4B93A

Complex of vamp7 cytoplasmic domain with 2nd ankyrin repeat domain of varp
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
157
Chain Sequence
SMAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFSFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Exocytosis
molecule keywords VESICLE-ASSOCIATED MEMBRANE PROTEIN 7
publication title The Binding of Varp to Vamp7 Traps Vamp7 in a Closed, Fusogenically Inactive Conformation.
pubmed doi rcsb
source organism Mus musculus
total genus 48
structure length 157
sequence length 164
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4b93A00
3BW6A 4AFIA 2NUPC 1H8MA 3EGXC 3EGDC 2VX8A 2NUTC 1IOUA 1IFQA 2DMWA 3KYQA 4B93A
chains in the Genus database with same CATH superfamily
3IX3A 4DXCA 4LPZA 4YINA 1JTDA 3QP2A 3MFXA 1G68A 5DJUA 2PR5A 1P0ZA 2E8JA 5HAIA 5FQMA 1UGUA 2PHYA 4N92A 4PAUA 4P85A 3NC8A 1IOUA 1KE3A 2JBFA 2XA7M 1OTIA 4GHIB 2HDRA 5JYPA 3EGDC 2HP5A 2J7VA 3MZEA 4NG2A 3KSIA 2ZL1B 4L9EA 1GHIA 4LV0A 3WS2A 3HVFA 3GMWA 2JKTM 4DMZA 1OJGA 2WGWA 1NY0A 4X56A 3ZG5A 3FV7A 5F82A 3U4LP 2PDRA 1K57C 1PWDA 4DE3A 3CWFA 2JKGA 2ZC5B 1G5UA 4KENB 5EVID 1IYPA 2EX2A 1ACFA 5AQ9A 2VK3A 2XR0A 2X01A 2UWXA 3NBLA 1YAXA 1PIOA 1I5QA 1SZVA 1YSQA 4ZRRA 1OJ5A 3WRZA 4Y2FA 2XA7S 2VKSA 1YKDA 2YKFA 2PYRA 4FOFA 1HD8A 4S2NA 5HPFA 4N1XA 3UY6A 4MMNA 1TF1A 5J7EA 2OV5A 2Y55A 4HOIA 5LBRA 1GA9A 5DF9A 3TSGA 4E3NA 4QY6A 3H7WB 3PBNA 3MZDA 3VP2A 2PD8A 2FZ0A 4O7DA 5I94A 3ZFZA 3LYXA 1J3WA 1K56D 1H5XA 2JHEA 3KSFA 3CITA 2J9PA 5F68A 3IWQA 3UMDA 2A2LA 2K2NA 3AGFA 1E4DA 3GQZA 3VE4A 1CI9A 4BBTA 4HJ6A 1L0FA 1LL8A 3JPUA 3SZTA 2X02A 3PAEA 4WN5A 2Q0OA 1XA1A 1DP6A 3DBAA 3UPPA 4WEJA 4HBTA 4OP5A 2NUPC 3G31A 5KZHA 2W1RA 4CLCD 4IBXA 4EBLA 5A93A 3ZGAB 1FSWA 1NXYA 1IKGA 1Y4OA 1G28A 3ITBA 1D1JA 1EI5A 2XRNA 3ZVTA 4HBUA 2EX8A 2OAP1 2WYXA 3LIDA 4JF5A 3IXBA 1JWVA 3A3DA 3HREA 5FASA 4XT2B 3Q7VB 4KZ9A 2Z2MB 3G4PA 2W3FA 3PR6A 3OPPA 3UDFA 3DWZA 2CC1A 2V8FA 3A3JA 3UPOA 2QPNA 3LR4A 3AGEA 3CI6A 3MKEA 2P08A 2E8IA 5E2GA 4LV1A 3IT9A 4HESA 3RJUA 4NEED 4LV3A 2KDKA 2QJ5A 1N9LA 3T4JA 4E3MA 5CTMA 5CRFA 1CQAA 5FSRA 4PM5A 2ZJ9A 3IWIA 5G18A 1BZAA 3M6BA 3UDIA 2Y79A 4ME4A 4WMCA 1E3UD 4FH4A 2HPBA 2DMWA 3DW0A 1H8ZA 3N6IA 3QP1A 3T4LA 5HARA 1FCOA 3E0YA 1ZC2A 2XQZA 3OCLA 3NDEA 4JF4A 2WGWB 2B5RA 4R3BA 2W0NA 2EX6A 4X1MA 4OPYA 4DJ3A 1N4OA 3LIFA 5DFXA 3SOIA 4YNRA 2ZQAA 4Y3IA 1ONHA 3ITAA 4ZJ3A 5F69A 4UA7A 4I5SA 3BQ8A 1DJBA 1RGYA 1E25A 3TE8A 3G34A 3ZHHA 2FFFB 3HLFA 2HJ9C 1C3BA 5HSQA 4UQIS 3LO7A 1GCEA 2EXAA 2J3TC 3EOIA 2ZC3B 3FKWA 3UB5P 2OWJA 3G2ZA 1FILA 3VP3A 1MWUA 3W2ZA 3PHYA 3RXWA 3A3EA 3HLDA 4OQ0A 4WUJA 3S7PA 3TOIA 3IBRA 3SW1A 3N7WA 2VJWA 5A91A 3ZNYA 1I2WA 2XGNA 3A0VA 2V1AA 1V9ZA 3A3FA 3T1QB 2PBDP 4P6BA 1W7FA 2WAFA 3D4FA 2XFSA 3LEQA 4K08A 5FA7A 5EVEA 3PBQA 3QNCA 4KQDA 3HJIA 1WA9A 1ERMA 4LRXC 3BWLA 1FOFA 3E4PA 1FSYA 2P04A 2IWCA 3HL9A 4KUKA 4OOLA 2WKIA 5TBMA 4PM7A 5DFYA 1PNEA 1BSGA 5CGXA 2G2WA 4H8RA 4HQAA 4YFMA 3N8SA 4DDYA 2OOLA 3M2JA 3CLOA 1I2SA 1ES4A 4E3OA 5EUAA 1K54C 2P7JA 3IQAA 4DRTA 2Y2NA 2FFYA 2O99A 3BEBA 1JVJA 3UNWA 4FCFA 3VFFA 3VV4A 4NXEA 4RX2A 3O5YA 2XROA 3OZHA 5AVFA 4K0XA 4L9FA 3T1RA 4MBKA 4OOMA 1ZG4A 5D3OA 3T4TA 3V3SA 5L8MA 4GD6A 3ZYTA 4S2LA 5HL6A 2IA2A 1CEFA 2Y2PA 3DTEA 3ZG7B 4P6ZM 5FAPA 3FZCA 3C2WA 3LEZA 1AXBA 2XEPA 4GHIA 4IVKA 1K6SA 4UEYA 3WS0A 5CHMA 1SHVA 3GDIA 2W3EA 2HP6A 2XDMA 3K2NA 3S7QA 1SDNA 4FTXA 5EVLA 3MQQA 1GSXA 3IXGA 3IF6C 1WYCA 1FR6A 4HEFA 4AFIA 4HJ3A 1SCWA 4GS9A 3C30A 1PWCA 3UE0A 4DE1A 4E04A 2WKQA 4B9OA 4WL9A 2VLGA 4OPZA 1VETA 1YLPA 2XD5A 4JPMA 2ZOIA 5FL3A 1YLJA 3LY4A 1GHPA 4Y15A 3BYDA 4EW7A 1O07A 2VX8A 4S2JA 5AVEA 1GSWA 4NKPA 1S66L 2JCHA 5GHZA 3OOVA 1Y54A 2ZM0A 5FI2A 1XJ3A 4QJGA 2D01A 3IXDA 2ZQ8A 2ZLYA 3AGDA 2WZXA 4OVDA 1VQQA 2V1ZA 3T50A 1YM1A 4LV2A 5E2HA 2A24A 1LL5A 4S2OA 4KG2A 3MKFA 4IEDA 1W79A 1OT6A 1Q2QA 3PBOA 4KG5A 3LIBA 3MXSA 4ID4A 4LCLA 2K7SA 2WADA 1UWPX 4GN2A 1QMEA 5MC7A 4F3LB 3E98A 5HDSA 3MR0A 5TBMB 4LRZE 4PM6A 1CF0A 4R0QA 3F1PB 3ZNTA 3IHAA 5KSCA 4OPRA 4WZ5C 1IYQA 4D2OA 5CECA 1ES2A 2G2UA 1K54A 5EVIC 3O87A 3W4PA 1H0MA 4EERA 4JXGA 5EE8A 3P7NA 4XT2A 4PHTA 2ZQ7A 1XJ6A 1NYMA 4KZ5A 1EW0A 1NJ4A 4HIAA 4ZAMA 5CGWA 4U0TA 2XF3A 1L0EA 1H8YA 3H9WA 1XGJA 3UB8A 3VOLA 1MY8A 1S6RA 3HLGA 2VGLS 4QD4A 2A49A 4I38A 4RVAA 1XGIA 4CJNA 5HX9A 2QZ6A 4DDSA 4JF6A 2DNSA 2I72A 1L0DA 5HDCA 1BYWA 3PXPA 3LCEA 2M7VA 3N8LA 1ALQA 2HGVA 3MMHA 4FD8A 3E2KA 4HP4A 5M19A 5J8XA 2H10A 3B47A 4B4XA 2Y2IA 4R1GA 3NULA 3NECA 2P74A 2WKHA 3VE3A 5HD3A 3M2KA 2C6WB 1JWZA 3CJMA 4Y0UA 2HDQA 3IF6A 3O88A 5FEFA 3C7UA 2HDUA 4GS9B 4CLCC 2PR6A 1YT4A 4EESA 3A0SA 3G30A 5A8BA 3VSKA 3MBZA 3GTCA 5HWTA 2ZQDA 1VETB 2ZC4B 2XH9A 5GLAA 5HWWA 5AJGA 3GR2A 5GL9A 3FC7A 5IU1A 4EUZA 1PYYA 4ZDXA 3P09A 1ODVA 1VEUA 2HDSA 4IBRA 4MN6A 4C75A 4E3IA 2KOIA 2OWHA 2CMNA 4OQHA 3L9KA 3A0RA 1IEMA 4QY5A 4KQOA 2X71A 3C5AA 3NY4A 1BLHA 1WE4A 4EQ1A 2A24B 1KDWA 3BQAA 1NYYA 4C3QA 1EWZA 5DKKA 4S2IA 4DXBA 2EFXA 4NK3A 3F1OA 5HFOA 2ZQCA 2ZQ9A 4Y17A 3HUOA 4OLGA 1P97A 3IX8A 1HTZA 2B02A 3TG9A 2B95A 5HD5A 3BRMA 1RGZA 2EFUA 4HHDA 2GZAA 3UB9A 3F1NA 5G4ZA 1BUEA 2P9VA 4O8GA 3SS3A 2Y91A 1TS6A 4WZ5A 1KGGA 5DJTA 2LB9A 5DF8A 2O0YA 2GX5A 2R9XA 1XFQA 4JLFA 4ZJ1A 5KIZA 1NRJA 4PPRA 3TJZC 5EVIA 3RXXA 2ZMFA 4B93A 5FQJA 1VHMA 1KDSA 3C8CA 1J9MA 4UHUA 1F9IA 3QP6A 1NZOA 3VMAA 2WUQA 1Z09A 2A3UA 5F5YA 3E4QA 2ZM2A 3LR3A 1OT9A 4GD8A 1XFNA 5A92A 1U60A 4XXRA 3DAVA 4XUZA 3V67A 2XSSA 4X25A 3KX0X 1UWNX 5KMWA 2VZWA 1T1CA 3PTEA 2XK1A 4DJ2A 1ZKJA 2ZOHA 3FYZA 2Y4AA 2ZMVA 3PBSA 2VA0A 3VSLA 1ESUA 2HJEA 2PBYA 2QYBA 4DN0A 3LI9A 1K55C 3UB7A 4YWZA 4KG6A 1NLYA 1K56A 3EGXC 1F5MA 4QB8A 4OONA 5CEDA 4UQIM 3NCKA 5HAQA 4LCMA 1L0GA 3FPWA 4N1HA 2R78A 3MZFA 4OOYA 3VP4A 2H28A 3GV9A 3IF6B 3LI8A 4GZBA 4BLMA 1K57A 1EROA 4CLCA 4JGRA 4X6TA 5FQ9A 3I7JA 4IJGA 5EOOA 3BW6A 3R4KA 3W4OA 2W1TB 2ACGA 1SDEA 4Y0TA 4LLOB 3QP4A 5EPHA 2WKEA 2JKFA 5E43A 1TS7A 2G7UA 3RTYA 4WELA 3WS1A 1VEUB 3CAXA 2HZ5A 4I39A 5DVAA 3VFHA 4R3AA 5G4YA 2C5WB 5FQIA 4ETXA 3S22A 2ZM8A 2Y2LA 2B18A 1LI9A 5IHVA 4MDZA 4OLDA 3VP0A 1AWIA 3MQ0A 4X55A 1DRMA 4ZBEA 1YMSA 4G3WA 1PI4A 3GSGA 4WYYA 3F1OB 3ULFA 4L0LA 3P98A 1IKIA 3LR5A 4JKTA 3ZCZA 1TDLA 3MQOA 5HWVA 2UV0E 1MWSA 1BLCA 4WZ4A 3ZG0A 4O0PA 4KZ6A 3LY3A 1E3UA 1DJCA 2PYPA 2ZC6B 3LICA 4F3LA 3C4PA 2XD1A 1ZTUA 1CK3A 3IWOA 3F1NB 3HLWA 3DTIA 3F1PA 3LIEA 4KZ4A 1VM1A 5CHJA 2P9VB 4HP9A 4E3JA 1T18A 3W8KA 4PMAA 3UE1A 4R6LA 4DKIA 1VB6A 4PM9A 3ZG9B 5EVIB 3ZQ5A 2O9BA 1W8QA 1CI8A 3K3DA 3CZDA 2J3WA 4BJPA 1TS8A 4GKUA 3ZG8B 5KSHA 2WK0A 3OPRA 4ARZA 4FUWA 5A90A 4CQHA 3W4QA 3OPHA 4BBVA 2V0UA 4OPQA 4NXFA 3MFDA 1A0KA 2JN7A 2RL3A 4BWIA 4RX3A 4C6YA 5DTSA 4FH2A 4WEKA 5F6AA 1FR1A 2IWDA 1Q2PA 4H6JA 1FCNA 1H8MA 3EEAA 3T12B 1K55A 4G3VA 2Q9MA 1TEMA 4PKYG 1D06A 2V1BA 3UN7A 1LL9A 5EV0A 1XPBA 1N9BA 5GLBA 4BENA 1YQSA 5GHXA 4LRYC 4CLCB 2VV8A 3HCYA 3T1SA 3TW8A 1NRFA 4MBFA 1PFLA 4MNRA 1ZHHB 4Y7PA 2R9WA 1DJAA 3HBRA 4FSFA 1LI0A 3KSGA 3LFVA 1NWZA 4E3KA 3LR0A 5EM1A 3UE6A 3O86A 3VOZA 2IWBA 3KSHA 1K4FA 1DY6A 3KYQA 3HLCA 3GECA 3HUMA 3TRCA 3CHWP 4YOFA 3BFEA 3GRJA 4JGQA 1H3QA 3JYIA 3IBJA 4QPRA 3B42A 5GLCA 3N4IA 1ZG6A 4EETB 1KE0A 2JKRI 3V3RA 5EOEA 2QMIA 2L0WA 1PRQA 3Q82A 4RA7A 2W27A 3CPTB 4MCWA 5BOHA 2WKPA 2ZMAA 4KZ3A 4ZJ2A 1M40A 3Q07A 1FIKA 5IS1A 3SH9A 2VGLM 2XFTA 2OSUA 1OTBA 1S67L 4JBFA 5GHYA 3RFBA 3B3XA 1PZOA 4EBNA 1YLWA 5IT5A 2Y2QA 4OH0A 4Y13A 1N9NA 1PI5A 2PRFA 4JXVA 1YLTA 2Y8HA 2W3GA 4MEZA 4ARZB 1N9OA 2HP9A 3IF5A 2M1CA 4ZTKA 3BLMA 2Y2MA 4I3IA 4HY8A 3UPNA 5CXWA 4ETZA 3OC2A 4KUOA 1KGFA 3HJKA 2Z6DA 2OLUA 4CLCE 3E2LA 1RP5A 4H6JB 2OLVA 2V8CA 4WLAA 4EV4A 5HW3A 4EWFA 3PBRA 1IFQA 1MKMA 1XXMA 3BLSA 3UO9A 2O9CA 5J3WA 1XJ4A 3QHYA 3G2YA 4DF6A 2EWVA 3T4OA 5EM0A 1BTLA 2JE5A 1JWPA 1CJFA 2PU2A 3Q1FA 3WS4A 2RCXA 1KVMA 3G35A 4DE0A 1QMFA 3IS2A 3SS5A 5EECA 1SKOB 4IUHA 3NOTC 2M7UA 3EWKA 4BL3A 4R38A 2EA9A 4B88A 3V50A 3Q81A 4MN5A 2W1TA 3S1YA 4GNUA 5U47A 2K31A 3C7VA 3MSHA 1FQGA 4NETA 1STZA 5AQAA 3IXHA 4IVIA 1V9YA 1F2KA 5L07A 2Y2GA 2INWA 5TFQA 3GVBA 2WZZA 4GB7A 1ES3A 3H82A 1O7EA 1MPLA 3G6OA 2BTFP 5EFWA 2PD7A 4OQIA 1IYSA 4Q0IA 1K0KA 4QWOA 5FATA 5JYOA 1KVLA 5CGSA 1LSXA 4JXSA 4D60A 4P87A 3BFFA 3A3IA 3OBFA 1MXOA 4KZ8A 3LIAA 4GW9A 3NOPC 5L2FA 5FEGA 2XLNA 4BQMA 2J9OA 4N9KA 5FI7A 5FAQA 3ISGA 4X1LA 3UMEA 2VV6A 4O01A 5CTNA 5FQQA 3BFCA 4EBPA 5M18A 5DTTA 1MBLA 3CMZA 1S1ZA 5FDSA 4WMCD 3OCNA 4HI4A 1MKIA 2H0YA 4F94A 5TGFA 5M1AA 2VGKA 1W5DA 2V2FF 4NXGA 1ERQA 1W8YA 4GDBA 2Y2HA 2Y2KA 4WF0A 3C38A 5FI6A 2OAQ1 1RCJA 4BD1A 3KYEA 5HL1A 3S7OA 3T1XA 3KYZA 3MS6A 5HAPA 3U2AA 2BG1A 4JXWA 1LSWA 3SH7A 1PW1A 2H5SA 1WYBA 3D9YA 4EU0A 5CERA 3G32A 4KZAA 3HLBA 2V20A 1T1AA 2JKRM 2MJ6A 1OTAA 1GSVA 3V39A 4UA6A 2WAEA 3BY8A 3SH8A 3PYPA 2WGIA 3T4SA 4XUXA 1XP4A 1OPXA 3S7NA 1MWTA 4EQIA 1S4RA 2Z6CA 3NJAA 3MJQA 1YLZA 1XX2A 2QKPA 2W3DA 1P9RA 4Z9QA 1X0OA 1P9WA 2J8YA 5E2FA 4U0XA 4MLLA 2Y2JA 1BLSA 3IX4A 3C4OA 2LB5A 4R70A 3UE3A 3PAGA 1L3LA 1MWRA 1XKZA 4GLQA 3IS2B 5AQBA 1SKFA 3BFDA 3DTKA 5K5BA 1M6KA 4K0WA 2PT7A 3EQVA 4QHCA 4NXBA 4KQQA 3JVUA 4GCZA 1ESIA 2WGVA 2BASA 1GHMA 4BD0A 2VGJA 3VOYA 4EEPA 4X69A 1DP8A 2W3HA 1CEGA 3DWKA 1HVBA 4Y0OA 4R23A 4B4ZA 5CX7A 3FG8A 4BBUA 3H82B 2EX9A 3D3OA 3R7WA 4K91A 1W63M 2HV1A 3QNBA 4S2MA 5DKLA 4G3KA 5FQKA 2O9AA 3K3CA 5HDDA 2VEAA 1NLZA 3WS5A 4UA9A 2NUTC 2PU4A 4Z1WA 3WWXA 1Z6FA 1T19A 2GDNA 4MN7A 5I5LA 1D7EA 4M3KA 4BMWA 4E3LA 4RYEA 3LGOA 2Z2LB 3UDXA 2V0WA 1LLBA 3CPTA 5TR7A 2ZD8A 4LENA 1IELA 5J4EA 4HH2A 4X53A 5F1GA 1YMXA 4X68A 2QHKA 1YLYA 2V9AA 4EXOA 4Q8IA 1KGEA 1PW8A 5F1FA 3B33A 4EEUA 1W63Q 3MF0A 1OTDA 1BULA 4HJ4A 5C5KA 3CUEC 2J80A 3P01A 3ZVWA 2DRWA 2FH5A 2WKRA 1ONGA 2GJ3A 2JKTI 3O3VA 1TVFA 4WM9A 4A5RA 4ESPA 3IHBA 4DE2A 3MXQA 1LSVA 2BLSA 4BL2A 2KLIA 5GLDA 3QP5A 1K6RA 3S4XA 2J3TD 1BLPA 3HUNA 1OTEA 1S0WA 4S2KA 3BECA 1LHYA 5L09A 2QJ7A 4U3TA 4M4XA 2Q9NA 1HLUP 3DTMA 2VV7A 3HLEA 1G6OA 3OLOA 4S2PA 2L4RA 5L10A 5TJJA 2D02A 3EEHA 1IYOA 1F98A 2GNXA 5CHUA 3ICYA 4I3AA 1TS0A 4Q0JA 1PZPA 3T4KA 1SKOA 4GOGA 3NOUC 2ZL1A 2AVXA 3IH8A 3E4OA 4P0MA 4PKYA 3Q7ZA 4OP8A 4GJ4A 1KOUA 3N8RA 4OQGA 1S4SA 4R4RA 1DP9A 3MXRA 3NI9A 1KE4A 2ZC7A 1LT0A 2H0TA 5DTKA 4I3JA 1NZUA 1Y28A 4KZBA 4JGOA 4KZ7A 3V5MA 3R7WB 5FAOA 3NHQA 3T4QA 1TDGA 1FCMA 2EXBA 4Q0HA 3FWLA 4P6ZS 3NDGA 3FPVA 1K38A 4S2NC 3RH8B 5DF7A 1K25A 3EQUA 3L7HA 5AQ7A 1JNUA 4R4SA 2DCFA 4JGPA 1L2SA 1XJ2A 2PAVP 3H7WA 1BT5A 5HZHA 4N9LA 3OPLA 1OMEA 2YKHA 3ZDJA 3NIAA 3BY9A 3LUQA 1PWGA 3QP8A 4E6XA 4KQRA 3WRTA 1GA0A 3BJNA 5FDHA 4WBGA 4PM8A 4IUKA 2Y59A 3JVVA 1ES5A 1T1BA 2EWWA 4EUVA 4MBHA 4LGWA 4RQ9A 1YSPA 1JTGA 4HH3A 2Y2OA 3UB6A 4HNBA 1MC0A 5CEBA 4CPKA 3VP1A 3SS4A 3BM6A 2L1MA 3CUEA 3IH9A 3KO6A 4OKPA 2ZBBA 4E6WA 1K4EA 2I9VA 4L9GA 3FKVA 3D72A 1TD5A 5E2EA 4Y5FA 4QU3A 4LFUA 1G6AA 3BFGA 3CG5A 4GDNA 1S1YA 4II7A 1HZOA 2QWSA 3Q7VA 5HPIA 4IHQA 5F83A 3M6HA 4UAAA 1XA7A 2JC7A 2HF6A 3PBTA 1YPRA 4R3JA 2KX6A 1MZUA
chains in the Genus database with same CATH topology
2B18A 2OAQ1 4MDZA 4LPZA 4AFIA 4HJ3A 3S7OA 4GS9A 3MQ0A 3C30A 3KYZA 1DRMA 3MFXA 4E04A 5DJUA 2PR5A 2WKQA 1P0ZA 4G3WA 4B9OA 3U2AA 4WL9A 2VLGA 3F1OB 3ULFA 4L0LA 1LSWA 1UGUA 2PHYA 4PAUA 2ZOIA 3LR5A 5FL3A 4EU0A 1IOUA 3MQOA 5HWVA 2XA7M 4EW7A 2VX8A 1OTIA 4GHIB 5AVEA 4O0PA 1T1AA 1GSWA 3EGDC 4NKPA 1S66L 2JKRM 3KSIA 2MJ6A 1OTAA 1GSVA 2PYPA 4L9EA 3BY8A 3LICA 4F3LA 3OOVA 1ZTUA 3PYPA 1XJ3A 3T4SA 1OPXA 3F1NB 3F1PA 2D01A 3LIEA 3S7NA 2JKTM 4DMZA 1S4RA 2Z6CA 1OJGA 4HP9A 3NJAA 3MJQA 3T50A 1T18A 2PDRA 4R6LA 2QKPA 1VB6A 2W3DA 3CWFA 1P9RA 2A24A 3ZQ5A 1X0OA 1P9WA 2O9BA 3K3DA 2J3WA 4BJPA 1TS8A 5KSHA 1OT6A 2LB5A 3PBOA 4R70A 1YAXA 4ARZA 3UE3A 3LIBA 4GLQA 1YSQA 3IS2B 4CQHA 4ZRRA 1OJ5A 2K7SA 5K5BA 1UWPX 4BBVA 2V0UA 4Y2FA 4NXFA 2XA7S 2JN7A 2PT7A 2VKSA 3EQVA 1YKDA 2YKFA 2PYRA 4FOFA 5HPFA 4BWIA 5MC7A 4F3LB 3E98A 4MMNA 3MR0A 1TF1A 5HDSA 5TBMB 5J7EA 4NXBA 4WEKA 4HOIA 4LRZE 5F6AA 5LBRA 3JVUA 4GCZA 5DF9A 3F1PB 4H6JA 2BASA 3H7WB 3PBNA 2PD8A 1H8MA 2FZ0A 4EEPA 3EEAA 1DP8A 2W3HA 3LYXA 4G3VA 2JHEA 3KSFA 3CITA 5CX7A 3FG8A 4PKYG 4EERA 5F68A 4BBUA 3UMDA 3H82B 2A2LA 2K2NA 1D06A 3D3OA 3VE4A 3P7NA 4XT2A 3R7WA 4BBTA 1W63M 2HV1A 4HJ6A 5DKLA 1LL8A 4PHTA 4G3KA 2V1BA 1XJ6A 2O9AA 3K3CA 4WN5A 1EW0A 5HDDA 1DP6A 2VEAA 1NLZA 3DBAA 2NUTC 4WEJA 4HIAA 4Z1WA 2NUPC 1T19A 2W1RA 4LRYC 2VV8A 3HCYA 4CLCB 4CLCD 3H9WA 4MN7A 5I5LA 3UB8A 3VOLA 1D7EA 3TW8A 2VGLS 4I38A 4BMWA 1G28A 2XRNA 1ZHHB 5HDCA 1BYWA 2V0WA 3PXPA 2OAP1 4FSFA 2M7VA 3LIDA 3KSGA 3LFVA 2HGVA 1NWZA 3MMHA 5J4EA 4HP4A 4HH2A 3LR0A 3UE6A 3B47A 4XT2B 3KSHA 2QHKA 3KYQA 2V9AA 2W3FA 3GECA 4EXOA 3VE3A 3PR6A 5HD3A 3TRCA 3B33A 4EEUA 4YOFA 3LR4A 4JGQA 1H3QA 1W63Q 3CI6A 4GS9B 4CLCC 2P08A 3IBJA 2PR6A 3MF0A 4QPRA 1OTDA 3B42A 4EESA 4HJ4A 5C5KA 3A0SA 3CUEC 4NEED 4EETB 2KDKA 2QJ5A 5A8BA 2J80A 2JKRI 3P01A 1N9LA 5HWTA 3T4JA 2L0WA 2FH5A 2WKRA 5HWWA 2GJ3A 2W27A 5AJGA 2JKTI 4MCWA 2WKPA 3FC7A 5IU1A 2Y79A 3MXQA 4ME4A 1LSVA 1ODVA 5IS1A 2DMWA 2VGLM 3T4LA 2KLIA 4MN6A 3E0YA 2KOIA 2OWHA 2CMNA 3A0RA 1OTBA 3OCLA 1S67L 2J3TD 4KQOA 1OTEA 3RFBA 4EQ1A 2W0NA 2QJ7A 4DJ3A 2A24B 3BQAA 3LIFA 4M4XA 2VV7A 5IT5A 1G6OA 3OLOA 2L4RA 5DFXA 1N9NA 5DKKA 5TJJA 4YNRA 2D02A 3EEHA 3F1OA 2Y8HA 2W3GA 2GNXA 1F98A 4Y3IA 4ARZB 1N9OA 3ICYA 4I3AA 2M1CA 1TS0A 5F69A 4Q0JA 1P97A 4I3IA 4I5SA 4HY8A 3BQ8A 3T4KA 3TE8A 4ETZA 2B02A 3OC2A 3NOUC 5HD5A 4KUOA 3HJKA 2Z6DA 3E4OA 2HJ9C 5HSQA 4CLCE 4UQIS 4HHDA 4PKYA 4GJ4A 2GZAA 3UB9A 1KOUA 4H6JB 3F1NA 5G4ZA 2J3TC 3EOIA 2OWJA 4O8GA 1S4SA 4WLAA 1TS6A 3W2ZA 5DJTA 1DP9A 2LB9A 3PHYA 3PBRA 2O0YA 1IFQA 2GX5A 1MKMA 4WUJA 3IBRA 3S7PA 3SW1A 1XFQA 1LT0A 2O9CA 2VJWA 5KIZA 1NRJA 5J3WA 4I3JA 1Y28A 3A0VA 3TJZC 1XJ4A 2ZMFA 4B93A 4JGOA 2V1AA 2EWVA 1V9ZA 3T4OA 1VHMA 3C8CA 3R7WB 1F9IA 3NHQA 4K08A 3T4QA 3PBQA 5F5YA 4Q0HA 3IS2A 4KQDA 3E4QA 3HJIA 3LR3A 4P6ZS 1OT9A 1WA9A 4LRXC 3BWLA 4IUHA 3E4PA 3NOTC 2M7UA 1XFNA 3FPVA 3EWKA 2P04A 4R38A 3RH8B 2EA9A 3V67A 2XSSA 3EQUA 4KUKA 4OOLA 3KX0X 5TBMA 4MN5A 1UWNX 5DFYA 2W1TA 2VZWA 1JNUA 1T1CA 4DJ2A 2K31A 4JGPA 1XJ2A 2ZOHA 4HQAA 3H7WA 2ZMVA 3PBSA 2VA0A 2OOLA 2HJEA 1STZA 2QYBA 3CLOA 5HZHA 2YKHA 4DN0A 4WF0A 3BY9A 3LI9A 3LUQA 3UB7A 4YWZA 1NLYA 3EGXC 1V9YA 3BJNA 2P7JA 2INWA 4IUKA 1F5MA 4UQIM 3H82A 3JVVA 3G6OA 2O99A 1T1BA 2EWWA 4EUVA 5EFWA 2PD7A 4Q0IA 4RQ9A 1YSPA 3FPWA 2R78A 2H28A 3VV4A 4HH3A 1LSXA 4NXEA 3LI8A 3UB6A 3O5YA 4HNBA 1MC0A 3OBFA 3LIAA 4GW9A 2XROA 3NOPC 5AVFA 4CLCA 4JGRA 4IJGA 4L9FA 3BW6A 4OOMA 3R4KA 2W1TB 2L1MA 3CUEA 3KO6A 4LLOB 3T4TA 2ZBBA 5L8MA 2I9VA 4L9GA 3ZYTA 3UMEA 3D72A 2VV6A 4O01A 5HL6A 2IA2A 1TD5A 4P6ZM 4Y5FA 1TS7A 3C2WA 2G7UA 3RTYA 1S1ZA 4GHIA 4WELA 4UEYA 3OCNA 4HI4A 3GDIA 3CAXA 1S1YA 4II7A 2W3EA 2QWSA 4I39A 3K2NA 3S7QA 4R3AA 5G4YA 5HPIA 4IHQA 4NXGA 2HF6A 3PBTA 3MQQA 4ETXA 1GSXA 3C38A 2KX6A 1MZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BW6 A;  4AFI A;  2NUP C;  1H8M A;  3EGX C;  3EGD C;  2VX8 A;  2NUT C;  1IOU A;  1IFQ A;  2DMW A;  3KYQ A;  4B93 A; 
#chains in the Genus database with same CATH topology
 3IX3 A;  4DXC A;  4LPZ A;  4YIN A;  1JTD A;  3QP2 A;  3MFX A;  1G68 A;  5DJU A;  2PR5 A;  1P0Z A;  2E8J A;  5HAI A;  5FQM A;  1UGU A;  2PHY A;  4N92 A;  4PAU A;  4P85 A;  3NC8 A;  1IOU A;  1KE3 A;  2JBF A;  2XA7 M;  1OTI A;  4GHI B;  2HDR A;  5JYP A;  3EGD C;  2HP5 A;  2J7V A;  3MZE A;  4NG2 A;  3KSI A;  2ZL1 B;  4L9E A;  1GHI A;  4LV0 A;  3WS2 A;  3HVF A;  3GMW A;  2JKT M;  4DMZ A;  1OJG A;  2WGW A;  1NY0 A;  4X56 A;  3ZG5 A;  3FV7 A;  5F82 A;  3U4L P;  2PDR A;  1K57 C;  1PWD A;  4DE3 A;  3CWF A;  2JKG A;  2ZC5 B;  1G5U A;  4KEN B;  5EVI D;  1IYP A;  2EX2 A;  1ACF A;  5AQ9 A;  2VK3 A;  2XR0 A;  2X01 A;  2UWX A;  3NBL A;  1YAX A;  1PIO A;  1I5Q A;  1SZV A;  1YSQ A;  4ZRR A;  1OJ5 A;  3WRZ A;  4Y2F A;  2XA7 S;  2VKS A;  1YKD A;  2YKF A;  2PYR A;  4FOF A;  1HD8 A;  4S2N A;  5HPF A;  4N1X A;  3UY6 A;  4MMN A;  1TF1 A;  5J7E A;  2OV5 A;  2Y55 A;  4HOI A;  5LBR A;  1GA9 A;  5DF9 A;  3TSG A;  4E3N A;  4QY6 A;  3H7W B;  3PBN A;  3MZD A;  3VP2 A;  2PD8 A;  2FZ0 A;  4O7D A;  5I94 A;  3ZFZ A;  3LYX A;  1J3W A;  1K56 D;  1H5X A;  2JHE A;  3KSF A;  3CIT A;  2J9P A;  5F68 A;  3IWQ A;  3UMD A;  2A2L A;  2K2N A;  3AGF A;  1E4D A;  3GQZ A;  3VE4 A;  1CI9 A;  4BBT A;  4HJ6 A;  1L0F A;  1LL8 A;  3JPU A;  3SZT A;  2X02 A;  3PAE A;  4WN5 A;  2Q0O A;  1XA1 A;  1DP6 A;  3DBA A;  3UPP A;  4WEJ A;  4HBT A;  4OP5 A;  2NUP C;  3G31 A;  5KZH A;  2W1R A;  4CLC D;  4IBX A;  4EBL A;  5A93 A;  3ZGA B;  1FSW A;  1NXY A;  1IKG A;  1Y4O A;  1G28 A;  3ITB A;  1D1J A;  1EI5 A;  2XRN A;  3ZVT A;  4HBU A;  2EX8 A;  2OAP 1;  2WYX A;  3LID A;  4JF5 A;  3IXB A;  1JWV A;  3A3D A;  3HRE A;  5FAS A;  4XT2 B;  3Q7V B;  4KZ9 A;  2Z2M B;  3G4P A;  2W3F A;  3PR6 A;  3OPP A;  3UDF A;  3DWZ A;  2CC1 A;  2V8F A;  3A3J A;  3UPO A;  2QPN A;  3LR4 A;  3AGE A;  3CI6 A;  3MKE A;  2P08 A;  2E8I A;  5E2G A;  4LV1 A;  3IT9 A;  4HES A;  3RJU A;  4NEE D;  4LV3 A;  2KDK A;  2QJ5 A;  1N9L A;  3T4J A;  4E3M A;  5CTM A;  5CRF A;  1CQA A;  5FSR A;  4PM5 A;  2ZJ9 A;  3IWI A;  5G18 A;  1BZA A;  3M6B A;  3UDI A;  2Y79 A;  4ME4 A;  4WMC A;  1E3U D;  4FH4 A;  2HPB A;  2DMW A;  3DW0 A;  1H8Z A;  3N6I A;  3QP1 A;  3T4L A;  5HAR A;  1FCO A;  3E0Y A;  1ZC2 A;  2XQZ A;  3OCL A;  3NDE A;  4JF4 A;  2WGW B;  2B5R A;  4R3B A;  2W0N A;  2EX6 A;  4X1M A;  4OPY A;  4DJ3 A;  1N4O A;  3LIF A;  5DFX A;  3SOI A;  4YNR A;  2ZQA A;  4Y3I A;  1ONH A;  3ITA A;  4ZJ3 A;  5F69 A;  4UA7 A;  4I5S A;  3BQ8 A;  1DJB A;  1RGY A;  1E25 A;  3TE8 A;  3G34 A;  3ZHH A;  2FFF B;  3HLF A;  2HJ9 C;  1C3B A;  5HSQ A;  4UQI S;  3LO7 A;  1GCE A;  2EXA A;  2J3T C;  3EOI A;  2ZC3 B;  3FKW A;  3UB5 P;  2OWJ A;  3G2Z A;  1FIL A;  3VP3 A;  1MWU A;  3W2Z A;  3PHY A;  3RXW A;  3A3E A;  3HLD A;  4OQ0 A;  4WUJ A;  3S7P A;  3TOI A;  3IBR A;  3SW1 A;  3N7W A;  2VJW A;  5A91 A;  3ZNY A;  1I2W A;  2XGN A;  3A0V A;  2V1A A;  1V9Z A;  3A3F A;  3T1Q B;  2PBD P;  4P6B A;  1W7F A;  2WAF A;  3D4F A;  2XFS A;  3LEQ A;  4K08 A;  5FA7 A;  5EVE A;  3PBQ A;  3QNC A;  4KQD A;  3HJI A;  1WA9 A;  1ERM A;  4LRX C;  3BWL A;  1FOF A;  3E4P A;  1FSY A;  2P04 A;  2IWC A;  3HL9 A;  4KUK A;  4OOL A;  2WKI A;  5TBM A;  4PM7 A;  5DFY A;  1PNE A;  1BSG A;  5CGX A;  2G2W A;  4H8R A;  4HQA A;  4YFM A;  3N8S A;  4DDY A;  2OOL A;  3M2J A;  3CLO A;  1I2S A;  1ES4 A;  4E3O A;  5EUA A;  1K54 C;  2P7J A;  3IQA A;  4DRT A;  2Y2N A;  2FFY A;  2O99 A;  3BEB A;  1JVJ A;  3UNW A;  4FCF A;  3VFF A;  3VV4 A;  4NXE A;  4RX2 A;  3O5Y A;  2XRO A;  3OZH A;  5AVF A;  4K0X A;  4L9F A;  3T1R A;  4MBK A;  4OOM A;  1ZG4 A;  5D3O A;  3T4T A;  3V3S A;  5L8M A;  4GD6 A;  3ZYT A;  4S2L A;  5HL6 A;  2IA2 A;  1CEF A;  2Y2P A;  3DTE A;  3ZG7 B;  4P6Z M;  5FAP A;  3FZC A;  3C2W A;  3LEZ A;  1AXB A;  2XEP A;  4GHI A;  4IVK A;  1K6S A;  4UEY A;  3WS0 A;  5CHM A;  1SHV A;  3GDI A;  2W3E A;  2HP6 A;  2XDM A;  3K2N A;  3S7Q A;  1SDN A;  4FTX A;  5EVL A;  3MQQ A;  1GSX A;  3IXG A;  3IF6 C;  1WYC A;  1FR6 A;  4HEF A;  4AFI A;  4HJ3 A;  1SCW A;  4GS9 A;  3C30 A;  1PWC A;  3UE0 A;  4DE1 A;  4E04 A;  2WKQ A;  4B9O A;  4WL9 A;  2VLG A;  4OPZ A;  1VET A;  1YLP A;  2XD5 A;  4JPM A;  2ZOI A;  5FL3 A;  1YLJ A;  3LY4 A;  1GHP A;  4Y15 A;  3BYD A;  4EW7 A;  1O07 A;  2VX8 A;  4S2J A;  5AVE A;  1GSW A;  4NKP A;  1S66 L;  2JCH A;  5GHZ A;  3OOV A;  1Y54 A;  2ZM0 A;  5FI2 A;  1XJ3 A;  4QJG A;  2D01 A;  3IXD A;  2ZQ8 A;  2ZLY A;  3AGD A;  2WZX A;  4OVD A;  1VQQ A;  2V1Z A;  3T50 A;  1YM1 A;  4LV2 A;  5E2H A;  2A24 A;  1LL5 A;  4S2O A;  4KG2 A;  3MKF A;  4IED A;  1W79 A;  1OT6 A;  1Q2Q A;  3PBO A;  4KG5 A;  3LIB A;  3MXS A;  4ID4 A;  4LCL A;  2K7S A;  2WAD A;  1UWP X;  4GN2 A;  1QME A;  5MC7 A;  4F3L B;  3E98 A;  5HDS A;  3MR0 A;  5TBM B;  4LRZ E;  4PM6 A;  1CF0 A;  4R0Q A;  3F1P B;  3ZNT A;  3IHA A;  5KSC A;  4OPR A;  4WZ5 C;  1IYQ A;  4D2O A;  5CEC A;  1ES2 A;  2G2U A;  1K54 A;  5EVI C;  3O87 A;  3W4P A;  1H0M A;  4EER A;  4JXG A;  5EE8 A;  3P7N A;  4XT2 A;  4PHT A;  2ZQ7 A;  1XJ6 A;  1NYM A;  4KZ5 A;  1EW0 A;  1NJ4 A;  4HIA A;  4ZAM A;  5CGW A;  4U0T A;  2XF3 A;  1L0E A;  1H8Y A;  3H9W A;  1XGJ A;  3UB8 A;  3VOL A;  1MY8 A;  1S6R A;  3HLG A;  2VGL S;  4QD4 A;  2A49 A;  4I38 A;  4RVA A;  1XGI A;  4CJN A;  5HX9 A;  2QZ6 A;  4DDS A;  4JF6 A;  2DNS A;  2I72 A;  1L0D A;  5HDC A;  1BYW A;  3PXP A;  3LCE A;  2M7V A;  3N8L A;  1ALQ A;  2HGV A;  3MMH A;  4FD8 A;  3E2K A;  4HP4 A;  5M19 A;  5J8X A;  2H10 A;  3B47 A;  4B4X A;  2Y2I A;  4R1G A;  3NUL A;  3NEC A;  2P74 A;  2WKH A;  3VE3 A;  5HD3 A;  3M2K A;  2C6W B;  1JWZ A;  3CJM A;  4Y0U A;  2HDQ A;  3IF6 A;  3O88 A;  5FEF A;  3C7U A;  2HDU A;  4GS9 B;  4CLC C;  2PR6 A;  1YT4 A;  4EES A;  3A0S A;  3G30 A;  5A8B A;  3VSK A;  3MBZ A;  3GTC A;  5HWT A;  2ZQD A;  1VET B;  2ZC4 B;  2XH9 A;  5GLA A;  5HWW A;  5AJG A;  3GR2 A;  5GL9 A;  3FC7 A;  5IU1 A;  4EUZ A;  1PYY A;  4ZDX A;  3P09 A;  1ODV A;  1VEU A;  2HDS A;  4IBR A;  4MN6 A;  4C75 A;  4E3I A;  2KOI A;  2OWH A;  2CMN A;  4OQH A;  3L9K A;  3A0R A;  1IEM A;  4QY5 A;  4KQO A;  2X71 A;  3C5A A;  3NY4 A;  1BLH A;  1WE4 A;  4EQ1 A;  2A24 B;  1KDW A;  3BQA A;  1NYY A;  4C3Q A;  1EWZ A;  5DKK A;  4S2I A;  4DXB A;  2EFX A;  4NK3 A;  3F1O A;  5HFO A;  2ZQC A;  2ZQ9 A;  4Y17 A;  3HUO A;  4OLG A;  1P97 A;  3IX8 A;  1HTZ A;  2B02 A;  3TG9 A;  2B95 A;  5HD5 A;  3BRM A;  1RGZ A;  2EFU A;  4HHD A;  2GZA A;  3UB9 A;  3F1N A;  5G4Z A;  1BUE A;  2P9V A;  4O8G A;  3SS3 A;  2Y91 A;  1TS6 A;  4WZ5 A;  1KGG A;  5DJT A;  2LB9 A;  5DF8 A;  2O0Y A;  2GX5 A;  2R9X A;  1XFQ A;  4JLF A;  4ZJ1 A;  5KIZ A;  1NRJ A;  4PPR A;  3TJZ C;  5EVI A;  3RXX A;  2ZMF A;  4B93 A;  5FQJ A;  1VHM A;  1KDS A;  3C8C A;  1J9M A;  4UHU A;  1F9I A;  3QP6 A;  1NZO A;  3VMA A;  2WUQ A;  1Z09 A;  2A3U A;  5F5Y A;  3E4Q A;  2ZM2 A;  3LR3 A;  1OT9 A;  4GD8 A;  1XFN A;  5A92 A;  1U60 A;  4XXR A;  3DAV A;  4XUZ A;  3V67 A;  2XSS A;  4X25 A;  3KX0 X;  1UWN X;  5KMW A;  2VZW A;  1T1C A;  3PTE A;  2XK1 A;  4DJ2 A;  1ZKJ A;  2ZOH A;  3FYZ A;  2Y4A A;  2ZMV A;  3PBS A;  2VA0 A;  3VSL A;  1ESU A;  2HJE A;  2PBY A;  2QYB A;  4DN0 A;  3LI9 A;  1K55 C;  3UB7 A;  4YWZ A;  4KG6 A;  1NLY A;  1K56 A;  3EGX C;  1F5M A;  4QB8 A;  4OON A;  5CED A;  4UQI M;  3NCK A;  5HAQ A;  4LCM A;  1L0G A;  3FPW A;  4N1H A;  2R78 A;  3MZF A;  4OOY A;  3VP4 A;  2H28 A;  3GV9 A;  3IF6 B;  3LI8 A;  4GZB A;  4BLM A;  1K57 A;  1ERO A;  4CLC A;  4JGR A;  4X6T A;  5FQ9 A;  3I7J A;  4IJG A;  5EOO A;  3BW6 A;  3R4K A;  3W4O A;  2W1T B;  2ACG A;  1SDE A;  4Y0T A;  4LLO B;  3QP4 A;  5EPH A;  2WKE A;  2JKF A;  5E43 A;  1TS7 A;  2G7U A;  3RTY A;  4WEL A;  3WS1 A;  1VEU B;  3CAX A;  2HZ5 A;  4I39 A;  5DVA A;  3VFH A;  4R3A A;  5G4Y A;  2C5W B;  5FQI A;  4ETX A;  3S22 A;  2ZM8 A;  2Y2L A;  2B18 A;  1LI9 A;  5IHV A;  4MDZ A;  4OLD A;  3VP0 A;  1AWI A;  3MQ0 A;  4X55 A;  1DRM A;  4ZBE A;  1YMS A;  4G3W A;  1PI4 A;  3GSG A;  4WYY A;  3F1O B;  3ULF A;  4L0L A;  3P98 A;  1IKI A;  3LR5 A;  4JKT A;  3ZCZ A;  1TDL A;  3MQO A;  5HWV A;  2UV0 E;  1MWS A;  1BLC A;  4WZ4 A;  3ZG0 A;  4O0P A;  4KZ6 A;  3LY3 A;  1E3U A;  1DJC A;  2PYP A;  2ZC6 B;  3LIC A;  4F3L A;  3C4P A;  2XD1 A;  1ZTU A;  1CK3 A;  3IWO A;  3F1N B;  3HLW A;  3DTI A;  3F1P A;  3LIE A;  4KZ4 A;  1VM1 A;  5CHJ A;  2P9V B;  4HP9 A;  4E3J A;  1T18 A;  3W8K A;  4PMA A;  3UE1 A;  4R6L A;  4DKI A;  1VB6 A;  4PM9 A;  3ZG9 B;  5EVI B;  3ZQ5 A;  2O9B A;  1W8Q A;  1CI8 A;  3K3D A;  3CZD A;  2J3W A;  4BJP A;  1TS8 A;  4GKU A;  3ZG8 B;  5KSH A;  2WK0 A;  3OPR A;  4ARZ A;  4FUW A;  5A90 A;  4CQH A;  3W4Q A;  3OPH A;  4BBV A;  2V0U A;  4OPQ A;  4NXF A;  3MFD A;  1A0K A;  2JN7 A;  2RL3 A;  4BWI A;  4RX3 A;  4C6Y A;  5DTS A;  4FH2 A;  4WEK A;  5F6A A;  1FR1 A;  2IWD A;  1Q2P A;  4H6J A;  1FCN A;  1H8M A;  3EEA A;  3T12 B;  1K55 A;  4G3V A;  2Q9M A;  1TEM A;  4PKY G;  1D06 A;  2V1B A;  3UN7 A;  1LL9 A;  5EV0 A;  1XPB A;  1N9B A;  5GLB A;  4BEN A;  1YQS A;  5GHX A;  4LRY C;  4CLC B;  2VV8 A;  3HCY A;  3T1S A;  3TW8 A;  1NRF A;  4MBF A;  1PFL A;  4MNR A;  1ZHH B;  4Y7P A;  2R9W A;  1DJA A;  3HBR A;  4FSF A;  1LI0 A;  3KSG A;  3LFV A;  1NWZ A;  4E3K A;  3LR0 A;  5EM1 A;  3UE6 A;  3O86 A;  3VOZ A;  2IWB A;  3KSH A;  1K4F A;  1DY6 A;  3KYQ A;  3HLC A;  3GEC A;  3HUM A;  3TRC A;  3CHW P;  4YOF A;  3BFE A;  3GRJ A;  4JGQ A;  1H3Q A;  3JYI A;  3IBJ A;  4QPR A;  3B42 A;  5GLC A;  3N4I A;  1ZG6 A;  4EET B;  1KE0 A;  2JKR I;  3V3R A;  5EOE A;  2QMI A;  2L0W A;  1PRQ A;  3Q82 A;  4RA7 A;  2W27 A;  3CPT B;  4MCW A;  5BOH A;  2WKP A;  2ZMA A;  4KZ3 A;  4ZJ2 A;  1M40 A;  3Q07 A;  1FIK A;  5IS1 A;  3SH9 A;  2VGL M;  2XFT A;  2OSU A;  1OTB A;  1S67 L;  4JBF A;  5GHY A;  3RFB A;  3B3X A;  1PZO A;  4EBN A;  1YLW A;  5IT5 A;  2Y2Q A;  4OH0 A;  4Y13 A;  1N9N A;  1PI5 A;  2PRF A;  4JXV A;  1YLT A;  2Y8H A;  2W3G A;  4MEZ A;  4ARZ B;  1N9O A;  2HP9 A;  3IF5 A;  2M1C A;  4ZTK A;  3BLM A;  2Y2M A;  4I3I A;  4HY8 A;  3UPN A;  5CXW A;  4ETZ A;  3OC2 A;  4KUO A;  1KGF A;  3HJK A;  2Z6D A;  2OLU A;  4CLC E;  3E2L A;  1RP5 A;  4H6J B;  2OLV A;  2V8C A;  4WLA A;  4EV4 A;  5HW3 A;  4EWF A;  3PBR A;  1IFQ A;  1MKM A;  1XXM A;  3BLS A;  3UO9 A;  2O9C A;  5J3W A;  1XJ4 A;  3QHY A;  3G2Y A;  4DF6 A;  2EWV A;  3T4O A;  5EM0 A;  1BTL A;  2JE5 A;  1JWP A;  1CJF A;  2PU2 A;  3Q1F A;  3WS4 A;  2RCX A;  1KVM A;  3G35 A;  4DE0 A;  1QMF A;  3IS2 A;  3SS5 A;  5EEC A;  1SKO B;  4IUH A;  3NOT C;  2M7U A;  3EWK A;  4BL3 A;  4R38 A;  2EA9 A;  4B88 A;  3V50 A;  3Q81 A;  4MN5 A;  2W1T A;  3S1Y A;  4GNU A;  5U47 A;  2K31 A;  3C7V A;  3MSH A;  1FQG A;  4NET A;  1STZ A;  5AQA A;  3IXH A;  4IVI A;  1V9Y A;  1F2K A;  5L07 A;  2Y2G A;  2INW A;  5TFQ A;  3GVB A;  2WZZ A;  4GB7 A;  1ES3 A;  3H82 A;  1O7E A;  1MPL A;  3G6O A;  2BTF P;  5EFW A;  2PD7 A;  4OQI A;  1IYS A;  4Q0I A;  1K0K A;  4QWO A;  5FAT A;  5JYO A;  1KVL A;  5CGS A;  1LSX A;  4JXS A;  4D60 A;  4P87 A;  3BFF A;  3A3I A;  3OBF A;  1MXO A;  4KZ8 A;  3LIA A;  4GW9 A;  3NOP C;  5L2F A;  5FEG A;  2XLN A;  4BQM A;  2J9O A;  4N9K A;  5FI7 A;  5FAQ A;  3ISG A;  4X1L A;  3UME A;  2VV6 A;  4O01 A;  5CTN A;  5FQQ A;  3BFC A;  4EBP A;  5M18 A;  5DTT A;  1MBL A;  3CMZ A;  1S1Z A;  5FDS A;  4WMC D;  3OCN A;  4HI4 A;  1MKI A;  2H0Y A;  4F94 A;  5TGF A;  5M1A A;  2VGK A;  1W5D A;  2V2F F;  4NXG A;  1ERQ A;  1W8Y A;  4GDB A;  2Y2H A;  2Y2K A;  4WF0 A;  3C38 A;  5FI6 A;  2OAQ 1;  1RCJ A;  4BD1 A;  3KYE A;  5HL1 A;  3S7O A;  3T1X A;  3KYZ A;  3MS6 A;  5HAP A;  3U2A A;  2BG1 A;  4JXW A;  1LSW A;  3SH7 A;  1PW1 A;  2H5S A;  1WYB A;  3D9Y A;  4EU0 A;  5CER A;  3G32 A;  4KZA A;  3HLB A;  2V20 A;  1T1A A;  2JKR M;  2MJ6 A;  1OTA A;  1GSV A;  3V39 A;  4UA6 A;  2WAE A;  3BY8 A;  3SH8 A;  3PYP A;  2WGI A;  3T4S A;  4XUX A;  1XP4 A;  1OPX A;  3S7N A;  1MWT A;  4EQI A;  1S4R A;  2Z6C A;  3NJA A;  3MJQ A;  1YLZ A;  1XX2 A;  2QKP A;  2W3D A;  1P9R A;  4Z9Q A;  1X0O A;  1P9W A;  2J8Y A;  5E2F A;  4U0X A;  4MLL A;  2Y2J A;  1BLS A;  3IX4 A;  3C4O A;  2LB5 A;  4R70 A;  3UE3 A;  3PAG A;  1L3L A;  1MWR A;  1XKZ A;  4GLQ A;  3IS2 B;  5AQB A;  1SKF A;  3BFD A;  3DTK A;  5K5B A;  1M6K A;  4K0W A;  2PT7 A;  3EQV A;  4QHC A;  4NXB A;  4KQQ A;  3JVU A;  4GCZ A;  1ESI A;  2WGV A;  2BAS A;  1GHM A;  4BD0 A;  2VGJ A;  3VOY A;  4EEP A;  4X69 A;  1DP8 A;  2W3H A;  1CEG A;  3DWK A;  1HVB A;  4Y0O A;  4R23 A;  4B4Z A;  5CX7 A;  3FG8 A;  4BBU A;  3H82 B;  2EX9 A;  3D3O A;  3R7W A;  4K91 A;  1W63 M;  2HV1 A;  3QNB A;  4S2M A;  5DKL A;  4G3K A;  5FQK A;  2O9A A;  3K3C A;  5HDD A;  2VEA A;  1NLZ A;  3WS5 A;  4UA9 A;  2NUT C;  2PU4 A;  4Z1W A;  3WWX A;  1Z6F A;  1T19 A;  2GDN A;  4MN7 A;  5I5L A;  1D7E A;  4M3K A;  4BMW A;  4E3L A;  4RYE A;  3LGO A;  2Z2L B;  3UDX A;  2V0W A;  1LLB A;  3CPT A;  5TR7 A;  2ZD8 A;  4LEN A;  1IEL A;  5J4E A;  4HH2 A;  4X53 A;  5F1G A;  1YMX A;  4X68 A;  2QHK A;  1YLY A;  2V9A A;  4EXO A;  4Q8I A;  1KGE A;  1PW8 A;  5F1F A;  3B33 A;  4EEU A;  1W63 Q;  3MF0 A;  1OTD A;  1BUL A;  4HJ4 A;  5C5K A;  3CUE C;  2J80 A;  3P01 A;  3ZVW A;  2DRW A;  2FH5 A;  2WKR A;  1ONG A;  2GJ3 A;  2JKT I;  3O3V A;  1TVF A;  4WM9 A;  4A5R A;  4ESP A;  3IHB A;  4DE2 A;  3MXQ A;  1LSV A;  2BLS A;  4BL2 A;  2KLI A;  5GLD A;  3QP5 A;  1K6R A;  3S4X A;  2J3T D;  1BLP A;  3HUN A;  1OTE A;  1S0W A;  4S2K A;  3BEC A;  1LHY A;  5L09 A;  2QJ7 A;  4U3T A;  4M4X A;  2Q9N A;  1HLU P;  3DTM A;  2VV7 A;  3HLE A;  1G6O A;  3OLO A;  4S2P A;  2L4R A;  5L10 A;  5TJJ A;  2D02 A;  3EEH A;  1IYO A;  1F98 A;  2GNX A;  5CHU A;  3ICY A;  4I3A A;  1TS0 A;  4Q0J A;  1PZP A;  3T4K A;  1SKO A;  4GOG A;  3NOU C;  2ZL1 A;  2AVX A;  3IH8 A;  3E4O A;  4P0M A;  4PKY A;  3Q7Z A;  4OP8 A;  4GJ4 A;  1KOU A;  3N8R A;  4OQG A;  1S4S A;  4R4R A;  1DP9 A;  3MXR A;  3NI9 A;  1KE4 A;  2ZC7 A;  1LT0 A;  2H0T A;  5DTK A;  4I3J A;  1NZU A;  1Y28 A;  4KZB A;  4JGO A;  4KZ7 A;  3V5M A;  3R7W B;  5FAO A;  3NHQ A;  3T4Q A;  1TDG A;  1FCM A;  2EXB A;  4Q0H A;  3FWL A;  4P6Z S;  3NDG A;  3FPV A;  1K38 A;  4S2N C;  3RH8 B;  5DF7 A;  1K25 A;  3EQU A;  3L7H A;  5AQ7 A;  1JNU A;  4R4S A;  2DCF A;  4JGP A;  1L2S A;  1XJ2 A;  2PAV P;  3H7W A;  1BT5 A;  5HZH A;  4N9L A;  3OPL A;  1OME A;  2YKH A;  3ZDJ A;  3NIA A;  3BY9 A;  3LUQ A;  1PWG A;  3QP8 A;  4E6X A;  4KQR A;  3WRT A;  1GA0 A;  3BJN A;  5FDH A;  4WBG A;  4PM8 A;  4IUK A;  2Y59 A;  3JVV A;  1ES5 A;  1T1B A;  2EWW A;  4EUV A;  4MBH A;  4LGW A;  4RQ9 A;  1YSP A;  1JTG A;  4HH3 A;  2Y2O A;  3UB6 A;  4HNB A;  1MC0 A;  5CEB A;  4CPK A;  3VP1 A;  3SS4 A;  3BM6 A;  2L1M A;  3CUE A;  3IH9 A;  3KO6 A;  4OKP A;  2ZBB A;  4E6W A;  1K4E A;  2I9V A;  4L9G A;  3FKV A;  3D72 A;  1TD5 A;  5E2E A;  4Y5F A;  4QU3 A;  4LFU A;  1G6A A;  3BFG A;  3CG5 A;  4GDN A;  1S1Y A;  4II7 A;  1HZO A;  2QWS A;  3Q7V A;  5HPI A;  4IHQ A;  5F83 A;  3M6H A;  4UAA A;  1XA7 A;  2JC7 A;  2HF6 A;  3PBT A;  1YPR A;  4R3J A;  2KX6 A;  1MZU A; 
#chains in the Genus database with same CATH homology
 2B18 A;  2OAQ 1;  4MDZ A;  4LPZ A;  4AFI A;  4HJ3 A;  3S7O A;  4GS9 A;  3MQ0 A;  3C30 A;  3KYZ A;  1DRM A;  3MFX A;  4E04 A;  5DJU A;  2PR5 A;  2WKQ A;  1P0Z A;  4G3W A;  4B9O A;  3U2A A;  4WL9 A;  2VLG A;  3F1O B;  3ULF A;  4L0L A;  1LSW A;  1UGU A;  2PHY A;  4PAU A;  2ZOI A;  3LR5 A;  5FL3 A;  4EU0 A;  1IOU A;  3MQO A;  5HWV A;  2XA7 M;  4EW7 A;  2VX8 A;  1OTI A;  4GHI B;  5AVE A;  4O0P A;  1T1A A;  1GSW A;  3EGD C;  4NKP A;  1S66 L;  2JKR M;  3KSI A;  2MJ6 A;  1OTA A;  1GSV A;  2PYP A;  4L9E A;  3BY8 A;  3LIC A;  4F3L A;  3OOV A;  1ZTU A;  3PYP A;  1XJ3 A;  3T4S A;  1OPX A;  3F1N B;  3F1P A;  2D01 A;  3LIE A;  3S7N A;  2JKT M;  4DMZ A;  1S4R A;  2Z6C A;  1OJG A;  4HP9 A;  3NJA A;  3MJQ A;  3T50 A;  1T18 A;  2PDR A;  4R6L A;  2QKP A;  1VB6 A;  2W3D A;  3CWF A;  1P9R A;  2A24 A;  3ZQ5 A;  1X0O A;  1P9W A;  2O9B A;  3K3D A;  2J3W A;  4BJP A;  1TS8 A;  5KSH A;  1OT6 A;  2LB5 A;  3PBO A;  4R70 A;  1YAX A;  4ARZ A;  3UE3 A;  3LIB A;  4GLQ A;  1YSQ A;  3IS2 B;  4CQH A;  4ZRR A;  1OJ5 A;  2K7S A;  5K5B A;  1UWP X;  4BBV A;  2V0U A;  4Y2F A;  4NXF A;  2XA7 S;  2JN7 A;  2PT7 A;  2VKS A;  3EQV A;  1YKD A;  2YKF A;  2PYR A;  4FOF A;  5HPF A;  4BWI A;  5MC7 A;  4F3L B;  3E98 A;  4MMN A;  3MR0 A;  1TF1 A;  5HDS A;  5TBM B;  5J7E A;  4NXB A;  4WEK A;  4HOI A;  4LRZ E;  5F6A A;  5LBR A;  3JVU A;  4GCZ A;  5DF9 A;  3F1P B;  4H6J A;  2BAS A;  3H7W B;  3PBN A;  2PD8 A;  1H8M A;  2FZ0 A;  4EEP A;  3EEA A;  1DP8 A;  2W3H A;  3LYX A;  4G3V A;  2JHE A;  3KSF A;  3CIT A;  5CX7 A;  3FG8 A;  4PKY G;  4EER A;  5F68 A;  4BBU A;  3UMD A;  3H82 B;  2A2L A;  2K2N A;  1D06 A;  3D3O A;  3VE4 A;  3P7N A;  4XT2 A;  3R7W A;  4BBT A;  1W63 M;  2HV1 A;  4HJ6 A;  5DKL A;  1LL8 A;  4PHT A;  4G3K A;  2V1B A;  1XJ6 A;  2O9A A;  3K3C A;  4WN5 A;  1EW0 A;  5HDD A;  1DP6 A;  2VEA A;  1NLZ A;  3DBA A;  2NUT C;  4WEJ A;  4HIA A;  4Z1W A;  2NUP C;  1T19 A;  2W1R A;  4LRY C;  2VV8 A;  3HCY A;  4CLC B;  4CLC D;  3H9W A;  4MN7 A;  5I5L A;  3UB8 A;  3VOL A;  1D7E A;  3TW8 A;  2VGL S;  4I38 A;  4BMW A;  1G28 A;  2XRN A;  1ZHH B;  5HDC A;  1BYW A;  2V0W A;  3PXP A;  2OAP 1;  4FSF A;  2M7V A;  3LID A;  3KSG A;  3LFV A;  2HGV A;  1NWZ A;  3MMH A;  5J4E A;  4HP4 A;  4HH2 A;  3LR0 A;  3UE6 A;  3B47 A;  4XT2 B;  3KSH A;  2QHK A;  3KYQ A;  2V9A A;  2W3F A;  3GEC A;  4EXO A;  3VE3 A;  3PR6 A;  5HD3 A;  3TRC A;  3B33 A;  4EEU A;  4YOF A;  3LR4 A;  4JGQ A;  1H3Q A;  1W63 Q;  3CI6 A;  4GS9 B;  4CLC C;  2P08 A;  3IBJ A;  2PR6 A;  3MF0 A;  4QPR A;  1OTD A;  3B42 A;  4EES A;  4HJ4 A;  5C5K A;  3A0S A;  3CUE C;  4NEE D;  4EET B;  2KDK A;  2QJ5 A;  5A8B A;  2J80 A;  2JKR I;  3P01 A;  1N9L A;  5HWT A;  3T4J A;  2L0W A;  2FH5 A;  2WKR A;  5HWW A;  2GJ3 A;  2W27 A;  5AJG A;  2JKT I;  4MCW A;  2WKP A;  3FC7 A;  5IU1 A;  2Y79 A;  3MXQ A;  4ME4 A;  1LSV A;  1ODV A;  5IS1 A;  2DMW A;  2VGL M;  3T4L A;  2KLI A;  4MN6 A;  3E0Y A;  2KOI A;  2OWH A;  2CMN A;  3A0R A;  1OTB A;  3OCL A;  1S67 L;  2J3T D;  4KQO A;  1OTE A;  3RFB A;  4EQ1 A;  2W0N A;  2QJ7 A;  4DJ3 A;  2A24 B;  3BQA A;  3LIF A;  4M4X A;  2VV7 A;  5IT5 A;  1G6O A;  3OLO A;  2L4R A;  5DFX A;  1N9N A;  5DKK A;  5TJJ A;  4YNR A;  2D02 A;  3EEH A;  3F1O A;  2Y8H A;  2W3G A;  2GNX A;  1F98 A;  4Y3I A;  4ARZ B;  1N9O A;  3ICY A;  4I3A A;  2M1C A;  1TS0 A;  5F69 A;  4Q0J A;  1P97 A;  4I3I A;  4I5S A;  4HY8 A;  3BQ8 A;  3T4K A;  3TE8 A;  4ETZ A;  2B02 A;  3OC2 A;  3NOU C;  5HD5 A;  4KUO A;  3HJK A;  2Z6D A;  3E4O A;  2HJ9 C;  5HSQ A;  4CLC E;  4UQI S;  4HHD A;  4PKY A;  4GJ4 A;  2GZA A;  3UB9 A;  1KOU A;  4H6J B;  3F1N A;  5G4Z A;  2J3T C;  3EOI A;  2OWJ A;  4O8G A;  1S4S A;  4WLA A;  1TS6 A;  3W2Z A;  5DJT A;  1DP9 A;  2LB9 A;  3PHY A;  3PBR A;  2O0Y A;  1IFQ A;  2GX5 A;  1MKM A;  4WUJ A;  3IBR A;  3S7P A;  3SW1 A;  1XFQ A;  1LT0 A;  2O9C A;  2VJW A;  5KIZ A;  1NRJ A;  5J3W A;  4I3J A;  1Y28 A;  3A0V A;  3TJZ C;  1XJ4 A;  2ZMF A;  4B93 A;  4JGO A;  2V1A A;  2EWV A;  1V9Z A;  3T4O A;  1VHM A;  3C8C A;  3R7W B;  1F9I A;  3NHQ A;  4K08 A;  3T4Q A;  3PBQ A;  5F5Y A;  4Q0H A;  3IS2 A;  4KQD A;  3E4Q A;  3HJI A;  3LR3 A;  4P6Z S;  1OT9 A;  1WA9 A;  4LRX C;  3BWL A;  4IUH A;  3E4P A;  3NOT C;  2M7U A;  1XFN A;  3FPV A;  3EWK A;  2P04 A;  4R38 A;  3RH8 B;  2EA9 A;  3V67 A;  2XSS A;  3EQU A;  4KUK A;  4OOL A;  3KX0 X;  5TBM A;  4MN5 A;  1UWN X;  5DFY A;  2W1T A;  2VZW A;  1JNU A;  1T1C A;  4DJ2 A;  2K31 A;  4JGP A;  1XJ2 A;  2ZOH A;  4HQA A;  3H7W A;  2ZMV A;  3PBS A;  2VA0 A;  2OOL A;  2HJE A;  1STZ A;  2QYB A;  3CLO A;  5HZH A;  2YKH A;  4DN0 A;  4WF0 A;  3BY9 A;  3LI9 A;  3LUQ A;  3UB7 A;  4YWZ A;  1NLY A;  3EGX C;  1V9Y A;  3BJN A;  2P7J A;  2INW A;  4IUK A;  1F5M A;  4UQI M;  3H82 A;  3JVV A;  3G6O A;  2O99 A;  1T1B A;  2EWW A;  4EUV A;  5EFW A;  2PD7 A;  4Q0I A;  4RQ9 A;  1YSP A;  3FPW A;  2R78 A;  2H28 A;  3VV4 A;  4HH3 A;  1LSX A;  4NXE A;  3LI8 A;  3UB6 A;  3O5Y A;  4HNB A;  1MC0 A;  3OBF A;  3LIA A;  4GW9 A;  2XRO A;  3NOP C;  5AVF A;  4CLC A;  4JGR A;  4IJG A;  4L9F A;  3BW6 A;  4OOM A;  3R4K A;  2W1T B;  2L1M A;  3CUE A;  3KO6 A;  4LLO B;  3T4T A;  2ZBB A;  5L8M A;  2I9V A;  4L9G A;  3ZYT A;  3UME A;  3D72 A;  2VV6 A;  4O01 A;  5HL6 A;  2IA2 A;  1TD5 A;  4P6Z M;  4Y5F A;  1TS7 A;  3C2W A;  2G7U A;  3RTY A;  1S1Z A;  4GHI A;  4WEL A;  4UEY A;  3OCN A;  4HI4 A;  3GDI A;  3CAX A;  1S1Y A;  4II7 A;  2W3E A;  2QWS A;  4I39 A;  3K2N A;  3S7Q A;  4R3A A;  5G4Y A;  5HPI A;  4IHQ A;  4NXG A;  2HF6 A;  3PBT A;  3MQQ A;  4ETX A;  1GSX A;  3C38 A;  2KX6 A;  1MZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...