4B93A

Complex of vamp7 cytoplasmic domain with 2nd ankyrin repeat domain of varp
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
157
Chain Sequence
b'SMAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFSFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VESICLE-ASSOCIATED MEMBRANE PROTEIN 7
publication title The Binding of Varp to Vamp7 Traps Vamp7 in a Closed, Fusogenically Inactive Conformation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Exocytosis
total genus 48
structure length 157
sequence length 164
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4b93A00
2VX8A 3EGDC 2DMWA 2NUTC 1IFQA 1IOUA 1H8MA 2NUPC 4B93A 3KYQA 3BW6A 3EGXC 4AFIA
chains in the Genus database with same CATH superfamily
3IF5A 2Y2OA 4HEFA 4IBXA 2GDNA 5GLDA 3P01A 5HDDA 3WS2A 4E3KA 4LRZE 3A0VA 2X71A 3DWKA 4JXWA 3LICA 5AVEA 3BFDA 1BT5A 3ZVWA 2HJ9C 1TD5A 3NI9A 3T4JA 2HV1A 1YLWA 3B3XA 4RA7A 2JCHA 4A5RA 3WS0A 3PR6A 5G4ZA 3T4LA 3W4QA 1NY0A 3G32A 1K38A 3HUMA 5DKKA 1CI8A 2WAFA 4ZBEA 2ZC6B 3QNBA 3UB6A 3UDFA 2XH9A 3HLGA 1G5UA 1FR1A 3GR2A 4LCLA 5CERA 2DRWA 1O07A 3H82B 2Q0OA 1KGFA 4E6WA 1U60A 4L9EA 5FASA 1EWZA 4LRXC 2Y2NA 2VLGA 1XJ3A 1I2SA 2DCFA 4BLMA 4JGQA 5E2HA 1OT9A 5F69A 2Q9MA 2RCXA 2O9CA 3TE8A 4LV1A 3LCEA 4QU3A 2G2WA 4E3LA 2OLUA 1BSGA 3MZDA 2HF6A 3PBTA 1LL8A 1JNUA 1ZKJA 4OPQA 3GVBA 2W1RA 3DWZA 2K2NA 4KUOA 2E8IA 4EQIA 3W4OA 3UE1A 2EXAA 4DDYA 3LI8A 2V9AA 2W1TA 4E3JA 1SKOA 2V1AA 2VK3A 5EVIC 1Z09A 4WUJA 4LGWA 3M2JA 1SDNA 3F1OA 4X69A 4O0PA 3FYZA 3A0RA 4MLLA 2Y2PA 1WA9A 2OAQ1 3NJAA 4KZ5A 4L9FA 4QY6A 2EX6A 5FAPA 3LO7A 4HJ4A 2WYXA 5G18A 2PD8A 1OPXA 4GD6A 3CLOA 5GLCA 2GZAA 3FV7A 1VHMA 5J3WA 2HDSA 4HI4A 3MKEA 3WWXA 4UA9A 3MQOA 1AWIA 5HPIA 4HOIA 4DE0A 4UEYA 2PDRA 3SOIA 4KQQA 3ZVTA 2XDMA 1JWPA 1K56A 1VETA 5EVID 2AVXA 3QNCA 1T1CA 4B93A 1D06A 4KZ6A 2OWJA 2C5WB 4RYEA 5CGWA 4HIAA 4MN5A 2O9BA 1CK3A 5CGXA 2BASA 3RH8B 2W3GA 1VQQA 4Y7PA 3PBOA 4I5SA 3H7WB 2WKRA 4P0MA 3H9WA 3N6IA 2PHYA 5I5LA 4K91A 3Q82A 3ZG7B 2O9AA 3OPPA 1YLTA 3F1PB 4Y13A 2ZQ8A 4EEPA 2OOLA 4KZ8A 3P7NA 3HBRA 1N9NA 4X1LA 4DE3A 1H8YA 3VFFA 3IF6B 2J80A 1TS6A 1VEUB 2G2UA 3UB8A 4MBFA 5F1GA 2R9XA 1O7EA 3LEZA 3SS4A 3CUEC 3T1QB 1STZA 3VMAA 4WN5A 4BBTA 1YMXA 2YKFA 2ZC7A 1T1AA 4F3LA 3NHQA 2WGIA 4M4XA 3LYXA 5TBMA 1OTAA 5HX9A 3VOYA 2B95A 2W3FA 2P9VA 3TW8A 3JPUA 1T18A 3VSKA 1YLJA 2GX5A 4UA6A 2ZQAA 1MWRA 2P04A 3W4PA 3CITA 4Q0JA 4YWZA 3MZFA 4N92A 3MBZA 1DP8A 3NOTC 3TSGA 1D1JA 1GHMA 3G30A 3IWOA 4PM8A 1ZG6A 5KZHA 4I3AA 4HJ3A 2H5SA 5FL3A 1PI5A 1ES3A 2JKTM 1JWZA 2Y2LA 4E6XA 5EM1A 1RP5A 5A93A 1S4SA 4JF5A 4UQIM 2NUTC 4KZ7A 1F5MA 1YSPA 1D7EA 2PU2A 3CI6A 2V8CA 2W3EA 3U4LP 1OTEA 2HGVA 4B4ZA 2QPNA 1FIKA 2FFFB 1BLHA 3R7WB 2M7UA 3VP4A 2L1MA 4BD1A 5DJUA 3BJNA 3M6HA 5GHXA 2HDQA 3Q07A 5F5YA 5GLAA 3K2NA 4X55A 5HWWA 5FAOA 4Y17A 4HP4A 3PXPA 1JTGA 4HH3A 4EWFA 2V2FF 3NOPC 4X68A 5HL1A 2CC1A 5E2FA 2Y2IA 2J3WA 4KG2A 4R70A 5L10A 3IF6C 4EESA 3LY4A 1DJAA 2PAVP 1SKOB 4R23A 3IXHA 4DN0A 2VGKA 5HARA 4CQHA 2GJ3A 3IS2A 1H8ZA 3LR5A 4FOFA 1VB6A 4EBPA 1ESUA 5I94A 1NXYA 1W63M 5EE8A 3VP0A 4HP9A 5FATA 5CX7A 3NCKA 3NULA 3BQ8A 5HWTA 5GL9A 3C8CA 3D4FA 3C7UA 3S7OA 1LLBA 2Z6DA 4JGRA 1OTDA 1XGIA 3PBRA 1IYSA 1IKGA 2GNXA 4X56A 4EW7A 3C5AA 5D3OA 4PPRA 1FSYA 1PIOA 1KDSA 3HJKA 4HESA 3IBJA 2P7JA 2L4RA 4Y0OA 1EROA 1VETB 3LEQA 1LSXA 1MWSA 1JWVA 3DTEA 2WADA 3T4QA 5FEFA 4DDSA 2EFXA 3LY3A 3D9YA 4PKYA 1W79A 3U2AA 4IUHA 3G2YA 4GD8A 3RTYA 2DNSA 2WAEA 4JPMA 4N1XA 3CZDA 4Q8IA 5DFYA 3ZDJA 3BLMA 2XEPA 3JYIA 4BENA 2VGLS 4HQAA 4N1HA 4JF4A 3G6OA 4DJ2A 3MXSA 4IJGA 1PZPA 2BTFP 2Y2JA 4ZJ3A 4E3OA 2WK0A 4S2NA 3E2LA 1BYWA 3PYPA 3QP2A 3BW6A 1XKZA 4WMCD 1Q2PA 2H0TA 3GECA 1FSWA 4LLOB 2ZOHA 2EXBA 1Q2QA 4CLCA 2QMIA 2R78A 5L2FA 4FUWA 3T4KA 4HH2A 1W7FA 5DKLA 3IX4A 2HZ5A 4LENA 1ES5A 3F1PA 4K0XA 5FDHA 5CHMA 2ZLYA 4WZ5A 4WEJA 5HDSA 3LGOA 5FI7A 3LI9A 5F83A 5TFQA 2FH5A 4R38A 4GJ4A 4BJPA 5TBMB 1H0MA 1VEUA 1FQGA 1S67L 2A49A 3N8RA 5KMWA 1CJFA 4WLAA 3TRCA 4JBFA 2P74A 3B33A 4B88A 2IWCA 1NRJA 2WKPA 3A3IA 3FPVA 2JKTI 2V1ZA 2WKHA 1LI0A 5HPFA 2VV8A 2UWXA 2JC7A 3VSLA 3S22A 3GMWA 3IX8A 4PM9A 4NK3A 5FQQA 4HBUA 5KSHA 2Y91A 3LIFA 3KSGA 3BECA 1P9RA 2V0UA 3VFHA 4EV4A 3MXQA 1MWTA 1IKIA 2YKHA 2ZQCA 2WKEA 4KZBA 4R4RA 1P0ZA 1T1BA 2VV6A 3A3FA 4KENB 4OOLA 1VM1A 1E3UD 3LIDA 1FOFA 4OQHA 2INWA 4LFUA 4EEUA 5GHZA 4L0LA 4QWOA 2ZMVA 5A8BA 5EECA 4BMWA 4CPKA 5A92A 5JYPA 2VGLM 1GSVA 4B4XA 1BTLA 3TJZC 4S2LA 3T1XA 4U0XA 1BLPA 1UWPX 3BY8A 3SH9A 1MKMA 2XRNA 4D60A 2G7UA 5EPHA 4DKIA 2CMNA 1KE0A 3HUNA 3R7WA 5HAIA 2XD1A 1TDLA 3AGDA 4GLQA 2Y2GA 4EUZA 3IT9A 1V9YA 4OPYA 3RJUA 4P6BA 1AXBA 3RXWA 2PYPA 3IS2B 2V8FA 4GDNA 1WYCA 1ALQA 2ZC4B 3NECA 4GNUA 3V67A 3NBLA 3DTKA 4GS9A 4XT2B 1UGUA 2M1CA 4UHUA 2RL3A 3DTIA 3O87A 4Y0TA 4FD8A 5EV0A 5AQ7A 1L0EA 3UB7A 2EWWA 3D3OA 2XA7M 4KQDA 3UMEA 3MMHA 3ZQ5A 4QPRA 3DBAA 3ITBA 3ICYA 2XFTA 3SW1A 4PMAA 1L3LA 1K57A 4C6YA 5E2EA 3S4XA 3DW0A 4BWIA 4EBNA 4KQOA 3UB5P 3ZYTA 2V0WA 3VV4A 1W8YA 4OOMA 1ERMA 3CWFA 3BWLA 1W63Q 4IHQA 1HD8A 3G35A 5HD5A 3KO6A 3KYEA 1HVBA 2EA9A 3UE6A 4I3IA 1PWCA 3MFDA 3HLCA 3UDXA 3FG8A 3SZTA 5KIZA 4KUKA 3IWQA 1YQSA 4OQIA 3BRMA 1LHYA 3CPTA 2PU4A 3BFGA 4BL3A 3ZCZA 2JKFA 5DTSA 3N4IA 3G34A 2ZL1A 1DJCA 1K4EA 3NDEA 1I2WA 2JN7A 4CLCB 3MZEA 2XK1A 3VOLA 3BY9A 1K55A 2KDKA 3SH8A 2WGWB 1XFNA 4KZ9A 4MMNA 5FEGA 3KYQA 3V5MA 2IWDA 4S2PA 4Z1WA 4UAAA 4S2IA 3VP3A 2OAP1 2PD7A 4HHDA 4R1GA 5HFOA 1OTIA 5DF8A 3SS5A 5M18A 4NG2A 4I3JA 2DMWA 3N7WA 1BLSA 2XR0A 3Q7VA 2PYRA 2I9VA 4LV0A 2UV0E 1N9LA 4DE1A 3CAXA 4IBRA 5TR7A 2B18A 3CHWP 4PM5A 5F1FA 3IXGA 1KVLA 1L0GA 5F6AA 4JLFA 2XSSA 1YMSA 1HTZA 1LSVA 3S1YA 3HL9A 2J3TC 5BOHA 1ACFA 4OP8A 3MQ0A 2XFSA 3ZNTA 3QP6A 5GLBA 1BUEA 3CMZA 4OKPA 4LV3A 1ES2A 3HCYA 3FWLA 4GCZA 3WS1A 1NLYA 4QY5A 1GSWA 2QWSA 4PKYG 3M6BA 5AQBA 4DRTA 1DJBA 5L8MA 1M40A 3M2KA 3QP8A 5EVIA 2ZM2A 4FH4A 1V9ZA 5AJGA 5AQAA 2L0WA 4O7DA 4BBUA 5HD3A 5HSQA 4BBVA 3UN7A 4OONA 3HJIA 3OPLA 4II7A 1K54A 3GQZA 3E0YA 2HJEA 4C75A 3GDIA 5FQMA 2BLSA 3C4PA 3N8LA 5EFWA 4ZJ2A 4ESPA 1ZTUA 4O01A 4S2NC 4JGPA 1ZC2A 3EGDC 4NXEA 5J8XA 2HDUA 1ZG4A 3HLFA 1XX2A 1WE4A 2ZM0A 2A24A 4CLCC 1PWDA 3KSHA 3ZHHA 3W2ZA 1S4RA 3WRTA 1KOUA 4ZTKA 5FQ9A 3BLSA 1KDWA 2J9OA 4Z9QA 4X25A 1XJ2A 3ULFA 4FSFA 4ETZA 3GTCA 2K31A 5CTNA 3C2WA 5EOEA 2WKQA 5FQKA 4WZ5C 4X6TA 1A0KA 4GS9B 1ZHHB 1NLZA 3ZG0A 1Y54A 3MQQA 1L2SA 3BM6A 1NZOA 2KLIA 4JXVA 3RFBA 2X02A 4OQ0A 3S7PA 1DP6A 2VV7A 4X53A 1ONHA 3C4OA 3A3DA 3T1RA 3F1NA 3HLDA 4NEED 1LT0A 4KZAA 2WZXA 2H0YA 2Z2MB 1ERQA 4EERA 5HAQA 4MCWA 5FAQA 4XT2A 3QP1A 1FCOA 1YKDA 3B42A 3OPHA 4O8GA 5J4EA 1C3BA 4ZJ1A 3IHBA 1K4FA 1J3WA 1NYYA 3ZG8B 3HREA 1XJ4A 1H8MA 1GSXA 1H3QA 2WGVA 5FA7A 1S1YA 3ZG5A 3UE0A 2Y2KA 4MBKA 4NXBA 1YT4A 1EI5A 3VP2A 5IHVA 4GW9A 3T4SA 1YPRA 4R3AA 4I38A 4EBLA 4U0TA 4WM9A 3P98A 5TGFA 3HUOA 1Y28A 1SDEA 4MEZA 3UPOA 3W8KA 3WS5A 1N9BA 3CPTB 2XQZA 3VOZA 3B47A 1MKIA 3LUQA 1OT6A 1WYBA 1SKFA 2ZJ9A 2ZL1B 5FQJA 3VP1A 4EU0A 3A3JA 3BFFA 4DE2A 3T4OA 3E4OA 1N9OA 4DJ3A 3P09A 3L9KA 4BD0A 1IYQA 1QMFA 3UPNA 5J7EA 1RGYA 5GHYA 1CF0A 1ONGA 3HLEA 4OPRA 1S1ZA 3CJMA 1PZOA 3IQAA 4OLDA 5G4YA 3UDIA 2VJWA 3ZFZA 2ZQ9A 2EX2A 3T4TA 3PAEA 5L07A 3Q7VB 2NUPC 2QHKA 4Y0UA 3NC8A 2ZMFA 1KE4A 3HLBA 4GKUA 2WGWA 4LRYC 4NETA 2Q9NA 3BQAA 5EM0A 1K25A 1IYOA 3SH7A 2XD5A 1PRQA 2XLNA 3AGFA 3EEAA 1PW1A 1PI4A 1IFQA 2PR5A 4WYYA 1PNEA 1XXMA 3DTMA 4S2MA 1L0DA 4GHIB 1FILA 5HZHA 1K57C 4OH0A 1G6AA 2HP9A 4P85A 4G3WA 4EUVA 2D02A 2VX8A 3CG5A 3GRJA 5DVAA 1S0WA 2W0NA 1GHPA 1YLYA 3PBNA 5HW3A 4ZRRA 5CXWA 3BEBA 3T12B 3E4QA 3UB9A 3A3EA 3TG9A 1N4OA 5EVIB 2HDRA 3ZGAB 1IEMA 1SHVA 4OQGA 4Q0IA 2WKIA 2B5RA 3EWKA 2QZ6A 4GB7A 3UO9A 2ZM8A 5DFXA 3GSGA 5HAPA 1DY6A 2VKSA 1TDGA 3VE3A 2QYBA 1G6OA 2JE5A 1BULA 3OCLA 4EQ1A 1XGJA 4RX3A 3IX3A 4GN2A 5M1AA 1CEFA 2A24B 4WMCA 1EW0A 5LBRA 4MDZA 2Y4AA 1FCMA 4YFMA 1MXOA 5C5KA 1K55C 5FSRA 2I72A 4JXSA 3ZNYA 4KG6A 5CRFA 5CHJA 1I5QA 4MBHA 2JKRM 3KYZA 2KX6A 4Q0HA 2HP5A 1L0FA 2PR6A 3UMDA 2JKGA 2FFYA 1SCWA 1K6SA 2O0YA 1K56D 4YOFA 3EQVA 4MN7A 2LB9A 5TJJA 1DP9A 2PBYA 2OWHA 1ODVA 3F1NB 3UPPA 4FTXA 5CECA 4H6JA 4DXCA 2VGJA 3DAVA 3G2ZA 2FZ0A 2E8JA 3E2KA 5CEDA 2A3UA 4PM7A 3N8SA 4KQRA 5DTKA 4Y3IA 3ISGA 4E3MA 1SZVA 1NRFA 1PWGA 5E2GA 2J7VA 1MY8A 4DXBA 4YINA 4S2JA 1IYPA 5CHUA 1BLCA 3ITAA 3MKFA 2VEAA 4MNRA 3EEHA 4X1MA 1HZOA 1OMEA 3NIAA 5EVEA 3O5YA 3MSHA 2EWVA 5E43A 4QB8A 1E3UA 4WF0A 2ZC5B 2JHEA 4WL9A 1H5XA 1BZAA 1OTBA 2ZMAA 1KGGA 3TOIA 2Y2MA 4KG5A 3EOIA 1K54C 1TS0A 2QKPA 1S6RA 1TS8A 4GDBA 4NKPA 5HDCA 1F98A 1PFLA 2VA0A 3K3CA 5JYOA 3JVVA 1YM1A 2Z2LB 1YSQA 1MBLA 3FPWA 4E3IA 4Y2FA 4ZAMA 1FCNA 1XFQA 5K5BA 4FCFA 3T50A 1GA0A 2V20A 3LR3A 1TVFA 1F2KA 4R4SA 2R9WA 3C7VA 4UQIS 4K0WA 4JGOA 1QMEA 1GHIA 2EX8A 5IT5A 1TS7A 3IH8A 4ID4A 5CEBA 3BFCA 2XGNA 1PW8A 1ESIA 3IWIA 1P97A 4OPZA 1GA9A 4JF6A 4LPZA 4ETXA 4D2OA 1ES4A 4IUKA 1JTDA 4JXGA 4OOYA 3QP5A 5KSCA 1E25A 3WRZA 2MJ6A 4NXGA 5IU1A 2WZZA 1OJGA 1HLUP 2LB5A 2OSUA 3LFVA 3PHYA 4XUZA 1TF1A 4HNBA 2Z6CA 1G68A 4QD4A 4L9GA 4C3QA 4PHTA 3KSIA 3HVFA 2Y55A 1NYMA 4ARZB 4GHIA 3PBQA 3OOVA 2ACGA 4CLCE 3OBFA 4S2KA 2J9PA 4IVKA 1IOUA 3G31A 4P87A 4XXRA 4F94A 5EOOA 3V39A 4IEDA 5AQ9A 2Y59A 3IHAA 4JKTA 2IWBA 5FDSA 2QJ7A 3I7JA 4WELA 1PYYA 2ZQ7A 3BYDA 5FI6A 2ZD8A 4GOGA 1KVMA 5MC7A 1T19A 3FKVA 3OC2A 3LIEA 1DRMA 3T1SA 2JKRI 4R3BA 3O86A 4FH2A 3LIBA 1CQAA 3IXBA 5CTMA 3PTEA 4QHCA 4EXOA 5EUAA 5IS1A 2J3TD 3AGEA 3FKWA 5F68A 1J9MA 2IA2A 3V3RA 1W5DA 3JVUA 2J8YA 3OPRA 4HY8A 3C30A 1K0KA 1FR6A 1OJ5A 1E4DA 4XUXA 3E98A 3GV9A 3G4PA 2JBFA 3MXRA 5L09A 3EGXC 4M3KA 2WUQA 4WBGA 5DJTA 5EVLA 4E04A 5M19A 3MF0A 5FI2A 4LCMA 4OP5A 4R0QA 3OZHA 4H6JB 2BG1A 3KSFA 4ZDXA 1YAXA 4RQ9A 2Y2QA 1LSWA 2PBDP 3LR0A 3Q7ZA 3R4KA 1JVJA 5DF9A 1CI9A 4Y5FA 2ZC3B 2Y79A 3H82A 4H8RA 3S7NA 5U47A 3UE3A 2XROA 2K7SA 1NWZA 4DF6A 1F9IA 1MWUA 2VZWA 4K08A 4P6ZS 2H10A 3HLWA 2W1TB 2P08A 3A0SA 3BFEA 4CLCD 3FZCA 2OV5A 2A2LA 2D01A 1LL5A 2PRFA 3D72A 1NJ4A 3QP4A 1X0OA 2PT7A 3OLOA 4GZBA 4EETB 3F1OB 4ME4A 3O3VA 4UA7A 3NDGA 1IELA 1RCJA 1Z6FA 1S66L 2W27A 3CUEA 3NY4A 4WZ4A 4HJ6A 4BQMA 4I39A 1YLPA 3SS3A 4N9LA 5AVFA 4QJGA 1XJ6A 3MR0A 3PAGA 4WEKA 3IH9A 3QHYA 3MFXA 3KX0X 4G3VA 2B02A 1W8QA 4R6LA 3V50A 2QJ5A 5DF7A 4YNRA 5HL6A 2EX9A 2ZOIA 3V3SA 2W3HA 3Q1FA 2Y2HA 1GCEA 3E4PA 1KE3A 3LIAA 4S2OA 4CJNA 1G28A 4U3TA 2X01A 1XP4A 1MPLA 4MN6A 2ZQDA 3FC7A 3IXDA 2HPBA 3OCNA 4RVAA 3VE4A 1KGEA 2M7VA 3WS4A 1M6KA 2ZBBA 1MC0A 2XF3A 2H28A 1K6RA 4E3NA 1CEGA 3MS6A 2V1BA 4DMZA 2W3DA 4G3KA 3Q81A 4KZ4A 3PBSA 3NOUC 5CGSA 1XA7A 3K3DA 3H7WA 2HP6A 4LV2A 5DTTA 1TEMA 2OLVA 4PM6A 3MJQA 1RGZA 3LR4A 4HBTA 3S7QA 4NXFA 4R3JA 1UWNX 1NZUA 4OVDA 2EFUA 4P6ZM 1LI9A 2O99A 4IVIA 5A91A 1LL9A 5A90A 1XA1A 3UNWA 4F3LB 4N9KA 4OLGA 5HWVA 4BL2A 3O88A 5F82A 1XPBA 3IF6A 3RXXA 3EQUA 4Y15A 1MZUA 3UY6A 2P9VB 4B9OA 4KZ3A 3IBRA 1YLZA 2KOIA 4PAUA 4AFIA 2C6WB 3ZG9B 2Y8HA 3C38A 4ARZA 2XA7S 4RX2A 3L7HA 1P9WA 5FQIA 1Y4OA
chains in the Genus database with same CATH topology
2Z6DA 4JGRA 1OTDA 3PBRA 4WF0A 3P01A 5HDDA 2JHEA 2GNXA 5L8MA 4WL9A 4LRZE 4EW7A 3A0VA 1OTBA 3LICA 5AVEA 3EOIA 1TS0A 2QKPA 3HJKA 1TS8A 3IBJA 2P7JA 4NKPA 2HJ9C 2L4RA 5HDCA 1TD5A 1V9ZA 5AJGA 1F98A 2VA0A 3T4JA 2HV1A 3K3CA 2L0WA 4BBUA 3JVVA 5HD3A 1LSXA 5HSQA 4BBVA 3T4QA 1YSQA 3FPWA 3HJIA 4II7A 4Y2FA 3E0YA 2HJEA 3GDIA 1XFQA 4PKYA 5K5BA 3U2AA 4IUHA 3PR6A 3RTYA 5G4ZA 5EFWA 3T50A 3T4LA 1ZTUA 3LR3A 4O01A 5DFYA 4JGPA 4UQIS 3EGDC 4JGOA 4NXEA 2VGLS 5DKKA 4HQAA 5IT5A 3G6OA 2A24A 4DJ2A 1TS7A 4CLCC 4IJGA 3KSHA 3W2ZA 3UB6A 1S4RA 1P97A 1KOUA 4LPZA 1BYWA 3PYPA 3BW6A 4ETXA 1XJ2A 3ULFA 4FSFA 3H82B 4ETZA 3GECA 4LLOB 2ZOHA 4L9EA 2K31A 4IUKA 3C2WA 2WKQA 4LRXC 4CLCA 2VLGA 2R78A 4GS9B 1XJ3A 1ZHHB 2MJ6A 4NXGA 3T4KA 1NLZA 4HH2A 5IU1A 5DKLA 1OJGA 3MQQA 2LB5A 4JGQA 1OT9A 5F69A 2O9CA 2KLIA 3RFBA 3F1PA 3LFVA 3TE8A 3PHYA 3S7PA 1DP6A 1TF1A 2VV7A 4WEJA 5HDSA 4HNBA 3LI9A 2Z6CA 2FH5A 4R38A 3F1NA 2HF6A 4NEED 1LT0A 3PBTA 1LL8A 1JNUA 4L9GA 4GJ4A 4BJPA 5TBMB 4EERA 2W1RA 4PHTA 2K2NA 4MCWA 1S67L 3KSIA 4KUOA 4XT2A 4WLAA 4ARZB 4GHIA 1YKDA 3PBQA 3B42A 3OOVA 3TRCA 4CLCE 3OBFA 4O8GA 3LI8A 2V9AA 5J4EA 2W1TA 1IOUA 3B33A 2V1AA 1NRJA 2WKPA 3FPVA 2JKTI 4WUJA 1XJ4A 1H8MA 1GSXA 1H3QA 3F1OA 1S1YA 4O0PA 3A0RA 2QJ7A 5HPFA 2VV8A 1WA9A 4WELA 2OAQ1 3NJAA 4NXBA 4L9FA 5MC7A 1T19A 4GW9A 4HJ4A 3T4SA 4R3AA 4I38A 3OC2A 5KSHA 2PD8A 1OPXA 3LIEA 3CLOA 1DRMA 2GZAA 3LIFA 3KSGA 1P9RA 1Y28A 2JKRI 1VHMA 2V0UA 5J3WA 3LIBA 3MXQA 2YKHA 4EXOA 5IS1A 2J3TD 4HI4A 5F68A 3B47A 3LUQA 1P0ZA 1T1BA 1OT6A 2VV6A 2IA2A 4OOLA 3LIDA 3MQOA 3JVUA 5HPIA 4EU0A 4HOIA 4UEYA 2PDRA 4HY8A 2INWA 4EEUA 3T4OA 3E4OA 1N9OA 4L0LA 4DJ3A 2ZMVA 3C30A 5A8BA 1OJ5A 4BMWA 5J7EA 1T1CA 3E98A 2VGLM 1GSVA 4B93A 3TJZC 1D06A 2OWJA 1S1ZA 1UWPX 4HIAA 4MN5A 2O9BA 2BASA 5G4YA 3RH8B 2W3GA 2VJWA 3BY8A 3EGXC 1MKMA 3PBOA 2XRNA 4I5SA 2G7UA 5DJTA 4E04A 3MF0A 3T4TA 3H7WB 2WKRA 2CMNA 3R7WA 3H9WA 2NUPC 4H6JB 2QHKA 2PHYA 5I5LA 3KSFA 4GLQA 1YAXA 2O9AA 2ZMFA 4RQ9A 1LSWA 3F1PB 1V9YA 4LRYC 3LR0A 4EEPA 3R4KA 3BQAA 2OOLA 5DF9A 3P7NA 4Y5FA 2PYPA 3IS2B 2Y79A 1N9NA 3H82A 3S7NA 3UE3A 3V67A 2XROA 2K7SA 3EEAA 1NWZA 1IFQA 2PR5A 2J80A 1F9IA 1TS6A 3UB8A 4GS9A 2VZWA 4XT2B 4K08A 1UGUA 2M1CA 4GHIB 4P6ZS 5HZHA 2W1TB 2P08A 3A0SA 4CLCD 4G3WA 2A2LA 2D01A 4EUVA 2D02A 3CUEC 3UB7A 1STZA 2VX8A 2EWWA 3D3OA 2XA7M 3D72A 4KQDA 4WN5A 4BBTA 2W0NA 1X0OA 3UMEA 2PT7A 2YKFA 3OLOA 4EETB 3F1OB 3MMHA 3PBNA 3ZQ5A 4QPRA 4ZRRA 1T1AA 4ME4A 3DBAA 4F3LA 3ICYA 3NHQA 3SW1A 3E4QA 3UB9A 4M4XA 3LYXA 5TBMA 1OTAA 1S66L 2W3FA 2W27A 4BWIA 3TW8A 3CUEA 1T18A 4KQOA 2GX5A 4HJ6A 4Q0IA 3ZYTA 2V0WA 3VV4A 4I39A 2P04A 4OOMA 3EWKA 3CITA 4Q0JA 4YWZA 3NOTC 1DP8A 3CWFA 5AVFA 3BWLA 1W63Q 5DFXA 4IHQA 1XJ6A 3MR0A 2VKSA 4WEKA 3VE3A 2QYBA 3KO6A 5HD5A 1G6OA 3MFXA 3KX0X 4G3VA 2B02A 2EA9A 4I3AA 3UE6A 4R6LA 4I3IA 4HJ3A 5FL3A 3OCLA 2QJ5A 2JKTM 4EQ1A 3FG8A 4YNRA 5HL6A 1S4SA 2ZOIA 5KIZA 4UQIM 2W3HA 2NUTC 4KUKA 2A24B 1F5MA 1EW0A 3E4PA 5LBRA 3LIAA 1YSPA 1D7EA 4MDZA 3CI6A 2W3EA 1G28A 1OTEA 2HGVA 5C5KA 4MN6A 3FC7A 3OCNA 2JKRM 3R7WB 3VE4A 3KYZA 2JN7A 2KX6A 4CLCB 4Q0HA 2M7VA 2M7UA 2PR6A 2L1MA 3UMDA 3VOLA 5DJUA 3BJNA 3BY9A 2ZBBA 1MC0A 2H28A 2KDKA 1XFNA 4MMNA 3KYQA 5F5YA 2O0YA 3K2NA 4YOFA 4Z1WA 3EQVA 2V1BA 4DMZA 5HWWA 4MN7A 2LB9A 2OAP1 2PD7A 2W3DA 4G3KA 4HHDA 5TJJA 1DP9A 1OTIA 3PBSA 3PXPA 4HP4A 3NOUC 2OWHA 1ODVA 3F1NB 4HH3A 3K3DA 4I3JA 2DMWA 3H7WA 3NOPC 2PYRA 2I9VA 4H6JA 1N9LA 3MJQA 2J3WA 3CAXA 3LR4A 4R70A 3S7QA 4NXFA 4EESA 2FZ0A 1UWNX 2B18A 4P6ZM 2O99A 5F6AA 4DN0A 2XSSA 1LSVA 4CQHA 2GJ3A 3IS2A 3LR5A 4F3LB 4FOFA 4Y3IA 5HWVA 2J3TC 1VB6A 3EQUA 1MZUA 1W63M 4B9OA 3MQ0A 3IBRA 4HP9A 2KOIA 4PAUA 4AFIA 2Y8HA 3C38A 2VEAA 4ARZA 2XA7S 5CX7A 3EEHA 3BQ8A 3HCYA 5HWTA 4GCZA 1NLYA 3O5YA 3C8CA 1GSWA 2QWSA 1P9WA 2EWVA 4PKYG 3S7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VX8 A;  3EGD C;  2DMW A;  2NUT C;  1IFQ A;  1IOU A;  1H8M A;  2NUP C;  4B93 A;  3KYQ A;  3BW6 A;  3EGX C;  4AFI A; 
#chains in the Genus database with same CATH topology
 3IF5 A;  2Y2O A;  4HEF A;  4IBX A;  2GDN A;  5GLD A;  3P01 A;  5HDD A;  3WS2 A;  4E3K A;  4LRZ E;  3A0V A;  2X71 A;  3DWK A;  4JXW A;  3LIC A;  5AVE A;  3BFD A;  1BT5 A;  3ZVW A;  2HJ9 C;  1TD5 A;  3NI9 A;  3T4J A;  2HV1 A;  1YLW A;  3B3X A;  4RA7 A;  2JCH A;  4A5R A;  3WS0 A;  3PR6 A;  5G4Z A;  3T4L A;  3W4Q A;  1NY0 A;  3G32 A;  1K38 A;  3HUM A;  5DKK A;  1CI8 A;  2WAF A;  4ZBE A;  2ZC6 B;  3QNB A;  3UB6 A;  3UDF A;  2XH9 A;  3HLG A;  1G5U A;  1FR1 A;  3GR2 A;  4LCL A;  5CER A;  2DRW A;  1O07 A;  3H82 B;  2Q0O A;  1KGF A;  4E6W A;  1U60 A;  4L9E A;  5FAS A;  1EWZ A;  4LRX C;  2Y2N A;  2VLG A;  1XJ3 A;  1I2S A;  2DCF A;  4BLM A;  4JGQ A;  5E2H A;  1OT9 A;  5F69 A;  2Q9M A;  2RCX A;  2O9C A;  3TE8 A;  4LV1 A;  3LCE A;  4QU3 A;  2G2W A;  4E3L A;  2OLU A;  1BSG A;  3MZD A;  2HF6 A;  3PBT A;  1LL8 A;  1JNU A;  1ZKJ A;  4OPQ A;  3GVB A;  2W1R A;  3DWZ A;  2K2N A;  4KUO A;  2E8I A;  4EQI A;  3W4O A;  3UE1 A;  2EXA A;  4DDY A;  3LI8 A;  2V9A A;  2W1T A;  4E3J A;  1SKO A;  2V1A A;  2VK3 A;  5EVI C;  1Z09 A;  4WUJ A;  4LGW A;  3M2J A;  1SDN A;  3F1O A;  4X69 A;  4O0P A;  3FYZ A;  3A0R A;  4MLL A;  2Y2P A;  1WA9 A;  2OAQ 1;  3NJA A;  4KZ5 A;  4L9F A;  4QY6 A;  2EX6 A;  5FAP A;  3LO7 A;  4HJ4 A;  2WYX A;  5G18 A;  2PD8 A;  1OPX A;  4GD6 A;  3CLO A;  5GLC A;  2GZA A;  3FV7 A;  1VHM A;  5J3W A;  2HDS A;  4HI4 A;  3MKE A;  3WWX A;  4UA9 A;  3MQO A;  1AWI A;  5HPI A;  4HOI A;  4DE0 A;  4UEY A;  2PDR A;  3SOI A;  4KQQ A;  3ZVT A;  2XDM A;  1JWP A;  1K56 A;  1VET A;  5EVI D;  2AVX A;  3QNC A;  1T1C A;  4B93 A;  1D06 A;  4KZ6 A;  2OWJ A;  2C5W B;  4RYE A;  5CGW A;  4HIA A;  4MN5 A;  2O9B A;  1CK3 A;  5CGX A;  2BAS A;  3RH8 B;  2W3G A;  1VQQ A;  4Y7P A;  3PBO A;  4I5S A;  3H7W B;  2WKR A;  4P0M A;  3H9W A;  3N6I A;  2PHY A;  5I5L A;  4K91 A;  3Q82 A;  3ZG7 B;  2O9A A;  3OPP A;  1YLT A;  3F1P B;  4Y13 A;  2ZQ8 A;  4EEP A;  2OOL A;  4KZ8 A;  3P7N A;  3HBR A;  1N9N A;  4X1L A;  4DE3 A;  1H8Y A;  3VFF A;  3IF6 B;  2J80 A;  1TS6 A;  1VEU B;  2G2U A;  3UB8 A;  4MBF A;  5F1G A;  2R9X A;  1O7E A;  3LEZ A;  3SS4 A;  3CUE C;  3T1Q B;  1STZ A;  3VMA A;  4WN5 A;  4BBT A;  1YMX A;  2YKF A;  2ZC7 A;  1T1A A;  4F3L A;  3NHQ A;  2WGI A;  4M4X A;  3LYX A;  5TBM A;  1OTA A;  5HX9 A;  3VOY A;  2B95 A;  2W3F A;  2P9V A;  3TW8 A;  3JPU A;  1T18 A;  3VSK A;  1YLJ A;  2GX5 A;  4UA6 A;  2ZQA A;  1MWR A;  2P04 A;  3W4P A;  3CIT A;  4Q0J A;  4YWZ A;  3MZF A;  4N92 A;  3MBZ A;  1DP8 A;  3NOT C;  3TSG A;  1D1J A;  1GHM A;  3G30 A;  3IWO A;  4PM8 A;  1ZG6 A;  5KZH A;  4I3A A;  4HJ3 A;  2H5S A;  5FL3 A;  1PI5 A;  1ES3 A;  2JKT M;  1JWZ A;  2Y2L A;  4E6X A;  5EM1 A;  1RP5 A;  5A93 A;  1S4S A;  4JF5 A;  4UQI M;  2NUT C;  4KZ7 A;  1F5M A;  1YSP A;  1D7E A;  2PU2 A;  3CI6 A;  2V8C A;  2W3E A;  3U4L P;  1OTE A;  2HGV A;  4B4Z A;  2QPN A;  1FIK A;  2FFF B;  1BLH A;  3R7W B;  2M7U A;  3VP4 A;  2L1M A;  4BD1 A;  5DJU A;  3BJN A;  3M6H A;  5GHX A;  2HDQ A;  3Q07 A;  5F5Y A;  5GLA A;  3K2N A;  4X55 A;  5HWW A;  5FAO A;  4Y17 A;  4HP4 A;  3PXP A;  1JTG A;  4HH3 A;  4EWF A;  2V2F F;  3NOP C;  4X68 A;  5HL1 A;  2CC1 A;  5E2F A;  2Y2I A;  2J3W A;  4KG2 A;  4R70 A;  5L10 A;  3IF6 C;  4EES A;  3LY4 A;  1DJA A;  2PAV P;  1SKO B;  4R23 A;  3IXH A;  4DN0 A;  2VGK A;  5HAR A;  4CQH A;  2GJ3 A;  3IS2 A;  1H8Z A;  3LR5 A;  4FOF A;  1VB6 A;  4EBP A;  1ESU A;  5I94 A;  1NXY A;  1W63 M;  5EE8 A;  3VP0 A;  4HP9 A;  5FAT A;  5CX7 A;  3NCK A;  3NUL A;  3BQ8 A;  5HWT A;  5GL9 A;  3C8C A;  3D4F A;  3C7U A;  3S7O A;  1LLB A;  2Z6D A;  4JGR A;  1OTD A;  1XGI A;  3PBR A;  1IYS A;  1IKG A;  2GNX A;  4X56 A;  4EW7 A;  3C5A A;  5D3O A;  4PPR A;  1FSY A;  1PIO A;  1KDS A;  3HJK A;  4HES A;  3IBJ A;  2P7J A;  2L4R A;  4Y0O A;  1ERO A;  1VET B;  3LEQ A;  1LSX A;  1MWS A;  1JWV A;  3DTE A;  2WAD A;  3T4Q A;  5FEF A;  4DDS A;  2EFX A;  3LY3 A;  3D9Y A;  4PKY A;  1W79 A;  3U2A A;  4IUH A;  3G2Y A;  4GD8 A;  3RTY A;  2DNS A;  2WAE A;  4JPM A;  4N1X A;  3CZD A;  4Q8I A;  5DFY A;  3ZDJ A;  3BLM A;  2XEP A;  3JYI A;  4BEN A;  2VGL S;  4HQA A;  4N1H A;  4JF4 A;  3G6O A;  4DJ2 A;  3MXS A;  4IJG A;  1PZP A;  2BTF P;  2Y2J A;  4ZJ3 A;  4E3O A;  2WK0 A;  4S2N A;  3E2L A;  1BYW A;  3PYP A;  3QP2 A;  3BW6 A;  1XKZ A;  4WMC D;  1Q2P A;  2H0T A;  3GEC A;  1FSW A;  4LLO B;  2ZOH A;  2EXB A;  1Q2Q A;  4CLC A;  2QMI A;  2R78 A;  5L2F A;  4FUW A;  3T4K A;  4HH2 A;  1W7F A;  5DKL A;  3IX4 A;  2HZ5 A;  4LEN A;  1ES5 A;  3F1P A;  4K0X A;  5FDH A;  5CHM A;  2ZLY A;  4WZ5 A;  4WEJ A;  5HDS A;  3LGO A;  5FI7 A;  3LI9 A;  5F83 A;  5TFQ A;  2FH5 A;  4R38 A;  4GJ4 A;  4BJP A;  5TBM B;  1H0M A;  1VEU A;  1FQG A;  1S67 L;  2A49 A;  3N8R A;  5KMW A;  1CJF A;  4WLA A;  3TRC A;  4JBF A;  2P74 A;  3B33 A;  4B88 A;  2IWC A;  1NRJ A;  2WKP A;  3A3I A;  3FPV A;  2JKT I;  2V1Z A;  2WKH A;  1LI0 A;  5HPF A;  2VV8 A;  2UWX A;  2JC7 A;  3VSL A;  3S22 A;  3GMW A;  3IX8 A;  4PM9 A;  4NK3 A;  5FQQ A;  4HBU A;  5KSH A;  2Y91 A;  3LIF A;  3KSG A;  3BEC A;  1P9R A;  2V0U A;  3VFH A;  4EV4 A;  3MXQ A;  1MWT A;  1IKI A;  2YKH A;  2ZQC A;  2WKE A;  4KZB A;  4R4R A;  1P0Z A;  1T1B A;  2VV6 A;  3A3F A;  4KEN B;  4OOL A;  1VM1 A;  1E3U D;  3LID A;  1FOF A;  4OQH A;  2INW A;  4LFU A;  4EEU A;  5GHZ A;  4L0L A;  4QWO A;  2ZMV A;  5A8B A;  5EEC A;  4BMW A;  4CPK A;  5A92 A;  5JYP A;  2VGL M;  1GSV A;  4B4X A;  1BTL A;  3TJZ C;  4S2L A;  3T1X A;  4U0X A;  1BLP A;  1UWP X;  3BY8 A;  3SH9 A;  1MKM A;  2XRN A;  4D60 A;  2G7U A;  5EPH A;  4DKI A;  2CMN A;  1KE0 A;  3HUN A;  3R7W A;  5HAI A;  2XD1 A;  1TDL A;  3AGD A;  4GLQ A;  2Y2G A;  4EUZ A;  3IT9 A;  1V9Y A;  4OPY A;  3RJU A;  4P6B A;  1AXB A;  3RXW A;  2PYP A;  3IS2 B;  2V8F A;  4GDN A;  1WYC A;  1ALQ A;  2ZC4 B;  3NEC A;  4GNU A;  3V67 A;  3NBL A;  3DTK A;  4GS9 A;  4XT2 B;  1UGU A;  2M1C A;  4UHU A;  2RL3 A;  3DTI A;  3O87 A;  4Y0T A;  4FD8 A;  5EV0 A;  5AQ7 A;  1L0E A;  3UB7 A;  2EWW A;  3D3O A;  2XA7 M;  4KQD A;  3UME A;  3MMH A;  3ZQ5 A;  4QPR A;  3DBA A;  3ITB A;  3ICY A;  2XFT A;  3SW1 A;  4PMA A;  1L3L A;  1K57 A;  4C6Y A;  5E2E A;  3S4X A;  3DW0 A;  4BWI A;  4EBN A;  4KQO A;  3UB5 P;  3ZYT A;  2V0W A;  3VV4 A;  1W8Y A;  4OOM A;  1ERM A;  3CWF A;  3BWL A;  1W63 Q;  4IHQ A;  1HD8 A;  3G35 A;  5HD5 A;  3KO6 A;  3KYE A;  1HVB A;  2EA9 A;  3UE6 A;  4I3I A;  1PWC A;  3MFD A;  3HLC A;  3UDX A;  3FG8 A;  3SZT A;  5KIZ A;  4KUK A;  3IWQ A;  1YQS A;  4OQI A;  3BRM A;  1LHY A;  3CPT A;  2PU4 A;  3BFG A;  4BL3 A;  3ZCZ A;  2JKF A;  5DTS A;  3N4I A;  3G34 A;  2ZL1 A;  1DJC A;  1K4E A;  3NDE A;  1I2W A;  2JN7 A;  4CLC B;  3MZE A;  2XK1 A;  3VOL A;  3BY9 A;  1K55 A;  2KDK A;  3SH8 A;  2WGW B;  1XFN A;  4KZ9 A;  4MMN A;  5FEG A;  3KYQ A;  3V5M A;  2IWD A;  4S2P A;  4Z1W A;  4UAA A;  4S2I A;  3VP3 A;  2OAP 1;  2PD7 A;  4HHD A;  4R1G A;  5HFO A;  1OTI A;  5DF8 A;  3SS5 A;  5M18 A;  4NG2 A;  4I3J A;  2DMW A;  3N7W A;  1BLS A;  2XR0 A;  3Q7V A;  2PYR A;  2I9V A;  4LV0 A;  2UV0 E;  1N9L A;  4DE1 A;  3CAX A;  4IBR A;  5TR7 A;  2B18 A;  3CHW P;  4PM5 A;  5F1F A;  3IXG A;  1KVL A;  1L0G A;  5F6A A;  4JLF A;  2XSS A;  1YMS A;  1HTZ A;  1LSV A;  3S1Y A;  3HL9 A;  2J3T C;  5BOH A;  1ACF A;  4OP8 A;  3MQ0 A;  2XFS A;  3ZNT A;  3QP6 A;  5GLB A;  1BUE A;  3CMZ A;  4OKP A;  4LV3 A;  1ES2 A;  3HCY A;  3FWL A;  4GCZ A;  3WS1 A;  1NLY A;  4QY5 A;  1GSW A;  2QWS A;  4PKY G;  3M6B A;  5AQB A;  4DRT A;  1DJB A;  5L8M A;  1M40 A;  3M2K A;  3QP8 A;  5EVI A;  2ZM2 A;  4FH4 A;  1V9Z A;  5AJG A;  5AQA A;  2L0W A;  4O7D A;  4BBU A;  5HD3 A;  5HSQ A;  4BBV A;  3UN7 A;  4OON A;  3HJI A;  3OPL A;  4II7 A;  1K54 A;  3GQZ A;  3E0Y A;  2HJE A;  4C75 A;  3GDI A;  5FQM A;  2BLS A;  3C4P A;  3N8L A;  5EFW A;  4ZJ2 A;  4ESP A;  1ZTU A;  4O01 A;  4S2N C;  4JGP A;  1ZC2 A;  3EGD C;  4NXE A;  5J8X A;  2HDU A;  1ZG4 A;  3HLF A;  1XX2 A;  1WE4 A;  2ZM0 A;  2A24 A;  4CLC C;  1PWD A;  3KSH A;  3ZHH A;  3W2Z A;  1S4R A;  3WRT A;  1KOU A;  4ZTK A;  5FQ9 A;  3BLS A;  1KDW A;  2J9O A;  4Z9Q A;  4X25 A;  1XJ2 A;  3ULF A;  4FSF A;  4ETZ A;  3GTC A;  2K31 A;  5CTN A;  3C2W A;  5EOE A;  2WKQ A;  5FQK A;  4WZ5 C;  4X6T A;  1A0K A;  4GS9 B;  1ZHH B;  1NLZ A;  3ZG0 A;  1Y54 A;  3MQQ A;  1L2S A;  3BM6 A;  1NZO A;  2KLI A;  4JXV A;  3RFB A;  2X02 A;  4OQ0 A;  3S7P A;  1DP6 A;  2VV7 A;  4X53 A;  1ONH A;  3C4O A;  3A3D A;  3T1R A;  3F1N A;  3HLD A;  4NEE D;  1LT0 A;  4KZA A;  2WZX A;  2H0Y A;  2Z2M B;  1ERQ A;  4EER A;  5HAQ A;  4MCW A;  5FAQ A;  4XT2 A;  3QP1 A;  1FCO A;  1YKD A;  3B42 A;  3OPH A;  4O8G A;  5J4E A;  1C3B A;  4ZJ1 A;  3IHB A;  1K4F A;  1J3W A;  1NYY A;  3ZG8 B;  3HRE A;  1XJ4 A;  1H8M A;  1GSX A;  1H3Q A;  2WGV A;  5FA7 A;  1S1Y A;  3ZG5 A;  3UE0 A;  2Y2K A;  4MBK A;  4NXB A;  1YT4 A;  1EI5 A;  3VP2 A;  5IHV A;  4GW9 A;  3T4S A;  1YPR A;  4R3A A;  4I38 A;  4EBL A;  4U0T A;  4WM9 A;  3P98 A;  5TGF A;  3HUO A;  1Y28 A;  1SDE A;  4MEZ A;  3UPO A;  3W8K A;  3WS5 A;  1N9B A;  3CPT B;  2XQZ A;  3VOZ A;  3B47 A;  1MKI A;  3LUQ A;  1OT6 A;  1WYB A;  1SKF A;  2ZJ9 A;  2ZL1 B;  5FQJ A;  3VP1 A;  4EU0 A;  3A3J A;  3BFF A;  4DE2 A;  3T4O A;  3E4O A;  1N9O A;  4DJ3 A;  3P09 A;  3L9K A;  4BD0 A;  1IYQ A;  1QMF A;  3UPN A;  5J7E A;  1RGY A;  5GHY A;  1CF0 A;  1ONG A;  3HLE A;  4OPR A;  1S1Z A;  3CJM A;  1PZO A;  3IQA A;  4OLD A;  5G4Y A;  3UDI A;  2VJW A;  3ZFZ A;  2ZQ9 A;  2EX2 A;  3T4T A;  3PAE A;  5L07 A;  3Q7V B;  2NUP C;  2QHK A;  4Y0U A;  3NC8 A;  2ZMF A;  1KE4 A;  3HLB A;  4GKU A;  2WGW A;  4LRY C;  4NET A;  2Q9N A;  3BQA A;  5EM0 A;  1K25 A;  1IYO A;  3SH7 A;  2XD5 A;  1PRQ A;  2XLN A;  3AGF A;  3EEA A;  1PW1 A;  1PI4 A;  1IFQ A;  2PR5 A;  4WYY A;  1PNE A;  1XXM A;  3DTM A;  4S2M A;  1L0D A;  4GHI B;  1FIL A;  5HZH A;  1K57 C;  4OH0 A;  1G6A A;  2HP9 A;  4P85 A;  4G3W A;  4EUV A;  2D02 A;  2VX8 A;  3CG5 A;  3GRJ A;  5DVA A;  1S0W A;  2W0N A;  1GHP A;  1YLY A;  3PBN A;  5HW3 A;  4ZRR A;  5CXW A;  3BEB A;  3T12 B;  3E4Q A;  3UB9 A;  3A3E A;  3TG9 A;  1N4O A;  5EVI B;  2HDR A;  3ZGA B;  1IEM A;  1SHV A;  4OQG A;  4Q0I A;  2WKI A;  2B5R A;  3EWK A;  2QZ6 A;  4GB7 A;  3UO9 A;  2ZM8 A;  5DFX A;  3GSG A;  5HAP A;  1DY6 A;  2VKS A;  1TDG A;  3VE3 A;  2QYB A;  1G6O A;  2JE5 A;  1BUL A;  3OCL A;  4EQ1 A;  1XGJ A;  4RX3 A;  3IX3 A;  4GN2 A;  5M1A A;  1CEF A;  2A24 B;  4WMC A;  1EW0 A;  5LBR A;  4MDZ A;  2Y4A A;  1FCM A;  4YFM A;  1MXO A;  5C5K A;  1K55 C;  5FSR A;  2I72 A;  4JXS A;  3ZNY A;  4KG6 A;  5CRF A;  5CHJ A;  1I5Q A;  4MBH A;  2JKR M;  3KYZ A;  2KX6 A;  4Q0H A;  2HP5 A;  1L0F A;  2PR6 A;  3UMD A;  2JKG A;  2FFY A;  1SCW A;  1K6S A;  2O0Y A;  1K56 D;  4YOF A;  3EQV A;  4MN7 A;  2LB9 A;  5TJJ A;  1DP9 A;  2PBY A;  2OWH A;  1ODV A;  3F1N B;  3UPP A;  4FTX A;  5CEC A;  4H6J A;  4DXC A;  2VGJ A;  3DAV A;  3G2Z A;  2FZ0 A;  2E8J A;  3E2K A;  5CED A;  2A3U A;  4PM7 A;  3N8S A;  4KQR A;  5DTK A;  4Y3I A;  3ISG A;  4E3M A;  1SZV A;  1NRF A;  1PWG A;  5E2G A;  2J7V A;  1MY8 A;  4DXB A;  4YIN A;  4S2J A;  1IYP A;  5CHU A;  1BLC A;  3ITA A;  3MKF A;  2VEA A;  4MNR A;  3EEH A;  4X1M A;  1HZO A;  1OME A;  3NIA A;  5EVE A;  3O5Y A;  3MSH A;  2EWV A;  5E43 A;  4QB8 A;  1E3U A;  4WF0 A;  2ZC5 B;  2JHE A;  4WL9 A;  1H5X A;  1BZA A;  1OTB A;  2ZMA A;  1KGG A;  3TOI A;  2Y2M A;  4KG5 A;  3EOI A;  1K54 C;  1TS0 A;  2QKP A;  1S6R A;  1TS8 A;  4GDB A;  4NKP A;  5HDC A;  1F98 A;  1PFL A;  2VA0 A;  3K3C A;  5JYO A;  3JVV A;  1YM1 A;  2Z2L B;  1YSQ A;  1MBL A;  3FPW A;  4E3I A;  4Y2F A;  4ZAM A;  1FCN A;  1XFQ A;  5K5B A;  4FCF A;  3T50 A;  1GA0 A;  2V20 A;  3LR3 A;  1TVF A;  1F2K A;  4R4S A;  2R9W A;  3C7V A;  4UQI S;  4K0W A;  4JGO A;  1QME A;  1GHI A;  2EX8 A;  5IT5 A;  1TS7 A;  3IH8 A;  4ID4 A;  5CEB A;  3BFC A;  2XGN A;  1PW8 A;  1ESI A;  3IWI A;  1P97 A;  4OPZ A;  1GA9 A;  4JF6 A;  4LPZ A;  4ETX A;  4D2O A;  1ES4 A;  4IUK A;  1JTD A;  4JXG A;  4OOY A;  3QP5 A;  5KSC A;  1E25 A;  3WRZ A;  2MJ6 A;  4NXG A;  5IU1 A;  2WZZ A;  1OJG A;  1HLU P;  2LB5 A;  2OSU A;  3LFV A;  3PHY A;  4XUZ A;  1TF1 A;  4HNB A;  2Z6C A;  1G68 A;  4QD4 A;  4L9G A;  4C3Q A;  4PHT A;  3KSI A;  3HVF A;  2Y55 A;  1NYM A;  4ARZ B;  4GHI A;  3PBQ A;  3OOV A;  2ACG A;  4CLC E;  3OBF A;  4S2K A;  2J9P A;  4IVK A;  1IOU A;  3G31 A;  4P87 A;  4XXR A;  4F94 A;  5EOO A;  3V39 A;  4IED A;  5AQ9 A;  2Y59 A;  3IHA A;  4JKT A;  2IWB A;  5FDS A;  2QJ7 A;  3I7J A;  4WEL A;  1PYY A;  2ZQ7 A;  3BYD A;  5FI6 A;  2ZD8 A;  4GOG A;  1KVM A;  5MC7 A;  1T19 A;  3FKV A;  3OC2 A;  3LIE A;  1DRM A;  3T1S A;  2JKR I;  4R3B A;  3O86 A;  4FH2 A;  3LIB A;  1CQA A;  3IXB A;  5CTM A;  3PTE A;  4QHC A;  4EXO A;  5EUA A;  5IS1 A;  2J3T D;  3AGE A;  3FKW A;  5F68 A;  1J9M A;  2IA2 A;  3V3R A;  1W5D A;  3JVU A;  2J8Y A;  3OPR A;  4HY8 A;  3C30 A;  1K0K A;  1FR6 A;  1OJ5 A;  1E4D A;  4XUX A;  3E98 A;  3GV9 A;  3G4P A;  2JBF A;  3MXR A;  5L09 A;  3EGX C;  4M3K A;  2WUQ A;  4WBG A;  5DJT A;  5EVL A;  4E04 A;  5M19 A;  3MF0 A;  5FI2 A;  4LCM A;  4OP5 A;  4R0Q A;  3OZH A;  4H6J B;  2BG1 A;  3KSF A;  4ZDX A;  1YAX A;  4RQ9 A;  2Y2Q A;  1LSW A;  2PBD P;  3LR0 A;  3Q7Z A;  3R4K A;  1JVJ A;  5DF9 A;  1CI9 A;  4Y5F A;  2ZC3 B;  2Y79 A;  3H82 A;  4H8R A;  3S7N A;  5U47 A;  3UE3 A;  2XRO A;  2K7S A;  1NWZ A;  4DF6 A;  1F9I A;  1MWU A;  2VZW A;  4K08 A;  4P6Z S;  2H10 A;  3HLW A;  2W1T B;  2P08 A;  3A0S A;  3BFE A;  4CLC D;  3FZC A;  2OV5 A;  2A2L A;  2D01 A;  1LL5 A;  2PRF A;  3D72 A;  1NJ4 A;  3QP4 A;  1X0O A;  2PT7 A;  3OLO A;  4GZB A;  4EET B;  3F1O B;  4ME4 A;  3O3V A;  4UA7 A;  3NDG A;  1IEL A;  1RCJ A;  1Z6F A;  1S66 L;  2W27 A;  3CUE A;  3NY4 A;  4WZ4 A;  4HJ6 A;  4BQM A;  4I39 A;  1YLP A;  3SS3 A;  4N9L A;  5AVF A;  4QJG A;  1XJ6 A;  3MR0 A;  3PAG A;  4WEK A;  3IH9 A;  3QHY A;  3MFX A;  3KX0 X;  4G3V A;  2B02 A;  1W8Q A;  4R6L A;  3V50 A;  2QJ5 A;  5DF7 A;  4YNR A;  5HL6 A;  2EX9 A;  2ZOI A;  3V3S A;  2W3H A;  3Q1F A;  2Y2H A;  1GCE A;  3E4P A;  1KE3 A;  3LIA A;  4S2O A;  4CJN A;  1G28 A;  4U3T A;  2X01 A;  1XP4 A;  1MPL A;  4MN6 A;  2ZQD A;  3FC7 A;  3IXD A;  2HPB A;  3OCN A;  4RVA A;  3VE4 A;  1KGE A;  2M7V A;  3WS4 A;  1M6K A;  2ZBB A;  1MC0 A;  2XF3 A;  2H28 A;  1K6R A;  4E3N A;  1CEG A;  3MS6 A;  2V1B A;  4DMZ A;  2W3D A;  4G3K A;  3Q81 A;  4KZ4 A;  3PBS A;  3NOU C;  5CGS A;  1XA7 A;  3K3D A;  3H7W A;  2HP6 A;  4LV2 A;  5DTT A;  1TEM A;  2OLV A;  4PM6 A;  3MJQ A;  1RGZ A;  3LR4 A;  4HBT A;  3S7Q A;  4NXF A;  4R3J A;  1UWN X;  1NZU A;  4OVD A;  2EFU A;  4P6Z M;  1LI9 A;  2O99 A;  4IVI A;  5A91 A;  1LL9 A;  5A90 A;  1XA1 A;  3UNW A;  4F3L B;  4N9K A;  4OLG A;  5HWV A;  4BL2 A;  3O88 A;  5F82 A;  1XPB A;  3IF6 A;  3RXX A;  3EQU A;  4Y15 A;  1MZU A;  3UY6 A;  2P9V B;  4B9O A;  4KZ3 A;  3IBR A;  1YLZ A;  2KOI A;  4PAU A;  4AFI A;  2C6W B;  3ZG9 B;  2Y8H A;  3C38 A;  4ARZ A;  2XA7 S;  4RX2 A;  3L7H A;  1P9W A;  5FQI A;  1Y4O A; 
#chains in the Genus database with same CATH homology
 2Z6D A;  4JGR A;  1OTD A;  3PBR A;  4WF0 A;  3P01 A;  5HDD A;  2JHE A;  2GNX A;  5L8M A;  4WL9 A;  4LRZ E;  4EW7 A;  3A0V A;  1OTB A;  3LIC A;  5AVE A;  3EOI A;  1TS0 A;  2QKP A;  3HJK A;  1TS8 A;  3IBJ A;  2P7J A;  4NKP A;  2HJ9 C;  2L4R A;  5HDC A;  1TD5 A;  1V9Z A;  5AJG A;  1F98 A;  2VA0 A;  3T4J A;  2HV1 A;  3K3C A;  2L0W A;  4BBU A;  3JVV A;  5HD3 A;  1LSX A;  5HSQ A;  4BBV A;  3T4Q A;  1YSQ A;  3FPW A;  3HJI A;  4II7 A;  4Y2F A;  3E0Y A;  2HJE A;  3GDI A;  1XFQ A;  4PKY A;  5K5B A;  3U2A A;  4IUH A;  3PR6 A;  3RTY A;  5G4Z A;  5EFW A;  3T50 A;  3T4L A;  1ZTU A;  3LR3 A;  4O01 A;  5DFY A;  4JGP A;  4UQI S;  3EGD C;  4JGO A;  4NXE A;  2VGL S;  5DKK A;  4HQA A;  5IT5 A;  3G6O A;  2A24 A;  4DJ2 A;  1TS7 A;  4CLC C;  4IJG A;  3KSH A;  3W2Z A;  3UB6 A;  1S4R A;  1P97 A;  1KOU A;  4LPZ A;  1BYW A;  3PYP A;  3BW6 A;  4ETX A;  1XJ2 A;  3ULF A;  4FSF A;  3H82 B;  4ETZ A;  3GEC A;  4LLO B;  2ZOH A;  4L9E A;  2K31 A;  4IUK A;  3C2W A;  2WKQ A;  4LRX C;  4CLC A;  2VLG A;  2R78 A;  4GS9 B;  1XJ3 A;  1ZHH B;  2MJ6 A;  4NXG A;  3T4K A;  1NLZ A;  4HH2 A;  5IU1 A;  5DKL A;  1OJG A;  3MQQ A;  2LB5 A;  4JGQ A;  1OT9 A;  5F69 A;  2O9C A;  2KLI A;  3RFB A;  3F1P A;  3LFV A;  3TE8 A;  3PHY A;  3S7P A;  1DP6 A;  1TF1 A;  2VV7 A;  4WEJ A;  5HDS A;  4HNB A;  3LI9 A;  2Z6C A;  2FH5 A;  4R38 A;  3F1N A;  2HF6 A;  4NEE D;  1LT0 A;  3PBT A;  1LL8 A;  1JNU A;  4L9G A;  4GJ4 A;  4BJP A;  5TBM B;  4EER A;  2W1R A;  4PHT A;  2K2N A;  4MCW A;  1S67 L;  3KSI A;  4KUO A;  4XT2 A;  4WLA A;  4ARZ B;  4GHI A;  1YKD A;  3PBQ A;  3B42 A;  3OOV A;  3TRC A;  4CLC E;  3OBF A;  4O8G A;  3LI8 A;  2V9A A;  5J4E A;  2W1T A;  1IOU A;  3B33 A;  2V1A A;  1NRJ A;  2WKP A;  3FPV A;  2JKT I;  4WUJ A;  1XJ4 A;  1H8M A;  1GSX A;  1H3Q A;  3F1O A;  1S1Y A;  4O0P A;  3A0R A;  2QJ7 A;  5HPF A;  2VV8 A;  1WA9 A;  4WEL A;  2OAQ 1;  3NJA A;  4NXB A;  4L9F A;  5MC7 A;  1T19 A;  4GW9 A;  4HJ4 A;  3T4S A;  4R3A A;  4I38 A;  3OC2 A;  5KSH A;  2PD8 A;  1OPX A;  3LIE A;  3CLO A;  1DRM A;  2GZA A;  3LIF A;  3KSG A;  1P9R A;  1Y28 A;  2JKR I;  1VHM A;  2V0U A;  5J3W A;  3LIB A;  3MXQ A;  2YKH A;  4EXO A;  5IS1 A;  2J3T D;  4HI4 A;  5F68 A;  3B47 A;  3LUQ A;  1P0Z A;  1T1B A;  1OT6 A;  2VV6 A;  2IA2 A;  4OOL A;  3LID A;  3MQO A;  3JVU A;  5HPI A;  4EU0 A;  4HOI A;  4UEY A;  2PDR A;  4HY8 A;  2INW A;  4EEU A;  3T4O A;  3E4O A;  1N9O A;  4L0L A;  4DJ3 A;  2ZMV A;  3C30 A;  5A8B A;  1OJ5 A;  4BMW A;  5J7E A;  1T1C A;  3E98 A;  2VGL M;  1GSV A;  4B93 A;  3TJZ C;  1D06 A;  2OWJ A;  1S1Z A;  1UWP X;  4HIA A;  4MN5 A;  2O9B A;  2BAS A;  5G4Y A;  3RH8 B;  2W3G A;  2VJW A;  3BY8 A;  3EGX C;  1MKM A;  3PBO A;  2XRN A;  4I5S A;  2G7U A;  5DJT A;  4E04 A;  3MF0 A;  3T4T A;  3H7W B;  2WKR A;  2CMN A;  3R7W A;  3H9W A;  2NUP C;  4H6J B;  2QHK A;  2PHY A;  5I5L A;  3KSF A;  4GLQ A;  1YAX A;  2O9A A;  2ZMF A;  4RQ9 A;  1LSW A;  3F1P B;  1V9Y A;  4LRY C;  3LR0 A;  4EEP A;  3R4K A;  3BQA A;  2OOL A;  5DF9 A;  3P7N A;  4Y5F A;  2PYP A;  3IS2 B;  2Y79 A;  1N9N A;  3H82 A;  3S7N A;  3UE3 A;  3V67 A;  2XRO A;  2K7S A;  3EEA A;  1NWZ A;  1IFQ A;  2PR5 A;  2J80 A;  1F9I A;  1TS6 A;  3UB8 A;  4GS9 A;  2VZW A;  4XT2 B;  4K08 A;  1UGU A;  2M1C A;  4GHI B;  4P6Z S;  5HZH A;  2W1T B;  2P08 A;  3A0S A;  4CLC D;  4G3W A;  2A2L A;  2D01 A;  4EUV A;  2D02 A;  3CUE C;  3UB7 A;  1STZ A;  2VX8 A;  2EWW A;  3D3O A;  2XA7 M;  3D72 A;  4KQD A;  4WN5 A;  4BBT A;  2W0N A;  1X0O A;  3UME A;  2PT7 A;  2YKF A;  3OLO A;  4EET B;  3F1O B;  3MMH A;  3PBN A;  3ZQ5 A;  4QPR A;  4ZRR A;  1T1A A;  4ME4 A;  3DBA A;  4F3L A;  3ICY A;  3NHQ A;  3SW1 A;  3E4Q A;  3UB9 A;  4M4X A;  3LYX A;  5TBM A;  1OTA A;  1S66 L;  2W3F A;  2W27 A;  4BWI A;  3TW8 A;  3CUE A;  1T18 A;  4KQO A;  2GX5 A;  4HJ6 A;  4Q0I A;  3ZYT A;  2V0W A;  3VV4 A;  4I39 A;  2P04 A;  4OOM A;  3EWK A;  3CIT A;  4Q0J A;  4YWZ A;  3NOT C;  1DP8 A;  3CWF A;  5AVF A;  3BWL A;  1W63 Q;  5DFX A;  4IHQ A;  1XJ6 A;  3MR0 A;  2VKS A;  4WEK A;  3VE3 A;  2QYB A;  3KO6 A;  5HD5 A;  1G6O A;  3MFX A;  3KX0 X;  4G3V A;  2B02 A;  2EA9 A;  4I3A A;  3UE6 A;  4R6L A;  4I3I A;  4HJ3 A;  5FL3 A;  3OCL A;  2QJ5 A;  2JKT M;  4EQ1 A;  3FG8 A;  4YNR A;  5HL6 A;  1S4S A;  2ZOI A;  5KIZ A;  4UQI M;  2W3H A;  2NUT C;  4KUK A;  2A24 B;  1F5M A;  1EW0 A;  3E4P A;  5LBR A;  3LIA A;  1YSP A;  1D7E A;  4MDZ A;  3CI6 A;  2W3E A;  1G28 A;  1OTE A;  2HGV A;  5C5K A;  4MN6 A;  3FC7 A;  3OCN A;  2JKR M;  3R7W B;  3VE4 A;  3KYZ A;  2JN7 A;  2KX6 A;  4CLC B;  4Q0H A;  2M7V A;  2M7U A;  2PR6 A;  2L1M A;  3UMD A;  3VOL A;  5DJU A;  3BJN A;  3BY9 A;  2ZBB A;  1MC0 A;  2H28 A;  2KDK A;  1XFN A;  4MMN A;  3KYQ A;  5F5Y A;  2O0Y A;  3K2N A;  4YOF A;  4Z1W A;  3EQV A;  2V1B A;  4DMZ A;  5HWW A;  4MN7 A;  2LB9 A;  2OAP 1;  2PD7 A;  2W3D A;  4G3K A;  4HHD A;  5TJJ A;  1DP9 A;  1OTI A;  3PBS A;  3PXP A;  4HP4 A;  3NOU C;  2OWH A;  1ODV A;  3F1N B;  4HH3 A;  3K3D A;  4I3J A;  2DMW A;  3H7W A;  3NOP C;  2PYR A;  2I9V A;  4H6J A;  1N9L A;  3MJQ A;  2J3W A;  3CAX A;  3LR4 A;  4R70 A;  3S7Q A;  4NXF A;  4EES A;  2FZ0 A;  1UWN X;  2B18 A;  4P6Z M;  2O99 A;  5F6A A;  4DN0 A;  2XSS A;  1LSV A;  4CQH A;  2GJ3 A;  3IS2 A;  3LR5 A;  4F3L B;  4FOF A;  4Y3I A;  5HWV A;  2J3T C;  1VB6 A;  3EQU A;  1MZU A;  1W63 M;  4B9O A;  3MQ0 A;  3IBR A;  4HP9 A;  2KOI A;  4PAU A;  4AFI A;  2Y8H A;  3C38 A;  2VEA A;  4ARZ A;  2XA7 S;  5CX7 A;  3EEH A;  3BQ8 A;  3HCY A;  5HWT A;  4GCZ A;  1NLY A;  3O5Y A;  3C8C A;  1GSW A;  2QWS A;  1P9W A;  2EWV A;  4PKY G;  3S7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...