4B93A

Complex of vamp7 cytoplasmic domain with 2nd ankyrin repeat domain of varp
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
157
Chain Sequence
SMAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFSFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Binding of Varp to Vamp7 Traps Vamp7 in a Closed, Fusogenically Inactive Conformation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Exocytosis
molecule keywords VESICLE-ASSOCIATED MEMBRANE PROTEIN 7
total genus 48
structure length 157
sequence length 164
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4b93A00
1IFQA 2NUPC 2NUTC 2VX8A 4AFIA 3KYQA 3EGDC 1IOUA 4B93A 1H8MA 3BW6A 3EGXC 2DMWA
chains in the Genus database with same CATH superfamily
3W4QA 4GDBA 1IKGA 3ITBA 5TBMA 4HP4A 3C38A 3WWXA 3MJQA 1IYPA 2QJ5A 3W4OA 2W3FA 1VQQA 3WS1A 1OMEA 5FQKA 3ZG5A 1S66L 3SS5A 3ZG9B 1OT6A 2VK3A 5A93A 3WS2A 2JKTM 3AGFA 2Y55A 3VFHA 2EFUA 4E3NA 3G35A 3T4SA 4UQIS 1T19A 2WYXA 4QU3A 1YLWA 1AXBA 3C30A 1EI5A 1YLZA 1ZHHB 5EV0A 3NI9A 1CI8A 3PAGA 4KQOA 4Y13A 1G6OA 5KMWA 2V1BA 4HBTA 4BL3A 4JGRA 3ZYTA 4DE2A 3BY8A 1VM1A 3QP1A 4JXVA 2J3TD 3LEQA 5FAPA 1HZOA 3S4XA 3T4OA 3HVFA 5M18A 3PXPA 4IJGA 3MXSA 5CTMA 4KG2A 3IBRA 3K3DA 2ZMAA 1FCNA 2JHEA 1RGZA 3UPPA 3UB9A 4IBRA 4ZDXA 4GZBA 3S7OA 4B4ZA 5E43A 2JN7A 1I2WA 5D3OA 3SZTA 4LV0A 3VFFA 4DE1A 5L07A 1K56D 4ZJ1A 3MZDA 2HDSA 3KSIA 2P04A 4ESPA 2GDNA 1H0MA 3SS3A 5DVAA 3M6HA 4WYYA 2HDUA 5CXWA 2B02A 3HLFA 1XGJA 3OBFA 2WZZA 5GLBA 2HV1A 3LFVA 1PWGA 4MEZA 4E3LA 1DJCA 1S6RA 2XDMA 4L9GA 2ZM8A 3HBRA 4DJ3A 1MWTA 4Z1WA 2BG1A 2EX2A 4EXOA 2H5SA 2VA0A 3BFCA 3P01A 2H10A 4BBVA 2ZM2A 2W1TA 5GL9A 1Q2PA 4QB8A 4KZAA 4OQIA 2Y2HA 2PBDP 1K57C 5CX7A 2INWA 3LEZA 4OPRA 3T12B 3Q81A 3WRTA 1L0FA 4NK3A 4D60A 1NLYA 1QMFA 4KUKA 2VLGA 1NRFA 4P87A 4BMWA 3NDGA 1K6RA 5FDSA 4HY8A 3Q7ZA 1XJ2A 5FQIA 1FCMA 3BJNA 4CLCA 1PWDA 5MC7A 4OLGA 5EVIB 2HP6A 3IXGA 3ITAA 3ZCZA 2Y2QA 5EVIC 1OTIA 2EWVA 1C3BA 2J3TC 1RGYA 1KE3A 4U3TA 5LBRA 1FCOA 2DNSA 2WAFA 4I3JA 4CPKA 2ZBBA 3MQ0A 3UPOA 3KX0X 3Q1FA 1LSXA 3IX3A 1LI0A 3F1OB 1RCJA 4GS9B 4PPRA 1K4FA 2ZL1A 1ZG4A 3EGDC 4RQ9A 5AVEA 1L3LA 5CGXA 5EPHA 3UE0A 3HLDA 1KE0A 2V1ZA 3LR5A 4YFMA 2W3DA 4LCLA 2KOIA 2VJWA 1BULA 1I2SA 3UE6A 1K55A 3H7WA 1VETB 3AGDA 3IS2B 5HDSA 1F5MA 3F1PA 3OLOA 4H6JB 2V2FF 4JGPA 3CMZA 3MMHA 1S4SA 4M4XA 5E2FA 4GD8A 3OPPA 1FR1A 1N9LA 2Y2IA 1NY0A 4WEJA 3MF0A 2JKTI 2JC7A 1FSYA 4R23A 5IU1A 4OH0A 1OJGA 3BYDA 2VGLS 4S2PA 3HJKA 4JKTA 3DAVA 4WEKA 1H8MA 4HH3A 1V9ZA 3FYZA 2Y8HA 3MR0A 2J9OA 2WKQA 3CAXA 3BW6A 4PM5A 2G2UA 3OOVA 2P08A 4PHTA 1WYBA 2CC1A 3GQZA 5TJJA 4EESA 5TGFA 4RVAA 1BUEA 2VX8A 3PBTA 1LLBA 4BBUA 3LO7A 3VP2A 3T1SA 5EUAA 1IELA 1KGFA 3HLCA 1VEUB 4R3JA 1PYYA 2M1CA 3LR0A 3BY9A 3D72A 5KSHA 4R0QA 2ZC3B 3DTIA 1NZOA 2R78A 3ICYA 5HWVA 4KZBA 4RX2A 4BQMA 4JGQA 3KO6A 1TF1A 3DTMA 2PD8A 4B93A 1X0OA 3LYXA 5HPIA 3UN7A 3TSGA 4MN5A 2V0WA 4HQAA 3R7WA 4L0LA 1CEGA 3PBOA 4EBNA 3CUEC 4KQRA 4XUZA 3JVVA 3P09A 1IKIA 3FC7A 3GVBA 1ONHA 1IYOA 3IF6C 1JWPA 2ZQAA 1CQAA 4EEUA 4E3OA 4S2NA 4WN5A 2KLIA 4K91A 4EQ1A 3PBQA 3ZG8B 3G4PA 2A2LA 2XA7M 4KG5A 5FA7A 5JYOA 4IUKA 1PI4A 4QD4A 1EWZA 4ARZB 4JPMA 4YNRA 1OTBA 2ZJ9A 4N9KA 4X55A 2GZAA 5CRFA 1Z09A 1SKOA 3R4KA 3IX4A 5F83A 1T1AA 2JE5A 2G7UA 5F82A 3CLOA 4EEPA 4MNRA 2XFSA 1Y28A 2PBYA 1K4EA 1ALQA 2ZC7A 1YQSA 1L0DA 3NC8A 2HP5A 5G4YA 1STZA 2XD5A 4KZ7A 4BD0A 2Y79A 1TD5A 3H7WB 3VE4A 5CEDA 4GB7A 1H5XA 3IS2A 3P7NA 2WKEA 4KQQA 4DKIA 1T1BA 3V3SA 3EWKA 3PYPA 1YKDA 2K31A 3MZFA 4Y17A 2L0WA 5HZHA 2WZXA 1N9BA 1SDEA 3M2KA 2WGWB 2W1RA 2IA2A 2Q0OA 4PM9A 2YKHA 3D3OA 3VOYA 5FQQA 1CEFA 5CEBA 4M3KA 4WZ5A 2WKHA 3S7QA 3VP4A 4NXFA 3Q82A 1K0KA 2Y2JA 4JXWA 2XGNA 3E4QA 3FKVA 5FI2A 3GV9A 1TVFA 3QNBA 5TBMB 3MSHA 3BFGA 2EWWA 3BLSA 4QJGA 3M2JA 1K56A 1MWUA 5GHXA 2JCHA 4Y0UA 5KSCA 3PBRA 2UV0E 5HAIA 3FG8A 4Y15A 3OPHA 1G5UA 5HWTA 2W3GA 1HLUP 1XA7A 1F9IA 2JBFA 4NXEA 1K38A 4FH4A 3RXWA 4A5RA 4S2KA 2VV7A 4LFUA 4UA6A 3QP2A 4EU0A 3N8SA 4C3QA 5I94A 3NULA 3OPRA 4EBLA 2AVXA 3C2WA 2EXAA 1SHVA 4X53A 4HI4A 2ZMVA 1H8YA 4BWIA 2QYBA 2H0TA 2JKRM 4RYEA 2WKIA 2OLUA 1A0KA 1DY6A 3T4JA 3R7WB 5CECA 1PWCA 3JVUA 2X02A 5FAOA 5FSRA 1GHIA 4X56A 2WK0A 1CF0A 5FQMA 2OLVA 5M1AA 3LUQA 3LIBA 4I3IA 1DRMA 2W0NA 1UWNX 4Y0TA 4O01A 1JWVA 4LRXC 4DMZA 1GSVA 1ES3A 2FZ0A 3KSHA 5AQBA 1ZC2A 2XR0A 4KZ8A 2IWBA 4G3VA 3RXXA 5DKKA 3EQUA 1W63Q 3MXRA 2B95A 2Y2PA 3NOPC 1S67L 4LPZA 3GR2A 2Y2GA 4HEFA 4R70A 4EW7A 4ARZA 3VMAA 2OV5A 1S4RA 4WZ5C 1SCWA 4DXCA 1KDWA 1YT4A 2A24A 4Y0OA 4RX3A 1SKOB 1BSGA 3BRMA 4IEDA 2DCFA 1H8ZA 5A91A 2ZQ9A 3M6BA 3S1YA 2HJ9C 5HL6A 1YAXA 5DTTA 1XJ4A 2G2WA 2XQZA 1AWIA 1MZUA 1ES4A 1DP8A 1GA0A 4DE3A 2IWDA 4KZ9A 1K55C 4G3KA 1GHPA 3DW0A 1XJ6A 2WGIA 3NOUC 3V50A 3E98A 3B33A 4GDNA 3UDFA 2XK1A 3LR3A 3NECA 4LLOB 5F69A 3NOTC 3RH8B 1GCEA 3ZHHA 1U60A 3LR4A 2W1TB 4Q8IA 3HUMA 2V8CA 1F2KA 3GRJA 2ZQ8A 2QJ7A 4FOFA 2J7VA 2ZC6B 5F5YA 2HDQA 4I5SA 2PR5A 5FI6A 4K0WA 1W8YA 1XGIA 1ES5A 3GECA 5HX9A 2PU4A 1HVBA 4CLCE 4OONA 4OP5A 1P9WA 4KUOA 5EVIA 4HIAA 1DJAA 2D01A 1K6SA 4MBHA 3NHQA 4KG6A 5AJGA 1W63M 1TDLA 4E3JA 2IWCA 1YLTA 1K54C 3WS0A 4CLCC 3B42A 2R9WA 5CTNA 1K54A 5AQ7A 5AVFA 1P0ZA 1NWZA 4PKYG 4XT2A 1BLCA 5A8BA 4R6LA 2QWSA 3CZDA 4H8RA 3WRZA 1KDSA 4KQDA 5J4EA 3JYIA 5HD3A 5M19A 3E4PA 2Z2LB 2HPBA 1ES2A 4N9LA 4UEYA 2ZQCA 1TS8A 3LI8A 4GS9A 3O87A 4OP8A 1D06A 4JF6A 2WADA 1NYMA 1MY8A 2M7UA 1LHYA 2O9BA 2PR6A 4PM7A 4WMCD 1W79A 1IFQA 1MBLA 3ZVWA 1S1YA 3N4IA 3BFEA 1W5DA 2Y2OA 3LGOA 5L09A 1LL9A 3ZG0A 4I39A 5A90A 1VETA 4IVIA 1ESIA 5E2GA 1DP6A 1Y4OA 2P7JA 1CJFA 1IOUA 1T18A 2O0YA 2EX6A 1HTZA 3DWKA 3AGEA 5HAQA 4PM8A 3HUOA 5E2HA 1KOUA 2V20A 2Y59A 3HREA 5FEGA 1Q2QA 1OPXA 4JF4A 2BTFP 4GJ4A 1S0WA 3CWFA 5EECA 3L9KA 4JXGA 3VP0A 2NUPC 4E3IA 4KZ3A 4BENA 3W4PA 2A24B 3A3DA 2UWXA 4HH2A 4UHUA 4IVKA 2KDKA 1TS6A 4FCFA 1ESUA 1PZOA 2EX9A 2RL3A 2CMNA 3PHYA 3ULFA 3RFBA 4MBFA 2XA7S 4QWOA 2JKGA 3O86A 4QPRA 2O9AA 1YSQA 3LIEA 4BBTA 3IWIA 4S2NC 4LRZE 3C7VA 3IXBA 4GHIA 1VEUA 4U0XA 5HL1A 4WELA 1W8QA 5CGWA 5GHYA 3E2KA 1NXYA 3IF6A 3A3FA 2QHKA 3LIDA 5EM0A 3BFFA 5A92A 2GX5A 1LL5A 3SH9A 5C5KA 1D7EA 4QY6A 3G34A 4PMAA 5TFQA 4DRTA 2FFFB 4OOMA 5HFOA 5GHZA 1JNUA 2EA9A 1LSWA 5CHMA 3UDXA 1N9NA 4P6ZS 3EQVA 3QP6A 5DTSA 2QZ6A 3QNCA 3KYZA 3U2AA 4PM6A 3LCEA 1NRJA 2PHYA 5GLDA 1GHMA 5EOEA 5HSQA 3JPUA 2ZC5B 2FH5A 4IBXA 3V39A 3Q07A 1BT5A 1PW1A 4GKUA 2P9VA 4QHCA 4HNBA 1FIKA 2L4RA 5IT5A 1YMSA 1YLYA 3P98A 3FPWA 5K5BA 5DKLA 4ZTKA 5KIZA 4HJ6A 4NETA 3N8RA 4JGOA 3PR6A 3WS5A 3B47A 1PNEA 4F94A 5FI7A 3PBNA 4OQGA 1KE4A 2HJEA 5F1GA 4PAUA 2LB9A 4P0MA 3MFXA 4WF0A 3KSFA 2WAEA 3UDIA 3SW1A 5FATA 3T1QB 1FQGA 4E6WA 1MWRA 2XROA 2H0YA 5HPFA 3T50A 3DTEA 4F3LA 3D9YA 1WE4A 4Y5FA 3EOIA 1GSWA 3HUNA 3N8LA 2V9AA 4BJPA 2W3HA 5DFYA 3IBJA 3QHYA 2ZOHA 1VHMA 2W3EA 1ZKJA 2K7SA 5J3WA 5L8MA 2WGWA 1E3UD 1LI9A 3KSGA 4GD6A 3SOIA 1NZUA 2Y2LA 3C8CA 5EVEA 2YKFA 4B4XA 4O7DA 1MXOA 2Z2MB 3BQAA 5GLCA 4R3BA 2OSUA 1NYYA 4CQHA 1PW8A 5U47A 3UB5P 1WYCA 4HHDA 3S7NA 1OTAA 4WL9A 4QY5A 3FPVA 3O88A 3ZQ5A 1I5QA 5DFXA 3MQOA 3S22A 3MQQA 4P6ZM 3TE8A 3NY4A 4LV3A 4P6BA 2E8JA 4AFIA 4LENA 3NCKA 1OJ5A 4DDSA 2E8IA 4FH2A 4Q0IA 2ZC4B 4Y7PA 2Z6CA 1H3QA 1BLSA 4ETXA 3IF6B 2VKSA 4MMNA 1LT0A 5FQ9A 4ME4A 4ZJ2A 3SH7A 3F1NA 4JLFA 4OPZA 1QMEA 2WGVA 2PYPA 3NJAA 3DWZA 5HDDA 3CG5A 3KYEA 1YSPA 3CUEA 3Q7VA 3OC2A 1SZVA 4YINA 3UY6A 5KZHA 4FSFA 1XFQA 4UAAA 3H9WA 4R1GA 4WLAA 5CHJA 2PYRA 3PTEA 4DE0A 3S7PA 1BLHA 4DXBA 3MFDA 3MBZA 4Q0JA 1JVJA 4UA7A 3IH8A 3HLEA 2JKRI 3OCNA 3ISGA 4S2LA 2J3WA 1FR6A 3W8KA 3ZNYA 3FV7A 2W27A 3H82B 1PI5A 1TS0A 1YLJA 1G6AA 4KZ5A 2PRFA 2JKFA 4HJ4A 2OOLA 3TRCA 3K2NA 3GSGA 4OQ0A 1TDGA 3UMDA 2GNXA 1XP4A 3VP1A 1DJBA 3E4OA 5EVLA 4I38A 1E4DA 3MXQA 4WBGA 4MCWA 3EEHA 3BEBA 4BD1A 3CJMA 3C5AA 3CHWP 2OWHA 3OCLA 3G32A 4G3WA 1DP9A 4HOIA 3V67A 1EROA 5FDHA 1SKFA 3EGXC 2ZMFA 4FUWA 4MDZA 3K3CA 3UPNA 4R3AA 4MLLA 3CPTB 2Y4AA 3IXHA 5F68A 2HZ5A 3IQAA 3NDEA 3NBLA 2RCXA 2Y91A 1MWSA 3GMWA 4O0PA 2K2NA 2V8FA 1NJ4A 1P9RA 2QMIA 4CJNA 1RP5A 5AQ9A 3UNWA 3ZFZA 1CI9A 1XX2A 1T1CA 3UMEA 4EERA 4FD8A 3HJIA 4KZ6A 5CHUA 4EWFA 4ZJ3A 3HLWA 3ZVTA 1E3UA 3W2ZA 5F1FA 1M6KA 5IHVA 4EUZA 3UE1A 3VSKA 1G28A 2QKPA 2XRNA 5CGSA 1K25A 3SH8A 5G4ZA 1UWPX 1BYWA 2D02A 4B88A 2ZLYA 4X68A 5EE8A 4OOYA 3UB7A 4WZ4A 5HARA 4D2OA 3IF5A 2Z6DA 3G31A 3FWLA 5L2FA 1NLZA 4XT2B 4NG2A 2B5RA 3V5MA 5EM1A 3BM6A 4S2IA 2XSSA 4LGWA 3F1NB 2HP9A 2PU2A 3T4LA 1V9YA 3ZGAB 1VB6A 3QP4A 1D1JA 4BLMA 3Q7VB 2OAP1 3MZEA 5FEFA 3T4KA 2VGKA 5AQAA 3FZCA 4E04A 2O99A 1G68A 3UE3A 1KGEA 2Y2NA 4JF5A 4ZAMA 4R4SA 2Q9MA 2PT7A 4BL2A 2MJ6A 4X25A 4CLCD 2M7VA 3QP5A 3BFDA 1MKMA 4OPQA 1ONGA 2XF3A 4OLDA 1IYSA 2Y2MA 3UB6A 3PAEA 4KENB 4EQIA 1KVMA 4EUVA 5DTKA 4O8GA 4N1HA 1IYQA 2Q9NA 2ZQDA 5EVID 2FFYA 4Y3IA 4MN6A 1PFLA 1XKZA 2V1AA 4DDYA 3U4LP 1OT9A 4Y2FA 2KX6A 2PDRA 3E0YA 4E3KA 3DTKA 3VOZA 3VE3A 4LV1A 4NEED 2WKRA 5FAQA 5DF9A 4GN2A 3ZNTA 4S2JA 1BTLA 4GW9A 3B3XA 4LV2A 1N4OA 1J9MA 4EBPA 2VGLM 3GDIA 4CLCB 4NKPA 1TS7A 5DF8A 4GHIB 2ZQ7A 3VOLA 2WUQA 1Y54A 4MN7A 4RA7A 4P85A 1XFNA 4JBFA 3OPLA 2XFTA 3CPTA 4I3AA 1M40A 4X1LA 4UA9A 5I5LA 1JTDA 1W7FA 2BASA 3V3RA 2ACGA 3N6IA 4OQHA 3IXDA 3I7JA 3SS4A 4WMCA 2X71A 5F6AA 5L10A 4XUXA 1O7EA 1E25A 4ETZA 1J3WA 1GA9A 1EW0A 3A0SA 2WKPA 1P97A 3A0RA 1YMXA 3F1OA 4N92A 3GTCA 3IHAA 1ZTUA 1PIOA 2ZL1B 2XEPA 1HD8A 4KZ4A 3C7UA 4Q0HA 1ODVA 4X69A 4LRYC 3ZG7B 2NUTC 3G2ZA 5HWWA 1OTDA 3FKWA 2I72A 4ZRRA 4L9EA 3HLBA 2P9VB 4L9FA 2VZWA 3OZHA 5J8XA 3A3IA 4XXRA 3QP8A 5FQJA 4ZBEA 3F1PB 4DF6A 3RJUA 2LB5A 3T1RA 1BLPA 4H6JA 4EETB 1PRQA 3LIAA 3D4FA 1JTGA 2VV6A 3PBSA 2X01A 2EFXA 5EOOA 2HGVA 4R38A 1TEMA 2PAVP 2H28A 1IEMA 2C6WB 5HW3A 4E6XA 2XLNA 4UQIM 4FTXA 1K57A 1XXMA 5DJUA 3IT9A 5E2EA 4LCMA 3NIAA 2OWJA 4YOFA 3BQ8A 5HDCA 3UO9A 1FOFA 4HP9A 3BWLA 3A0VA 5GLAA 2XD1A 4GOGA 5FASA 4F3LB 3WS4A 5TR7A 1YPRA 5DF7A 4JXSA 5IS1A 4OKPA 1XJ3A 1Z6FA 4WUJA 1OTEA 1UGUA 3LIFA 2OAQ1 4X1MA 2I9VA 5G18A 4NXGA 3LI9A 4HJ3A 3VV4A 1MC0A 1MPLA 4U0TA 1XA1A 1JWZA 4EV4A 2HDRA 4IUHA 1XPBA 2A3UA 3MKEA 4OVDA 2GJ3A 2XH9A 2DRWA 1L0GA 2ZOIA 2QPNA 1KVLA 5HAPA 4N1XA 4GNUA 1YM1A 4DN0A 2ZM0A 3HLGA 4OPYA 3C4OA 3BLMA 2V0UA 3O3VA 2DMWA 1O07A 1ACFA 5HD5A 3O5YA 3T4QA 3CITA 3LY4A 5JYPA 2VGJA 3E2LA 3TG9A 5CERA 3G6OA 3C4PA 4NXBA 3IHBA 1PZPA 3N7WA 4DJ2A 3MKFA 4HESA 3G2YA 4X6TA 3CI6A 2A49A 3A3EA 4WM9A 4HBUA 3IH9A 4MBKA 1CK3A 2C5WB 3IX8A 3LICA 5J7EA 3HL9A 3TOIA 4C75A 1LL8A 4C6YA 2EXBA 1BZAA 3RTYA 2O9CA 1ERMA 3LY3A 1L2SA 3TW8A 3IWOA 2PD7A 2HF6A 5EFWA 2VEAA 2EX8A 3VP3A 3H82A 1LSVA 2R9XA 4K0XA 1L0EA 2J8YA 1GSXA 1KGGA 2ZD8A 1F98A 2J80A 3T1XA 3IWQA 1ZG6A 2BLSA 5DJTA 1WA9A 4B9OA 3VSLA 3UB8A 4Z9QA 2J9PA 4GCZA 4ID4A 4E3MA 2Y2KA 2L1MA 1FILA 3G30A 4II7A 3L7HA 4R4RA 5BOHA 4GLQA 4OOLA 1ERQA 3BECA 1S1ZA 1FSWA 1SDNA 2B18A 1MKIA 1N9OA 1YLPA 2P74A 2VV8A 3KYQA 3TJZC 3T4TA 3EEAA 3HCYA 3DBAA 4YWZA 3A3JA 3MS6A 4S2OA 4PKYA 4IHQA 4S2MA 3ZDJA 5FL3A 4K08A
chains in the Genus database with same CATH topology
4QPRA 3T4LA 2O9AA 1V9YA 1OTBA 1YSQA 3LIEA 5TBMA 4BBTA 4HP4A 3C38A 1VB6A 4LRZE 2GZAA 4GHIA 3MJQA 2QJ5A 4WELA 2OAP1 2W3FA 3R4KA 1T1AA 2G7UA 1S66L 3CLOA 2QHKA 4EEPA 1OT6A 3LIDA 1Y28A 3T4KA 2GX5A 2JKTM 5C5KA 4E04A 1D7EA 2O99A 3UE3A 3T4SA 5G4YA 1STZA 4UQIS 4OOMA 1JNUA 2Y79A 1T19A 2EA9A 1TD5A 2PT7A 1LSWA 3H7WB 2MJ6A 3C30A 3VE4A 4CLCD 2M7VA 1N9NA 4P6ZS 3EQVA 1ZHHB 3IS2A 3P7NA 1MKMA 4KQOA 1G6OA 1T1BA 3EWKA 3KYZA 3U2AA 2V1BA 3PYPA 3UB6A 4JGRA 3ZYTA 1YKDA 2K31A 3BY8A 4EUVA 1NRJA 2L0WA 2PHYA 5HZHA 4O8GA 5HSQA 2J3TD 2W1RA 4Y3IA 4MN6A 2IA2A 2FH5A 2V1AA 1OT9A 4Y2FA 3T4OA 2YKHA 3D3OA 3PXPA 2KX6A 4IJGA 2PDRA 3E0YA 3VE3A 3IBRA 3K3DA 2JHEA 4HNBA 2L4RA 4NEED 2WKRA 3S7QA 5IT5A 5DF9A 4NXFA 3UB9A 3FPWA 5K5BA 4GW9A 5DKLA 5KIZA 3E4QA 3S7OA 4HJ6A 2JN7A 2VGLM 5TBMB 3GDIA 4CLCB 4NKPA 2EWWA 1TS7A 4GHIB 3VOLA 4JGOA 3PR6A 3B47A 4MN7A 3KSIA 3PBRA 1XFNA 2P04A 3PBNA 3FG8A 4I3AA 2HJEA 5I5LA 4PAUA 5HWTA 2LB9A 2W3GA 3MFXA 4WF0A 1F9IA 3KSFA 2BASA 4NXEA 3SW1A 2B02A 2VV7A 4EU0A 3OBFA 2XROA 3C2WA 5F6AA 2HV1A 5HPFA 3T50A 3LFVA 4F3LA 4HI4A 4ETZA 2ZMVA 4Y5FA 3EOIA 1EW0A 1GSWA 3A0SA 2WKPA 4BWIA 1P97A 2QYBA 3A0RA 2JKRM 4L9GA 2V9AA 3F1OA 4BJPA 4DJ3A 2W3HA 5DFYA 3IBJA 1ZTUA 2ZOHA 4Z1WA 3T4JA 3R7WB 1VHMA 4Q0HA 2W3EA 1ODVA 2K7SA 3JVUA 4EXOA 2VA0A 5J3WA 3P01A 5L8MA 3KSGA 4LRYC 4BBVA 2NUTC 2W1TA 5HWWA 1OTDA 3C8CA 4ZRRA 4L9EA 5CX7A 2YKFA 2INWA 3LUQA 3LIBA 4I3IA 4L9FA 2VZWA 1DRMA 3BQAA 2W0NA 1UWNX 4O01A 1NLYA 4CQHA 4LRXC 4DMZA 1GSVA 4KUKA 2VLGA 3F1PB 2FZ0A 4HHDA 3S7NA 3KSHA 2LB5A 4H6JA 1OTAA 4BMWA 4EETB 4WL9A 4G3VA 3FPVA 4HY8A 3LIAA 5DKKA 1XJ2A 3ZQ5A 5DFXA 3EQUA 1W63Q 3NOPC 1S67L 2VV6A 3BJNA 4LPZA 3MQOA 4R70A 4CLCA 3PBSA 4ARZA 3MQQA 4EW7A 5MC7A 2HGVA 4P6ZM 4R38A 3TE8A 2H28A 1S4RA 4AFIA 1OJ5A 2A24A 4UQIM 4Q0IA 5DJUA 2Z6CA 1H3QA 1OTIA 2EWVA 4ETXA 2OWJA 2J3TC 2VKSA 4MMNA 1LT0A 4YOFA 4ME4A 3BQ8A 2HJ9C 5HL6A 5HDCA 1YAXA 3F1NA 1XJ4A 4HP9A 5LBRA 3BWLA 3A0VA 1MZUA 1DP8A 2PYPA 3NJAA 4I3JA 5HDDA 4F3LB 2ZBBA 3MQ0A 3KX0X 1YSPA 3CUEA 1LSXA 3OC2A 4G3KA 3F1OB 1XJ6A 4FSFA 4GS9B 1XFQA 5IS1A 3NOUC 1XJ3A 3E98A 3H9WA 4WUJA 3B33A 1OTEA 4WLAA 1UGUA 3LIFA 2OAQ1 3EGDC 2PYRA 4RQ9A 2I9VA 5AVEA 3S7PA 3LR3A 4LLOB 5F69A 3NOTC 3LR5A 3RH8B 4NXGA 3LR4A 2W1TB 3LI9A 4Q0JA 2W3DA 4HJ3A 3VV4A 2KOIA 2VJWA 2JKRI 3OCNA 1MC0A 3UE6A 2QJ7A 4FOFA 2J3WA 3H7WA 5F5YA 4I5SA 4IUHA 2PR5A 3IS2B 5HDSA 1F5MA 3F1PA 3OLOA 2W27A 3H82B 4H6JB 4JGPA 1TS0A 2GJ3A 3GECA 2ZOIA 4CLCE 4HJ4A 2OOLA 3MMHA 1S4SA 4M4XA 3TRCA 3K2NA 1P9WA 4KUOA 3UMDA 4DN0A 2GNXA 4HIAA 1N9LA 3E4OA 4I38A 2D01A 2V0UA 3NHQA 4WEJA 5AJGA 1W63M 2JKTI 3MF0A 3MXQA 2DMWA 4MCWA 5IU1A 3EEHA 5HD5A 4CLCC 1OJGA 3O5YA 2VGLS 3B42A 3T4QA 3CITA 1P0ZA 3HJKA 5AVFA 1NWZA 2OWHA 3OCLA 4G3WA 4WEKA 1H8MA 4HH3A 1DP9A 1V9ZA 4PKYG 4XT2A 3G6OA 4HOIA 5A8BA 4R6LA 4NXBA 3V67A 2Y8HA 3MR0A 2WKQA 3CAXA 3BW6A 2QWSA 3EGXC 4KQDA 4DJ2A 5J4EA 2ZMFA 3OOVA 2P08A 4PHTA 5HD3A 4MDZA 3E4PA 3K3CA 4R3AA 4UEYA 5TJJA 4EESA 3CI6A 1TS8A 3LI8A 2VX8A 4GS9A 3PBTA 4BBUA 1D06A 5F68A 2M7UA 2O9BA 2M1CA 2PR6A 3LICA 3LR0A 3BY9A 5J7EA 1IFQA 3D72A 5KSHA 1S1YA 4O0PA 1LL8A 2K2NA 1P9RA 2R78A 3RTYA 2O9CA 3TW8A 4I39A 3ICYA 5HWVA 2PD7A 1T1CA 2HF6A 5EFWA 3UMEA 4EERA 2VEAA 4JGQA 3HJIA 3KO6A 1TF1A 2PD8A 4B93A 1DP6A 1X0OA 3H82A 3LYXA 5HPIA 1LSVA 2P7JA 3W2ZA 1IOUA 4MN5A 1T18A 2V0WA 1GSXA 4HQAA 3R7WA 2O0YA 4L0LA 1F98A 2J80A 3PBOA 1G28A 3CUEC 5DJTA 2QKPA 1KOUA 2XRNA 1WA9A 4B9OA 3JVVA 3UB8A 3FC7A 5G4ZA 1UWPX 4GCZA 1BYWA 1OPXA 2D02A 2L1MA 4GJ4A 3CWFA 4II7A 2NUPC 4EEUA 3UB7A 4WN5A 4GLQA 2KLIA 4OOLA 2A24B 4HH2A 4EQ1A 3PBQA 2A2LA 2XA7M 2KDKA 1TS6A 2Z6DA 1NLZA 1S1ZA 4XT2B 2B18A 3KYQA 1N9OA 2VV8A 4IUKA 3TJZC 3T4TA 3EEAA 3HCYA 3DBAA 4YWZA 4ARZB 2XSSA 3PHYA 2CMNA 3ULFA 3RFBA 2XA7S 4PKYA 4IHQA 3F1NB 5FL3A 4K08A 4YNRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFQ A;  2NUP C;  2NUT C;  2VX8 A;  4AFI A;  3KYQ A;  3EGD C;  1IOU A;  4B93 A;  1H8M A;  3BW6 A;  3EGX C;  2DMW A; 
#chains in the Genus database with same CATH topology
 3W4Q A;  4GDB A;  1IKG A;  3ITB A;  5TBM A;  4HP4 A;  3C38 A;  3WWX A;  3MJQ A;  1IYP A;  2QJ5 A;  3W4O A;  2W3F A;  1VQQ A;  3WS1 A;  1OME A;  5FQK A;  3ZG5 A;  1S66 L;  3SS5 A;  3ZG9 B;  1OT6 A;  2VK3 A;  5A93 A;  3WS2 A;  2JKT M;  3AGF A;  2Y55 A;  3VFH A;  2EFU A;  4E3N A;  3G35 A;  3T4S A;  4UQI S;  1T19 A;  2WYX A;  4QU3 A;  1YLW A;  1AXB A;  3C30 A;  1EI5 A;  1YLZ A;  1ZHH B;  5EV0 A;  3NI9 A;  1CI8 A;  3PAG A;  4KQO A;  4Y13 A;  1G6O A;  5KMW A;  2V1B A;  4HBT A;  4BL3 A;  4JGR A;  3ZYT A;  4DE2 A;  3BY8 A;  1VM1 A;  3QP1 A;  4JXV A;  2J3T D;  3LEQ A;  5FAP A;  1HZO A;  3S4X A;  3T4O A;  3HVF A;  5M18 A;  3PXP A;  4IJG A;  3MXS A;  5CTM A;  4KG2 A;  3IBR A;  3K3D A;  2ZMA A;  1FCN A;  2JHE A;  1RGZ A;  3UPP A;  3UB9 A;  4IBR A;  4ZDX A;  4GZB A;  3S7O A;  4B4Z A;  5E43 A;  2JN7 A;  1I2W A;  5D3O A;  3SZT A;  4LV0 A;  3VFF A;  4DE1 A;  5L07 A;  1K56 D;  4ZJ1 A;  3MZD A;  2HDS A;  3KSI A;  2P04 A;  4ESP A;  2GDN A;  1H0M A;  3SS3 A;  5DVA A;  3M6H A;  4WYY A;  2HDU A;  5CXW A;  2B02 A;  3HLF A;  1XGJ A;  3OBF A;  2WZZ A;  5GLB A;  2HV1 A;  3LFV A;  1PWG A;  4MEZ A;  4E3L A;  1DJC A;  1S6R A;  2XDM A;  4L9G A;  2ZM8 A;  3HBR A;  4DJ3 A;  1MWT A;  4Z1W A;  2BG1 A;  2EX2 A;  4EXO A;  2H5S A;  2VA0 A;  3BFC A;  3P01 A;  2H10 A;  4BBV A;  2ZM2 A;  2W1T A;  5GL9 A;  1Q2P A;  4QB8 A;  4KZA A;  4OQI A;  2Y2H A;  2PBD P;  1K57 C;  5CX7 A;  2INW A;  3LEZ A;  4OPR A;  3T12 B;  3Q81 A;  3WRT A;  1L0F A;  4NK3 A;  4D60 A;  1NLY A;  1QMF A;  4KUK A;  2VLG A;  1NRF A;  4P87 A;  4BMW A;  3NDG A;  1K6R A;  5FDS A;  4HY8 A;  3Q7Z A;  1XJ2 A;  5FQI A;  1FCM A;  3BJN A;  4CLC A;  1PWD A;  5MC7 A;  4OLG A;  5EVI B;  2HP6 A;  3IXG A;  3ITA A;  3ZCZ A;  2Y2Q A;  5EVI C;  1OTI A;  2EWV A;  1C3B A;  2J3T C;  1RGY A;  1KE3 A;  4U3T A;  5LBR A;  1FCO A;  2DNS A;  2WAF A;  4I3J A;  4CPK A;  2ZBB A;  3MQ0 A;  3UPO A;  3KX0 X;  3Q1F A;  1LSX A;  3IX3 A;  1LI0 A;  3F1O B;  1RCJ A;  4GS9 B;  4PPR A;  1K4F A;  2ZL1 A;  1ZG4 A;  3EGD C;  4RQ9 A;  5AVE A;  1L3L A;  5CGX A;  5EPH A;  3UE0 A;  3HLD A;  1KE0 A;  2V1Z A;  3LR5 A;  4YFM A;  2W3D A;  4LCL A;  2KOI A;  2VJW A;  1BUL A;  1I2S A;  3UE6 A;  1K55 A;  3H7W A;  1VET B;  3AGD A;  3IS2 B;  5HDS A;  1F5M A;  3F1P A;  3OLO A;  4H6J B;  2V2F F;  4JGP A;  3CMZ A;  3MMH A;  1S4S A;  4M4X A;  5E2F A;  4GD8 A;  3OPP A;  1FR1 A;  1N9L A;  2Y2I A;  1NY0 A;  4WEJ A;  3MF0 A;  2JKT I;  2JC7 A;  1FSY A;  4R23 A;  5IU1 A;  4OH0 A;  1OJG A;  3BYD A;  2VGL S;  4S2P A;  3HJK A;  4JKT A;  3DAV A;  4WEK A;  1H8M A;  4HH3 A;  1V9Z A;  3FYZ A;  2Y8H A;  3MR0 A;  2J9O A;  2WKQ A;  3CAX A;  3BW6 A;  4PM5 A;  2G2U A;  3OOV A;  2P08 A;  4PHT A;  1WYB A;  2CC1 A;  3GQZ A;  5TJJ A;  4EES A;  5TGF A;  4RVA A;  1BUE A;  2VX8 A;  3PBT A;  1LLB A;  4BBU A;  3LO7 A;  3VP2 A;  3T1S A;  5EUA A;  1IEL A;  1KGF A;  3HLC A;  1VEU B;  4R3J A;  1PYY A;  2M1C A;  3LR0 A;  3BY9 A;  3D72 A;  5KSH A;  4R0Q A;  2ZC3 B;  3DTI A;  1NZO A;  2R78 A;  3ICY A;  5HWV A;  4KZB A;  4RX2 A;  4BQM A;  4JGQ A;  3KO6 A;  1TF1 A;  3DTM A;  2PD8 A;  4B93 A;  1X0O A;  3LYX A;  5HPI A;  3UN7 A;  3TSG A;  4MN5 A;  2V0W A;  4HQA A;  3R7W A;  4L0L A;  1CEG A;  3PBO A;  4EBN A;  3CUE C;  4KQR A;  4XUZ A;  3JVV A;  3P09 A;  1IKI A;  3FC7 A;  3GVB A;  1ONH A;  1IYO A;  3IF6 C;  1JWP A;  2ZQA A;  1CQA A;  4EEU A;  4E3O A;  4S2N A;  4WN5 A;  2KLI A;  4K91 A;  4EQ1 A;  3PBQ A;  3ZG8 B;  3G4P A;  2A2L A;  2XA7 M;  4KG5 A;  5FA7 A;  5JYO A;  4IUK A;  1PI4 A;  4QD4 A;  1EWZ A;  4ARZ B;  4JPM A;  4YNR A;  1OTB A;  2ZJ9 A;  4N9K A;  4X55 A;  2GZA A;  5CRF A;  1Z09 A;  1SKO A;  3R4K A;  3IX4 A;  5F83 A;  1T1A A;  2JE5 A;  2G7U A;  5F82 A;  3CLO A;  4EEP A;  4MNR A;  2XFS A;  1Y28 A;  2PBY A;  1K4E A;  1ALQ A;  2ZC7 A;  1YQS A;  1L0D A;  3NC8 A;  2HP5 A;  5G4Y A;  1STZ A;  2XD5 A;  4KZ7 A;  4BD0 A;  2Y79 A;  1TD5 A;  3H7W B;  3VE4 A;  5CED A;  4GB7 A;  1H5X A;  3IS2 A;  3P7N A;  2WKE A;  4KQQ A;  4DKI A;  1T1B A;  3V3S A;  3EWK A;  3PYP A;  1YKD A;  2K31 A;  3MZF A;  4Y17 A;  2L0W A;  5HZH A;  2WZX A;  1N9B A;  1SDE A;  3M2K A;  2WGW B;  2W1R A;  2IA2 A;  2Q0O A;  4PM9 A;  2YKH A;  3D3O A;  3VOY A;  5FQQ A;  1CEF A;  5CEB A;  4M3K A;  4WZ5 A;  2WKH A;  3S7Q A;  3VP4 A;  4NXF A;  3Q82 A;  1K0K A;  2Y2J A;  4JXW A;  2XGN A;  3E4Q A;  3FKV A;  5FI2 A;  3GV9 A;  1TVF A;  3QNB A;  5TBM B;  3MSH A;  3BFG A;  2EWW A;  3BLS A;  4QJG A;  3M2J A;  1K56 A;  1MWU A;  5GHX A;  2JCH A;  4Y0U A;  5KSC A;  3PBR A;  2UV0 E;  5HAI A;  3FG8 A;  4Y15 A;  3OPH A;  1G5U A;  5HWT A;  2W3G A;  1HLU P;  1XA7 A;  1F9I A;  2JBF A;  4NXE A;  1K38 A;  4FH4 A;  3RXW A;  4A5R A;  4S2K A;  2VV7 A;  4LFU A;  4UA6 A;  3QP2 A;  4EU0 A;  3N8S A;  4C3Q A;  5I94 A;  3NUL A;  3OPR A;  4EBL A;  2AVX A;  3C2W A;  2EXA A;  1SHV A;  4X53 A;  4HI4 A;  2ZMV A;  1H8Y A;  4BWI A;  2QYB A;  2H0T A;  2JKR M;  4RYE A;  2WKI A;  2OLU A;  1A0K A;  1DY6 A;  3T4J A;  3R7W B;  5CEC A;  1PWC A;  3JVU A;  2X02 A;  5FAO A;  5FSR A;  1GHI A;  4X56 A;  2WK0 A;  1CF0 A;  5FQM A;  2OLV A;  5M1A A;  3LUQ A;  3LIB A;  4I3I A;  1DRM A;  2W0N A;  1UWN X;  4Y0T A;  4O01 A;  1JWV A;  4LRX C;  4DMZ A;  1GSV A;  1ES3 A;  2FZ0 A;  3KSH A;  5AQB A;  1ZC2 A;  2XR0 A;  4KZ8 A;  2IWB A;  4G3V A;  3RXX A;  5DKK A;  3EQU A;  1W63 Q;  3MXR A;  2B95 A;  2Y2P A;  3NOP C;  1S67 L;  4LPZ A;  3GR2 A;  2Y2G A;  4HEF A;  4R70 A;  4EW7 A;  4ARZ A;  3VMA A;  2OV5 A;  1S4R A;  4WZ5 C;  1SCW A;  4DXC A;  1KDW A;  1YT4 A;  2A24 A;  4Y0O A;  4RX3 A;  1SKO B;  1BSG A;  3BRM A;  4IED A;  2DCF A;  1H8Z A;  5A91 A;  2ZQ9 A;  3M6B A;  3S1Y A;  2HJ9 C;  5HL6 A;  1YAX A;  5DTT A;  1XJ4 A;  2G2W A;  2XQZ A;  1AWI A;  1MZU A;  1ES4 A;  1DP8 A;  1GA0 A;  4DE3 A;  2IWD A;  4KZ9 A;  1K55 C;  4G3K A;  1GHP A;  3DW0 A;  1XJ6 A;  2WGI A;  3NOU C;  3V50 A;  3E98 A;  3B33 A;  4GDN A;  3UDF A;  2XK1 A;  3LR3 A;  3NEC A;  4LLO B;  5F69 A;  3NOT C;  3RH8 B;  1GCE A;  3ZHH A;  1U60 A;  3LR4 A;  2W1T B;  4Q8I A;  3HUM A;  2V8C A;  1F2K A;  3GRJ A;  2ZQ8 A;  2QJ7 A;  4FOF A;  2J7V A;  2ZC6 B;  5F5Y A;  2HDQ A;  4I5S A;  2PR5 A;  5FI6 A;  4K0W A;  1W8Y A;  1XGI A;  1ES5 A;  3GEC A;  5HX9 A;  2PU4 A;  1HVB A;  4CLC E;  4OON A;  4OP5 A;  1P9W A;  4KUO A;  5EVI A;  4HIA A;  1DJA A;  2D01 A;  1K6S A;  4MBH A;  3NHQ A;  4KG6 A;  5AJG A;  1W63 M;  1TDL A;  4E3J A;  2IWC A;  1YLT A;  1K54 C;  3WS0 A;  4CLC C;  3B42 A;  2R9W A;  5CTN A;  1K54 A;  5AQ7 A;  5AVF A;  1P0Z A;  1NWZ A;  4PKY G;  4XT2 A;  1BLC A;  5A8B A;  4R6L A;  2QWS A;  3CZD A;  4H8R A;  3WRZ A;  1KDS A;  4KQD A;  5J4E A;  3JYI A;  5HD3 A;  5M19 A;  3E4P A;  2Z2L B;  2HPB A;  1ES2 A;  4N9L A;  4UEY A;  2ZQC A;  1TS8 A;  3LI8 A;  4GS9 A;  3O87 A;  4OP8 A;  1D06 A;  4JF6 A;  2WAD A;  1NYM A;  1MY8 A;  2M7U A;  1LHY A;  2O9B A;  2PR6 A;  4PM7 A;  4WMC D;  1W79 A;  1IFQ A;  1MBL A;  3ZVW A;  1S1Y A;  3N4I A;  3BFE A;  1W5D A;  2Y2O A;  3LGO A;  5L09 A;  1LL9 A;  3ZG0 A;  4I39 A;  5A90 A;  1VET A;  4IVI A;  1ESI A;  5E2G A;  1DP6 A;  1Y4O A;  2P7J A;  1CJF A;  1IOU A;  1T18 A;  2O0Y A;  2EX6 A;  1HTZ A;  3DWK A;  3AGE A;  5HAQ A;  4PM8 A;  3HUO A;  5E2H A;  1KOU A;  2V20 A;  2Y59 A;  3HRE A;  5FEG A;  1Q2Q A;  1OPX A;  4JF4 A;  2BTF P;  4GJ4 A;  1S0W A;  3CWF A;  5EEC A;  3L9K A;  4JXG A;  3VP0 A;  2NUP C;  4E3I A;  4KZ3 A;  4BEN A;  3W4P A;  2A24 B;  3A3D A;  2UWX A;  4HH2 A;  4UHU A;  4IVK A;  2KDK A;  1TS6 A;  4FCF A;  1ESU A;  1PZO A;  2EX9 A;  2RL3 A;  2CMN A;  3PHY A;  3ULF A;  3RFB A;  4MBF A;  2XA7 S;  4QWO A;  2JKG A;  3O86 A;  4QPR A;  2O9A A;  1YSQ A;  3LIE A;  4BBT A;  3IWI A;  4S2N C;  4LRZ E;  3C7V A;  3IXB A;  4GHI A;  1VEU A;  4U0X A;  5HL1 A;  4WEL A;  1W8Q A;  5CGW A;  5GHY A;  3E2K A;  1NXY A;  3IF6 A;  3A3F A;  2QHK A;  3LID A;  5EM0 A;  3BFF A;  5A92 A;  2GX5 A;  1LL5 A;  3SH9 A;  5C5K A;  1D7E A;  4QY6 A;  3G34 A;  4PMA A;  5TFQ A;  4DRT A;  2FFF B;  4OOM A;  5HFO A;  5GHZ A;  1JNU A;  2EA9 A;  1LSW A;  5CHM A;  3UDX A;  1N9N A;  4P6Z S;  3EQV A;  3QP6 A;  5DTS A;  2QZ6 A;  3QNC A;  3KYZ A;  3U2A A;  4PM6 A;  3LCE A;  1NRJ A;  2PHY A;  5GLD A;  1GHM A;  5EOE A;  5HSQ A;  3JPU A;  2ZC5 B;  2FH5 A;  4IBX A;  3V39 A;  3Q07 A;  1BT5 A;  1PW1 A;  4GKU A;  2P9V A;  4QHC A;  4HNB A;  1FIK A;  2L4R A;  5IT5 A;  1YMS A;  1YLY A;  3P98 A;  3FPW A;  5K5B A;  5DKL A;  4ZTK A;  5KIZ A;  4HJ6 A;  4NET A;  3N8R A;  4JGO A;  3PR6 A;  3WS5 A;  3B47 A;  1PNE A;  4F94 A;  5FI7 A;  3PBN A;  4OQG A;  1KE4 A;  2HJE A;  5F1G A;  4PAU A;  2LB9 A;  4P0M A;  3MFX A;  4WF0 A;  3KSF A;  2WAE A;  3UDI A;  3SW1 A;  5FAT A;  3T1Q B;  1FQG A;  4E6W A;  1MWR A;  2XRO A;  2H0Y A;  5HPF A;  3T50 A;  3DTE A;  4F3L A;  3D9Y A;  1WE4 A;  4Y5F A;  3EOI A;  1GSW A;  3HUN A;  3N8L A;  2V9A A;  4BJP A;  2W3H A;  5DFY A;  3IBJ A;  3QHY A;  2ZOH A;  1VHM A;  2W3E A;  1ZKJ A;  2K7S A;  5J3W A;  5L8M A;  2WGW A;  1E3U D;  1LI9 A;  3KSG A;  4GD6 A;  3SOI A;  1NZU A;  2Y2L A;  3C8C A;  5EVE A;  2YKF A;  4B4X A;  4O7D A;  1MXO A;  2Z2M B;  3BQA A;  5GLC A;  4R3B A;  2OSU A;  1NYY A;  4CQH A;  1PW8 A;  5U47 A;  3UB5 P;  1WYC A;  4HHD A;  3S7N A;  1OTA A;  4WL9 A;  4QY5 A;  3FPV A;  3O88 A;  3ZQ5 A;  1I5Q A;  5DFX A;  3MQO A;  3S22 A;  3MQQ A;  4P6Z M;  3TE8 A;  3NY4 A;  4LV3 A;  4P6B A;  2E8J A;  4AFI A;  4LEN A;  3NCK A;  1OJ5 A;  4DDS A;  2E8I A;  4FH2 A;  4Q0I A;  2ZC4 B;  4Y7P A;  2Z6C A;  1H3Q A;  1BLS A;  4ETX A;  3IF6 B;  2VKS A;  4MMN A;  1LT0 A;  5FQ9 A;  4ME4 A;  4ZJ2 A;  3SH7 A;  3F1N A;  4JLF A;  4OPZ A;  1QME A;  2WGV A;  2PYP A;  3NJA A;  3DWZ A;  5HDD A;  3CG5 A;  3KYE A;  1YSP A;  3CUE A;  3Q7V A;  3OC2 A;  1SZV A;  4YIN A;  3UY6 A;  5KZH A;  4FSF A;  1XFQ A;  4UAA A;  3H9W A;  4R1G A;  4WLA A;  5CHJ A;  2PYR A;  3PTE A;  4DE0 A;  3S7P A;  1BLH A;  4DXB A;  3MFD A;  3MBZ A;  4Q0J A;  1JVJ A;  4UA7 A;  3IH8 A;  3HLE A;  2JKR I;  3OCN A;  3ISG A;  4S2L A;  2J3W A;  1FR6 A;  3W8K A;  3ZNY A;  3FV7 A;  2W27 A;  3H82 B;  1PI5 A;  1TS0 A;  1YLJ A;  1G6A A;  4KZ5 A;  2PRF A;  2JKF A;  4HJ4 A;  2OOL A;  3TRC A;  3K2N A;  3GSG A;  4OQ0 A;  1TDG A;  3UMD A;  2GNX A;  1XP4 A;  3VP1 A;  1DJB A;  3E4O A;  5EVL A;  4I38 A;  1E4D A;  3MXQ A;  4WBG A;  4MCW A;  3EEH A;  3BEB A;  4BD1 A;  3CJM A;  3C5A A;  3CHW P;  2OWH A;  3OCL A;  3G32 A;  4G3W A;  1DP9 A;  4HOI A;  3V67 A;  1ERO A;  5FDH A;  1SKF A;  3EGX C;  2ZMF A;  4FUW A;  4MDZ A;  3K3C A;  3UPN A;  4R3A A;  4MLL A;  3CPT B;  2Y4A A;  3IXH A;  5F68 A;  2HZ5 A;  3IQA A;  3NDE A;  3NBL A;  2RCX A;  2Y91 A;  1MWS A;  3GMW A;  4O0P A;  2K2N A;  2V8F A;  1NJ4 A;  1P9R A;  2QMI A;  4CJN A;  1RP5 A;  5AQ9 A;  3UNW A;  3ZFZ A;  1CI9 A;  1XX2 A;  1T1C A;  3UME A;  4EER A;  4FD8 A;  3HJI A;  4KZ6 A;  5CHU A;  4EWF A;  4ZJ3 A;  3HLW A;  3ZVT A;  1E3U A;  3W2Z A;  5F1F A;  1M6K A;  5IHV A;  4EUZ A;  3UE1 A;  3VSK A;  1G28 A;  2QKP A;  2XRN A;  5CGS A;  1K25 A;  3SH8 A;  5G4Z A;  1UWP X;  1BYW A;  2D02 A;  4B88 A;  2ZLY A;  4X68 A;  5EE8 A;  4OOY A;  3UB7 A;  4WZ4 A;  5HAR A;  4D2O A;  3IF5 A;  2Z6D A;  3G31 A;  3FWL A;  5L2F A;  1NLZ A;  4XT2 B;  4NG2 A;  2B5R A;  3V5M A;  5EM1 A;  3BM6 A;  4S2I A;  2XSS A;  4LGW A;  3F1N B;  2HP9 A;  2PU2 A;  3T4L A;  1V9Y A;  3ZGA B;  1VB6 A;  3QP4 A;  1D1J A;  4BLM A;  3Q7V B;  2OAP 1;  3MZE A;  5FEF A;  3T4K A;  2VGK A;  5AQA A;  3FZC A;  4E04 A;  2O99 A;  1G68 A;  3UE3 A;  1KGE A;  2Y2N A;  4JF5 A;  4ZAM A;  4R4S A;  2Q9M A;  2PT7 A;  4BL2 A;  2MJ6 A;  4X25 A;  4CLC D;  2M7V A;  3QP5 A;  3BFD A;  1MKM A;  4OPQ A;  1ONG A;  2XF3 A;  4OLD A;  1IYS A;  2Y2M A;  3UB6 A;  3PAE A;  4KEN B;  4EQI A;  1KVM A;  4EUV A;  5DTK A;  4O8G A;  4N1H A;  1IYQ A;  2Q9N A;  2ZQD A;  5EVI D;  2FFY A;  4Y3I A;  4MN6 A;  1PFL A;  1XKZ A;  2V1A A;  4DDY A;  3U4L P;  1OT9 A;  4Y2F A;  2KX6 A;  2PDR A;  3E0Y A;  4E3K A;  3DTK A;  3VOZ A;  3VE3 A;  4LV1 A;  4NEE D;  2WKR A;  5FAQ A;  5DF9 A;  4GN2 A;  3ZNT A;  4S2J A;  1BTL A;  4GW9 A;  3B3X A;  4LV2 A;  1N4O A;  1J9M A;  4EBP A;  2VGL M;  3GDI A;  4CLC B;  4NKP A;  1TS7 A;  5DF8 A;  4GHI B;  2ZQ7 A;  3VOL A;  2WUQ A;  1Y54 A;  4MN7 A;  4RA7 A;  4P85 A;  1XFN A;  4JBF A;  3OPL A;  2XFT A;  3CPT A;  4I3A A;  1M40 A;  4X1L A;  4UA9 A;  5I5L A;  1JTD A;  1W7F A;  2BAS A;  3V3R A;  2ACG A;  3N6I A;  4OQH A;  3IXD A;  3I7J A;  3SS4 A;  4WMC A;  2X71 A;  5F6A A;  5L10 A;  4XUX A;  1O7E A;  1E25 A;  4ETZ A;  1J3W A;  1GA9 A;  1EW0 A;  3A0S A;  2WKP A;  1P97 A;  3A0R A;  1YMX A;  3F1O A;  4N92 A;  3GTC A;  3IHA A;  1ZTU A;  1PIO A;  2ZL1 B;  2XEP A;  1HD8 A;  4KZ4 A;  3C7U A;  4Q0H A;  1ODV A;  4X69 A;  4LRY C;  3ZG7 B;  2NUT C;  3G2Z A;  5HWW A;  1OTD A;  3FKW A;  2I72 A;  4ZRR A;  4L9E A;  3HLB A;  2P9V B;  4L9F A;  2VZW A;  3OZH A;  5J8X A;  3A3I A;  4XXR A;  3QP8 A;  5FQJ A;  4ZBE A;  3F1P B;  4DF6 A;  3RJU A;  2LB5 A;  3T1R A;  1BLP A;  4H6J A;  4EET B;  1PRQ A;  3LIA A;  3D4F A;  1JTG A;  2VV6 A;  3PBS A;  2X01 A;  2EFX A;  5EOO A;  2HGV A;  4R38 A;  1TEM A;  2PAV P;  2H28 A;  1IEM A;  2C6W B;  5HW3 A;  4E6X A;  2XLN A;  4UQI M;  4FTX A;  1K57 A;  1XXM A;  5DJU A;  3IT9 A;  5E2E A;  4LCM A;  3NIA A;  2OWJ A;  4YOF A;  3BQ8 A;  5HDC A;  3UO9 A;  1FOF A;  4HP9 A;  3BWL A;  3A0V A;  5GLA A;  2XD1 A;  4GOG A;  5FAS A;  4F3L B;  3WS4 A;  5TR7 A;  1YPR A;  5DF7 A;  4JXS A;  5IS1 A;  4OKP A;  1XJ3 A;  1Z6F A;  4WUJ A;  1OTE A;  1UGU A;  3LIF A;  2OAQ 1;  4X1M A;  2I9V A;  5G18 A;  4NXG A;  3LI9 A;  4HJ3 A;  3VV4 A;  1MC0 A;  1MPL A;  4U0T A;  1XA1 A;  1JWZ A;  4EV4 A;  2HDR A;  4IUH A;  1XPB A;  2A3U A;  3MKE A;  4OVD A;  2GJ3 A;  2XH9 A;  2DRW A;  1L0G A;  2ZOI A;  2QPN A;  1KVL A;  5HAP A;  4N1X A;  4GNU A;  1YM1 A;  4DN0 A;  2ZM0 A;  3HLG A;  4OPY A;  3C4O A;  3BLM A;  2V0U A;  3O3V A;  2DMW A;  1O07 A;  1ACF A;  5HD5 A;  3O5Y A;  3T4Q A;  3CIT A;  3LY4 A;  5JYP A;  2VGJ A;  3E2L A;  3TG9 A;  5CER A;  3G6O A;  3C4P A;  4NXB A;  3IHB A;  1PZP A;  3N7W A;  4DJ2 A;  3MKF A;  4HES A;  3G2Y A;  4X6T A;  3CI6 A;  2A49 A;  3A3E A;  4WM9 A;  4HBU A;  3IH9 A;  4MBK A;  1CK3 A;  2C5W B;  3IX8 A;  3LIC A;  5J7E A;  3HL9 A;  3TOI A;  4C75 A;  1LL8 A;  4C6Y A;  2EXB A;  1BZA A;  3RTY A;  2O9C A;  1ERM A;  3LY3 A;  1L2S A;  3TW8 A;  3IWO A;  2PD7 A;  2HF6 A;  5EFW A;  2VEA A;  2EX8 A;  3VP3 A;  3H82 A;  1LSV A;  2R9X A;  4K0X A;  1L0E A;  2J8Y A;  1GSX A;  1KGG A;  2ZD8 A;  1F98 A;  2J80 A;  3T1X A;  3IWQ A;  1ZG6 A;  2BLS A;  5DJT A;  1WA9 A;  4B9O A;  3VSL A;  3UB8 A;  4Z9Q A;  2J9P A;  4GCZ A;  4ID4 A;  4E3M A;  2Y2K A;  2L1M A;  1FIL A;  3G30 A;  4II7 A;  3L7H A;  4R4R A;  5BOH A;  4GLQ A;  4OOL A;  1ERQ A;  3BEC A;  1S1Z A;  1FSW A;  1SDN A;  2B18 A;  1MKI A;  1N9O A;  1YLP A;  2P74 A;  2VV8 A;  3KYQ A;  3TJZ C;  3T4T A;  3EEA A;  3HCY A;  3DBA A;  4YWZ A;  3A3J A;  3MS6 A;  4S2O A;  4PKY A;  4IHQ A;  4S2M A;  3ZDJ A;  5FL3 A;  4K08 A; 
#chains in the Genus database with same CATH homology
 4QPR A;  3T4L A;  2O9A A;  1V9Y A;  1OTB A;  1YSQ A;  3LIE A;  5TBM A;  4BBT A;  4HP4 A;  3C38 A;  1VB6 A;  4LRZ E;  2GZA A;  4GHI A;  3MJQ A;  2QJ5 A;  4WEL A;  2OAP 1;  2W3F A;  3R4K A;  1T1A A;  2G7U A;  1S66 L;  3CLO A;  2QHK A;  4EEP A;  1OT6 A;  3LID A;  1Y28 A;  3T4K A;  2GX5 A;  2JKT M;  5C5K A;  4E04 A;  1D7E A;  2O99 A;  3UE3 A;  3T4S A;  5G4Y A;  1STZ A;  4UQI S;  4OOM A;  1JNU A;  2Y79 A;  1T19 A;  2EA9 A;  1TD5 A;  2PT7 A;  1LSW A;  3H7W B;  2MJ6 A;  3C30 A;  3VE4 A;  4CLC D;  2M7V A;  1N9N A;  4P6Z S;  3EQV A;  1ZHH B;  3IS2 A;  3P7N A;  1MKM A;  4KQO A;  1G6O A;  1T1B A;  3EWK A;  3KYZ A;  3U2A A;  2V1B A;  3PYP A;  3UB6 A;  4JGR A;  3ZYT A;  1YKD A;  2K31 A;  3BY8 A;  4EUV A;  1NRJ A;  2L0W A;  2PHY A;  5HZH A;  4O8G A;  5HSQ A;  2J3T D;  2W1R A;  4Y3I A;  4MN6 A;  2IA2 A;  2FH5 A;  2V1A A;  1OT9 A;  4Y2F A;  3T4O A;  2YKH A;  3D3O A;  3PXP A;  2KX6 A;  4IJG A;  2PDR A;  3E0Y A;  3VE3 A;  3IBR A;  3K3D A;  2JHE A;  4HNB A;  2L4R A;  4NEE D;  2WKR A;  3S7Q A;  5IT5 A;  5DF9 A;  4NXF A;  3UB9 A;  3FPW A;  5K5B A;  4GW9 A;  5DKL A;  5KIZ A;  3E4Q A;  3S7O A;  4HJ6 A;  2JN7 A;  2VGL M;  5TBM B;  3GDI A;  4CLC B;  4NKP A;  2EWW A;  1TS7 A;  4GHI B;  3VOL A;  4JGO A;  3PR6 A;  3B47 A;  4MN7 A;  3KSI A;  3PBR A;  1XFN A;  2P04 A;  3PBN A;  3FG8 A;  4I3A A;  2HJE A;  5I5L A;  4PAU A;  5HWT A;  2LB9 A;  2W3G A;  3MFX A;  4WF0 A;  1F9I A;  3KSF A;  2BAS A;  4NXE A;  3SW1 A;  2B02 A;  2VV7 A;  4EU0 A;  3OBF A;  2XRO A;  3C2W A;  5F6A A;  2HV1 A;  5HPF A;  3T50 A;  3LFV A;  4F3L A;  4HI4 A;  4ETZ A;  2ZMV A;  4Y5F A;  3EOI A;  1EW0 A;  1GSW A;  3A0S A;  2WKP A;  4BWI A;  1P97 A;  2QYB A;  3A0R A;  2JKR M;  4L9G A;  2V9A A;  3F1O A;  4BJP A;  4DJ3 A;  2W3H A;  5DFY A;  3IBJ A;  1ZTU A;  2ZOH A;  4Z1W A;  3T4J A;  3R7W B;  1VHM A;  4Q0H A;  2W3E A;  1ODV A;  2K7S A;  3JVU A;  4EXO A;  2VA0 A;  5J3W A;  3P01 A;  5L8M A;  3KSG A;  4LRY C;  4BBV A;  2NUT C;  2W1T A;  5HWW A;  1OTD A;  3C8C A;  4ZRR A;  4L9E A;  5CX7 A;  2YKF A;  2INW A;  3LUQ A;  3LIB A;  4I3I A;  4L9F A;  2VZW A;  1DRM A;  3BQA A;  2W0N A;  1UWN X;  4O01 A;  1NLY A;  4CQH A;  4LRX C;  4DMZ A;  1GSV A;  4KUK A;  2VLG A;  3F1P B;  2FZ0 A;  4HHD A;  3S7N A;  3KSH A;  2LB5 A;  4H6J A;  1OTA A;  4BMW A;  4EET B;  4WL9 A;  4G3V A;  3FPV A;  4HY8 A;  3LIA A;  5DKK A;  1XJ2 A;  3ZQ5 A;  5DFX A;  3EQU A;  1W63 Q;  3NOP C;  1S67 L;  2VV6 A;  3BJN A;  4LPZ A;  3MQO A;  4R70 A;  4CLC A;  3PBS A;  4ARZ A;  3MQQ A;  4EW7 A;  5MC7 A;  2HGV A;  4P6Z M;  4R38 A;  3TE8 A;  2H28 A;  1S4R A;  4AFI A;  1OJ5 A;  2A24 A;  4UQI M;  4Q0I A;  5DJU A;  2Z6C A;  1H3Q A;  1OTI A;  2EWV A;  4ETX A;  2OWJ A;  2J3T C;  2VKS A;  4MMN A;  1LT0 A;  4YOF A;  4ME4 A;  3BQ8 A;  2HJ9 C;  5HL6 A;  5HDC A;  1YAX A;  3F1N A;  1XJ4 A;  4HP9 A;  5LBR A;  3BWL A;  3A0V A;  1MZU A;  1DP8 A;  2PYP A;  3NJA A;  4I3J A;  5HDD A;  4F3L B;  2ZBB A;  3MQ0 A;  3KX0 X;  1YSP A;  3CUE A;  1LSX A;  3OC2 A;  4G3K A;  3F1O B;  1XJ6 A;  4FSF A;  4GS9 B;  1XFQ A;  5IS1 A;  3NOU C;  1XJ3 A;  3E98 A;  3H9W A;  4WUJ A;  3B33 A;  1OTE A;  4WLA A;  1UGU A;  3LIF A;  2OAQ 1;  3EGD C;  2PYR A;  4RQ9 A;  2I9V A;  5AVE A;  3S7P A;  3LR3 A;  4LLO B;  5F69 A;  3NOT C;  3LR5 A;  3RH8 B;  4NXG A;  3LR4 A;  2W1T B;  3LI9 A;  4Q0J A;  2W3D A;  4HJ3 A;  3VV4 A;  2KOI A;  2VJW A;  2JKR I;  3OCN A;  1MC0 A;  3UE6 A;  2QJ7 A;  4FOF A;  2J3W A;  3H7W A;  5F5Y A;  4I5S A;  4IUH A;  2PR5 A;  3IS2 B;  5HDS A;  1F5M A;  3F1P A;  3OLO A;  2W27 A;  3H82 B;  4H6J B;  4JGP A;  1TS0 A;  2GJ3 A;  3GEC A;  2ZOI A;  4CLC E;  4HJ4 A;  2OOL A;  3MMH A;  1S4S A;  4M4X A;  3TRC A;  3K2N A;  1P9W A;  4KUO A;  3UMD A;  4DN0 A;  2GNX A;  4HIA A;  1N9L A;  3E4O A;  4I38 A;  2D01 A;  2V0U A;  3NHQ A;  4WEJ A;  5AJG A;  1W63 M;  2JKT I;  3MF0 A;  3MXQ A;  2DMW A;  4MCW A;  5IU1 A;  3EEH A;  5HD5 A;  4CLC C;  1OJG A;  3O5Y A;  2VGL S;  3B42 A;  3T4Q A;  3CIT A;  1P0Z A;  3HJK A;  5AVF A;  1NWZ A;  2OWH A;  3OCL A;  4G3W A;  4WEK A;  1H8M A;  4HH3 A;  1DP9 A;  1V9Z A;  4PKY G;  4XT2 A;  3G6O A;  4HOI A;  5A8B A;  4R6L A;  4NXB A;  3V67 A;  2Y8H A;  3MR0 A;  2WKQ A;  3CAX A;  3BW6 A;  2QWS A;  3EGX C;  4KQD A;  4DJ2 A;  5J4E A;  2ZMF A;  3OOV A;  2P08 A;  4PHT A;  5HD3 A;  4MDZ A;  3E4P A;  3K3C A;  4R3A A;  4UEY A;  5TJJ A;  4EES A;  3CI6 A;  1TS8 A;  3LI8 A;  2VX8 A;  4GS9 A;  3PBT A;  4BBU A;  1D06 A;  5F68 A;  2M7U A;  2O9B A;  2M1C A;  2PR6 A;  3LIC A;  3LR0 A;  3BY9 A;  5J7E A;  1IFQ A;  3D72 A;  5KSH A;  1S1Y A;  4O0P A;  1LL8 A;  2K2N A;  1P9R A;  2R78 A;  3RTY A;  2O9C A;  3TW8 A;  4I39 A;  3ICY A;  5HWV A;  2PD7 A;  1T1C A;  2HF6 A;  5EFW A;  3UME A;  4EER A;  2VEA A;  4JGQ A;  3HJI A;  3KO6 A;  1TF1 A;  2PD8 A;  4B93 A;  1DP6 A;  1X0O A;  3H82 A;  3LYX A;  5HPI A;  1LSV A;  2P7J A;  3W2Z A;  1IOU A;  4MN5 A;  1T18 A;  2V0W A;  1GSX A;  4HQA A;  3R7W A;  2O0Y A;  4L0L A;  1F98 A;  2J80 A;  3PBO A;  1G28 A;  3CUE C;  5DJT A;  2QKP A;  1KOU A;  2XRN A;  1WA9 A;  4B9O A;  3JVV A;  3UB8 A;  3FC7 A;  5G4Z A;  1UWP X;  4GCZ A;  1BYW A;  1OPX A;  2D02 A;  2L1M A;  4GJ4 A;  3CWF A;  4II7 A;  2NUP C;  4EEU A;  3UB7 A;  4WN5 A;  4GLQ A;  2KLI A;  4OOL A;  2A24 B;  4HH2 A;  4EQ1 A;  3PBQ A;  2A2L A;  2XA7 M;  2KDK A;  1TS6 A;  2Z6D A;  1NLZ A;  1S1Z A;  4XT2 B;  2B18 A;  3KYQ A;  1N9O A;  2VV8 A;  4IUK A;  3TJZ C;  3T4T A;  3EEA A;  3HCY A;  3DBA A;  4YWZ A;  4ARZ B;  2XSS A;  3PHY A;  2CMN A;  3ULF A;  3RFB A;  2XA7 S;  4PKY A;  4IHQ A;  3F1N B;  5FL3 A;  4K08 A;  4YNR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...