3UB5P

Profilin:actin with a wide open nucleotide cleft
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
139
structure length
139
Chain Sequence
b'AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGILVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVHGGMINKKCYEMASHLRRSQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin, cytoplasmic 1
publication title Structural basis for profilin-mediated actin nucleotide exchange.
pubmed doi rcsb
molecule tags Structural protein
total genus 45
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2011-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3ub5P00
1J3WA 3T1XA 1D1JA 1SKOB 1PNEA 4D60A 2ZL1B 2V8FA 4FUWA 3T1QB 1A0KA 3T1SA 1SKOA 1PRQA 2VK3A 3T1RA 4FTXA 2HZ5A 1VETA 2JKGA 4X25A 1FIKA 1HLUP 2JKFA 2ACGA 2B95A 3MSHA 3L7HA 5EM0A 1VETB 3CHWP 3UB5P 2PBDP 3MS6A 1FILA 2PRFA 5EV0A 3KYEA 5FEGA 1Y4OA 1PFLA 3L9KA 1CJFA 2V8CA 3D9YA 3LGOA 1G5UA 5FDSA 2E8JA 1YPRA 1AWIA 2PAVP 4ESPA 3LEQA 3U4LP 5EVEA 1SZVA 1ACFA 3NECA 3T12B 5FEFA 5EM1A 1CQAA 1VEUA 4X1MA 4X1LA 3NULA 2BTFP 3CPTA 1VEUB 1Z09A 1K0KA 3DAVA 1CF0A 3CPTB 2ZL1A 1F2KA 4QWOA
chains in the Genus database with same CATH superfamily
4Y5FA 1PWCA 3HUMA 1GHIA 3FKWA 4QY6A 2Y91A 3E0YA 5M18A 1KE4A 4FD8A 1VM1A 4DF6A 3MXQA 1H8YA 1P97A 1QMEA 1N4OA 2D01A 1LHYA 5HAPA 5DF9A 1PRQA 3ZG9B 4K0WA 1I2WA 4ME4A 4E6XA 3F1NB 1VETA 3O88A 4ZAMA 4R3AA 1KVMA 3GMWA 4KG2A 2XEPA 3C38A 3PBTA 3CHWP 1HD8A 3UB5P 3DBAA 2ZC5B 3BLSA 4DE3A 1T1BA 1FILA 4JXWA 5CHUA 4L9EA 3ZG8B 1GHMA 2K31A 2DNSA 5G4YA 2WKPA 1N9BA 3LR5A 3PBOA 3PTEA 3ZG5A 2HGVA 3SH7A 2OSUA 4HQAA 4CLCC 3S7OA 1MPLA 1H8MA 1K56D 1WYBA 3LIAA 4EWFA 4EESA 3PBNA 3GV9A 2FFYA 4OQ0A 3UE6A 4P0MA 1L0DA 5M19A 2OAQ1 1ZG4A 2XQZA 5E2FA 3MXSA 5CXWA 5DTKA 4EEUA 4OVDA 5EFWA 4R38A 3TW8A 4Q0IA 1G6OA 2L4RA 3IX8A 1ZKJA 1TDLA 1RGZA 3IT9A 4BQMA 2G2WA 2WKEA 3IX4A 3BFDA 1P9RA 2OAP1 3ZNYA 4BBVA 1PI5A 5TFQA 4IJGA 3G31A 1SKOA 5A91A 1IYSA 1EI5A 1XJ6A 1FSWA 3WS0A 4WN5A 3NIAA 2PR5A 4GD6A 3F1PA 1V9ZA 3EQVA 3BQ8A 4U0XA 1OMEA 3E4QA 4F3LB 2WAEA 1KDSA 2XA7S 1Y4OA 3N7WA 1NLYA 4E6WA 3VOZA 1K25A 4JGPA 1K54A 3FWLA 1PI4A 1GA0A 4DDSA 3H82A 1O7EA 4WZ5A 3BW6A 1KGGA 3HJIA 3SH8A 3NC8A 4F94A 5FQJA 1DP9A 3IF6A 4OPZA 3DW0A 4WEJA 4G3VA 1XFNA 2O9AA 1SDEA 2BG1A 3NOTC 1FSYA 3TJZC 4OOMA 4XXRA 2ZQ9A 2JKRI 2ZM8A 4MN6A 5IT5A 3FPWA 3IXDA 3M2KA 4WYYA 2J3TC 1IEMA 5J3WA 5DF8A 3UB8A 3PYPA 4P87A 3M2JA 5HL6A 3UB7A 1CK3A 3FYZA 3BQAA 3N8LA 1LT0A 4LFUA 3MZDA 3BFEA 3NDEA 1DY6A 1E25A 1VQQA 5E2HA 4MEZA 5GL9A 2A2LA 2V1BA 2LB5A 5GHZA 4C3QA 3P7NA 3HLFA 1GHPA 5TBMA 3VE4A 2VK3A 3BLMA 3WWXA 2H0YA 3B47A 4GB7A 4ARZB 2CC1A 1LL8A 4MDZA 2V20A 5MC7A 1OT6A 3CJMA 3T4KA 3UDXA 2P74A 2IA2A 1W79A 2HJEA 4E3LA 2XFTA 3KYQA 1STZA 1MWRA 1PWGA 4JF4A 3QP4A 4NXFA 5FI6A 1FCMA 3C4PA 2A49A 2XGNA 2EFXA 4RX3A 2FFFB 3P98A 4OH0A 4R23A 4NG2A 3B33A 5DTTA 1YPRA 1IFQA 1WA9A 4IHQA 1S67L 4FSFA 1MY8A 2HDQA 1TS6A 5F83A 4PHTA 2X71A 4BMWA 2E8IA 2WGWA 4JBFA 3NCKA 4EUZA 1M6KA 3O86A 3UN7A 5FA7A 1XGJA 3WS2A 4CLCD 4C6YA 2K7SA 3BYDA 4P6ZS 5EOOA 4UEYA 3CPTB 5EOEA 3UB9A 2JBFA 4DRTA 3GTCA 4GDBA 1J3WA 3VMAA 3C30A 2VX8A 2W1TA 3IS2A 4RX2A 3W4QA 3A0RA 1XX2A 3CWFA 1G68A 3NDGA 5CEBA 4E3MA 4GDNA 1J9MA 3PBSA 3A3FA 2B18A 3UE0A 2QMIA 4PM7A 3OPRA 2K2NA 3BFFA 2Z2LB 5FAOA 3IHBA 1IYPA 2VGLS 2EX9A 2ZQAA 1DJBA 4MBFA 4JXVA 1S4RA 1VB6A 4GOGA 3EEAA 4ETZA 3ULFA 4OONA 4BD1A 3S22A 1JWVA 4U0TA 2Y79A 3SS5A 1BULA 5KSHA 4MBHA 1G28A 3HL9A 3LYXA 5C5KA 1GSWA 2HP9A 2OV5A 4II7A 5L2FA 2VGJA 1K55A 2ZC7A 3ZFZA 4R4RA 4WBGA 4XT2B 5DF7A 4JGQA 5HZHA 1BT5A 1NYMA 2E8JA 3F1OB 3OZHA 1YSPA 3CUEC 3O5YA 1FCNA 3LFVA 3WRZA 3KX0X 1ACFA 3VP0A 3IX3A 3LY4A 4C75A 2Y2OA 3D3OA 1UWNX 2XF3A 4PM9A 3ZDJA 5AQAA 1XKZA 2JC7A 3UMEA 4X1LA 3CMZA 3CI6A 3S7PA 1BZAA 3B42A 4B4ZA 4GS9A 1O07A 2OWHA 3OCNA 5G4ZA 4KQDA 2ZL1A 5KIZA 2V9AA 4NK3A 3T4SA 4QWOA 4NXEA 4Q0HA 1K54C 4HJ4A 3A3JA 1PNEA 2Y2GA 2VJWA 5EVIA 2J3TD 4WZ5C 4PMAA 4Y15A 1TS8A 3TE8A 3A0SA 1BLHA 3C2WA 1YLTA 1A0KA 1NRFA 1P9WA 1GSXA 4Y0UA 4WF0A 5F6AA 4I3IA 4MN7A 3H7WB 2NUPC 2PR6A 2RCXA 2ACGA 4PKYA 4Y7PA 5EM0A 1PWDA 1DJCA 2PBDP 1LL9A 2KX6A 4R1GA 4DKIA 2ZD8A 3EWKA 3UDIA 3C8CA 5JYOA 3IWIA 2KLIA 4RYEA 4KZ5A 4WMCD 5F1GA 4N1HA 5EUAA 2M7VA 2Y2JA 3GECA 4UQIS 4LCMA 4Z9QA 2JKTI 3U4LP 2ZC3B 4X69A 3VP2A 5D3OA 2J80A 5FSRA 3DWKA 2Y55A 3EEHA 4OP8A 4HH2A 3HVFA 4NKPA 2BLSA 3N8SA 1XA7A 1K38A 4KZ4A 2M7UA 3MQ0A 4Y0OA 3A3DA 4MCWA 1T1CA 1D7EA 1KOUA 5I94A 4FH2A 4LV0A 4FUWA 1Z6FA 2KDKA 2ZQ7A 4WMCA 3FZCA 3V5MA 2WKRA 1TF1A 4HP9A 1L0EA 4EETB 2QJ7A 1WE4A 1JVJA 2HDSA 5DKLA 3NI9A 1LL5A 1S66L 3MSHA 2ZQCA 4I39A 4EXOA 5EPHA 3NJAA 4A5RA 3GSGA 2O9BA 1W8QA 4DDYA 4E3JA 3KYEA 3ITBA 4O0PA 1H0MA 4DXCA 1MXOA 4HBUA 4JGOA 1NZUA 4GKUA 1Q2QA 2V1AA 4Q0JA 1IOUA 4NXBA 4EEPA 5AVFA 2VA0A 4JGRA 3K3DA 2VV6A 2XFSA 2P9VB 3ISGA 2PYRA 4LLOB 5GLBA 3RH8B 4OLGA 5A93A 1HTZA 4LV1A 1IKGA 1YLYA 3P01A 1ERQA 4O01A 2ZC6B 4K08A 4RQ9A 4EQIA 1Z09A 5FI2A 4R3BA 5DVAA 3LY3A 4GD8A 4I5SA 4WLAA 4O8GA 3WS4A 3TRCA 3PAEA 3MZFA 2DCFA 5M1AA 4OQGA 4OOLA 2PDRA 3IH9A 2ZBBA 1G6AA 1K55C 3ZGAB 5HPIA 1S0WA 3SS3A 1TS7A 1EWZA 2WKHA 3TG9A 3V67A 1YLWA 3V3RA 5AQ7A 2HP5A 2QKPA 4LGWA 4G3WA 4UA6A 3P09A 5TJJA 2W3EA 1TEMA 4X6TA 2W3HA 4EV4A 5DJUA 4F3LA 2V1ZA 3S7NA 3PR6A 2V0UA 1FOFA 4S2PA 1RCJA 1NYYA 1HZOA 3FPVA 4WUJA 3MMHA 1FR6A 3CUEA 3MKFA 3G35A 3RJUA 3R4KA 1P0ZA 1V9YA 3L9KA 4UAAA 5DKKA 5EVIC 2H5SA 5HDSA 1YAXA 1Y28A 4KZBA 3V3SA 1XA1A 5HFOA 2PHYA 1U60A 5TR7A 2XA7M 1KGEA 5L07A 2Y2PA 3N8RA 3AGFA 4R6LA 2GNXA 3EOIA 3SS4A 2XLNA 1L0GA 4KQRA 2P04A 3SW1A 1OTIA 1HVBA 4LV2A 4FOFA 1WYCA 1LI9A 2WUQA 1VEUB 5AJGA 3BY8A 1LSVA 4QD4A 4KQQA 1ODVA 2EX6A 3OPPA 1PZOA 1IKIA 3Q07A 3A3IA 1SKOB 4D60A 4EQ1A 5GHXA 3O87A 4JLFA 3WS5A 3T1QB 3C4OA 2L0WA 3F1PB 3UY6A 3CLOA 3PHYA 2X01A 1NZOA 3VP4A 4GZBA 4GHIA 4X53A 2HDRA 4H8RA 1EROA 2VV8A 2GX5A 3IBJA 3FG8A 5IS1A 2KOIA 4QPRA 3V50A 4YOFA 3W8KA 3L7HA 3BFGA 1PYYA 4QHCA 4JXGA 4HESA 3QHYA 1K4EA 3DTKA 5FQIA 2YKFA 5J4EA 4HHDA 5EV0A 4Y13A 3E4PA 1K4FA 3C7VA 4GLQA 2JN7A 4N9KA 1S1YA 3IF6B 3G30A 4B9OA 5DFXA 3TSGA 1OTBA 1K6RA 4E3NA 1LSXA 2QWSA 4BL2A 4ZBEA 2EFUA 4KZ9A 1W5DA 3PBRA 3HLWA 1T18A 1FQGA 3ZG0A 1MZUA 2H0TA 2QHKA 5HARA 2ZQ8A 3PXPA 3UE3A 2V2FF 4L9FA 2HF6A 4ZRRA 4JF6A 2WGIA 3LI9A 3E4OA 3Q7VA 3CPTA 2J7VA 1JWZA 5CEDA 4EBNA 4QB8A 3HLGA 3ZCZA 3HLBA 1W7FA 1F2KA 5HL1A 2VLGA 1ES3A 4KG5A 1NLZA 3T1XA 3MZEA 4KQOA 5FAQA 4S2MA 2QZ6A 1ONHA 1Y54A 3MJQA 4R0QA 2B5RA 4U3TA 3T4TA 2WZZA 1YM1A 2RL3A 4YINA 5IHVA 2I9VA 4S2OA 2Y2NA 3OC2A 1F5MA 4LV3A 2JCHA 3BY9A 1Q2PA 3HUOA 2Y2KA 4IBRA 4ID4A 3LUQA 2WGVA 3Q1FA 5BOHA 5JYPA 3DTEA 1BYWA 1M40A 2VGLM 4UA7A 4XT2A 3H9WA 5F82A 2EX2A 2UWXA 2W27A 5F5YA 2I72A 4LCLA 3E2LA 1CI9A 2PYPA 1S1ZA 3IF5A 5U47A 2PAVP 4RVAA 2W0NA 1I2SA 4GJ4A 5EM1A 5FEFA 1RP5A 1XFQA 5EVID 1LLBA 5GHYA 2Q9MA 5FATA 2ZQDA 4O7DA 2INWA 3CAXA 1UGUA 1JTDA 2Z6CA 3KSHA 1LSWA 3BWLA 1FR1A 3DAVA 3IWQA 3VOLA 4Q8IA 4X55A 3SH9A 4BL3A 4E3KA 1NXYA 3QP1A 1D1JA 5A90A 2EX8A 2FH5A 5F68A 5HD5A 3IXBA 5L8MA 4LRXC 3H7WA 3OBFA 3BFCA 2A24A 1L2SA 4K91A 3KYZA 4ZJ1A 1ERMA 2O99A 2R9XA 4Y17A 2BASA 5LBRA 1BSGA 5GLAA 4CLCB 3G32A 2HP6A 3BM6A 3MS6A 3E98A 3RFBA 1BLPA 5KSCA 2PRFA 1F98A 1ZG6A 3W4OA 3A3EA 4PKYG 3KSIA 4E3IA 1W8YA 1H8ZA 1OT9A 2XD5A 5GLDA 1ONGA 3BJNA 2ZMAA 4WELA 4M3KA 3D9YA 3WRTA 5FDSA 1ALQA 3CZDA 5DFYA 4DE2A 3Q7ZA 4OQIA 2JE5A 4S2LA 1L0FA 1EW0A 4DXBA 2HJ9C 3MXRA 4JF5A 4NXGA 2O0YA 1PW1A 4GS9B 5F69A 4IVKA 3GDIA 4HEFA 5KZHA 3HREA 4KZ7A 3OPLA 2OWJA 1W63Q 2OLVA 2ZJ9A 3UPOA 3K3CA 4UQIM 3CG5A 1VHMA 2H10A 4XUZA 3IH8A 4OP5A 5E2GA 3LI8A 2MJ6A 3C5AA 5A92A 4HOIA 5J8XA 5HAIA 1BTLA 3VFHA 2G2UA 5FI7A 4KUKA 2XROA 2XH9A 1IELA 3QP6A 4GW9A 2VZWA 3PBQA 1OPXA 3G6OA 1OTEA 1ZTUA 4N92A 4QY5A 1IYQA 5CHMA 2XRNA 2HZ5A 4HBTA 4HP4A 4FH4A 4CJNA 2GJ3A 2JKRM 4X25A 1TDGA 3LO7A 3VE3A 3NOUC 5HSQA 3ICYA 4IEDA 5FQ9A 4LRZE 1NRJA 4DJ2A 1E3UA 1OJGA 3U2AA 3DTIA 5KMWA 2J9PA 2ZC4B 3F1NA 5CGSA 5HWWA 3T50A 2HV1A 3HUNA 1ES2A 5CGXA 2WADA 2XD1A 3D72A 4JXSA 5GLCA 2VEAA 1IYOA 4HH3A 1BLCA 3R7WB 3JVUA 3JVVA 3UDFA 5AVEA 2A3UA 2Z6DA 4CLCE 3LGOA 1G5UA 3ZVTA 3VSLA 4MN5A 3LEQA 2PU4A 1XJ4A 2IWDA 2UV0E 2G7UA 4H6JB 3LCEA 3NBLA 3T4LA 1KDWA 2ZM2A 3VOYA 3OCLA 1K57A 2GZAA 1LI0A 4KZAA 3V39A 4WM9A 5E2EA 1XXMA 2EWVA 2IWCA 4HIAA 1XJ3A 1K0KA 3LR3A 1OTDA 4EBPA 5CERA 3HCYA 1OJ5A 3OPHA 1TD5A 1YSQA 2Y4AA 4IVIA 3IXGA 3I7JA 3LR4A 4N1XA 5A8BA 2ZMVA 4HI4A 3D4FA 4EU0A 4Y2FA 1XPBA 1MBLA 1ES4A 1JTGA 3Q82A 4PM8A 3T1SA 3HLCA 3FC7A 4ZTKA 2PBYA 4OLDA 4OQHA 2O9CA 4R3JA 1L3LA 4ZJ3A 1DJAA 4Y3IA 2EA9A 1HLUP 2WKQA 1VETB 4MBKA 3MQQA 2AVXA 2PD7A 2Y2LA 2L1MA 3MR0A 3ITAA 2D02A 1TVFA 3PAGA 4JPMA 4OPQA 3DWZA 4BLMA 3G4PA 1S6RA 5CTNA 1PIOA 1N9NA 2W1RA 1C3BA 2ZMFA 1S4SA 5FDHA 4I38A 4DJ3A 3ZQ5A 4Z1WA 4OKPA 3NECA 3IWOA 1CQAA 3A0VA 1VEUA 4X56A 3VP3A 4FCFA 1AXBA 2Y8HA 4ZJ2A 1D06A 3VV4A 2Y2QA 3NULA 4S2KA 1TS0A 4BENA 2J9OA 2V0WA 3G2ZA 4DN0A 5AQBA 1GSVA 1K56A 3QNCA 5L09A 2V8FA 4LRYC 1FCOA 1SCWA 5FQMA 3VP1A 1KGFA 3LIEA 4B4XA 3UE1A 1N9OA 3T1RA 3S4XA 1H3QA 5DTSA 3M6HA 3BRMA 4X68A 2JKGA 4WEKA 1NJ4A 1FIKA 4QJGA 3NHQA 1DRMA 2W3FA 4S2IA 4DMZA 3HBRA 3UPNA 4I3JA 2B02A 4PAUA 4BJPA 2HDUA 3HLDA 4GNUA 4CQHA 4ARZA 4WZ4A 5FQKA 5FEGA 5FASA 1PFLA 4L0LA 3MKEA 4E3OA 5FL3A 4QU3A 2EWWA 4GN2A 1MKIA 3O3VA 2FZ0A 4JKTA 1F9IA 5HPFA 3MFXA 5CTMA 2XK1A 1AWIA 3H82B 1YLPA 4S2NC 2WYXA 5EVEA 4ETXA 2QYBA 3RXXA 3IHAA 3NY4A 3OOVA 4XUXA 4B93A 3LICA 4EUVA 3KSFA 4YNRA 3KSGA 3RXWA 4MLLA 3Q81A 4K0XA 2QJ5A 1GA9A 2PT7A 2XR0A 3NOPC 5HW3A 1YT4A 5HX9A 1JWPA 2CMNA 3UO9A 4KZ8A 4OPRA 4GHIB 3JPUA 4GCZA 5TGFA 5CRFA 4KZ3A 1YLJA 1NY0A 3AGEA 3DTMA 2JHEA 3VFFA 2WK0A 1MKMA 3LIBA 3ZYTA 3LR0A 1K6SA 2JKTM 1CEGA 3SOIA 3T4QA 1K57C 3SZTA 1BLSA 3RTYA 5TBMB 3LEZA 5HAQA 5HWVA 4HJ6A 1JNUA 5EECA 3UMDA 4P6ZM 2WKIA 5HD3A 4YFMA 5HWTA 1SHVA 4BD0A 1N9LA 3MQOA 4LPZA 4OOYA 2VV7A 5FQQA 5G18A 1QMFA 2Z2MB 3WS1A 1CI8A 3ZVWA 3JYIA 1H5XA 5J7EA 2C6WB 1ESUA 2ZLYA 4PPRA 4S2JA 1YMXA 2NUTC 2EXAA 2Q9NA 4ESPA 3KO6A 3Q7VB 1NWZA 1XJ2A 1KVLA 4NEED 4CPKA 4BBUA 5CHJA 2VKSA 3F1OA 1T1AA 2R78A 5CX7A 1T19A 1SDNA 4OPYA 4ZDXA 3IBRA 2WGWB 1MWSA 3N6IA 4BBTA 5HDCA 3E2KA 4N9LA 3T4JA 5E43A 1ZC2A 5I5LA 3W4PA 3UNWA 2WZXA 4DE0A 5CGWA 4P85A 2PD8A 4L9GA 4LENA 5EE8A 3HLEA 2W1TB 3IS2B 5IU1A 2DMWA 3FV7A 4CLCA 4P6BA 4FTXA 5EVLA 2P08A 3GQZA 1BUEA 3QP5A 1W63M 4PM5A 1MWTA 1YLZA 1CEFA 1MWUA 2B95A 2JKFA 2YKHA 5HDDA 5CECA 2Y2IA 3MFDA 2Y2MA 4KENB 2VGKA 2GDNA 2ZM0A 3N4IA 3GVBA 1XP4A 4R4SA 1SKFA 1XGIA 4EW7A 2HPBA 1DP6A 3UPPA 1ZHHB 1CJFA 2M1CA 2J3WA 3EGXC 2XSSA 4UHUA 4HJ3A 4RA7A 4YWZA 3M6BA 2ZOHA 2X02A 4HY8A 3HJKA 3OLOA 3T12B 5DJTA 3VSKA 1MC0A 1X0OA 2Q0OA 4B88A 2W3DA 4UA9A 3BECA 4WL9A 5L10A 4I3AA 3IF6C 5F1FA 4KG6A 1KE0A 4KUOA 1CF0A 3IXHA 1YKDA 4EERA 1I5QA 2A24B 1RGYA 3QP8A 4HNBA 2ZL1B 3MBZA 3S1YA 4Y0TA 1UWPX 4D2OA 1E3UD 3MF0A 4G3KA 4MNRA 3ZG7B 3QNBA 5EVIB 5AQ9A 4MMNA 2EXBA 1OTAA 1PZPA 2IWBA 3EGDC 4AFIA 1KE3A 2P7JA 3AGDA 2H28A 2OOLA 3K2NA 3T4OA 3GR2A 4IUHA 4EBLA 3FKVA 2W3GA 2Y2HA 5K5BA 3EQUA 4S2NA 2R9WA 3G34A 3R7WA 3CITA 3GRJA 1DP8A 3BEBA 2DRWA 2XDMA 3QP2A 3S7QA 3UB6A 4E04A 3ZHHA 3TOIA 2ZOIA 5FAPA 2J8YA 2V8CA 4KZ6A 4H6JA 4PM6A 2QPNA 2Y59A 3B3XA 3IQAA 1YQSA 3C7UA 3LIDA 1SZVA 1ES5A 4IUKA 2OLUA 4X1MA 2C5WB 4IBXA 4M4XA 3ZNTA 3G2YA 2BTFP 3LIFA 4DE1A 1E4DA 1YMSA 2LB9A 4NETA 2P9VA 1ESIA 4BWIA 1PW8A 3W2ZA 1GCEA 2WAFA 4R70A 2PU2A
chains in the Genus database with same CATH topology
1J3WA 3T1XA 1D1JA 1SKOB 1PNEA 4D60A 2ZL1B 2V8FA 4FUWA 3T1QB 1A0KA 3T1SA 1SKOA 1PRQA 2VK3A 3T1RA 4FTXA 2HZ5A 1VETA 2JKGA 4X25A 1FIKA 1HLUP 2JKFA 2ACGA 2B95A 3MSHA 3L7HA 5EM0A 1VETB 3CHWP 3UB5P 2PBDP 3MS6A 1FILA 2PRFA 5EV0A 3KYEA 5FEGA 1Y4OA 1PFLA 3L9KA 1CJFA 2V8CA 3D9YA 3LGOA 1G5UA 5FDSA 2E8JA 1YPRA 1AWIA 2PAVP 4ESPA 3LEQA 3U4LP 5EVEA 1SZVA 1ACFA 3NECA 3T12B 5FEFA 5EM1A 1CQAA 1VEUA 4X1MA 4X1LA 3NULA 2BTFP 3CPTA 1VEUB 1Z09A 1K0KA 3DAVA 1CF0A 3CPTB 2ZL1A 1F2KA 4QWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J3W A;  3T1X A;  1D1J A;  1SKO B;  1PNE A;  4D60 A;  2ZL1 B;  2V8F A;  4FUW A;  3T1Q B;  1A0K A;  3T1S A;  1SKO A;  1PRQ A;  2VK3 A;  3T1R A;  4FTX A;  2HZ5 A;  1VET A;  2JKG A;  4X25 A;  1FIK A;  1HLU P;  2JKF A;  2ACG A;  2B95 A;  3MSH A;  3L7H A;  5EM0 A;  1VET B;  3CHW P;  3UB5 P;  2PBD P;  3MS6 A;  1FIL A;  2PRF A;  5EV0 A;  3KYE A;  5FEG A;  1Y4O A;  1PFL A;  3L9K A;  1CJF A;  2V8C A;  3D9Y A;  3LGO A;  1G5U A;  5FDS A;  2E8J A;  1YPR A;  1AWI A;  2PAV P;  4ESP A;  3LEQ A;  3U4L P;  5EVE A;  1SZV A;  1ACF A;  3NEC A;  3T12 B;  5FEF A;  5EM1 A;  1CQA A;  1VEU A;  4X1M A;  4X1L A;  3NUL A;  2BTF P;  3CPT A;  1VEU B;  1Z09 A;  1K0K A;  3DAV A;  1CF0 A;  3CPT B;  2ZL1 A;  1F2K A;  4QWO A; 
#chains in the Genus database with same CATH topology
 4Y5F A;  1PWC A;  3HUM A;  1GHI A;  3FKW A;  4QY6 A;  2Y91 A;  3E0Y A;  5M18 A;  1KE4 A;  4FD8 A;  1VM1 A;  4DF6 A;  3MXQ A;  1H8Y A;  1P97 A;  1QME A;  1N4O A;  2D01 A;  1LHY A;  5HAP A;  5DF9 A;  1PRQ A;  3ZG9 B;  4K0W A;  1I2W A;  4ME4 A;  4E6X A;  3F1N B;  1VET A;  3O88 A;  4ZAM A;  4R3A A;  1KVM A;  3GMW A;  4KG2 A;  2XEP A;  3C38 A;  3PBT A;  3CHW P;  1HD8 A;  3UB5 P;  3DBA A;  2ZC5 B;  3BLS A;  4DE3 A;  1T1B A;  1FIL A;  4JXW A;  5CHU A;  4L9E A;  3ZG8 B;  1GHM A;  2K31 A;  2DNS A;  5G4Y A;  2WKP A;  1N9B A;  3LR5 A;  3PBO A;  3PTE A;  3ZG5 A;  2HGV A;  3SH7 A;  2OSU A;  4HQA A;  4CLC C;  3S7O A;  1MPL A;  1H8M A;  1K56 D;  1WYB A;  3LIA A;  4EWF A;  4EES A;  3PBN A;  3GV9 A;  2FFY A;  4OQ0 A;  3UE6 A;  4P0M A;  1L0D A;  5M19 A;  2OAQ 1;  1ZG4 A;  2XQZ A;  5E2F A;  3MXS A;  5CXW A;  5DTK A;  4EEU A;  4OVD A;  5EFW A;  4R38 A;  3TW8 A;  4Q0I A;  1G6O A;  2L4R A;  3IX8 A;  1ZKJ A;  1TDL A;  1RGZ A;  3IT9 A;  4BQM A;  2G2W A;  2WKE A;  3IX4 A;  3BFD A;  1P9R A;  2OAP 1;  3ZNY A;  4BBV A;  1PI5 A;  5TFQ A;  4IJG A;  3G31 A;  1SKO A;  5A91 A;  1IYS A;  1EI5 A;  1XJ6 A;  1FSW A;  3WS0 A;  4WN5 A;  3NIA A;  2PR5 A;  4GD6 A;  3F1P A;  1V9Z A;  3EQV A;  3BQ8 A;  4U0X A;  1OME A;  3E4Q A;  4F3L B;  2WAE A;  1KDS A;  2XA7 S;  1Y4O A;  3N7W A;  1NLY A;  4E6W A;  3VOZ A;  1K25 A;  4JGP A;  1K54 A;  3FWL A;  1PI4 A;  1GA0 A;  4DDS A;  3H82 A;  1O7E A;  4WZ5 A;  3BW6 A;  1KGG A;  3HJI A;  3SH8 A;  3NC8 A;  4F94 A;  5FQJ A;  1DP9 A;  3IF6 A;  4OPZ A;  3DW0 A;  4WEJ A;  4G3V A;  1XFN A;  2O9A A;  1SDE A;  2BG1 A;  3NOT C;  1FSY A;  3TJZ C;  4OOM A;  4XXR A;  2ZQ9 A;  2JKR I;  2ZM8 A;  4MN6 A;  5IT5 A;  3FPW A;  3IXD A;  3M2K A;  4WYY A;  2J3T C;  1IEM A;  5J3W A;  5DF8 A;  3UB8 A;  3PYP A;  4P87 A;  3M2J A;  5HL6 A;  3UB7 A;  1CK3 A;  3FYZ A;  3BQA A;  3N8L A;  1LT0 A;  4LFU A;  3MZD A;  3BFE A;  3NDE A;  1DY6 A;  1E25 A;  1VQQ A;  5E2H A;  4MEZ A;  5GL9 A;  2A2L A;  2V1B A;  2LB5 A;  5GHZ A;  4C3Q A;  3P7N A;  3HLF A;  1GHP A;  5TBM A;  3VE4 A;  2VK3 A;  3BLM A;  3WWX A;  2H0Y A;  3B47 A;  4GB7 A;  4ARZ B;  2CC1 A;  1LL8 A;  4MDZ A;  2V20 A;  5MC7 A;  1OT6 A;  3CJM A;  3T4K A;  3UDX A;  2P74 A;  2IA2 A;  1W79 A;  2HJE A;  4E3L A;  2XFT A;  3KYQ A;  1STZ A;  1MWR A;  1PWG A;  4JF4 A;  3QP4 A;  4NXF A;  5FI6 A;  1FCM A;  3C4P A;  2A49 A;  2XGN A;  2EFX A;  4RX3 A;  2FFF B;  3P98 A;  4OH0 A;  4R23 A;  4NG2 A;  3B33 A;  5DTT A;  1YPR A;  1IFQ A;  1WA9 A;  4IHQ A;  1S67 L;  4FSF A;  1MY8 A;  2HDQ A;  1TS6 A;  5F83 A;  4PHT A;  2X71 A;  4BMW A;  2E8I A;  2WGW A;  4JBF A;  3NCK A;  4EUZ A;  1M6K A;  3O86 A;  3UN7 A;  5FA7 A;  1XGJ A;  3WS2 A;  4CLC D;  4C6Y A;  2K7S A;  3BYD A;  4P6Z S;  5EOO A;  4UEY A;  3CPT B;  5EOE A;  3UB9 A;  2JBF A;  4DRT A;  3GTC A;  4GDB A;  1J3W A;  3VMA A;  3C30 A;  2VX8 A;  2W1T A;  3IS2 A;  4RX2 A;  3W4Q A;  3A0R A;  1XX2 A;  3CWF A;  1G68 A;  3NDG A;  5CEB A;  4E3M A;  4GDN A;  1J9M A;  3PBS A;  3A3F A;  2B18 A;  3UE0 A;  2QMI A;  4PM7 A;  3OPR A;  2K2N A;  3BFF A;  2Z2L B;  5FAO A;  3IHB A;  1IYP A;  2VGL S;  2EX9 A;  2ZQA A;  1DJB A;  4MBF A;  4JXV A;  1S4R A;  1VB6 A;  4GOG A;  3EEA A;  4ETZ A;  3ULF A;  4OON A;  4BD1 A;  3S22 A;  1JWV A;  4U0T A;  2Y79 A;  3SS5 A;  1BUL A;  5KSH A;  4MBH A;  1G28 A;  3HL9 A;  3LYX A;  5C5K A;  1GSW A;  2HP9 A;  2OV5 A;  4II7 A;  5L2F A;  2VGJ A;  1K55 A;  2ZC7 A;  3ZFZ A;  4R4R A;  4WBG A;  4XT2 B;  5DF7 A;  4JGQ A;  5HZH A;  1BT5 A;  1NYM A;  2E8J A;  3F1O B;  3OZH A;  1YSP A;  3CUE C;  3O5Y A;  1FCN A;  3LFV A;  3WRZ A;  3KX0 X;  1ACF A;  3VP0 A;  3IX3 A;  3LY4 A;  4C75 A;  2Y2O A;  3D3O A;  1UWN X;  2XF3 A;  4PM9 A;  3ZDJ A;  5AQA A;  1XKZ A;  2JC7 A;  3UME A;  4X1L A;  3CMZ A;  3CI6 A;  3S7P A;  1BZA A;  3B42 A;  4B4Z A;  4GS9 A;  1O07 A;  2OWH A;  3OCN A;  5G4Z A;  4KQD A;  2ZL1 A;  5KIZ A;  2V9A A;  4NK3 A;  3T4S A;  4QWO A;  4NXE A;  4Q0H A;  1K54 C;  4HJ4 A;  3A3J A;  1PNE A;  2Y2G A;  2VJW A;  5EVI A;  2J3T D;  4WZ5 C;  4PMA A;  4Y15 A;  1TS8 A;  3TE8 A;  3A0S A;  1BLH A;  3C2W A;  1YLT A;  1A0K A;  1NRF A;  1P9W A;  1GSX A;  4Y0U A;  4WF0 A;  5F6A A;  4I3I A;  4MN7 A;  3H7W B;  2NUP C;  2PR6 A;  2RCX A;  2ACG A;  4PKY A;  4Y7P A;  5EM0 A;  1PWD A;  1DJC A;  2PBD P;  1LL9 A;  2KX6 A;  4R1G A;  4DKI A;  2ZD8 A;  3EWK A;  3UDI A;  3C8C A;  5JYO A;  3IWI A;  2KLI A;  4RYE A;  4KZ5 A;  4WMC D;  5F1G A;  4N1H A;  5EUA A;  2M7V A;  2Y2J A;  3GEC A;  4UQI S;  4LCM A;  4Z9Q A;  2JKT I;  3U4L P;  2ZC3 B;  4X69 A;  3VP2 A;  5D3O A;  2J80 A;  5FSR A;  3DWK A;  2Y55 A;  3EEH A;  4OP8 A;  4HH2 A;  3HVF A;  4NKP A;  2BLS A;  3N8S A;  1XA7 A;  1K38 A;  4KZ4 A;  2M7U A;  3MQ0 A;  4Y0O A;  3A3D A;  4MCW A;  1T1C A;  1D7E A;  1KOU A;  5I94 A;  4FH2 A;  4LV0 A;  4FUW A;  1Z6F A;  2KDK A;  2ZQ7 A;  4WMC A;  3FZC A;  3V5M A;  2WKR A;  1TF1 A;  4HP9 A;  1L0E A;  4EET B;  2QJ7 A;  1WE4 A;  1JVJ A;  2HDS A;  5DKL A;  3NI9 A;  1LL5 A;  1S66 L;  3MSH A;  2ZQC A;  4I39 A;  4EXO A;  5EPH A;  3NJA A;  4A5R A;  3GSG A;  2O9B A;  1W8Q A;  4DDY A;  4E3J A;  3KYE A;  3ITB A;  4O0P A;  1H0M A;  4DXC A;  1MXO A;  4HBU A;  4JGO A;  1NZU A;  4GKU A;  1Q2Q A;  2V1A A;  4Q0J A;  1IOU A;  4NXB A;  4EEP A;  5AVF A;  2VA0 A;  4JGR A;  3K3D A;  2VV6 A;  2XFS A;  2P9V B;  3ISG A;  2PYR A;  4LLO B;  5GLB A;  3RH8 B;  4OLG A;  5A93 A;  1HTZ A;  4LV1 A;  1IKG A;  1YLY A;  3P01 A;  1ERQ A;  4O01 A;  2ZC6 B;  4K08 A;  4RQ9 A;  4EQI A;  1Z09 A;  5FI2 A;  4R3B A;  5DVA A;  3LY3 A;  4GD8 A;  4I5S A;  4WLA A;  4O8G A;  3WS4 A;  3TRC A;  3PAE A;  3MZF A;  2DCF A;  5M1A A;  4OQG A;  4OOL A;  2PDR A;  3IH9 A;  2ZBB A;  1G6A A;  1K55 C;  3ZGA B;  5HPI A;  1S0W A;  3SS3 A;  1TS7 A;  1EWZ A;  2WKH A;  3TG9 A;  3V67 A;  1YLW A;  3V3R A;  5AQ7 A;  2HP5 A;  2QKP A;  4LGW A;  4G3W A;  4UA6 A;  3P09 A;  5TJJ A;  2W3E A;  1TEM A;  4X6T A;  2W3H A;  4EV4 A;  5DJU A;  4F3L A;  2V1Z A;  3S7N A;  3PR6 A;  2V0U A;  1FOF A;  4S2P A;  1RCJ A;  1NYY A;  1HZO A;  3FPV A;  4WUJ A;  3MMH A;  1FR6 A;  3CUE A;  3MKF A;  3G35 A;  3RJU A;  3R4K A;  1P0Z A;  1V9Y A;  3L9K A;  4UAA A;  5DKK A;  5EVI C;  2H5S A;  5HDS A;  1YAX A;  1Y28 A;  4KZB A;  3V3S A;  1XA1 A;  5HFO A;  2PHY A;  1U60 A;  5TR7 A;  2XA7 M;  1KGE A;  5L07 A;  2Y2P A;  3N8R A;  3AGF A;  4R6L A;  2GNX A;  3EOI A;  3SS4 A;  2XLN A;  1L0G A;  4KQR A;  2P04 A;  3SW1 A;  1OTI A;  1HVB A;  4LV2 A;  4FOF A;  1WYC A;  1LI9 A;  2WUQ A;  1VEU B;  5AJG A;  3BY8 A;  1LSV A;  4QD4 A;  4KQQ A;  1ODV A;  2EX6 A;  3OPP A;  1PZO A;  1IKI A;  3Q07 A;  3A3I A;  1SKO B;  4D60 A;  4EQ1 A;  5GHX A;  3O87 A;  4JLF A;  3WS5 A;  3T1Q B;  3C4O A;  2L0W A;  3F1P B;  3UY6 A;  3CLO A;  3PHY A;  2X01 A;  1NZO A;  3VP4 A;  4GZB A;  4GHI A;  4X53 A;  2HDR A;  4H8R A;  1ERO A;  2VV8 A;  2GX5 A;  3IBJ A;  3FG8 A;  5IS1 A;  2KOI A;  4QPR A;  3V50 A;  4YOF A;  3W8K A;  3L7H A;  3BFG A;  1PYY A;  4QHC A;  4JXG A;  4HES A;  3QHY A;  1K4E A;  3DTK A;  5FQI A;  2YKF A;  5J4E A;  4HHD A;  5EV0 A;  4Y13 A;  3E4P A;  1K4F A;  3C7V A;  4GLQ A;  2JN7 A;  4N9K A;  1S1Y A;  3IF6 B;  3G30 A;  4B9O A;  5DFX A;  3TSG A;  1OTB A;  1K6R A;  4E3N A;  1LSX A;  2QWS A;  4BL2 A;  4ZBE A;  2EFU A;  4KZ9 A;  1W5D A;  3PBR A;  3HLW A;  1T18 A;  1FQG A;  3ZG0 A;  1MZU A;  2H0T A;  2QHK A;  5HAR A;  2ZQ8 A;  3PXP A;  3UE3 A;  2V2F F;  4L9F A;  2HF6 A;  4ZRR A;  4JF6 A;  2WGI A;  3LI9 A;  3E4O A;  3Q7V A;  3CPT A;  2J7V A;  1JWZ A;  5CED A;  4EBN A;  4QB8 A;  3HLG A;  3ZCZ A;  3HLB A;  1W7F A;  1F2K A;  5HL1 A;  2VLG A;  1ES3 A;  4KG5 A;  1NLZ A;  3T1X A;  3MZE A;  4KQO A;  5FAQ A;  4S2M A;  2QZ6 A;  1ONH A;  1Y54 A;  3MJQ A;  4R0Q A;  2B5R A;  4U3T A;  3T4T A;  2WZZ A;  1YM1 A;  2RL3 A;  4YIN A;  5IHV A;  2I9V A;  4S2O A;  2Y2N A;  3OC2 A;  1F5M A;  4LV3 A;  2JCH A;  3BY9 A;  1Q2P A;  3HUO A;  2Y2K A;  4IBR A;  4ID4 A;  3LUQ A;  2WGV A;  3Q1F A;  5BOH A;  5JYP A;  3DTE A;  1BYW A;  1M40 A;  2VGL M;  4UA7 A;  4XT2 A;  3H9W A;  5F82 A;  2EX2 A;  2UWX A;  2W27 A;  5F5Y A;  2I72 A;  4LCL A;  3E2L A;  1CI9 A;  2PYP A;  1S1Z A;  3IF5 A;  5U47 A;  2PAV P;  4RVA A;  2W0N A;  1I2S A;  4GJ4 A;  5EM1 A;  5FEF A;  1RP5 A;  1XFQ A;  5EVI D;  1LLB A;  5GHY A;  2Q9M A;  5FAT A;  2ZQD A;  4O7D A;  2INW A;  3CAX A;  1UGU A;  1JTD A;  2Z6C A;  3KSH A;  1LSW A;  3BWL A;  1FR1 A;  3DAV A;  3IWQ A;  3VOL A;  4Q8I A;  4X55 A;  3SH9 A;  4BL3 A;  4E3K A;  1NXY A;  3QP1 A;  1D1J A;  5A90 A;  2EX8 A;  2FH5 A;  5F68 A;  5HD5 A;  3IXB A;  5L8M A;  4LRX C;  3H7W A;  3OBF A;  3BFC A;  2A24 A;  1L2S A;  4K91 A;  3KYZ A;  4ZJ1 A;  1ERM A;  2O99 A;  2R9X A;  4Y17 A;  2BAS A;  5LBR A;  1BSG A;  5GLA A;  4CLC B;  3G32 A;  2HP6 A;  3BM6 A;  3MS6 A;  3E98 A;  3RFB A;  1BLP A;  5KSC A;  2PRF A;  1F98 A;  1ZG6 A;  3W4O A;  3A3E A;  4PKY G;  3KSI A;  4E3I A;  1W8Y A;  1H8Z A;  1OT9 A;  2XD5 A;  5GLD A;  1ONG A;  3BJN A;  2ZMA A;  4WEL A;  4M3K A;  3D9Y A;  3WRT A;  5FDS A;  1ALQ A;  3CZD A;  5DFY A;  4DE2 A;  3Q7Z A;  4OQI A;  2JE5 A;  4S2L A;  1L0F A;  1EW0 A;  4DXB A;  2HJ9 C;  3MXR A;  4JF5 A;  4NXG A;  2O0Y A;  1PW1 A;  4GS9 B;  5F69 A;  4IVK A;  3GDI A;  4HEF A;  5KZH A;  3HRE A;  4KZ7 A;  3OPL A;  2OWJ A;  1W63 Q;  2OLV A;  2ZJ9 A;  3UPO A;  3K3C A;  4UQI M;  3CG5 A;  1VHM A;  2H10 A;  4XUZ A;  3IH8 A;  4OP5 A;  5E2G A;  3LI8 A;  2MJ6 A;  3C5A A;  5A92 A;  4HOI A;  5J8X A;  5HAI A;  1BTL A;  3VFH A;  2G2U A;  5FI7 A;  4KUK A;  2XRO A;  2XH9 A;  1IEL A;  3QP6 A;  4GW9 A;  2VZW A;  3PBQ A;  1OPX A;  3G6O A;  1OTE A;  1ZTU A;  4N92 A;  4QY5 A;  1IYQ A;  5CHM A;  2XRN A;  2HZ5 A;  4HBT A;  4HP4 A;  4FH4 A;  4CJN A;  2GJ3 A;  2JKR M;  4X25 A;  1TDG A;  3LO7 A;  3VE3 A;  3NOU C;  5HSQ A;  3ICY A;  4IED A;  5FQ9 A;  4LRZ E;  1NRJ A;  4DJ2 A;  1E3U A;  1OJG A;  3U2A A;  3DTI A;  5KMW A;  2J9P A;  2ZC4 B;  3F1N A;  5CGS A;  5HWW A;  3T50 A;  2HV1 A;  3HUN A;  1ES2 A;  5CGX A;  2WAD A;  2XD1 A;  3D72 A;  4JXS A;  5GLC A;  2VEA A;  1IYO A;  4HH3 A;  1BLC A;  3R7W B;  3JVU A;  3JVV A;  3UDF A;  5AVE A;  2A3U A;  2Z6D A;  4CLC E;  3LGO A;  1G5U A;  3ZVT A;  3VSL A;  4MN5 A;  3LEQ A;  2PU4 A;  1XJ4 A;  2IWD A;  2UV0 E;  2G7U A;  4H6J B;  3LCE A;  3NBL A;  3T4L A;  1KDW A;  2ZM2 A;  3VOY A;  3OCL A;  1K57 A;  2GZA A;  1LI0 A;  4KZA A;  3V39 A;  4WM9 A;  5E2E A;  1XXM A;  2EWV A;  2IWC A;  4HIA A;  1XJ3 A;  1K0K A;  3LR3 A;  1OTD A;  4EBP A;  5CER A;  3HCY A;  1OJ5 A;  3OPH A;  1TD5 A;  1YSQ A;  2Y4A A;  4IVI A;  3IXG A;  3I7J A;  3LR4 A;  4N1X A;  5A8B A;  2ZMV A;  4HI4 A;  3D4F A;  4EU0 A;  4Y2F A;  1XPB A;  1MBL A;  1ES4 A;  1JTG A;  3Q82 A;  4PM8 A;  3T1S A;  3HLC A;  3FC7 A;  4ZTK A;  2PBY A;  4OLD A;  4OQH A;  2O9C A;  4R3J A;  1L3L A;  4ZJ3 A;  1DJA A;  4Y3I A;  2EA9 A;  1HLU P;  2WKQ A;  1VET B;  4MBK A;  3MQQ A;  2AVX A;  2PD7 A;  2Y2L A;  2L1M A;  3MR0 A;  3ITA A;  2D02 A;  1TVF A;  3PAG A;  4JPM A;  4OPQ A;  3DWZ A;  4BLM A;  3G4P A;  1S6R A;  5CTN A;  1PIO A;  1N9N A;  2W1R A;  1C3B A;  2ZMF A;  1S4S A;  5FDH A;  4I38 A;  4DJ3 A;  3ZQ5 A;  4Z1W A;  4OKP A;  3NEC A;  3IWO A;  1CQA A;  3A0V A;  1VEU A;  4X56 A;  3VP3 A;  4FCF A;  1AXB A;  2Y8H A;  4ZJ2 A;  1D06 A;  3VV4 A;  2Y2Q A;  3NUL A;  4S2K A;  1TS0 A;  4BEN A;  2J9O A;  2V0W A;  3G2Z A;  4DN0 A;  5AQB A;  1GSV A;  1K56 A;  3QNC A;  5L09 A;  2V8F A;  4LRY C;  1FCO A;  1SCW A;  5FQM A;  3VP1 A;  1KGF A;  3LIE A;  4B4X A;  3UE1 A;  1N9O A;  3T1R A;  3S4X A;  1H3Q A;  5DTS A;  3M6H A;  3BRM A;  4X68 A;  2JKG A;  4WEK A;  1NJ4 A;  1FIK A;  4QJG A;  3NHQ A;  1DRM A;  2W3F A;  4S2I A;  4DMZ A;  3HBR A;  3UPN A;  4I3J A;  2B02 A;  4PAU A;  4BJP A;  2HDU A;  3HLD A;  4GNU A;  4CQH A;  4ARZ A;  4WZ4 A;  5FQK A;  5FEG A;  5FAS A;  1PFL A;  4L0L A;  3MKE A;  4E3O A;  5FL3 A;  4QU3 A;  2EWW A;  4GN2 A;  1MKI A;  3O3V A;  2FZ0 A;  4JKT A;  1F9I A;  5HPF A;  3MFX A;  5CTM A;  2XK1 A;  1AWI A;  3H82 B;  1YLP A;  4S2N C;  2WYX A;  5EVE A;  4ETX A;  2QYB A;  3RXX A;  3IHA A;  3NY4 A;  3OOV A;  4XUX A;  4B93 A;  3LIC A;  4EUV A;  3KSF A;  4YNR A;  3KSG A;  3RXW A;  4MLL A;  3Q81 A;  4K0X A;  2QJ5 A;  1GA9 A;  2PT7 A;  2XR0 A;  3NOP C;  5HW3 A;  1YT4 A;  5HX9 A;  1JWP A;  2CMN A;  3UO9 A;  4KZ8 A;  4OPR A;  4GHI B;  3JPU A;  4GCZ A;  5TGF A;  5CRF A;  4KZ3 A;  1YLJ A;  1NY0 A;  3AGE A;  3DTM A;  2JHE A;  3VFF A;  2WK0 A;  1MKM A;  3LIB A;  3ZYT A;  3LR0 A;  1K6S A;  2JKT M;  1CEG A;  3SOI A;  3T4Q A;  1K57 C;  3SZT A;  1BLS A;  3RTY A;  5TBM B;  3LEZ A;  5HAQ A;  5HWV A;  4HJ6 A;  1JNU A;  5EEC A;  3UMD A;  4P6Z M;  2WKI A;  5HD3 A;  4YFM A;  5HWT A;  1SHV A;  4BD0 A;  1N9L A;  3MQO A;  4LPZ A;  4OOY A;  2VV7 A;  5FQQ A;  5G18 A;  1QMF A;  2Z2M B;  3WS1 A;  1CI8 A;  3ZVW A;  3JYI A;  1H5X A;  5J7E A;  2C6W B;  1ESU A;  2ZLY A;  4PPR A;  4S2J A;  1YMX A;  2NUT C;  2EXA A;  2Q9N A;  4ESP A;  3KO6 A;  3Q7V B;  1NWZ A;  1XJ2 A;  1KVL A;  4NEE D;  4CPK A;  4BBU A;  5CHJ A;  2VKS A;  3F1O A;  1T1A A;  2R78 A;  5CX7 A;  1T19 A;  1SDN A;  4OPY A;  4ZDX A;  3IBR A;  2WGW B;  1MWS A;  3N6I A;  4BBT A;  5HDC A;  3E2K A;  4N9L A;  3T4J A;  5E43 A;  1ZC2 A;  5I5L A;  3W4P A;  3UNW A;  2WZX A;  4DE0 A;  5CGW A;  4P85 A;  2PD8 A;  4L9G A;  4LEN A;  5EE8 A;  3HLE A;  2W1T B;  3IS2 B;  5IU1 A;  2DMW A;  3FV7 A;  4CLC A;  4P6B A;  4FTX A;  5EVL A;  2P08 A;  3GQZ A;  1BUE A;  3QP5 A;  1W63 M;  4PM5 A;  1MWT A;  1YLZ A;  1CEF A;  1MWU A;  2B95 A;  2JKF A;  2YKH A;  5HDD A;  5CEC A;  2Y2I A;  3MFD A;  2Y2M A;  4KEN B;  2VGK A;  2GDN A;  2ZM0 A;  3N4I A;  3GVB A;  1XP4 A;  4R4S A;  1SKF A;  1XGI A;  4EW7 A;  2HPB A;  1DP6 A;  3UPP A;  1ZHH B;  1CJF A;  2M1C A;  2J3W A;  3EGX C;  2XSS A;  4UHU A;  4HJ3 A;  4RA7 A;  4YWZ A;  3M6B A;  2ZOH A;  2X02 A;  4HY8 A;  3HJK A;  3OLO A;  3T12 B;  5DJT A;  3VSK A;  1MC0 A;  1X0O A;  2Q0O A;  4B88 A;  2W3D A;  4UA9 A;  3BEC A;  4WL9 A;  5L10 A;  4I3A A;  3IF6 C;  5F1F A;  4KG6 A;  1KE0 A;  4KUO A;  1CF0 A;  3IXH A;  1YKD A;  4EER A;  1I5Q A;  2A24 B;  1RGY A;  3QP8 A;  4HNB A;  2ZL1 B;  3MBZ A;  3S1Y A;  4Y0T A;  1UWP X;  4D2O A;  1E3U D;  3MF0 A;  4G3K A;  4MNR A;  3ZG7 B;  3QNB A;  5EVI B;  5AQ9 A;  4MMN A;  2EXB A;  1OTA A;  1PZP A;  2IWB A;  3EGD C;  4AFI A;  1KE3 A;  2P7J A;  3AGD A;  2H28 A;  2OOL A;  3K2N A;  3T4O A;  3GR2 A;  4IUH A;  4EBL A;  3FKV A;  2W3G A;  2Y2H A;  5K5B A;  3EQU A;  4S2N A;  2R9W A;  3G34 A;  3R7W A;  3CIT A;  3GRJ A;  1DP8 A;  3BEB A;  2DRW A;  2XDM A;  3QP2 A;  3S7Q A;  3UB6 A;  4E04 A;  3ZHH A;  3TOI A;  2ZOI A;  5FAP A;  2J8Y A;  2V8C A;  4KZ6 A;  4H6J A;  4PM6 A;  2QPN A;  2Y59 A;  3B3X A;  3IQA A;  1YQS A;  3C7U A;  3LID A;  1SZV A;  1ES5 A;  4IUK A;  2OLU A;  4X1M A;  2C5W B;  4IBX A;  4M4X A;  3ZNT A;  3G2Y A;  2BTF P;  3LIF A;  4DE1 A;  1E4D A;  1YMS A;  2LB9 A;  4NET A;  2P9V A;  1ESI A;  4BWI A;  1PW8 A;  3W2Z A;  1GCE A;  2WAF A;  4R70 A;  2PU2 A; 
#chains in the Genus database with same CATH homology
 1J3W A;  3T1X A;  1D1J A;  1SKO B;  1PNE A;  4D60 A;  2ZL1 B;  2V8F A;  4FUW A;  3T1Q B;  1A0K A;  3T1S A;  1SKO A;  1PRQ A;  2VK3 A;  3T1R A;  4FTX A;  2HZ5 A;  1VET A;  2JKG A;  4X25 A;  1FIK A;  1HLU P;  2JKF A;  2ACG A;  2B95 A;  3MSH A;  3L7H A;  5EM0 A;  1VET B;  3CHW P;  3UB5 P;  2PBD P;  3MS6 A;  1FIL A;  2PRF A;  5EV0 A;  3KYE A;  5FEG A;  1Y4O A;  1PFL A;  3L9K A;  1CJF A;  2V8C A;  3D9Y A;  3LGO A;  1G5U A;  5FDS A;  2E8J A;  1YPR A;  1AWI A;  2PAV P;  4ESP A;  3LEQ A;  3U4L P;  5EVE A;  1SZV A;  1ACF A;  3NEC A;  3T12 B;  5FEF A;  5EM1 A;  1CQA A;  1VEU A;  4X1M A;  4X1L A;  3NUL A;  2BTF P;  3CPT A;  1VEU B;  1Z09 A;  1K0K A;  3DAV A;  1CF0 A;  3CPT B;  2ZL1 A;  1F2K A;  4QWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...