3UB5P

Profilin:actin with a wide open nucleotide cleft
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
139
structure length
139
Chain Sequence
AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVHGGMINKKCYEMASHLRRSQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for profilin-mediated actin nucleotide exchange.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Actin, cytoplasmic 1
total genus 45
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2011-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3ub5P00
2PRFA 3UB5P 3T12B 3CPTB 2ACGA 2B95A 5FEFA 3T1RA 3U4LP 4D60A 1PNEA 1CQAA 1SKOA 1K0KA 1CF0A 1VETB 1Z09A 5FEGA 2PBDP 2V8CA 3NULA 4X1MA 2VK3A 1Y4OA 3D9YA 4QWOA 4X1LA 1G5UA 5EM0A 2JKGA 2ZL1B 3MSHA 5EVEA 1A0KA 2E8JA 2V8FA 1F2KA 2ZL1A 5EV0A 2BTFP 3T1XA 3CHWP 3KYEA 3DAVA 2HZ5A 1SKOB 3T1SA 1VETA 3CPTA 4FTXA 1SZVA 2PAVP 3LGOA 4FUWA 1ACFA 1AWIA 1D1JA 1VEUA 1PRQA 2JKFA 3L9KA 1YPRA 1J3WA 3MS6A 4X25A 5FDSA 3L7HA 3LEQA 3NECA 1HLUP 1FIKA 1PFLA 4ESPA 3T1QB 1VEUB 1FILA 5EM1A 1CJFA
chains in the Genus database with same CATH superfamily
4N92A 5HPIA 2WUQA 5FI6A 1F2KA 4OP5A 3N8LA 1OTDA 3ITAA 3CG5A 3KSHA 3LIBA 5TR7A 3DTMA 5HZHA 1D1JA 3MS6A 5TBMA 3FKVA 4DE2A 1K55A 2ZD8A 4JGPA 2XRNA 4Y0UA 1CF0A 3F1NA 2Y55A 3D72A 3MMHA 2INWA 2VEAA 2ZMAA 1YLTA 4BQMA 4HQAA 4M4XA 3DTIA 3F1NB 1IEMA 5HD3A 5F69A 4IUKA 2Y2GA 2WKIA 1FCOA 4JXSA 2QHKA 4CJNA 3HLEA 4CLCE 1JTGA 1GHMA 4D60A 3JVUA 5IU1A 1XP4A 2I72A 2PD8A 1KOUA 4KZBA 5HWVA 4NG2A 5GLCA 2K31A 1XXMA 5DVAA 5G4ZA 1T1AA 5EVLA 1H8MA 3WRTA 5AQ9A 2PU2A 2CMNA 4OP8A 1BSGA 4FD8A 1NZUA 2HDRA 3AGEA 5A90A 3T4QA 4S2IA 1PW8A 5HPFA 3MZDA 4OLDA 3BEBA 5FQJA 2IWBA 1W5DA 1N9OA 3E2KA 4MDZA 5HD5A 3NOTC 2VV6A 3KSFA 4GCZA 4R0QA 2XDMA 1KE3A 4H6JB 1GA9A 3NULA 3R7WB 3BQAA 3DAVA 1KGFA 3BJNA 4DXBA 2KX6A 2A3UA 4HH3A 1T18A 2YKFA 2Z2LB 2QJ5A 3OBFA 3IWIA 3VOLA 5KSHA 3TE8A 1M6KA 2R9XA 1S66L 5AVEA 4KQOA 2Y2JA 1V9YA 4HJ3A 3SS3A 4B4XA 3G6OA 1OT6A 1XGJA 2NUTC 4B88A 2OWJA 3QNBA 4GW9A 3U2AA 3R7WA 4L9FA 5TGFA 2GNXA 4GHIB 4OPQA 4RYEA 3PBOA 3ZGAB 4BBVA 3BFGA 3LIDA 5M18A 5MC7A 3B47A 4I38A 2J8YA 3S7OA 2A2LA 4MNRA 4E3JA 5KIZA 4P6ZM 2Y2PA 3WS2A 1K57C 4EWFA 3G2YA 1NLZA 3ZNTA 3RJUA 3IXHA 2BTFP 1IFQA 2Y2HA 4O01A 3DTKA 1UGUA 2PR5A 1SKOB 1I2WA 3NBLA 1SZVA 5FAPA 4LV1A 3DWKA 4X6TA 2DNSA 2WKHA 3D3OA 1PWCA 3ZQ5A 5JYOA 3KYZA 1FSYA 1K4FA 1KDWA 3CITA 2WK0A 4Y17A 3UPPA 4ZRRA 2IA2A 3ZVTA 4LV3A 4QY5A 2EA9A 2PR6A 1VEUA 4KZ7A 2W1TA 2L0WA 3QP2A 4ESPA 2HJEA 2JKTI 2V1AA 3IF6C 2H5SA 4FSFA 3ZG9B 2XF3A 2HPBA 4KG2A 4ETXA 4KZ3A 1FR6A 2JN7A 2BLSA 5DJUA 4ZDXA 1PZOA 3NIAA 3W4OA 1ERQA 3SH7A 3V67A 1VHMA 4WZ5A 1FILA 1GSXA 1EI5A 1W63M 1S67L 2V20A 2W0NA 3UB7A 1MXOA 1PI5A 4EUZA 4HP9A 1S0WA 3UB9A 1PWGA 3UMEA 2C6WB 4I3AA 1S6RA 3OLOA 3IXGA 2ZQ7A 2OWHA 1PW1A 4OLGA 4GOGA 4DKIA 4GJ4A 3SS5A 1P97A 3Q82A 2JCHA 4K91A 3WS1A 2XEPA 4EBNA 4HIAA 1GSVA 5HW3A 3BFFA 5EUAA 3VE4A 1ZKJA 3LEQA 2H0TA 2Q9NA 1CJFA 2J7VA 5AQBA 4WL9A 2VJWA 4BMWA 2ZL1B 5M19A 1P0ZA 4B93A 3V3SA 2PAVP 4X56A 2O9CA 3M2JA 1PRQA 3SZTA 1T1CA 1TS6A 1O7EA 3IF6B 5BOHA 1IYQA 1KE4A 4EETB 1K0KA 2XROA 1G6AA 2EX2A 2HF6A 1GSWA 3VSKA 4LRXC 3A0VA 3LIAA 4L9GA 2LB9A 4DXCA 4ZJ2A 4KUKA 1HLUP 2QZ6A 3S22A 2ZQ8A 5J7EA 4PAUA 5FQQA 1K56A 3MSHA 5CHJA 5I94A 4LLOB 3Q7VA 4MCWA 2EXBA 1IYOA 4QD4A 3A3JA 4WMCD 5EVIA 2PU4A 5L8MA 1ZTUA 3UDFA 3G4PA 3ZHHA 2JKTM 2ACGA 3EGDC 3BM6A 1OTIA 3T4TA 1TEMA 3MQOA 4IJGA 1Y28A 1XJ3A 5CGWA 4Y0OA 5FQ9A 2XFTA 5E2FA 3CPTA 3C5AA 3M2KA 3WWXA 2HDSA 4P85A 1DP6A 3LY4A 2R78A 1YLJA 1YLPA 1L0FA 5EOOA 2BG1A 2WZZA 1F9IA 1E3UD 1FOFA 3HUNA 4HHDA 1PYYA 2WAEA 3M6BA 4PMAA 3T4JA 1FSWA 3WRZA 1G6OA 3T1RA 3UE3A 1NJ4A 1Z09A 2Y2MA 5FAQA 4R70A 3G32A 1TS8A 2K7SA 4RQ9A 4XXRA 1YLWA 4E6WA 3VP2A 5EE8A 2VGLS 5U47A 3E4OA 2HV1A 4B4ZA 3FC7A 3A3DA 1H5XA 2IWDA 3CWFA 3FG8A 2XA7S 1K4EA 5HSQA 2O0YA 1OJGA 3G34A 3B42A 3MFXA 3LY3A 4U3TA 3UE6A 2E8IA 3MBZA 4YOFA 4OPZA 1EWZA 4MBKA 1OTAA 1BUEA 1FR1A 1K54C 5A91A 2WKPA 3OPRA 2G2WA 3GQZA 3A0RA 1CI9A 1W8QA 2Y8HA 5FI7A 4GNUA 3T4KA 4LV0A 1YMSA 5KZHA 4NXGA 2V1BA 1BYWA 3SW1A 1S1ZA 2WZXA 3MKFA 1CEFA 3S7NA 3KSGA 4O7DA 4YNRA 5L09A 4XUZA 3E0YA 3KSIA 5KSCA 3FV7A 3UDIA 3S1YA 2WADA 4ME4A 3EGXC 5CTNA 1XJ2A 5DF7A 1BULA 3UB6A 5F1GA 2A24A 3MXSA 3F1PB 1IYPA 3E4PA 4GDNA 5FAOA 4S2JA 5GL9A 4DJ3A 1N9NA 4NK3A 2ZBBA 3ICYA 4GB7A 3FPVA 3PTEA 2UV0E 3PBNA 3CMZA 3ZG8B 4FCFA 1OMEA 3V5MA 5HARA 3LIFA 4CQHA 1ZG6A 1C3BA 2WGVA 4WZ4A 1ONHA 2J3TD 3VSLA 3MZFA 2HP6A 1LI9A 1OTEA 4X25A 1SDNA 3NOUC 3W4QA 2ZQCA 2WKEA 3PBTA 2J9PA 3MF0A 2V1ZA 5HDSA 4BENA 4WF0A 2H28A 2OSUA 4JXVA 4E3NA 3S7QA 2L4RA 1TDGA 3T4OA 2EFUA 3MFDA 2H0YA 3BECA 4I3IA 1MWRA 3W2ZA 2PYPA 3BFEA 5HWTA 4Z9QA 2QMIA 3C2WA 4OPRA 3GV9A 1RGZA 2ZM0A 4JLFA 4EESA 4S2NA 1DJCA 4YWZA 3HLFA 5CGSA 5CRFA 4IEDA 4X55A 4E3KA 4KG5A 1XFQA 1RCJA 5CEDA 2W3HA 1BTLA 3Q1FA 3A3EA 1IOUA 3RFBA 2AVXA 4II7A 3LIEA 4BD0A 1LSXA 3RH8B 2ZC7A 5IS1A 4XUXA 5L07A 3MXRA 4DRTA 4UEYA 3B33A 5I5LA 1OT9A 2P74A 2O9BA 4HEFA 4HESA 5F1FA 1ZG4A 1UWNX 3BRMA 1OPXA 1AXBA 4R3JA 3WS5A 4U0TA 3ULFA 5LBRA 5FEFA 2Y59A 4KZ6A 3HLWA 3KYEA 1H0MA 5TFQA 2X71A 4FUWA 4WEKA 3QP1A 1TS7A 4DDYA 3V39A 3UB5P 3P98A 3IWOA 1LL5A 3QP4A 2GJ3A 1N9LA 1DJAA 2W3DA 3BY9A 4I39A 1VB6A 3UPOA 2WGWA 5DFXA 1MWUA 3C4OA 1GHPA 1YSPA 2W1RA 3UO9A 3A3IA 1K55C 1JWZA 4JF4A 4CPKA 5EM1A 3VP3A 4BL2A 5DF9A 1NYMA 2W3GA 4R23A 2HDUA 3NHQA 3C7VA 1XFNA 5EVEA 3FYZA 2EX9A 4EW7A 1GA0A 3OPLA 1IKIA 4IBXA 2J9OA 4DDSA 2Y2IA 5J4EA 3PR6A 1E25A 1MKIA 1OJ5A 2HJ9C 2E8JA 3F1PA 1WYBA 3FKWA 3IH9A 3SS4A 5GHYA 4ARZA 4C75A 1LL9A 1AWIA 4ZTKA 5FA7A 1ZHHB 4PHTA 3TW8A 1FIKA 4Q0JA 4K0XA 1MY8A 2VGJA 3HUOA 1LSVA 3GTCA 1I2SA 1HZOA 2W27A 3BQ8A 1W7FA 3NY4A 1HTZA 2ZL1A 3UN7A 3Q81A 3T1SA 3MXQA 4H6JA 2WKRA 1O07A 3BWLA 2P7JA 5EVIB 4EBLA 1YT4A 3RXXA 3PHYA 5AQAA 5G4YA 1G28A 1ES3A 4RVAA 3E2LA 4HY8A 5FI2A 1XA7A 4PM6A 4LRYC 3FPWA 2ZC3B 1GCEA 3LR5A 3HREA 3H82A 4C3QA 5FDSA 3TRCA 5F6AA 4RX3A 4Q0IA 4S2KA 4CLCA 2Y2KA 4Y13A 4O8GA 1L0GA 1WYCA 4P6BA 1K25A 4N9KA 2I9VA 5C5KA 3CLOA 1DP9A 4EEUA 2XA7M 3IX8A 3JPUA 5F68A 1FQGA 3O3VA 5KMWA 2XK1A 3HJIA 2ZOHA 4ZJ3A 1OTBA 2QYBA 1ONGA 4DE3A 3OC2A 5EPHA 3IXDA 1K6SA 2VV7A 3JVVA 4X53A 4I5SA 5EM0A 3PBSA 1JTDA 3R4KA 4DN0A 5HAPA 1F98A 3NJAA 2UWXA 3O5YA 3P09A 4ID4A 4OQIA 2W1TB 1VEUB 4E3MA 2EFXA 1TVFA 3OZHA 1X0OA 3LUQA 2XD5A 4MLLA 3LO7A 4BWIA 2Y91A 3PXPA 4BBTA 1T19A 5CGXA 3P01A 1JWVA 2HP9A 4KZ9A 4OONA 4WBGA 5CHUA 1SKFA 1SHVA 3ISGA 3CPTB 1D7EA 4GN2A 2OAP1 1CQAA 1SKOA 3A0SA 2V8CA 4EBPA 2LB5A 3D9YA 4N1HA 2VZWA 4PM5A 3GECA 2Y2NA 4EERA 4OQHA 2VA0A 4Q8IA 4QJGA 2D01A 2OAQ1 3EQVA 4E6XA 3LGOA 4K08A 3ZVWA 4UQIS 4OH0A 4KZ5A 3NECA 2ZC4B 2QPNA 1RGYA 2B5RA 5FATA 1DJBA 3Q7VB 5F82A 1QMEA 2C5WB 4LENA 3CI6A 4JKTA 4QWOA 3RTYA 2PHYA 4LCMA 4NXFA 1XPBA 3V3RA 2FH5A 4Y0TA 1K6RA 2VX8A 2VLGA 4OQGA 3IX3A 4JXWA 3H7WB 1XJ4A 1TF1A 4ARZB 4NEED 1VETB 4S2OA 4ZAMA 4EU0A 4EXOA 4OOMA 5TJJA 2G2UA 2JBFA 3IHBA 4MBFA 4HOIA 3TJZC 3S4XA 1ESIA 1MWSA 5HWWA 1VETA 2P08A 3H7WA 4R38A 3M6HA 4JGRA 4Y5FA 1LHYA 5FQIA 3P7NA 4D2OA 2PBYA 3F1OA 3ZG7B 2HP5A 2K2NA 4X1MA 1YAXA 4MMNA 1VQQA 4OOYA 4E3LA 2VV8A 3BFDA 3UY6A 4CLCD 4DJ2A 4GZBA 1CEGA 4KZ8A 5L10A 1WA9A 4MN5A 3VP1A 3AGDA 1XX2A 1LL8A 3VOZA 2PT7A 5DJTA 3K3DA 1ES4A 3G30A 2J3WA 2A49A 1KGGA 3ZG5A 5DKLA 2WGWB 1Y54A 2OV5A 2L1MA 4MN6A 2XGNA 4Y7PA 2B18A 4LCLA 1K54A 4CLCB 3BY8A 1TDLA 3F1OB 1RP5A 3NCKA 3NI9A 4H8RA 2EXAA 4G3WA 4P87A 3AGFA 2O9AA 3N7WA 5GLAA 2G7UA 2EWWA 2MJ6A 3LI9A 3S7PA 4LFUA 1SDEA 3C8CA 5GLBA 1KGEA 2JKRI 4KZAA 1SCWA 2XSSA 2Y79A 5IHVA 4WYYA 3IXBA 1BLPA 2DRWA 3N8SA 1DP8A 1G5UA 1JNUA 3CHWP 4S2NC 1LSWA 4WUJA 5DTSA 5F5YA 4DE1A 4GDBA 1Z6FA 3IQAA 2Z2MB 4HP4A 1BT5A 1PNEA 3UB8A 1E3UA 1W8YA 4IBRA 2ZQDA 2XR0A 3G2ZA 4JPMA 1KVLA 3C4PA 3HUMA 1NRJA 2D02A 2YKHA 1N9BA 4P0MA 4X68A 5AVFA 1DY6A 3LYXA 5E2GA 2QWSA 4PM7A 4A5RA 4YFMA 4PM9A 3MJQA 2XQZA 3BLSA 3U4LP 3C7UA 3QP5A 3FWLA 4HBUA 4LGWA 4EV4A 2H10A 5CHMA 3B3XA 1ERMA 4K0WA 4WMCA 5EVID 3L7HA 2V0UA 4LRZE 1Q2QA 3GVBA 5FDHA 5CX7A 4RX2A 4KZ4A 4X69A 1LT0A 3IF5A 2FZ0A 2PBDP 2M7UA 2O99A 4QPRA 1QMFA 1U60A 1L2SA 2J80A 5GHXA 1NLYA 2ZQAA 4PKYG 3L9KA 3NOPC 1PZPA 4Y15A 4PPRA 5HDDA 3MQQA 3BW6A 1YKDA 3W8KA 4C6YA 2VKSA 1TD5A 2JC7A 1EW0A 1BLCA 4GD8A 4AFIA 2A24B 2OLVA 3E4QA 2ZC5B 1NRFA 2JE5A 3A3FA 4Q0HA 3QHYA 3W4PA 1MKMA 1YPRA 1P9WA 2J3TC 4KQDA 1CI8A 2WAFA 5A93A 3QP6A 2Q0OA 4EQ1A 5J8XA 2DCFA 1YQSA 5EOEA 2VK3A 1Y4OA 1FCMA 1T1BA 2Q9MA 4CLCC 1HD8A 3GR2A 4EQIA 3VE3A 3IWQA 4ETZA 4FTXA 1HVBA 3N8RA 3G31A 1ACFA 1YLZA 1WE4A 1NY0A 4F3LB 2HDQA 5JYPA 1V9ZA 4HJ6A 5TBMB 3TG9A 4QB8A 4QY6A 4S2LA 4F94A 3HLDA 3NDGA 1K57A 1XGIA 5D3OA 1L3LA 3C38A 4S2PA 4OKPA 3ZFZA 3IT9A 5AQ7A 1M40A 2X02A 3OCLA 3UE1A 1DRMA 3VMAA 2EWVA 5HL1A 3LR3A 2PD7A 5HX9A 3QP8A 2FFFB 1L0EA 1GHIA 1NXYA 2ZMFA 3PBRA 3H82B 3QNCA 3SH9A 4BLMA 4G3KA 4L9EA 1N4OA 2M1CA 4EUVA 4DE0A 4LV2A 5J3WA 2ZM8A 1ZC2A 5EECA 5FASA 2VGLM 5E2HA 4HBTA 4JXGA 4WEJA 2ZLYA 4HJ4A 5M1AA 1MPLA 2ZC6B 3MR0A 3EOIA 1STZA 3ZDJA 2OOLA 2Y2OA 1KE0A 3IX4A 4OPYA 1BLHA 4I3JA 3WS0A 2RCXA 4FH4A 3HJKA 4BBUA 3VV4A 3HL9A 4GLQA 3WS4A 2B95A 1XJ6A 5HL6A 1NWZA 4FH2A 1IELA 1YLYA 1A0KA 4BJPA 4UAAA 3T1XA 4HNBA 1UWPX 1YM1A 5EVIC 1W79A 3I7JA 3IS2B 2P04A 2Y2LA 3HLBA 4EEPA 4O0PA 3IS2A 1PWDA 1IKGA 3EQUA 3EEHA 1JWPA 1G68A 5CECA 3CUEC 1NZOA 1MC0A 1LI0A 5HAIA 2JKFA 4WM9A 4E3OA 3K2NA 3T4SA 5A92A 1S4RA 3KYQA 5CXWA 3LR4A 3MKEA 3O88A 2QKPA 1MWTA 1H3QA 1VM1A 1MBLA 4GKUA 5FL3A 2ZQ9A 2BASA 3HLCA 5FQMA 5GLDA 3LR0A 2R9WA 2JKRM 4JF5A 4B9OA 3V50A 3K3CA 5DTKA 3CAXA 3HCYA 1W63Q 5E43A 4KQRA 3MQ0A 4MEZA 4NKPA 1CK3A 1PI4A 3T12B 5DKKA 3DW0A 3SH8A 2KDKA 2P9VB 2Z6DA 4WN5A 1MZUA 2EX8A 3VP0A 5F83A 2EX6A 4WZ5C 4NXEA 4ZJ1A 1TS0A 2OLUA 3TOIA 3VOYA 3LEZA 5DFYA 4U0XA 4GS9B 4PKYA 4IHQA 4PM8A 2B02A 3G35A 2ZOIA 5DF8A 1L0DA 3CJMA 4FOFA 4YINA 3OPHA 3NDEA 3KX0X 2V0WA 4OVDA 4F3LA 4KQQA 3IHAA 1JVJA 4Y3IA 3DWZA 4KG6A 4DF6A 3HLGA 4IUHA 2QJ7A 1XKZA 2KOIA 2VGKA 3ITBA 3N6IA 2IWCA 3IBRA 3VP4A 4M3KA 2HGVA 3VFHA 1IYSA 2RL3A 1J3WA 2KLIA 3SOIA 4DMZA 3D4FA 4OQ0A 4NETA 1E4DA 5DTTA 4QHCA 4E3IA 4JBFA 1K38A 1K56D 4BD1A 4X1LA 3BLMA 5EV0A 2W3EA 2P9VA 4IVIA 1XA1A 3GDIA 1BLSA 3GRJA 1H8ZA 3CUEA 2GZAA 3HVFA 2ZM2A 3EWKA 3OCNA 4KENB 3TSGA 4XT2B 3LICA 3C30A 5FQKA 2W3FA 1PIOA 2XFSA 2M7VA 3LCEA 3LFVA 3Q07A 4XT2A 1D06A 3T4LA 4JGQA 1PFLA 4JF6A 4HI4A 3NC8A 4R3AA 5K5BA 2Y4AA 4ZBEA 3JYIA 3VFFA 3ZYTA 1H8YA 2XD1A 5CERA 5E2EA 4WLAA 3UNWA 3FZCA 2XH9A 3IF6A 4G3VA 3UPNA 2PDRA 2WKQA 4LPZA 2Y2QA 3CZDA 4N9LA 3UMDA 1KDSA 2PRFA 3GMWA 4E04A 3N4IA 1P9RA 3RXWA 3T50A 3EEAA 4OOLA 4UHUA 4JGOA 3UDXA 3IH8A 4R4SA 1BZAA 3O87A 3MZEA 3E98A 3PAGA 4RA7A 4UA6A 5A8BA 5HAQA 4P6ZS 4R4RA 4BL3A 3DBAA 1ESUA 5GHZA 4R6LA 1FCNA 4R3BA 3UE0A 5HDCA 1LLBA 2Z6CA 1S1YA 5IT5A 4Z1WA 4GHIA 1J9MA 4UA7A 2WGIA 2V2FF 2V9AA 1ES2A 4IVKA 5FSRA 4GS9A 5HFOA 4MBHA 4N1XA 3IBJA 5FEGA 5G18A 3OPPA 2JKGA 1ALQA 2V8FA 2CC1A 2FFYA 3KO6A 2JHEA 1S4SA 4S2MA 1F5MA 3H9WA 1Q2PA 3BYDA 4R1GA 4UA9A 5EFWA 3ZG0A 3PAEA 1YMXA 2WYXA 4MN7A 1ODVA 2GDNA 5L2FA 3Q7ZA 4WELA 3ZCZA 3OOVA 4GD6A 2XLNA 2PYRA 3LI8A 3DTEA 5CEBA 4L0LA 5CTMA 4HH2A 3PBQA 2DMWA 2GX5A 3GSGA 3T1QB 1YSQA 4UQIM 5AJGA 4Y2FA 3ZNYA 1KVMA 1I5QA 3BFCA 4KUOA 4NXBA 4QU3A 2ZMVA 1NYYA 2HZ5A 2X01A 1ES5A 3HBRA 2NUPC 3O86A 3PYPA 1EROA 2ZJ9A
chains in the Genus database with same CATH topology
2PRFA 3UB5P 3T12B 3CPTB 2ACGA 2B95A 5FEFA 3T1RA 3U4LP 4D60A 1PNEA 1CQAA 1SKOA 1K0KA 1CF0A 1VETB 1Z09A 5FEGA 2PBDP 2V8CA 3NULA 4X1MA 2VK3A 1Y4OA 3D9YA 4QWOA 4X1LA 1G5UA 5EM0A 2JKGA 2ZL1B 3MSHA 5EVEA 1A0KA 2E8JA 2V8FA 1F2KA 2ZL1A 5EV0A 2BTFP 3T1XA 3CHWP 3KYEA 3DAVA 2HZ5A 1SKOB 3T1SA 1VETA 3CPTA 4FTXA 1SZVA 2PAVP 3LGOA 4FUWA 1ACFA 1AWIA 1D1JA 1VEUA 1PRQA 2JKFA 3L9KA 1YPRA 1J3WA 3MS6A 4X25A 5FDSA 3L7HA 3LEQA 3NECA 1HLUP 1FIKA 1PFLA 4ESPA 3T1QB 1VEUB 1FILA 5EM1A 1CJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PRF A;  3UB5 P;  3T12 B;  3CPT B;  2ACG A;  2B95 A;  5FEF A;  3T1R A;  3U4L P;  4D60 A;  1PNE A;  1CQA A;  1SKO A;  1K0K A;  1CF0 A;  1VET B;  1Z09 A;  5FEG A;  2PBD P;  2V8C A;  3NUL A;  4X1M A;  2VK3 A;  1Y4O A;  3D9Y A;  4QWO A;  4X1L A;  1G5U A;  5EM0 A;  2JKG A;  2ZL1 B;  3MSH A;  5EVE A;  1A0K A;  2E8J A;  2V8F A;  1F2K A;  2ZL1 A;  5EV0 A;  2BTF P;  3T1X A;  3CHW P;  3KYE A;  3DAV A;  2HZ5 A;  1SKO B;  3T1S A;  1VET A;  3CPT A;  4FTX A;  1SZV A;  2PAV P;  3LGO A;  4FUW A;  1ACF A;  1AWI A;  1D1J A;  1VEU A;  1PRQ A;  2JKF A;  3L9K A;  1YPR A;  1J3W A;  3MS6 A;  4X25 A;  5FDS A;  3L7H A;  3LEQ A;  3NEC A;  1HLU P;  1FIK A;  1PFL A;  4ESP A;  3T1Q B;  1VEU B;  1FIL A;  5EM1 A;  1CJF A; 
#chains in the Genus database with same CATH topology
 4N92 A;  5HPI A;  2WUQ A;  5FI6 A;  1F2K A;  4OP5 A;  3N8L A;  1OTD A;  3ITA A;  3CG5 A;  3KSH A;  3LIB A;  5TR7 A;  3DTM A;  5HZH A;  1D1J A;  3MS6 A;  5TBM A;  3FKV A;  4DE2 A;  1K55 A;  2ZD8 A;  4JGP A;  2XRN A;  4Y0U A;  1CF0 A;  3F1N A;  2Y55 A;  3D72 A;  3MMH A;  2INW A;  2VEA A;  2ZMA A;  1YLT A;  4BQM A;  4HQA A;  4M4X A;  3DTI A;  3F1N B;  1IEM A;  5HD3 A;  5F69 A;  4IUK A;  2Y2G A;  2WKI A;  1FCO A;  4JXS A;  2QHK A;  4CJN A;  3HLE A;  4CLC E;  1JTG A;  1GHM A;  4D60 A;  3JVU A;  5IU1 A;  1XP4 A;  2I72 A;  2PD8 A;  1KOU A;  4KZB A;  5HWV A;  4NG2 A;  5GLC A;  2K31 A;  1XXM A;  5DVA A;  5G4Z A;  1T1A A;  5EVL A;  1H8M A;  3WRT A;  5AQ9 A;  2PU2 A;  2CMN A;  4OP8 A;  1BSG A;  4FD8 A;  1NZU A;  2HDR A;  3AGE A;  5A90 A;  3T4Q A;  4S2I A;  1PW8 A;  5HPF A;  3MZD A;  4OLD A;  3BEB A;  5FQJ A;  2IWB A;  1W5D A;  1N9O A;  3E2K A;  4MDZ A;  5HD5 A;  3NOT C;  2VV6 A;  3KSF A;  4GCZ A;  4R0Q A;  2XDM A;  1KE3 A;  4H6J B;  1GA9 A;  3NUL A;  3R7W B;  3BQA A;  3DAV A;  1KGF A;  3BJN A;  4DXB A;  2KX6 A;  2A3U A;  4HH3 A;  1T18 A;  2YKF A;  2Z2L B;  2QJ5 A;  3OBF A;  3IWI A;  3VOL A;  5KSH A;  3TE8 A;  1M6K A;  2R9X A;  1S66 L;  5AVE A;  4KQO A;  2Y2J A;  1V9Y A;  4HJ3 A;  3SS3 A;  4B4X A;  3G6O A;  1OT6 A;  1XGJ A;  2NUT C;  4B88 A;  2OWJ A;  3QNB A;  4GW9 A;  3U2A A;  3R7W A;  4L9F A;  5TGF A;  2GNX A;  4GHI B;  4OPQ A;  4RYE A;  3PBO A;  3ZGA B;  4BBV A;  3BFG A;  3LID A;  5M18 A;  5MC7 A;  3B47 A;  4I38 A;  2J8Y A;  3S7O A;  2A2L A;  4MNR A;  4E3J A;  5KIZ A;  4P6Z M;  2Y2P A;  3WS2 A;  1K57 C;  4EWF A;  3G2Y A;  1NLZ A;  3ZNT A;  3RJU A;  3IXH A;  2BTF P;  1IFQ A;  2Y2H A;  4O01 A;  3DTK A;  1UGU A;  2PR5 A;  1SKO B;  1I2W A;  3NBL A;  1SZV A;  5FAP A;  4LV1 A;  3DWK A;  4X6T A;  2DNS A;  2WKH A;  3D3O A;  1PWC A;  3ZQ5 A;  5JYO A;  3KYZ A;  1FSY A;  1K4F A;  1KDW A;  3CIT A;  2WK0 A;  4Y17 A;  3UPP A;  4ZRR A;  2IA2 A;  3ZVT A;  4LV3 A;  4QY5 A;  2EA9 A;  2PR6 A;  1VEU A;  4KZ7 A;  2W1T A;  2L0W A;  3QP2 A;  4ESP A;  2HJE A;  2JKT I;  2V1A A;  3IF6 C;  2H5S A;  4FSF A;  3ZG9 B;  2XF3 A;  2HPB A;  4KG2 A;  4ETX A;  4KZ3 A;  1FR6 A;  2JN7 A;  2BLS A;  5DJU A;  4ZDX A;  1PZO A;  3NIA A;  3W4O A;  1ERQ A;  3SH7 A;  3V67 A;  1VHM A;  4WZ5 A;  1FIL A;  1GSX A;  1EI5 A;  1W63 M;  1S67 L;  2V20 A;  2W0N A;  3UB7 A;  1MXO A;  1PI5 A;  4EUZ A;  4HP9 A;  1S0W A;  3UB9 A;  1PWG A;  3UME A;  2C6W B;  4I3A A;  1S6R A;  3OLO A;  3IXG A;  2ZQ7 A;  2OWH A;  1PW1 A;  4OLG A;  4GOG A;  4DKI A;  4GJ4 A;  3SS5 A;  1P97 A;  3Q82 A;  2JCH A;  4K91 A;  3WS1 A;  2XEP A;  4EBN A;  4HIA A;  1GSV A;  5HW3 A;  3BFF A;  5EUA A;  3VE4 A;  1ZKJ A;  3LEQ A;  2H0T A;  2Q9N A;  1CJF A;  2J7V A;  5AQB A;  4WL9 A;  2VJW A;  4BMW A;  2ZL1 B;  5M19 A;  1P0Z A;  4B93 A;  3V3S A;  2PAV P;  4X56 A;  2O9C A;  3M2J A;  1PRQ A;  3SZT A;  1T1C A;  1TS6 A;  1O7E A;  3IF6 B;  5BOH A;  1IYQ A;  1KE4 A;  4EET B;  1K0K A;  2XRO A;  1G6A A;  2EX2 A;  2HF6 A;  1GSW A;  3VSK A;  4LRX C;  3A0V A;  3LIA A;  4L9G A;  2LB9 A;  4DXC A;  4ZJ2 A;  4KUK A;  1HLU P;  2QZ6 A;  3S22 A;  2ZQ8 A;  5J7E A;  4PAU A;  5FQQ A;  1K56 A;  3MSH A;  5CHJ A;  5I94 A;  4LLO B;  3Q7V A;  4MCW A;  2EXB A;  1IYO A;  4QD4 A;  3A3J A;  4WMC D;  5EVI A;  2PU4 A;  5L8M A;  1ZTU A;  3UDF A;  3G4P A;  3ZHH A;  2JKT M;  2ACG A;  3EGD C;  3BM6 A;  1OTI A;  3T4T A;  1TEM A;  3MQO A;  4IJG A;  1Y28 A;  1XJ3 A;  5CGW A;  4Y0O A;  5FQ9 A;  2XFT A;  5E2F A;  3CPT A;  3C5A A;  3M2K A;  3WWX A;  2HDS A;  4P85 A;  1DP6 A;  3LY4 A;  2R78 A;  1YLJ A;  1YLP A;  1L0F A;  5EOO A;  2BG1 A;  2WZZ A;  1F9I A;  1E3U D;  1FOF A;  3HUN A;  4HHD A;  1PYY A;  2WAE A;  3M6B A;  4PMA A;  3T4J A;  1FSW A;  3WRZ A;  1G6O A;  3T1R A;  3UE3 A;  1NJ4 A;  1Z09 A;  2Y2M A;  5FAQ A;  4R70 A;  3G32 A;  1TS8 A;  2K7S A;  4RQ9 A;  4XXR A;  1YLW A;  4E6W A;  3VP2 A;  5EE8 A;  2VGL S;  5U47 A;  3E4O A;  2HV1 A;  4B4Z A;  3FC7 A;  3A3D A;  1H5X A;  2IWD A;  3CWF A;  3FG8 A;  2XA7 S;  1K4E A;  5HSQ A;  2O0Y A;  1OJG A;  3G34 A;  3B42 A;  3MFX A;  3LY3 A;  4U3T A;  3UE6 A;  2E8I A;  3MBZ A;  4YOF A;  4OPZ A;  1EWZ A;  4MBK A;  1OTA A;  1BUE A;  1FR1 A;  1K54 C;  5A91 A;  2WKP A;  3OPR A;  2G2W A;  3GQZ A;  3A0R A;  1CI9 A;  1W8Q A;  2Y8H A;  5FI7 A;  4GNU A;  3T4K A;  4LV0 A;  1YMS A;  5KZH A;  4NXG A;  2V1B A;  1BYW A;  3SW1 A;  1S1Z A;  2WZX A;  3MKF A;  1CEF A;  3S7N A;  3KSG A;  4O7D A;  4YNR A;  5L09 A;  4XUZ A;  3E0Y A;  3KSI A;  5KSC A;  3FV7 A;  3UDI A;  3S1Y A;  2WAD A;  4ME4 A;  3EGX C;  5CTN A;  1XJ2 A;  5DF7 A;  1BUL A;  3UB6 A;  5F1G A;  2A24 A;  3MXS A;  3F1P B;  1IYP A;  3E4P A;  4GDN A;  5FAO A;  4S2J A;  5GL9 A;  4DJ3 A;  1N9N A;  4NK3 A;  2ZBB A;  3ICY A;  4GB7 A;  3FPV A;  3PTE A;  2UV0 E;  3PBN A;  3CMZ A;  3ZG8 B;  4FCF A;  1OME A;  3V5M A;  5HAR A;  3LIF A;  4CQH A;  1ZG6 A;  1C3B A;  2WGV A;  4WZ4 A;  1ONH A;  2J3T D;  3VSL A;  3MZF A;  2HP6 A;  1LI9 A;  1OTE A;  4X25 A;  1SDN A;  3NOU C;  3W4Q A;  2ZQC A;  2WKE A;  3PBT A;  2J9P A;  3MF0 A;  2V1Z A;  5HDS A;  4BEN A;  4WF0 A;  2H28 A;  2OSU A;  4JXV A;  4E3N A;  3S7Q A;  2L4R A;  1TDG A;  3T4O A;  2EFU A;  3MFD A;  2H0Y A;  3BEC A;  4I3I A;  1MWR A;  3W2Z A;  2PYP A;  3BFE A;  5HWT A;  4Z9Q A;  2QMI A;  3C2W A;  4OPR A;  3GV9 A;  1RGZ A;  2ZM0 A;  4JLF A;  4EES A;  4S2N A;  1DJC A;  4YWZ A;  3HLF A;  5CGS A;  5CRF A;  4IED A;  4X55 A;  4E3K A;  4KG5 A;  1XFQ A;  1RCJ A;  5CED A;  2W3H A;  1BTL A;  3Q1F A;  3A3E A;  1IOU A;  3RFB A;  2AVX A;  4II7 A;  3LIE A;  4BD0 A;  1LSX A;  3RH8 B;  2ZC7 A;  5IS1 A;  4XUX A;  5L07 A;  3MXR A;  4DRT A;  4UEY A;  3B33 A;  5I5L A;  1OT9 A;  2P74 A;  2O9B A;  4HEF A;  4HES A;  5F1F A;  1ZG4 A;  1UWN X;  3BRM A;  1OPX A;  1AXB A;  4R3J A;  3WS5 A;  4U0T A;  3ULF A;  5LBR A;  5FEF A;  2Y59 A;  4KZ6 A;  3HLW A;  3KYE A;  1H0M A;  5TFQ A;  2X71 A;  4FUW A;  4WEK A;  3QP1 A;  1TS7 A;  4DDY A;  3V39 A;  3UB5 P;  3P98 A;  3IWO A;  1LL5 A;  3QP4 A;  2GJ3 A;  1N9L A;  1DJA A;  2W3D A;  3BY9 A;  4I39 A;  1VB6 A;  3UPO A;  2WGW A;  5DFX A;  1MWU A;  3C4O A;  1GHP A;  1YSP A;  2W1R A;  3UO9 A;  3A3I A;  1K55 C;  1JWZ A;  4JF4 A;  4CPK A;  5EM1 A;  3VP3 A;  4BL2 A;  5DF9 A;  1NYM A;  2W3G A;  4R23 A;  2HDU A;  3NHQ A;  3C7V A;  1XFN A;  5EVE A;  3FYZ A;  2EX9 A;  4EW7 A;  1GA0 A;  3OPL A;  1IKI A;  4IBX A;  2J9O A;  4DDS A;  2Y2I A;  5J4E A;  3PR6 A;  1E25 A;  1MKI A;  1OJ5 A;  2HJ9 C;  2E8J A;  3F1P A;  1WYB A;  3FKW A;  3IH9 A;  3SS4 A;  5GHY A;  4ARZ A;  4C75 A;  1LL9 A;  1AWI A;  4ZTK A;  5FA7 A;  1ZHH B;  4PHT A;  3TW8 A;  1FIK A;  4Q0J A;  4K0X A;  1MY8 A;  2VGJ A;  3HUO A;  1LSV A;  3GTC A;  1I2S A;  1HZO A;  2W27 A;  3BQ8 A;  1W7F A;  3NY4 A;  1HTZ A;  2ZL1 A;  3UN7 A;  3Q81 A;  3T1S A;  3MXQ A;  4H6J A;  2WKR A;  1O07 A;  3BWL A;  2P7J A;  5EVI B;  4EBL A;  1YT4 A;  3RXX A;  3PHY A;  5AQA A;  5G4Y A;  1G28 A;  1ES3 A;  4RVA A;  3E2L A;  4HY8 A;  5FI2 A;  1XA7 A;  4PM6 A;  4LRY C;  3FPW A;  2ZC3 B;  1GCE A;  3LR5 A;  3HRE A;  3H82 A;  4C3Q A;  5FDS A;  3TRC A;  5F6A A;  4RX3 A;  4Q0I A;  4S2K A;  4CLC A;  2Y2K A;  4Y13 A;  4O8G A;  1L0G A;  1WYC A;  4P6B A;  1K25 A;  4N9K A;  2I9V A;  5C5K A;  3CLO A;  1DP9 A;  4EEU A;  2XA7 M;  3IX8 A;  3JPU A;  5F68 A;  1FQG A;  3O3V A;  5KMW A;  2XK1 A;  3HJI A;  2ZOH A;  4ZJ3 A;  1OTB A;  2QYB A;  1ONG A;  4DE3 A;  3OC2 A;  5EPH A;  3IXD A;  1K6S A;  2VV7 A;  3JVV A;  4X53 A;  4I5S A;  5EM0 A;  3PBS A;  1JTD A;  3R4K A;  4DN0 A;  5HAP A;  1F98 A;  3NJA A;  2UWX A;  3O5Y A;  3P09 A;  4ID4 A;  4OQI A;  2W1T B;  1VEU B;  4E3M A;  2EFX A;  1TVF A;  3OZH A;  1X0O A;  3LUQ A;  2XD5 A;  4MLL A;  3LO7 A;  4BWI A;  2Y91 A;  3PXP A;  4BBT A;  1T19 A;  5CGX A;  3P01 A;  1JWV A;  2HP9 A;  4KZ9 A;  4OON A;  4WBG A;  5CHU A;  1SKF A;  1SHV A;  3ISG A;  3CPT B;  1D7E A;  4GN2 A;  2OAP 1;  1CQA A;  1SKO A;  3A0S A;  2V8C A;  4EBP A;  2LB5 A;  3D9Y A;  4N1H A;  2VZW A;  4PM5 A;  3GEC A;  2Y2N A;  4EER A;  4OQH A;  2VA0 A;  4Q8I A;  4QJG A;  2D01 A;  2OAQ 1;  3EQV A;  4E6X A;  3LGO A;  4K08 A;  3ZVW A;  4UQI S;  4OH0 A;  4KZ5 A;  3NEC A;  2ZC4 B;  2QPN A;  1RGY A;  2B5R A;  5FAT A;  1DJB A;  3Q7V B;  5F82 A;  1QME A;  2C5W B;  4LEN A;  3CI6 A;  4JKT A;  4QWO A;  3RTY A;  2PHY A;  4LCM A;  4NXF A;  1XPB A;  3V3R A;  2FH5 A;  4Y0T A;  1K6R A;  2VX8 A;  2VLG A;  4OQG A;  3IX3 A;  4JXW A;  3H7W B;  1XJ4 A;  1TF1 A;  4ARZ B;  4NEE D;  1VET B;  4S2O A;  4ZAM A;  4EU0 A;  4EXO A;  4OOM A;  5TJJ A;  2G2U A;  2JBF A;  3IHB A;  4MBF A;  4HOI A;  3TJZ C;  3S4X A;  1ESI A;  1MWS A;  5HWW A;  1VET A;  2P08 A;  3H7W A;  4R38 A;  3M6H A;  4JGR A;  4Y5F A;  1LHY A;  5FQI A;  3P7N A;  4D2O A;  2PBY A;  3F1O A;  3ZG7 B;  2HP5 A;  2K2N A;  4X1M A;  1YAX A;  4MMN A;  1VQQ A;  4OOY A;  4E3L A;  2VV8 A;  3BFD A;  3UY6 A;  4CLC D;  4DJ2 A;  4GZB A;  1CEG A;  4KZ8 A;  5L10 A;  1WA9 A;  4MN5 A;  3VP1 A;  3AGD A;  1XX2 A;  1LL8 A;  3VOZ A;  2PT7 A;  5DJT A;  3K3D A;  1ES4 A;  3G30 A;  2J3W A;  2A49 A;  1KGG A;  3ZG5 A;  5DKL A;  2WGW B;  1Y54 A;  2OV5 A;  2L1M A;  4MN6 A;  2XGN A;  4Y7P A;  2B18 A;  4LCL A;  1K54 A;  4CLC B;  3BY8 A;  1TDL A;  3F1O B;  1RP5 A;  3NCK A;  3NI9 A;  4H8R A;  2EXA A;  4G3W A;  4P87 A;  3AGF A;  2O9A A;  3N7W A;  5GLA A;  2G7U A;  2EWW A;  2MJ6 A;  3LI9 A;  3S7P A;  4LFU A;  1SDE A;  3C8C A;  5GLB A;  1KGE A;  2JKR I;  4KZA A;  1SCW A;  2XSS A;  2Y79 A;  5IHV A;  4WYY A;  3IXB A;  1BLP A;  2DRW A;  3N8S A;  1DP8 A;  1G5U A;  1JNU A;  3CHW P;  4S2N C;  1LSW A;  4WUJ A;  5DTS A;  5F5Y A;  4DE1 A;  4GDB A;  1Z6F A;  3IQA A;  2Z2M B;  4HP4 A;  1BT5 A;  1PNE A;  3UB8 A;  1E3U A;  1W8Y A;  4IBR A;  2ZQD A;  2XR0 A;  3G2Z A;  4JPM A;  1KVL A;  3C4P A;  3HUM A;  1NRJ A;  2D02 A;  2YKH A;  1N9B A;  4P0M A;  4X68 A;  5AVF A;  1DY6 A;  3LYX A;  5E2G A;  2QWS A;  4PM7 A;  4A5R A;  4YFM A;  4PM9 A;  3MJQ A;  2XQZ A;  3BLS A;  3U4L P;  3C7U A;  3QP5 A;  3FWL A;  4HBU A;  4LGW A;  4EV4 A;  2H10 A;  5CHM A;  3B3X A;  1ERM A;  4K0W A;  4WMC A;  5EVI D;  3L7H A;  2V0U A;  4LRZ E;  1Q2Q A;  3GVB A;  5FDH A;  5CX7 A;  4RX2 A;  4KZ4 A;  4X69 A;  1LT0 A;  3IF5 A;  2FZ0 A;  2PBD P;  2M7U A;  2O99 A;  4QPR A;  1QMF A;  1U60 A;  1L2S A;  2J80 A;  5GHX A;  1NLY A;  2ZQA A;  4PKY G;  3L9K A;  3NOP C;  1PZP A;  4Y15 A;  4PPR A;  5HDD A;  3MQQ A;  3BW6 A;  1YKD A;  3W8K A;  4C6Y A;  2VKS A;  1TD5 A;  2JC7 A;  1EW0 A;  1BLC A;  4GD8 A;  4AFI A;  2A24 B;  2OLV A;  3E4Q A;  2ZC5 B;  1NRF A;  2JE5 A;  3A3F A;  4Q0H A;  3QHY A;  3W4P A;  1MKM A;  1YPR A;  1P9W A;  2J3T C;  4KQD A;  1CI8 A;  2WAF A;  5A93 A;  3QP6 A;  2Q0O A;  4EQ1 A;  5J8X A;  2DCF A;  1YQS A;  5EOE A;  2VK3 A;  1Y4O A;  1FCM A;  1T1B A;  2Q9M A;  4CLC C;  1HD8 A;  3GR2 A;  4EQI A;  3VE3 A;  3IWQ A;  4ETZ A;  4FTX A;  1HVB A;  3N8R A;  3G31 A;  1ACF A;  1YLZ A;  1WE4 A;  1NY0 A;  4F3L B;  2HDQ A;  5JYP A;  1V9Z A;  4HJ6 A;  5TBM B;  3TG9 A;  4QB8 A;  4QY6 A;  4S2L A;  4F94 A;  3HLD A;  3NDG A;  1K57 A;  1XGI A;  5D3O A;  1L3L A;  3C38 A;  4S2P A;  4OKP A;  3ZFZ A;  3IT9 A;  5AQ7 A;  1M40 A;  2X02 A;  3OCL A;  3UE1 A;  1DRM A;  3VMA A;  2EWV A;  5HL1 A;  3LR3 A;  2PD7 A;  5HX9 A;  3QP8 A;  2FFF B;  1L0E A;  1GHI A;  1NXY A;  2ZMF A;  3PBR A;  3H82 B;  3QNC A;  3SH9 A;  4BLM A;  4G3K A;  4L9E A;  1N4O A;  2M1C A;  4EUV A;  4DE0 A;  4LV2 A;  5J3W A;  2ZM8 A;  1ZC2 A;  5EEC A;  5FAS A;  2VGL M;  5E2H A;  4HBT A;  4JXG A;  4WEJ A;  2ZLY A;  4HJ4 A;  5M1A A;  1MPL A;  2ZC6 B;  3MR0 A;  3EOI A;  1STZ A;  3ZDJ A;  2OOL A;  2Y2O A;  1KE0 A;  3IX4 A;  4OPY A;  1BLH A;  4I3J A;  3WS0 A;  2RCX A;  4FH4 A;  3HJK A;  4BBU A;  3VV4 A;  3HL9 A;  4GLQ A;  3WS4 A;  2B95 A;  1XJ6 A;  5HL6 A;  1NWZ A;  4FH2 A;  1IEL A;  1YLY A;  1A0K A;  4BJP A;  4UAA A;  3T1X A;  4HNB A;  1UWP X;  1YM1 A;  5EVI C;  1W79 A;  3I7J A;  3IS2 B;  2P04 A;  2Y2L A;  3HLB A;  4EEP A;  4O0P A;  3IS2 A;  1PWD A;  1IKG A;  3EQU A;  3EEH A;  1JWP A;  1G68 A;  5CEC A;  3CUE C;  1NZO A;  1MC0 A;  1LI0 A;  5HAI A;  2JKF A;  4WM9 A;  4E3O A;  3K2N A;  3T4S A;  5A92 A;  1S4R A;  3KYQ A;  5CXW A;  3LR4 A;  3MKE A;  3O88 A;  2QKP A;  1MWT A;  1H3Q A;  1VM1 A;  1MBL A;  4GKU A;  5FL3 A;  2ZQ9 A;  2BAS A;  3HLC A;  5FQM A;  5GLD A;  3LR0 A;  2R9W A;  2JKR M;  4JF5 A;  4B9O A;  3V50 A;  3K3C A;  5DTK A;  3CAX A;  3HCY A;  1W63 Q;  5E43 A;  4KQR A;  3MQ0 A;  4MEZ A;  4NKP A;  1CK3 A;  1PI4 A;  3T12 B;  5DKK A;  3DW0 A;  3SH8 A;  2KDK A;  2P9V B;  2Z6D A;  4WN5 A;  1MZU A;  2EX8 A;  3VP0 A;  5F83 A;  2EX6 A;  4WZ5 C;  4NXE A;  4ZJ1 A;  1TS0 A;  2OLU A;  3TOI A;  3VOY A;  3LEZ A;  5DFY A;  4U0X A;  4GS9 B;  4PKY A;  4IHQ A;  4PM8 A;  2B02 A;  3G35 A;  2ZOI A;  5DF8 A;  1L0D A;  3CJM A;  4FOF A;  4YIN A;  3OPH A;  3NDE A;  3KX0 X;  2V0W A;  4OVD A;  4F3L A;  4KQQ A;  3IHA A;  1JVJ A;  4Y3I A;  3DWZ A;  4KG6 A;  4DF6 A;  3HLG A;  4IUH A;  2QJ7 A;  1XKZ A;  2KOI A;  2VGK A;  3ITB A;  3N6I A;  2IWC A;  3IBR A;  3VP4 A;  4M3K A;  2HGV A;  3VFH A;  1IYS A;  2RL3 A;  1J3W A;  2KLI A;  3SOI A;  4DMZ A;  3D4F A;  4OQ0 A;  4NET A;  1E4D A;  5DTT A;  4QHC A;  4E3I A;  4JBF A;  1K38 A;  1K56 D;  4BD1 A;  4X1L A;  3BLM A;  5EV0 A;  2W3E A;  2P9V A;  4IVI A;  1XA1 A;  3GDI A;  1BLS A;  3GRJ A;  1H8Z A;  3CUE A;  2GZA A;  3HVF A;  2ZM2 A;  3EWK A;  3OCN A;  4KEN B;  3TSG A;  4XT2 B;  3LIC A;  3C30 A;  5FQK A;  2W3F A;  1PIO A;  2XFS A;  2M7V A;  3LCE A;  3LFV A;  3Q07 A;  4XT2 A;  1D06 A;  3T4L A;  4JGQ A;  1PFL A;  4JF6 A;  4HI4 A;  3NC8 A;  4R3A A;  5K5B A;  2Y4A A;  4ZBE A;  3JYI A;  3VFF A;  3ZYT A;  1H8Y A;  2XD1 A;  5CER A;  5E2E A;  4WLA A;  3UNW A;  3FZC A;  2XH9 A;  3IF6 A;  4G3V A;  3UPN A;  2PDR A;  2WKQ A;  4LPZ A;  2Y2Q A;  3CZD A;  4N9L A;  3UMD A;  1KDS A;  2PRF A;  3GMW A;  4E04 A;  3N4I A;  1P9R A;  3RXW A;  3T50 A;  3EEA A;  4OOL A;  4UHU A;  4JGO A;  3UDX A;  3IH8 A;  4R4S A;  1BZA A;  3O87 A;  3MZE A;  3E98 A;  3PAG A;  4RA7 A;  4UA6 A;  5A8B A;  5HAQ A;  4P6Z S;  4R4R A;  4BL3 A;  3DBA A;  1ESU A;  5GHZ A;  4R6L A;  1FCN A;  4R3B A;  3UE0 A;  5HDC A;  1LLB A;  2Z6C A;  1S1Y A;  5IT5 A;  4Z1W A;  4GHI A;  1J9M A;  4UA7 A;  2WGI A;  2V2F F;  2V9A A;  1ES2 A;  4IVK A;  5FSR A;  4GS9 A;  5HFO A;  4MBH A;  4N1X A;  3IBJ A;  5FEG A;  5G18 A;  3OPP A;  2JKG A;  1ALQ A;  2V8F A;  2CC1 A;  2FFY A;  3KO6 A;  2JHE A;  1S4S A;  4S2M A;  1F5M A;  3H9W A;  1Q2P A;  3BYD A;  4R1G A;  4UA9 A;  5EFW A;  3ZG0 A;  3PAE A;  1YMX A;  2WYX A;  4MN7 A;  1ODV A;  2GDN A;  5L2F A;  3Q7Z A;  4WEL A;  3ZCZ A;  3OOV A;  4GD6 A;  2XLN A;  2PYR A;  3LI8 A;  3DTE A;  5CEB A;  4L0L A;  5CTM A;  4HH2 A;  3PBQ A;  2DMW A;  2GX5 A;  3GSG A;  3T1Q B;  1YSQ A;  4UQI M;  5AJG A;  4Y2F A;  3ZNY A;  1KVM A;  1I5Q A;  3BFC A;  4KUO A;  4NXB A;  4QU3 A;  2ZMV A;  1NYY A;  2HZ5 A;  2X01 A;  1ES5 A;  3HBR A;  2NUP C;  3O86 A;  3PYP A;  1ERO A;  2ZJ9 A; 
#chains in the Genus database with same CATH homology
 2PRF A;  3UB5 P;  3T12 B;  3CPT B;  2ACG A;  2B95 A;  5FEF A;  3T1R A;  3U4L P;  4D60 A;  1PNE A;  1CQA A;  1SKO A;  1K0K A;  1CF0 A;  1VET B;  1Z09 A;  5FEG A;  2PBD P;  2V8C A;  3NUL A;  4X1M A;  2VK3 A;  1Y4O A;  3D9Y A;  4QWO A;  4X1L A;  1G5U A;  5EM0 A;  2JKG A;  2ZL1 B;  3MSH A;  5EVE A;  1A0K A;  2E8J A;  2V8F A;  1F2K A;  2ZL1 A;  5EV0 A;  2BTF P;  3T1X A;  3CHW P;  3KYE A;  3DAV A;  2HZ5 A;  1SKO B;  3T1S A;  1VET A;  3CPT A;  4FTX A;  1SZV A;  2PAV P;  3LGO A;  4FUW A;  1ACF A;  1AWI A;  1D1J A;  1VEU A;  1PRQ A;  2JKF A;  3L9K A;  1YPR A;  1J3W A;  3MS6 A;  4X25 A;  5FDS A;  3L7H A;  3LEQ A;  3NEC A;  1HLU P;  1FIK A;  1PFL A;  4ESP A;  3T1Q B;  1VEU B;  1FIL A;  5EM1 A;  1CJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...