MKFA 3PBTA 3SOIA 1K57C 3V3SA 1ZKJA 2EX9A 4GZBA 4OPZA 1SCWA 2QPNA 4JBFA 5FQQA 1XX2A 4BQMA 3PBOA 3WRTA 1XP4A 1XPBA 3PBQA 3QHYA 1PIOA 4MNRA 3W4OA 3AGEA 3N7WA 1KE4A 2Y4AA 1H8ZA 2RCXA 3GVBA 1K56D 2H0YA 4GDBA 5EOEA 5FAQA 1GCEA 4GNUA 1BLPA 2OSUA 4X68A 3SH8A 4KZ4A 3HLWA 2JC7A 2QZ6A 4OOMA 5TFQA 1KDSA 3OZHA 3SS3A 1TDLA 4E3OA 1XA1A 3P98A 4OOLA 3OCLA 3PBNA 2JE5A 4OLGA 4WMCA 4H8RA 2WKEA 2ZQ7A 4GB7A 1JWZA 3NDEA 1L2SA 1YLTA 2V1ZA 3IF6B 3NBLA 1BSGA 4JXWA 4QHCA 4WBGA 1FSYA 4KQOA 1DJCA 2PU4A 1KGFA 5A92A 3P09A 4ID4A 2WUQA 3N8RA 1KDWA 5FQ9A 3LO7A 4Y7PA 3Q7ZA 5FSRA 4X69A 2Y2IA 1K57A 5F1FA 4XUZA 3MFDA 2WKIA 1K54A 2VGJA 3AGDA 2XEPA 4BD0A 2WZXA 1PI5A 1IYQA 1XGIA 4R4RA 5E43A 5EUAA 4DE0A 1E25A 4E6WA 5FQJA 3IH9A 4WZ5C 3VP2A 4DDYA 4LCMA 5FI7A 3V39A 5HL1A 3V5MA 2ZC6B 3BLMA 2WAFA 1MWUA 4EQIA 2WGWA 3HL9A 3SH9A 5EE8A 1N9BA 2P9VA 2J9OA 3G30A 1I2SA 1E4DA 1NY0A 3NIAA 2ZQDA 3VSKA 3LEZA 3WS5A 3DWZA 2EFXA 3IT9A 1FCNA 4HESA 2FFFB 5AQ9A 4WEKA 1KGGA 5FATA 1RP5A 3VP4A 1XXMA 3BFCA 4FCFA 4OQHA 3W4PA 2HDUA 4LV3A 3C7UA 3VP1A 4IVIA 5CEDA 1E3UD 1DJAA 3TG9A 3O88A 4JF6A 3UPOA 3RJUA 4PM9A 1ERQA 1GA0A 3C4OA 1NRFA 4JF5A 1EROA 4EBNA 2ZJ9A 3E2LA 3VOYA 4DE3A 4IBRA 5GHZA 4PM5A 5HARA 1WYCA 1FR6A 4U3TA 4DE2A 3C4PA 4UA7A 2B5RA 5GLBA 1XKZA 2X71A 3V50A 5FASA 3FV7A 1BLCA 4WZ5A 5EOOA 3HBRA 4EBPA 4S2KA 3ITBA 3MZEA 5HAIA 3UPNA 4JXVA 3SS4A 1YLYA 4NETA 5CEBA 5DF8A 1TEMA 5CTMA 3UDXA 1W8YA 2WGIA 3G35A 2ZM8A 1AXBA 1NYMA 4JXGA 1L0FA 4U0XA 5GHYA 3IWQA 2ZC4B 1G6AA 3FZCA 3G32A 2C5WB 3IHBA 4O7DA 1JTGA 4KZ3A 1J9MA 4MBHA 4BJPA 3VFHA 3HVFA 4KQRA 4QB8A 5GLAA 2ZQAA 2ZQCA 3OPLA 2QMIA 3G2ZA 3BFDA 3A3IA 1I2WA 1CEFA 3LY4A 1IKGA 2ZLYA 4HBTA 3PAGA 5EVLA 1RCJA 1GHPA 4MLLA 3BYDA 1W8QA 1TDGA 4EUZA 4KZAA 3IF6A 1IELA 4RVAA 3O86A 4BD1A 3HLEA 4DF6A 5CGXA 5EVID 1DY6A 4QJGA 3OCNA 4KZ9A 2X02A 3UN7A 3BECA 1K54C 4MBKA 1PWCA 2G2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EI5 A;  5HW3 A;  4B4X A;  1TVF A;  3E2K A;  4GKU A;  4ZDX A;  3IH8 A;  2Y2N A;  2J9P A;  1KE0 A;  5JYP A;  5FQK A;  1ALQ A;  5FAP A;  3SH7 A;  3ZG9 B;  1K56 A;  2EXA A;  1RGZ A;  3QNB A;  2XQZ A;  1OME A;  2XFS A;  4IVK A;  4K0W A;  3DTM A;  5CGS A;  4X6T A;  1BZA A;  3MZF A;  2Y2K A;  4PM8 A;  5AQ7 A;  3SS5 A;  4FH4 A;  4ZJ2 A;  2HP5 A;  2JCH A;  4N1X A;  3UE0 A;  4WEL A;  3IXD A;  4Y0O A;  1JWV A;  5CHJ A;  3ZGA B;  3M6H A;  2ZM2 A;  3N8L A;  2VGK A;  4XXR A;  4UAA A;  5FI6 A;  5M18 A;  3ZVW A;  1HTZ A;  2A3U A;  3Q7V A;  4OLD A;  5EVI B;  3OPR A;  2H5S A;  3GV9 A;  3HUN A;  4X53 A;  3BFF A;  4NK3 A;  4C6Y A;  1MWS A;  4BEN A;  1ES3 A;  3EQV A;  4N9L A;  4IBX A;  1FQG A;  4A5R A;  5KSH A;  2XLN A;  3Q81 A;  4LEN A;  1MPL A;  1JTD A;  3FWL A;  3HUM A;  5DTK A;  1RGY A;  1MWT A;  4ZAM A;  4OP5 A;  3ZDJ A;  1YMS A;  5L2F A;  4C75 A;  1Z6F A;  1SDE A;  3ZG8 B;  1CI9 A;  4KG5 A;  5CHU A;  3VOZ A;  2ZQ9 A;  5AQB A;  1YQS A;  3VP3 A;  5I94 A;  1NYY A;  5DF7 A;  5FA7 A;  2XK1 A;  3O87 A;  1IEM A;  3G31 A;  3UY6 A;  3GTC A;  2UWX A;  5DVA A;  1CI8 A;  3FYZ A;  2I72 A;  3UDI A;  2Y2H A;  1ONG A;  1NXY A;  4RX2 A;  3NY4 A;  3FKW A;  3BRM A;  2Y2G A;  4FH2 A;  5FAO A;  2FFY A;  4JXS A;  1E3U A;  3W4Q A;  1O07 A;  3N8S A;  3ISG A;  5E2E A;  1ESI A;  5E2F A;  4B88 A;  3M6B A;  3ZG0 A;  2BG1 A;  2WAD A;  2IWD A;  4N1H A;  4R23 A;  2WK0 A;  4DDS A;  5M19 A;  2Y2O A;  3NC8 A;  4EBL A;  4X55 A;  4S2N C;  4B4Z A;  3BEB A;  2EXB A;  5HFO A;  5HAP A;  1GHM A;  1IYS A;  1MWR A;  1S6R A;  5KMW A;  4KG2 A;  4N92 A;  3A3D A;  2WYX A;  4ZTK A;  3IF6 C;  3M2K A;  4Y0U A;  1MKI A;  1CEG A;  1M6K A;  1YM1 A;  4PPR A;  3MZD A;  4PM6 A;  4EV4 A;  1QMF A;  1K38 A;  4Z9Q A;  3WWX A;  2JBF A;  3TOI A;  4S2L A;  1C3B A;  1MXO A;  3ZCZ A;  4ZJ1 A;  4CPK A;  2Y55 A;  2H0T A;  4F94 A;  1GA9 A;  4QY5 A;  4P87 A;  3IHA A;  4R3B A;  3M2J A;  3LY3 A;  1FCO A;  4KEN B;  1PZO A;  5HX9 A;  4OPY A;  4P0M A;  4LCL A;  2XF3 A;  1U60 A;  3FKV A;  4U0T A;  4S2M A;  1K6S A;  5FI2 A;  2XD5 A;  1H5X A;  4HBU A;  3O3V A;  4D2O A;  1W7F A;  4YIN A;  1S0W A;  4WYY A;  4E3J A;  5F82 A;  4WM9 A;  3IWO A;  3IXB A;  1BLH A;  2Q9M A;  3CZD A;  1H8Y A;  5M1A A;  4E6X A;  1IYP A;  2Z2L B;  4K0X A;  2XDM A;  2WGW B;  1K4E A;  4KG6 A;  2DCF A;  3MKE A;  2E8I A;  1Q2Q A;  2Y59 A;  4S2N A;  4MBF A;  4DXB A;  4HEF A;  1L0E A;  1PW1 A;  4QU3 A;  1JWP A;  5FDH A;  3CMZ A;  1BUL A;  2XGN A;  1FSW A;  3AGF A;  3N4I A;  3PBR A;  4KZ8 A;  2HDQ A;  1GHI A;  1K55 A;  3DWK A;  5EVI A;  5A93 A;  5CEC A;  1JVJ A;  4DE1 A;  3LCE A;  1ZC2 A;  1WYB A;  4IED A;  4E3I A;  3BM6 A;  3A3E A;  2IWB A;  3A3J A;  2J8Y A;  5BOH A;  1YLP A;  1IKI A;  2XR0 A;  3Q82 A;  1VQQ A;  3HUO A;  4RX3 A;  1BT5 A;  3JYI A;  3PAE A;  3D4F A;  2ZD8 A;  3HLB A;  3PTE A;  3RXW A;  3ZNT A;  4FD8 A;  3MXR A;  5D3O A;  3B3X A;  3QNC A;  3G2Y A;  4EWF A;  4UHU A;  4OP8 A;  4E3N A;  3IQA A;  3OPH A;  3S1Y A;  1PYY A;  1ERM A;  3GQZ A;  3HRE A;  5DTT A;  3WS4 A;  2GDN A;  4FSF A;  4RYE A;  5EPH A;  2PBY A;  5F83 A;  3DW0 A;  3GR2 A;  4OOY A;  2CC1 A;  3C7V A;  4OQI A;  4KZ5 A;  4OVD A;  1N4O A;  4XUX A;  5FQI A;  4GN2 A;  2A49 A;  2WZZ A;  3WS2 A;  5G18 A;  4GOG A;  1KE3 A;  3HLC A;  4N9K A;  5KSC A;  1YLW A;  4OQG A;  3ZVT A;  3UNW A;  5J8X A;  4OKP A;  3UE1 A;  1LLB A;  1EWZ A;  2EX2 A;  3GSG A;  4P6B A;  3ZFZ A;  5GLD A;  4DXC A;  4PMA A;  3V3R A;  5DTS A;  2EFU A;  3HLF A;  4LV2 A;  2DRW A;  1KVL A;  2WAE A;  5A90 A;  2C6W B;  1K6R A;  4CJN A;  5CHM A;  3OC2 A;  4JKT A;  4WMC D;  5GLC A;  2X01 A;  1ONH A;  4RA7 A;  3ITA A;  2Y2M A;  2V2F F;  4P85 A;  4KZB A;  2Y2P A;  2ZMA A;  2RL3 A;  1Y54 A;  5TGF A;  3BFE A;  1ES5 A;  4R1G A;  5FQM A;  5GL9 A;  3EQU A;  1K4F A;  2OLU A;  2Z2M B;  2Y2L A;  1BUE A;  2R9X A;  2H10 A;  3A3F A;  4X56 A;  4ZJ3 A;  3I7J A;  3GRJ A;  5CGW A;  1PW8 A;  4LV1 A;  3HLG A;  3UO9 A;  4S2O A;  2R9W A;  2IWC A;  5IHV A;  3IXH A;  4OH0 A;  5EEC A;  3OPP A;  4BLM A;  4JLF A;  2P74 A;  1ESU A;  4QY6 A;  2HDS A;  2EX6 A;  1ZG6 A;  4ZBE A;  2HP6 A;  1MBL A;  3UPP A;  1G68 A;  1HVB A;  4S2J A;  4WZ4 A;  1ES2 A;  4R0Q A;  3ZG5 A;  5AQA A;  4BL2 A;  3TSG A;  3VP0 A;  4YFM A;  4S2P A;  4R3J A;  4GDN A;  5E2G A;  1SDN A;  1HD8 A;  3HLD A;  3NDG A;  1BLS A;  3S4X A;  3NI9 A;  2HP9 A;  2ZC3 B;  4JPM A;  2PU2 A;  1K55 C;  1LL9 A;  5EVI C;  2XFT A;  3ZG7 B;  3NCK A;  1XGJ A;  1PZP A;  1M40 A;  3Q7V B;  2BLS A;  2WKH A;  5A91 A;  1LHY A;  4KZ7 A;  2Y2Q A;  4GD8 A;  1LL5 A;  1YT4 A;  1DJB A;  1YLZ A;  3UDF A;  4L0L A;  2ZQ8 A;  2XD1 A;  5E2H A;  4GD6 A;  3VMA A;  1L0D A;  1PWG A;  2Q9N A;  3CJM A;  3S22 A;  1PI4 A;  3W8K A;  1HZO A;  4S2I A;  5CXW A;  4OPQ A;  3ZHH A;  5CTN A;  4R4S A;  1LI9 A;  3WS1 A;  3ZNY A;  3MXS A;  4WEJ A;  4K91 A;  1NJ4 A;  1WE4 A;  1ES4 A;  2HPB A;  5F1G A;  2EX8 A;  4MEZ A;  4OQ0 A;  3G4P A;  5U47 A;  4E3M A;  4E3L A;  1KVM A;  2P9V B;  4OPR A;  2J7V A;  1FR1 A;  2G2W A;  3VSL A;  4UA9 A;  3PBS A;  1SHV A;  1VM1 A;  4Y0T A;  4BL3 A;  4DRT A;  1O7E A;  1K25 A;  5CER A;  4C3Q A;  2OV5 A;  1YLJ A;  1SKF A;  1W5D A;  1CK3 A;  3G34 A;  4UA6 A;  1Q2P A;  1PWD A;  2HDR A;  4DKI A;  1LI0 A;  1NZO A;  5KZH A;  4JF4 A;  2ZM0 A;  2WGV A;  1W79 A;  4LV0 A;  3MBZ A;  3CG5 A;  4M3K A;  2DNS A;  5HAQ A;  2Y91 A;  2V20 A;  3Q07 A;  4PM7 A;  3WS0 A;  3C5A A;  1YMX A;  3IXG A;  3BLS A;  1QME A;  1MY8 A;  5CRF A;  3VFF A;  3N6I A;  3GMW A;  4KZ6 A;  4KQQ A;  1I5Q A;  5JYO A;  5GHX A;  2XH9 A;  3BFG A;  2ZC5 B;  4E3K A;  5DF9 A;  1FOF A;  1NZU A;  3IWI A;  1ZG4 A;  4OON A;  3WRZ A;  2Y2J A;  1IYO A;  1BTL A;  2ZC7 A;  1L0G A;  3IF5 A;  4Q8I A;  1FCM A;  3UE3 A;  3RXX A;  4QD4 A;  3Q1F A;  5TR7 A;  1XA7 A;  1KGE A;  2OLV A;  3MKF A;  3PBT A;  3SOI A;  1K57 C;  3V3S A;  1ZKJ A;  2EX9 A;  4GZB A;  4OPZ A;  1SCW A;  2QPN A;  4JBF A;  5FQQ A;  1XX2 A;  4BQM A;  3PBO A;  3WRT A;  1XP4 A;  1XPB A;  3PBQ A;  3QHY A;  1PIO A;  4MNR A;  3W4O A;  3AGE A;  3N7W A;  1KE4 A;  2Y4A A;  1H8Z A;  2RCX A;  3GVB A;  1K56 D;  2H0Y A;  4GDB A;  5EOE A;  5FAQ A;  1GCE A;  4GNU A;  1BLP A;  2OSU A;  4X68 A;  3SH8 A;  4KZ4 A;  3HLW A;  2JC7 A;  2QZ6 A;  4OOM A;  5TFQ A;  1KDS A;  3OZH A;  3SS3 A;  1TDL A;  4E3O A;  1XA1 A;  3P98 A;  4OOL A;  3OCL A;  3PBN A;  2JE5 A;  4OLG A;  4WMC A;  4H8R A;  2WKE A;  2ZQ7 A;  4GB7 A;  1JWZ A;  3NDE A;  1L2S A;  1YLT A;  2V1Z A;  3IF6 B;  3NBL A;  1BSG A;  4JXW A;  4QHC A;  4WBG A;  1FSY A;  4KQO A;  1DJC A;  2PU4 A;  1KGF A;  5A92 A;  3P09 A;  4ID4 A;  2WUQ A;  3N8R A;  1KDW A;  5FQ9 A;  3LO7 A;  4Y7P A;  3Q7Z A;  5FSR A;  4X69 A;  2Y2I A;  1K57 A;  5F1F A;  4XUZ A;  3MFD A;  2WKI A;  1K54 A;  2VGJ A;  3AGD A;  2XEP A;  4BD0 A;  2WZX A;  1PI5 A;  1IYQ A;  1XGI A;  4R4R A;  5E43 A;  5EUA A;  4DE0 A;  1E25 A;  4E6W A;  5FQJ A;  3IH9 A;  4WZ5 C;  3VP2 A;  4DDY A;  4LCM A;  5FI7 A;  3V39 A;  5HL1 A;  3V5M A;  2ZC6 B;  3BLM A;  2WAF A;  1MWU A;  4EQI A;  2WGW A;  3HL9 A;  3SH9 A;  5EE8 A;  1N9B A;  2P9V A;  2J9O A;  3G30 A;  1I2S A;  1E4D A;  1NY0 A;  3NIA A;  2ZQD A;  3VSK A;  3LEZ A;  3WS5 A;  3DWZ A;  2EFX A;  3IT9 A;  1FCN A;  4HES A;  2FFF B;  5AQ9 A;  4WEK A;  1KGG A;  5FAT A;  1RP5 A;  3VP4 A;  1XXM A;  3BFC A;  4FCF A;  4OQH A;  3W4P A;  2HDU A;  4LV3 A;  3C7U A;  3VP1 A;  4IVI A;  5CED A;  1E3U D;  1DJA A;  3TG9 A;  3O88 A;  4JF6 A;  3UPO A;  3RJU A;  4PM9 A;  1ERQ A;  1GA0 A;  3C4O A;  1NRF A;  4JF5 A;  1ERO A;  4EBN A;  2ZJ9 A;  3E2L A;  3VOY A;  4DE3 A;  4IBR A;  5GHZ A;  4PM5 A;  5HAR A;  1WYC A;  1FR6 A;  4U3T A;  4DE2 A;  3C4P A;  4UA7 A;  2B5R A;  5GLB A;  1XKZ A;  2X71 A;  3V50 A;  5FAS A;  3FV7 A;  1BLC A;  4WZ5 A;  5EOO A;  3HBR A;  4EBP A;  4S2K A;  3ITB A;  3MZE A;  5HAI A;  3UPN A;  4JXV A;  3SS4 A;  1YLY A;  4NET A;  5CEB A;  5DF8 A;  1TEM A;  5CTM A;  3UDX A;  1W8Y A;  2WGI A;  3G35 A;  2ZM8 A;  1AXB A;  1NYM A;  4JXG A;  1L0F A;  4U0X A;  5GHY A;  3IWQ A;  2ZC4 B;  1G6A A;  3FZC A;  3G32 A;  2C5W B;  3IHB A;  4O7D A;  1JTG A;  4KZ3 A;  1J9M A;  4MBH A;  4BJP A;  3VFH A;  3HVF A;  4KQR A;  4QB8 A;  5GLA A;  2ZQA A;  2ZQC A;  3OPL A;  2QMI A;  3G2Z A;  3BFD A;  3A3I A;  1I2W A;  1CEF A;  3LY4 A;  1IKG A;  2ZLY A;  4HBT A;  3PAG A;  5EVL A;  1RCJ A;  1GHP A;  4MLL A;  3BYD A;  1W8Q A;  1TDG A;  4EUZ A;  4KZA A;  3IF6 A;  1IEL A;  4RVA A;  3O86 A;  4BD1 A;  3HLE A;  4DF6 A;  5CGX A;  5EVI D;  1DY6 A;  4QJG A;  3OCN A;  4KZ9 A;  2X02 A;  3UN7 A;  3BEC A;  1K54 C;  4MBK A;  1PWC A;  2G2U A; 
#chains in the Genus database with same CATH topology
 5TBM B;  4X25 A;  4B4X A;  4ZDX A;  3IH8 A;  2L0W A;  4LPZ A;  2ZMV A;  3ZG9 B;  1K56 A;  3K3C A;  2XFS A;  3CUE A;  3DTM A;  5CGS A;  2V8C A;  2Y2K A;  4PM8 A;  2W0N A;  3UB7 A;  4FH4 A;  4N1X A;  4BBT A;  4NXB A;  1G5U A;  4WEL A;  4Y0O A;  4MCW A;  5CHJ A;  3ZGA B;  3M6H A;  2VGK A;  1CQA A;  1ZHH B;  4UAA A;  3ZVW A;  1HTZ A;  3S7N A;  5EVI B;  5EFW A;  3GV9 A;  4X53 A;  5HZH A;  4BEN A;  3MJQ A;  5EVE A;  1MPL A;  3HUM A;  2E8J A;  1RGY A;  3ZDJ A;  5L2F A;  1YAX A;  3LR5 A;  3ZG8 B;  3VOZ A;  1YQS A;  5I94 A;  1S4S A;  3O87 A;  3UY6 A;  1OT9 A;  2UWX A;  3TW8 A;  2Y2H A;  3NY4 A;  3FKW A;  3QP6 A;  3S7P A;  1STZ A;  2CMN A;  2FFY A;  4WUJ A;  2BG1 A;  4R23 A;  2Y2O A;  4YNR A;  1EW0 A;  5HAP A;  3DTI A;  3BWL A;  1MWR A;  1S6R A;  2JHE A;  4KG2 A;  5KMW A;  2WYX A;  4ZTK A;  2P04 A;  2VV6 A;  4HJ3 A;  3C8C A;  1J3W A;  1K38 A;  3IX4 A;  4Z9Q A;  3WWX A;  1PNE A;  4S2L A;  1C3B A;  5FEF A;  5J7E A;  3NOU C;  2H0T A;  3LY3 A;  2XF3 A;  4I5S A;  1GSX A;  4LFU A;  1K6S A;  4S2M A;  1H5X A;  3O3V A;  3UME A;  3BJN A;  4WM9 A;  3IWO A;  3F1O A;  2OOL A;  1H8Y A;  3RFB A;  1IYP A;  3MKE A;  4MBF A;  1PW1 A;  3B42 A;  1JWP A;  3CMZ A;  2XGN A;  1Y28 A;  2W1R A;  3ULF A;  4DE1 A;  2PT7 A;  3A3E A;  3BM6 A;  2IWB A;  5BOH A;  4K08 A;  3NOP C;  1IKI A;  5EM1 A;  2PDR A;  3R7W A;  4P6Z M;  1BT5 A;  3JYI A;  4WF0 A;  3HLB A;  4O0P A;  3F1P A;  4LLO B;  3MXR A;  3B3X A;  3QNC A;  4UHU A;  4OP8 A;  4IHQ A;  4E3N A;  3OPH A;  1XFN A;  1PYY A;  3WS4 A;  3T4O A;  4RYE A;  5EPH A;  4BBU A;  2J80 A;  5F83 A;  3DW0 A;  3GR2 A;  3D9Y A;  3UE6 A;  4OQI A;  5FQI A;  2A49 A;  4GOG A;  3HLC A;  5KSC A;  1SKO A;  2OWJ A;  4OKP A;  2EX2 A;  4NG2 A;  4PMA A;  5G4Y A;  3V3R A;  3ZYT A;  3QP4 A;  3HLF A;  4HOI A;  4LV2 A;  3LFV A;  4Y5F A;  1K6R A;  4WMC D;  4JKT A;  1ONH A;  3MS6 A;  5IU1 A;  4KZB A;  5AVF A;  2ZMA A;  5TGF A;  1ES5 A;  2Z2M B;  2Y2L A;  3HCY A;  5DFX A;  3UO9 A;  2R9W A;  5EEC A;  4JLF A;  2P74 A;  1ESU A;  4WZ4 A;  4DJ3 A;  4HH2 A;  3ZG5 A;  3PR6 A;  4R6L A;  4GDN A;  3S4X A;  1JNU A;  3RH8 B;  1XGJ A;  1PZP A;  2BLS A;  4F3L A;  5DJU A;  2Y2Q A;  4GD8 A;  1DJB A;  2ZQ8 A;  3NJA A;  2FH5 A;  3VMA A;  2Q9N A;  3LEQ A;  4O8G A;  5CXW A;  4R4S A;  1LI9 A;  4KQD A;  3WS1 A;  2QHK A;  1NJ4 A;  3DBA A;  2EX8 A;  2P08 A;  4OQ0 A;  1KVM A;  4Y15 A;  4OPR A;  2J7V A;  1H3Q A;  4BL3 A;  1YLJ A;  1DRM A;  4UA6 A;  1NZO A;  4PAU A;  2ZM0 A;  2WGV A;  1W79 A;  4LV0 A;  4M3K A;  2DNS A;  3S7O A;  2ZOH A;  3BLS A;  4KZ6 A;  2V8F A;  4CLC E;  3LI8 A;  1NZU A;  1OPX A;  4YOF A;  1L0G A;  3IF5 A;  2W3G A;  2JKT M;  1FCM A;  3Q1F A;  1XA7 A;  2PAV P;  4OPZ A;  2AVX A;  3PBQ A;  1PIO A;  4MNR A;  3W4O A;  1VEU B;  1KE4 A;  2Y4A A;  2H0Y A;  4GDB A;  5FAQ A;  3MFX A;  1GCE A;  2OSU A;  3HLW A;  2QZ6 A;  3SS3 A;  2V1A A;  3T4J A;  3PBN A;  4WMC A;  2FZ0 A;  3MQQ A;  2OAP 1;  3H7W B;  3K3D A;  3NBL A;  1FSY A;  1HLU P;  5A92 A;  5L09 A;  1KDW A;  4Y7P A;  4EEU A;  5L8M A;  4NEE D;  2WZX A;  1XGI A;  4CLC C;  3VP2 A;  3S7Q A;  4BMW A;  5HL1 A;  3EWK A;  1MWU A;  1OTD A;  3EEA A;  2P9V A;  1NY0 A;  3NIA A;  5FAT A;  1UGU A;  1NRJ A;  1XJ6 A;  4IVI A;  5CED A;  1E3U D;  2JKF A;  1SZV A;  2VX8 A;  4EBN A;  2ZJ9 A;  1D1J A;  5GHZ A;  1H0M A;  3CIT A;  4DE2 A;  5GLB A;  1XKZ A;  5FAS A;  4UQI M;  3FV7 A;  4I38 A;  4EBP A;  3KYQ A;  5HAI A;  4JXV A;  1YLY A;  4NET A;  5DF8 A;  1TEM A;  3UDX A;  1W8Y A;  2WGI A;  3NEC A;  4ZRR A;  2O0Y A;  3SW1 A;  2ZC4 B;  3CUE C;  1VET B;  3EOI A;  3IHB A;  4O7D A;  4MBH A;  3GDI A;  4KQR A;  5GLA A;  3OPL A;  2JKR M;  1I2W A;  5F68 A;  3PAG A;  4H6J A;  5EVL A;  4MMN A;  3LIE A;  4EUZ A;  4KZA A;  3IF6 A;  3CPT B;  3HLE A;  5EVI D;  2I9V A;  4NXE A;  4MBK A;  5GHX A;  1EI5 A;  5HW3 A;  1GSW A;  2VK3 A;  3CI6 A;  2J9P A;  5FQK A;  1ALQ A;  5FAP A;  3SH7 A;  1RGZ A;  3PYP A;  2XQZ A;  1OME A;  1ACF A;  3QP8 A;  4GS9 B;  4X6T A;  2J3T C;  2VLG A;  4ZJ2 A;  4NXF A;  3IXD A;  1JWV A;  1F2K A;  3N8L A;  3HJI A;  3Q7V A;  4OLD A;  4NK3 A;  4LRY C;  4N9L A;  5KSH A;  3Q81 A;  1MWT A;  4ZAM A;  5A8B A;  2GNX A;  1Z6F A;  3TE8 A;  3MQO A;  4KG5 A;  1YSQ A;  1V9Y A;  4BWI A;  2XK1 A;  3H82 A;  4LRX C;  3GTC A;  3QP1 A;  5DVA A;  2YKF A;  4RX2 A;  4ARZ A;  2XRN A;  3LIA A;  3KO6 A;  1E3U A;  3ISG A;  5E2E A;  3M6B A;  1MC0 A;  2WAD A;  2IWD A;  1H8M A;  4EBL A;  4X55 A;  4Z1W A;  5CX7 A;  1GHM A;  1MKI A;  1CEG A;  3LI9 A;  4GLQ A;  3MR0 A;  4R3B A;  4P87 A;  3VV4 A;  4B9O A;  2W3E A;  1FCO A;  4KEN B;  1PZO A;  5HX9 A;  4LCL A;  3GEC A;  5FI2 A;  2XD5 A;  4HBU A;  3F1N A;  4PKY A;  4D2O A;  1W7F A;  3IX8 A;  4HH3 A;  1S0W A;  4WYY A;  3IXB A;  1BLH A;  2Q9M A;  2O9B A;  1K4E A;  2DCF A;  3FG8 A;  1Q2Q A;  3A0V A;  5HL6 A;  2O9C A;  1L0E A;  4MN6 A;  4WLA A;  4HY8 A;  4KZ8 A;  1GHI A;  1K55 A;  5EVI A;  1JVJ A;  4IED A;  1WYB A;  3UB6 A;  3HUO A;  2ACG A;  4YWZ A;  2ZD8 A;  2K7S A;  3U4L P;  2Z6C A;  3D3O A;  4CLC B;  1ERM A;  5DTT A;  2GDN A;  2CC1 A;  4OVD A;  4KZ5 A;  4XUX A;  1S66 L;  1W63 M;  3KX0 X;  1YLW A;  4OQG A;  5J8X A;  2QJ5 A;  1OJ5 A;  5DKK A;  2W3H A;  4DXC A;  4E04 A;  1XJ3 A;  1T1B A;  1KVL A;  2WAE A;  4EEP A;  5CHM A;  5GLC A;  4RA7 A;  2Y2M A;  5DKL A;  2Y2P A;  4R1G A;  5F69 A;  2HF6 A;  3EQU A;  1K4F A;  1OTB A;  3MSH A;  3KSF A;  1LL8 A;  2O9A A;  1YPR A;  4X56 A;  5CGW A;  5HDS A;  1TS6 A;  1TS0 A;  2IWC A;  3OPP A;  4XT2 B;  4EUV A;  1MBL A;  1HVB A;  4R0Q A;  3VP0 A;  1SDN A;  3NDG A;  3NI9 A;  1P0Z A;  2ZC3 B;  4JPM A;  2XFT A;  5FEG A;  5A91 A;  1PFL A;  4X1L A;  5K5B A;  1LL5 A;  3UDF A;  4EW7 A;  2XD1 A;  5HWV A;  4GD6 A;  1PI4 A;  5HWT A;  1S1Y A;  4S2I A;  4OPQ A;  5CTN A;  2JKR I;  3MXS A;  3DTK A;  1ES4 A;  2HPB A;  4KUK A;  4MEZ A;  5U47 A;  4E3M A;  2INW A;  2XA7 S;  5HD5 A;  1FR1 A;  2G2W A;  4HJ6 A;  1VM1 A;  1W5D A;  1MKM A;  2PRF A;  1PWD A;  2HDR A;  4LGW A;  3MBZ A;  3CG5 A;  4UEY A;  1MZU A;  5CRF A;  3N6I A;  3LR3 A;  2P7J A;  3A0R A;  3IWI A;  4OON A;  2Y2J A;  2ZC7 A;  1BTL A;  5C5K A;  3VE3 A;  3PBT A;  3SOI A;  3LGO A;  1TF1 A;  3BY9 A;  1VB6 A;  1ZKJ A;  1SCW A;  3T1S A;  2UV0 E;  3GVB A;  4X68 A;  3SH8 A;  3F1O B;  2L4R A;  4KZ4 A;  5TFQ A;  4OOM A;  1KDS A;  2HJ9 C;  3OZH A;  4E3O A;  1LSV A;  3IBJ A;  3SZT A;  4H8R A;  2WKE A;  3VE4 A;  1JWZ A;  3NDE A;  5F6A A;  2EWV A;  2Y79 A;  2NUT C;  3H9W A;  2XSS A;  4L9E A;  5IS1 A;  2PU4 A;  3P09 A;  5FQ9 A;  3LO7 A;  5FSR A;  4BBV A;  3DAV A;  4XUZ A;  2VGJ A;  2HV1 A;  4BD0 A;  3F1P B;  1Z09 A;  1E25 A;  3IH9 A;  1ZTU A;  2VGL S;  4G3W A;  1WA9 A;  2WGW A;  4G3K A;  3HL9 A;  3SH9 A;  2J9O A;  1I2S A;  4ETX A;  3LEZ A;  3DWZ A;  2EFX A;  5AQ9 A;  3VP4 A;  1RP5 A;  3W4P A;  4OQH A;  1SKO B;  2HDU A;  3C7U A;  4MDZ A;  1DJA A;  3O88 A;  3RJU A;  1GA0 A;  3C4O A;  1ERO A;  3E2L A;  4DE3 A;  5HAR A;  2BAS A;  2KOI A;  3CWF A;  3TJZ C;  1BLC A;  4WZ5 A;  2W1T B;  3HBR A;  4S2K A;  2JN7 A;  3ITB A;  3MZE A;  3UPN A;  5CEB A;  5CTM A;  2ZBB A;  1NYM A;  4JXG A;  5EV0 A;  1L0F A;  4U0X A;  5GHY A;  1VEU A;  1G6A A;  3FZC A;  3G32 A;  4EES A;  2C5W B;  3JVU A;  1JTG A;  4BJP A;  5I5L A;  2Z6D A;  2ZQA A;  2QMI A;  5EM0 A;  3A3I A;  3UB8 A;  3LY4 A;  2ZLY A;  1RCJ A;  1GHP A;  2D02 A;  3OOV A;  4F3L B;  2ZL1 A;  2KLI A;  2VZW A;  3BEC A;  1K54 C;  1TVF A;  3E2K A;  4GKU A;  2IA2 A;  5TJJ A;  5JYP A;  3CHW P;  3E4O A;  4CQH A;  4IVK A;  3LUQ A;  4GHI A;  4K0W A;  1S1Z A;  3MZF A;  3ICY A;  5AQ7 A;  2VV8 A;  4PKY G;  3FPV A;  3UE0 A;  3LR4 A;  5FI6 A;  2ZM2 A;  5M18 A;  4ESP A;  1N9N A;  5AVE A;  3LR0 A;  2H5S A;  3HUN A;  3BFF A;  4C6Y A;  1MWS A;  3NOT C;  1ES3 A;  3IS2 A;  4IBX A;  1FQG A;  4LEN A;  2W3F A;  1JTD A;  3FWL A;  4C75 A;  4JGO A;  1SDE A;  3E98 A;  1CI9 A;  5CHU A;  5AQB A;  1NYY A;  1IEM A;  1TD5 A;  2I72 A;  3UDI A;  4IJG A;  1TS7 A;  5KIZ A;  2W3D A;  4FH2 A;  4Y2F A;  4JXS A;  3W4Q A;  1O07 A;  3N8S A;  1ESI A;  5E2F A;  3ZG0 A;  4DDS A;  4N1H A;  2QYB A;  5M19 A;  1W63 Q;  3NC8 A;  4B4Z A;  3BEB A;  5J3W A;  5HPF A;  5HFO A;  1IYS A;  3M2K A;  3R4K A;  1T1C A;  4PPR A;  4EV4 A;  3MZD A;  4PM6 A;  1T18 A;  2QWS A;  5DJT A;  2JBF A;  3TOI A;  2OAQ 1;  4F94 A;  1GA9 A;  1DP8 A;  4QY5 A;  2H28 A;  2B18 A;  4OPY A;  4P0M A;  4U0T A;  1U60 A;  5HD3 A;  4YIN A;  5F82 A;  2W27 A;  3CZD A;  5M1A A;  2A24 A;  2ZMF A;  4K0X A;  2XDM A;  1P9W A;  2YKH A;  4R38 A;  3LID A;  2Y59 A;  4S2N A;  4DXB A;  4HEF A;  1BUL A;  1FSW A;  3PBR A;  2MJ6 A;  4R70 A;  2M7U A;  3T4K A;  5CEC A;  3LCE A;  1ZC2 A;  4RQ9 A;  1LSW A;  3PAE A;  1X0O A;  2NUP C;  4EWF A;  3G2Y A;  4MN7 A;  3IQA A;  3W2Z A;  2Q0O A;  5J4E A;  4QPR A;  3IX3 A;  2WKP A;  4FSF A;  2PBY A;  4OOY A;  3C7V A;  1N4O A;  2B02 A;  3WS2 A;  1KE3 A;  2PD8 A;  3ZVT A;  3UE1 A;  1LLB A;  3GSG A;  4P6B A;  3ZFZ A;  5GLD A;  5DTS A;  2EFU A;  2Y8H A;  2PD7 A;  2L1M A;  4EER A;  3OC2 A;  4H6J B;  4WN5 A;  2PYR A;  4I39 A;  1Y54 A;  5FQM A;  2K2N A;  4NXG A;  4EQ1 A;  2R9X A;  2H10 A;  3A3F A;  3CAX A;  1PW8 A;  3HLG A;  5IHV A;  4QY6 A;  4ZBE A;  1ZG6 A;  2HP6 A;  3T1Q B;  3K2N A;  1ES2 A;  2M1C A;  3UB5 P;  5AQA A;  4BL2 A;  3TSG A;  3NUL A;  4S2P A;  4R3J A;  1BLS A;  3T50 A;  2PU2 A;  1LL9 A;  1DP9 A;  3Q7V B;  1M40 A;  2WKH A;  1LHY A;  4KZ7 A;  2V0U A;  4L0L A;  5TBM A;  3E4P A;  1UWN X;  1L0D A;  1PWG A;  3CJM A;  3W8K A;  3ZHH A;  1G6O A;  3H82 B;  2VV7 A;  4K91 A;  1WE4 A;  4B93 A;  5F1G A;  4E3L A;  2LB9 A;  4ARZ B;  3QP5 A;  2JKT I;  4UA9 A;  3PBS A;  1O7E A;  1K25 A;  5CER A;  4C3Q A;  2OV5 A;  1SKF A;  4DKI A;  1CK3 A;  3E4Q A;  1XJ4 A;  1Q2P A;  4GCZ A;  1LI0 A;  4JF4 A;  4EET B;  2HGV A;  4AFI A;  5MC7 A;  2V20 A;  3WS0 A;  3C5A A;  1YMX A;  3BQA A;  1VHM A;  5JYO A;  2GZA A;  2XH9 A;  4JGP A;  1GSV A;  2ZC5 B;  5DF9 A;  2DMW A;  1ZG4 A;  4QD4 A;  5TR7 A;  3MKF A;  3V3S A;  2GX5 A;  3T4Q A;  2EX9 A;  2LB5 A;  2QPN A;  3MQ0 A;  2PR6 A;  1XX2 A;  3PBO A;  1XP4 A;  1XPB A;  3AGE A;  3F1N B;  3N7W A;  4Q0I A;  5L10 A;  5EOE A;  4XT2 A;  2JC7 A;  4MN5 A;  1TDL A;  3L7H A;  2V1B A;  1XA1 A;  3P98 A;  4OOL A;  3OCL A;  4OLG A;  3T1R A;  3V67 A;  3BQ8 A;  4QWO A;  4WBG A;  4QHC A;  1BSG A;  4JXW A;  3T1X A;  1KGF A;  2EA9 A;  2WUQ A;  1T19 A;  2ZOI A;  4Y3I A;  3Q7Z A;  4X69 A;  1K57 A;  4I3I A;  2XA7 M;  3MFD A;  2WKI A;  4R3A A;  4R4R A;  2GJ3 A;  3HJK A;  4DE0 A;  4E6W A;  5FQJ A;  4WZ5 C;  4LCM A;  5IT5 A;  3TRC A;  5FI7 A;  1PRQ A;  3V39 A;  3BLM A;  2WAF A;  2QKP A;  4EQI A;  1N9B A;  3NHQ A;  3WS5 A;  1E4D A;  2ZQD A;  3VSK A;  3IT9 A;  1FCN A;  1KGG A;  2WKR A;  3BFC A;  4FCF A;  4HJ4 A;  3VP1 A;  3TG9 A;  2BTF P;  1K0K A;  4JF6 A;  4Q0J A;  4PM9 A;  4ME4 A;  2VEA A;  1NRF A;  3FC7 A;  1WYC A;  1FR6 A;  4U3T A;  2HJE A;  1NWZ A;  2X71 A;  4EXO A;  2KDK A;  5EOO A;  3LIF A;  1NLY A;  3SS4 A;  3G35 A;  1AXB A;  1S4R A;  4IUK A;  3UMD A;  1XJ2 A;  3KYZ A;  4HI4 A;  2G7U A;  1P9R A;  3T4T A;  3U2A A;  3VFH A;  3HVF A;  4QB8 A;  3KSI A;  2ZQC A;  3BFD A;  1CEF A;  4HBT A;  3BYD A;  1TDG A;  1D7E A;  1YSP A;  4RVA A;  2VGL M;  3OCN A;  3UN7 A;  3G2Z A;  3ZNT A;  1PWC A;  2G2U A;  4HP4 A;  3C38 A;  3IBR A;  3PHY A;  2Y2N A;  1KE0 A;  1CF0 A;  2EXA A;  3QNB A;  1BYW A;  4FUW A;  4WL9 A;  1BZA A;  2JKG A;  4Y17 A;  3SS5 A;  2HP5 A;  2JCH A;  4PHT A;  4EU0 A;  4XXR A;  2QJ7 A;  4FOF A;  2A3U A;  4L9G A;  3OPR A;  5DFY A;  4LRZ E;  3EQV A;  1OJG A;  3R7W B;  4A5R A;  2XLN A;  5DTK A;  4OP5 A;  1YMS A;  1F5M A;  1IOU A;  3B33 A;  2ZQ9 A;  4D60 A;  3VP3 A;  5G4Z A;  5DF7 A;  5FA7 A;  3G31 A;  2W1T A;  1CI8 A;  3FYZ A;  4P6Z S;  5HPI A;  1F9I A;  4ETZ A;  1ONG A;  1NXY A;  3BRM A;  3ZQ5 A;  2Y2G A;  5FAO A;  4B88 A;  3C2W A;  2WK0 A;  1S67 L;  4S2N C;  2EXB A;  5F5Y A;  4N92 A;  3A3D A;  4HHD A;  1UWP X;  3IF6 C;  4Y0U A;  2O99 A;  3T4S A;  1M6K A;  1YM1 A;  1QMF A;  3JPU A;  3ZCZ A;  1MXO A;  4FTX A;  4ZJ1 A;  4CPK A;  2Y55 A;  3EEH A;  3IHA A;  3M2J A;  3MXQ A;  4I3A A;  3MMH A;  3FKV A;  2HZ5 A;  4E3J A;  5HWW A;  4HQA A;  1LSX A;  4E6X A;  2Z2L B;  1OTI A;  2WGW B;  4KG6 A;  5L07 A;  2B95 A;  2E8I A;  2R78 A;  2VKS A;  3A0S A;  3P7N A;  1LT0 A;  4QU3 A;  1Y4O A;  5FDH A;  3H7W A;  3AGF A;  3N4I A;  2HDQ A;  5A93 A;  3DWK A;  1ODV A;  4E3I A;  3A3J A;  2J8Y A;  1YLP A;  2XR0 A;  3Q82 A;  1VQQ A;  4X1M A;  4RX3 A;  3D4F A;  3PTE A;  3RXW A;  4FD8 A;  5D3O A;  4G3V A;  2XRO A;  3S1Y A;  3GQZ A;  3HRE A;  1N9L A;  4GN2 A;  2WZZ A;  5G18 A;  4HP9 A;  1T1A A;  4N9K A;  5HDC A;  4HIA A;  3UNW A;  1EWZ A;  1F98 A;  3BY8 A;  1G28 A;  1IFQ A;  1OTA A;  2DRW A;  1DP6 A;  1YKD A;  2C6W B;  5A90 A;  4CJN A;  2X01 A;  3ITA A;  3PXP A;  1CJF A;  2V2F F;  4P85 A;  2PYP A;  2RL3 A;  2J3W A;  3LIC A;  3BFE A;  2ZL1 B;  5GL9 A;  2OLU A;  3OLO A;  1BUE A;  3CLO A;  4ZJ3 A;  3I7J A;  3GRJ A;  4LV1 A;  3BW6 A;  4S2O A;  3IXH A;  4OH0 A;  4Q0H A;  4BLM A;  2VA0 A;  2HDS A;  2EX6 A;  1VET A;  4GHI B;  3UPP A;  1G68 A;  4S2J A;  3KSH A;  4YFM A;  3MF0 A;  5E2G A;  1HD8 A;  3HLD A;  2EWW A;  2HP9 A;  3E0Y A;  1K55 C;  3ZG7 B;  5EVI C;  3NCK A;  3CPT A;  1YT4 A;  3IS2 B;  1YLZ A;  4GW9 A;  5E2H A;  2K31 A;  1P97 A;  5HDD A;  3S22 A;  1HZO A;  3P01 A;  3ZNY A;  4WEJ A;  4GS9 A;  4CLC D;  2A2L A;  5FDS A;  1N9O A;  3G4P A;  2P9V B;  3DTE A;  4O01 A;  3LIB A;  3VSL A;  3B47 A;  1SHV A;  4Y0T A;  4KUO A;  4DRT A;  3RTY A;  3G34 A;  5KZH A;  3EGX C;  5HAQ A;  2Y91 A;  3T4L A;  3Q07 A;  4PM7 A;  3IXG A;  1QME A;  1MY8 A;  3KYE A;  2VJW A;  3VFF A;  3GMW A;  4KQQ A;  1I5Q A;  4L9F A;  3BFG A;  4E3K A;  4II7 A;  1FOF A;  3QP2 A;  4JGR A;  3WRZ A;  4DMZ A;  1IYO A;  4Q8I A;  3UE3 A;  3RXX A;  1KGE A;  2OLV A;  1K57 C;  3C30 A;  4GZB A;  4JBF A;  5FQQ A;  4BQM A;  3WRT A;  3QHY A;  1H8Z A;  4UQI S;  2RCX A;  1K56 D;  4GNU A;  1BLP A;  1AWI A;  2WKQ A;  2A24 B;  2OWH A;  2PR5 A;  2JE5 A;  2ZQ7 A;  4HNB A;  4GB7 A;  3EGD C;  1YLT A;  2V1Z A;  3IF6 B;  4KQO A;  3UB9 A;  1DJC A;  4ID4 A;  3N8R A;  3KSG A;  2Y2I A;  3VOL A;  2PHY A;  5F1F A;  1K54 A;  3AGD A;  2XEP A;  1PI5 A;  1IYQ A;  5E43 A;  5EUA A;  3FPW A;  4DDY A;  1FIL A;  3JVV A;  3O5Y A;  1V9Z A;  3V5M A;  2ZC6 B;  4GJ4 A;  4Y13 A;  2PBD P;  5EE8 A;  3T12 B;  3G30 A;  2J3T D;  3G6O A;  4HES A;  1FIK A;  2FFF B;  1L3L A;  4WEK A;  1XXM A;  1OTE A;  4LV3 A;  4IUH A;  3UPO A;  1ERQ A;  4JF5 A;  4M4X A;  5FL3 A;  1OT6 A;  5AJG A;  3VOY A;  4IBR A;  4PM5 A;  4JGQ A;  1XFQ A;  5LBR A;  1D06 A;  3C4P A;  4UA7 A;  2B5R A;  3V50 A;  1KOU A;  4CLC A;  2D01 A;  3L9K A;  2V9A A;  2ZM8 A;  3D72 A;  2M7V A;  4I3J A;  3IWQ A;  4DN0 A;  4NKP A;  1NLZ A;  1A0K A;  4KZ3 A;  1J9M A;  3LYX A;  4DJ2 A;  1IKG A;  2V0W A;  1TS8 A;  4MLL A;  1W8Q A;  1IEL A;  3OBF A;  5HSQ A;  3O86 A;  4BD1 A;  4DF6 A;  5CGX A;  1DY6 A;  4QJG A;  2KX6 A;  4KZ9 A;  2X02 A;  1L2S A; 
#chains in the Genus database with same CATH homology
 1EI5 A;  5HW3 A;  4B4X A;  1TVF A;  3E2K A;  4GKU A;  4ZDX A;  3IH8 A;  2Y2N A;  2J9P A;  1KE0 A;  5JYP A;  5FQK A;  1ALQ A;  5FAP A;  3SH7 A;  3ZG9 B;  1K56 A;  2EXA A;  1RGZ A;  3QNB A;  2XQZ A;  1OME A;  2XFS A;  4IVK A;  4K0W A;  3DTM A;  5CGS A;  4X6T A;  1BZA A;  3MZF A;  2Y2K A;  4PM8 A;  5AQ7 A;  3SS5 A;  4FH4 A;  4ZJ2 A;  2HP5 A;  2JCH A;  4N1X A;  3UE0 A;  4WEL A;  3IXD A;  4Y0O A;  1JWV A;  5CHJ A;  3ZGA B;  3M6H A;  2ZM2 A;  3N8L A;  2VGK A;  4XXR A;  4UAA A;  5FI6 A;  5M18 A;  3ZVW A;  1HTZ A;  2A3U A;  3Q7V A;  4OLD A;  5EVI B;  3OPR A;  2H5S A;  3GV9 A;  3HUN A;  4X53 A;  3BFF A;  4NK3 A;  4C6Y A;  1MWS A;  4BEN A;  1ES3 A;  3EQV A;  4N9L A;  4IBX A;  1FQG A;  4A5R A;  5KSH A;  2XLN A;  3Q81 A;  4LEN A;  1MPL A;  1JTD A;  3FWL A;  3HUM A;  5DTK A;  1RGY A;  1MWT A;  4ZAM A;  4OP5 A;  3ZDJ A;  1YMS A;  5L2F A;  4C75 A;  1Z6F A;  1SDE A;  3ZG8 B;  1CI9 A;  4KG5 A;  5CHU A;  3VOZ A;  2ZQ9 A;  5AQB A;  1YQS A;  3VP3 A;  5I94 A;  1NYY A;  5DF7 A;  5FA7 A;  2XK1 A;  3O87 A;  1IEM A;  3G31 A;  3UY6 A;  3GTC A;  2UWX A;  5DVA A;  1CI8 A;  3FYZ A;  2I72 A;  3UDI A;  2Y2H A;  1ONG A;  1NXY A;  4RX2 A;  3NY4 A;  3FKW A;  3BRM A;  2Y2G A;  4FH2 A;  5FAO A;  2FFY A;  4JXS A;  1E3U A;  3W4Q A;  1O07 A;  3N8S A;  3ISG A;  5E2E A;  1ESI A;  5E2F A;  4B88 A;  3M6B A;  3ZG0 A;  2BG1 A;  2WAD A;  2IWD A;  4N1H A;  4R23 A;  2WK0 A;  4DDS A;  5M19 A;  2Y2O A;  3NC8 A;  4EBL A;  4X55 A;  4S2N C;  4B4Z A;  3BEB A;  2EXB A;  5HFO A;  5HAP A;  1GHM A;  1IYS A;  1MWR A;  1S6R A;  5KMW A;  4KG2 A;  4N92 A;  3A3D A;  2WYX A;  4ZTK A;  3IF6 C;  3M2K A;  4Y0U A;  1MKI A;  1CEG A;  1M6K A;  1YM1 A;  4PPR A;  3MZD A;  4PM6 A;  4EV4 A;  1QMF A;  1K38 A;  4Z9Q A;  3WWX A;  2JBF A;  3TOI A;  4S2L A;  1C3B A;  1MXO A;  3ZCZ A;  4ZJ1 A;  4CPK A;  2Y55 A;  2H0T A;  4F94 A;  1GA9 A;  4QY5 A;  4P87 A;  3IHA A;  4R3B A;  3M2J A;  3LY3 A;  1FCO A;  4KEN B;  1PZO A;  5HX9 A;  4OPY A;  4P0M A;  4LCL A;  2XF3 A;  1U60 A;  3FKV A;  4U0T A;  4S2M A;  1K6S A;  5FI2 A;  2XD5 A;  1H5X A;  4HBU A;  3O3V A;  4D2O A;  1W7F A;  4YIN A;  1S0W A;  4WYY A;  4E3J A;  5F82 A;  4WM9 A;  3IWO A;  3IXB A;  1BLH A;  2Q9M A;  3CZD A;  1H8Y A;  5M1A A;  4E6X A;  1IYP A;  2Z2L B;  4K0X A;  2XDM A;  2WGW B;  1K4E A;  4KG6 A;  2DCF A;  3MKE A;  2E8I A;  1Q2Q A;  2Y59 A;  4S2N A;  4MBF A;  4DXB A;  4HEF A;  1L0E A;  1PW1 A;  4QU3 A;  1JWP A;  5FDH A;  3CMZ A;  1BUL A;  2XGN A;  1FSW A;  3AGF A;  3N4I A;  3PBR A;  4KZ8 A;  2HDQ A;  1GHI A;  1K55 A;  3DWK A;  5EVI A;  5A93 A;  5CEC A;  1JVJ A;  4DE1 A;  3LCE A;  1ZC2 A;  1WYB A;  4IED A;  4E3I A;  3BM6 A;  3A3E A;  2IWB A;  3A3J A;  2J8Y A;  5BOH A;  1YLP A;  1IKI A;  2XR0 A;  3Q82 A;  1VQQ A;  3HUO A;  4RX3 A;  1BT5 A;  3JYI A;  3PAE A;  3D4F A;  2ZD8 A;  3HLB A;  3PTE A;  3RXW A;  3ZNT A;  4FD8 A;  3MXR A;  5D3O A;  3B3X A;  3QNC A;  3G2Y A;  4EWF A;  4UHU A;  4OP8 A;  4E3N A;  3IQA A;  3OPH A;  3S1Y A;  1PYY A;  1ERM A;  3GQZ A;  3HRE A;  5DTT A;  3WS4 A;  2GDN A;  4FSF A;  4RYE A;  5EPH A;  2PBY A;  5F83 A;  3DW0 A;  3GR2 A;  4OOY A;  2CC1 A;  3C7V A;  4OQI A;  4KZ5 A;  4OVD A;  1N4O A;  4XUX A;  5FQI A;  4GN2 A;  2A49 A;  2WZZ A;  3WS2 A;  5G18 A;  4GOG A;  1KE3 A;  3HLC A;  4N9K A;  5KSC A;  1YLW A;  4OQG A;  3ZVT A;  3UNW A;  5J8X A;  4OKP A;  3UE1 A;  1LLB A;  1EWZ A;  2EX2 A;  3GSG A;  4P6B A;  3ZFZ A;  5GLD A;  4DXC A;  4PMA A;  3V3R A;  5DTS A;  2EFU A;  3HLF A;  4LV2 A;  2DRW A;  1KVL A;  2WAE A;  5A90 A;  2C6W B;  1K6R A;  4CJN A;  5CHM A;  3OC2 A;  4JKT A;  4WMC D;  5GLC A;  2X01 A;  1ONH A;  4RA7 A;  3ITA A;  2Y2M A;  2V2F F;  4P85 A;  4KZB A;  2Y2P A;  2ZMA A;  2RL3 A;  1Y54 A;  5TGF A;  3BFE A;  1ES5 A;  4R1G A;  5FQM A;  5GL9 A;  3EQU A;  1K4F A;  2OLU A;  2Z2M B;  2Y2L A;  1BUE A;  2R9X A;  2H10 A;  3A3F A;  4X56 A;  4ZJ3 A;  3I7J A;  3GRJ A;  5CGW A;  1PW8 A;  4LV1 A;  3HLG A;  3UO9 A;  4S2O A;  2R9W A;  2IWC A;  5IHV A;  3IXH A;  4OH0 A;  5EEC A;  3OPP A;  4BLM A;  4JLF A;  2P74 A;  1ESU A;  4QY6 A;  2HDS A;  2EX6 A;  1ZG6 A;  4ZBE A;  2HP6 A;  1MBL A;  3UPP A;  1G68 A;  1HVB A;  4S2J A;  4WZ4 A;  1ES2 A;  4R0Q A;  3ZG5 A;  5AQA A;  4BL2 A;  3TSG A;  3VP0 A;  4YFM A;  4S2P A;  4R3J A;  4GDN A;  5E2G A;  1SDN A;  1HD8 A;  3HLD A;  3NDG A;  1BLS A;  3S4X A;  3NI9 A;  2HP9 A;  2ZC3 B;  4JPM A;  2PU2 A;  1K55 C;  1LL9 A;  5EVI C;  2XFT A;  3ZG7 B;  3NCK A;  1XGJ A;  1PZP A;  1M40 A;  3Q7V B;  2BLS A;  2WKH A;  5A91 A;  1LHY A;  4KZ7 A;  2Y2Q A;  4GD8 A;  1LL5 A;  1YT4 A;  1DJB A;  1YLZ A;  3UDF A;  4L0L A;  2ZQ8 A;  2XD1 A;  5E2H A;  4GD6 A;  3VMA A;  1L0D A;  1PWG A;  2Q9N A;  3CJM A;  3S22 A;  1PI4 A;  3W8K A;  1HZO A;  4S2I A;  5CXW A;  4OPQ A;  3ZHH A;  5CTN A;  4R4S A;  1LI9 A;  3WS1 A;  3ZNY A;  3MXS A;  4WEJ A;  4K91 A;  1NJ4 A;  1WE4 A;  1ES4 A;  2HPB A;  5F1G A;  2EX8 A;  4MEZ A;  4OQ0 A;  3G4P A;  5U47 A;  4E3M A;  4E3L A;  1KVM A;  2P9V B;  4OPR A;  2J7V A;  1FR1 A;  2G2W A;  3VSL A;  4UA9 A;  3PBS A;  1SHV A;  1VM1 A;  4Y0T A;  4BL3 A;  4DRT A;  1O7E A;  1K25 A;  5CER A;  4C3Q A;  2OV5 A;  1YLJ A;  1SKF A;  1W5D A;  1CK3 A;  3G34 A;  4UA6 A;  1Q2P A;  1PWD A;  2HDR A;  4DKI A;  1LI0 A;  1NZO A;  5KZH A;  4JF4 A;  2ZM0 A;  2WGV A;  1W79 A;  4LV0 A;  3MBZ A;  3CG5 A;  4M3K A;  2DNS A;  5HAQ A;  2Y91 A;  2V20 A;  3Q07 A;  4PM7 A;  3WS0 A;  3C5A A;  1YMX A;  3IXG A;  3BLS A;  1QME A;  1MY8 A;  5CRF A;  3VFF A;  3N6I A;  3GMW A;  4KZ6 A;  4KQQ A;  1I5Q A;  5JYO A;  5GHX A;  2XH9 A;  3BFG A;  2ZC5 B;  4E3K A;  5DF9 A;  1FOF A;  1NZU A;  3IWI A;  1ZG4 A;  4OON A;  3WRZ A;  2Y2J A;  1IYO A;  1BTL A;  2ZC7 A;  1L0G A;  3IF5 A;  4Q8I A;  1FCM A;  3UE3 A;  3RXX A;  4QD4 A;  3Q1F A;  5TR7 A;  1XA7 A;  1KGE A;  2OLV A;  3MKF A;  3PBT A;  3SOI A;  1K57 C;  3V3S A;  1ZKJ A;  2EX9 A;  4GZB A;  4OPZ A;  1SCW A;  2QPN A;  4JBF A;  5FQQ A;  1XX2 A;  4BQM A;  3PBO A;  3WRT A;  1XP4 A;  1XPB A;  3PBQ A;  3QHY A;  1PIO A;  4MNR A;  3W4O A;  3AGE A;  3N7W A;  1KE4 A;  2Y4A A;  1H8Z A;  2RCX A;  3GVB A;  1K56 D;  2H0Y A;  4GDB A;  5EOE A;  5FAQ A;  1GCE A;  4GNU A;  1BLP A;  2OSU A;  4X68 A;  3SH8 A;  4KZ4 A;  3HLW A;  2JC7 A;  2QZ6 A;  4OOM A;  5TFQ A;  1KDS A;  3OZH A;  3SS3 A;  1TDL A;  4E3O A;  1XA1 A;  3P98 A;  4OOL A;  3OCL A;  3PBN A;  2JE5 A;  4OLG A;  4WMC A;  4H8R A;  2WKE A;  2ZQ7 A;  4GB7 A;  1JWZ A;  3NDE A;  1L2S A;  1YLT A;  2V1Z A;  3IF6 B;  3NBL A;  1BSG A;  4JXW A;  4QHC A;  4WBG A;  1FSY A;  4KQO A;  1DJC A;  2PU4 A;  1KGF A;  5A92 A;  3P09 A;  4ID4 A;  2WUQ A;  3N8R A;  1KDW A;  5FQ9 A;  3LO7 A;  4Y7P A;  3Q7Z A;  5FSR A;  4X69 A;  2Y2I A;  1K57 A;  5F1F A;  4XUZ A;  3MFD A;  2WKI A;  1K54 A;  2VGJ A;  3AGD A;  2XEP A;  4BD0 A;  2WZX A;  1PI5 A;  1IYQ A;  1XGI A;  4R4R A;  5E43 A;  5EUA A;  4DE0 A;  1E25 A;  4E6W A;  5FQJ A;  3IH9 A;  4WZ5 C;  3VP2 A;  4DDY A;  4LCM A;  5FI7 A;  3V39 A;  5HL1 A;  3V5M A;  2ZC6 B;  3BLM A;  2WAF A;  1MWU A;  4EQI A;  2WGW A;  3HL9 A;  3SH9 A;  5EE8 A;  1N9B A;  2P9V A;  2J9O A;  3G30 A;  1I2S A;  1E4D A;  1NY0 A;  3NIA A;  2ZQD A;  3VSK A;  3LEZ A;  3WS5 A;  3DWZ A;  2EFX A;  3IT9 A;  1FCN A;  4HES A;  2FFF B;  5AQ9 A;  4WEK A;  1KGG A;  5FAT A;  1RP5 A;  3VP4 A;  1XXM A;  3BFC A;  4FCF A;  4OQH A;  3W4P A;  2HDU A;  4LV3 A;  3C7U A;  3VP1 A;  4IVI A;  5CED A;  1E3U D;  1DJA A;  3TG9 A;  3O88 A;  4JF6 A;  3UPO A;  3RJU A;  4PM9 A;  1ERQ A;  1GA0 A;  3C4O A;  1NRF A;  4JF5 A;  1ERO A;  4EBN A;  2ZJ9 A;  3E2L A;  3VOY A;  4DE3 A;  4IBR A;  5GHZ A;  4PM5 A;  5HAR A;  1WYC A;  1FR6 A;  4U3T A;  4DE2 A;  3C4P A;  4UA7 A;  2B5R A;  5GLB A;  1XKZ A;  2X71 A;  3V50 A;  5FAS A;  3FV7 A;  1BLC A;  4WZ5 A;  5EOO A;  3HBR A;  4EBP A;  4S2K A;  3ITB A;  3MZE A;  5HAI A;  3UPN A;  4JXV A;  3SS4 A;  1YLY A;  4NET A;  5CEB A;  5DF8 A;  1TEM A;  5CTM A;  3UDX A;  1W8Y A;  2WGI A;  3G35 A;  2ZM8 A;  1AXB A;  1NYM A;  4JXG A;  1L0F A;  4U0X A;  5GHY A;  3IWQ A;  2ZC4 B;  1G6A A;  3FZC A;  3G32 A;  2C5W B;  3IHB A;  4O7D A;  1JTG A;  4KZ3 A;  1J9M A;  4MBH A;  4BJP A;  3VFH A;  3HVF A;  4KQR A;  4QB8 A;  5GLA A;  2ZQA A;  2ZQC A;  3OPL A;  2QMI A;  3G2Z A;  3BFD A;  3A3I A;  1I2W A;  1CEF A;  3LY4 A;  1IKG A;  2ZLY A;  4HBT A;  3PAG A;  5EVL A;  1RCJ A;  1GHP A;  4MLL A;  3BYD A;  1W8Q A;  1TDG A;  4EUZ A;  4KZA A;  3IF6 A;  1IEL A;  4RVA A;  3O86 A;  4BD1 A;  3HLE A;  4DF6 A;  5CGX A;  5EVI D;  1DY6 A;  4QJG A;  3OCN A;  4KZ9 A;  2X02 A;  3UN7 A;  3BEC A;  1K54 C;  4MBK A;  1PWC A;  2G2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...