2W3GA

Air-oxidized structure of the first gaf domain of mycobacterium tuberculosis doss
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
150
structure length
150
Chain Sequence
GAMDPDLEATLRAIVHSATSLVDARYGAMEVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRVRDESFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAVANARLYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords TWO COMPONENT SENSOR HISTIDINE KINASE DEVS (GAF FAMILY PROTE
publication title Structural Insight Into the Heme-Based Redox Sensing by Doss from Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 38
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w3gA00
1TF1A 2W3EA 4O0PA 2W1TA 4GW9A 2XROA 4O01A 2K2NA 2W3HA 1ZTUA 2O9BA 5I5LA 3MF0A 3C2WA 4ETXA 3E98A 4EUVA 3RFBA 2KLIA 1YSPA 3ZQ5A 4EU0A 2VZWA 3S7QA 3NOTC 4IUHA 4DMZA 3K2NA 3CITA 5HSQA 4MN7A 2O9CA 3OBFA 2VEAA 4G3VA 5HL6A 4YNRA 3E0YA 4CQHA 4E04A 3S7OA 4YOFA 4Q0IA 5DFXA 4Q0JA 2W3GA 2QYBA 4Y2FA 4GLQA 1MKMA 4PAUA 5K5BA 3EEAA 2M7VA 3D3OA 4LRYC 4MMNA 4ME4A 2G7UA 5LBRA 4R70A 2LB9A 5L8MA 2LB5A 2W3FA 4MDZA 3KSIA 4IUKA 2Y8HA 1TD5A 4Y3IA 3VV4A 3HCYA 5TJJA 3LFVA 3S7PA 4LRXC 2GX5A 2HGVA 1YKDA 2KOIA 5HPFA 3NOUC 5DFYA 3KO6A 4G3KA 2O99A 2O0YA 4ZRRA 4DN0A 3KSHA 4Z1WA 2XSSA 2VKSA 3KSFA 2K31A 2Y79A 3O5YA 3NOPC 4FOFA 3OOVA 2W1RA 1YSQA 5HPIA 4ETZA 3CI6A 4O8GA 1MC0A 3G6OA 2M7UA 2ZMFA 1VHMA 4LRZE 3IBJA 4G3WA 4Y5FA 3DBAA 2W3DA 1F5MA 3BJNA 3NHQA 2XRNA 3KSGA 4BWIA 2O9AA 4Q0HA 2W1TB 4IJGA 4MCWA 2VJWA 3MQ0A 2IA2A 3R4KA 4R6LA 1STZA 3S7NA 3MMHA 4RQ9A 5C5KA 3TRCA 5AJGA 4QPRA 3W2ZA 2OOLA 3IBRA 2B18A
chains in the Genus database with same CATH superfamily
2E8IA 3LI9A 1XFQA 3DTEA 1YT4A 3Q7VB 4CJNA 1DJAA 1L0GA 4HHDA 4IBRA 4ESPA 4I5SA 3VFFA 3U2AA 3C4PA 1H3QA 1GHIA 4BMWA 4CPKA 1ONHA 2H0TA 4UQIM 4RA7A 3QP1A 1XJ4A 2O9CA 5EVID 4EWFA 3E0YA 4JGQA 4LV1A 2MJ6A 3ZG7B 4GDBA 2W3GA 5E43A 4GLQA 2JKTI 3GVBA 4OH0A 1K55C 2ZL1A 3D72A 4NXEA 1KE3A 2AVXA 1ERQA 3S7PA 2EWVA 3WS2A 3I7JA 5FDHA 1IYSA 2D01A 3ZVWA 3P09A 5DFYA 1LLBA 4G3KA 2J9PA 3ZHHA 1CK3A 4WZ5A 2VKSA 4NETA 1VEUA 4JGRA 1NZUA 1OT9A 3NOPC 3IX4A 3GSGA 4LCLA 3NC8A 3CI6A 3PAEA 4OP8A 4KZ3A 3FC7A 3C30A 4P6BA 4BWIA 3V67A 2V1ZA 3NI9A 3ZG9B 4KG6A 3VSLA 3BFDA 3VE3A 3GV9A 2WYXA 4R6LA 3S7NA 1ES4A 4RQ9A 5CECA 2Y2JA 4DDYA 5TR7A 1GSWA 2WKPA 3UE0A 1DJCA 3TSGA 1MPLA 1YLJA 1SDEA 1YLYA 3HLBA 2WUQA 4DKIA 5FAPA 3B42A 3PBQA 3T4SA 1BTLA 3ISGA 5DF7A 5FI7A 4S2PA 3S7QA 4MBFA 2HJ9C 1V9ZA 1K6SA 1N9OA 2ZM0A 1O7EA 4N9LA 5EOEA 1Y28A 3QNCA 3P98A 3QNBA 2W0NA 3LIFA 5A90A 4EBNA 3ICYA 4KG2A 2FFYA 3IHAA 1NLYA 5CHUA 4Y2FA 1MKMA 2QJ7A 3UPNA 3JPUA 3UDIA 1S0WA 2BLSA 3BLMA 3G2ZA 5A93A 4RYEA 5FAOA 4IVKA 2QWSA 2PR5A 3GECA 1XXMA 2HGVA 4HBTA 4L9GA 3M2KA 3TE8A 2XFTA 3KO6A 4XUXA 1LSVA 2QHKA 3VMAA 2ZLYA 2P04A 4EBLA 2WZZA 1YLTA 4MLLA 2HF6A 4KZ8A 1N4OA 4HH2A 4O8GA 5AQBA 3FKWA 2J9OA 2XFSA 3QP5A 4OOYA 3EQVA 2B02A 5KMWA 3MMHA 1T1CA 3EWKA 4KZ7A 4KZBA 3IBRA 1TEMA 4HESA 4BJPA 3UPOA 5E2EA 4Y13A 1N9BA 1JVJA 2PU2A 2O9BA 2EA9A 4K91A 4FSFA 1YLWA 3BFGA 3NOTC 4IUHA 5DF9A 3GTCA 5A91A 2A49A 2VEAA 1FOFA 4BENA 2W27A 3S7OA 4E3NA 4H6JB 1XJ6A 2Y2KA 3G4PA 1T18A 4OQGA 2HZ5A 4GDNA 1MWUA 1N9NA 1IEMA 1XPBA 2BTFP 4KZAA 4CLCD 4HQAA 4ZJ1A 2YKFA 3FPWA 3IH9A 4S2NC 5J8XA 4M3KA 5DKKA 1FCMA 3UE3A 1E3UD 5U47A 5A92A 3ZYTA 5CGSA 2P9VA 5GHYA 2PBDP 5BOHA 3UMDA 2ZD8A 1JTGA 1BUEA 2ZOHA 1M40A 3Q07A 2V0UA 2ZOIA 3MXSA 5DF8A 3VP1A 4MCWA 4BD1A 4EUZA 1DP6A 3LICA 1H8MA 5FASA 2Y2IA 4U3TA 5KSCA 3MS6A 1SKOA 2BASA 3WRTA 4QPRA 3CHWP 1K54C 2W3EA 1DJBA 2W1TA 5E2FA 2YKHA 3LGOA 1MWTA 1K4EA 4EBPA 5L2FA 2P74A 1LI9A 3LR0A 5HD3A 2OWJA 2UV0E 4A5RA 1SDNA 3RFBA 3QP6A 1YSPA 4WLAA 4HY8A 1N9LA 3E4OA 1K25A 2VZWA 4EERA 4S2JA 4GD6A 4YWZA 1JWVA 4IHQA 4HOIA 5J3WA 5L10A 3WS0A 5EVIC 3PHYA 4YOFA 3EQUA 1NLZA 1HLUP 2RCXA 1T1AA 5G18A 1ZHHB 3SS4A 1T1BA 1WYBA 3QP4A 5HFOA 2PHYA 2GDNA 5L09A 2G7UA 2LB5A 3PBOA 2Y8HA 5TJJA 3LEZA 1ZG4A 4D60A 3BWLA 1X0OA 2FFFB 2L1MA 2KOIA 3TOIA 1C3BA 3FKVA 2H10A 3KSFA 1PIOA 4OP5A 1OTDA 1S1ZA 2XLNA 1YSQA 3SH9A 5HD5A 1W8YA 2EWWA 4BLMA 3MQOA 2JHEA 1BYWA 4S2OA 5GLBA 3DWKA 2WKRA 3IX8A 4B4XA 3M6HA 3UDXA 3MQ0A 4C3QA 2HP5A 5FEFA 4BBVA 2JKRM 1E4DA 4F94A 4QJGA 3LUQA 2Y4AA 3HLDA 2J3TD 5TBMA 5AQ9A 3NDGA 2EXBA 3BYDA 5TFQA 1CI8A 1G6AA 2ZC7A 4DMZA 2UWXA 2ZL1B 4X55A 5IS1A 5HZHA 2HDRA 1ES5A 1OTAA 1Q2QA 1YPRA 4E04A 1LL8A 5HWTA 1Y4OA 4OQ0A 1YMXA 5E2GA 1PYYA 1KE0A 2OSUA 4QY5A 4PAUA 1W7FA 1IOUA 4R4SA 5F68A 4UAAA 1OJGA 1VEUB 2JKTM 2W3FA 3UPPA 3UMEA 2P08A 1CEFA 3VV4A 2OLVA 2VX8A 4PHTA 4GN2A 4X1LA 3EGXC 1ONGA 4OPZA 3FV7A 1RGYA 3S4XA 2Y79A 1RCJA 1BLSA 1Y54A 3CUEC 4MN5A 3O87A 2A3UA 3F1PA 3CMZA 3AGDA 1MC0A 1JWZA 2EFXA 5D3OA 3WWXA 1KDSA 4GJ4A 4FCFA 4E3JA 5GL9A 2WGIA 1FIKA 2J8YA 3HLWA 3ZGAB 2K7SA 4XUZA 2WGVA 3HLCA 2XEPA 3HUMA 2V20A 2Q9NA 4EV4A 3U4LP 1W63Q 1W8QA 4LCMA 1GHMA 1MZUA 4HNBA 1XP4A 1JTDA 4WMCA 3PBRA 4ARZA 4EXOA 4L9FA 2QJ5A 2XH9A 4EQIA 1L3LA 4LV2A 1TS6A 1L2SA 2ZQ9A 4QHCA 5EFWA 3S1YA 3BLSA 5GHXA 3OBFA 4E3IA 3HLFA 4CQHA 2Z6DA 3ZG0A 1LSWA 3IS2A 3NY4A 3VP2A 2QYBA 2L4RA 1UWPX 4B9OA 2DNSA 3HBRA 2BG1A 4HI4A 4CLCC 5IHVA 5EV0A 1K55A 4ZAMA 3HCYA 3VOYA 4WELA 4WM9A 3OCNA 1P0ZA 1XGIA 1CI9A 4L0LA 1YLPA 3HJKA 5HAIA 1FCOA 1ES3A 4OONA 3A0RA 1YM1A 4F3LA 1TS0A 3F1OA 1I2WA 1VHMA 1CJFA 1KDWA 4LRZE 4JXVA 4ZJ2A 3BJNA 3NHQA 4Y0UA 5L07A 4Y17A 1XA1A 2HP9A 4M4XA 3R4KA 2WKHA 5EM1A 5AJGA 5DTTA 2PAVP 1LI0A 5DJUA 2XROA 4GW9A 1GA0A 5FQJA 1SKFA 1XKZA 3OPLA 2W3HA 4PPRA 3HVFA 4R3AA 3UE6A 1S4RA 3LR5A 4KQDA 3ZDJA 4X68A 1G68A 3IXBA 2KLIA 3OPPA 3Q82A 1S6RA 4MBHA 5CTNA 4N1XA 2Z2LB 5CERA 3DTIA 4WZ5C 2OWHA 2H28A 4Q8IA 2XD1A 2VGKA 3GQZA 2V9AA 3V3SA 1ODVA 2EX2A 4HJ6A 3LY4A 4HP4A 3HUOA 2VGJA 3GDIA 2QPNA 4KQRA 4GD8A 3IWIA 4Y3IA 3Q7ZA 1MBLA 2P9VB 4WZ4A 2Y2GA 3LEQA 2Y2QA 1XGJA 3S22A 1A0KA 5E2HA 4LPZA 3OPRA 3UY6A 3T1QB 2W1RA 4P6ZS 1H5XA 4UHUA 3T4OA 3G6OA 4HH3A 2WGWA 1K56A 3IBJA 1SKOB 4HBUA 4WEKA 1L0FA 1KVMA 2O9AA 2W1TB 3LCEA 5KZHA 1NY0A 3WS1A 4NG2A 3A3DA 2V1BA 3W2ZA 2B18A 2Y55A 4NEED 1TF1A 4IBXA 2J3TC 3A3EA 4DDSA 3O86A 2ZC5B 4P85A 4WF0A 2ZQAA 4EUVA 4WBGA 1PZOA 2J80A 1UWNX 3ZQ5A 3RXXA 5KIZA 5DTSA 3L7HA 4QY6A 2Z2MB 1KGFA 3D3OA 4DXBA 2G2WA 3QP2A 2LB9A 2Y2LA 5FATA 2ZM8A 3BFCA 2EX8A 5CEDA 5HPFA 2ACGA 3NOUC 3HLGA 4NXFA 2V8CA 3O3VA 3VP3A 5FQ9A 3UN7A 2XD5A 3HL9A 5EPHA 4FOFA 3OOVA 4BBUA 4OVDA 2V8FA 4OPYA 4GS9A 4JPMA 3N8RA 4WMCD 4R3JA 4BL3A 3ZCZA 4NXGA 3CWFA 1F98A 2EX6A 4E3MA 3T12B 5TBMB 4KZ6A 4GNUA 1BZAA 1P97A 3FZCA 4ID4A 3TJZC 4R4RA 2XA7S 3A3FA 2VLGA 1VETA 1TDLA 1YLZA 3SH7A 4MEZA 1K54A 4C75A 4PMAA 3N6IA 4O7DA 1V9YA 3CPTA 3TG9A 5F5YA 1VB6A 5AQAA 2DCFA 4DE2A 3WRZA 2CMNA 3C7UA 4Y7PA 1D06A 4JGPA 3E2LA 4R23A 1NXYA 2HDUA 2Y2MA 3W8KA 4Y15A 2PD8A 2A24A 1P9RA 5HSQA 3UDFA 1IKIA 4LV0A 1NRJA 1YQSA 5HL6A 4WN5A 3SS5A 3LR3A 3JVUA 5EVIA 3HUNA 3DW0A 4PM6A 4LLOB 5K5BA 2C6WB 2ZQCA 3OPHA 5F83A 3DWZA 4LV3A 1WYCA 1ALQA 1BLCA 3F1PB 4JXGA 4U0TA 1EW0A 4E3LA 3W4QA 2ZC4B 5A8BA 4ZRRA 3RTYA 4Z1WA 3A0VA 2KX6A 2WKQA 4QU3A 2R9WA 3O5YA 4D2OA 2GZAA 2Y2HA 3QP8A 5HPIA 4AFIA 2B5RA 4ZTKA 4HJ4A 2VK3A 1O07A 2NUTC 1DP9A 4KZ4A 3VP0A 4G3WA 4Y5FA 3VP4A 4X56A 4OLGA 4I38A 3T50A 3NCKA 3MXRA 4R1GA 4ARZB 3G30A 4E3KA 3SH8A 5CHJA 4OPRA 5C5KA 4MBKA 4DJ3A 5M18A 2RL3A 2VV6A 4KUOA 3KX0X 2WKEA 4PKYG 2VGLS 3GMWA 1PNEA 3LIAA 2XQZA 1VM1A 2K2NA 3LR4A 4JXSA 5KSHA 3C2WA 4ETXA 3VOZA 3PBTA 3IS2B 2ZQDA 3BFEA 1FCNA 5HWVA 1OMEA 3K2NA 5DJTA 2H5SA 4JGOA 1LHYA 4QB8A 5DTKA 1J9MA 1CF0A 4MN6A 2EFUA 2PU4A 5CX7A 3UO9A 2X02A 5HW3A 3UNWA 3T1SA 4U0XA 3DTMA 3H7WA 3CAXA 5M19A 1J3WA 4FH4A 4R70A 5L8MA 3A3JA 3WS5A 4IUKA 1IKGA 3IHBA 3LFVA 2OAP1 4FTXA 3T4JA 2ZQ7A 4F3LB 4XT2A 4PM8A 1MXOA 3F1OB 4L9EA 1YAXA 1GSVA 1HTZA 3WS4A 3OCLA 3MBZA 1G28A 2WAFA 3R7WA 2HV1A 3OC2A 3PR6A 1EWZA 1PFLA 1D1JA 1L0DA 4DE1A 1WA9A 2FZ0A 3SS3A 3MZDA 4WEJA 4I39A 1S1YA 1WE4A 1P9WA 3BM6A 1KVLA 2X01A 5FEGA 1IYPA 4Q0HA 3MQQA 1XA7A 4I3IA 2I9VA 1PW8A 2PD7A 3IF6A 1STZA 3PBNA 5GLCA 3G2YA 3H9WA 2JC7A 3G35A 3F1NB 4B93A 4O01A 1MY8A 3E2KA 3N7WA 3E98A 4RVAA 4EU0A 3C7VA 4ZDXA 3IF5A 1SCWA 1SHVA 5FA7A 4HJ3A 5FAQA 4LENA 3BRMA 2IWBA 1NWZA 1BT5A 1FR1A 4WYYA 1SZVA 4P87A 5J7EA 3FYZA 3JVVA 1ZKJA 3G31A 2IWCA 4E3OA 1UGUA 4P6ZM 5F1GA 2M7VA 4FD8A 3IXGA 2EX9A 1IYOA 5HARA 3KYZA 4CLCA 4LRXC 1L0EA 2VA0A 1OTBA 4RX3A 3UB9A 2WGWB 4BL2A 3NECA 1W63M 1E3UA 4X6TA 1K57C 2PR6A 4H8RA 5JYPA 3C5AA 3O88A 3PXPA 5J4EA 2HDQA 3AGFA 1LT0A 2Q9MA 5M1AA 5G4YA 1FR6A 3BFFA 4K0XA 5EOOA 2WAEA 2VJWA 4Y0TA 3E4PA 5CRFA 2ZBBA 3TRCA 3RXWA 2X71A 5EVLA 1GCEA 3B47A 5CGWA 5HDDA 1K0KA 3T4LA 3V39A 3MF0A 4JF4A 3DTKA 3K3CA 3MXQA 5FDSA 2XF3A 3IXDA 3ZNTA 3NBLA 4OPQA 2WADA 4HEFA 2B95A 4MN7A 1G6OA 1FSYA 4X1MA 3HJIA 5FL3A 4YINA 2FH5A 3MKFA 4JBFA 3LI8A 4GHIA 3RH8B 5TGFA 4KQOA 3EEAA 1FSWA 5EM0A 4LRYC 1AWIA 4JF6A 4CLCE 3LO7A 4GOGA 4B4ZA 4MDZA 1K6RA 2ZMAA 3F1NA 2ZMVA 1TD5A 4GCZA 2GX5A 1RP5A 2HDSA 2V1AA 1BULA 1YKDA 1T19A 3AGEA 4EEUA 4I3JA 4UA7A 5CEBA 4GS9B 2Z6CA 4DN0A 4OKPA 5IT5A 3IQAA 1G5UA 3G34A 1HD8A 2JKFA 5CTMA 1NYYA 2XA7M 1IELA 4IEDA 5IU1A 1NRFA 2PRFA 1LL5A 5G4ZA 1NYMA 3MFXA 3VE4A 5AQ7A 3DBAA 1PRQA 4KUKA 2ZC3B 1VETB 2XRNA 3UE1A 3ZVTA 1S4SA 5F1FA 4IJGA 3VSKA 3ITAA 2IA2A 3CPTB 5CHMA 1OJ5A 5HAPA 2GJ3A 5CXWA 3SW1A 2OOLA 3L9KA 5F69A 1S66L 2A24B 3EEHA 1PI4A 4II7A 1DP8A 1K4FA 1Q2PA 5FI6A 5GLDA 1PW1A 3A3IA 3MSHA 5EVIB 1MKIA 2Y2OA 2XDMA 3BW6A 2V0WA 3G32A 4EEPA 1BLPA 3C8CA 3UB6A 3BY8A 3NDEA 1OT6A 4DE3A 3IH8A 4HIAA 3Q7VA 3T4QA 3LIEA 1RGZA 2DRWA 3PTEA 3CZDA 1CEGA 4Q0JA 2PDRA 2J7VA 1OPXA 1ACFA 1E25A 2VV7A 3D9YA 4OOMA 4WUJA 1IFQA 3BECA 3N4IA 1PWDA 2OV5A 3UB5P 1I5QA 4UQIS 1ESIA 3N8SA 5AVFA 3RJUA 2O99A 2NUPC 3PYPA 4P0MA 4DE0A 2K31A 3IT9A 1BSGA 2WK0A 1XJ3A 1XJ2A 4KZ5A 4PM7A 1KGEA 1DY6A 3VFHA 2IWDA 4ETZA 3BQ8A 5HAQA 2VGLM 1OTEA 1LL9A 1MWSA 4S2NA 3T1RA 2P7JA 3M6BA 1TDGA 1NJ4A 5FQIA 2JCHA 1LSXA 1W79A 1HZOA 4LGWA 3SZTA 4DJ2A 1HVBA 5HX9A 2CC1A 2G2UA 3GRJA 5FSRA 1VQQA 1NZOA 2E8JA 4O0PA 3MFDA 4B88A 1I2SA 3M2JA 3B33A 3MR0A 3ULFA 1ZTUA 3Q81A 1DRMA 3T4TA 5JYOA 2QMIA 1W5DA 5HWWA 1XFNA 4S2LA 4X69A 3H7WB 4JF5A 3CITA 4QWOA 1U60A 1KOUA 2ZC6B 2JKGA 4NKPA 4G3VA 3EOIA 2ZM2A 1GA9A 4N9KA 1H8ZA 4XT2B 4R3BA 3FG8A 4GZBA 4EW7A 1PWCA 4ME4A 1JWPA 3R7WB 2D02A 3KSIA 1QMEA 4ZBEA 2R9XA 3LIBA 4UEYA 5FQMA 4FH2A 3HLEA 3C4OA 4R38A 3LYXA 2Y2PA 1ES2A 2M1CA 3H82B 3UB7A 3ZG8B 5F6AA 5EE8A 3C38A 3MZFA 1XX2A 3IXHA 4E6XA 4EETB 4XXRA 3VOLA 1GSXA 3IWQA 3JYIA 2XGNA 2ZMFA 3IF6B 3V3RA 4EESA 3P7NA 1YMSA 2W3DA 3IWOA 1ZC2A 3FWLA 3D4FA 1JNUA 4GKUA 4JLFA 3OZHA 3W4PA 3ZNYA 3DAVA 5DVAA 1H0MA 5AVEA 1H8YA 1TVFA 2Y91A 4PM9A 5CGXA 2ZQ8A 2OLUA 5I5LA 2XR0A 3CLOA 4KQQA 3NIAA 4KZ9A 3UB8A 2PYRA 4OQHA 1OTIA 2GNXA 3MJQA 1PZPA 2R78A 2C5WB 2Q0OA 4JKTA 3CJMA 2HPBA 4YNRA 3KYEA 4CLCB 4YFMA 2PT7A 4GB7A 4HP9A 1PWGA 4Q0IA 2PBYA 5DFXA 4Z9QA 2HJEA 4UA6A 2A2LA 3BQAA 1Z6FA 3W4OA 3N8LA 3EGDC 1MWRA 3ZFZA 5GLAA 3MZEA 4BD0A 2JN7A 3BEBA 3V50A 4H6JA 3K3DA 1Z09A 4OQIA 3HREA 4BBTA 2O0YA 4I3AA 5HDSA 3KSHA 5MC7A 1FILA 3LY3A 1IYQA 1AXBA 1F9IA 1ZG6A 4WL9A 4S2MA 1CQAA 4K08A 1K56D 4PM5A 1TS8A 4NXBA 5F82A 1QMFA 5FI2A 3QHYA 5FQQA 3BY9A 5EVEA 3MKEA 4IVIA 3LIDA 1BLHA 4N92A 5GHZA 2QKPA 5EUAA 4LFUA 3ZG5A 2QZ6A 5FQKA 3T4KA 2PYPA 3SOIA 3CUEA 5HDCA 4BQMA 4X53A 4X25A 4OLDA 2DMWA 5DKLA 1GHPA 3NULA 4QD4A 3H82A 3Q1FA 3V5MA 1FQGA 2HP6A 2WZXA 4PKYA 5I94A 3ITBA 4KG5A 4GHIB 4N1HA 2XK1A 4RX2A 1D7EA 2I72A 4S2KA 2JBFA 1KGGA 3A0SA 4R0QA 2Y59A 4JXWA 4DRTA 3CG5A 2KDKA 4DF6A 4E6WA 4UA9A 1S67L 4MNRA 1TS7A 3IX3A 4OOLA 1ESUA 2INWA 2JE5A 4K0WA 4MMNA 3B3XA 3NJAA 2WKIA 5LBRA 2J3WA 3OLOA 2ZJ9A 3FPVA 1PI5A 1K38A 4Y0OA 4ZJ3A 1M6KA 2XSSA 2L0WA 3PBSA 4FUWA 1EI5A 4NK3A 3IF6C 1ERMA 2V2FF 4DXCA 5HL1A 1K57A 3P01A 1KE4A 3PAGA 2M7UA 1EROA 5EECA 2H0YA 4C6YA 1F2KA 1F5MA 3KYQA 2EXAA 2VV8A 3KSGA 2Y2NA 3E4QA 4KENB 3T1XA 4S2IA 2JKRI 3GR2A 4EQ1A 3TW8A 2OAQ1
chains in the Genus database with same CATH topology
5F69A 1S66L 3LI9A 1XFQA 2A24B 2J3TD 3EEHA 4II7A 5TBMA 1DP8A 1V9YA 5F5YA 1VB6A 4HHDA 2CMNA 4I5SA 3U2AA 1D06A 1H3QA 4JGPA 3BW6A 2V0WA 4EEPA 4BMWA 4DMZA 3C8CA 2PD8A 3UB6A 2A24A 1P9RA 3BY8A 4UQIM 5HSQA 1XJ4A 1OT6A 2O9CA 5HZHA 5IS1A 1NRJA 4HIAA 5HL6A 3T4QA 3LIEA 1OTAA 3E0YA 4WN5A 3LR3A 4E04A 3JVUA 4JGQA 2MJ6A 1LL8A 5HWTA 4Q0JA 2W3GA 2PDRA 1OPXA 4GLQA 2JKTI 4LLOB 2VV7A 4PAUA 1IOUA 5F68A 5K5BA 1OJGA 4OOMA 3D72A 4NXEA 2JKTM 4WUJA 2W3FA 3UMEA 1IFQA 2P08A 3VV4A 3F1PB 2VX8A 3S7PA 1EW0A 2EWVA 4UQIS 4PHTA 2D01A 5AVFA 3EGXC 5DFYA 4G3KA 2O99A 2NUPC 3PYPA 4ZRRA 5A8BA 3RTYA 4Z1WA 2VKSA 2KX6A 2WKQA 3A0VA 4JGRA 1OT9A 2K31A 2Y79A 3O5YA 3CUEC 3NOPC 1XJ3A 1XJ2A 4MN5A 3F1PA 2GZAA 5HPIA 4AFIA 4ETZA 3CI6A 4HJ4A 3BQ8A 1MC0A 2NUTC 2VGLM 1DP9A 1OTEA 3FC7A 4G3WA 4Y5FA 3C30A 4GJ4A 2P7JA 4BWIA 3V67A 1LSXA 4I38A 3T50A 2K7SA 3VE3A 4ARZB 4DJ2A 4R6LA 3S7NA 4RQ9A 5C5KA 4DJ3A 2VV6A 1W63Q 4KUOA 1GSWA 2WKPA 3KX0X 4O0PA 4PKYG 2VGLS 3LUQA 3LIAA 1MZUA 3B33A 3MR0A 4HNBA 2K2NA 3ULFA 3LR4A 1ZTUA 3B42A 3PBRA 4ARZA 1DRMA 3PBQA 3T4TA 4EXOA 3T4SA 5KSHA 3C2WA 4ETXA 4L9FA 3PBTA 2QJ5A 3IS2B 5HWWA 1XFNA 5HWVA 1TS6A 3S7QA 3H7WB 5EFWA 2HJ9C 3CITA 3K2NA 5DJTA 1V9ZA 1KOUA 1N9OA 4JGOA 3OBFA 4NKPA 4G3VA 1Y28A 3EOIA 4MN6A 5CX7A 2W0NA 2Z6DA 4CQHA 3LIFA 3ICYA 1LSWA 3IS2A 4XT2B 1NLYA 2QYBA 4Y2FA 1MKMA 2L4RA 1UWPX 2QJ7A 3H7WA 3FG8A 4B9OA 3CAXA 4EW7A 4HI4A 4ME4A 4R70A 5L8MA 4CLCC 2QWSA 3R7WB 2D02A 3KSIA 4IUKA 3LIBA 2PR5A 3HCYA 4UEYA 3GECA 3LFVA 4WELA 2OAP1 3T4JA 4F3LB 2HGVA 4R38A 3LYXA 1P0ZA 3OCNA 4L0LA 3F1OB 4L9EA 4L9GA 4XT2A 1YAXA 3TE8A 3HJKA 2M1CA 3KO6A 1LSVA 2QHKA 1GSVA 3H82B 3OCLA 3UB7A 5F6AA 2P04A 1G28A 3A0RA 3C38A 3R7WA 2HV1A 3OC2A 3PR6A 2HF6A 4EETB 4F3LA 1TS0A 4HH2A 4O8GA 3F1OA 3VOLA 1GSXA 1WA9A 2FZ0A 2ZMFA 1VHMA 4WEJA 4EESA 3P7NA 4LRZE 4I39A 1S1YA 2W3DA 1P9WA 3BJNA 3NHQA 4Q0HA 3MQQA 4I3IA 1JNUA 3EQVA 2I9VA 2B02A 4M4XA 3R4KA 2PD7A 1STZA 3PBNA 3MMHA 1T1CA 5AJGA 3H9WA 3EWKA 5DJUA 3IBRA 3F1NB 2XROA 4GW9A 5AVEA 4B93A 4BJPA 4O01A 2W3HA 2O9BA 5I5LA 4R3AA 2EA9A 3UE6A 1S4RA 3LR5A 3CLOA 4KQDA 3E98A 4FSFA 3UB8A 2KLIA 2PYRA 4EU0A 3NOTC 4IUHA 1OTIA 2GNXA 3MJQA 4HJ3A 5DF9A 2R78A 1NWZA 2VEAA 4YNRA 4CLCB 2W27A 3S7OA 2OWHA 2H28A 4H6JB 5J7EA 2PT7A 3JVVA 1XJ6A 4HP9A 4Q0IA 5DFXA 1T18A 2HJEA 2A2LA 2V9AA 1N9NA 1UGUA 4P6ZM 1ODVA 3BQAA 2M7VA 4HJ6A 3EGDC 4CLCD 4HP4A 4HQAA 2YKFA 3GDIA 3FPWA 3KYZA 4Y3IA 4CLCA 2JN7A 4LRXC 4H6JA 2VA0A 3K3DA 1OTBA 4BBTA 5DKKA 3UB9A 2O0YA 4I3AA 5HDSA 3KSHA 3UE3A 5MC7A 1F9IA 1W63M 4LPZA 4WL9A 2PR6A 3PXPA 3ZYTA 2W1RA 4P6ZS 5J4EA 4K08A 3UMDA 3T4OA 3G6OA 1TS8A 1LT0A 4NXBA 4HH3A 2ZOHA 3IBJA 5G4YA 3BY9A 4WEKA 2V0UA 3LIDA 2ZOIA 2O9AA 2W1TB 2QKPA 4MCWA 2VJWA 1DP6A 3LICA 3T4KA 1H8MA 2PYPA 3E4PA 3CUEA 2ZBBA 5HDCA 3TRCA 2BASA 4QPRA 3W2ZA 2V1BA 2DMWA 5DKLA 3B47A 2B18A 4NEED 1TF1A 2W3EA 2W1TA 2YKHA 5HDDA 3H82A 2J3TC 3T4LA 4PKYA 3LR0A 5HD3A 2OWJA 3MF0A 3K3CA 4WF0A 3MXQA 4EUVA 4GHIB 3RFBA 2J80A 1UWNX 1YSPA 1D7EA 4WLAA 3A0SA 3ZQ5A 4HY8A 1N9LA 3E4OA 2VZWA 4EERA 4YWZA 5KIZA 4IHQA 4HOIA 5J3WA 4MN7A 2KDKA 1G6OA 3PHYA 3HJIA 5FL3A 2FH5A 1S67L 4YOFA 3EQUA 1NLZA 3LI8A 4GHIA 1TS7A 1T1AA 3RH8B 4OOLA 1ZHHB 1T1BA 4KQOA 2INWA 3EEAA 2PHYA 3D3OA 4LRYC 4MMNA 3NJAA 4CLCE 5LBRA 2G7UA 2LB9A 2LB5A 2J3WA 3PBOA 4MDZA 3F1NA 3FPVA 2Y8HA 3OLOA 2ZMVA 1TD5A 5TJJA 4GCZA 2GX5A 3BWLA 1X0OA 2L1MA 2V1AA 1YKDA 1T19A 2KOIA 4EEUA 5HPFA 4I3JA 3NOUC 4GS9B 2Z6CA 4DN0A 4NXFA 2XSSA 2L0WA 3PBSA 5IT5A 3KSFA 1OTDA 1S1ZA 4FOFA 3OOVA 1YSQA 4BBUA 2XA7M 5IU1A 3P01A 5HD5A 2EWWA 5G4ZA 4GS9A 3MQOA 3MFXA 2M7UA 2JHEA 3VE4A 3DBAA 1BYWA 4KUKA 1F5MA 3KYQA 2XRNA 2VV8A 2WKRA 3KSGA 4NXGA 1S4SA 3CWFA 1F98A 3E4QA 5TBMB 4IJGA 2JKRI 3MQ0A 2IA2A 1P97A 1OJ5A 4EQ1A 2GJ3A 3TW8A 2JKRM 4BBVA 3TJZC 3SW1A 2OAQ1 2XA7S 2OOLA 2VLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TF1 A;  2W3E A;  4O0P A;  2W1T A;  4GW9 A;  2XRO A;  4O01 A;  2K2N A;  2W3H A;  1ZTU A;  2O9B A;  5I5L A;  3MF0 A;  3C2W A;  4ETX A;  3E98 A;  4EUV A;  3RFB A;  2KLI A;  1YSP A;  3ZQ5 A;  4EU0 A;  2VZW A;  3S7Q A;  3NOT C;  4IUH A;  4DMZ A;  3K2N A;  3CIT A;  5HSQ A;  4MN7 A;  2O9C A;  3OBF A;  2VEA A;  4G3V A;  5HL6 A;  4YNR A;  3E0Y A;  4CQH A;  4E04 A;  3S7O A;  4YOF A;  4Q0I A;  5DFX A;  4Q0J A;  2W3G A;  2QYB A;  4Y2F A;  4GLQ A;  1MKM A;  4PAU A;  5K5B A;  3EEA A;  2M7V A;  3D3O A;  4LRY C;  4MMN A;  4ME4 A;  2G7U A;  5LBR A;  4R70 A;  2LB9 A;  5L8M A;  2LB5 A;  2W3F A;  4MDZ A;  3KSI A;  4IUK A;  2Y8H A;  1TD5 A;  4Y3I A;  3VV4 A;  3HCY A;  5TJJ A;  3LFV A;  3S7P A;  4LRX C;  2GX5 A;  2HGV A;  1YKD A;  2KOI A;  5HPF A;  3NOU C;  5DFY A;  3KO6 A;  4G3K A;  2O99 A;  2O0Y A;  4ZRR A;  4DN0 A;  3KSH A;  4Z1W A;  2XSS A;  2VKS A;  3KSF A;  2K31 A;  2Y79 A;  3O5Y A;  3NOP C;  4FOF A;  3OOV A;  2W1R A;  1YSQ A;  5HPI A;  4ETZ A;  3CI6 A;  4O8G A;  1MC0 A;  3G6O A;  2M7U A;  2ZMF A;  1VHM A;  4LRZ E;  3IBJ A;  4G3W A;  4Y5F A;  3DBA A;  2W3D A;  1F5M A;  3BJN A;  3NHQ A;  2XRN A;  3KSG A;  4BWI A;  2O9A A;  4Q0H A;  2W1T B;  4IJG A;  4MCW A;  2VJW A;  3MQ0 A;  2IA2 A;  3R4K A;  4R6L A;  1STZ A;  3S7N A;  3MMH A;  4RQ9 A;  5C5K A;  3TRC A;  5AJG A;  4QPR A;  3W2Z A;  2OOL A;  3IBR A;  2B18 A; 
#chains in the Genus database with same CATH topology
 2E8I A;  3LI9 A;  1XFQ A;  3DTE A;  1YT4 A;  3Q7V B;  4CJN A;  1DJA A;  1L0G A;  4HHD A;  4IBR A;  4ESP A;  4I5S A;  3VFF A;  3U2A A;  3C4P A;  1H3Q A;  1GHI A;  4BMW A;  4CPK A;  1ONH A;  2H0T A;  4UQI M;  4RA7 A;  3QP1 A;  1XJ4 A;  2O9C A;  5EVI D;  4EWF A;  3E0Y A;  4JGQ A;  4LV1 A;  2MJ6 A;  3ZG7 B;  4GDB A;  2W3G A;  5E43 A;  4GLQ A;  2JKT I;  3GVB A;  4OH0 A;  1K55 C;  2ZL1 A;  3D72 A;  4NXE A;  1KE3 A;  2AVX A;  1ERQ A;  3S7P A;  2EWV A;  3WS2 A;  3I7J A;  5FDH A;  1IYS A;  2D01 A;  3ZVW A;  3P09 A;  5DFY A;  1LLB A;  4G3K A;  2J9P A;  3ZHH A;  1CK3 A;  4WZ5 A;  2VKS A;  4NET A;  1VEU A;  4JGR A;  1NZU A;  1OT9 A;  3NOP C;  3IX4 A;  3GSG A;  4LCL A;  3NC8 A;  3CI6 A;  3PAE A;  4OP8 A;  4KZ3 A;  3FC7 A;  3C30 A;  4P6B A;  4BWI A;  3V67 A;  2V1Z A;  3NI9 A;  3ZG9 B;  4KG6 A;  3VSL A;  3BFD A;  3VE3 A;  3GV9 A;  2WYX A;  4R6L A;  3S7N A;  1ES4 A;  4RQ9 A;  5CEC A;  2Y2J A;  4DDY A;  5TR7 A;  1GSW A;  2WKP A;  3UE0 A;  1DJC A;  3TSG A;  1MPL A;  1YLJ A;  1SDE A;  1YLY A;  3HLB A;  2WUQ A;  4DKI A;  5FAP A;  3B42 A;  3PBQ A;  3T4S A;  1BTL A;  3ISG A;  5DF7 A;  5FI7 A;  4S2P A;  3S7Q A;  4MBF A;  2HJ9 C;  1V9Z A;  1K6S A;  1N9O A;  2ZM0 A;  1O7E A;  4N9L A;  5EOE A;  1Y28 A;  3QNC A;  3P98 A;  3QNB A;  2W0N A;  3LIF A;  5A90 A;  4EBN A;  3ICY A;  4KG2 A;  2FFY A;  3IHA A;  1NLY A;  5CHU A;  4Y2F A;  1MKM A;  2QJ7 A;  3UPN A;  3JPU A;  3UDI A;  1S0W A;  2BLS A;  3BLM A;  3G2Z A;  5A93 A;  4RYE A;  5FAO A;  4IVK A;  2QWS A;  2PR5 A;  3GEC A;  1XXM A;  2HGV A;  4HBT A;  4L9G A;  3M2K A;  3TE8 A;  2XFT A;  3KO6 A;  4XUX A;  1LSV A;  2QHK A;  3VMA A;  2ZLY A;  2P04 A;  4EBL A;  2WZZ A;  1YLT A;  4MLL A;  2HF6 A;  4KZ8 A;  1N4O A;  4HH2 A;  4O8G A;  5AQB A;  3FKW A;  2J9O A;  2XFS A;  3QP5 A;  4OOY A;  3EQV A;  2B02 A;  5KMW A;  3MMH A;  1T1C A;  3EWK A;  4KZ7 A;  4KZB A;  3IBR A;  1TEM A;  4HES A;  4BJP A;  3UPO A;  5E2E A;  4Y13 A;  1N9B A;  1JVJ A;  2PU2 A;  2O9B A;  2EA9 A;  4K91 A;  4FSF A;  1YLW A;  3BFG A;  3NOT C;  4IUH A;  5DF9 A;  3GTC A;  5A91 A;  2A49 A;  2VEA A;  1FOF A;  4BEN A;  2W27 A;  3S7O A;  4E3N A;  4H6J B;  1XJ6 A;  2Y2K A;  3G4P A;  1T18 A;  4OQG A;  2HZ5 A;  4GDN A;  1MWU A;  1N9N A;  1IEM A;  1XPB A;  2BTF P;  4KZA A;  4CLC D;  4HQA A;  4ZJ1 A;  2YKF A;  3FPW A;  3IH9 A;  4S2N C;  5J8X A;  4M3K A;  5DKK A;  1FCM A;  3UE3 A;  1E3U D;  5U47 A;  5A92 A;  3ZYT A;  5CGS A;  2P9V A;  5GHY A;  2PBD P;  5BOH A;  3UMD A;  2ZD8 A;  1JTG A;  1BUE A;  2ZOH A;  1M40 A;  3Q07 A;  2V0U A;  2ZOI A;  3MXS A;  5DF8 A;  3VP1 A;  4MCW A;  4BD1 A;  4EUZ A;  1DP6 A;  3LIC A;  1H8M A;  5FAS A;  2Y2I A;  4U3T A;  5KSC A;  3MS6 A;  1SKO A;  2BAS A;  3WRT A;  4QPR A;  3CHW P;  1K54 C;  2W3E A;  1DJB A;  2W1T A;  5E2F A;  2YKH A;  3LGO A;  1MWT A;  1K4E A;  4EBP A;  5L2F A;  2P74 A;  1LI9 A;  3LR0 A;  5HD3 A;  2OWJ A;  2UV0 E;  4A5R A;  1SDN A;  3RFB A;  3QP6 A;  1YSP A;  4WLA A;  4HY8 A;  1N9L A;  3E4O A;  1K25 A;  2VZW A;  4EER A;  4S2J A;  4GD6 A;  4YWZ A;  1JWV A;  4IHQ A;  4HOI A;  5J3W A;  5L10 A;  3WS0 A;  5EVI C;  3PHY A;  4YOF A;  3EQU A;  1NLZ A;  1HLU P;  2RCX A;  1T1A A;  5G18 A;  1ZHH B;  3SS4 A;  1T1B A;  1WYB A;  3QP4 A;  5HFO A;  2PHY A;  2GDN A;  5L09 A;  2G7U A;  2LB5 A;  3PBO A;  2Y8H A;  5TJJ A;  3LEZ A;  1ZG4 A;  4D60 A;  3BWL A;  1X0O A;  2FFF B;  2L1M A;  2KOI A;  3TOI A;  1C3B A;  3FKV A;  2H10 A;  3KSF A;  1PIO A;  4OP5 A;  1OTD A;  1S1Z A;  2XLN A;  1YSQ A;  3SH9 A;  5HD5 A;  1W8Y A;  2EWW A;  4BLM A;  3MQO A;  2JHE A;  1BYW A;  4S2O A;  5GLB A;  3DWK A;  2WKR A;  3IX8 A;  4B4X A;  3M6H A;  3UDX A;  3MQ0 A;  4C3Q A;  2HP5 A;  5FEF A;  4BBV A;  2JKR M;  1E4D A;  4F94 A;  4QJG A;  3LUQ A;  2Y4A A;  3HLD A;  2J3T D;  5TBM A;  5AQ9 A;  3NDG A;  2EXB A;  3BYD A;  5TFQ A;  1CI8 A;  1G6A A;  2ZC7 A;  4DMZ A;  2UWX A;  2ZL1 B;  4X55 A;  5IS1 A;  5HZH A;  2HDR A;  1ES5 A;  1OTA A;  1Q2Q A;  1YPR A;  4E04 A;  1LL8 A;  5HWT A;  1Y4O A;  4OQ0 A;  1YMX A;  5E2G A;  1PYY A;  1KE0 A;  2OSU A;  4QY5 A;  4PAU A;  1W7F A;  1IOU A;  4R4S A;  5F68 A;  4UAA A;  1OJG A;  1VEU B;  2JKT M;  2W3F A;  3UPP A;  3UME A;  2P08 A;  1CEF A;  3VV4 A;  2OLV A;  2VX8 A;  4PHT A;  4GN2 A;  4X1L A;  3EGX C;  1ONG A;  4OPZ A;  3FV7 A;  1RGY A;  3S4X A;  2Y79 A;  1RCJ A;  1BLS A;  1Y54 A;  3CUE C;  4MN5 A;  3O87 A;  2A3U A;  3F1P A;  3CMZ A;  3AGD A;  1MC0 A;  1JWZ A;  2EFX A;  5D3O A;  3WWX A;  1KDS A;  4GJ4 A;  4FCF A;  4E3J A;  5GL9 A;  2WGI A;  1FIK A;  2J8Y A;  3HLW A;  3ZGA B;  2K7S A;  4XUZ A;  2WGV A;  3HLC A;  2XEP A;  3HUM A;  2V20 A;  2Q9N A;  4EV4 A;  3U4L P;  1W63 Q;  1W8Q A;  4LCM A;  1GHM A;  1MZU A;  4HNB A;  1XP4 A;  1JTD A;  4WMC A;  3PBR A;  4ARZ A;  4EXO A;  4L9F A;  2QJ5 A;  2XH9 A;  4EQI A;  1L3L A;  4LV2 A;  1TS6 A;  1L2S A;  2ZQ9 A;  4QHC A;  5EFW A;  3S1Y A;  3BLS A;  5GHX A;  3OBF A;  4E3I A;  3HLF A;  4CQH A;  2Z6D A;  3ZG0 A;  1LSW A;  3IS2 A;  3NY4 A;  3VP2 A;  2QYB A;  2L4R A;  1UWP X;  4B9O A;  2DNS A;  3HBR A;  2BG1 A;  4HI4 A;  4CLC C;  5IHV A;  5EV0 A;  1K55 A;  4ZAM A;  3HCY A;  3VOY A;  4WEL A;  4WM9 A;  3OCN A;  1P0Z A;  1XGI A;  1CI9 A;  4L0L A;  1YLP A;  3HJK A;  5HAI A;  1FCO A;  1ES3 A;  4OON A;  3A0R A;  1YM1 A;  4F3L A;  1TS0 A;  3F1O A;  1I2W A;  1VHM A;  1CJF A;  1KDW A;  4LRZ E;  4JXV A;  4ZJ2 A;  3BJN A;  3NHQ A;  4Y0U A;  5L07 A;  4Y17 A;  1XA1 A;  2HP9 A;  4M4X A;  3R4K A;  2WKH A;  5EM1 A;  5AJG A;  5DTT A;  2PAV P;  1LI0 A;  5DJU A;  2XRO A;  4GW9 A;  1GA0 A;  5FQJ A;  1SKF A;  1XKZ A;  3OPL A;  2W3H A;  4PPR A;  3HVF A;  4R3A A;  3UE6 A;  1S4R A;  3LR5 A;  4KQD A;  3ZDJ A;  4X68 A;  1G68 A;  3IXB A;  2KLI A;  3OPP A;  3Q82 A;  1S6R A;  4MBH A;  5CTN A;  4N1X A;  2Z2L B;  5CER A;  3DTI A;  4WZ5 C;  2OWH A;  2H28 A;  4Q8I A;  2XD1 A;  2VGK A;  3GQZ A;  2V9A A;  3V3S A;  1ODV A;  2EX2 A;  4HJ6 A;  3LY4 A;  4HP4 A;  3HUO A;  2VGJ A;  3GDI A;  2QPN A;  4KQR A;  4GD8 A;  3IWI A;  4Y3I A;  3Q7Z A;  1MBL A;  2P9V B;  4WZ4 A;  2Y2G A;  3LEQ A;  2Y2Q A;  1XGJ A;  3S22 A;  1A0K A;  5E2H A;  4LPZ A;  3OPR A;  3UY6 A;  3T1Q B;  2W1R A;  4P6Z S;  1H5X A;  4UHU A;  3T4O A;  3G6O A;  4HH3 A;  2WGW A;  1K56 A;  3IBJ A;  1SKO B;  4HBU A;  4WEK A;  1L0F A;  1KVM A;  2O9A A;  2W1T B;  3LCE A;  5KZH A;  1NY0 A;  3WS1 A;  4NG2 A;  3A3D A;  2V1B A;  3W2Z A;  2B18 A;  2Y55 A;  4NEE D;  1TF1 A;  4IBX A;  2J3T C;  3A3E A;  4DDS A;  3O86 A;  2ZC5 B;  4P85 A;  4WF0 A;  2ZQA A;  4EUV A;  4WBG A;  1PZO A;  2J80 A;  1UWN X;  3ZQ5 A;  3RXX A;  5KIZ A;  5DTS A;  3L7H A;  4QY6 A;  2Z2M B;  1KGF A;  3D3O A;  4DXB A;  2G2W A;  3QP2 A;  2LB9 A;  2Y2L A;  5FAT A;  2ZM8 A;  3BFC A;  2EX8 A;  5CED A;  5HPF A;  2ACG A;  3NOU C;  3HLG A;  4NXF A;  2V8C A;  3O3V A;  3VP3 A;  5FQ9 A;  3UN7 A;  2XD5 A;  3HL9 A;  5EPH A;  4FOF A;  3OOV A;  4BBU A;  4OVD A;  2V8F A;  4OPY A;  4GS9 A;  4JPM A;  3N8R A;  4WMC D;  4R3J A;  4BL3 A;  3ZCZ A;  4NXG A;  3CWF A;  1F98 A;  2EX6 A;  4E3M A;  3T12 B;  5TBM B;  4KZ6 A;  4GNU A;  1BZA A;  1P97 A;  3FZC A;  4ID4 A;  3TJZ C;  4R4R A;  2XA7 S;  3A3F A;  2VLG A;  1VET A;  1TDL A;  1YLZ A;  3SH7 A;  4MEZ A;  1K54 A;  4C75 A;  4PMA A;  3N6I A;  4O7D A;  1V9Y A;  3CPT A;  3TG9 A;  5F5Y A;  1VB6 A;  5AQA A;  2DCF A;  4DE2 A;  3WRZ A;  2CMN A;  3C7U A;  4Y7P A;  1D06 A;  4JGP A;  3E2L A;  4R23 A;  1NXY A;  2HDU A;  2Y2M A;  3W8K A;  4Y15 A;  2PD8 A;  2A24 A;  1P9R A;  5HSQ A;  3UDF A;  1IKI A;  4LV0 A;  1NRJ A;  1YQS A;  5HL6 A;  4WN5 A;  3SS5 A;  3LR3 A;  3JVU A;  5EVI A;  3HUN A;  3DW0 A;  4PM6 A;  4LLO B;  5K5B A;  2C6W B;  2ZQC A;  3OPH A;  5F83 A;  3DWZ A;  4LV3 A;  1WYC A;  1ALQ A;  1BLC A;  3F1P B;  4JXG A;  4U0T A;  1EW0 A;  4E3L A;  3W4Q A;  2ZC4 B;  5A8B A;  4ZRR A;  3RTY A;  4Z1W A;  3A0V A;  2KX6 A;  2WKQ A;  4QU3 A;  2R9W A;  3O5Y A;  4D2O A;  2GZA A;  2Y2H A;  3QP8 A;  5HPI A;  4AFI A;  2B5R A;  4ZTK A;  4HJ4 A;  2VK3 A;  1O07 A;  2NUT C;  1DP9 A;  4KZ4 A;  3VP0 A;  4G3W A;  4Y5F A;  3VP4 A;  4X56 A;  4OLG A;  4I38 A;  3T50 A;  3NCK A;  3MXR A;  4R1G A;  4ARZ B;  3G30 A;  4E3K A;  3SH8 A;  5CHJ A;  4OPR A;  5C5K A;  4MBK A;  4DJ3 A;  5M18 A;  2RL3 A;  2VV6 A;  4KUO A;  3KX0 X;  2WKE A;  4PKY G;  2VGL S;  3GMW A;  1PNE A;  3LIA A;  2XQZ A;  1VM1 A;  2K2N A;  3LR4 A;  4JXS A;  5KSH A;  3C2W A;  4ETX A;  3VOZ A;  3PBT A;  3IS2 B;  2ZQD A;  3BFE A;  1FCN A;  5HWV A;  1OME A;  3K2N A;  5DJT A;  2H5S A;  4JGO A;  1LHY A;  4QB8 A;  5DTK A;  1J9M A;  1CF0 A;  4MN6 A;  2EFU A;  2PU4 A;  5CX7 A;  3UO9 A;  2X02 A;  5HW3 A;  3UNW A;  3T1S A;  4U0X A;  3DTM A;  3H7W A;  3CAX A;  5M19 A;  1J3W A;  4FH4 A;  4R70 A;  5L8M A;  3A3J A;  3WS5 A;  4IUK A;  1IKG A;  3IHB A;  3LFV A;  2OAP 1;  4FTX A;  3T4J A;  2ZQ7 A;  4F3L B;  4XT2 A;  4PM8 A;  1MXO A;  3F1O B;  4L9E A;  1YAX A;  1GSV A;  1HTZ A;  3WS4 A;  3OCL A;  3MBZ A;  1G28 A;  2WAF A;  3R7W A;  2HV1 A;  3OC2 A;  3PR6 A;  1EWZ A;  1PFL A;  1D1J A;  1L0D A;  4DE1 A;  1WA9 A;  2FZ0 A;  3SS3 A;  3MZD A;  4WEJ A;  4I39 A;  1S1Y A;  1WE4 A;  1P9W A;  3BM6 A;  1KVL A;  2X01 A;  5FEG A;  1IYP A;  4Q0H A;  3MQQ A;  1XA7 A;  4I3I A;  2I9V A;  1PW8 A;  2PD7 A;  3IF6 A;  1STZ A;  3PBN A;  5GLC A;  3G2Y A;  3H9W A;  2JC7 A;  3G35 A;  3F1N B;  4B93 A;  4O01 A;  1MY8 A;  3E2K A;  3N7W A;  3E98 A;  4RVA A;  4EU0 A;  3C7V A;  4ZDX A;  3IF5 A;  1SCW A;  1SHV A;  5FA7 A;  4HJ3 A;  5FAQ A;  4LEN A;  3BRM A;  2IWB A;  1NWZ A;  1BT5 A;  1FR1 A;  4WYY A;  1SZV A;  4P87 A;  5J7E A;  3FYZ A;  3JVV A;  1ZKJ A;  3G31 A;  2IWC A;  4E3O A;  1UGU A;  4P6Z M;  5F1G A;  2M7V A;  4FD8 A;  3IXG A;  2EX9 A;  1IYO A;  5HAR A;  3KYZ A;  4CLC A;  4LRX C;  1L0E A;  2VA0 A;  1OTB A;  4RX3 A;  3UB9 A;  2WGW B;  4BL2 A;  3NEC A;  1W63 M;  1E3U A;  4X6T A;  1K57 C;  2PR6 A;  4H8R A;  5JYP A;  3C5A A;  3O88 A;  3PXP A;  5J4E A;  2HDQ A;  3AGF A;  1LT0 A;  2Q9M A;  5M1A A;  5G4Y A;  1FR6 A;  3BFF A;  4K0X A;  5EOO A;  2WAE A;  2VJW A;  4Y0T A;  3E4P A;  5CRF A;  2ZBB A;  3TRC A;  3RXW A;  2X71 A;  5EVL A;  1GCE A;  3B47 A;  5CGW A;  5HDD A;  1K0K A;  3T4L A;  3V39 A;  3MF0 A;  4JF4 A;  3DTK A;  3K3C A;  3MXQ A;  5FDS A;  2XF3 A;  3IXD A;  3ZNT A;  3NBL A;  4OPQ A;  2WAD A;  4HEF A;  2B95 A;  4MN7 A;  1G6O A;  1FSY A;  4X1M A;  3HJI A;  5FL3 A;  4YIN A;  2FH5 A;  3MKF A;  4JBF A;  3LI8 A;  4GHI A;  3RH8 B;  5TGF A;  4KQO A;  3EEA A;  1FSW A;  5EM0 A;  4LRY C;  1AWI A;  4JF6 A;  4CLC E;  3LO7 A;  4GOG A;  4B4Z A;  4MDZ A;  1K6R A;  2ZMA A;  3F1N A;  2ZMV A;  1TD5 A;  4GCZ A;  2GX5 A;  1RP5 A;  2HDS A;  2V1A A;  1BUL A;  1YKD A;  1T19 A;  3AGE A;  4EEU A;  4I3J A;  4UA7 A;  5CEB A;  4GS9 B;  2Z6C A;  4DN0 A;  4OKP A;  5IT5 A;  3IQA A;  1G5U A;  3G34 A;  1HD8 A;  2JKF A;  5CTM A;  1NYY A;  2XA7 M;  1IEL A;  4IED A;  5IU1 A;  1NRF A;  2PRF A;  1LL5 A;  5G4Z A;  1NYM A;  3MFX A;  3VE4 A;  5AQ7 A;  3DBA A;  1PRQ A;  4KUK A;  2ZC3 B;  1VET B;  2XRN A;  3UE1 A;  3ZVT A;  1S4S A;  5F1F A;  4IJG A;  3VSK A;  3ITA A;  2IA2 A;  3CPT B;  5CHM A;  1OJ5 A;  5HAP A;  2GJ3 A;  5CXW A;  3SW1 A;  2OOL A;  3L9K A;  5F69 A;  1S66 L;  2A24 B;  3EEH A;  1PI4 A;  4II7 A;  1DP8 A;  1K4F A;  1Q2P A;  5FI6 A;  5GLD A;  1PW1 A;  3A3I A;  3MSH A;  5EVI B;  1MKI A;  2Y2O A;  2XDM A;  3BW6 A;  2V0W A;  3G32 A;  4EEP A;  1BLP A;  3C8C A;  3UB6 A;  3BY8 A;  3NDE A;  1OT6 A;  4DE3 A;  3IH8 A;  4HIA A;  3Q7V A;  3T4Q A;  3LIE A;  1RGZ A;  2DRW A;  3PTE A;  3CZD A;  1CEG A;  4Q0J A;  2PDR A;  2J7V A;  1OPX A;  1ACF A;  1E25 A;  2VV7 A;  3D9Y A;  4OOM A;  4WUJ A;  1IFQ A;  3BEC A;  3N4I A;  1PWD A;  2OV5 A;  3UB5 P;  1I5Q A;  4UQI S;  1ESI A;  3N8S A;  5AVF A;  3RJU A;  2O99 A;  2NUP C;  3PYP A;  4P0M A;  4DE0 A;  2K31 A;  3IT9 A;  1BSG A;  2WK0 A;  1XJ3 A;  1XJ2 A;  4KZ5 A;  4PM7 A;  1KGE A;  1DY6 A;  3VFH A;  2IWD A;  4ETZ A;  3BQ8 A;  5HAQ A;  2VGL M;  1OTE A;  1LL9 A;  1MWS A;  4S2N A;  3T1R A;  2P7J A;  3M6B A;  1TDG A;  1NJ4 A;  5FQI A;  2JCH A;  1LSX A;  1W79 A;  1HZO A;  4LGW A;  3SZT A;  4DJ2 A;  1HVB A;  5HX9 A;  2CC1 A;  2G2U A;  3GRJ A;  5FSR A;  1VQQ A;  1NZO A;  2E8J A;  4O0P A;  3MFD A;  4B88 A;  1I2S A;  3M2J A;  3B33 A;  3MR0 A;  3ULF A;  1ZTU A;  3Q81 A;  1DRM A;  3T4T A;  5JYO A;  2QMI A;  1W5D A;  5HWW A;  1XFN A;  4S2L A;  4X69 A;  3H7W B;  4JF5 A;  3CIT A;  4QWO A;  1U60 A;  1KOU A;  2ZC6 B;  2JKG A;  4NKP A;  4G3V A;  3EOI A;  2ZM2 A;  1GA9 A;  4N9K A;  1H8Z A;  4XT2 B;  4R3B A;  3FG8 A;  4GZB A;  4EW7 A;  1PWC A;  4ME4 A;  1JWP A;  3R7W B;  2D02 A;  3KSI A;  1QME A;  4ZBE A;  2R9X A;  3LIB A;  4UEY A;  5FQM A;  4FH2 A;  3HLE A;  3C4O A;  4R38 A;  3LYX A;  2Y2P A;  1ES2 A;  2M1C A;  3H82 B;  3UB7 A;  3ZG8 B;  5F6A A;  5EE8 A;  3C38 A;  3MZF A;  1XX2 A;  3IXH A;  4E6X A;  4EET B;  4XXR A;  3VOL A;  1GSX A;  3IWQ A;  3JYI A;  2XGN A;  2ZMF A;  3IF6 B;  3V3R A;  4EES A;  3P7N A;  1YMS A;  2W3D A;  3IWO A;  1ZC2 A;  3FWL A;  3D4F A;  1JNU A;  4GKU A;  4JLF A;  3OZH A;  3W4P A;  3ZNY A;  3DAV A;  5DVA A;  1H0M A;  5AVE A;  1H8Y A;  1TVF A;  2Y91 A;  4PM9 A;  5CGX A;  2ZQ8 A;  2OLU A;  5I5L A;  2XR0 A;  3CLO A;  4KQQ A;  3NIA A;  4KZ9 A;  3UB8 A;  2PYR A;  4OQH A;  1OTI A;  2GNX A;  3MJQ A;  1PZP A;  2R78 A;  2C5W B;  2Q0O A;  4JKT A;  3CJM A;  2HPB A;  4YNR A;  3KYE A;  4CLC B;  4YFM A;  2PT7 A;  4GB7 A;  4HP9 A;  1PWG A;  4Q0I A;  2PBY A;  5DFX A;  4Z9Q A;  2HJE A;  4UA6 A;  2A2L A;  3BQA A;  1Z6F A;  3W4O A;  3N8L A;  3EGD C;  1MWR A;  3ZFZ A;  5GLA A;  3MZE A;  4BD0 A;  2JN7 A;  3BEB A;  3V50 A;  4H6J A;  3K3D A;  1Z09 A;  4OQI A;  3HRE A;  4BBT A;  2O0Y A;  4I3A A;  5HDS A;  3KSH A;  5MC7 A;  1FIL A;  3LY3 A;  1IYQ A;  1AXB A;  1F9I A;  1ZG6 A;  4WL9 A;  4S2M A;  1CQA A;  4K08 A;  1K56 D;  4PM5 A;  1TS8 A;  4NXB A;  5F82 A;  1QMF A;  5FI2 A;  3QHY A;  5FQQ A;  3BY9 A;  5EVE A;  3MKE A;  4IVI A;  3LID A;  1BLH A;  4N92 A;  5GHZ A;  2QKP A;  5EUA A;  4LFU A;  3ZG5 A;  2QZ6 A;  5FQK A;  3T4K A;  2PYP A;  3SOI A;  3CUE A;  5HDC A;  4BQM A;  4X53 A;  4X25 A;  4OLD A;  2DMW A;  5DKL A;  1GHP A;  3NUL A;  4QD4 A;  3H82 A;  3Q1F A;  3V5M A;  1FQG A;  2HP6 A;  2WZX A;  4PKY A;  5I94 A;  3ITB A;  4KG5 A;  4GHI B;  4N1H A;  2XK1 A;  4RX2 A;  1D7E A;  2I72 A;  4S2K A;  2JBF A;  1KGG A;  3A0S A;  4R0Q A;  2Y59 A;  4JXW A;  4DRT A;  3CG5 A;  2KDK A;  4DF6 A;  4E6W A;  4UA9 A;  1S67 L;  4MNR A;  1TS7 A;  3IX3 A;  4OOL A;  1ESU A;  2INW A;  2JE5 A;  4K0W A;  4MMN A;  3B3X A;  3NJA A;  2WKI A;  5LBR A;  2J3W A;  3OLO A;  2ZJ9 A;  3FPV A;  1PI5 A;  1K38 A;  4Y0O A;  4ZJ3 A;  1M6K A;  2XSS A;  2L0W A;  3PBS A;  4FUW A;  1EI5 A;  4NK3 A;  3IF6 C;  1ERM A;  2V2F F;  4DXC A;  5HL1 A;  1K57 A;  3P01 A;  1KE4 A;  3PAG A;  2M7U A;  1ERO A;  5EEC A;  2H0Y A;  4C6Y A;  1F2K A;  1F5M A;  3KYQ A;  2EXA A;  2VV8 A;  3KSG A;  2Y2N A;  3E4Q A;  4KEN B;  3T1X A;  4S2I A;  2JKR I;  3GR2 A;  4EQ1 A;  3TW8 A;  2OAQ 1; 
#chains in the Genus database with same CATH homology
 5F69 A;  1S66 L;  3LI9 A;  1XFQ A;  2A24 B;  2J3T D;  3EEH A;  4II7 A;  5TBM A;  1DP8 A;  1V9Y A;  5F5Y A;  1VB6 A;  4HHD A;  2CMN A;  4I5S A;  3U2A A;  1D06 A;  1H3Q A;  4JGP A;  3BW6 A;  2V0W A;  4EEP A;  4BMW A;  4DMZ A;  3C8C A;  2PD8 A;  3UB6 A;  2A24 A;  1P9R A;  3BY8 A;  4UQI M;  5HSQ A;  1XJ4 A;  1OT6 A;  2O9C A;  5HZH A;  5IS1 A;  1NRJ A;  4HIA A;  5HL6 A;  3T4Q A;  3LIE A;  1OTA A;  3E0Y A;  4WN5 A;  3LR3 A;  4E04 A;  3JVU A;  4JGQ A;  2MJ6 A;  1LL8 A;  5HWT A;  4Q0J A;  2W3G A;  2PDR A;  1OPX A;  4GLQ A;  2JKT I;  4LLO B;  2VV7 A;  4PAU A;  1IOU A;  5F68 A;  5K5B A;  1OJG A;  4OOM A;  3D72 A;  4NXE A;  2JKT M;  4WUJ A;  2W3F A;  3UME A;  1IFQ A;  2P08 A;  3VV4 A;  3F1P B;  2VX8 A;  3S7P A;  1EW0 A;  2EWV A;  4UQI S;  4PHT A;  2D01 A;  5AVF A;  3EGX C;  5DFY A;  4G3K A;  2O99 A;  2NUP C;  3PYP A;  4ZRR A;  5A8B A;  3RTY A;  4Z1W A;  2VKS A;  2KX6 A;  2WKQ A;  3A0V A;  4JGR A;  1OT9 A;  2K31 A;  2Y79 A;  3O5Y A;  3CUE C;  3NOP C;  1XJ3 A;  1XJ2 A;  4MN5 A;  3F1P A;  2GZA A;  5HPI A;  4AFI A;  4ETZ A;  3CI6 A;  4HJ4 A;  3BQ8 A;  1MC0 A;  2NUT C;  2VGL M;  1DP9 A;  1OTE A;  3FC7 A;  4G3W A;  4Y5F A;  3C30 A;  4GJ4 A;  2P7J A;  4BWI A;  3V67 A;  1LSX A;  4I38 A;  3T50 A;  2K7S A;  3VE3 A;  4ARZ B;  4DJ2 A;  4R6L A;  3S7N A;  4RQ9 A;  5C5K A;  4DJ3 A;  2VV6 A;  1W63 Q;  4KUO A;  1GSW A;  2WKP A;  3KX0 X;  4O0P A;  4PKY G;  2VGL S;  3LUQ A;  3LIA A;  1MZU A;  3B33 A;  3MR0 A;  4HNB A;  2K2N A;  3ULF A;  3LR4 A;  1ZTU A;  3B42 A;  3PBR A;  4ARZ A;  1DRM A;  3PBQ A;  3T4T A;  4EXO A;  3T4S A;  5KSH A;  3C2W A;  4ETX A;  4L9F A;  3PBT A;  2QJ5 A;  3IS2 B;  5HWW A;  1XFN A;  5HWV A;  1TS6 A;  3S7Q A;  3H7W B;  5EFW A;  2HJ9 C;  3CIT A;  3K2N A;  5DJT A;  1V9Z A;  1KOU A;  1N9O A;  4JGO A;  3OBF A;  4NKP A;  4G3V A;  1Y28 A;  3EOI A;  4MN6 A;  5CX7 A;  2W0N A;  2Z6D A;  4CQH A;  3LIF A;  3ICY A;  1LSW A;  3IS2 A;  4XT2 B;  1NLY A;  2QYB A;  4Y2F A;  1MKM A;  2L4R A;  1UWP X;  2QJ7 A;  3H7W A;  3FG8 A;  4B9O A;  3CAX A;  4EW7 A;  4HI4 A;  4ME4 A;  4R70 A;  5L8M A;  4CLC C;  2QWS A;  3R7W B;  2D02 A;  3KSI A;  4IUK A;  3LIB A;  2PR5 A;  3HCY A;  4UEY A;  3GEC A;  3LFV A;  4WEL A;  2OAP 1;  3T4J A;  4F3L B;  2HGV A;  4R38 A;  3LYX A;  1P0Z A;  3OCN A;  4L0L A;  3F1O B;  4L9E A;  4L9G A;  4XT2 A;  1YAX A;  3TE8 A;  3HJK A;  2M1C A;  3KO6 A;  1LSV A;  2QHK A;  1GSV A;  3H82 B;  3OCL A;  3UB7 A;  5F6A A;  2P04 A;  1G28 A;  3A0R A;  3C38 A;  3R7W A;  2HV1 A;  3OC2 A;  3PR6 A;  2HF6 A;  4EET B;  4F3L A;  1TS0 A;  4HH2 A;  4O8G A;  3F1O A;  3VOL A;  1GSX A;  1WA9 A;  2FZ0 A;  2ZMF A;  1VHM A;  4WEJ A;  4EES A;  3P7N A;  4LRZ E;  4I39 A;  1S1Y A;  2W3D A;  1P9W A;  3BJN A;  3NHQ A;  4Q0H A;  3MQQ A;  4I3I A;  1JNU A;  3EQV A;  2I9V A;  2B02 A;  4M4X A;  3R4K A;  2PD7 A;  1STZ A;  3PBN A;  3MMH A;  1T1C A;  5AJG A;  3H9W A;  3EWK A;  5DJU A;  3IBR A;  3F1N B;  2XRO A;  4GW9 A;  5AVE A;  4B93 A;  4BJP A;  4O01 A;  2W3H A;  2O9B A;  5I5L A;  4R3A A;  2EA9 A;  3UE6 A;  1S4R A;  3LR5 A;  3CLO A;  4KQD A;  3E98 A;  4FSF A;  3UB8 A;  2KLI A;  2PYR A;  4EU0 A;  3NOT C;  4IUH A;  1OTI A;  2GNX A;  3MJQ A;  4HJ3 A;  5DF9 A;  2R78 A;  1NWZ A;  2VEA A;  4YNR A;  4CLC B;  2W27 A;  3S7O A;  2OWH A;  2H28 A;  4H6J B;  5J7E A;  2PT7 A;  3JVV A;  1XJ6 A;  4HP9 A;  4Q0I A;  5DFX A;  1T18 A;  2HJE A;  2A2L A;  2V9A A;  1N9N A;  1UGU A;  4P6Z M;  1ODV A;  3BQA A;  2M7V A;  4HJ6 A;  3EGD C;  4CLC D;  4HP4 A;  4HQA A;  2YKF A;  3GDI A;  3FPW A;  3KYZ A;  4Y3I A;  4CLC A;  2JN7 A;  4LRX C;  4H6J A;  2VA0 A;  3K3D A;  1OTB A;  4BBT A;  5DKK A;  3UB9 A;  2O0Y A;  4I3A A;  5HDS A;  3KSH A;  3UE3 A;  5MC7 A;  1F9I A;  1W63 M;  4LPZ A;  4WL9 A;  2PR6 A;  3PXP A;  3ZYT A;  2W1R A;  4P6Z S;  5J4E A;  4K08 A;  3UMD A;  3T4O A;  3G6O A;  1TS8 A;  1LT0 A;  4NXB A;  4HH3 A;  2ZOH A;  3IBJ A;  5G4Y A;  3BY9 A;  4WEK A;  2V0U A;  3LID A;  2ZOI A;  2O9A A;  2W1T B;  2QKP A;  4MCW A;  2VJW A;  1DP6 A;  3LIC A;  3T4K A;  1H8M A;  2PYP A;  3E4P A;  3CUE A;  2ZBB A;  5HDC A;  3TRC A;  2BAS A;  4QPR A;  3W2Z A;  2V1B A;  2DMW A;  5DKL A;  3B47 A;  2B18 A;  4NEE D;  1TF1 A;  2W3E A;  2W1T A;  2YKH A;  5HDD A;  3H82 A;  2J3T C;  3T4L A;  4PKY A;  3LR0 A;  5HD3 A;  2OWJ A;  3MF0 A;  3K3C A;  4WF0 A;  3MXQ A;  4EUV A;  4GHI B;  3RFB A;  2J80 A;  1UWN X;  1YSP A;  1D7E A;  4WLA A;  3A0S A;  3ZQ5 A;  4HY8 A;  1N9L A;  3E4O A;  2VZW A;  4EER A;  4YWZ A;  5KIZ A;  4IHQ A;  4HOI A;  5J3W A;  4MN7 A;  2KDK A;  1G6O A;  3PHY A;  3HJI A;  5FL3 A;  2FH5 A;  1S67 L;  4YOF A;  3EQU A;  1NLZ A;  3LI8 A;  4GHI A;  1TS7 A;  1T1A A;  3RH8 B;  4OOL A;  1ZHH B;  1T1B A;  4KQO A;  2INW A;  3EEA A;  2PHY A;  3D3O A;  4LRY C;  4MMN A;  3NJA A;  4CLC E;  5LBR A;  2G7U A;  2LB9 A;  2LB5 A;  2J3W A;  3PBO A;  4MDZ A;  3F1N A;  3FPV A;  2Y8H A;  3OLO A;  2ZMV A;  1TD5 A;  5TJJ A;  4GCZ A;  2GX5 A;  3BWL A;  1X0O A;  2L1M A;  2V1A A;  1YKD A;  1T19 A;  2KOI A;  4EEU A;  5HPF A;  4I3J A;  3NOU C;  4GS9 B;  2Z6C A;  4DN0 A;  4NXF A;  2XSS A;  2L0W A;  3PBS A;  5IT5 A;  3KSF A;  1OTD A;  1S1Z A;  4FOF A;  3OOV A;  1YSQ A;  4BBU A;  2XA7 M;  5IU1 A;  3P01 A;  5HD5 A;  2EWW A;  5G4Z A;  4GS9 A;  3MQO A;  3MFX A;  2M7U A;  2JHE A;  3VE4 A;  3DBA A;  1BYW A;  4KUK A;  1F5M A;  3KYQ A;  2XRN A;  2VV8 A;  2WKR A;  3KSG A;  4NXG A;  1S4S A;  3CWF A;  1F98 A;  3E4Q A;  5TBM B;  4IJG A;  2JKR I;  3MQ0 A;  2IA2 A;  1P97 A;  1OJ5 A;  4EQ1 A;  2GJ3 A;  3TW8 A;  2JKR M;  4BBV A;  3TJZ C;  3SW1 A;  2OAQ 1;  2XA7 S;  2OOL A;  2VLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...