2JC7A

The crystal structure of the carbapenemase oxa-24 reveals new insights into the mechanism of carbapenem-hydrolysis
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
244
structure length
244
Chain Sequence
HISSQQHEKAIKSYFDEAQTQGVIIIKEGKNLSTYGNALARANKEYVPASTFKMLNALIGLENHKATTNEIFKWDGKKRTYPMWEKDMTLGEAMALSAVPVYQELARRTGLELMQKEVKRVNFGNTNIGTQVDNFWLVGPLKITPVQEVNFADDLAHNRLPFKLETQEEVKKMLLIKEVNGSKIYAKSGWGMGVTPQVGWLTGWVEQANGKKIPFSLNLEMKEGMSGSIRNEITYKSLENLGII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE OXA-24
publication title Crystal Structure of the Carbapenemase Oxa-24 Reveals Insights Into the Mechanism of Carbapenem Hydrolysis.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Hydrolase
total genus 81
structure length 244
sequence length 244
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2006-12-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2jc7A00
3ZDJA 3IXGA 5EUAA 2ZQCA 2ZD8A 4X6TA 5I94A 1W8QA 1HVBA 3HLEA 3N6IA 4S2JA 4N92A 4O7DA 1XA1A 5CEBA 5EVIC 1OMEA 2ZM8A 2EFUA 5A90A 2EX9A 2H5SA 3O87A 1KVLA 1PZPA 4S2PA 5GL9A 3VP3A 3ZFZA 4DRTA 1J9MA 5F82A 3VOZA 1EWZA 3IXBA 4N1XA 4S2MA 3G34A 1S0WA 3W4QA 4OOLA 2FFFB 4UHUA 3ITAA 3FZCA 3MXRA 3PAEA 2WK0A 3ZGAB 2ZQDA 2ZC3B 2WKEA 4JF4A 2HP9A 1LL5A 3MZEA 2WGWA 4NETA 5FATA 4GB7A 2ZQ7A 4BQMA 5CXWA 3N8LA 4EBPA 4U0TA 1YQSA 3CJMA 4BL2A 2QZ6A 1WYCA 2G2UA 5E2FA 4DXCA 3Q81A 3CZDA 3C7UA 5CTNA 4JXVA 4ZDXA 3HUOA 4EUZA 2J8YA 4YFMA 1BUEA 1K25A 1NZUA 4KZ7A 2IWBA 1L0DA 5HAQA 4LCLA 4DDYA 2EXAA 2I72A 4WZ5A 2X71A 3O3VA 3FKVA 4JBFA 2EX2A 4D2OA 1FOFA 3A3EA 5U47A 3Q82A 4R4RA 4OP5A 1SDNA 4MEZA 3FWLA 5FA7A 5M1AA 1PZOA 2XFTA 3N8RA 2Q9MA 4FSFA 4S2OA 5DVAA 5AQAA 3RJUA 3E2KA 3WS4A 3I7JA 1IYOA 1SCWA 4P87A 2G2WA 1K6RA 2C6WB 3TSGA 1K55A 4KZ8A 3UNWA 1MBLA 3HBRA 4ZJ3A 2ZM0A 2WADA 3C4OA 4XUXA 2HDRA 4MBKA 4OPRA 3EQUA 3G35A 1KE0A 1PW8A 1BLHA 4MBFA 4EBLA 3DW0A 4WZ5C 4E3MA 3A3DA 2ZMAA 2XQZA 3AGFA 2ZJ9A 1DJCA 2VGKA 3S4XA 4JPMA 1IELA 3UDIA 3GTCA 3AGEA 4XUZA 5EVID 2HP5A 3ZG9B 3TOIA 1GA0A 2XGNA 2E8IA 3MKFA 3FV7A 4E3LA 1VM1A 1K54C 3A3JA 3FYZA 4KZ9A 5EOEA 5HARA 3C4PA 4GNUA 4ZJ2A 4C6YA 4DE1A 5AQBA 4PM5A 5HX9A 4JLFA 1K55C 2ZC5B 3MKEA 2XLNA 4OP8A 4Y7PA 3WS2A 1QMFA 5JYOA 2OLUA 3LCEA 1YLZA 4DDSA 2XR0A 3UDFA 5GHZA 1HD8A 2BG1A 1E3UA 3RXWA 4IEDA 1CI8A 3VSLA 4WZ4A 1ZG4A 3OPPA 4IVKA 4KQRA 1IKGA 5CTMA 3VFFA 5F1GA 3ZNYA 5TFQA 2ZC6B 3Q07A 4PM9A 2Y2GA 3EQVA 1JWZA 2EXBA 1TVFA 3VSKA 3C7VA 1Q2PA 1CEFA 4OPQA 1FCOA 1ES3A 4OQHA 4UA6A 1HZOA 1Z6FA 1NYYA 4LENA 3LO7A 1LLBA 2FFYA 5CEDA 1XXMA 3W8KA 4JF5A 5FASA 1W8YA 1WYBA 3PTEA 5FI2A 2H10A 4LV1A 2XFSA 2ZM2A 3BFCA 3ZG8B 4QHCA 2Y2NA 1SKFA 5FQ9A 3V3RA 1ESIA 2WAEA 3IF6A 2EX8A 3AGDA 4E3KA 2V1ZA 1HTZA 3BFEA 4OVDA 3OCLA 3BFGA 4LV0A 3HLDA 1SDEA 4OPZA 4PMAA 5DTSA 4EQIA 1PYYA 1W5DA 2IWCA 1I2SA 1YMSA 2J7VA 3HLWA 5DF9A 5A91A 3IH9A 5KZHA 2BLSA 5CHUA 1LHYA 3Q7VA 3DWKA 2XF3A 3MBZA 3WRZA 3D4FA 3GR2A 3OPRA 4OQIA 1L0EA 1WE4A 1BZAA 5GLDA 4CPKA 1MWUA 5AQ7A 5GLAA 3RXXA 2C5WB 2P9VA 3UPNA 3ZVTA 2WAFA 1KGEA 4H8RA 3MZFA 3G4PA 1ESUA 1ES4A 2XD1A 3QNBA 3WS1A 5A92A 3ISGA 4EBNA 4N9KA 4OLDA 2PU2A 2WGIA 3IF6C 4Y0UA 3IHBA 2PU4A 4HBUA 5KSHA 1MWRA 4GOGA 5E2HA 5GLBA 4JKTA 4CJNA 2Y2KA 1L2SA 4HESA 4X69A 4OONA 5CGXA 5EE8A 1XKZA 4WBGA 3W4OA 3SH7A 3SH8A 4FH2A 1MWSA 2Y2PA 5CRFA 1YM1A 4E3IA 1K56D 1EROA 3M2KA 1XX2A 4RYEA 5A93A 5FQMA 3GVBA 4S2LA 5TR7A 3E2LA 5J8XA 3UY6A 3GV9A 4ZBEA 1TDGA 3NC8A 3N8SA 1Q2QA 3IT9A 3LY4A 2WZZA 4WYYA 1BT5A 1XGJA 1JWPA 4IBRA 5IHVA 3WRTA 5GHYA 1EI5A 1U60A 2HP6A 4QU3A 1MKIA 1PI5A 1BLSA 4X56A 3PBTA 3N7WA 3CMZA 5E43A 4JXWA 4KZ5A 3NIAA 3VFHA 4B4XA 1IKIA 5D3OA 3BM6A 1IEMA 4E3NA 2JCHA 1ONHA 1IYQA 2JE5A 1W7FA 3BFDA 5HAIA 3MFDA 4M3KA 4C3QA 1K6SA 3V50A 4DE0A 4QY6A 1S6RA 4N9LA 2HPBA 1W79A 3P09A 1JTDA 4GN2A 2RCXA 1BLPA 3A3FA 1YLPA 2H0YA 1ZG6A 5FDHA 1K4EA 3V39A 4K0XA 4QY5A 1NJ4A 3UO9A 4XXRA 5EVIB 1YMXA 4ZTKA 4WEJA 1VQQA 3G2YA 5CHMA 3C5AA 3A3IA 3JYIA 3ZG0A 3OCNA 4UA7A 5EECA 2Y91A 5DF8A 2UWXA 3PBQA 4DF6A 3O88A 1KDWA 3DWZA 1FR6A 1ONGA 1XP4A 3MXSA 4FCFA 4PM8A 4E3OA 1PWCA 5L2FA 1N9BA 1JVJA 2Q9NA 1FR1A 4EWFA 4WMCA 3UPOA 1CEGA 1LI9A 4BD1A 1ERMA 1BLCA 1XA7A 4Y0OA 3IH8A 2VGJA 4YINA 1QMEA 3QHYA 3V5MA 3HUMA 2Y59A 4BL3A 4QJGA 4E3JA 4WM9A 1N4OA 1CK3A 4KZAA 2RL3A 3HLCA 1NRFA 4OOMA 3ZCZA 5FAQA 3ZVWA 3CG5A 4R4SA 4Y0TA 3FKWA 4KZ4A 4LV3A 3IWIA 3W4PA 4KG6A 3BLMA 4KQOA 5FQIA 4HEFA 2EX6A 1ES2A 5M18A 3BECA 3HLGA 3SS3A 1JWVA 5FAPA 2P74A 1YLJA 2Y2OA 3M6BA 4GZBA 3NBLA 4N1HA 3LY3A 3HLFA 4IVIA 1O7EA 2DRWA 2XDMA 4FH4A 5DTTA 3V3SA 1H8YA 4JF6A 3O86A 5EVLA 5CHJA 3UE1A 3S1YA 2ZC4B 4WELA 4R1GA 4S2IA 2WKHA 5HAPA 3B3XA 3OPHA 3OZHA 2J9PA 3HREA 4GD8A 1PI4A 2Y4AA 4ZAMA 2WGWB 1ERQA 4X68A 2ZC7A 2B5RA 1NXYA 4LCMA 4R0QA 3IXDA 5JYPA 4HBTA 3ZG7B 1MPLA 2QPNA 2ZQ9A 3UE0A 4RVAA 4KZBA 2Z2LB 3HLBA 2QMIA 3NCKA 4GD6A 2XK1A 3BLSA 4OH0A 2OV5A 1RP5A 5KSCA 2OLVA 3NI9A 3TG9A 5DF7A 1ZKJA 2CC1A 1LI0A 2JC7A 3LEZA 4DXBA 1NZOA 3S22A 5AQ9A 4RX2A 4KQQA 2JBFA 3G31A 2GDNA 1G6AA 4JXSA 4U0XA 4P85A 3HVFA 5HW3A 5F1FA 4GDBA 3OPLA 5F83A 1KDSA 3M6HA 2DNSA 2Y2LA 4LV2A 4P6BA 3G2ZA 4WEKA 4OQ0A 3IF5A 1BULA 2R9XA 4S2KA 1FQGA 2WGVA 2A49A 2WZXA 4F94A 1LL9A 2A3UA 1IYSA 1GHMA 4KG5A 5FAOA 3IQAA 2R9WA 4ZJ1A 5CGWA 1MWTA 1BSGA 2H0TA 2WKIA 3BFFA 4IBXA 5EPHA 1M6KA 1MY8A 1XGIA 4R3BA 5FI6A 3BYDA 1ES5A 1NYMA 1L0GA 1CI9A 3NY4A 5BOHA 2Y2QA 3HL9A 3GQZA 3G32A 5FQJA 4BD0A 4DE3A 5KMWA 4BENA 1MXOA 5GLCA 4KG2A 5GHXA 4UAAA 3BRMA 2OSUA 4GDNA 3SS4A 3VMAA 1RGZA 1XPBA 1YLTA 5EOOA 1E3UD 3GRJA 4OQGA 1FCMA 1FCNA 1K38A 1PWGA 1E25A 4WMCD 3N4IA 4E6XA 3PBRA 3VP4A 1YLYA 1L0FA 2V20A 2ZQ8A 3ZG5A 5M19A 4MBHA 3Q1FA 4JXGA 1E4DA 3WWXA 4B88A 1ALQA 1RGYA 3VP2A 1K54A 1Y54A 1KGGA 5FI7A 5E2GA 4Z9QA 4DKIA 5FQKA 3VOYA 4KENB 4OLGA 2J9OA 1TDLA 2ZQAA 1TEMA 3OC2A 3UPPA 4C75A 3UN7A 3IWQA 4U3TA 4K91A 3Q7ZA 2ZLYA 3IWOA 2PBYA 1K56A 2HDQA 3G30A 3P98A 4X55A 4E6WA 1I2WA 4X53A 2XH9A 4R23A 5E2EA 5FSRA 1O07A 4GKUA 4NK3A 1JTGA 3DTMA 5DTKA 3IF6B 3QNCA 3NDEA 1G68A 3HUNA 4S2NA 5G18A 5HL1A 4KZ3A 1GHIA 1KGFA 1BTLA 4B4ZA 4A5RA 4MNRA 1KE4A 4K0WA 2HDSA 1IYPA 2Y2HA 2Y2JA 3GMWA 1GCEA 2HDUA 1AXBA 3PAGA 3Q7VB 4P0MA 4QD4A 3SH9A 3VP0A 3ITBA 1I5QA 1FSYA 5CGSA 5CECA 2P9VB 4BJPA 3PBOA 5HFOA 1K57A 1KVMA 4FD8A 3MZDA 1DY6A 4Q8IA 1DJAA 2V2FF 2Y55A 1PW1A 3NDGA 3SOIA 1K4FA 4KZ6A 3PBNA 2WYXA 4PM6A 1YT4A 4ID4A 3WS0A 4OPYA 4S2NC 1M40A 2X02A 2IWDA 4DE2A 5FQQA 1NY0A 2Y2IA 3PBSA 4RX3A 4RA7A 4OKPA 5EVIA 5TGFA 4L0LA 1SHVA 4MLLA 4R3JA 1ZC2A 3IXHA 2XEPA 1DJBA 2WUQA 4BLMA 3UDXA 3ZNTA 3UE3A 4QB8A 1KE3A 2Z2MB 3GSGA 1FSWA 3IHAA 3SS5A 3ZHHA 1H8ZA 3WS5A 3M2JA 4OOYA 2EFXA 1H5XA 1YLWA 1GA9A 4UA9A 3VP1A 4EV4A 1PWDA 2DCFA 1K57C 3BEBA 2Y2MA 1PIOA 1GHPA 2X01A 1C3BA 5CERA 4PM7A 1RCJA 2XD5A 4PPRA
chains in the Genus database with same CATH superfamily
3ZDJA 4X6TA 3H82A 1W8QA 3N6IA 4O7DA 1DP9A 2ACGA 5GL9A 3VP3A 1YPRA 3IXBA 4EU0A 3G34A 3CHWP 4Y3IA 2V1BA 4EW7A 3ZGAB 4FOFA 2PR5A 3LR0A 2MJ6A 2WGWA 4GB7A 2ZQ7A 4BL2A 1WYCA 2G2UA 5E2FA 3Q81A 4JXVA 4EUZA 2J8YA 1NZUA 5TBMB 2I72A 2EX2A 1SZVA 3TW8A 3A0RA 1V9YA 1SDNA 5EFWA 4F3LA 3VV4A 2Q9MA 5AQAA 3OLOA 1IYOA 3UNWA 4DMZA 3HBRA 4ZJ3A 3QP8A 3L9KA 4WUJA 3IBJA 4MBKA 2W27A 1KE0A 4MBFA 3T12B 2J3TD 3AGFA 2XQZA 1DJCA 2VGKA 4JPMA 3GTCA 5EVID 2HP5A 2HZ5A 3IX8A 4ESPA 1GA0A 1VM1A 4KZ9A 4DE1A 4PM5A 2B02A 5HX9A 3KYQA 3CPTB 4Y5FA 2XLNA 2OLUA 3UMDA 1D1JA 2WKRA 3UDFA 5GHZA 1IFQA 3RXWA 2XRNA 4WZ4A 1IKGA 1ACFA 3ZNYA 3Q07A 1NLYA 2EXBA 3VSKA 3EGXC 3QP1A 2VK3A 2PYPA 1NYYA 3LO7A 5FDSA 1XXMA 5F6AA 4GS9A 4LV1A 2W3DA 2XFSA 1SKFA 3W2ZA 3V3RA 2WAEA 3AGDA 4LV0A 4PMAA 1SDEA 2BLSA 1LHYA 2XF3A 3D4FA 3LGOA 1VEUA 5HWTA 3RXXA 3S7QA 1KGEA 1N9LA 4H8RA 3MZFA 4HP4A 3G4PA 2O9CA 5J3WA 5HZHA 4N9KA 2ZL1A 3HJKA 2WGIA 4BWIA 2O99A 3IHBA 5KSHA 1XJ4A 1MWRA 4JKTA 4CJNA 2PDRA 1T1AA 4OONA 5CGXA 1XKZA 4WBGA 3LFVA 3BWLA 3SH8A 2O9AA 2KX6A 3T1SA 1EROA 2K2NA 1W63Q 1OT9A 5TR7A 1TDGA 2Y79A 3N8SA 3FPVA 3IT9A 4IJGA 2VGLM 2AVXA 1JWPA 5IHVA 3MSHA 3SZTA 2HP6A 1U60A 1MKIA 1PI5A 1BLSA 4X56A 2QWSA 1UWNX 3N7WA 2H28A 5E43A 3KSIA 3NIAA 2JKTI 1IEMA 3UB5P 1ONHA 2W3EA 2JE5A 5HL6A 1OJ5A 3V50A 4N9LA 2HPBA 4GN2A 1YLPA 4K0XA 5EVIB 1YMXA 3F1PA 2D01A 3A3IA 3C5AA 3ZG0A 3HJIA 3C2WA 5DF8A 5HDDA 1FR6A 4PM8A 3LIEA 4HJ4A 4E3OA 2Q9NA 1CEGA 4HNBA 2VGJA 3QHYA 4BL3A 2WKPA 1CK3A 4KZAA 1NLZA 3CITA 2RL3A 1NRFA 3H82B 4OOMA 3ZCZA 4R4SA 4Z1WA 4Y0TA 4KZ4A 4YNRA 4LV3A 3IWIA 5FQIA 3LIDA 1XFQA 2EX6A 1ES2A 3BECA 3SS3A 3IBRA 4N1HA 3HLFA 4IVIA 3O86A 4KUOA 5EVLA 5CHJA 4WELA 4S2IA 3C38A 2VKSA 1EW0A 1TS7A 2WGWB 4X68A 3EEAA 2EWWA 1MPLA 2ZQ9A 3MQQA 4KZBA 1H0MA 4OH0A 4Y15A 3TG9A 1LI0A 5TJJA 1NZOA 3KO6A 1TD5A 4F3LB 4RX2A 2VX8A 4KQQA 4JXSA 3DTEA 3T1QB 2Y2LA 3T1RA 4P6BA 1AWIA 4WEKA 4K08A 3BJNA 3CAXA 1FQGA 3DBAA 2WZXA 1GHMA 3GECA 3IQAA 1MWTA 2WKIA 2CMNA 1M6KA 3BYDA 2VGLS 3R7WA 5BOHA 2Y2QA 4BENA 4KG2A 5HPFA 4GDNA 2OSUA 3SS4A 1XPBA 4HH3A 4OQGA 1YLYA 1L0FA 5M19A 3Q1FA 1T19A 4JXGA 3V67A 5FI7A 4JGQA 5FQKA 1TDLA 2ZQAA 3O5YA 3IWOA 4GS9B 1GSWA 4X55A 2VEAA 2XH9A 4GKUA 3DTMA 3QNCA 4YWZA 3HUNA 4ETZA 1W63M 4II7A 4KZ3A 1BTLA 3KYEA 4A5RA 1KE4A 2Y2HA 3P7NA 1AXBA 2JKTM 1VEUB 2JHEA 1T18A 5CGSA 1YAXA 5HFOA 4LGWA 1KVMA 4FD8A 5MC7A 2V2FF 1PW1A 3NDGA 2ZL1B 4PM6A 3WS0A 4S2NC 1M40A 1PNEA 3PYPA 4OKPA 5EM0A 5TGFA 1SHVA 2ZOIA 3MMHA 4BLMA 3GSGA 3SS5A 4EEPA 2EFXA 1GA9A 1PWDA 1K57C 2Z6DA 1PIOA 1GHPA 1C3BA 4MCWA 1RCJA 2ZQCA 5I94A 2L4RA 3HLEA 4S2JA 5CEBA 1PFLA 5IU1A 2ZM8A 2EX9A 2H5SA 3O87A 1KVLA 3ZFZA 1J9MA 3U4LP 1EWZA 4N1XA 2R78A 4OOLA 4UHUA 3FZCA 3MXRA 2WK0A 4BMWA 2W1TA 4E04A 2HP9A 3K3CA 2FZ0A 4NETA 1LL5A 3MZEA 1F9IA 4BQMA 5CXWA 1T1CA 5L8MA 2J80A 4DXCA 3CZDA 3A0VA 4ZDXA 4YFMA 2GX5A 1BUEA 4KZ7A 2IWBA 5HAQA 1L0DA 4ME4A 4DDYA 2Z6CA 2EXAA 4WZ5A 1S1ZA 4D2OA 3A3EA 1S1YA 4OP5A 3FWLA 3IX4A 4FSFA 3RJUA 3WS4A 4S2OA 3E2KA 3CUEC 1SCWA 1K6RA 5AVFA 1CJFA 3C4OA 4OPRA 3G35A 1PW8A 1ZHHB 3A3DA 3KSHA 2ZMAA 3UDIA 1F2KA 4AFIA 3UB6A 1K54C 3A3JA 3KSFA 4ZJ2A 3C4PA 3F1NA 1K55C 2ZC5B 3NULA 1QMFA 4JGOA 1CI8A 2LB5A 1LSXA 2VV7A 3T4QA 1L3LA 3RFBA 2ZC6B 4PM9A 2GJ3A 3C7VA 4OPQA 1ES3A 1Z6FA 3GDIA 4NKPA 1YKDA 3FC7A 5FASA 1WYBA 5EV0A 5CX7A 5L09A 3ZG8B 2Y2NA 3BFEA 5DJTA 3OCLA 4OPZA 3EOIA 2IWCA 5DF9A 3R7WB 5CHUA 3Q7VA 3MBZA 3WRZA 3GR2A 4OQIA 1WE4A 4L9EA 3WS1A 4G3VA 4EBNA 4OLDA 3IF6C 4HBUA 5E2HA 5GLBA 3JVUA 4Y17A 2V8CA 4X69A 4FH2A 2Y2PA 1YM1A 1K56D 3M2KA 5A93A 4S2LA 3NC8A 4ZRRA 1DP8A 2WZZA 4IBRA 2ZBBA 5GHYA 4QU3A 4I3AA 1A0KA 3CMZA 4JXWA 4KZ5A 4NXGA 3BM6A 4E3NA 3TRCA 4G3KA 1IYQA 5HWVA 1W7FA 3BFDA 1JNUA 3LYXA 2A2LA 4M3KA 4C3QA 4CLCD 1W79A 4FUWA 1S66L 1ZG6A 2NUTC 4QY5A 3IX3A 1VQQA 5CHMA 2Y91A 2UWXA 3H9WA 4KUKA 4DF6A 3O88A 3DWZA 1ONGA 4R70A 1XP4A 1N9BA 4NXFA 1XA7A 4Y0OA 3D9YA 2INWA 4UQIM 5FEFA 2VLGA 3ZVWA 2JKRI 4IUKA 3FKWA 1UGUA 4HY8A 1TS6A 3W4PA 3BLMA 2JN7A 3HLGA 5FAPA 5K5BA 1YLJA 3D72A 3K2NA 3M6BA 3CLOA 2DRWA 2XDMA 5DTTA 3V3SA 4JF6A 3UE1A 2W1TB 3BY8A 4R1GA 4GD8A 1PI4A 1ERQA 2ZC7A 4LCMA 4R0QA 1MC0A 5DJUA 3ZG7B 1MZUA 3UB8A 4RVAA 2Z2LB 2QMIA 2PHYA 4GD6A 3BLSA 2OV5A 1ZKJA 4ARZA 5HD5A 2G7UA 4ETXA 3S22A 2UV0E 2JBFA 3G31A 2GDNA 5F1FA 1KDSA 2OAP1 2DNSA 3G2ZA 4WF0A 2P7JA 2R9XA 4S2KA 2HF6A 2WGVA 3KSGA 4F94A 1LL9A 1IYSA 1NWZA 4ZJ1A 2JKFA 5FI6A 3TE8A 3CUEA 1ES5A 2V0UA 3HL9A 4BD0A 1MXOA 1YLTA 3EGDC 1PWGA 1E25A 3VP4A 2JKGA 4MN6A 3ZG5A 1E4DA 2O9BA 4B88A 4CLCB 1XJ3A 3VP2A 1K54A 1K0KA 4D60A 2V8FA 1TEMA 4C75A 4MMNA 4Q0IA 4MDZA 2HDQA 1J3WA 1SKOB 3G30A 4E6WA 4X53A 4LRZE 4R23A 1JTGA 1OTEA 5DTKA 3NDEA 3LIBA 4MNRA 2HDSA 1IYPA 1ZTUA 2OOLA 3PAGA 3Q7VB 3VP0A 4QD4A 4UQIS 5J7EA 2WKQA 3ITBA 4QWOA 4Q8IA 2Y55A 4KZ6A 2WYXA 1YT4A 2X02A 4RX3A 3QP4A 4Q0HA 4R3JA 3UDXA 1P9WA 4HI4A 5HDCA 3T4TA 1KE3A 4LRYC 1VHMA 3M2JA 4OOYA 3T50A 3D3OA 1H5XA 1YLWA 5HPIA 2P08A 4UA9A 3ZQ5A 1F5MA 3BW6A 3UB7A 4PM7A 1Y28A 4PPRA 3IXGA 4GW9A 2J3TC 1HVBA 1XA1A 5EVIC 1OMEA 5A90A 1PZPA 3T4LA 3T1XA 4BBVA 4S2MA 2QKPA 2FFFB 3ITAA 3E4QA 2YKFA 5FATA 2J3WA 2EWVA 5KIZA 4GCZA 4U0TA 1YQSA 3CJMA 4DJ2A 3MQ0A 3BY9A 3C7UA 1XFNA 4PAUA 3HUOA 2W0NA 3MFXA 1K25A 1LSVA 4LCLA 5G4ZA 1MKMA 3FKVA 4JBFA 4R38A 3Q82A 4MEZA 5FA7A 1PZOA 2XFTA 5DVAA 3I7JA 2G2WA 2C6WB 4KZ8A 2B95A 1MBLA 4LPZA 4P6ZM 1DRMA 2WADA 2HGVA 3EQUA 4EBLA 1BLHA 1S67L 4DN0A 5FL3A 4E3MA 2D02A 3S4XA 3NOPC 3AGEA 4XUZA 2NUPC 2PBDP 2XGNA 3MKFA 3FV7A 4E3LA 4O01A 2GZAA 4DKIA 4C6YA 5HARA 4GNUA 5AQBA 4Y7PA 4OP8A 3WS2A 3LCEA 4NEED 3PHYA 1YLZA 4DDSA 2L1MA 3E0YA 1E3UA 4IEDA 1ZG4A 3OPPA 4KQRA 5CTMA 4ARZB 2P04A 4HJ3A 4UEYA 2K7SA 3EQVA 3JVVA 1JWZA 3B33A 4OQHA 5CEDA 3T4SA 1OT6A 1WA9A 3OBFA 3B47A 2H10A 5DFXA 2Y8HA 4QHCA 1ESIA 2EX8A 4E3KA 1OJGA 3BFGA 2QYBA 3HLDA 5DTSA 1W5DA 1I2SA 1YMSA 3CPTA 2K31A 5AQ7A 5GLAA 3UPNA 2C5WB 2P9VA 5AVEA 5LBRA 3ZVTA 2XROA 2V1AA 1ESUA 3QNBA 5A92A 4HH2A 3EWKA 4Y0UA 3RTYA 3DAVA 1H8MA 1L2SA 1NRJA 4HESA 3W4OA 3SH7A 1MWSA 5CRFA 3F1PB 3A0SA 5FQMA 3GVBA 3E2LA 3S7NA 4ZBEA 2KOIA 3C8CA 4WYYA 3LY4A 1BT5A 1XGJA 3WRTA 1N9OA 3PBTA 3NJAA 5EVEA 4MN5A 2HJEA 4PHTA 4B4XA 5D3OA 5HD3A 5HAIA 3MFDA 1K6SA 5IS1A 4P6ZS 3P09A 1JTDA 4L9GA 3A3FA 2H0YA 5FDHA 1K4EA 1P97A 4RQ9A 2M7UA 4UA7A 5EECA 1TF1A 1CQAA 3PBQA 1KDWA 4X25A 5L2FA 5J4EA 4LLOB 3RH8B 3UPOA 4BD1A 1ERMA 3HUMA 1N4OA 3MS6A 3UMEA 3HLCA 5FAQA 3CG5A 4KQOA 4HP9A 4HEFA 3S7OA 1JWVA 2P74A 2Y2OA 3NBLA 3LY3A 1O7EA 4FH4A 4JGRA 2DMWA 4BBTA 1Y4OA 3OZHA 3OPHA 4XT2A 1UWPX 1NXYA 5JYPA 3QP5A 3MXQA 2Q0OA 2QPNA 4LFUA 3E4PA 3HLBA 1RP5A 3NI9A 4DXBA 1PRQA 4DJ3A 1G6AA 4U0XA 1N9NA 3MF0A 4P85A 3M6HA 4LV2A 1FIKA 4OQ0A 3IF5A 1BULA 1HLUP 2A3UA 4KG5A 5FAOA 2R9WA 5CGWA 1BSGA 2BTFP 3BFFA 4IBXA 2QHKA 1MY8A 1NYMA 3QP6A 1L0GA 3KYZA 5F68A 3NY4A 3G32A 5KMWA 4DE3A 1P9RA 5GLCA 4UAAA 3BRMA 3VMAA 2PD8A 1RGZA 3GRJA 1FCNA 1K38A 4EERA 3S7PA 3N4IA 3PBRA 3VOLA 2ZQ8A 4MBHA 3WWXA 4MN7A 4I5SA 3UE6A 1ALQA 3FPWA 1KGGA 2QJ7A 5E2GA 4Z9QA 2FH5A 2PR6A 3VOYA 3OOVA 2HV1A 3OC2A 3UPPA 3UN7A 3IWQA 3Q7ZA 2ZLYA 2PBYA 3P98A 1I2WA 1GSXA 5E2EA 1O07A 2HJ9C 3G6OA 4NK3A 1G68A 4S2NA 2QJ5A 5HL1A 3P01A 4B4ZA 1VB6A 3ICYA 4B93A 1LT0A 3GMWA 4WN5A 2YKHA 1FSYA 4H6JA 2P9VB 3PBOA 1K57A 1DY6A 4YOFA 1DJAA 3SOIA 4GHIA 4ID4A 5AJGA 3L7HA 3LIFA 2Y2IA 3PBSA 3SW1A 1OPXA 4HJ6A 4L0LA 4BBUA 2L0WA 4MLLA 3IXHA 2XEPA 3LI8A 1V9ZA 2E8JA 3UE3A 3IHAA 1H8ZA 3VP1A 4EV4A 1X0OA 2VJWA 2DCFA 3BEBA 2Y2MA 5DFYA 2X01A 2XD5A 5EUAA 2ZD8A 1YSPA 4N92A 2EFUA 5G4YA 4S2PA 4DRTA 3CI6A 4O8GA 5F82A 2EA9A 3VOZA 4Q0JA 1VETA 4GLQA 1S0WA 3W4QA 3PAEA 2ZQDA 2ZC3B 2WKEA 4JF4A 4R3AA 4CLCE 3LI9A 4KQDA 3H7WA 4EBPA 2GNXA 3N8LA 2QZ6A 5CTNA 3DTKA 3F1NB 1XJ6A 2W3HA 2X71A 3O3VA 4I38A 1FOFA 5U47A 1D06A 4R4RA 5M1AA 5HDSA 3N8RA 2XA7M 4P87A 3TSGA 1K55A 2PRFA 2ZM0A 2PT7A 4XUXA 2HDRA 2I9VA 3DW0A 4O0PA 4WZ5C 2ZJ9A 1IELA 2IA2A 3ZG9B 3TOIA 4HIAA 2E8IA 4CQHA 3IS2A 1T1BA 3FYZA 5EOEA 4XT2B 4JLFA 2A24A 3MKEA 5JYOA 1OTDA 2XR0A 1HD8A 3NOUC 2BG1A 4X1LA 3VSLA 4IVKA 3VFFA 5F1GA 4B9OA 4JGPA 5TFQA 3U2AA 3DTIA 3ULFA 3F1OA 2Y2GA 2VV8A 1TVFA 1Q2PA 1CEFA 1FCOA 2W3FA 4UA6A 1HZOA 3UB9A 4LENA 1LLBA 2FFYA 3W8KA 4JF5A 1S4RA 1W8YA 3T4OA 3PTEA 1S4SA 1G5UA 5FI2A 2ZM2A 1STZA 1YSQA 3BFCA 4NXEA 5FQ9A 3IF6A 2V1ZA 1HTZA 4OVDA 4CLCC 4EQIA 1OTAA 1PYYA 1TS0A 2J7VA 3HLWA 2OWJA 5KZHA 5A91A 3IH9A 3DWKA 1IOUA 2JKRM 3HCYA 5HSQA 1FILA 3OPRA 1L0EA 4QPRA 1BZAA 5GLDA 3VE3A 1MWUA 4CPKA 2ZMVA 1KOUA 4NXBA 2WAFA 1LSWA 1OTBA 1ES4A 2XD1A 3ISGA 3T4JA 2PU2A 2PU4A 4GOGA 3LUQA 2Y2KA 5EE8A 3VE4A 5DKLA 2M1CA 4E3IA 1XX2A 4RYEA 3B42A 2V9AA 5J8XA 3UY6A 3GV9A 1Q2QA 5DKKA 3T4KA 5I5LA 3BQAA 1EI5A 3MR0A 4L9FA 3VFHA 1IKIA 2JCHA 1LL8A 2XA7S 3C30A 4H6JB 2OWHA 4DE0A 4QY6A 5L10A 1S6RA 3LEQA 4GHIB 4PKYG 2RCXA 1BLPA 3NOTC 3V39A 1G6OA 1NJ4A 3UO9A 4XXRA 4ZTKA 4WEJA 3G2YA 5L07A 3JYIA 5A8BA 3OCNA 3MJQA 3MXSA 4FCFA 5TBMA 2B18A 1PWCA 4I3IA 1JVJA 4EWFA 1FR1A 4WMCA 1LI9A 1Z09A 1BLCA 3IH8A 4YINA 1QMEA 3V5MA 2Y59A 2LB9A 4QJGA 4E3JA 4WM9A 3MQOA 1CF0A 2ZMFA 2M7VA 5F69A 1G28A 2VZWA 4KG6A 4Y13A 3LIAA 5M18A 4R6LA 4M4XA 4GZBA 1VETB 3FG8A 2PYRA 1DP6A 1H8YA 3EEHA 3S1YA 2ZC4B 5HAPA 2WKHA 3B3XA 2J9PA 3HREA 4EESA 2Y4AA 4ZAMA 3H7WB 5HWWA 2B5RA 3IXDA 3NECA 4EXOA 4HBTA 3BQ8A 3UE0A 3R4KA 3NCKA 4WLAA 2XK1A 5KSCA 2OLVA 5DF7A 2CC1A 2JC7A 3LEZA 4Y2FA 3TJZC 5AQ9A 1ODVA 3CWFA 2PAVP 3E98A 3HVFA 5HW3A 4GDBA 3OPLA 5F83A 4IHQA 1XJ2A 1H3QA 3NHQA 2W3GA 2A49A 4I3JA 5IT5A 3LR3A 2XSSA 2H0TA 5F5YA 1P0ZA 1XGIA 4R3BA 5EPHA 1TS8A 3IS2B 1CI9A 2OAQ1 3GQZA 4PKYA 5FQJA 2BASA 5GHXA 2A24B 4X1MA 5EOOA 1E3UD 1FCMA 4WMCD 4NG2A 4E6XA 4LRXC 2O0YA 4HHDA 2V20A 5C5KA 3JPUA 1RGYA 1Y54A 4EUVA 3F1OB 4KENB 4OLGA 2J9OA 4HOIA 4HQAA 4U3TA 4K91A 3KX0X 1K56A 4WL9A 2ZOHA 5FSRA 4EEUA 3IF6B 3LR5A 5G18A 1GHIA 5EM1A 1KGFA 1GSVA 2W1RA 4K0WA 2Y2JA 1GCEA 2HDUA 3LICA 4IUHA 4P0MA 3SH9A 1OTIA 3LR4A 1I5QA 2VA0A 4I39A 5CECA 3PXPA 4BJPA 3MZDA 2V0WA 1K4FA 4CLCA 1D7EA 3PBNA 5FEGA 4OPYA 3ZYTA 2IWDA 2KLIA 5FQQA 1NY0A 1F98A 4DE2A 4RA7A 5EVIA 2PD7A 4EQ1A 1ZC2A 2VV6A 1DJBA 2WUQA 3E4OA 3ZNTA 1BYWA 4QB8A 4GJ4A 2Z2MB 3ZHHA 1FSWA 1SKOA 3K3DA 3WS5A 3QP2A 4G3WA 3PR6A 4EETB 5CERA 4FTXA 2KDKA
chains in the Genus database with same CATH topology
3ZDJA 3IXGA 5EUAA 2ZQCA 2ZD8A 4X6TA 5I94A 1W8QA 1HVBA 3HLEA 3N6IA 4S2JA 4N92A 4O7DA 1XA1A 5CEBA 5EVIC 1OMEA 2ZM8A 2EFUA 5A90A 2EX9A 2H5SA 3O87A 1KVLA 1PZPA 4S2PA 5GL9A 3VP3A 3ZFZA 4DRTA 1J9MA 5F82A 3VOZA 1EWZA 3IXBA 4N1XA 4S2MA 3G34A 1S0WA 3W4QA 4OOLA 2FFFB 4UHUA 3ITAA 3FZCA 3MXRA 3PAEA 2WK0A 3ZGAB 2ZQDA 2ZC3B 2WKEA 4JF4A 2HP9A 1LL5A 3MZEA 2WGWA 4NETA 5FATA 4GB7A 2ZQ7A 4BQMA 5CXWA 3N8LA 4EBPA 4U0TA 1YQSA 3CJMA 4BL2A 2QZ6A 1WYCA 2G2UA 5E2FA 4DXCA 3Q81A 3CZDA 3C7UA 5CTNA 4JXVA 4ZDXA 3HUOA 4EUZA 2J8YA 4YFMA 1BUEA 1K25A 1NZUA 4KZ7A 2IWBA 1L0DA 5HAQA 4LCLA 4DDYA 2EXAA 2I72A 4WZ5A 2X71A 3O3VA 3FKVA 4JBFA 2EX2A 4D2OA 1FOFA 3A3EA 5U47A 3Q82A 4R4RA 4OP5A 1SDNA 4MEZA 3FWLA 5FA7A 5M1AA 1PZOA 2XFTA 3N8RA 2Q9MA 4FSFA 4S2OA 5DVAA 5AQAA 3RJUA 3E2KA 3WS4A 3I7JA 1IYOA 1SCWA 4P87A 2G2WA 1K6RA 2C6WB 3TSGA 1K55A 4KZ8A 3UNWA 1MBLA 3HBRA 4ZJ3A 2ZM0A 2WADA 3C4OA 4XUXA 2HDRA 4MBKA 4OPRA 3EQUA 3G35A 1KE0A 1PW8A 1BLHA 4MBFA 4EBLA 3DW0A 4WZ5C 4E3MA 3A3DA 2ZMAA 2XQZA 3AGFA 2ZJ9A 1DJCA 2VGKA 3S4XA 4JPMA 1IELA 3UDIA 3GTCA 3AGEA 4XUZA 5EVID 2HP5A 3ZG9B 3TOIA 1GA0A 2XGNA 2E8IA 3MKFA 3FV7A 4E3LA 1VM1A 1K54C 3A3JA 3FYZA 4KZ9A 5EOEA 5HARA 3C4PA 4GNUA 4ZJ2A 4C6YA 4DE1A 5AQBA 4PM5A 5HX9A 4JLFA 1K55C 2ZC5B 3MKEA 2XLNA 4OP8A 4Y7PA 3WS2A 1QMFA 5JYOA 2OLUA 3LCEA 1YLZA 4DDSA 2XR0A 3UDFA 5GHZA 1HD8A 2BG1A 1E3UA 3RXWA 4IEDA 1CI8A 3VSLA 4WZ4A 1ZG4A 3OPPA 4IVKA 4KQRA 1IKGA 5CTMA 3VFFA 5F1GA 3ZNYA 5TFQA 2ZC6B 3Q07A 4PM9A 2Y2GA 3EQVA 1JWZA 2EXBA 1TVFA 3VSKA 3C7VA 1Q2PA 1CEFA 4OPQA 1FCOA 1ES3A 4OQHA 4UA6A 1HZOA 1Z6FA 1NYYA 4LENA 3LO7A 1LLBA 2FFYA 5CEDA 1XXMA 3W8KA 4JF5A 5FASA 1W8YA 1WYBA 3PTEA 5FI2A 2H10A 4LV1A 2XFSA 2ZM2A 3BFCA 3ZG8B 4QHCA 2Y2NA 1SKFA 5FQ9A 3V3RA 1ESIA 2WAEA 3IF6A 2EX8A 3AGDA 4E3KA 2V1ZA 1HTZA 3BFEA 4OVDA 3OCLA 3BFGA 4LV0A 3HLDA 1SDEA 4OPZA 4PMAA 5DTSA 4EQIA 1PYYA 1W5DA 2IWCA 1I2SA 1YMSA 2J7VA 3HLWA 5DF9A 5A91A 3IH9A 5KZHA 2BLSA 5CHUA 1LHYA 3Q7VA 3DWKA 2XF3A 3MBZA 3WRZA 3D4FA 3GR2A 3OPRA 4OQIA 1L0EA 1WE4A 1BZAA 5GLDA 4CPKA 1MWUA 5AQ7A 5GLAA 3RXXA 2C5WB 2P9VA 3UPNA 3ZVTA 2WAFA 1KGEA 4H8RA 3MZFA 3G4PA 1ESUA 1ES4A 2XD1A 3QNBA 3WS1A 5A92A 3ISGA 4EBNA 4N9KA 4OLDA 2PU2A 2WGIA 3IF6C 4Y0UA 3IHBA 2PU4A 4HBUA 5KSHA 1MWRA 4GOGA 5E2HA 5GLBA 4JKTA 4CJNA 2Y2KA 1L2SA 4HESA 4X69A 4OONA 5CGXA 5EE8A 1XKZA 4WBGA 3W4OA 3SH7A 3SH8A 4FH2A 1MWSA 2Y2PA 5CRFA 1YM1A 4E3IA 1K56D 1EROA 3M2KA 1XX2A 4RYEA 5A93A 5FQMA 3GVBA 4S2LA 5TR7A 3E2LA 5J8XA 3UY6A 3GV9A 4ZBEA 1TDGA 3NC8A 3N8SA 1Q2QA 3IT9A 3LY4A 2WZZA 4WYYA 1BT5A 1XGJA 1JWPA 4IBRA 5IHVA 3WRTA 5GHYA 1EI5A 1U60A 2HP6A 4QU3A 1MKIA 1PI5A 1BLSA 4X56A 3PBTA 3N7WA 3CMZA 5E43A 4JXWA 4KZ5A 3NIAA 3VFHA 4B4XA 1IKIA 5D3OA 3BM6A 1IEMA 4E3NA 2JCHA 1ONHA 1IYQA 2JE5A 1W7FA 3BFDA 5HAIA 3MFDA 4M3KA 4C3QA 1K6SA 3V50A 4DE0A 4QY6A 1S6RA 4N9LA 2HPBA 1W79A 3P09A 1JTDA 4GN2A 2RCXA 1BLPA 3A3FA 1YLPA 2H0YA 1ZG6A 5FDHA 1K4EA 3V39A 4K0XA 4QY5A 1NJ4A 3UO9A 4XXRA 5EVIB 1YMXA 4ZTKA 4WEJA 1VQQA 3G2YA 5CHMA 3C5AA 3A3IA 3JYIA 3ZG0A 3OCNA 4UA7A 5EECA 2Y91A 5DF8A 2UWXA 3PBQA 4DF6A 3O88A 1KDWA 3DWZA 1FR6A 1ONGA 1XP4A 3MXSA 4FCFA 4PM8A 4E3OA 1PWCA 5L2FA 1N9BA 1JVJA 2Q9NA 1FR1A 4EWFA 4WMCA 3UPOA 1CEGA 1LI9A 4BD1A 1ERMA 1BLCA 1XA7A 4Y0OA 3IH8A 2VGJA 4YINA 1QMEA 3QHYA 3V5MA 3HUMA 2Y59A 4BL3A 4QJGA 4E3JA 4WM9A 1N4OA 1CK3A 4KZAA 2RL3A 3HLCA 1NRFA 4OOMA 3ZCZA 5FAQA 3ZVWA 3CG5A 4R4SA 4Y0TA 3FKWA 4KZ4A 4LV3A 3IWIA 3W4PA 4KG6A 3BLMA 4KQOA 5FQIA 4HEFA 2EX6A 1ES2A 5M18A 3BECA 3HLGA 3SS3A 1JWVA 5FAPA 2P74A 1YLJA 2Y2OA 3M6BA 4GZBA 3NBLA 4N1HA 3LY3A 3HLFA 4IVIA 1O7EA 2DRWA 2XDMA 4FH4A 5DTTA 3V3SA 1H8YA 4JF6A 3O86A 5EVLA 5CHJA 3UE1A 3S1YA 2ZC4B 4WELA 4R1GA 4S2IA 2WKHA 5HAPA 3B3XA 3OPHA 3OZHA 2J9PA 3HREA 4GD8A 1PI4A 2Y4AA 4ZAMA 2WGWB 1ERQA 4X68A 2ZC7A 2B5RA 1NXYA 4LCMA 4R0QA 3IXDA 5JYPA 4HBTA 3ZG7B 1MPLA 2QPNA 2ZQ9A 3UE0A 4RVAA 4KZBA 2Z2LB 3HLBA 2QMIA 3NCKA 4GD6A 2XK1A 3BLSA 4OH0A 2OV5A 1RP5A 5KSCA 2OLVA 3NI9A 3TG9A 5DF7A 1ZKJA 2CC1A 1LI0A 2JC7A 3LEZA 4DXBA 1NZOA 3S22A 5AQ9A 4RX2A 4KQQA 2JBFA 3G31A 2GDNA 1G6AA 4JXSA 4U0XA 4P85A 3HVFA 5HW3A 5F1FA 4GDBA 3OPLA 5F83A 1KDSA 3M6HA 2DNSA 2Y2LA 4LV2A 4P6BA 3G2ZA 4WEKA 4OQ0A 3IF5A 1BULA 2R9XA 4S2KA 1FQGA 2WGVA 2A49A 2WZXA 4F94A 1LL9A 2A3UA 1IYSA 1GHMA 4KG5A 5FAOA 3IQAA 2R9WA 4ZJ1A 5CGWA 1MWTA 1BSGA 2H0TA 2WKIA 3BFFA 4IBXA 5EPHA 1M6KA 1MY8A 1XGIA 4R3BA 5FI6A 3BYDA 1ES5A 1NYMA 1L0GA 1CI9A 3NY4A 5BOHA 2Y2QA 3HL9A 3GQZA 3G32A 5FQJA 4BD0A 4DE3A 5KMWA 4BENA 1MXOA 5GLCA 4KG2A 5GHXA 4UAAA 3BRMA 2OSUA 4GDNA 3SS4A 3VMAA 1RGZA 1XPBA 1YLTA 5EOOA 1E3UD 3GRJA 4OQGA 1FCMA 1FCNA 1K38A 1PWGA 1E25A 4WMCD 3N4IA 4E6XA 3PBRA 3VP4A 1YLYA 1L0FA 2V20A 2ZQ8A 3ZG5A 5M19A 4MBHA 3Q1FA 4JXGA 1E4DA 3WWXA 4B88A 1ALQA 1RGYA 3VP2A 1K54A 1Y54A 1KGGA 5FI7A 5E2GA 4Z9QA 4DKIA 5FQKA 3VOYA 4KENB 4OLGA 2J9OA 1TDLA 2ZQAA 1TEMA 3OC2A 3UPPA 4C75A 3UN7A 3IWQA 4U3TA 4K91A 3Q7ZA 2ZLYA 3IWOA 2PBYA 1K56A 2HDQA 3G30A 3P98A 4X55A 4E6WA 1I2WA 4X53A 2XH9A 4R23A 5E2EA 5FSRA 1O07A 4GKUA 4NK3A 1JTGA 3DTMA 5DTKA 3IF6B 3QNCA 3NDEA 1G68A 3HUNA 4S2NA 5G18A 5HL1A 4KZ3A 1GHIA 1KGFA 1BTLA 4B4ZA 4A5RA 4MNRA 1KE4A 4K0WA 2HDSA 1IYPA 2Y2HA 2Y2JA 3GMWA 1GCEA 2HDUA 1AXBA 3PAGA 3Q7VB 4P0MA 4QD4A 3SH9A 3VP0A 3ITBA 1I5QA 1FSYA 5CGSA 5CECA 2P9VB 4BJPA 3PBOA 5HFOA 1K57A 1KVMA 4FD8A 3MZDA 1DY6A 4Q8IA 1DJAA 2V2FF 2Y55A 1PW1A 3NDGA 3SOIA 1K4FA 4KZ6A 3PBNA 2WYXA 4PM6A 1YT4A 4ID4A 3WS0A 4OPYA 4S2NC 1M40A 2X02A 2IWDA 4DE2A 5FQQA 1NY0A 2Y2IA 3PBSA 4RX3A 4RA7A 4OKPA 5EVIA 5TGFA 4L0LA 1SHVA 4MLLA 4R3JA 1ZC2A 3IXHA 2XEPA 1DJBA 2WUQA 4BLMA 3UDXA 3ZNTA 3UE3A 4QB8A 1KE3A 2Z2MB 3GSGA 1FSWA 3IHAA 3SS5A 3ZHHA 1H8ZA 3WS5A 3M2JA 4OOYA 2EFXA 1H5XA 1YLWA 1GA9A 4UA9A 3VP1A 4EV4A 1PWDA 2DCFA 1K57C 3BEBA 2Y2MA 1PIOA 1GHPA 2X01A 1C3BA 5CERA 4PM7A 1RCJA 2XD5A 4PPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDJ A;  3IXG A;  5EUA A;  2ZQC A;  2ZD8 A;  4X6T A;  5I94 A;  1W8Q A;  1HVB A;  3HLE A;  3N6I A;  4S2J A;  4N92 A;  4O7D A;  1XA1 A;  5CEB A;  5EVI C;  1OME A;  2ZM8 A;  2EFU A;  5A90 A;  2EX9 A;  2H5S A;  3O87 A;  1KVL A;  1PZP A;  4S2P A;  5GL9 A;  3VP3 A;  3ZFZ A;  4DRT A;  1J9M A;  5F82 A;  3VOZ A;  1EWZ A;  3IXB A;  4N1X A;  4S2M A;  3G34 A;  1S0W A;  3W4Q A;  4OOL A;  2FFF B;  4UHU A;  3ITA A;  3FZC A;  3MXR A;  3PAE A;  2WK0 A;  3ZGA B;  2ZQD A;  2ZC3 B;  2WKE A;  4JF4 A;  2HP9 A;  1LL5 A;  3MZE A;  2WGW A;  4NET A;  5FAT A;  4GB7 A;  2ZQ7 A;  4BQM A;  5CXW A;  3N8L A;  4EBP A;  4U0T A;  1YQS A;  3CJM A;  4BL2 A;  2QZ6 A;  1WYC A;  2G2U A;  5E2F A;  4DXC A;  3Q81 A;  3CZD A;  3C7U A;  5CTN A;  4JXV A;  4ZDX A;  3HUO A;  4EUZ A;  2J8Y A;  4YFM A;  1BUE A;  1K25 A;  1NZU A;  4KZ7 A;  2IWB A;  1L0D A;  5HAQ A;  4LCL A;  4DDY A;  2EXA A;  2I72 A;  4WZ5 A;  2X71 A;  3O3V A;  3FKV A;  4JBF A;  2EX2 A;  4D2O A;  1FOF A;  3A3E A;  5U47 A;  3Q82 A;  4R4R A;  4OP5 A;  1SDN A;  4MEZ A;  3FWL A;  5FA7 A;  5M1A A;  1PZO A;  2XFT A;  3N8R A;  2Q9M A;  4FSF A;  4S2O A;  5DVA A;  5AQA A;  3RJU A;  3E2K A;  3WS4 A;  3I7J A;  1IYO A;  1SCW A;  4P87 A;  2G2W A;  1K6R A;  2C6W B;  3TSG A;  1K55 A;  4KZ8 A;  3UNW A;  1MBL A;  3HBR A;  4ZJ3 A;  2ZM0 A;  2WAD A;  3C4O A;  4XUX A;  2HDR A;  4MBK A;  4OPR A;  3EQU A;  3G35 A;  1KE0 A;  1PW8 A;  1BLH A;  4MBF A;  4EBL A;  3DW0 A;  4WZ5 C;  4E3M A;  3A3D A;  2ZMA A;  2XQZ A;  3AGF A;  2ZJ9 A;  1DJC A;  2VGK A;  3S4X A;  4JPM A;  1IEL A;  3UDI A;  3GTC A;  3AGE A;  4XUZ A;  5EVI D;  2HP5 A;  3ZG9 B;  3TOI A;  1GA0 A;  2XGN A;  2E8I A;  3MKF A;  3FV7 A;  4E3L A;  1VM1 A;  1K54 C;  3A3J A;  3FYZ A;  4KZ9 A;  5EOE A;  5HAR A;  3C4P A;  4GNU A;  4ZJ2 A;  4C6Y A;  4DE1 A;  5AQB A;  4PM5 A;  5HX9 A;  4JLF A;  1K55 C;  2ZC5 B;  3MKE A;  2XLN A;  4OP8 A;  4Y7P A;  3WS2 A;  1QMF A;  5JYO A;  2OLU A;  3LCE A;  1YLZ A;  4DDS A;  2XR0 A;  3UDF A;  5GHZ A;  1HD8 A;  2BG1 A;  1E3U A;  3RXW A;  4IED A;  1CI8 A;  3VSL A;  4WZ4 A;  1ZG4 A;  3OPP A;  4IVK A;  4KQR A;  1IKG A;  5CTM A;  3VFF A;  5F1G A;  3ZNY A;  5TFQ A;  2ZC6 B;  3Q07 A;  4PM9 A;  2Y2G A;  3EQV A;  1JWZ A;  2EXB A;  1TVF A;  3VSK A;  3C7V A;  1Q2P A;  1CEF A;  4OPQ A;  1FCO A;  1ES3 A;  4OQH A;  4UA6 A;  1HZO A;  1Z6F A;  1NYY A;  4LEN A;  3LO7 A;  1LLB A;  2FFY A;  5CED A;  1XXM A;  3W8K A;  4JF5 A;  5FAS A;  1W8Y A;  1WYB A;  3PTE A;  5FI2 A;  2H10 A;  4LV1 A;  2XFS A;  2ZM2 A;  3BFC A;  3ZG8 B;  4QHC A;  2Y2N A;  1SKF A;  5FQ9 A;  3V3R A;  1ESI A;  2WAE A;  3IF6 A;  2EX8 A;  3AGD A;  4E3K A;  2V1Z A;  1HTZ A;  3BFE A;  4OVD A;  3OCL A;  3BFG A;  4LV0 A;  3HLD A;  1SDE A;  4OPZ A;  4PMA A;  5DTS A;  4EQI A;  1PYY A;  1W5D A;  2IWC A;  1I2S A;  1YMS A;  2J7V A;  3HLW A;  5DF9 A;  5A91 A;  3IH9 A;  5KZH A;  2BLS A;  5CHU A;  1LHY A;  3Q7V A;  3DWK A;  2XF3 A;  3MBZ A;  3WRZ A;  3D4F A;  3GR2 A;  3OPR A;  4OQI A;  1L0E A;  1WE4 A;  1BZA A;  5GLD A;  4CPK A;  1MWU A;  5AQ7 A;  5GLA A;  3RXX A;  2C5W B;  2P9V A;  3UPN A;  3ZVT A;  2WAF A;  1KGE A;  4H8R A;  3MZF A;  3G4P A;  1ESU A;  1ES4 A;  2XD1 A;  3QNB A;  3WS1 A;  5A92 A;  3ISG A;  4EBN A;  4N9K A;  4OLD A;  2PU2 A;  2WGI A;  3IF6 C;  4Y0U A;  3IHB A;  2PU4 A;  4HBU A;  5KSH A;  1MWR A;  4GOG A;  5E2H A;  5GLB A;  4JKT A;  4CJN A;  2Y2K A;  1L2S A;  4HES A;  4X69 A;  4OON A;  5CGX A;  5EE8 A;  1XKZ A;  4WBG A;  3W4O A;  3SH7 A;  3SH8 A;  4FH2 A;  1MWS A;  2Y2P A;  5CRF A;  1YM1 A;  4E3I A;  1K56 D;  1ERO A;  3M2K A;  1XX2 A;  4RYE A;  5A93 A;  5FQM A;  3GVB A;  4S2L A;  5TR7 A;  3E2L A;  5J8X A;  3UY6 A;  3GV9 A;  4ZBE A;  1TDG A;  3NC8 A;  3N8S A;  1Q2Q A;  3IT9 A;  3LY4 A;  2WZZ A;  4WYY A;  1BT5 A;  1XGJ A;  1JWP A;  4IBR A;  5IHV A;  3WRT A;  5GHY A;  1EI5 A;  1U60 A;  2HP6 A;  4QU3 A;  1MKI A;  1PI5 A;  1BLS A;  4X56 A;  3PBT A;  3N7W A;  3CMZ A;  5E43 A;  4JXW A;  4KZ5 A;  3NIA A;  3VFH A;  4B4X A;  1IKI A;  5D3O A;  3BM6 A;  1IEM A;  4E3N A;  2JCH A;  1ONH A;  1IYQ A;  2JE5 A;  1W7F A;  3BFD A;  5HAI A;  3MFD A;  4M3K A;  4C3Q A;  1K6S A;  3V50 A;  4DE0 A;  4QY6 A;  1S6R A;  4N9L A;  2HPB A;  1W79 A;  3P09 A;  1JTD A;  4GN2 A;  2RCX A;  1BLP A;  3A3F A;  1YLP A;  2H0Y A;  1ZG6 A;  5FDH A;  1K4E A;  3V39 A;  4K0X A;  4QY5 A;  1NJ4 A;  3UO9 A;  4XXR A;  5EVI B;  1YMX A;  4ZTK A;  4WEJ A;  1VQQ A;  3G2Y A;  5CHM A;  3C5A A;  3A3I A;  3JYI A;  3ZG0 A;  3OCN A;  4UA7 A;  5EEC A;  2Y91 A;  5DF8 A;  2UWX A;  3PBQ A;  4DF6 A;  3O88 A;  1KDW A;  3DWZ A;  1FR6 A;  1ONG A;  1XP4 A;  3MXS A;  4FCF A;  4PM8 A;  4E3O A;  1PWC A;  5L2F A;  1N9B A;  1JVJ A;  2Q9N A;  1FR1 A;  4EWF A;  4WMC A;  3UPO A;  1CEG A;  1LI9 A;  4BD1 A;  1ERM A;  1BLC A;  1XA7 A;  4Y0O A;  3IH8 A;  2VGJ A;  4YIN A;  1QME A;  3QHY A;  3V5M A;  3HUM A;  2Y59 A;  4BL3 A;  4QJG A;  4E3J A;  4WM9 A;  1N4O A;  1CK3 A;  4KZA A;  2RL3 A;  3HLC A;  1NRF A;  4OOM A;  3ZCZ A;  5FAQ A;  3ZVW A;  3CG5 A;  4R4S A;  4Y0T A;  3FKW A;  4KZ4 A;  4LV3 A;  3IWI A;  3W4P A;  4KG6 A;  3BLM A;  4KQO A;  5FQI A;  4HEF A;  2EX6 A;  1ES2 A;  5M18 A;  3BEC A;  3HLG A;  3SS3 A;  1JWV A;  5FAP A;  2P74 A;  1YLJ A;  2Y2O A;  3M6B A;  4GZB A;  3NBL A;  4N1H A;  3LY3 A;  3HLF A;  4IVI A;  1O7E A;  2DRW A;  2XDM A;  4FH4 A;  5DTT A;  3V3S A;  1H8Y A;  4JF6 A;  3O86 A;  5EVL A;  5CHJ A;  3UE1 A;  3S1Y A;  2ZC4 B;  4WEL A;  4R1G A;  4S2I A;  2WKH A;  5HAP A;  3B3X A;  3OPH A;  3OZH A;  2J9P A;  3HRE A;  4GD8 A;  1PI4 A;  2Y4A A;  4ZAM A;  2WGW B;  1ERQ A;  4X68 A;  2ZC7 A;  2B5R A;  1NXY A;  4LCM A;  4R0Q A;  3IXD A;  5JYP A;  4HBT A;  3ZG7 B;  1MPL A;  2QPN A;  2ZQ9 A;  3UE0 A;  4RVA A;  4KZB A;  2Z2L B;  3HLB A;  2QMI A;  3NCK A;  4GD6 A;  2XK1 A;  3BLS A;  4OH0 A;  2OV5 A;  1RP5 A;  5KSC A;  2OLV A;  3NI9 A;  3TG9 A;  5DF7 A;  1ZKJ A;  2CC1 A;  1LI0 A;  2JC7 A;  3LEZ A;  4DXB A;  1NZO A;  3S22 A;  5AQ9 A;  4RX2 A;  4KQQ A;  2JBF A;  3G31 A;  2GDN A;  1G6A A;  4JXS A;  4U0X A;  4P85 A;  3HVF A;  5HW3 A;  5F1F A;  4GDB A;  3OPL A;  5F83 A;  1KDS A;  3M6H A;  2DNS A;  2Y2L A;  4LV2 A;  4P6B A;  3G2Z A;  4WEK A;  4OQ0 A;  3IF5 A;  1BUL A;  2R9X A;  4S2K A;  1FQG A;  2WGV A;  2A49 A;  2WZX A;  4F94 A;  1LL9 A;  2A3U A;  1IYS A;  1GHM A;  4KG5 A;  5FAO A;  3IQA A;  2R9W A;  4ZJ1 A;  5CGW A;  1MWT A;  1BSG A;  2H0T A;  2WKI A;  3BFF A;  4IBX A;  5EPH A;  1M6K A;  1MY8 A;  1XGI A;  4R3B A;  5FI6 A;  3BYD A;  1ES5 A;  1NYM A;  1L0G A;  1CI9 A;  3NY4 A;  5BOH A;  2Y2Q A;  3HL9 A;  3GQZ A;  3G32 A;  5FQJ A;  4BD0 A;  4DE3 A;  5KMW A;  4BEN A;  1MXO A;  5GLC A;  4KG2 A;  5GHX A;  4UAA A;  3BRM A;  2OSU A;  4GDN A;  3SS4 A;  3VMA A;  1RGZ A;  1XPB A;  1YLT A;  5EOO A;  1E3U D;  3GRJ A;  4OQG A;  1FCM A;  1FCN A;  1K38 A;  1PWG A;  1E25 A;  4WMC D;  3N4I A;  4E6X A;  3PBR A;  3VP4 A;  1YLY A;  1L0F A;  2V20 A;  2ZQ8 A;  3ZG5 A;  5M19 A;  4MBH A;  3Q1F A;  4JXG A;  1E4D A;  3WWX A;  4B88 A;  1ALQ A;  1RGY A;  3VP2 A;  1K54 A;  1Y54 A;  1KGG A;  5FI7 A;  5E2G A;  4Z9Q A;  4DKI A;  5FQK A;  3VOY A;  4KEN B;  4OLG A;  2J9O A;  1TDL A;  2ZQA A;  1TEM A;  3OC2 A;  3UPP A;  4C75 A;  3UN7 A;  3IWQ A;  4U3T A;  4K91 A;  3Q7Z A;  2ZLY A;  3IWO A;  2PBY A;  1K56 A;  2HDQ A;  3G30 A;  3P98 A;  4X55 A;  4E6W A;  1I2W A;  4X53 A;  2XH9 A;  4R23 A;  5E2E A;  5FSR A;  1O07 A;  4GKU A;  4NK3 A;  1JTG A;  3DTM A;  5DTK A;  3IF6 B;  3QNC A;  3NDE A;  1G68 A;  3HUN A;  4S2N A;  5G18 A;  5HL1 A;  4KZ3 A;  1GHI A;  1KGF A;  1BTL A;  4B4Z A;  4A5R A;  4MNR A;  1KE4 A;  4K0W A;  2HDS A;  1IYP A;  2Y2H A;  2Y2J A;  3GMW A;  1GCE A;  2HDU A;  1AXB A;  3PAG A;  3Q7V B;  4P0M A;  4QD4 A;  3SH9 A;  3VP0 A;  3ITB A;  1I5Q A;  1FSY A;  5CGS A;  5CEC A;  2P9V B;  4BJP A;  3PBO A;  5HFO A;  1K57 A;  1KVM A;  4FD8 A;  3MZD A;  1DY6 A;  4Q8I A;  1DJA A;  2V2F F;  2Y55 A;  1PW1 A;  3NDG A;  3SOI A;  1K4F A;  4KZ6 A;  3PBN A;  2WYX A;  4PM6 A;  1YT4 A;  4ID4 A;  3WS0 A;  4OPY A;  4S2N C;  1M40 A;  2X02 A;  2IWD A;  4DE2 A;  5FQQ A;  1NY0 A;  2Y2I A;  3PBS A;  4RX3 A;  4RA7 A;  4OKP A;  5EVI A;  5TGF A;  4L0L A;  1SHV A;  4MLL A;  4R3J A;  1ZC2 A;  3IXH A;  2XEP A;  1DJB A;  2WUQ A;  4BLM A;  3UDX A;  3ZNT A;  3UE3 A;  4QB8 A;  1KE3 A;  2Z2M B;  3GSG A;  1FSW A;  3IHA A;  3SS5 A;  3ZHH A;  1H8Z A;  3WS5 A;  3M2J A;  4OOY A;  2EFX A;  1H5X A;  1YLW A;  1GA9 A;  4UA9 A;  3VP1 A;  4EV4 A;  1PWD A;  2DCF A;  1K57 C;  3BEB A;  2Y2M A;  1PIO A;  1GHP A;  2X01 A;  1C3B A;  5CER A;  4PM7 A;  1RCJ A;  2XD5 A;  4PPR A; 
#chains in the Genus database with same CATH topology
 3ZDJ A;  4X6T A;  3H82 A;  1W8Q A;  3N6I A;  4O7D A;  1DP9 A;  2ACG A;  5GL9 A;  3VP3 A;  1YPR A;  3IXB A;  4EU0 A;  3G34 A;  3CHW P;  4Y3I A;  2V1B A;  4EW7 A;  3ZGA B;  4FOF A;  2PR5 A;  3LR0 A;  2MJ6 A;  2WGW A;  4GB7 A;  2ZQ7 A;  4BL2 A;  1WYC A;  2G2U A;  5E2F A;  3Q81 A;  4JXV A;  4EUZ A;  2J8Y A;  1NZU A;  5TBM B;  2I72 A;  2EX2 A;  1SZV A;  3TW8 A;  3A0R A;  1V9Y A;  1SDN A;  5EFW A;  4F3L A;  3VV4 A;  2Q9M A;  5AQA A;  3OLO A;  1IYO A;  3UNW A;  4DMZ A;  3HBR A;  4ZJ3 A;  3QP8 A;  3L9K A;  4WUJ A;  3IBJ A;  4MBK A;  2W27 A;  1KE0 A;  4MBF A;  3T12 B;  2J3T D;  3AGF A;  2XQZ A;  1DJC A;  2VGK A;  4JPM A;  3GTC A;  5EVI D;  2HP5 A;  2HZ5 A;  3IX8 A;  4ESP A;  1GA0 A;  1VM1 A;  4KZ9 A;  4DE1 A;  4PM5 A;  2B02 A;  5HX9 A;  3KYQ A;  3CPT B;  4Y5F A;  2XLN A;  2OLU A;  3UMD A;  1D1J A;  2WKR A;  3UDF A;  5GHZ A;  1IFQ A;  3RXW A;  2XRN A;  4WZ4 A;  1IKG A;  1ACF A;  3ZNY A;  3Q07 A;  1NLY A;  2EXB A;  3VSK A;  3EGX C;  3QP1 A;  2VK3 A;  2PYP A;  1NYY A;  3LO7 A;  5FDS A;  1XXM A;  5F6A A;  4GS9 A;  4LV1 A;  2W3D A;  2XFS A;  1SKF A;  3W2Z A;  3V3R A;  2WAE A;  3AGD A;  4LV0 A;  4PMA A;  1SDE A;  2BLS A;  1LHY A;  2XF3 A;  3D4F A;  3LGO A;  1VEU A;  5HWT A;  3RXX A;  3S7Q A;  1KGE A;  1N9L A;  4H8R A;  3MZF A;  4HP4 A;  3G4P A;  2O9C A;  5J3W A;  5HZH A;  4N9K A;  2ZL1 A;  3HJK A;  2WGI A;  4BWI A;  2O99 A;  3IHB A;  5KSH A;  1XJ4 A;  1MWR A;  4JKT A;  4CJN A;  2PDR A;  1T1A A;  4OON A;  5CGX A;  1XKZ A;  4WBG A;  3LFV A;  3BWL A;  3SH8 A;  2O9A A;  2KX6 A;  3T1S A;  1ERO A;  2K2N A;  1W63 Q;  1OT9 A;  5TR7 A;  1TDG A;  2Y79 A;  3N8S A;  3FPV A;  3IT9 A;  4IJG A;  2VGL M;  2AVX A;  1JWP A;  5IHV A;  3MSH A;  3SZT A;  2HP6 A;  1U60 A;  1MKI A;  1PI5 A;  1BLS A;  4X56 A;  2QWS A;  1UWN X;  3N7W A;  2H28 A;  5E43 A;  3KSI A;  3NIA A;  2JKT I;  1IEM A;  3UB5 P;  1ONH A;  2W3E A;  2JE5 A;  5HL6 A;  1OJ5 A;  3V50 A;  4N9L A;  2HPB A;  4GN2 A;  1YLP A;  4K0X A;  5EVI B;  1YMX A;  3F1P A;  2D01 A;  3A3I A;  3C5A A;  3ZG0 A;  3HJI A;  3C2W A;  5DF8 A;  5HDD A;  1FR6 A;  4PM8 A;  3LIE A;  4HJ4 A;  4E3O A;  2Q9N A;  1CEG A;  4HNB A;  2VGJ A;  3QHY A;  4BL3 A;  2WKP A;  1CK3 A;  4KZA A;  1NLZ A;  3CIT A;  2RL3 A;  1NRF A;  3H82 B;  4OOM A;  3ZCZ A;  4R4S A;  4Z1W A;  4Y0T A;  4KZ4 A;  4YNR A;  4LV3 A;  3IWI A;  5FQI A;  3LID A;  1XFQ A;  2EX6 A;  1ES2 A;  3BEC A;  3SS3 A;  3IBR A;  4N1H A;  3HLF A;  4IVI A;  3O86 A;  4KUO A;  5EVL A;  5CHJ A;  4WEL A;  4S2I A;  3C38 A;  2VKS A;  1EW0 A;  1TS7 A;  2WGW B;  4X68 A;  3EEA A;  2EWW A;  1MPL A;  2ZQ9 A;  3MQQ A;  4KZB A;  1H0M A;  4OH0 A;  4Y15 A;  3TG9 A;  1LI0 A;  5TJJ A;  1NZO A;  3KO6 A;  1TD5 A;  4F3L B;  4RX2 A;  2VX8 A;  4KQQ A;  4JXS A;  3DTE A;  3T1Q B;  2Y2L A;  3T1R A;  4P6B A;  1AWI A;  4WEK A;  4K08 A;  3BJN A;  3CAX A;  1FQG A;  3DBA A;  2WZX A;  1GHM A;  3GEC A;  3IQA A;  1MWT A;  2WKI A;  2CMN A;  1M6K A;  3BYD A;  2VGL S;  3R7W A;  5BOH A;  2Y2Q A;  4BEN A;  4KG2 A;  5HPF A;  4GDN A;  2OSU A;  3SS4 A;  1XPB A;  4HH3 A;  4OQG A;  1YLY A;  1L0F A;  5M19 A;  3Q1F A;  1T19 A;  4JXG A;  3V67 A;  5FI7 A;  4JGQ A;  5FQK A;  1TDL A;  2ZQA A;  3O5Y A;  3IWO A;  4GS9 B;  1GSW A;  4X55 A;  2VEA A;  2XH9 A;  4GKU A;  3DTM A;  3QNC A;  4YWZ A;  3HUN A;  4ETZ A;  1W63 M;  4II7 A;  4KZ3 A;  1BTL A;  3KYE A;  4A5R A;  1KE4 A;  2Y2H A;  3P7N A;  1AXB A;  2JKT M;  1VEU B;  2JHE A;  1T18 A;  5CGS A;  1YAX A;  5HFO A;  4LGW A;  1KVM A;  4FD8 A;  5MC7 A;  2V2F F;  1PW1 A;  3NDG A;  2ZL1 B;  4PM6 A;  3WS0 A;  4S2N C;  1M40 A;  1PNE A;  3PYP A;  4OKP A;  5EM0 A;  5TGF A;  1SHV A;  2ZOI A;  3MMH A;  4BLM A;  3GSG A;  3SS5 A;  4EEP A;  2EFX A;  1GA9 A;  1PWD A;  1K57 C;  2Z6D A;  1PIO A;  1GHP A;  1C3B A;  4MCW A;  1RCJ A;  2ZQC A;  5I94 A;  2L4R A;  3HLE A;  4S2J A;  5CEB A;  1PFL A;  5IU1 A;  2ZM8 A;  2EX9 A;  2H5S A;  3O87 A;  1KVL A;  3ZFZ A;  1J9M A;  3U4L P;  1EWZ A;  4N1X A;  2R78 A;  4OOL A;  4UHU A;  3FZC A;  3MXR A;  2WK0 A;  4BMW A;  2W1T A;  4E04 A;  2HP9 A;  3K3C A;  2FZ0 A;  4NET A;  1LL5 A;  3MZE A;  1F9I A;  4BQM A;  5CXW A;  1T1C A;  5L8M A;  2J80 A;  4DXC A;  3CZD A;  3A0V A;  4ZDX A;  4YFM A;  2GX5 A;  1BUE A;  4KZ7 A;  2IWB A;  5HAQ A;  1L0D A;  4ME4 A;  4DDY A;  2Z6C A;  2EXA A;  4WZ5 A;  1S1Z A;  4D2O A;  3A3E A;  1S1Y A;  4OP5 A;  3FWL A;  3IX4 A;  4FSF A;  3RJU A;  3WS4 A;  4S2O A;  3E2K A;  3CUE C;  1SCW A;  1K6R A;  5AVF A;  1CJF A;  3C4O A;  4OPR A;  3G35 A;  1PW8 A;  1ZHH B;  3A3D A;  3KSH A;  2ZMA A;  3UDI A;  1F2K A;  4AFI A;  3UB6 A;  1K54 C;  3A3J A;  3KSF A;  4ZJ2 A;  3C4P A;  3F1N A;  1K55 C;  2ZC5 B;  3NUL A;  1QMF A;  4JGO A;  1CI8 A;  2LB5 A;  1LSX A;  2VV7 A;  3T4Q A;  1L3L A;  3RFB A;  2ZC6 B;  4PM9 A;  2GJ3 A;  3C7V A;  4OPQ A;  1ES3 A;  1Z6F A;  3GDI A;  4NKP A;  1YKD A;  3FC7 A;  5FAS A;  1WYB A;  5EV0 A;  5CX7 A;  5L09 A;  3ZG8 B;  2Y2N A;  3BFE A;  5DJT A;  3OCL A;  4OPZ A;  3EOI A;  2IWC A;  5DF9 A;  3R7W B;  5CHU A;  3Q7V A;  3MBZ A;  3WRZ A;  3GR2 A;  4OQI A;  1WE4 A;  4L9E A;  3WS1 A;  4G3V A;  4EBN A;  4OLD A;  3IF6 C;  4HBU A;  5E2H A;  5GLB A;  3JVU A;  4Y17 A;  2V8C A;  4X69 A;  4FH2 A;  2Y2P A;  1YM1 A;  1K56 D;  3M2K A;  5A93 A;  4S2L A;  3NC8 A;  4ZRR A;  1DP8 A;  2WZZ A;  4IBR A;  2ZBB A;  5GHY A;  4QU3 A;  4I3A A;  1A0K A;  3CMZ A;  4JXW A;  4KZ5 A;  4NXG A;  3BM6 A;  4E3N A;  3TRC A;  4G3K A;  1IYQ A;  5HWV A;  1W7F A;  3BFD A;  1JNU A;  3LYX A;  2A2L A;  4M3K A;  4C3Q A;  4CLC D;  1W79 A;  4FUW A;  1S66 L;  1ZG6 A;  2NUT C;  4QY5 A;  3IX3 A;  1VQQ A;  5CHM A;  2Y91 A;  2UWX A;  3H9W A;  4KUK A;  4DF6 A;  3O88 A;  3DWZ A;  1ONG A;  4R70 A;  1XP4 A;  1N9B A;  4NXF A;  1XA7 A;  4Y0O A;  3D9Y A;  2INW A;  4UQI M;  5FEF A;  2VLG A;  3ZVW A;  2JKR I;  4IUK A;  3FKW A;  1UGU A;  4HY8 A;  1TS6 A;  3W4P A;  3BLM A;  2JN7 A;  3HLG A;  5FAP A;  5K5B A;  1YLJ A;  3D72 A;  3K2N A;  3M6B A;  3CLO A;  2DRW A;  2XDM A;  5DTT A;  3V3S A;  4JF6 A;  3UE1 A;  2W1T B;  3BY8 A;  4R1G A;  4GD8 A;  1PI4 A;  1ERQ A;  2ZC7 A;  4LCM A;  4R0Q A;  1MC0 A;  5DJU A;  3ZG7 B;  1MZU A;  3UB8 A;  4RVA A;  2Z2L B;  2QMI A;  2PHY A;  4GD6 A;  3BLS A;  2OV5 A;  1ZKJ A;  4ARZ A;  5HD5 A;  2G7U A;  4ETX A;  3S22 A;  2UV0 E;  2JBF A;  3G31 A;  2GDN A;  5F1F A;  1KDS A;  2OAP 1;  2DNS A;  3G2Z A;  4WF0 A;  2P7J A;  2R9X A;  4S2K A;  2HF6 A;  2WGV A;  3KSG A;  4F94 A;  1LL9 A;  1IYS A;  1NWZ A;  4ZJ1 A;  2JKF A;  5FI6 A;  3TE8 A;  3CUE A;  1ES5 A;  2V0U A;  3HL9 A;  4BD0 A;  1MXO A;  1YLT A;  3EGD C;  1PWG A;  1E25 A;  3VP4 A;  2JKG A;  4MN6 A;  3ZG5 A;  1E4D A;  2O9B A;  4B88 A;  4CLC B;  1XJ3 A;  3VP2 A;  1K54 A;  1K0K A;  4D60 A;  2V8F A;  1TEM A;  4C75 A;  4MMN A;  4Q0I A;  4MDZ A;  2HDQ A;  1J3W A;  1SKO B;  3G30 A;  4E6W A;  4X53 A;  4LRZ E;  4R23 A;  1JTG A;  1OTE A;  5DTK A;  3NDE A;  3LIB A;  4MNR A;  2HDS A;  1IYP A;  1ZTU A;  2OOL A;  3PAG A;  3Q7V B;  3VP0 A;  4QD4 A;  4UQI S;  5J7E A;  2WKQ A;  3ITB A;  4QWO A;  4Q8I A;  2Y55 A;  4KZ6 A;  2WYX A;  1YT4 A;  2X02 A;  4RX3 A;  3QP4 A;  4Q0H A;  4R3J A;  3UDX A;  1P9W A;  4HI4 A;  5HDC A;  3T4T A;  1KE3 A;  4LRY C;  1VHM A;  3M2J A;  4OOY A;  3T50 A;  3D3O A;  1H5X A;  1YLW A;  5HPI A;  2P08 A;  4UA9 A;  3ZQ5 A;  1F5M A;  3BW6 A;  3UB7 A;  4PM7 A;  1Y28 A;  4PPR A;  3IXG A;  4GW9 A;  2J3T C;  1HVB A;  1XA1 A;  5EVI C;  1OME A;  5A90 A;  1PZP A;  3T4L A;  3T1X A;  4BBV A;  4S2M A;  2QKP A;  2FFF B;  3ITA A;  3E4Q A;  2YKF A;  5FAT A;  2J3W A;  2EWV A;  5KIZ A;  4GCZ A;  4U0T A;  1YQS A;  3CJM A;  4DJ2 A;  3MQ0 A;  3BY9 A;  3C7U A;  1XFN A;  4PAU A;  3HUO A;  2W0N A;  3MFX A;  1K25 A;  1LSV A;  4LCL A;  5G4Z A;  1MKM A;  3FKV A;  4JBF A;  4R38 A;  3Q82 A;  4MEZ A;  5FA7 A;  1PZO A;  2XFT A;  5DVA A;  3I7J A;  2G2W A;  2C6W B;  4KZ8 A;  2B95 A;  1MBL A;  4LPZ A;  4P6Z M;  1DRM A;  2WAD A;  2HGV A;  3EQU A;  4EBL A;  1BLH A;  1S67 L;  4DN0 A;  5FL3 A;  4E3M A;  2D02 A;  3S4X A;  3NOP C;  3AGE A;  4XUZ A;  2NUP C;  2PBD P;  2XGN A;  3MKF A;  3FV7 A;  4E3L A;  4O01 A;  2GZA A;  4DKI A;  4C6Y A;  5HAR A;  4GNU A;  5AQB A;  4Y7P A;  4OP8 A;  3WS2 A;  3LCE A;  4NEE D;  3PHY A;  1YLZ A;  4DDS A;  2L1M A;  3E0Y A;  1E3U A;  4IED A;  1ZG4 A;  3OPP A;  4KQR A;  5CTM A;  4ARZ B;  2P04 A;  4HJ3 A;  4UEY A;  2K7S A;  3EQV A;  3JVV A;  1JWZ A;  3B33 A;  4OQH A;  5CED A;  3T4S A;  1OT6 A;  1WA9 A;  3OBF A;  3B47 A;  2H10 A;  5DFX A;  2Y8H A;  4QHC A;  1ESI A;  2EX8 A;  4E3K A;  1OJG A;  3BFG A;  2QYB A;  3HLD A;  5DTS A;  1W5D A;  1I2S A;  1YMS A;  3CPT A;  2K31 A;  5AQ7 A;  5GLA A;  3UPN A;  2C5W B;  2P9V A;  5AVE A;  5LBR A;  3ZVT A;  2XRO A;  2V1A A;  1ESU A;  3QNB A;  5A92 A;  4HH2 A;  3EWK A;  4Y0U A;  3RTY A;  3DAV A;  1H8M A;  1L2S A;  1NRJ A;  4HES A;  3W4O A;  3SH7 A;  1MWS A;  5CRF A;  3F1P B;  3A0S A;  5FQM A;  3GVB A;  3E2L A;  3S7N A;  4ZBE A;  2KOI A;  3C8C A;  4WYY A;  3LY4 A;  1BT5 A;  1XGJ A;  3WRT A;  1N9O A;  3PBT A;  3NJA A;  5EVE A;  4MN5 A;  2HJE A;  4PHT A;  4B4X A;  5D3O A;  5HD3 A;  5HAI A;  3MFD A;  1K6S A;  5IS1 A;  4P6Z S;  3P09 A;  1JTD A;  4L9G A;  3A3F A;  2H0Y A;  5FDH A;  1K4E A;  1P97 A;  4RQ9 A;  2M7U A;  4UA7 A;  5EEC A;  1TF1 A;  1CQA A;  3PBQ A;  1KDW A;  4X25 A;  5L2F A;  5J4E A;  4LLO B;  3RH8 B;  3UPO A;  4BD1 A;  1ERM A;  3HUM A;  1N4O A;  3MS6 A;  3UME A;  3HLC A;  5FAQ A;  3CG5 A;  4KQO A;  4HP9 A;  4HEF A;  3S7O A;  1JWV A;  2P74 A;  2Y2O A;  3NBL A;  3LY3 A;  1O7E A;  4FH4 A;  4JGR A;  2DMW A;  4BBT A;  1Y4O A;  3OZH A;  3OPH A;  4XT2 A;  1UWP X;  1NXY A;  5JYP A;  3QP5 A;  3MXQ A;  2Q0O A;  2QPN A;  4LFU A;  3E4P A;  3HLB A;  1RP5 A;  3NI9 A;  4DXB A;  1PRQ A;  4DJ3 A;  1G6A A;  4U0X A;  1N9N A;  3MF0 A;  4P85 A;  3M6H A;  4LV2 A;  1FIK A;  4OQ0 A;  3IF5 A;  1BUL A;  1HLU P;  2A3U A;  4KG5 A;  5FAO A;  2R9W A;  5CGW A;  1BSG A;  2BTF P;  3BFF A;  4IBX A;  2QHK A;  1MY8 A;  1NYM A;  3QP6 A;  1L0G A;  3KYZ A;  5F68 A;  3NY4 A;  3G32 A;  5KMW A;  4DE3 A;  1P9R A;  5GLC A;  4UAA A;  3BRM A;  3VMA A;  2PD8 A;  1RGZ A;  3GRJ A;  1FCN A;  1K38 A;  4EER A;  3S7P A;  3N4I A;  3PBR A;  3VOL A;  2ZQ8 A;  4MBH A;  3WWX A;  4MN7 A;  4I5S A;  3UE6 A;  1ALQ A;  3FPW A;  1KGG A;  2QJ7 A;  5E2G A;  4Z9Q A;  2FH5 A;  2PR6 A;  3VOY A;  3OOV A;  2HV1 A;  3OC2 A;  3UPP A;  3UN7 A;  3IWQ A;  3Q7Z A;  2ZLY A;  2PBY A;  3P98 A;  1I2W A;  1GSX A;  5E2E A;  1O07 A;  2HJ9 C;  3G6O A;  4NK3 A;  1G68 A;  4S2N A;  2QJ5 A;  5HL1 A;  3P01 A;  4B4Z A;  1VB6 A;  3ICY A;  4B93 A;  1LT0 A;  3GMW A;  4WN5 A;  2YKH A;  1FSY A;  4H6J A;  2P9V B;  3PBO A;  1K57 A;  1DY6 A;  4YOF A;  1DJA A;  3SOI A;  4GHI A;  4ID4 A;  5AJG A;  3L7H A;  3LIF A;  2Y2I A;  3PBS A;  3SW1 A;  1OPX A;  4HJ6 A;  4L0L A;  4BBU A;  2L0W A;  4MLL A;  3IXH A;  2XEP A;  3LI8 A;  1V9Z A;  2E8J A;  3UE3 A;  3IHA A;  1H8Z A;  3VP1 A;  4EV4 A;  1X0O A;  2VJW A;  2DCF A;  3BEB A;  2Y2M A;  5DFY A;  2X01 A;  2XD5 A;  5EUA A;  2ZD8 A;  1YSP A;  4N92 A;  2EFU A;  5G4Y A;  4S2P A;  4DRT A;  3CI6 A;  4O8G A;  5F82 A;  2EA9 A;  3VOZ A;  4Q0J A;  1VET A;  4GLQ A;  1S0W A;  3W4Q A;  3PAE A;  2ZQD A;  2ZC3 B;  2WKE A;  4JF4 A;  4R3A A;  4CLC E;  3LI9 A;  4KQD A;  3H7W A;  4EBP A;  2GNX A;  3N8L A;  2QZ6 A;  5CTN A;  3DTK A;  3F1N B;  1XJ6 A;  2W3H A;  2X71 A;  3O3V A;  4I38 A;  1FOF A;  5U47 A;  1D06 A;  4R4R A;  5M1A A;  5HDS A;  3N8R A;  2XA7 M;  4P87 A;  3TSG A;  1K55 A;  2PRF A;  2ZM0 A;  2PT7 A;  4XUX A;  2HDR A;  2I9V A;  3DW0 A;  4O0P A;  4WZ5 C;  2ZJ9 A;  1IEL A;  2IA2 A;  3ZG9 B;  3TOI A;  4HIA A;  2E8I A;  4CQH A;  3IS2 A;  1T1B A;  3FYZ A;  5EOE A;  4XT2 B;  4JLF A;  2A24 A;  3MKE A;  5JYO A;  1OTD A;  2XR0 A;  1HD8 A;  3NOU C;  2BG1 A;  4X1L A;  3VSL A;  4IVK A;  3VFF A;  5F1G A;  4B9O A;  4JGP A;  5TFQ A;  3U2A A;  3DTI A;  3ULF A;  3F1O A;  2Y2G A;  2VV8 A;  1TVF A;  1Q2P A;  1CEF A;  1FCO A;  2W3F A;  4UA6 A;  1HZO A;  3UB9 A;  4LEN A;  1LLB A;  2FFY A;  3W8K A;  4JF5 A;  1S4R A;  1W8Y A;  3T4O A;  3PTE A;  1S4S A;  1G5U A;  5FI2 A;  2ZM2 A;  1STZ A;  1YSQ A;  3BFC A;  4NXE A;  5FQ9 A;  3IF6 A;  2V1Z A;  1HTZ A;  4OVD A;  4CLC C;  4EQI A;  1OTA A;  1PYY A;  1TS0 A;  2J7V A;  3HLW A;  2OWJ A;  5KZH A;  5A91 A;  3IH9 A;  3DWK A;  1IOU A;  2JKR M;  3HCY A;  5HSQ A;  1FIL A;  3OPR A;  1L0E A;  4QPR A;  1BZA A;  5GLD A;  3VE3 A;  1MWU A;  4CPK A;  2ZMV A;  1KOU A;  4NXB A;  2WAF A;  1LSW A;  1OTB A;  1ES4 A;  2XD1 A;  3ISG A;  3T4J A;  2PU2 A;  2PU4 A;  4GOG A;  3LUQ A;  2Y2K A;  5EE8 A;  3VE4 A;  5DKL A;  2M1C A;  4E3I A;  1XX2 A;  4RYE A;  3B42 A;  2V9A A;  5J8X A;  3UY6 A;  3GV9 A;  1Q2Q A;  5DKK A;  3T4K A;  5I5L A;  3BQA A;  1EI5 A;  3MR0 A;  4L9F A;  3VFH A;  1IKI A;  2JCH A;  1LL8 A;  2XA7 S;  3C30 A;  4H6J B;  2OWH A;  4DE0 A;  4QY6 A;  5L10 A;  1S6R A;  3LEQ A;  4GHI B;  4PKY G;  2RCX A;  1BLP A;  3NOT C;  3V39 A;  1G6O A;  1NJ4 A;  3UO9 A;  4XXR A;  4ZTK A;  4WEJ A;  3G2Y A;  5L07 A;  3JYI A;  5A8B A;  3OCN A;  3MJQ A;  3MXS A;  4FCF A;  5TBM A;  2B18 A;  1PWC A;  4I3I A;  1JVJ A;  4EWF A;  1FR1 A;  4WMC A;  1LI9 A;  1Z09 A;  1BLC A;  3IH8 A;  4YIN A;  1QME A;  3V5M A;  2Y59 A;  2LB9 A;  4QJG A;  4E3J A;  4WM9 A;  3MQO A;  1CF0 A;  2ZMF A;  2M7V A;  5F69 A;  1G28 A;  2VZW A;  4KG6 A;  4Y13 A;  3LIA A;  5M18 A;  4R6L A;  4M4X A;  4GZB A;  1VET B;  3FG8 A;  2PYR A;  1DP6 A;  1H8Y A;  3EEH A;  3S1Y A;  2ZC4 B;  5HAP A;  2WKH A;  3B3X A;  2J9P A;  3HRE A;  4EES A;  2Y4A A;  4ZAM A;  3H7W B;  5HWW A;  2B5R A;  3IXD A;  3NEC A;  4EXO A;  4HBT A;  3BQ8 A;  3UE0 A;  3R4K A;  3NCK A;  4WLA A;  2XK1 A;  5KSC A;  2OLV A;  5DF7 A;  2CC1 A;  2JC7 A;  3LEZ A;  4Y2F A;  3TJZ C;  5AQ9 A;  1ODV A;  3CWF A;  2PAV P;  3E98 A;  3HVF A;  5HW3 A;  4GDB A;  3OPL A;  5F83 A;  4IHQ A;  1XJ2 A;  1H3Q A;  3NHQ A;  2W3G A;  2A49 A;  4I3J A;  5IT5 A;  3LR3 A;  2XSS A;  2H0T A;  5F5Y A;  1P0Z A;  1XGI A;  4R3B A;  5EPH A;  1TS8 A;  3IS2 B;  1CI9 A;  2OAQ 1;  3GQZ A;  4PKY A;  5FQJ A;  2BAS A;  5GHX A;  2A24 B;  4X1M A;  5EOO A;  1E3U D;  1FCM A;  4WMC D;  4NG2 A;  4E6X A;  4LRX C;  2O0Y A;  4HHD A;  2V20 A;  5C5K A;  3JPU A;  1RGY A;  1Y54 A;  4EUV A;  3F1O B;  4KEN B;  4OLG A;  2J9O A;  4HOI A;  4HQA A;  4U3T A;  4K91 A;  3KX0 X;  1K56 A;  4WL9 A;  2ZOH A;  5FSR A;  4EEU A;  3IF6 B;  3LR5 A;  5G18 A;  1GHI A;  5EM1 A;  1KGF A;  1GSV A;  2W1R A;  4K0W A;  2Y2J A;  1GCE A;  2HDU A;  3LIC A;  4IUH A;  4P0M A;  3SH9 A;  1OTI A;  3LR4 A;  1I5Q A;  2VA0 A;  4I39 A;  5CEC A;  3PXP A;  4BJP A;  3MZD A;  2V0W A;  1K4F A;  4CLC A;  1D7E A;  3PBN A;  5FEG A;  4OPY A;  3ZYT A;  2IWD A;  2KLI A;  5FQQ A;  1NY0 A;  1F98 A;  4DE2 A;  4RA7 A;  5EVI A;  2PD7 A;  4EQ1 A;  1ZC2 A;  2VV6 A;  1DJB A;  2WUQ A;  3E4O A;  3ZNT A;  1BYW A;  4QB8 A;  4GJ4 A;  2Z2M B;  3ZHH A;  1FSW A;  1SKO A;  3K3D A;  3WS5 A;  3QP2 A;  4G3W A;  3PR6 A;  4EET B;  5CER A;  4FTX A;  2KDK A; 
#chains in the Genus database with same CATH homology
 3ZDJ A;  3IXG A;  5EUA A;  2ZQC A;  2ZD8 A;  4X6T A;  5I94 A;  1W8Q A;  1HVB A;  3HLE A;  3N6I A;  4S2J A;  4N92 A;  4O7D A;  1XA1 A;  5CEB A;  5EVI C;  1OME A;  2ZM8 A;  2EFU A;  5A90 A;  2EX9 A;  2H5S A;  3O87 A;  1KVL A;  1PZP A;  4S2P A;  5GL9 A;  3VP3 A;  3ZFZ A;  4DRT A;  1J9M A;  5F82 A;  3VOZ A;  1EWZ A;  3IXB A;  4N1X A;  4S2M A;  3G34 A;  1S0W A;  3W4Q A;  4OOL A;  2FFF B;  4UHU A;  3ITA A;  3FZC A;  3MXR A;  3PAE A;  2WK0 A;  3ZGA B;  2ZQD A;  2ZC3 B;  2WKE A;  4JF4 A;  2HP9 A;  1LL5 A;  3MZE A;  2WGW A;  4NET A;  5FAT A;  4GB7 A;  2ZQ7 A;  4BQM A;  5CXW A;  3N8L A;  4EBP A;  4U0T A;  1YQS A;  3CJM A;  4BL2 A;  2QZ6 A;  1WYC A;  2G2U A;  5E2F A;  4DXC A;  3Q81 A;  3CZD A;  3C7U A;  5CTN A;  4JXV A;  4ZDX A;  3HUO A;  4EUZ A;  2J8Y A;  4YFM A;  1BUE A;  1K25 A;  1NZU A;  4KZ7 A;  2IWB A;  1L0D A;  5HAQ A;  4LCL A;  4DDY A;  2EXA A;  2I72 A;  4WZ5 A;  2X71 A;  3O3V A;  3FKV A;  4JBF A;  2EX2 A;  4D2O A;  1FOF A;  3A3E A;  5U47 A;  3Q82 A;  4R4R A;  4OP5 A;  1SDN A;  4MEZ A;  3FWL A;  5FA7 A;  5M1A A;  1PZO A;  2XFT A;  3N8R A;  2Q9M A;  4FSF A;  4S2O A;  5DVA A;  5AQA A;  3RJU A;  3E2K A;  3WS4 A;  3I7J A;  1IYO A;  1SCW A;  4P87 A;  2G2W A;  1K6R A;  2C6W B;  3TSG A;  1K55 A;  4KZ8 A;  3UNW A;  1MBL A;  3HBR A;  4ZJ3 A;  2ZM0 A;  2WAD A;  3C4O A;  4XUX A;  2HDR A;  4MBK A;  4OPR A;  3EQU A;  3G35 A;  1KE0 A;  1PW8 A;  1BLH A;  4MBF A;  4EBL A;  3DW0 A;  4WZ5 C;  4E3M A;  3A3D A;  2ZMA A;  2XQZ A;  3AGF A;  2ZJ9 A;  1DJC A;  2VGK A;  3S4X A;  4JPM A;  1IEL A;  3UDI A;  3GTC A;  3AGE A;  4XUZ A;  5EVI D;  2HP5 A;  3ZG9 B;  3TOI A;  1GA0 A;  2XGN A;  2E8I A;  3MKF A;  3FV7 A;  4E3L A;  1VM1 A;  1K54 C;  3A3J A;  3FYZ A;  4KZ9 A;  5EOE A;  5HAR A;  3C4P A;  4GNU A;  4ZJ2 A;  4C6Y A;  4DE1 A;  5AQB A;  4PM5 A;  5HX9 A;  4JLF A;  1K55 C;  2ZC5 B;  3MKE A;  2XLN A;  4OP8 A;  4Y7P A;  3WS2 A;  1QMF A;  5JYO A;  2OLU A;  3LCE A;  1YLZ A;  4DDS A;  2XR0 A;  3UDF A;  5GHZ A;  1HD8 A;  2BG1 A;  1E3U A;  3RXW A;  4IED A;  1CI8 A;  3VSL A;  4WZ4 A;  1ZG4 A;  3OPP A;  4IVK A;  4KQR A;  1IKG A;  5CTM A;  3VFF A;  5F1G A;  3ZNY A;  5TFQ A;  2ZC6 B;  3Q07 A;  4PM9 A;  2Y2G A;  3EQV A;  1JWZ A;  2EXB A;  1TVF A;  3VSK A;  3C7V A;  1Q2P A;  1CEF A;  4OPQ A;  1FCO A;  1ES3 A;  4OQH A;  4UA6 A;  1HZO A;  1Z6F A;  1NYY A;  4LEN A;  3LO7 A;  1LLB A;  2FFY A;  5CED A;  1XXM A;  3W8K A;  4JF5 A;  5FAS A;  1W8Y A;  1WYB A;  3PTE A;  5FI2 A;  2H10 A;  4LV1 A;  2XFS A;  2ZM2 A;  3BFC A;  3ZG8 B;  4QHC A;  2Y2N A;  1SKF A;  5FQ9 A;  3V3R A;  1ESI A;  2WAE A;  3IF6 A;  2EX8 A;  3AGD A;  4E3K A;  2V1Z A;  1HTZ A;  3BFE A;  4OVD A;  3OCL A;  3BFG A;  4LV0 A;  3HLD A;  1SDE A;  4OPZ A;  4PMA A;  5DTS A;  4EQI A;  1PYY A;  1W5D A;  2IWC A;  1I2S A;  1YMS A;  2J7V A;  3HLW A;  5DF9 A;  5A91 A;  3IH9 A;  5KZH A;  2BLS A;  5CHU A;  1LHY A;  3Q7V A;  3DWK A;  2XF3 A;  3MBZ A;  3WRZ A;  3D4F A;  3GR2 A;  3OPR A;  4OQI A;  1L0E A;  1WE4 A;  1BZA A;  5GLD A;  4CPK A;  1MWU A;  5AQ7 A;  5GLA A;  3RXX A;  2C5W B;  2P9V A;  3UPN A;  3ZVT A;  2WAF A;  1KGE A;  4H8R A;  3MZF A;  3G4P A;  1ESU A;  1ES4 A;  2XD1 A;  3QNB A;  3WS1 A;  5A92 A;  3ISG A;  4EBN A;  4N9K A;  4OLD A;  2PU2 A;  2WGI A;  3IF6 C;  4Y0U A;  3IHB A;  2PU4 A;  4HBU A;  5KSH A;  1MWR A;  4GOG A;  5E2H A;  5GLB A;  4JKT A;  4CJN A;  2Y2K A;  1L2S A;  4HES A;  4X69 A;  4OON A;  5CGX A;  5EE8 A;  1XKZ A;  4WBG A;  3W4O A;  3SH7 A;  3SH8 A;  4FH2 A;  1MWS A;  2Y2P A;  5CRF A;  1YM1 A;  4E3I A;  1K56 D;  1ERO A;  3M2K A;  1XX2 A;  4RYE A;  5A93 A;  5FQM A;  3GVB A;  4S2L A;  5TR7 A;  3E2L A;  5J8X A;  3UY6 A;  3GV9 A;  4ZBE A;  1TDG A;  3NC8 A;  3N8S A;  1Q2Q A;  3IT9 A;  3LY4 A;  2WZZ A;  4WYY A;  1BT5 A;  1XGJ A;  1JWP A;  4IBR A;  5IHV A;  3WRT A;  5GHY A;  1EI5 A;  1U60 A;  2HP6 A;  4QU3 A;  1MKI A;  1PI5 A;  1BLS A;  4X56 A;  3PBT A;  3N7W A;  3CMZ A;  5E43 A;  4JXW A;  4KZ5 A;  3NIA A;  3VFH A;  4B4X A;  1IKI A;  5D3O A;  3BM6 A;  1IEM A;  4E3N A;  2JCH A;  1ONH A;  1IYQ A;  2JE5 A;  1W7F A;  3BFD A;  5HAI A;  3MFD A;  4M3K A;  4C3Q A;  1K6S A;  3V50 A;  4DE0 A;  4QY6 A;  1S6R A;  4N9L A;  2HPB A;  1W79 A;  3P09 A;  1JTD A;  4GN2 A;  2RCX A;  1BLP A;  3A3F A;  1YLP A;  2H0Y A;  1ZG6 A;  5FDH A;  1K4E A;  3V39 A;  4K0X A;  4QY5 A;  1NJ4 A;  3UO9 A;  4XXR A;  5EVI B;  1YMX A;  4ZTK A;  4WEJ A;  1VQQ A;  3G2Y A;  5CHM A;  3C5A A;  3A3I A;  3JYI A;  3ZG0 A;  3OCN A;  4UA7 A;  5EEC A;  2Y91 A;  5DF8 A;  2UWX A;  3PBQ A;  4DF6 A;  3O88 A;  1KDW A;  3DWZ A;  1FR6 A;  1ONG A;  1XP4 A;  3MXS A;  4FCF A;  4PM8 A;  4E3O A;  1PWC A;  5L2F A;  1N9B A;  1JVJ A;  2Q9N A;  1FR1 A;  4EWF A;  4WMC A;  3UPO A;  1CEG A;  1LI9 A;  4BD1 A;  1ERM A;  1BLC A;  1XA7 A;  4Y0O A;  3IH8 A;  2VGJ A;  4YIN A;  1QME A;  3QHY A;  3V5M A;  3HUM A;  2Y59 A;  4BL3 A;  4QJG A;  4E3J A;  4WM9 A;  1N4O A;  1CK3 A;  4KZA A;  2RL3 A;  3HLC A;  1NRF A;  4OOM A;  3ZCZ A;  5FAQ A;  3ZVW A;  3CG5 A;  4R4S A;  4Y0T A;  3FKW A;  4KZ4 A;  4LV3 A;  3IWI A;  3W4P A;  4KG6 A;  3BLM A;  4KQO A;  5FQI A;  4HEF A;  2EX6 A;  1ES2 A;  5M18 A;  3BEC A;  3HLG A;  3SS3 A;  1JWV A;  5FAP A;  2P74 A;  1YLJ A;  2Y2O A;  3M6B A;  4GZB A;  3NBL A;  4N1H A;  3LY3 A;  3HLF A;  4IVI A;  1O7E A;  2DRW A;  2XDM A;  4FH4 A;  5DTT A;  3V3S A;  1H8Y A;  4JF6 A;  3O86 A;  5EVL A;  5CHJ A;  3UE1 A;  3S1Y A;  2ZC4 B;  4WEL A;  4R1G A;  4S2I A;  2WKH A;  5HAP A;  3B3X A;  3OPH A;  3OZH A;  2J9P A;  3HRE A;  4GD8 A;  1PI4 A;  2Y4A A;  4ZAM A;  2WGW B;  1ERQ A;  4X68 A;  2ZC7 A;  2B5R A;  1NXY A;  4LCM A;  4R0Q A;  3IXD A;  5JYP A;  4HBT A;  3ZG7 B;  1MPL A;  2QPN A;  2ZQ9 A;  3UE0 A;  4RVA A;  4KZB A;  2Z2L B;  3HLB A;  2QMI A;  3NCK A;  4GD6 A;  2XK1 A;  3BLS A;  4OH0 A;  2OV5 A;  1RP5 A;  5KSC A;  2OLV A;  3NI9 A;  3TG9 A;  5DF7 A;  1ZKJ A;  2CC1 A;  1LI0 A;  2JC7 A;  3LEZ A;  4DXB A;  1NZO A;  3S22 A;  5AQ9 A;  4RX2 A;  4KQQ A;  2JBF A;  3G31 A;  2GDN A;  1G6A A;  4JXS A;  4U0X A;  4P85 A;  3HVF A;  5HW3 A;  5F1F A;  4GDB A;  3OPL A;  5F83 A;  1KDS A;  3M6H A;  2DNS A;  2Y2L A;  4LV2 A;  4P6B A;  3G2Z A;  4WEK A;  4OQ0 A;  3IF5 A;  1BUL A;  2R9X A;  4S2K A;  1FQG A;  2WGV A;  2A49 A;  2WZX A;  4F94 A;  1LL9 A;  2A3U A;  1IYS A;  1GHM A;  4KG5 A;  5FAO A;  3IQA A;  2R9W A;  4ZJ1 A;  5CGW A;  1MWT A;  1BSG A;  2H0T A;  2WKI A;  3BFF A;  4IBX A;  5EPH A;  1M6K A;  1MY8 A;  1XGI A;  4R3B A;  5FI6 A;  3BYD A;  1ES5 A;  1NYM A;  1L0G A;  1CI9 A;  3NY4 A;  5BOH A;  2Y2Q A;  3HL9 A;  3GQZ A;  3G32 A;  5FQJ A;  4BD0 A;  4DE3 A;  5KMW A;  4BEN A;  1MXO A;  5GLC A;  4KG2 A;  5GHX A;  4UAA A;  3BRM A;  2OSU A;  4GDN A;  3SS4 A;  3VMA A;  1RGZ A;  1XPB A;  1YLT A;  5EOO A;  1E3U D;  3GRJ A;  4OQG A;  1FCM A;  1FCN A;  1K38 A;  1PWG A;  1E25 A;  4WMC D;  3N4I A;  4E6X A;  3PBR A;  3VP4 A;  1YLY A;  1L0F A;  2V20 A;  2ZQ8 A;  3ZG5 A;  5M19 A;  4MBH A;  3Q1F A;  4JXG A;  1E4D A;  3WWX A;  4B88 A;  1ALQ A;  1RGY A;  3VP2 A;  1K54 A;  1Y54 A;  1KGG A;  5FI7 A;  5E2G A;  4Z9Q A;  4DKI A;  5FQK A;  3VOY A;  4KEN B;  4OLG A;  2J9O A;  1TDL A;  2ZQA A;  1TEM A;  3OC2 A;  3UPP A;  4C75 A;  3UN7 A;  3IWQ A;  4U3T A;  4K91 A;  3Q7Z A;  2ZLY A;  3IWO A;  2PBY A;  1K56 A;  2HDQ A;  3G30 A;  3P98 A;  4X55 A;  4E6W A;  1I2W A;  4X53 A;  2XH9 A;  4R23 A;  5E2E A;  5FSR A;  1O07 A;  4GKU A;  4NK3 A;  1JTG A;  3DTM A;  5DTK A;  3IF6 B;  3QNC A;  3NDE A;  1G68 A;  3HUN A;  4S2N A;  5G18 A;  5HL1 A;  4KZ3 A;  1GHI A;  1KGF A;  1BTL A;  4B4Z A;  4A5R A;  4MNR A;  1KE4 A;  4K0W A;  2HDS A;  1IYP A;  2Y2H A;  2Y2J A;  3GMW A;  1GCE A;  2HDU A;  1AXB A;  3PAG A;  3Q7V B;  4P0M A;  4QD4 A;  3SH9 A;  3VP0 A;  3ITB A;  1I5Q A;  1FSY A;  5CGS A;  5CEC A;  2P9V B;  4BJP A;  3PBO A;  5HFO A;  1K57 A;  1KVM A;  4FD8 A;  3MZD A;  1DY6 A;  4Q8I A;  1DJA A;  2V2F F;  2Y55 A;  1PW1 A;  3NDG A;  3SOI A;  1K4F A;  4KZ6 A;  3PBN A;  2WYX A;  4PM6 A;  1YT4 A;  4ID4 A;  3WS0 A;  4OPY A;  4S2N C;  1M40 A;  2X02 A;  2IWD A;  4DE2 A;  5FQQ A;  1NY0 A;  2Y2I A;  3PBS A;  4RX3 A;  4RA7 A;  4OKP A;  5EVI A;  5TGF A;  4L0L A;  1SHV A;  4MLL A;  4R3J A;  1ZC2 A;  3IXH A;  2XEP A;  1DJB A;  2WUQ A;  4BLM A;  3UDX A;  3ZNT A;  3UE3 A;  4QB8 A;  1KE3 A;  2Z2M B;  3GSG A;  1FSW A;  3IHA A;  3SS5 A;  3ZHH A;  1H8Z A;  3WS5 A;  3M2J A;  4OOY A;  2EFX A;  1H5X A;  1YLW A;  1GA9 A;  4UA9 A;  3VP1 A;  4EV4 A;  1PWD A;  2DCF A;  1K57 C;  3BEB A;  2Y2M A;  1PIO A;  1GHP A;  2X01 A;  1C3B A;  5CER A;  4PM7 A;  1RCJ A;  2XD5 A;  4PPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...