4B93A

Complex of vamp7 cytoplasmic domain with 2nd ankyrin repeat domain of varp
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
157
Chain Sequence
b'SMAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFSFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VESICLE-ASSOCIATED MEMBRANE PROTEIN 7
molecule tags Exocytosis
source organism Mus musculus
publication title The Binding of Varp to Vamp7 Traps Vamp7 in a Closed, Fusogenically Inactive Conformation.
pubmed doi rcsb
total genus 48
structure length 157
sequence length 164
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4b93A00
1IFQA 3BW6A 3EGDC 4B93A 3EGXC 2NUPC 2VX8A 1IOUA 3KYQA 1H8MA 2NUTC 2DMWA 4AFIA
chains in the Genus database with same CATH superfamily
3HLWA 4RVAA 2WUQA 4K91A 1YSPA 2XFSA 2HDQA 1SZVA 3MZFA 2A49A 1IELA 4S2KA 1OTAA 3HLCA 1O07A 3T1SA 4DDYA 1PW1A 3W4QA 4BMWA 1K0KA 4UQIS 3IF6C 4BBTA 1PFLA 4OOLA 2Y59A 3CUEC 4S2NA 1DRMA 3O88A 1K54C 4OH0A 4FD8A 5DF9A 1MWRA 4PM8A 2WKQA 2XLNA 4LCMA 3IXHA 1NYMA 4P6ZS 1D1JA 3JPUA 3OLOA 4OOMA 3NHQA 1T1BA 3BWLA 2ZLYA 4KZ9A 4X25A 1FCNA 4UA6A 5E43A 2ZC7A 4NG2A 4I3IA 1HZOA 2Y2PA 3MS6A 2J3WA 3FZCA 3LUQA 1DJAA 4JGOA 2VV6A 3NOTC 4Y5FA 3KSIA 3MR0A 4PHTA 5EUAA 4ZTKA 3MZEA 1N4OA 3A3DA 3M6BA 2XSSA 1FR6A 3FPVA 3LO7A 1KOUA 5HAPA 1C3BA 2O99A 3VMAA 3QP4A 4OOYA 5F68A 1YKDA 3EEHA 1GSVA 3T4SA 2HDRA 1X0OA 3LIFA 5TBMA 3LY3A 2Z2MB 3PBQA 5HZHA 1YPRA 3UN7A 3UB9A 4IBRA 3ZG9B 3VV4A 5FQ9A 1NZOA 4O8GA 1K57A 3UY6A 5CECA 4OPZA 4O0PA 2YKFA 3A3EA 4JF4A 1XXMA 3QNCA 4JGQA 4DKIA 4WLAA 1EI5A 4HI4A 3BFFA 4HIAA 1NRFA 3ZFZA 3NJAA 3SH9A 1KGGA 3BJNA 4G3VA 3TE8A 4HJ3A 4UHUA 1XA1A 2WAEA 1SKOA 3RTYA 1P9WA 2WGWB 1KDSA 3LI8A 3GSGA 1FOFA 2R9WA 1IYSA 4R23A 3T4QA 1GCEA 3MQOA 3MQQA 2QJ5A 1VEUB 5FQKA 1ODVA 4UEYA 3ZCZA 2XH9A 4WUJA 5GLDA 4DE0A 3RXXA 4R3BA 2ZQAA 3C4OA 4NEED 1AWIA 2WGWA 4S2LA 4BQMA 1S0WA 1G6OA 3DBAA 4GJ4A 4EBLA 5CEDA 5KMWA 3A0VA 4E6XA 4EBNA 4BD1A 4Y0TA 1T1CA 1ONGA 4C3QA 1T1AA 1LL9A 1DP8A 2L0WA 3KSGA 4S2IA 2Y2KA 3T4OA 1ACFA 2V2FF 2Z6CA 2PRFA 2C6WB 3DTIA 2HDUA 4LV1A 2J7VA 5HW3A 3V50A 3UE3A 4MBFA 1JTGA 4JGPA 5AJGA 4GHIB 4PM9A 3UPPA 4EV4A 3E0YA 2B18A 4L9EA 4FUWA 1XA7A 2Y2QA 5GLCA 1SDEA 3NC8A 1ESUA 2HZ5A 1RP5A 5G4ZA 5EVLA 2P7JA 1CJFA 4Y0OA 3IBJA 3KSFA 3CUEA 4S2NC 2QKPA 5FAPA 1ES4A 4IBXA 1P0ZA 3C5AA 1BUEA 2JN7A 3OZHA 3MF0A 1Z09A 3EGXC 5FI7A 3A0RA 2JCHA 4ZBEA 5A91A 3HLFA 3ZG5A 4L0LA 5F69A 4IVIA 4CLCE 1NXYA 3M2JA 5FATA 3VSLA 4LPZA 1NYYA 4BLMA 2ZMAA 4HEFA 4DXBA 1YSQA 2XD1A 1ZTUA 2X02A 4HBTA 1K25A 1VM1A 1WE4A 2EFXA 5HL6A 1PZPA 1ALQA 1PNEA 2WKPA 2NUTC 5DF7A 2ZQ7A 1XJ4A 3IX4A 3C8CA 5HARA 2WYXA 2WZXA 1PZOA 3WRZA 3Q1FA 3G2YA 2J80A 1QMEA 2W3EA 2Y2JA 4DJ2A 4WEJA 2W3GA 2ACGA 4I38A 4UA7A 2QZ6A 1E3UD 2W3FA 5EVIB 3S1YA 5J4EA 3PBSA 5EE8A 3R7WB 2OV5A 1ZG6A 1D06A 4BWIA 3UB8A 4KG6A 3T4TA 2HGVA 4X1LA 2QYBA 1XJ6A 1OTBA 1PYYA 1DP9A 3VE3A 3FKVA 5KSCA 3TJZC 2VGJA 1MWSA 3IS2A 1E4DA 2ZC5B 5A92A 4MDZA 1IYQA 4X56A 1Q2PA 2W1TA 2Y55A 4X1MA 1Q2QA 2ZQDA 3IXGA 3FC7A 1EROA 3ZNYA 2WAFA 1CEFA 1M40A 3S4XA 3ZVTA 5HPIA 1LSXA 2EX6A 1PIOA 2ZC4B 4LRYC 4Y0UA 1KE4A 3ISGA 4R1GA 3BQ8A 5AQ9A 1LSWA 4FCFA 2EXBA 5CERA 1N9BA 3JVUA 5FQIA 1P9RA 3CLOA 4U3TA 1ERMA 4X53A 2NUPC 3NULA 3WS4A 1W63Q 4BBUA 4KZ8A 4R4SA 3ZG0A 4KZ5A 5KSHA 4E3LA 4EESA 1LL5A 3BQAA 4DMZA 3LIAA 4NETA 2JHEA 2CMNA 5U47A 3MFDA 5M18A 3IHAA 1S4SA 3AGFA 3F1NB 1HLUP 2P04A 2BASA 3W4OA 5E2GA 4Y15A 1TD5A 2Y91A 2R78A 4GW9A 5EECA 3DW0A 1KGEA 3UB5P 4A5RA 4HNBA 2ZMVA 4KZ7A 5A93A 3FG8A 2OLVA 3HLEA 3SW1A 1OJGA 4DN0A 1K54A 4F3LB 4K0WA 1XGIA 1K55C 4N92A 4E6WA 1PWCA 2KOIA 3ICYA 4FSFA 1PI4A 3G34A 3FWLA 3OPPA 1BLPA 3HJKA 1GA9A 5MC7A 5TBMB 3NY4A 1NJ4A 3CI6A 1PI5A 3OBFA 2WGVA 4QPRA 3SH7A 1S66L 5CHJA 3S7NA 2G2UA 4PAUA 2EA9A 4ETXA 2ZD8A 3Q7VB 3UB7A 4EEPA 3B33A 1W79A 3MSHA 4PM7A 4PMAA 2V1AA 5FDHA 5A90A 1TDGA 5DTKA 3IBRA 1YMSA 3T1QB 5K5BA 2EXAA 2W27A 3GVBA 1VETA 1TVFA 3NI9A 5CHUA 4FOFA 4N9LA 3IXBA 2K7SA 3E2LA 2PT7A 3KYQA 4B9OA 2PHYA 2PU4A 4Y3IA 5DJTA 3MKFA 4K0XA 3ZDJA 5M1AA 2QJ7A 4RX2A 1LI9A 1ESIA 2BG1A 4WELA 1A0KA 3T4LA 5EVID 4PM5A 3VOLA 1SCWA 5I5LA 3AGDA 4BJPA 1H8MA 2O9AA 4KUKA 4YINA 3HLBA 1MWUA 1NRJA 4O01A 5CGSA 2WKIA 1ONHA 2ZQ9A 3NOUC 5BOHA 3B42A 1K57C 1ES3A 2H10A 3TW8A 1M6KA 4YNRA 4R3AA 1KE3A 2D02A 2QMIA 4OLDA 4X69A 1YLWA 2XF3A 5J7EA 2J3TD 4X68A 5J8XA 2ZOIA 2JE5A 2I72A 1XX2A 4CLCA 3QP1A 2D01A 3IH9A 1J3WA 3C30A 2JKRM 2XFTA 1MC0A 5HSQA 2XEPA 4LLOB 3UDXA 3GMWA 3HREA 3N7WA 4LV0A 1XJ3A 1WYBA 2XDMA 3BLSA 4BL3A 4IEDA 3S7OA 3F1PB 2B95A 3JYIA 5CX7A 5DTSA 2V0UA 1LHYA 4KENB 3PHYA 4QB8A 2LB9A 1YLPA 5HD5A 2Y2LA 4R38A 1SDNA 2HP6A 3IH8A 3WS5A 2IWCA 1L0GA 1D7EA 5CEBA 3HVFA 3E4OA 3EQUA 1H8YA 5E2HA 2H28A 4MBHA 3LR3A 3D9YA 4EQIA 3UMEA 3RJUA 4G3WA 5HPFA 2PBDP 2V1ZA 3LR0A 5HD3A 2JKGA 1XGJA 4BBVA 4DE1A 2EWWA 2XA7M 4X6TA 3VP4A 4K08A 4ZAMA 1K6RA 2JC7A 2G7UA 2JKTM 1FCMA 3CPTB 4CQHA 3SOIA 2OWHA 4EERA 5FQQA 2XROA 3QP6A 1EW0A 3UPOA 2W3DA 4MEZA 2XQZA 4MLLA 1S1ZA 4LRXC 2EX8A 1Y4OA 4CJNA 1E25A 3Q82A 4PKYG 1K56D 4HBUA 3D72A 3LCEA 4ZRRA 4ZDXA 4P87A 3F1NA 3ZG7B 3BFEA 2VV7A 4S2JA 3LEZA 2JKTI 2HV1A 5IHVA 2P9VA 3VOZA 1CI8A 3FYZA 2WKRA 5DF8A 3MBZA 2BTFP 1N9NA 5FL3A 1GHIA 2ZC6B 2O0YA 4H8RA 1L0FA 1RGYA 3ZYTA 4E3JA 4JKTA 3LICA 3IHBA 4JGRA 2VKSA 3NCKA 3WS1A 1OTDA 4EWFA 1KDWA 5J3WA 4D2OA 2PBYA 4OPYA 2V1BA 4Z1WA 4WZ5C 1N9LA 1HTZA 2PR6A 1XFNA 4DE3A 1MWTA 3F1OA 4MNRA 1LSVA 2J9PA 3ZQ5A 3LR5A 4EUZA 4Q0IA 2Z2LB 1G6AA 3DTMA 4HJ6A 1FIKA 1GHPA 3HLGA 5AVFA 2H5SA 3DTEA 5F1FA 4WMCA 1BYWA 2EX2A 2HJEA 5EPHA 3LIBA 1IKGA 3N8RA 3UB6A 4KQQA 4LFUA 3PBNA 4QWOA 1L0EA 4JXSA 2W1RA 1OTEA 1ES2A 2YKHA 4NXGA 4QHCA 4GN2A 4WZ4A 2QHKA 5E2FA 4EEUA 3VOYA 4R0QA 5IT5A 1RCJA 4MN5A 4XT2A 1BSGA 4HY8A 5CHMA 2VZWA 2ZM2A 4GD8A 3FPWA 2DCFA 3N8LA 1K56A 1MY8A 2Q9MA 4KG2A 4IVKA 4GS9B 4GDBA 1YQSA 1MKIA 1K55A 4WBGA 3LR4A 3F1OB 3VP0A 4I39A 4OONA 4RX3A 4NK3A 3C38A 5M19A 4QU3A 5EM0A 3P98A 3SS5A 1KE0A 3UO9A 1CQAA 1VHMA 3OPHA 3ZGAB 3MXQA 2IA2A 2C5WB 1UWPX 2KDKA 1TF1A 3Q81A 4Z9QA 1BZAA 3QP8A 2A2LA 3I7JA 4H6JB 2OAQ1 2VGKA 5GL9A 1CK3A 1G5UA 4PM6A 1LLBA 2JKFA 1SHVA 1QMFA 2K31A 1K6SA 2RCXA 3WRTA 2PYRA 1K38A 1OT9A 4HH3A 4OQIA 4GD6A 3RXWA 3IF5A 3VFFA 5GLAA 5L8MA 4B4ZA 3W2ZA 4DXCA 1F5MA 4N1HA 1J9MA 1BLCA 4WF0A 3NBLA 3GECA 3E4PA 4KZ6A 4L9GA 4ESPA 4B4XA 3LYXA 3WS0A 3C2WA 2OWJA 3K2NA 3IF6A 1JTDA 3C7VA 3PBRA 4JF6A 3D4FA 2VEAA 3H9WA 1W63M 1NZUA 5F1GA 4IUKA 4B93A 4FH4A 2J8YA 3VP2A 4OPQA 5GHXA 5CTNA 1H8ZA 5LBRA 4QJGA 4P6BA 4WMCD 1W7FA 2PYPA 2W0NA 2R9XA 4JF5A 2W1TB 4IUHA 4E3MA 3HL9A 1IYPA 3DTKA 1IEMA 1VETB 5TFQA 1PW8A 1VQQA 5DVAA 3ITBA 2IWDA 4XT2B 5CGWA 5DKKA 4GLQA 3QP2A 3CPTA 3E2KA 1W8YA 1UWNX 3Q7VA 3G4PA 1G28A 1G68A 3MZDA 1E3UA 3AGEA 3QNBA 3SH8A 4GKUA 4E3NA 3U4LP 1YMXA 4P6ZM 3A0SA 2Y2OA 2Q0OA 4C6YA 3ULFA 3GV9A 3BFCA 5EM1A 4GDNA 4IHQA 5EOOA 4LV2A 2PU2A 4UA9A 3BYDA 4OQ0A 1LI0A 3V39A 1H5XA 1XJ2A 2O9CA 2H0TA 4DJ3A 4MCWA 5FEGA 4RYEA 4WL9A 4DE2A 4U0TA 3Q7ZA 2ZL1B 2PD8A 4XUZA 1GSWA 1DP6A 3LFVA 1JWZA 1I2SA 3G6OA 4HP9A 3BM6A 1STZA 1ZC2A 4EBPA 3C7UA 4OP8A 4LENA 3GTCA 5JYOA 2RL3A 3G31A 1JNUA 1FQGA 4B88A 2FFFB 2UV0E 4II7A 1YLTA 3PAGA 1OJ5A 3UE0A 5EV0A 1FSYA 2O9BA 5L09A 3O3VA 1ERQA 3ZHHA 3A3FA 1AXBA 1WYCA 4M3KA 4HHDA 2V8FA 2K2NA 5AVEA 1TEMA 4HOIA 3MFXA 4Y2FA 1MZUA 3UE1A 4OVDA 4OKPA 3T1RA 1KVLA 4F94A 4N1XA 2EX9A 1Z6FA 3MQ0A 4RA7A 3VFHA 1YM1A 3W8KA 4R6LA 4NKPA 1S6RA 2QWSA 1YLJA 4EXOA 3Q07A 3HJIA 3UE6A 2HF6A 4FTXA 5HDDA 4PPRA 5FSRA 4GOGA 1XPBA 1JWPA 3C4PA 3PBOA 2EWVA 4OQGA 3IF6B 4KQDA 4P85A 5CTMA 1MPLA 2HPBA 1N9OA 5AQ7A 3BFDA 1FSWA 1NLZA 4M4XA 1ZHHB 5C5KA 3TSGA 3P7NA 4G3KA 2KLIA 3HUMA 4YOFA 3EWKA 4CLCC 4E3KA 3U2AA 2WKEA 2PR5A 5AQBA 2L4RA 3WS2A 1H3QA 2M1CA 3GRJA 4Q0HA 3L7HA 1CEGA 4L9FA 1OMEA 3R7WA 2B5RA 3SS3A 1XKZA 2ZMFA 4NXBA 1V9YA 4KQOA 4NXFA 2QPNA 5HAQA 1BLHA 5L10A 4BL2A 3BECA 3NDGA 3A3IA 3OCLA 2ZM8A 2ZQ8A 2V9AA 3FV7A 4OQHA 3BW6A 1OPXA 4P0MA 4WEKA 3GR2A 5L2FA 3B47A 1K4FA 1MBLA 4NXEA 1JWVA 3IXDA 1VB6A 2Y2HA 2VJWA 4WN5A 2XD5A 4LRZE 3H82A 1FILA 3N8SA 3G32A 1T18A 2HP5A 4KZ3A 5DTTA 3EQVA 4UQIM 1FR1A 3RH8B 3B3XA 2ZOHA 5GHZA 4JBFA 2HJ9C 4IJGA 3CZDA 3UNWA 5G18A 5HFOA 3G2ZA 4KZAA 4Q0JA 5HAIA 4CLCD 4OP5A 3M2KA 1NWZA 4ZJ3A 4CLCB 3M6HA 3KO6A 2ZM0A 5FAOA 1NLYA 2HP9A 3EEAA 2X71A 1L3LA 2MJ6A 2WKHA 3S7QA 4GZBA 1KGFA 4JLFA 4MN7A 4EUVA 2ZC3B 1XFQA 4EQ1A 1OT6A 4GCZA 5AQAA 1L0DA 4H6JA 3PXPA 3HUOA 3V67A 2LB5A 2GJ3A 1NY0A 3JVVA 3MXRA 3OPRA 1PWGA 4GHIA 1MXOA 3L9KA 3O86A 2XA7S 2M7VA 3H7WB 2H0YA 3DWKA 5CXWA 3VSKA 3CMZA 3V3RA 4YWZA 5FI6A 2UWXA 1GSXA 3E4QA 2DMWA 5IS1A 4I3JA 3N4IA 1S67L 4D60A 5CRFA 1CF0A 1CI9A 2X01A 2PD7A 2P08A 1IKIA 3T12B 1VEUA 1SKOB 3KSHA 5HL1A 3MMHA 3S22A 1H0MA 5HX9A 4X55A 3KYZA 5EVEA 3CG5A 1WA9A 4HP4A 3KX0X 2P9VB 1K4EA 4DDSA 1EWZA 5GHYA 4JPMA 3T50A 4ARZA 1I5QA 3CWFA 1U60A 3BRMA 4XUXA 3T1XA 2VX8A 3D3OA 4KG5A 5DJUA 1PWDA 3NDEA 2GX5A 2AVXA 2ZJ9A 2V0WA 3G30A 4CPKA 4S2OA 3GQZA 4UAAA 3NECA 3BFGA 2VGLM 4E3IA 3PR6A 1MKMA 1PRQA 4F3LA 3PAEA 4GB7A 2GZAA 3R4KA 1DJBA 3RFBA 4R3JA 3VP3A 2FFYA 3NOPC 2Y2GA 2V20A 4U0XA 3H7WA 3TRCA 2G2WA 2VGLS 2PDRA 2A24A 4LGWA 3ZVWA 2PAVP 4QD4A 2KX6A 5JYPA 3CITA 1RGZA 2DNSA 4OLGA 3T4JA 2XK1A 1TS6A 2W3HA 1ES5A 4LCLA 3CJMA 3IT9A 2EFUA 5DFXA 1FCOA 2CC1A 2OLUA 5F5YA 3UPNA 4DF6A 3BLMA 5FI2A 2OAP1 2XR0A 3VE4A 1S4RA 2Y2NA 3UMDA 3IWIA 5FDSA 5FQMA 5HWVA 3BY8A 2Z6DA 4RQ9A 4QY6A 1KVMA 5IU1A 5TR7A 1LL8A 2JKRI 3IS2B 5KIZA 1XP4A 3IWOA 4O7DA 2A24B 3SZTA 3CAXA 4YFMA 2ZBBA 3PYPA 4Q8IA 1GA0A 1L2SA 4HESA 4BD0A 4S2MA 3O87A 4EU0A 3H82B 1BLSA 1UGUA 3SS4A 4FH2A 4I5SA 3LY4A 1Y54A 4Y17A 3VP1A 4E3OA 4Y13A 4WZ5A 2GDNA 2Y2MA 1TS8A 3K3DA 2Y2IA 2M7UA 3ITAA 4JXVA 5FQJA 4GNUA 3P09A 4C75A 2Q9NA 1V9ZA 1BTLA 4JXWA 3ZG8B 1ZG4A 3TOIA 1F2KA 4ARZB 2E8IA 3UDFA 4MMNA 1BULA 2FZ0A 4WYYA 3IX3A 5HWTA 3A3JA 3ZNTA 2Y4AA 2ZL1A 3LI9A 1GHMA 3IWQA 1W5DA 1F98A 3S7PA 4GS9A 4XXRA 1BT5A 1YLYA 1YAXA 2XGNA 1W8QA 2E8JA 3CHWP 2VLGA 1YT4A 4EW7A 2IWBA 2Y8HA 4PKYA 3LIEA 5DFYA 5G4YA 1TS0A 1TS7A 2OSUA 5TGFA 5FASA 2FH5A 3OPLA 4HH2A 4ID4A 5L07A 3FKWA 5A8BA 5FEFA 5HDCA 1Y28A 3K3CA 4MBKA 5FAQA 5GLBA 3HBRA 3P01A 2P74A 3T4KA 3EOIA 1O7EA 2HDSA 3E98A 4BENA 4OPRA 3F1PA 3IX8A 4ZJ1A 2WADA 3G35A 3DWZA 3HCYA 3BEBA 3OCNA 4DRTA 4HJ4A 2VK3A 5CGXA 4ME4A 2A3UA 1IYOA 4KZBA 1IFQA 4R70A 1DY6A 1I2WA 2V8CA 3GDIA 2VV8A 4R4RA 1JVJA 3QHYA 2VA0A 2XRNA 2B02A 3O5YA 5HWWA 2OOLA 2Y79A 3DAVA 5EOEA 3N6IA 2WZZA 3OOVA 2L1MA 3QP5A 3WWXA 1HVBA 4Y7PA 3V3SA 5EVIA 4ZJ2A 1LT0A 4I3AA 5F82A 1ZKJA 5EFWA 2I9VA 4S2PA 2J9OA 1S1YA 3PTEA 4EETB 1P97A 4HQAA 3UDIA 4KQRA 3LGOA 3W4PA 5I94A 2INWA 2GNXA 3BY9A 2ZQCA 3HUNA 3NIAA 3MJQA 5KZHA 3LIDA 5TJJA 3TG9A 1OTIA 5EVIC 2J3TC 2JBFA 5HDSA 1IOUA 3MKEA 4KZ4A 4WM9A 4AFIA 1T19A 1DJCA 4ETZA 4N9KA 3PBTA 3IQAA 4E04A 1HD8A 5E2EA 5DKLA 2WGIA 3KYEA 4QY5A 2WK0A 1F9IA 5D3OA 5FA7A 1TDLA 5F83A 2BLSA 3V5MA 1SKFA 5F6AA 1YLZA 3LEQA 4KUOA 4MN6A 4LV3A 2DRWA 3HLDA 3OC2A 3EGDC 3MXSA 4JXGA
chains in the Genus database with same CATH topology
2XA7S 2M7VA 1W63Q 4BBUA 3H7WB 1YSPA 1VHMA 5KSHA 3MXQA 2IA2A 4YWZA 4EESA 3BQAA 1OTAA 1GSXA 3E4QA 2DMWA 1UWPX 2KDKA 4DMZA 3LIAA 5IS1A 2JHEA 4I3JA 1TF1A 2CMNA 1S67L 2A2LA 4BMWA 4H6JB 2OAQ1 4UQIS 1S4SA 3F1NB 2PD7A 2P04A 2P08A 4BBTA 2BASA 1TD5A 3KSHA 4OOLA 3MMHA 2R78A 4GW9A 3KYZA 3CUEC 1WA9A 2K31A 4HP4A 1DRMA 2PYRA 4HNBA 1OT9A 4HH3A 5DF9A 2ZMVA 2WKQA 3KX0X 4P6ZS 3FG8A 5L8MA 3SW1A 1OJGA 3W2ZA 3T50A 4ARZA 4DN0A 3CWFA 3OLOA 4OOMA 4F3LB 3NHQA 1F5MA 1T1BA 3BWLA 2VX8A 3D3OA 4WF0A 2KOIA 3ICYA 5DJUA 3GECA 4FSFA 3E4PA 2GX5A 4L9GA 4I3IA 3LYXA 2V0WA 2J3WA 3C2WA 2OWJA 3LUQA 3HJKA 4JGOA 3K2NA 2VV6A 3NOTC 5MC7A 3PBRA 5TBMB 2VEAA 3H9WA 3CI6A 4Y5FA 3KSIA 1W63M 3OBFA 3MR0A 2VGLM 4PHTA 4IUKA 4QPRA 4B93A 1S66L 3PR6A 1MKMA 2XSSA 3S7NA 4PAUA 2EA9A 4ETXA 5LBRA 4F3LA 3FPVA 3UB7A 4EEPA 1KOUA 2GZAA 2O99A 2PYPA 3B33A 2W0NA 3R4KA 5F68A 2W1TB 2V1AA 4IUHA 3RFBA 1YKDA 3EEHA 1GSVA 3NOPC 3T4SA 3IBRA 1X0OA 3LIFA 5TBMA 3PBQA 5HZHA 3H7WA 3UB9A 3TRCA 3VV4A 5K5BA 2W27A 2VGLS 4O8GA 2PDRA 2A24A 4XT2B 5DKKA 4GLQA 4FOFA 2KX6A 3CITA 4O0PA 2YKFA 2K7SA 2PT7A 1UWNX 3KYQA 4B9OA 2PHYA 3T4JA 1G28A 1TS6A 2W3HA 4Y3IA 5DJTA 2QJ7A 5DFXA 4JGQA 4P6ZM 5F5YA 4WLAA 3A0SA 3ULFA 4HI4A 4WELA 3T4LA 4HIAA 3VOLA 2OAP1 3VE4A 3NJAA 4IHQA 5I5LA 1S4RA 3BJNA 4G3VA 3TE8A 4HJ3A 3UMDA 4BJPA 5HWVA 1H8MA 2O9AA 4KUKA 3BY8A 1XJ2A 2O9CA 1NRJA 4DJ3A 2Z6DA 4O01A 4RQ9A 1P9WA 3RTYA 4MCWA 3NOUC 5IU1A 4WL9A 3B42A 1LL8A 2JKRI 3IS2B 3TW8A 5KIZA 3LI8A 4YNRA 4R3AA 2A24B 2D02A 2PD8A 1GSWA 1DP6A 3CAXA 3LFVA 3T4QA 2ZBBA 3G6OA 3MQOA 3MQQA 4HP9A 3PYPA 2QJ5A 5J7EA 2J3TD 2ZOIA 1STZA 4EU0A 1ODVA 3H82B 4UEYA 4CLCA 1UGUA 4WUJA 2D01A 4I5SA 3C30A 2JKRM 1MC0A 5HSQA 4NEED 1JNUA 1TS8A 4LLOB 3K3DA 4II7A 1OJ5A 2M7UA 2O9BA 1XJ3A 1G6OA 3DBAA 4GJ4A 3A0VA 3S7OA 3F1PB 4HHDA 1V9ZA 2K2NA 5AVEA 5CX7A 1T1CA 2V0UA 1T1AA 4HOIA 1DP8A 2L0WA 3KSGA 3PHYA 2LB9A 4ARZB 5HD5A 3T4OA 3MFXA 4R38A 4MMNA 4Y2FA 1MZUA 2Z6CA 1D7EA 2FZ0A 3E4OA 3EQUA 2H28A 3LR3A 5HWTA 3UMEA 3UE3A 4G3WA 5HPFA 3LI9A 4JGPA 3LR0A 1F98A 5HD3A 5AJGA 3S7PA 4BBVA 4GS9A 2EWWA 4GHIB 2XA7M 1YAXA 3MQ0A 4K08A 2G7UA 2JKTM 3E0YA 2B18A 2VLGA 4L9EA 4R6LA 4NKPA 2QWSA 4CQHA 4EW7A 2OWHA 4EERA 2Y8HA 4PKYA 3LIEA 5DFYA 5G4YA 1TS0A 4EXOA 2XROA 1EW0A 1TS7A 3HJIA 2W3DA 3UE6A 2HF6A 2FH5A 1S1ZA 4LRXC 5HDDA 5G4ZA 4HH2A 2P7JA 3PBOA 3IBJA 2EWVA 4PKYG 3KSFA 3D72A 3CUEA 4ZRRA 2QKPA 5A8BA 4KQDA 3F1NA 5HDCA 2VV7A 1N9OA 1Y28A 1P0ZA 3K3CA 3P01A 2JKTI 2JN7A 1NLZA 3MF0A 3EGXC 2HV1A 4M4XA 1ZHHB 5C5KA 3T4KA 3A0RA 3EOIA 2WKRA 3E98A 3P7NA 4G3KA 4L0LA 2KLIA 5F69A 4CLCE 4YOFA 3F1PA 3EWKA 4CLCC 1N9NA 5FL3A 3U2AA 2PR5A 2O0YA 4LPZA 3ZYTA 3HCYA 2L4RA 3OCNA 1YSQA 1H3QA 1ZTUA 4HJ4A 2M1CA 3LICA 5HL6A 4ME4A 4Q0HA 4JGRA 2VKSA 2WKPA 2NUTC 4L9FA 1OTDA 3R7WA 1IFQA 1XJ4A 4R70A 2ZMFA 4NXBA 1V9YA 3C8CA 4KQOA 4NXFA 5J3WA 3GDIA 2VV8A 2VA0A 2XRNA 2V1BA 2B02A 2J80A 2W3EA 4DJ2A 3O5YA 4WEJA 2OOLA 5HWWA 2W3GA 4Z1WA 4I38A 2Y79A 3OCLA 1N9LA 2PR6A 1XFNA 2W3FA 2V9AA 3F1OA 3OOVA 1LSVA 5J4EA 3ZQ5A 3PBSA 3BW6A 1OPXA 2L1MA 3LR5A 4WEKA 3R7WB 1D06A 4BWIA 3B47A 3UB8A 4Q0IA 4NXEA 3T4TA 1VB6A 2HGVA 2VJWA 4HJ6A 4WN5A 2QYBA 1XJ6A 1OTBA 1LT0A 4I3AA 4LRZE 3H82A 1DP9A 3VE3A 1T18A 5EFWA 2I9VA 3TJZC 3EQVA 1S1YA 3IS2A 4UQIM 5AVFA 4EETB 1P97A 4HQAA 3RH8B 4MDZA 1BYWA 2ZOHA 2INWA 2GNXA 3BY9A 2HJEA 2W1TA 3LIBA 2HJ9C 3MJQA 4IJGA 3UB6A 3LIDA 5TJJA 3FC7A 1OTIA 3PBNA 4Q0JA 2J3TC 4CLCD 2W1RA 5HDSA 1OTEA 2YKHA 4NXGA 1NWZA 1IOUA 2QHKA 4CLCB 4EEUA 5IT5A 4MN5A 4XT2A 3KO6A 5HPIA 1LSXA 4AFIA 1NLYA 1T19A 3EEAA 4HY8A 2MJ6A 2VZWA 4ETZA 4LRYC 3S7QA 3BQ8A 1LSWA 3PBTA 4MN7A 4EUVA 4E04A 1XFQA 4EQ1A 3FPWA 5DKLA 3JVUA 1F9IA 1OT6A 4GCZA 4H6JA 1P9RA 3PXPA 3V67A 5F6AA 3CLOA 4GS9B 4KUOA 4MN6A 3OC2A 3LR4A 3EGDC 3F1OB 2LB5A 2GJ3A 4I39A 3JVVA 3C38A 2NUPC 4GHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFQ A;  3BW6 A;  3EGD C;  4B93 A;  3EGX C;  2NUP C;  2VX8 A;  1IOU A;  3KYQ A;  1H8M A;  2NUT C;  2DMW A;  4AFI A; 
#chains in the Genus database with same CATH topology
 3HLW A;  4RVA A;  2WUQ A;  4K91 A;  1YSP A;  2XFS A;  2HDQ A;  1SZV A;  3MZF A;  2A49 A;  1IEL A;  4S2K A;  1OTA A;  3HLC A;  1O07 A;  3T1S A;  4DDY A;  1PW1 A;  3W4Q A;  4BMW A;  1K0K A;  4UQI S;  3IF6 C;  4BBT A;  1PFL A;  4OOL A;  2Y59 A;  3CUE C;  4S2N A;  1DRM A;  3O88 A;  1K54 C;  4OH0 A;  4FD8 A;  5DF9 A;  1MWR A;  4PM8 A;  2WKQ A;  2XLN A;  4LCM A;  3IXH A;  1NYM A;  4P6Z S;  1D1J A;  3JPU A;  3OLO A;  4OOM A;  3NHQ A;  1T1B A;  3BWL A;  2ZLY A;  4KZ9 A;  4X25 A;  1FCN A;  4UA6 A;  5E43 A;  2ZC7 A;  4NG2 A;  4I3I A;  1HZO A;  2Y2P A;  3MS6 A;  2J3W A;  3FZC A;  3LUQ A;  1DJA A;  4JGO A;  2VV6 A;  3NOT C;  4Y5F A;  3KSI A;  3MR0 A;  4PHT A;  5EUA A;  4ZTK A;  3MZE A;  1N4O A;  3A3D A;  3M6B A;  2XSS A;  1FR6 A;  3FPV A;  3LO7 A;  1KOU A;  5HAP A;  1C3B A;  2O99 A;  3VMA A;  3QP4 A;  4OOY A;  5F68 A;  1YKD A;  3EEH A;  1GSV A;  3T4S A;  2HDR A;  1X0O A;  3LIF A;  5TBM A;  3LY3 A;  2Z2M B;  3PBQ A;  5HZH A;  1YPR A;  3UN7 A;  3UB9 A;  4IBR A;  3ZG9 B;  3VV4 A;  5FQ9 A;  1NZO A;  4O8G A;  1K57 A;  3UY6 A;  5CEC A;  4OPZ A;  4O0P A;  2YKF A;  3A3E A;  4JF4 A;  1XXM A;  3QNC A;  4JGQ A;  4DKI A;  4WLA A;  1EI5 A;  4HI4 A;  3BFF A;  4HIA A;  1NRF A;  3ZFZ A;  3NJA A;  3SH9 A;  1KGG A;  3BJN A;  4G3V A;  3TE8 A;  4HJ3 A;  4UHU A;  1XA1 A;  2WAE A;  1SKO A;  3RTY A;  1P9W A;  2WGW B;  1KDS A;  3LI8 A;  3GSG A;  1FOF A;  2R9W A;  1IYS A;  4R23 A;  3T4Q A;  1GCE A;  3MQO A;  3MQQ A;  2QJ5 A;  1VEU B;  5FQK A;  1ODV A;  4UEY A;  3ZCZ A;  2XH9 A;  4WUJ A;  5GLD A;  4DE0 A;  3RXX A;  4R3B A;  2ZQA A;  3C4O A;  4NEE D;  1AWI A;  2WGW A;  4S2L A;  4BQM A;  1S0W A;  1G6O A;  3DBA A;  4GJ4 A;  4EBL A;  5CED A;  5KMW A;  3A0V A;  4E6X A;  4EBN A;  4BD1 A;  4Y0T A;  1T1C A;  1ONG A;  4C3Q A;  1T1A A;  1LL9 A;  1DP8 A;  2L0W A;  3KSG A;  4S2I A;  2Y2K A;  3T4O A;  1ACF A;  2V2F F;  2Z6C A;  2PRF A;  2C6W B;  3DTI A;  2HDU A;  4LV1 A;  2J7V A;  5HW3 A;  3V50 A;  3UE3 A;  4MBF A;  1JTG A;  4JGP A;  5AJG A;  4GHI B;  4PM9 A;  3UPP A;  4EV4 A;  3E0Y A;  2B18 A;  4L9E A;  4FUW A;  1XA7 A;  2Y2Q A;  5GLC A;  1SDE A;  3NC8 A;  1ESU A;  2HZ5 A;  1RP5 A;  5G4Z A;  5EVL A;  2P7J A;  1CJF A;  4Y0O A;  3IBJ A;  3KSF A;  3CUE A;  4S2N C;  2QKP A;  5FAP A;  1ES4 A;  4IBX A;  1P0Z A;  3C5A A;  1BUE A;  2JN7 A;  3OZH A;  3MF0 A;  1Z09 A;  3EGX C;  5FI7 A;  3A0R A;  2JCH A;  4ZBE A;  5A91 A;  3HLF A;  3ZG5 A;  4L0L A;  5F69 A;  4IVI A;  4CLC E;  1NXY A;  3M2J A;  5FAT A;  3VSL A;  4LPZ A;  1NYY A;  4BLM A;  2ZMA A;  4HEF A;  4DXB A;  1YSQ A;  2XD1 A;  1ZTU A;  2X02 A;  4HBT A;  1K25 A;  1VM1 A;  1WE4 A;  2EFX A;  5HL6 A;  1PZP A;  1ALQ A;  1PNE A;  2WKP A;  2NUT C;  5DF7 A;  2ZQ7 A;  1XJ4 A;  3IX4 A;  3C8C A;  5HAR A;  2WYX A;  2WZX A;  1PZO A;  3WRZ A;  3Q1F A;  3G2Y A;  2J80 A;  1QME A;  2W3E A;  2Y2J A;  4DJ2 A;  4WEJ A;  2W3G A;  2ACG A;  4I38 A;  4UA7 A;  2QZ6 A;  1E3U D;  2W3F A;  5EVI B;  3S1Y A;  5J4E A;  3PBS A;  5EE8 A;  3R7W B;  2OV5 A;  1ZG6 A;  1D06 A;  4BWI A;  3UB8 A;  4KG6 A;  3T4T A;  2HGV A;  4X1L A;  2QYB A;  1XJ6 A;  1OTB A;  1PYY A;  1DP9 A;  3VE3 A;  3FKV A;  5KSC A;  3TJZ C;  2VGJ A;  1MWS A;  3IS2 A;  1E4D A;  2ZC5 B;  5A92 A;  4MDZ A;  1IYQ A;  4X56 A;  1Q2P A;  2W1T A;  2Y55 A;  4X1M A;  1Q2Q A;  2ZQD A;  3IXG A;  3FC7 A;  1ERO A;  3ZNY A;  2WAF A;  1CEF A;  1M40 A;  3S4X A;  3ZVT A;  5HPI A;  1LSX A;  2EX6 A;  1PIO A;  2ZC4 B;  4LRY C;  4Y0U A;  1KE4 A;  3ISG A;  4R1G A;  3BQ8 A;  5AQ9 A;  1LSW A;  4FCF A;  2EXB A;  5CER A;  1N9B A;  3JVU A;  5FQI A;  1P9R A;  3CLO A;  4U3T A;  1ERM A;  4X53 A;  2NUP C;  3NUL A;  3WS4 A;  1W63 Q;  4BBU A;  4KZ8 A;  4R4S A;  3ZG0 A;  4KZ5 A;  5KSH A;  4E3L A;  4EES A;  1LL5 A;  3BQA A;  4DMZ A;  3LIA A;  4NET A;  2JHE A;  2CMN A;  5U47 A;  3MFD A;  5M18 A;  3IHA A;  1S4S A;  3AGF A;  3F1N B;  1HLU P;  2P04 A;  2BAS A;  3W4O A;  5E2G A;  4Y15 A;  1TD5 A;  2Y91 A;  2R78 A;  4GW9 A;  5EEC A;  3DW0 A;  1KGE A;  3UB5 P;  4A5R A;  4HNB A;  2ZMV A;  4KZ7 A;  5A93 A;  3FG8 A;  2OLV A;  3HLE A;  3SW1 A;  1OJG A;  4DN0 A;  1K54 A;  4F3L B;  4K0W A;  1XGI A;  1K55 C;  4N92 A;  4E6W A;  1PWC A;  2KOI A;  3ICY A;  4FSF A;  1PI4 A;  3G34 A;  3FWL A;  3OPP A;  1BLP A;  3HJK A;  1GA9 A;  5MC7 A;  5TBM B;  3NY4 A;  1NJ4 A;  3CI6 A;  1PI5 A;  3OBF A;  2WGV A;  4QPR A;  3SH7 A;  1S66 L;  5CHJ A;  3S7N A;  2G2U A;  4PAU A;  2EA9 A;  4ETX A;  2ZD8 A;  3Q7V B;  3UB7 A;  4EEP A;  3B33 A;  1W79 A;  3MSH A;  4PM7 A;  4PMA A;  2V1A A;  5FDH A;  5A90 A;  1TDG A;  5DTK A;  3IBR A;  1YMS A;  3T1Q B;  5K5B A;  2EXA A;  2W27 A;  3GVB A;  1VET A;  1TVF A;  3NI9 A;  5CHU A;  4FOF A;  4N9L A;  3IXB A;  2K7S A;  3E2L A;  2PT7 A;  3KYQ A;  4B9O A;  2PHY A;  2PU4 A;  4Y3I A;  5DJT A;  3MKF A;  4K0X A;  3ZDJ A;  5M1A A;  2QJ7 A;  4RX2 A;  1LI9 A;  1ESI A;  2BG1 A;  4WEL A;  1A0K A;  3T4L A;  5EVI D;  4PM5 A;  3VOL A;  1SCW A;  5I5L A;  3AGD A;  4BJP A;  1H8M A;  2O9A A;  4KUK A;  4YIN A;  3HLB A;  1MWU A;  1NRJ A;  4O01 A;  5CGS A;  2WKI A;  1ONH A;  2ZQ9 A;  3NOU C;  5BOH A;  3B42 A;  1K57 C;  1ES3 A;  2H10 A;  3TW8 A;  1M6K A;  4YNR A;  4R3A A;  1KE3 A;  2D02 A;  2QMI A;  4OLD A;  4X69 A;  1YLW A;  2XF3 A;  5J7E A;  2J3T D;  4X68 A;  5J8X A;  2ZOI A;  2JE5 A;  2I72 A;  1XX2 A;  4CLC A;  3QP1 A;  2D01 A;  3IH9 A;  1J3W A;  3C30 A;  2JKR M;  2XFT A;  1MC0 A;  5HSQ A;  2XEP A;  4LLO B;  3UDX A;  3GMW A;  3HRE A;  3N7W A;  4LV0 A;  1XJ3 A;  1WYB A;  2XDM A;  3BLS A;  4BL3 A;  4IED A;  3S7O A;  3F1P B;  2B95 A;  3JYI A;  5CX7 A;  5DTS A;  2V0U A;  1LHY A;  4KEN B;  3PHY A;  4QB8 A;  2LB9 A;  1YLP A;  5HD5 A;  2Y2L A;  4R38 A;  1SDN A;  2HP6 A;  3IH8 A;  3WS5 A;  2IWC A;  1L0G A;  1D7E A;  5CEB A;  3HVF A;  3E4O A;  3EQU A;  1H8Y A;  5E2H A;  2H28 A;  4MBH A;  3LR3 A;  3D9Y A;  4EQI A;  3UME A;  3RJU A;  4G3W A;  5HPF A;  2PBD P;  2V1Z A;  3LR0 A;  5HD3 A;  2JKG A;  1XGJ A;  4BBV A;  4DE1 A;  2EWW A;  2XA7 M;  4X6T A;  3VP4 A;  4K08 A;  4ZAM A;  1K6R A;  2JC7 A;  2G7U A;  2JKT M;  1FCM A;  3CPT B;  4CQH A;  3SOI A;  2OWH A;  4EER A;  5FQQ A;  2XRO A;  3QP6 A;  1EW0 A;  3UPO A;  2W3D A;  4MEZ A;  2XQZ A;  4MLL A;  1S1Z A;  4LRX C;  2EX8 A;  1Y4O A;  4CJN A;  1E25 A;  3Q82 A;  4PKY G;  1K56 D;  4HBU A;  3D72 A;  3LCE A;  4ZRR A;  4ZDX A;  4P87 A;  3F1N A;  3ZG7 B;  3BFE A;  2VV7 A;  4S2J A;  3LEZ A;  2JKT I;  2HV1 A;  5IHV A;  2P9V A;  3VOZ A;  1CI8 A;  3FYZ A;  2WKR A;  5DF8 A;  3MBZ A;  2BTF P;  1N9N A;  5FL3 A;  1GHI A;  2ZC6 B;  2O0Y A;  4H8R A;  1L0F A;  1RGY A;  3ZYT A;  4E3J A;  4JKT A;  3LIC A;  3IHB A;  4JGR A;  2VKS A;  3NCK A;  3WS1 A;  1OTD A;  4EWF A;  1KDW A;  5J3W A;  4D2O A;  2PBY A;  4OPY A;  2V1B A;  4Z1W A;  4WZ5 C;  1N9L A;  1HTZ A;  2PR6 A;  1XFN A;  4DE3 A;  1MWT A;  3F1O A;  4MNR A;  1LSV A;  2J9P A;  3ZQ5 A;  3LR5 A;  4EUZ A;  4Q0I A;  2Z2L B;  1G6A A;  3DTM A;  4HJ6 A;  1FIK A;  1GHP A;  3HLG A;  5AVF A;  2H5S A;  3DTE A;  5F1F A;  4WMC A;  1BYW A;  2EX2 A;  2HJE A;  5EPH A;  3LIB A;  1IKG A;  3N8R A;  3UB6 A;  4KQQ A;  4LFU A;  3PBN A;  4QWO A;  1L0E A;  4JXS A;  2W1R A;  1OTE A;  1ES2 A;  2YKH A;  4NXG A;  4QHC A;  4GN2 A;  4WZ4 A;  2QHK A;  5E2F A;  4EEU A;  3VOY A;  4R0Q A;  5IT5 A;  1RCJ A;  4MN5 A;  4XT2 A;  1BSG A;  4HY8 A;  5CHM A;  2VZW A;  2ZM2 A;  4GD8 A;  3FPW A;  2DCF A;  3N8L A;  1K56 A;  1MY8 A;  2Q9M A;  4KG2 A;  4IVK A;  4GS9 B;  4GDB A;  1YQS A;  1MKI A;  1K55 A;  4WBG A;  3LR4 A;  3F1O B;  3VP0 A;  4I39 A;  4OON A;  4RX3 A;  4NK3 A;  3C38 A;  5M19 A;  4QU3 A;  5EM0 A;  3P98 A;  3SS5 A;  1KE0 A;  3UO9 A;  1CQA A;  1VHM A;  3OPH A;  3ZGA B;  3MXQ A;  2IA2 A;  2C5W B;  1UWP X;  2KDK A;  1TF1 A;  3Q81 A;  4Z9Q A;  1BZA A;  3QP8 A;  2A2L A;  3I7J A;  4H6J B;  2OAQ 1;  2VGK A;  5GL9 A;  1CK3 A;  1G5U A;  4PM6 A;  1LLB A;  2JKF A;  1SHV A;  1QMF A;  2K31 A;  1K6S A;  2RCX A;  3WRT A;  2PYR A;  1K38 A;  1OT9 A;  4HH3 A;  4OQI A;  4GD6 A;  3RXW A;  3IF5 A;  3VFF A;  5GLA A;  5L8M A;  4B4Z A;  3W2Z A;  4DXC A;  1F5M A;  4N1H A;  1J9M A;  1BLC A;  4WF0 A;  3NBL A;  3GEC A;  3E4P A;  4KZ6 A;  4L9G A;  4ESP A;  4B4X A;  3LYX A;  3WS0 A;  3C2W A;  2OWJ A;  3K2N A;  3IF6 A;  1JTD A;  3C7V A;  3PBR A;  4JF6 A;  3D4F A;  2VEA A;  3H9W A;  1W63 M;  1NZU A;  5F1G A;  4IUK A;  4B93 A;  4FH4 A;  2J8Y A;  3VP2 A;  4OPQ A;  5GHX A;  5CTN A;  1H8Z A;  5LBR A;  4QJG A;  4P6B A;  4WMC D;  1W7F A;  2PYP A;  2W0N A;  2R9X A;  4JF5 A;  2W1T B;  4IUH A;  4E3M A;  3HL9 A;  1IYP A;  3DTK A;  1IEM A;  1VET B;  5TFQ A;  1PW8 A;  1VQQ A;  5DVA A;  3ITB A;  2IWD A;  4XT2 B;  5CGW A;  5DKK A;  4GLQ A;  3QP2 A;  3CPT A;  3E2K A;  1W8Y A;  1UWN X;  3Q7V A;  3G4P A;  1G28 A;  1G68 A;  3MZD A;  1E3U A;  3AGE A;  3QNB A;  3SH8 A;  4GKU A;  4E3N A;  3U4L P;  1YMX A;  4P6Z M;  3A0S A;  2Y2O A;  2Q0O A;  4C6Y A;  3ULF A;  3GV9 A;  3BFC A;  5EM1 A;  4GDN A;  4IHQ A;  5EOO A;  4LV2 A;  2PU2 A;  4UA9 A;  3BYD A;  4OQ0 A;  1LI0 A;  3V39 A;  1H5X A;  1XJ2 A;  2O9C A;  2H0T A;  4DJ3 A;  4MCW A;  5FEG A;  4RYE A;  4WL9 A;  4DE2 A;  4U0T A;  3Q7Z A;  2ZL1 B;  2PD8 A;  4XUZ A;  1GSW A;  1DP6 A;  3LFV A;  1JWZ A;  1I2S A;  3G6O A;  4HP9 A;  3BM6 A;  1STZ A;  1ZC2 A;  4EBP A;  3C7U A;  4OP8 A;  4LEN A;  3GTC A;  5JYO A;  2RL3 A;  3G31 A;  1JNU A;  1FQG A;  4B88 A;  2FFF B;  2UV0 E;  4II7 A;  1YLT A;  3PAG A;  1OJ5 A;  3UE0 A;  5EV0 A;  1FSY A;  2O9B A;  5L09 A;  3O3V A;  1ERQ A;  3ZHH A;  3A3F A;  1AXB A;  1WYC A;  4M3K A;  4HHD A;  2V8F A;  2K2N A;  5AVE A;  1TEM A;  4HOI A;  3MFX A;  4Y2F A;  1MZU A;  3UE1 A;  4OVD A;  4OKP A;  3T1R A;  1KVL A;  4F94 A;  4N1X A;  2EX9 A;  1Z6F A;  3MQ0 A;  4RA7 A;  3VFH A;  1YM1 A;  3W8K A;  4R6L A;  4NKP A;  1S6R A;  2QWS A;  1YLJ A;  4EXO A;  3Q07 A;  3HJI A;  3UE6 A;  2HF6 A;  4FTX A;  5HDD A;  4PPR A;  5FSR A;  4GOG A;  1XPB A;  1JWP A;  3C4P A;  3PBO A;  2EWV A;  4OQG A;  3IF6 B;  4KQD A;  4P85 A;  5CTM A;  1MPL A;  2HPB A;  1N9O A;  5AQ7 A;  3BFD A;  1FSW A;  1NLZ A;  4M4X A;  1ZHH B;  5C5K A;  3TSG A;  3P7N A;  4G3K A;  2KLI A;  3HUM A;  4YOF A;  3EWK A;  4CLC C;  4E3K A;  3U2A A;  2WKE A;  2PR5 A;  5AQB A;  2L4R A;  3WS2 A;  1H3Q A;  2M1C A;  3GRJ A;  4Q0H A;  3L7H A;  1CEG A;  4L9F A;  1OME A;  3R7W A;  2B5R A;  3SS3 A;  1XKZ A;  2ZMF A;  4NXB A;  1V9Y A;  4KQO A;  4NXF A;  2QPN A;  5HAQ A;  1BLH A;  5L10 A;  4BL2 A;  3BEC A;  3NDG A;  3A3I A;  3OCL A;  2ZM8 A;  2ZQ8 A;  2V9A A;  3FV7 A;  4OQH A;  3BW6 A;  1OPX A;  4P0M A;  4WEK A;  3GR2 A;  5L2F A;  3B47 A;  1K4F A;  1MBL A;  4NXE A;  1JWV A;  3IXD A;  1VB6 A;  2Y2H A;  2VJW A;  4WN5 A;  2XD5 A;  4LRZ E;  3H82 A;  1FIL A;  3N8S A;  3G32 A;  1T18 A;  2HP5 A;  4KZ3 A;  5DTT A;  3EQV A;  4UQI M;  1FR1 A;  3RH8 B;  3B3X A;  2ZOH A;  5GHZ A;  4JBF A;  2HJ9 C;  4IJG A;  3CZD A;  3UNW A;  5G18 A;  5HFO A;  3G2Z A;  4KZA A;  4Q0J A;  5HAI A;  4CLC D;  4OP5 A;  3M2K A;  1NWZ A;  4ZJ3 A;  4CLC B;  3M6H A;  3KO6 A;  2ZM0 A;  5FAO A;  1NLY A;  2HP9 A;  3EEA A;  2X71 A;  1L3L A;  2MJ6 A;  2WKH A;  3S7Q A;  4GZB A;  1KGF A;  4JLF A;  4MN7 A;  4EUV A;  2ZC3 B;  1XFQ A;  4EQ1 A;  1OT6 A;  4GCZ A;  5AQA A;  1L0D A;  4H6J A;  3PXP A;  3HUO A;  3V67 A;  2LB5 A;  2GJ3 A;  1NY0 A;  3JVV A;  3MXR A;  3OPR A;  1PWG A;  4GHI A;  1MXO A;  3L9K A;  3O86 A;  2XA7 S;  2M7V A;  3H7W B;  2H0Y A;  3DWK A;  5CXW A;  3VSK A;  3CMZ A;  3V3R A;  4YWZ A;  5FI6 A;  2UWX A;  1GSX A;  3E4Q A;  2DMW A;  5IS1 A;  4I3J A;  3N4I A;  1S67 L;  4D60 A;  5CRF A;  1CF0 A;  1CI9 A;  2X01 A;  2PD7 A;  2P08 A;  1IKI A;  3T12 B;  1VEU A;  1SKO B;  3KSH A;  5HL1 A;  3MMH A;  3S22 A;  1H0M A;  5HX9 A;  4X55 A;  3KYZ A;  5EVE A;  3CG5 A;  1WA9 A;  4HP4 A;  3KX0 X;  2P9V B;  1K4E A;  4DDS A;  1EWZ A;  5GHY A;  4JPM A;  3T50 A;  4ARZ A;  1I5Q A;  3CWF A;  1U60 A;  3BRM A;  4XUX A;  3T1X A;  2VX8 A;  3D3O A;  4KG5 A;  5DJU A;  1PWD A;  3NDE A;  2GX5 A;  2AVX A;  2ZJ9 A;  2V0W A;  3G30 A;  4CPK A;  4S2O A;  3GQZ A;  4UAA A;  3NEC A;  3BFG A;  2VGL M;  4E3I A;  3PR6 A;  1MKM A;  1PRQ A;  4F3L A;  3PAE A;  4GB7 A;  2GZA A;  3R4K A;  1DJB A;  3RFB A;  4R3J A;  3VP3 A;  2FFY A;  3NOP C;  2Y2G A;  2V20 A;  4U0X A;  3H7W A;  3TRC A;  2G2W A;  2VGL S;  2PDR A;  2A24 A;  4LGW A;  3ZVW A;  2PAV P;  4QD4 A;  2KX6 A;  5JYP A;  3CIT A;  1RGZ A;  2DNS A;  4OLG A;  3T4J A;  2XK1 A;  1TS6 A;  2W3H A;  1ES5 A;  4LCL A;  3CJM A;  3IT9 A;  2EFU A;  5DFX A;  1FCO A;  2CC1 A;  2OLU A;  5F5Y A;  3UPN A;  4DF6 A;  3BLM A;  5FI2 A;  2OAP 1;  2XR0 A;  3VE4 A;  1S4R A;  2Y2N A;  3UMD A;  3IWI A;  5FDS A;  5FQM A;  5HWV A;  3BY8 A;  2Z6D A;  4RQ9 A;  4QY6 A;  1KVM A;  5IU1 A;  5TR7 A;  1LL8 A;  2JKR I;  3IS2 B;  5KIZ A;  1XP4 A;  3IWO A;  4O7D A;  2A24 B;  3SZT A;  3CAX A;  4YFM A;  2ZBB A;  3PYP A;  4Q8I A;  1GA0 A;  1L2S A;  4HES A;  4BD0 A;  4S2M A;  3O87 A;  4EU0 A;  3H82 B;  1BLS A;  1UGU A;  3SS4 A;  4FH2 A;  4I5S A;  3LY4 A;  1Y54 A;  4Y17 A;  3VP1 A;  4E3O A;  4Y13 A;  4WZ5 A;  2GDN A;  2Y2M A;  1TS8 A;  3K3D A;  2Y2I A;  2M7U A;  3ITA A;  4JXV A;  5FQJ A;  4GNU A;  3P09 A;  4C75 A;  2Q9N A;  1V9Z A;  1BTL A;  4JXW A;  3ZG8 B;  1ZG4 A;  3TOI A;  1F2K A;  4ARZ B;  2E8I A;  3UDF A;  4MMN A;  1BUL A;  2FZ0 A;  4WYY A;  3IX3 A;  5HWT A;  3A3J A;  3ZNT A;  2Y4A A;  2ZL1 A;  3LI9 A;  1GHM A;  3IWQ A;  1W5D A;  1F98 A;  3S7P A;  4GS9 A;  4XXR A;  1BT5 A;  1YLY A;  1YAX A;  2XGN A;  1W8Q A;  2E8J A;  3CHW P;  2VLG A;  1YT4 A;  4EW7 A;  2IWB A;  2Y8H A;  4PKY A;  3LIE A;  5DFY A;  5G4Y A;  1TS0 A;  1TS7 A;  2OSU A;  5TGF A;  5FAS A;  2FH5 A;  3OPL A;  4HH2 A;  4ID4 A;  5L07 A;  3FKW A;  5A8B A;  5FEF A;  5HDC A;  1Y28 A;  3K3C A;  4MBK A;  5FAQ A;  5GLB A;  3HBR A;  3P01 A;  2P74 A;  3T4K A;  3EOI A;  1O7E A;  2HDS A;  3E98 A;  4BEN A;  4OPR A;  3F1P A;  3IX8 A;  4ZJ1 A;  2WAD A;  3G35 A;  3DWZ A;  3HCY A;  3BEB A;  3OCN A;  4DRT A;  4HJ4 A;  2VK3 A;  5CGX A;  4ME4 A;  2A3U A;  1IYO A;  4KZB A;  1IFQ A;  4R70 A;  1DY6 A;  1I2W A;  2V8C A;  3GDI A;  2VV8 A;  4R4R A;  1JVJ A;  3QHY A;  2VA0 A;  2XRN A;  2B02 A;  3O5Y A;  5HWW A;  2OOL A;  2Y79 A;  3DAV A;  5EOE A;  3N6I A;  2WZZ A;  3OOV A;  2L1M A;  3QP5 A;  3WWX A;  1HVB A;  4Y7P A;  3V3S A;  5EVI A;  4ZJ2 A;  1LT0 A;  4I3A A;  5F82 A;  1ZKJ A;  5EFW A;  2I9V A;  4S2P A;  2J9O A;  1S1Y A;  3PTE A;  4EET B;  1P97 A;  4HQA A;  3UDI A;  4KQR A;  3LGO A;  3W4P A;  5I94 A;  2INW A;  2GNX A;  3BY9 A;  2ZQC A;  3HUN A;  3NIA A;  3MJQ A;  5KZH A;  3LID A;  5TJJ A;  3TG9 A;  1OTI A;  5EVI C;  2J3T C;  2JBF A;  5HDS A;  1IOU A;  3MKE A;  4KZ4 A;  4WM9 A;  4AFI A;  1T19 A;  1DJC A;  4ETZ A;  4N9K A;  3PBT A;  3IQA A;  4E04 A;  1HD8 A;  5E2E A;  5DKL A;  2WGI A;  3KYE A;  4QY5 A;  2WK0 A;  1F9I A;  5D3O A;  5FA7 A;  1TDL A;  5F83 A;  2BLS A;  3V5M A;  1SKF A;  5F6A A;  1YLZ A;  3LEQ A;  4KUO A;  4MN6 A;  4LV3 A;  2DRW A;  3HLD A;  3OC2 A;  3EGD C;  3MXS A;  4JXG A; 
#chains in the Genus database with same CATH homology
 2XA7 S;  2M7V A;  1W63 Q;  4BBU A;  3H7W B;  1YSP A;  1VHM A;  5KSH A;  3MXQ A;  2IA2 A;  4YWZ A;  4EES A;  3BQA A;  1OTA A;  1GSX A;  3E4Q A;  2DMW A;  1UWP X;  2KDK A;  4DMZ A;  3LIA A;  5IS1 A;  2JHE A;  4I3J A;  1TF1 A;  2CMN A;  1S67 L;  2A2L A;  4BMW A;  4H6J B;  2OAQ 1;  4UQI S;  1S4S A;  3F1N B;  2PD7 A;  2P04 A;  2P08 A;  4BBT A;  2BAS A;  1TD5 A;  3KSH A;  4OOL A;  3MMH A;  2R78 A;  4GW9 A;  3KYZ A;  3CUE C;  1WA9 A;  2K31 A;  4HP4 A;  1DRM A;  2PYR A;  4HNB A;  1OT9 A;  4HH3 A;  5DF9 A;  2ZMV A;  2WKQ A;  3KX0 X;  4P6Z S;  3FG8 A;  5L8M A;  3SW1 A;  1OJG A;  3W2Z A;  3T50 A;  4ARZ A;  4DN0 A;  3CWF A;  3OLO A;  4OOM A;  4F3L B;  3NHQ A;  1F5M A;  1T1B A;  3BWL A;  2VX8 A;  3D3O A;  4WF0 A;  2KOI A;  3ICY A;  5DJU A;  3GEC A;  4FSF A;  3E4P A;  2GX5 A;  4L9G A;  4I3I A;  3LYX A;  2V0W A;  2J3W A;  3C2W A;  2OWJ A;  3LUQ A;  3HJK A;  4JGO A;  3K2N A;  2VV6 A;  3NOT C;  5MC7 A;  3PBR A;  5TBM B;  2VEA A;  3H9W A;  3CI6 A;  4Y5F A;  3KSI A;  1W63 M;  3OBF A;  3MR0 A;  2VGL M;  4PHT A;  4IUK A;  4QPR A;  4B93 A;  1S66 L;  3PR6 A;  1MKM A;  2XSS A;  3S7N A;  4PAU A;  2EA9 A;  4ETX A;  5LBR A;  4F3L A;  3FPV A;  3UB7 A;  4EEP A;  1KOU A;  2GZA A;  2O99 A;  2PYP A;  3B33 A;  2W0N A;  3R4K A;  5F68 A;  2W1T B;  2V1A A;  4IUH A;  3RFB A;  1YKD A;  3EEH A;  1GSV A;  3NOP C;  3T4S A;  3IBR A;  1X0O A;  3LIF A;  5TBM A;  3PBQ A;  5HZH A;  3H7W A;  3UB9 A;  3TRC A;  3VV4 A;  5K5B A;  2W27 A;  2VGL S;  4O8G A;  2PDR A;  2A24 A;  4XT2 B;  5DKK A;  4GLQ A;  4FOF A;  2KX6 A;  3CIT A;  4O0P A;  2YKF A;  2K7S A;  2PT7 A;  1UWN X;  3KYQ A;  4B9O A;  2PHY A;  3T4J A;  1G28 A;  1TS6 A;  2W3H A;  4Y3I A;  5DJT A;  2QJ7 A;  5DFX A;  4JGQ A;  4P6Z M;  5F5Y A;  4WLA A;  3A0S A;  3ULF A;  4HI4 A;  4WEL A;  3T4L A;  4HIA A;  3VOL A;  2OAP 1;  3VE4 A;  3NJA A;  4IHQ A;  5I5L A;  1S4R A;  3BJN A;  4G3V A;  3TE8 A;  4HJ3 A;  3UMD A;  4BJP A;  5HWV A;  1H8M A;  2O9A A;  4KUK A;  3BY8 A;  1XJ2 A;  2O9C A;  1NRJ A;  4DJ3 A;  2Z6D A;  4O01 A;  4RQ9 A;  1P9W A;  3RTY A;  4MCW A;  3NOU C;  5IU1 A;  4WL9 A;  3B42 A;  1LL8 A;  2JKR I;  3IS2 B;  3TW8 A;  5KIZ A;  3LI8 A;  4YNR A;  4R3A A;  2A24 B;  2D02 A;  2PD8 A;  1GSW A;  1DP6 A;  3CAX A;  3LFV A;  3T4Q A;  2ZBB A;  3G6O A;  3MQO A;  3MQQ A;  4HP9 A;  3PYP A;  2QJ5 A;  5J7E A;  2J3T D;  2ZOI A;  1STZ A;  4EU0 A;  1ODV A;  3H82 B;  4UEY A;  4CLC A;  1UGU A;  4WUJ A;  2D01 A;  4I5S A;  3C30 A;  2JKR M;  1MC0 A;  5HSQ A;  4NEE D;  1JNU A;  1TS8 A;  4LLO B;  3K3D A;  4II7 A;  1OJ5 A;  2M7U A;  2O9B A;  1XJ3 A;  1G6O A;  3DBA A;  4GJ4 A;  3A0V A;  3S7O A;  3F1P B;  4HHD A;  1V9Z A;  2K2N A;  5AVE A;  5CX7 A;  1T1C A;  2V0U A;  1T1A A;  4HOI A;  1DP8 A;  2L0W A;  3KSG A;  3PHY A;  2LB9 A;  4ARZ B;  5HD5 A;  3T4O A;  3MFX A;  4R38 A;  4MMN A;  4Y2F A;  1MZU A;  2Z6C A;  1D7E A;  2FZ0 A;  3E4O A;  3EQU A;  2H28 A;  3LR3 A;  5HWT A;  3UME A;  3UE3 A;  4G3W A;  5HPF A;  3LI9 A;  4JGP A;  3LR0 A;  1F98 A;  5HD3 A;  5AJG A;  3S7P A;  4BBV A;  4GS9 A;  2EWW A;  4GHI B;  2XA7 M;  1YAX A;  3MQ0 A;  4K08 A;  2G7U A;  2JKT M;  3E0Y A;  2B18 A;  2VLG A;  4L9E A;  4R6L A;  4NKP A;  2QWS A;  4CQH A;  4EW7 A;  2OWH A;  4EER A;  2Y8H A;  4PKY A;  3LIE A;  5DFY A;  5G4Y A;  1TS0 A;  4EXO A;  2XRO A;  1EW0 A;  1TS7 A;  3HJI A;  2W3D A;  3UE6 A;  2HF6 A;  2FH5 A;  1S1Z A;  4LRX C;  5HDD A;  5G4Z A;  4HH2 A;  2P7J A;  3PBO A;  3IBJ A;  2EWV A;  4PKY G;  3KSF A;  3D72 A;  3CUE A;  4ZRR A;  2QKP A;  5A8B A;  4KQD A;  3F1N A;  5HDC A;  2VV7 A;  1N9O A;  1Y28 A;  1P0Z A;  3K3C A;  3P01 A;  2JKT I;  2JN7 A;  1NLZ A;  3MF0 A;  3EGX C;  2HV1 A;  4M4X A;  1ZHH B;  5C5K A;  3T4K A;  3A0R A;  3EOI A;  2WKR A;  3E98 A;  3P7N A;  4G3K A;  4L0L A;  2KLI A;  5F69 A;  4CLC E;  4YOF A;  3F1P A;  3EWK A;  4CLC C;  1N9N A;  5FL3 A;  3U2A A;  2PR5 A;  2O0Y A;  4LPZ A;  3ZYT A;  3HCY A;  2L4R A;  3OCN A;  1YSQ A;  1H3Q A;  1ZTU A;  4HJ4 A;  2M1C A;  3LIC A;  5HL6 A;  4ME4 A;  4Q0H A;  4JGR A;  2VKS A;  2WKP A;  2NUT C;  4L9F A;  1OTD A;  3R7W A;  1IFQ A;  1XJ4 A;  4R70 A;  2ZMF A;  4NXB A;  1V9Y A;  3C8C A;  4KQO A;  4NXF A;  5J3W A;  3GDI A;  2VV8 A;  2VA0 A;  2XRN A;  2V1B A;  2B02 A;  2J80 A;  2W3E A;  4DJ2 A;  3O5Y A;  4WEJ A;  2OOL A;  5HWW A;  2W3G A;  4Z1W A;  4I38 A;  2Y79 A;  3OCL A;  1N9L A;  2PR6 A;  1XFN A;  2W3F A;  2V9A A;  3F1O A;  3OOV A;  1LSV A;  5J4E A;  3ZQ5 A;  3PBS A;  3BW6 A;  1OPX A;  2L1M A;  3LR5 A;  4WEK A;  3R7W B;  1D06 A;  4BWI A;  3B47 A;  3UB8 A;  4Q0I A;  4NXE A;  3T4T A;  1VB6 A;  2HGV A;  2VJW A;  4HJ6 A;  4WN5 A;  2QYB A;  1XJ6 A;  1OTB A;  1LT0 A;  4I3A A;  4LRZ E;  3H82 A;  1DP9 A;  3VE3 A;  1T18 A;  5EFW A;  2I9V A;  3TJZ C;  3EQV A;  1S1Y A;  3IS2 A;  4UQI M;  5AVF A;  4EET B;  1P97 A;  4HQA A;  3RH8 B;  4MDZ A;  1BYW A;  2ZOH A;  2INW A;  2GNX A;  3BY9 A;  2HJE A;  2W1T A;  3LIB A;  2HJ9 C;  3MJQ A;  4IJG A;  3UB6 A;  3LID A;  5TJJ A;  3FC7 A;  1OTI A;  3PBN A;  4Q0J A;  2J3T C;  4CLC D;  2W1R A;  5HDS A;  1OTE A;  2YKH A;  4NXG A;  1NWZ A;  1IOU A;  2QHK A;  4CLC B;  4EEU A;  5IT5 A;  4MN5 A;  4XT2 A;  3KO6 A;  5HPI A;  1LSX A;  4AFI A;  1NLY A;  1T19 A;  3EEA A;  4HY8 A;  2MJ6 A;  2VZW A;  4ETZ A;  4LRY C;  3S7Q A;  3BQ8 A;  1LSW A;  3PBT A;  4MN7 A;  4EUV A;  4E04 A;  1XFQ A;  4EQ1 A;  3FPW A;  5DKL A;  3JVU A;  1F9I A;  1OT6 A;  4GCZ A;  4H6J A;  1P9R A;  3PXP A;  3V67 A;  5F6A A;  3CLO A;  4GS9 B;  4KUO A;  4MN6 A;  3OC2 A;  3LR4 A;  3EGD C;  3F1O B;  2LB5 A;  2GJ3 A;  4I39 A;  3JVV A;  3C38 A;  2NUP C;  4GHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...