4B93A

Complex of vamp7 cytoplasmic domain with 2nd ankyrin repeat domain of varp
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
164
structure length
157
Chain Sequence
SMAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFSFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VESICLE-ASSOCIATED MEMBRANE PROTEIN 7
publication title The Binding of Varp to Vamp7 Traps Vamp7 in a Closed, Fusogenically Inactive Conformation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Exocytosis
total genus 48
structure length 157
sequence length 164
ec nomenclature
pdb deposition date 2012-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13774 Longin Regulated-SNARE-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.50 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4b93A00
3EGXC 1H8MA 2NUTC 2DMWA 4AFIA 1IOUA 2NUPC 3KYQA 3BW6A 3EGDC 4B93A 1IFQA 2VX8A
chains in the Genus database with same CATH superfamily
2WGWB 5M1AA 3NOTC 1UGUA 5U47A 5E2GA 3N8LA 1IYSA 4OQIA 3HLDA 1OJ5A 2W3DA 4WLAA 1PI4A 2BLSA 4CLCE 4ZJ1A 1N9NA 3ITAA 5HL1A 3MS6A 3PBNA 3LFVA 2HP5A 3IT9A 4R6LA 2XA7M 3W8KA 4Y13A 4LCLA 3G34A 4OKPA 1W79A 4R1GA 3D9YA 3EEAA 1JTGA 4Y15A 2J9PA 1I2WA 4OOLA 3NDGA 3GQZA 4UQIM 1Y4OA 4EV4A 3FWLA 3EWKA 3IF6B 1Q2QA 3KSHA 4HJ3A 3CI6A 3B33A 4OOYA 1LLBA 5G18A 1GHMA 1XJ4A 3MKEA 4DKIA 1PRQA 2HDQA 3DBAA 3UB7A 5TGFA 4E3OA 2HP9A 4GNUA 2ZC5B 2PBYA 3V3RA 4JGPA 4IUHA 1SZVA 4LV0A 4UAAA 2PD7A 3CHWP 4LRZE 5TFQA 3UDXA 3ZG7B 3O87A 3K2NA 4BQMA 1L3LA 4G3WA 4L9FA 4P6ZM 3F1PB 1V9ZA 1LSXA 3WS5A 4WN5A 3SS4A 4DJ3A 4R4SA 1YKDA 1NJ4A 3IH9A 1VETB 4BENA 3QHYA 1VEUB 1Z09A 4Y5FA 5KMWA 4I3IA 4S2MA 2ZMAA 3WS1A 4LRYC 5DJUA 1D06A 1U60A 3ULFA 3E98A 4IBXA 4BLMA 5KZHA 3BQ8A 3PYPA 3ZG9B 4NXBA 2XF3A 2XA7S 4QJGA 3E4QA 3S22A 5L10A 2EFXA 4EEPA 3T4KA 2YKHA 3Q07A 3NJAA 5CEBA 3MQOA 1XGIA 1SKFA 1W7FA 4GB7A 2JKRI 1CF0A 3OPPA 3UE6A 4H6JB 2WKIA 1PWDA 4P85A 1OTDA 4LGWA 1ESIA 3H7WA 3O5YA 4GZBA 5HDCA 4KQQA 3HLGA 1CI9A 2JKRM 5F69A 3AGDA 4MNRA 1BLPA 5FAOA 1KVLA 2VGLM 4E3KA 2ZJ9A 5HPIA 3ZDJA 3PTEA 4BD0A 1YLJA 3LIAA 4IUKA 1S66L 4WMCD 4JGOA 2GDNA 1S1YA 4F94A 2V8FA 4GHIB 1UWPX 4OQHA 4GDNA 1IFQA 1PZOA 4OVDA 5KSHA 3E2LA 3T4LA 1JTDA 2W1RA 4HJ6A 3WS4A 1NZUA 2G7UA 4YOFA 4Q0JA 3G2ZA 4UA7A 3PBTA 3B47A 3JVVA 5CEDA 2EX8A 3LCEA 3UNWA 2EWWA 3R7WB 3O88A 4ID4A 3UPOA 5G4YA 1OTIA 2W3HA 4A5RA 4DE2A 3MZDA 3ZYTA 1E3UA 3G2YA 3VOLA 5FA7A 4E3NA 1K6SA 4NEED 4U0TA 4OQGA 4QU3A 3CPTA 4PHTA 1G68A 1FILA 4IVIA 4Y17A 5FATA 4O01A 3A3IA 3C4OA 4OP8A 4UEYA 3IHBA 5FQMA 4EU0A 3VE3A 4ZRRA 1MBLA 4S2LA 5M18A 3UB9A 3ZVTA 3V3SA 5CHUA 5EM0A 1SKOB 5DTKA 4WELA 4EW7A 3T12B 4HH2A 3HLFA 2VGLS 1I2SA 3F1NA 2QJ5A 2X02A 4EUVA 2CC1A 5AVFA 4K0WA 2QYBA 1N4OA 1D7EA 4HEFA 3S4XA 4E3MA 2HP6A 1KE0A 3VP4A 2EFUA 1ERMA 3N6IA 4EWFA 1T1CA 4YINA 4MN7A 3WS0A 3KX0X 3DTEA 5A92A 2ZMFA 1BZAA 3OC2A 4EBPA 1VETA 2WKEA 2PHYA 4Y7PA 1TS7A 1JWPA 4Z1WA 4CLCB 1H3QA 5DFXA 3S7NA 4HBUA 5EPHA 4YNRA 5E2FA 1NXYA 3BLSA 1DP9A 3PR6A 4X69A 1XXMA 1H0MA 1T18A 3ZVWA 1OPXA 3RXXA 3UPNA 5F82A 1K4FA 1YQSA 1IYPA 2GNXA 3QP5A 4KZ8A 1MPLA 3LIFA 3ICYA 3SH9A 3MZFA 3CLOA 1D1JA 1PW1A 4H6JA 5GHZA 3TJZC 4OPZA 4BBTA 4E6WA 1TS6A 2K2NA 1M6KA 1K57A 1LL9A 2HJ9C 3S7QA 3GSGA 4O7DA 4GW9A 1RGYA 3CAXA 3HVFA 2HDUA 5DKKA 1FCOA 5CGXA 3VP3A 2A49A 2VK3A 2IWBA 5FASA 2VV7A 4MBKA 4PM6A 4GOGA 5J3WA 3T50A 2B95A 2Y59A 3FPWA 4IBRA 3VMAA 5LBRA 3HUOA 3PBOA 2OWHA 2L0WA 3PBRA 2JKTM 3UPPA 2E8JA 3LI9A 2J8YA 3Q7ZA 1RCJA 5FQKA 4OPYA 1AXBA 1P9RA 1K57C 2WGVA 4BBVA 4KQRA 4GHIA 1T1AA 2JBFA 4WZ5A 3OCLA 1NLZA 1WE4A 4QY5A 2WZZA 3CMZA 2EWVA 3SS5A 4OH0A 1GSVA 2O9CA 4NXFA 2Y2NA 3C7UA 4JPMA 3O3VA 4Y0UA 3GR2A 1Y28A 4JXGA 4GCZA 4BL3A 2OV5A 2V1BA 4F3LB 3IQAA 3IXBA 2V1ZA 2ZLYA 4X56A 3HJIA 4Y0OA 3GRJA 1QMFA 5DTSA 1IEMA 2XH9A 5TBMA 1MZUA 4XUXA 3T4OA 3SZTA 3UY6A 3IXDA 2J3TC 3CWFA 2Q9MA 4HHDA 4LFUA 3GDIA 1KE4A 3M6BA 4DXBA 4KUKA 5DJTA 4NXGA 1XKZA 3ZHHA 3C5AA 4RA7A 5FAQA 3WRTA 1SKOA 2V2FF 1L0FA 2VKSA 2IWDA 3NOPC 1IELA 1ES5A 1HVBA 5J8XA 2XFTA 3S7OA 3EEHA 1G6OA 3L7HA 2K31A 4QY6A 4JXVA 2VLGA 4GS9A 1L2SA 1KGEA 3TW8A 1T19A 2OAQ1 2UWXA 1HTZA 1BT5A 2EX6A 4BD1A 3HLWA 1K56D 1ESUA 2HJEA 1KDSA 5F1GA 4IJGA 1DP8A 1GHPA 3T1SA 1DJBA 3PXPA 5L09A 4R0QA 2Y8HA 5AQAA 2Y4AA 3G32A 3SH7A 1VB6A 2WKHA 3PHYA 3HLCA 3Q81A 2DCFA 5JYOA 4PM7A 4L9GA 1DRMA 4EERA 2A24A 3OPRA 1OTAA 2W3FA 5HPFA 4NG2A 4XT2B 5EOOA 2PYRA 3LR4A 1IKIA 2XD5A 1EW0A 4OLDA 3KSIA 5DTTA 4JGQA 3ZG8B 2RCXA 4PKYA 4QHCA 2QJ7A 1XPBA 5EVIA 4EQIA 1O7EA 4MBFA 3OLOA 3DWKA 3NC8A 2ZM0A 1TF1A 5EECA 3JYIA 5CRFA 5HD3A 4QD4A 4R3JA 2Y79A 2ZQ8A 1GHIA 4R38A 3QNBA 3LI8A 4E3JA 4JGRA 2ZQ7A 3DAVA 3Q7VB 1BYWA 1K0KA 1JVJA 2WADA 2FZ0A 3PBQA 3KO6A 4I3AA 1MXOA 3ZNYA 2ZL1B 3H9WA 1MKIA 3C2WA 2P9VA 3TE8A 3SH8A 3I7JA 4HESA 5IU1A 3T1QB 5G4ZA 5GLDA 3O86A 4MLLA 3UMEA 1TS8A 4PPRA 5EOEA 5EVIC 2UV0E 5HWVA 3M2KA 2M7VA 1P97A 1LI9A 2VEAA 3IX3A 3BFFA 1N9BA 4GD8A 3BM6A 4I38A 4S2PA 1SDNA 2VV6A 4Q0HA 3FKVA 4X6TA 2PDRA 2QMIA 3UB8A 3FV7A 4PMAA 5CX7A 5HW3A 4X68A 4R4RA 4P0MA 4N92A 2WKQA 4I39A 1WA9A 2EA9A 4U3TA 3IH8A 5KSCA 3FG8A 1AWIA 3H82A 3N7WA 4UQIS 4LRXC 4JF6A 5FI7A 4CQHA 2Y2KA 2WK0A 4X53A 5CTMA 1MC0A 1RP5A 1VM1A 2B18A 3QP8A 2O0YA 4WUJA 3KYZA 4FCFA 1TVFA 4E6XA 4QWOA 4O8GA 1BLCA 1L0DA 2P08A 3LYXA 2G2WA 5FQ9A 4RVAA 3IHAA 1ES4A 4II7A 1TD5A 3LUQA 4S2KA 3VFHA 3AGFA 4RX2A 3C38A 1YPRA 1BULA 1I5QA 1HLUP 1LT0A 3NCKA 4P6ZS 3MBZA 2H28A 1ZG4A 4B88A 4PAUA 2Y2MA 3M2JA 3MKFA 4KQDA 3EQUA 5AQBA 2I72A 3HLEA 1FR6A 1VQQA 2WGWA 1XP4A 3GMWA 4BL2A 1CQAA 3BYDA 1TS0A 5KIZA 1ACFA 1TDLA 2P74A 1KGGA 1SDEA 3T4SA 3FPVA 2PBDP 3JPUA 3NOUC 2H0YA 5HWTA 1FSWA 4OQ0A 1W8YA 3F1OB 3FC7A 4X1LA 1QMEA 4HQAA 3FKWA 5TJJA 1E3UD 4X55A 4PKYG 2EX9A 3IWQA 3OOVA 2L1MA 1ZTUA 2M1CA 4FSFA 1SCWA 3IF6A 2J80A 3K3CA 2Y55A 3BFGA 4FH2A 3MFXA 3VP1A 4DXCA 4OPRA 3G30A 1ZHHB 4DE3A 3VFFA 4PM5A 1KOUA 3IWIA 1GCEA 2QZ6A 1YLWA 1ES3A 3Q7VA 4XUZA 5M19A 3N8SA 3IS2B 1N9LA 1S6RA 4I3JA 4G3VA 3BFDA 5HZHA 3SW1A 2OLVA 3V5MA 3AGEA 4BWIA 3CITA 4WEKA 3IF6C 2Y2GA 2W3GA 3A0SA 4LV3A 3F1PA 4KZ5A 3Q82A 3CJMA 2VA0A 1XA1A 3UDIA 1X0OA 5F83A 1BUEA 1MWSA 4HBTA 5GHXA 1STZA 1VEUA 4D60A 4UA6A 1TDGA 4MMNA 2BG1A 2XDMA 3W4OA 2P04A 3T1XA 3LR3A 2BASA 3ZCZA 5HDDA 2XGNA 4M3KA 4KENB 1DJCA 1LL5A 2HF6A 2HDSA 1G5UA 2D01A 3D4FA 1MY8A 4LENA 1W63M 2EX2A 1HZOA 5FEFA 5HFOA 3ZGAB 1HD8A 4HI4A 3BFCA 5FI6A 3BY9A 1K25A 2PD8A 3G4PA 3FYZA 2OLUA 3MFDA 5K5BA 3IXGA 3GTCA 3M6HA 1YLTA 4M4XA 4GD6A 3S1YA 3UDFA 4ME4A 1YLZA 1E4DA 3V50A 3RFBA 4L0LA 2XR0A 2ZOHA 3LY4A 4MN5A 3IBRA 4LV2A 4C6YA 4ZBEA 1VHMA 2Z6CA 4JLFA 2H5SA 4RYEA 3ZQ5A 3HLBA 3KYEA 1OTBA 1OTEA 4UA9A 5AVEA 5L8MA 1K54A 5CHMA 3VSKA 5HARA 3UO9A 2B02A 4WEJA 2Y91A 3UE0A 2XSSA 2YKFA 3HUMA 3LIDA 3JVUA 3ZG5A 2VGKA 4UHUA 2J3TD 3NIAA 2W0NA 2WUQA 4YFMA 4IEDA 1BTLA 4DDYA 2WKPA 5A8BA 4EETB 5A93A 4U0XA 2RL3A 4ZDXA 3R7WA 1V9YA 1CEGA 1ERQA 4N1HA 1P9WA 4N1XA 2DNSA 1PWCA 3ISGA 3W4PA 1XFQA 1K54C 4MN6A 5EM1A 4WZ5C 2V8CA 2XQZA 1GSXA 1LL8A 3F1OA 2PT7A 1H8YA 3IWOA 3W2ZA 2VZWA 3LO7A 4S2NA 4C3QA 5GL9A 2PU2A 3DTMA 3TOIA 5FAPA 1S0WA 3BECA 2V0UA 4E3IA 3P98A 2NUTC 1BLSA 1CJFA 3VV4A 2VJWA 5EE8A 3IXHA 4B93A 3E4PA 2G2UA 4FH4A 2Q9NA 4CPKA 2WZXA 2QPNA 1ES2A 1F5MA 3DTIA 3A3FA 1NYYA 3VP2A 3R4KA 1FCMA 4KZ3A 5FDHA 4EXOA 5CERA 1XJ6A 1YAXA 3TG9A 5IS1A 1S1ZA 3HL9A 4OONA 3V39A 3H7WB 1L0GA 1WYCA 3RXWA 3MSHA 4EUZA 4S2NC 3UB6A 5L07A 4JBFA 2ZOIA 1YLPA 2LB9A 5FEGA 5J7EA 4DE0A 2Z2LB 1Q2PA 4WM9A 5FDSA 1K55A 5HAPA 2J3WA 2ZD8A 4K0XA 1OT9A 3MQ0A 4KZ6A 3UMDA 2W3EA 3MR0A 1G28A 5HAQA 4CLCA 2X71A 4S2IA 3P7NA 4ARZB 3A0VA 3ZG0A 1SHVA 4WYYA 4CJNA 1YLYA 1ONHA 4IHQA 2Y2PA 3G6OA 1YMSA 3NHQA 5DF9A 3E2KA 4FOFA 3MZEA 3MQQA 3HUNA 5EUAA 5L2FA 1K55C 4R23A 1GA9A 3T4QA 2HGVA 4JKTA 4PM9A 3EQVA 3LIEA 3G31A 4KG2A 2J7VA 2IA2A 4HY8A 1YSPA 3KYQA 1KGFA 5DF8A 5IHVA 1NZOA 2W1TB 4HJ4A 5D3OA 4CLCC 5I5LA 5J4EA 2XK1A 4L9EA 3RH8B 1G6AA 3G35A 3WRZA 2WAFA 5EVID 5HD5A 2Y2IA 5CXWA 4HOIA 2JN7A 4WL9A 1ZKJA 2IWCA 3CPTB 4C75A 5I94A 2HDRA 2VGJA 4NKPA 2Y2JA 4O0PA 3LY3A 3B42A 3T4JA 4EBLA 2INWA 3UE1A 2NUPC 4GJ4A 2GZAA 1F9IA 2LB5A 5BOHA 2C6WB 4LLOB 1CI8A 4KZAA 3F1NB 3U4LP 2D02A 1BLHA 1LHYA 4EESA 3KSGA 1P0ZA 2OWJA 5DKLA 4KQOA 1PIOA 4DE1A 3MF0A 3OPHA 4B9OA 1MKMA 3WS2A 2VX8A 3EGXC 2H0TA 3TRCA 4RQ9A 4KZ4A 3EGDC 1F98A 4N9KA 2JC7A 4KUOA 4KZBA 4WZ4A 5EVLA 2OOLA 5EV0A 2ZBBA 2DRWA 4F3LA 1FSYA 1PFLA 1S67L 2KOIA 2ZC4B 3A0RA 4BJPA 3PAGA 3VOYA 4WF0A 2V9AA 1EROA 1EI5A 1GA0A 2JHEA 3N4IA 4DJ2A 5HX9A 2MJ6A 2XRNA 3LGOA 4GKUA 5F68A 3HCYA 1IYQA 4NXEA 1DJAA 1OMEA 1YMXA 3E4OA 4QPRA 3BJNA 1LSWA 1O07A 1PWGA 4ETXA 2ACGA 2JKFA 1LI0A 3A3JA 2PAVP 4ZAMA 3DW0A 3PBSA 3UB5P 1S4RA 4KG5A 1K4EA 5MC7A 1EWZA 4QB8A 5GLBA 3LEQA 1XJ3A 1OT6A 4MEZA 2PR6A 3T4TA 4KZ9A 5EVEA 4YWZA 4NK3A 1XA7A 4JXSA 3A3EA 2WAEA 4KG6A 4DRTA 3IX4A 3BWLA 5CGSA 4Z9QA 3VP0A 2FFFB 2PR5A 3GV9A 3NI9A 4IVKA 1UWNX 3C7VA 3OPLA 1YSQA 3D72A 4HIAA 3GECA 2AVXA 1ODVA 3NBLA 3D3OA 4WMCA 4ZJ3A 4Q8IA 2A2LA 3QNCA 2ZQAA 3IBJA 1A0KA 2EXBA 3VOZA 1E25A 2C5WB 4ARZA 1JWVA 1PYYA 4E3LA 1JWZA 4DN0A 2XD1A 3MXQA 1C3BA 4D2OA 5HDSA 3CUEA 2PRFA 2WGIA 4RX3A 2R9WA 2JCHA 3MJQA 1ZG6A 4BBUA 1J9MA 5HAIA 2XFSA 1FCNA 4FTXA 4XT2A 5FSRA 2XLNA 1YT4A 4R3AA 2Y2OA 4G3KA 2I9VA 3L9KA 4ZJ2A 3NULA 2W1TA 3VE4A 3S7PA 4GDBA 1DY6A 3LR5A 5TR7A 2ZC6B 4XXRA 4MBHA 4MDZA 5A90A 3OCNA 2XROA 5TBMB 5DF7A 1N9OA 3CUEC 4OOMA 5DFYA 2ZC7A 2WYXA 5CECA 3KSFA 2ZL1A 1XX2A 5CHJA 4K91A 5AJGA 2KX6A 5E43A 2DMWA 1XFNA 3GVBA 1S4SA 5AQ9A 2H10A 4B4ZA 4LV1A 1M40A 3FZCA 2JKGA 3T1RA 2ZQDA 4ZTKA 3IX8A 4NETA 4JF4A 4GS9B 5E2EA 1H5XA 3K3DA 2FH5A 2ZM8A 5F5YA 4HNBA 2XEPA 4P87A 5FL3A 3E0YA 3LICA 2X01A 2ZC3B 1Y54A 1MWRA 3BFEA 1H8MA 1F2KA 4Y3IA 4Q0IA 1OJGA 2GX5A 4Y0TA 3EOIA 2Q0OA 2Y2HA 5CTNA 3RTYA 4DF6A 5FQJA 2HV1A 2Y2LA 3V67A 1KDWA 1K6RA 4DDSA 4K08A 2PYPA 3W4QA 3NDEA 4HH3A 3Q1FA 4FD8A 2KLIA 2QWSA 2Y2QA 2A24B 2R9XA 4KZ7A 1BSGA 1DP6A 2B5RA 3LR0A 5E2HA 3IF5A 3QP1A 1IKGA 5HSQA 2HPBA 4R3BA 5IT5A 1TEMA 1Z6FA 2VV8A 4PM8A 2HZ5A 2QKPA 5GLCA 1IYOA 3UE3A 2OAP1 5HL6A 3DTKA 1XGJA 1XJ2A 3MXRA 5EVIB 2CMNA 4GLQA 3DWZA 4EEUA 2V20A 3ZFZA 5FI2A 1IOUA 1WYBA 1CK3A 2JKTI 4DMZA 1FOFA 3A3DA 2K7SA 3NECA 3C4PA 3BLMA 3CZDA 2FFYA 3BW6A 4ETZA 1GSWA 2GJ3A 3LEZA 2P9VB 2W27A 1NLYA 4JXWA 3N8RA 1ALQA 3BQAA 2ZMVA 4OLGA 1J3WA 3BEBA 3RJUA 1PZPA 5FQIA 4EBNA 1FQGA 3OZHA 1PW8A 2V1AA 4I5SA 1ZC2A 5F1FA 4X25A 1NY0A 3WWXA 5A91A 4N9LA 2O99A 1PI5A 4OPQA 1KVMA 2R78A 4GN2A 4P6BA 5JYPA 5CGWA 3ITBA 3SS3A 3UN7A 4LPZA 1ONGA 1LSVA 1FIKA 1MWTA 2O9AA 2A3UA 3OBFA 3C30A 3U2AA 1MWUA 4AFIA 1PNEA 5DVAA 4LCMA 2ZQCA 5F6AA 4B4XA 2E8IA 3HJKA 4ESPA 1KE3A 3MMHA 3H82B 3LIBA 1FR1A 3NY4A 2PU4A 5GHYA 4OP5A 2V0WA 1W8QA 4BMWA 3SOIA 3QP6A 3ZNTA 3IS2A 2WKRA 3CG5A 3P09A 5AQ7A 4JF5A 2JE5A 2KDKA 3BY8A 2ZM2A 3PAEA 1W63Q 2Z2MB 2O9BA 1YM1A 4S2JA 3HBRA 1JNUA 4H8RA 2Z6DA 4Y2FA 2L4RA 5EFWA 1NWZA 3QP2A 4MCWA 4FUWA 2J9OA 3MXSA 1K38A 3BRMA 1CEFA 2OSUA 3P01A 1NYMA 4EQ1A 3QP4A 3HREA 2QHKA 1NRJA 1T1BA 4X1MA 2ZQ9A 1H8ZA 4WBGA 2EXAA 3B3XA 1K56A 3C8CA 4HP4A 1RGZA 1NRFA 1L0EA 3VSLA 5GLAA 4E04A 4CLCD 4HP9A 4S2OA 2BTFP 4R70A 2P7JA 5C5KA 2M7UA 5HWWA 1W5DA 5FQQA 3TSGA
chains in the Genus database with same CATH topology
3PBSA 3NOTC 1P9RA 1S4RA 1UGUA 4BBVA 4GHIA 1T1AA 1N9LA 3IS2B 5MC7A 3OCLA 1NLZA 4I3JA 1OJ5A 4G3VA 2W3DA 5HZHA 3SW1A 1XJ3A 1OT6A 4WLAA 2PR6A 3T4TA 4YWZA 4CLCE 2EWVA 4BWIA 1N9NA 3CITA 3PBNA 4WEKA 3LFVA 1GSVA 2O9CA 4NXFA 3BWLA 2W3GA 3A0SA 4R6LA 2XA7M 3F1PA 1Y28A 4GCZA 2V1BA 2VA0A 2PR5A 3EEAA 1X0OA 4F3LB 1UWNX 3HJIA 4OOLA 1STZA 4MMNA 4UQIM 3EWKA 1YSQA 3KSHA 3D72A 3CI6A 4HJ3A 5TBMA 1MZUA 3T4OA 3B33A 3GECA 4HIAA 2P04A 3LR3A 2BASA 5HDDA 1ODVA 2J3TC 3CWFA 3D3OA 1XJ4A 4HHDA 2A2LA 2HF6A 3GDIA 3IBJA 2D01A 3DBAA 3UB7A 1W63M 4KUKA 4ARZA 5DJTA 4NXGA 4JGPA 4IUHA 4DN0A 4HI4A 3MXQA 3BY9A 2PD8A 5HDSA 3CUEA 2VKSA 2PD7A 3NOPC 5K5BA 3MJQA 4LRZE 3S7OA 4BBUA 3EEHA 1G6OA 3K2NA 4M4XA 2K31A 4XT2A 4G3WA 4L9FA 4P6ZM 3F1PB 1V9ZA 4R3AA 1LSXA 4WN5A 4DJ3A 4G3KA 1YKDA 2I9VA 4ME4A 2VLGA 4GS9A 2W1TA 3VE4A 3S7PA 3RFBA 4L0LA 3TW8A 1T19A 2OAQ1 2ZOHA 3LR5A 4MN5A 3IBRA 4Y5FA 4MDZA 3OCNA 2XROA 4I3IA 5TBMB 1VHMA 1N9OA 4LRYC 5DJUA 1D06A 3ULFA 2Z6CA 3CUEC 3E98A 3ZQ5A 4OOMA 3BQ8A 3PYPA 5DFYA 2HJEA 1OTBA 4NXBA 1OTEA 2XA7S 4IJGA 3E4QA 1DP8A 5AVEA 5L8MA 4EEPA 3PXPA 3T4KA 2Y8HA 3KSFA 2YKHA 3NJAA 2B02A 3MQOA 5AJGA 2KX6A 4WEJA 2XSSA 2YKFA 1VB6A 2DMWA 3LIDA 1XFNA 3JVUA 2JKRI 3PHYA 2J3TD 3UE6A 1S4SA 2W0NA 4H6JB 4L9GA 1DRMA 4EERA 2A24A 2WKPA 5A8BA 4EETB 1OTAA 2W3FA 5HPFA 1OTDA 4XT2B 2PYRA 3H7WA 3R7WA 1V9YA 3O5YA 3LR4A 1EW0A 4GS9B 5HDCA 1P9WA 5F69A 2JKRM 3KSIA 3K3DA 2FH5A 4JGQA 1XFQA 5F5YA 4HNBA 4PKYA 2QJ7A 4MN6A 1GSXA 1LL8A 2VGLM 3F1OA 3OLOA 5HPIA 5FL3A 2PT7A 3E0YA 1TF1A 3LICA 5HD3A 3LIAA 2Y79A 3W2ZA 4IUKA 4R38A 1S66L 3LI8A 2VZWA 1H8MA 4JGRA 4Y3IA 4Q0IA 1OJGA 4JGOA 1S1YA 2GX5A 1BYWA 3EOIA 2FZ0A 3PBQA 3RTYA 3KO6A 1UWPX 2V0UA 4GHIB 4I3AA 2HV1A 3V67A 3H9WA 2NUTC 1IFQA 3C2WA 4K08A 3TE8A 2PYPA 3VV4A 2VJWA 4B93A 3E4PA 5KSHA 5IU1A 3T4LA 5G4ZA 1F5MA 2W1RA 3UMEA 4HJ6A 4HH3A 2G7UA 4YOFA 1TS8A 4Q0JA 5HWVA 2KLIA 2QWSA 3R4KA 2M7VA 2A24B 1P97A 3PBTA 1DP6A 4EXOA 2VEAA 1XJ6A 3B47A 1YAXA 3JVVA 3LR0A 5IS1A 1S1ZA 4I38A 2EWWA 3H7WB 5HSQA 3R7WB 5IT5A 5G4YA 2VV6A 1OTIA 2VV8A 4Q0HA 2W3HA 3UB6A 2QKPA 3UE3A 2OAP1 2ZOIA 2LB9A 2PDRA 5J7EA 5HL6A 3UB8A 3ZYTA 1XJ2A 5CX7A 3VOLA 2CMNA 4GLQA 2J3WA 4EEUA 1OT9A 3MQ0A 4NEED 3UMDA 2W3EA 1IOUA 2JKTI 2WKQA 3MR0A 4DMZA 1G28A 4I39A 1WA9A 4PHTA 2EA9A 4O01A 4CLCA 2K7SA 4UEYA 3P7NA 4EU0A 3VE3A 4ARZB 4ZRRA 3A0VA 3BW6A 4ETZA 1GSWA 4IHQA 3FG8A 3UB9A 2GJ3A 3H82A 4UQIS 4WELA 4LRXC 4EW7A 2W27A 3G6OA 3NHQA 1NLYA 4HH2A 4CQHA 5DF9A 4FOFA 2VGLS 3F1NA 3MQQA 2QJ5A 2ZMVA 1MC0A 3BQAA 2B18A 3T4QA 4EUVA 2HGVA 3EQVA 2O0YA 4WUJA 3LIEA 3KYZA 5AVFA 2QYBA 2V1AA 4I5SA 2IA2A 4HY8A 1YSPA 1D7EA 3KYQA 4O8GA 1T1CA 2P08A 3LYXA 2W1TB 2O99A 4HJ4A 4CLCC 4MN7A 5I5LA 2R78A 5J4EA 4II7A 4L9EA 3KX0X 3RH8B 1TD5A 3LUQA 2ZMFA 3OC2A 3C38A 4LPZA 5HD5A 4HOIA 2PHYA 1LSVA 1TS7A 2JN7A 4Z1WA 2O9AA 4WL9A 1LT0A 3OBFA 3C30A 4P6ZS 3U2AA 4CLCB 4NKPA 1H3QA 4O0PA 4AFIA 3B42A 3T4JA 5DFXA 2INWA 2H28A 5F6AA 3S7NA 2NUPC 4GJ4A 2GZAA 1F9IA 4PAUA 4YNRA 2LB5A 3HJKA 4KQDA 3EQUA 3MMHA 3H82B 3LIBA 1DP9A 3PR6A 2V0WA 4LLOB 1T18A 1OPXA 4BMWA 3F1NB 2D02A 3IS2A 2WKRA 4EESA 2KDKA 1P0ZA 3BY8A 1TS0A 2OWJA 3KSGA 2GNXA 1W63Q 5KIZA 2O9BA 5DKLA 1JNUA 4KQOA 3LIFA 2Z6DA 4Y2FA 3MF0A 2L4RA 5EFWA 3T4SA 3FPVA 1NWZA 3ICYA 4MCWA 4B9OA 1MKMA 3CLOA 2VX8A 3EGXC 4H6JA 3TJZC 3TRCA 4RQ9A 3NOUC 4BBTA 1TS6A 1F98A 2K2NA 3EGDC 3P01A 5HWTA 2HJ9C 3S7QA 4KUOA 4EQ1A 2OOLA 2ZBBA 3F1OB 2QHKA 3FC7A 1NRJA 3CAXA 4GW9A 4HQAA 1T1BA 5DKKA 5TJJA 4F3LA 1S67L 2KOIA 4BJPA 3A0RA 4WF0A 4PKYG 2V9AA 3OOVA 2L1MA 2JHEA 2VV7A 4DJ2A 3C8CA 1ZTUA 2M1CA 4HP4A 2MJ6A 2XRNA 4FSFA 5J3WA 2J80A 3T50A 3K3CA 4E04A 5F68A 4CLCD 3HCYA 3FPWA 3MFXA 4NXEA 5LBRA 3PBOA 3E4OA 4HP9A 2OWHA 4QPRA 3BJNA 4R70A 1ZHHB 2L0WA 1LSWA 2P7JA 2JKTM 3PBRA 5C5KA 2M7UA 4ETXA 5HWWA 3LI9A 1KOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EGX C;  1H8M A;  2NUT C;  2DMW A;  4AFI A;  1IOU A;  2NUP C;  3KYQ A;  3BW6 A;  3EGD C;  4B93 A;  1IFQ A;  2VX8 A; 
#chains in the Genus database with same CATH topology
 2WGW B;  5M1A A;  3NOT C;  1UGU A;  5U47 A;  5E2G A;  3N8L A;  1IYS A;  4OQI A;  3HLD A;  1OJ5 A;  2W3D A;  4WLA A;  1PI4 A;  2BLS A;  4CLC E;  4ZJ1 A;  1N9N A;  3ITA A;  5HL1 A;  3MS6 A;  3PBN A;  3LFV A;  2HP5 A;  3IT9 A;  4R6L A;  2XA7 M;  3W8K A;  4Y13 A;  4LCL A;  3G34 A;  4OKP A;  1W79 A;  4R1G A;  3D9Y A;  3EEA A;  1JTG A;  4Y15 A;  2J9P A;  1I2W A;  4OOL A;  3NDG A;  3GQZ A;  4UQI M;  1Y4O A;  4EV4 A;  3FWL A;  3EWK A;  3IF6 B;  1Q2Q A;  3KSH A;  4HJ3 A;  3CI6 A;  3B33 A;  4OOY A;  1LLB A;  5G18 A;  1GHM A;  1XJ4 A;  3MKE A;  4DKI A;  1PRQ A;  2HDQ A;  3DBA A;  3UB7 A;  5TGF A;  4E3O A;  2HP9 A;  4GNU A;  2ZC5 B;  2PBY A;  3V3R A;  4JGP A;  4IUH A;  1SZV A;  4LV0 A;  4UAA A;  2PD7 A;  3CHW P;  4LRZ E;  5TFQ A;  3UDX A;  3ZG7 B;  3O87 A;  3K2N A;  4BQM A;  1L3L A;  4G3W A;  4L9F A;  4P6Z M;  3F1P B;  1V9Z A;  1LSX A;  3WS5 A;  4WN5 A;  3SS4 A;  4DJ3 A;  4R4S A;  1YKD A;  1NJ4 A;  3IH9 A;  1VET B;  4BEN A;  3QHY A;  1VEU B;  1Z09 A;  4Y5F A;  5KMW A;  4I3I A;  4S2M A;  2ZMA A;  3WS1 A;  4LRY C;  5DJU A;  1D06 A;  1U60 A;  3ULF A;  3E98 A;  4IBX A;  4BLM A;  5KZH A;  3BQ8 A;  3PYP A;  3ZG9 B;  4NXB A;  2XF3 A;  2XA7 S;  4QJG A;  3E4Q A;  3S22 A;  5L10 A;  2EFX A;  4EEP A;  3T4K A;  2YKH A;  3Q07 A;  3NJA A;  5CEB A;  3MQO A;  1XGI A;  1SKF A;  1W7F A;  4GB7 A;  2JKR I;  1CF0 A;  3OPP A;  3UE6 A;  4H6J B;  2WKI A;  1PWD A;  4P85 A;  1OTD A;  4LGW A;  1ESI A;  3H7W A;  3O5Y A;  4GZB A;  5HDC A;  4KQQ A;  3HLG A;  1CI9 A;  2JKR M;  5F69 A;  3AGD A;  4MNR A;  1BLP A;  5FAO A;  1KVL A;  2VGL M;  4E3K A;  2ZJ9 A;  5HPI A;  3ZDJ A;  3PTE A;  4BD0 A;  1YLJ A;  3LIA A;  4IUK A;  1S66 L;  4WMC D;  4JGO A;  2GDN A;  1S1Y A;  4F94 A;  2V8F A;  4GHI B;  1UWP X;  4OQH A;  4GDN A;  1IFQ A;  1PZO A;  4OVD A;  5KSH A;  3E2L A;  3T4L A;  1JTD A;  2W1R A;  4HJ6 A;  3WS4 A;  1NZU A;  2G7U A;  4YOF A;  4Q0J A;  3G2Z A;  4UA7 A;  3PBT A;  3B47 A;  3JVV A;  5CED A;  2EX8 A;  3LCE A;  3UNW A;  2EWW A;  3R7W B;  3O88 A;  4ID4 A;  3UPO A;  5G4Y A;  1OTI A;  2W3H A;  4A5R A;  4DE2 A;  3MZD A;  3ZYT A;  1E3U A;  3G2Y A;  3VOL A;  5FA7 A;  4E3N A;  1K6S A;  4NEE D;  4U0T A;  4OQG A;  4QU3 A;  3CPT A;  4PHT A;  1G68 A;  1FIL A;  4IVI A;  4Y17 A;  5FAT A;  4O01 A;  3A3I A;  3C4O A;  4OP8 A;  4UEY A;  3IHB A;  5FQM A;  4EU0 A;  3VE3 A;  4ZRR A;  1MBL A;  4S2L A;  5M18 A;  3UB9 A;  3ZVT A;  3V3S A;  5CHU A;  5EM0 A;  1SKO B;  5DTK A;  4WEL A;  4EW7 A;  3T12 B;  4HH2 A;  3HLF A;  2VGL S;  1I2S A;  3F1N A;  2QJ5 A;  2X02 A;  4EUV A;  2CC1 A;  5AVF A;  4K0W A;  2QYB A;  1N4O A;  1D7E A;  4HEF A;  3S4X A;  4E3M A;  2HP6 A;  1KE0 A;  3VP4 A;  2EFU A;  1ERM A;  3N6I A;  4EWF A;  1T1C A;  4YIN A;  4MN7 A;  3WS0 A;  3KX0 X;  3DTE A;  5A92 A;  2ZMF A;  1BZA A;  3OC2 A;  4EBP A;  1VET A;  2WKE A;  2PHY A;  4Y7P A;  1TS7 A;  1JWP A;  4Z1W A;  4CLC B;  1H3Q A;  5DFX A;  3S7N A;  4HBU A;  5EPH A;  4YNR A;  5E2F A;  1NXY A;  3BLS A;  1DP9 A;  3PR6 A;  4X69 A;  1XXM A;  1H0M A;  1T18 A;  3ZVW A;  1OPX A;  3RXX A;  3UPN A;  5F82 A;  1K4F A;  1YQS A;  1IYP A;  2GNX A;  3QP5 A;  4KZ8 A;  1MPL A;  3LIF A;  3ICY A;  3SH9 A;  3MZF A;  3CLO A;  1D1J A;  1PW1 A;  4H6J A;  5GHZ A;  3TJZ C;  4OPZ A;  4BBT A;  4E6W A;  1TS6 A;  2K2N A;  1M6K A;  1K57 A;  1LL9 A;  2HJ9 C;  3S7Q A;  3GSG A;  4O7D A;  4GW9 A;  1RGY A;  3CAX A;  3HVF A;  2HDU A;  5DKK A;  1FCO A;  5CGX A;  3VP3 A;  2A49 A;  2VK3 A;  2IWB A;  5FAS A;  2VV7 A;  4MBK A;  4PM6 A;  4GOG A;  5J3W A;  3T50 A;  2B95 A;  2Y59 A;  3FPW A;  4IBR A;  3VMA A;  5LBR A;  3HUO A;  3PBO A;  2OWH A;  2L0W A;  3PBR A;  2JKT M;  3UPP A;  2E8J A;  3LI9 A;  2J8Y A;  3Q7Z A;  1RCJ A;  5FQK A;  4OPY A;  1AXB A;  1P9R A;  1K57 C;  2WGV A;  4BBV A;  4KQR A;  4GHI A;  1T1A A;  2JBF A;  4WZ5 A;  3OCL A;  1NLZ A;  1WE4 A;  4QY5 A;  2WZZ A;  3CMZ A;  2EWV A;  3SS5 A;  4OH0 A;  1GSV A;  2O9C A;  4NXF A;  2Y2N A;  3C7U A;  4JPM A;  3O3V A;  4Y0U A;  3GR2 A;  1Y28 A;  4JXG A;  4GCZ A;  4BL3 A;  2OV5 A;  2V1B A;  4F3L B;  3IQA A;  3IXB A;  2V1Z A;  2ZLY A;  4X56 A;  3HJI A;  4Y0O A;  3GRJ A;  1QMF A;  5DTS A;  1IEM A;  2XH9 A;  5TBM A;  1MZU A;  4XUX A;  3T4O A;  3SZT A;  3UY6 A;  3IXD A;  2J3T C;  3CWF A;  2Q9M A;  4HHD A;  4LFU A;  3GDI A;  1KE4 A;  3M6B A;  4DXB A;  4KUK A;  5DJT A;  4NXG A;  1XKZ A;  3ZHH A;  3C5A A;  4RA7 A;  5FAQ A;  3WRT A;  1SKO A;  2V2F F;  1L0F A;  2VKS A;  2IWD A;  3NOP C;  1IEL A;  1ES5 A;  1HVB A;  5J8X A;  2XFT A;  3S7O A;  3EEH A;  1G6O A;  3L7H A;  2K31 A;  4QY6 A;  4JXV A;  2VLG A;  4GS9 A;  1L2S A;  1KGE A;  3TW8 A;  1T19 A;  2OAQ 1;  2UWX A;  1HTZ A;  1BT5 A;  2EX6 A;  4BD1 A;  3HLW A;  1K56 D;  1ESU A;  2HJE A;  1KDS A;  5F1G A;  4IJG A;  1DP8 A;  1GHP A;  3T1S A;  1DJB A;  3PXP A;  5L09 A;  4R0Q A;  2Y8H A;  5AQA A;  2Y4A A;  3G32 A;  3SH7 A;  1VB6 A;  2WKH A;  3PHY A;  3HLC A;  3Q81 A;  2DCF A;  5JYO A;  4PM7 A;  4L9G A;  1DRM A;  4EER A;  2A24 A;  3OPR A;  1OTA A;  2W3F A;  5HPF A;  4NG2 A;  4XT2 B;  5EOO A;  2PYR A;  3LR4 A;  1IKI A;  2XD5 A;  1EW0 A;  4OLD A;  3KSI A;  5DTT A;  4JGQ A;  3ZG8 B;  2RCX A;  4PKY A;  4QHC A;  2QJ7 A;  1XPB A;  5EVI A;  4EQI A;  1O7E A;  4MBF A;  3OLO A;  3DWK A;  3NC8 A;  2ZM0 A;  1TF1 A;  5EEC A;  3JYI A;  5CRF A;  5HD3 A;  4QD4 A;  4R3J A;  2Y79 A;  2ZQ8 A;  1GHI A;  4R38 A;  3QNB A;  3LI8 A;  4E3J A;  4JGR A;  2ZQ7 A;  3DAV A;  3Q7V B;  1BYW A;  1K0K A;  1JVJ A;  2WAD A;  2FZ0 A;  3PBQ A;  3KO6 A;  4I3A A;  1MXO A;  3ZNY A;  2ZL1 B;  3H9W A;  1MKI A;  3C2W A;  2P9V A;  3TE8 A;  3SH8 A;  3I7J A;  4HES A;  5IU1 A;  3T1Q B;  5G4Z A;  5GLD A;  3O86 A;  4MLL A;  3UME A;  1TS8 A;  4PPR A;  5EOE A;  5EVI C;  2UV0 E;  5HWV A;  3M2K A;  2M7V A;  1P97 A;  1LI9 A;  2VEA A;  3IX3 A;  3BFF A;  1N9B A;  4GD8 A;  3BM6 A;  4I38 A;  4S2P A;  1SDN A;  2VV6 A;  4Q0H A;  3FKV A;  4X6T A;  2PDR A;  2QMI A;  3UB8 A;  3FV7 A;  4PMA A;  5CX7 A;  5HW3 A;  4X68 A;  4R4R A;  4P0M A;  4N92 A;  2WKQ A;  4I39 A;  1WA9 A;  2EA9 A;  4U3T A;  3IH8 A;  5KSC A;  3FG8 A;  1AWI A;  3H82 A;  3N7W A;  4UQI S;  4LRX C;  4JF6 A;  5FI7 A;  4CQH A;  2Y2K A;  2WK0 A;  4X53 A;  5CTM A;  1MC0 A;  1RP5 A;  1VM1 A;  2B18 A;  3QP8 A;  2O0Y A;  4WUJ A;  3KYZ A;  4FCF A;  1TVF A;  4E6X A;  4QWO A;  4O8G A;  1BLC A;  1L0D A;  2P08 A;  3LYX A;  2G2W A;  5FQ9 A;  4RVA A;  3IHA A;  1ES4 A;  4II7 A;  1TD5 A;  3LUQ A;  4S2K A;  3VFH A;  3AGF A;  4RX2 A;  3C38 A;  1YPR A;  1BUL A;  1I5Q A;  1HLU P;  1LT0 A;  3NCK A;  4P6Z S;  3MBZ A;  2H28 A;  1ZG4 A;  4B88 A;  4PAU A;  2Y2M A;  3M2J A;  3MKF A;  4KQD A;  3EQU A;  5AQB A;  2I72 A;  3HLE A;  1FR6 A;  1VQQ A;  2WGW A;  1XP4 A;  3GMW A;  4BL2 A;  1CQA A;  3BYD A;  1TS0 A;  5KIZ A;  1ACF A;  1TDL A;  2P74 A;  1KGG A;  1SDE A;  3T4S A;  3FPV A;  2PBD P;  3JPU A;  3NOU C;  2H0Y A;  5HWT A;  1FSW A;  4OQ0 A;  1W8Y A;  3F1O B;  3FC7 A;  4X1L A;  1QME A;  4HQA A;  3FKW A;  5TJJ A;  1E3U D;  4X55 A;  4PKY G;  2EX9 A;  3IWQ A;  3OOV A;  2L1M A;  1ZTU A;  2M1C A;  4FSF A;  1SCW A;  3IF6 A;  2J80 A;  3K3C A;  2Y55 A;  3BFG A;  4FH2 A;  3MFX A;  3VP1 A;  4DXC A;  4OPR A;  3G30 A;  1ZHH B;  4DE3 A;  3VFF A;  4PM5 A;  1KOU A;  3IWI A;  1GCE A;  2QZ6 A;  1YLW A;  1ES3 A;  3Q7V A;  4XUZ A;  5M19 A;  3N8S A;  3IS2 B;  1N9L A;  1S6R A;  4I3J A;  4G3V A;  3BFD A;  5HZH A;  3SW1 A;  2OLV A;  3V5M A;  3AGE A;  4BWI A;  3CIT A;  4WEK A;  3IF6 C;  2Y2G A;  2W3G A;  3A0S A;  4LV3 A;  3F1P A;  4KZ5 A;  3Q82 A;  3CJM A;  2VA0 A;  1XA1 A;  3UDI A;  1X0O A;  5F83 A;  1BUE A;  1MWS A;  4HBT A;  5GHX A;  1STZ A;  1VEU A;  4D60 A;  4UA6 A;  1TDG A;  4MMN A;  2BG1 A;  2XDM A;  3W4O A;  2P04 A;  3T1X A;  3LR3 A;  2BAS A;  3ZCZ A;  5HDD A;  2XGN A;  4M3K A;  4KEN B;  1DJC A;  1LL5 A;  2HF6 A;  2HDS A;  1G5U A;  2D01 A;  3D4F A;  1MY8 A;  4LEN A;  1W63 M;  2EX2 A;  1HZO A;  5FEF A;  5HFO A;  3ZGA B;  1HD8 A;  4HI4 A;  3BFC A;  5FI6 A;  3BY9 A;  1K25 A;  2PD8 A;  3G4P A;  3FYZ A;  2OLU A;  3MFD A;  5K5B A;  3IXG A;  3GTC A;  3M6H A;  1YLT A;  4M4X A;  4GD6 A;  3S1Y A;  3UDF A;  4ME4 A;  1YLZ A;  1E4D A;  3V50 A;  3RFB A;  4L0L A;  2XR0 A;  2ZOH A;  3LY4 A;  4MN5 A;  3IBR A;  4LV2 A;  4C6Y A;  4ZBE A;  1VHM A;  2Z6C A;  4JLF A;  2H5S A;  4RYE A;  3ZQ5 A;  3HLB A;  3KYE A;  1OTB A;  1OTE A;  4UA9 A;  5AVE A;  5L8M A;  1K54 A;  5CHM A;  3VSK A;  5HAR A;  3UO9 A;  2B02 A;  4WEJ A;  2Y91 A;  3UE0 A;  2XSS A;  2YKF A;  3HUM A;  3LID A;  3JVU A;  3ZG5 A;  2VGK A;  4UHU A;  2J3T D;  3NIA A;  2W0N A;  2WUQ A;  4YFM A;  4IED A;  1BTL A;  4DDY A;  2WKP A;  5A8B A;  4EET B;  5A93 A;  4U0X A;  2RL3 A;  4ZDX A;  3R7W A;  1V9Y A;  1CEG A;  1ERQ A;  4N1H A;  1P9W A;  4N1X A;  2DNS A;  1PWC A;  3ISG A;  3W4P A;  1XFQ A;  1K54 C;  4MN6 A;  5EM1 A;  4WZ5 C;  2V8C A;  2XQZ A;  1GSX A;  1LL8 A;  3F1O A;  2PT7 A;  1H8Y A;  3IWO A;  3W2Z A;  2VZW A;  3LO7 A;  4S2N A;  4C3Q A;  5GL9 A;  2PU2 A;  3DTM A;  3TOI A;  5FAP A;  1S0W A;  3BEC A;  2V0U A;  4E3I A;  3P98 A;  2NUT C;  1BLS A;  1CJF A;  3VV4 A;  2VJW A;  5EE8 A;  3IXH A;  4B93 A;  3E4P A;  2G2U A;  4FH4 A;  2Q9N A;  4CPK A;  2WZX A;  2QPN A;  1ES2 A;  1F5M A;  3DTI A;  3A3F A;  1NYY A;  3VP2 A;  3R4K A;  1FCM A;  4KZ3 A;  5FDH A;  4EXO A;  5CER A;  1XJ6 A;  1YAX A;  3TG9 A;  5IS1 A;  1S1Z A;  3HL9 A;  4OON A;  3V39 A;  3H7W B;  1L0G A;  1WYC A;  3RXW A;  3MSH A;  4EUZ A;  4S2N C;  3UB6 A;  5L07 A;  4JBF A;  2ZOI A;  1YLP A;  2LB9 A;  5FEG A;  5J7E A;  4DE0 A;  2Z2L B;  1Q2P A;  4WM9 A;  5FDS A;  1K55 A;  5HAP A;  2J3W A;  2ZD8 A;  4K0X A;  1OT9 A;  3MQ0 A;  4KZ6 A;  3UMD A;  2W3E A;  3MR0 A;  1G28 A;  5HAQ A;  4CLC A;  2X71 A;  4S2I A;  3P7N A;  4ARZ B;  3A0V A;  3ZG0 A;  1SHV A;  4WYY A;  4CJN A;  1YLY A;  1ONH A;  4IHQ A;  2Y2P A;  3G6O A;  1YMS A;  3NHQ A;  5DF9 A;  3E2K A;  4FOF A;  3MZE A;  3MQQ A;  3HUN A;  5EUA A;  5L2F A;  1K55 C;  4R23 A;  1GA9 A;  3T4Q A;  2HGV A;  4JKT A;  4PM9 A;  3EQV A;  3LIE A;  3G31 A;  4KG2 A;  2J7V A;  2IA2 A;  4HY8 A;  1YSP A;  3KYQ A;  1KGF A;  5DF8 A;  5IHV A;  1NZO A;  2W1T B;  4HJ4 A;  5D3O A;  4CLC C;  5I5L A;  5J4E A;  2XK1 A;  4L9E A;  3RH8 B;  1G6A A;  3G35 A;  3WRZ A;  2WAF A;  5EVI D;  5HD5 A;  2Y2I A;  5CXW A;  4HOI A;  2JN7 A;  4WL9 A;  1ZKJ A;  2IWC A;  3CPT B;  4C75 A;  5I94 A;  2HDR A;  2VGJ A;  4NKP A;  2Y2J A;  4O0P A;  3LY3 A;  3B42 A;  3T4J A;  4EBL A;  2INW A;  3UE1 A;  2NUP C;  4GJ4 A;  2GZA A;  1F9I A;  2LB5 A;  5BOH A;  2C6W B;  4LLO B;  1CI8 A;  4KZA A;  3F1N B;  3U4L P;  2D02 A;  1BLH A;  1LHY A;  4EES A;  3KSG A;  1P0Z A;  2OWJ A;  5DKL A;  4KQO A;  1PIO A;  4DE1 A;  3MF0 A;  3OPH A;  4B9O A;  1MKM A;  3WS2 A;  2VX8 A;  3EGX C;  2H0T A;  3TRC A;  4RQ9 A;  4KZ4 A;  3EGD C;  1F98 A;  4N9K A;  2JC7 A;  4KUO A;  4KZB A;  4WZ4 A;  5EVL A;  2OOL A;  5EV0 A;  2ZBB A;  2DRW A;  4F3L A;  1FSY A;  1PFL A;  1S67 L;  2KOI A;  2ZC4 B;  3A0R A;  4BJP A;  3PAG A;  3VOY A;  4WF0 A;  2V9A A;  1ERO A;  1EI5 A;  1GA0 A;  2JHE A;  3N4I A;  4DJ2 A;  5HX9 A;  2MJ6 A;  2XRN A;  3LGO A;  4GKU A;  5F68 A;  3HCY A;  1IYQ A;  4NXE A;  1DJA A;  1OME A;  1YMX A;  3E4O A;  4QPR A;  3BJN A;  1LSW A;  1O07 A;  1PWG A;  4ETX A;  2ACG A;  2JKF A;  1LI0 A;  3A3J A;  2PAV P;  4ZAM A;  3DW0 A;  3PBS A;  3UB5 P;  1S4R A;  4KG5 A;  1K4E A;  5MC7 A;  1EWZ A;  4QB8 A;  5GLB A;  3LEQ A;  1XJ3 A;  1OT6 A;  4MEZ A;  2PR6 A;  3T4T A;  4KZ9 A;  5EVE A;  4YWZ A;  4NK3 A;  1XA7 A;  4JXS A;  3A3E A;  2WAE A;  4KG6 A;  4DRT A;  3IX4 A;  3BWL A;  5CGS A;  4Z9Q A;  3VP0 A;  2FFF B;  2PR5 A;  3GV9 A;  3NI9 A;  4IVK A;  1UWN X;  3C7V A;  3OPL A;  1YSQ A;  3D72 A;  4HIA A;  3GEC A;  2AVX A;  1ODV A;  3NBL A;  3D3O A;  4WMC A;  4ZJ3 A;  4Q8I A;  2A2L A;  3QNC A;  2ZQA A;  3IBJ A;  1A0K A;  2EXB A;  3VOZ A;  1E25 A;  2C5W B;  4ARZ A;  1JWV A;  1PYY A;  4E3L A;  1JWZ A;  4DN0 A;  2XD1 A;  3MXQ A;  1C3B A;  4D2O A;  5HDS A;  3CUE A;  2PRF A;  2WGI A;  4RX3 A;  2R9W A;  2JCH A;  3MJQ A;  1ZG6 A;  4BBU A;  1J9M A;  5HAI A;  2XFS A;  1FCN A;  4FTX A;  4XT2 A;  5FSR A;  2XLN A;  1YT4 A;  4R3A A;  2Y2O A;  4G3K A;  2I9V A;  3L9K A;  4ZJ2 A;  3NUL A;  2W1T A;  3VE4 A;  3S7P A;  4GDB A;  1DY6 A;  3LR5 A;  5TR7 A;  2ZC6 B;  4XXR A;  4MBH A;  4MDZ A;  5A90 A;  3OCN A;  2XRO A;  5TBM B;  5DF7 A;  1N9O A;  3CUE C;  4OOM A;  5DFY A;  2ZC7 A;  2WYX A;  5CEC A;  3KSF A;  2ZL1 A;  1XX2 A;  5CHJ A;  4K91 A;  5AJG A;  2KX6 A;  5E43 A;  2DMW A;  1XFN A;  3GVB A;  1S4S A;  5AQ9 A;  2H10 A;  4B4Z A;  4LV1 A;  1M40 A;  3FZC A;  2JKG A;  3T1R A;  2ZQD A;  4ZTK A;  3IX8 A;  4NET A;  4JF4 A;  4GS9 B;  5E2E A;  1H5X A;  3K3D A;  2FH5 A;  2ZM8 A;  5F5Y A;  4HNB A;  2XEP A;  4P87 A;  5FL3 A;  3E0Y A;  3LIC A;  2X01 A;  2ZC3 B;  1Y54 A;  1MWR A;  3BFE A;  1H8M A;  1F2K A;  4Y3I A;  4Q0I A;  1OJG A;  2GX5 A;  4Y0T A;  3EOI A;  2Q0O A;  2Y2H A;  5CTN A;  3RTY A;  4DF6 A;  5FQJ A;  2HV1 A;  2Y2L A;  3V67 A;  1KDW A;  1K6R A;  4DDS A;  4K08 A;  2PYP A;  3W4Q A;  3NDE A;  4HH3 A;  3Q1F A;  4FD8 A;  2KLI A;  2QWS A;  2Y2Q A;  2A24 B;  2R9X A;  4KZ7 A;  1BSG A;  1DP6 A;  2B5R A;  3LR0 A;  5E2H A;  3IF5 A;  3QP1 A;  1IKG A;  5HSQ A;  2HPB A;  4R3B A;  5IT5 A;  1TEM A;  1Z6F A;  2VV8 A;  4PM8 A;  2HZ5 A;  2QKP A;  5GLC A;  1IYO A;  3UE3 A;  2OAP 1;  5HL6 A;  3DTK A;  1XGJ A;  1XJ2 A;  3MXR A;  5EVI B;  2CMN A;  4GLQ A;  3DWZ A;  4EEU A;  2V20 A;  3ZFZ A;  5FI2 A;  1IOU A;  1WYB A;  1CK3 A;  2JKT I;  4DMZ A;  1FOF A;  3A3D A;  2K7S A;  3NEC A;  3C4P A;  3BLM A;  3CZD A;  2FFY A;  3BW6 A;  4ETZ A;  1GSW A;  2GJ3 A;  3LEZ A;  2P9V B;  2W27 A;  1NLY A;  4JXW A;  3N8R A;  1ALQ A;  3BQA A;  2ZMV A;  4OLG A;  1J3W A;  3BEB A;  3RJU A;  1PZP A;  5FQI A;  4EBN A;  1FQG A;  3OZH A;  1PW8 A;  2V1A A;  4I5S A;  1ZC2 A;  5F1F A;  4X25 A;  1NY0 A;  3WWX A;  5A91 A;  4N9L A;  2O99 A;  1PI5 A;  4OPQ A;  1KVM A;  2R78 A;  4GN2 A;  4P6B A;  5JYP A;  5CGW A;  3ITB A;  3SS3 A;  3UN7 A;  4LPZ A;  1ONG A;  1LSV A;  1FIK A;  1MWT A;  2O9A A;  2A3U A;  3OBF A;  3C30 A;  3U2A A;  1MWU A;  4AFI A;  1PNE A;  5DVA A;  4LCM A;  2ZQC A;  5F6A A;  4B4X A;  2E8I A;  3HJK A;  4ESP A;  1KE3 A;  3MMH A;  3H82 B;  3LIB A;  1FR1 A;  3NY4 A;  2PU4 A;  5GHY A;  4OP5 A;  2V0W A;  1W8Q A;  4BMW A;  3SOI A;  3QP6 A;  3ZNT A;  3IS2 A;  2WKR A;  3CG5 A;  3P09 A;  5AQ7 A;  4JF5 A;  2JE5 A;  2KDK A;  3BY8 A;  2ZM2 A;  3PAE A;  1W63 Q;  2Z2M B;  2O9B A;  1YM1 A;  4S2J A;  3HBR A;  1JNU A;  4H8R A;  2Z6D A;  4Y2F A;  2L4R A;  5EFW A;  1NWZ A;  3QP2 A;  4MCW A;  4FUW A;  2J9O A;  3MXS A;  1K38 A;  3BRM A;  1CEF A;  2OSU A;  3P01 A;  1NYM A;  4EQ1 A;  3QP4 A;  3HRE A;  2QHK A;  1NRJ A;  1T1B A;  4X1M A;  2ZQ9 A;  1H8Z A;  4WBG A;  2EXA A;  3B3X A;  1K56 A;  3C8C A;  4HP4 A;  1RGZ A;  1NRF A;  1L0E A;  3VSL A;  5GLA A;  4E04 A;  4CLC D;  4HP9 A;  4S2O A;  2BTF P;  4R70 A;  2P7J A;  5C5K A;  2M7U A;  5HWW A;  1W5D A;  5FQQ A;  3TSG A; 
#chains in the Genus database with same CATH homology
 3PBS A;  3NOT C;  1P9R A;  1S4R A;  1UGU A;  4BBV A;  4GHI A;  1T1A A;  1N9L A;  3IS2 B;  5MC7 A;  3OCL A;  1NLZ A;  4I3J A;  1OJ5 A;  4G3V A;  2W3D A;  5HZH A;  3SW1 A;  1XJ3 A;  1OT6 A;  4WLA A;  2PR6 A;  3T4T A;  4YWZ A;  4CLC E;  2EWV A;  4BWI A;  1N9N A;  3CIT A;  3PBN A;  4WEK A;  3LFV A;  1GSV A;  2O9C A;  4NXF A;  3BWL A;  2W3G A;  3A0S A;  4R6L A;  2XA7 M;  3F1P A;  1Y28 A;  4GCZ A;  2V1B A;  2VA0 A;  2PR5 A;  3EEA A;  1X0O A;  4F3L B;  1UWN X;  3HJI A;  4OOL A;  1STZ A;  4MMN A;  4UQI M;  3EWK A;  1YSQ A;  3KSH A;  3D72 A;  3CI6 A;  4HJ3 A;  5TBM A;  1MZU A;  3T4O A;  3B33 A;  3GEC A;  4HIA A;  2P04 A;  3LR3 A;  2BAS A;  5HDD A;  1ODV A;  2J3T C;  3CWF A;  3D3O A;  1XJ4 A;  4HHD A;  2A2L A;  2HF6 A;  3GDI A;  3IBJ A;  2D01 A;  3DBA A;  3UB7 A;  1W63 M;  4KUK A;  4ARZ A;  5DJT A;  4NXG A;  4JGP A;  4IUH A;  4DN0 A;  4HI4 A;  3MXQ A;  3BY9 A;  2PD8 A;  5HDS A;  3CUE A;  2VKS A;  2PD7 A;  3NOP C;  5K5B A;  3MJQ A;  4LRZ E;  3S7O A;  4BBU A;  3EEH A;  1G6O A;  3K2N A;  4M4X A;  2K31 A;  4XT2 A;  4G3W A;  4L9F A;  4P6Z M;  3F1P B;  1V9Z A;  4R3A A;  1LSX A;  4WN5 A;  4DJ3 A;  4G3K A;  1YKD A;  2I9V A;  4ME4 A;  2VLG A;  4GS9 A;  2W1T A;  3VE4 A;  3S7P A;  3RFB A;  4L0L A;  3TW8 A;  1T19 A;  2OAQ 1;  2ZOH A;  3LR5 A;  4MN5 A;  3IBR A;  4Y5F A;  4MDZ A;  3OCN A;  2XRO A;  4I3I A;  5TBM B;  1VHM A;  1N9O A;  4LRY C;  5DJU A;  1D06 A;  3ULF A;  2Z6C A;  3CUE C;  3E98 A;  3ZQ5 A;  4OOM A;  3BQ8 A;  3PYP A;  5DFY A;  2HJE A;  1OTB A;  4NXB A;  1OTE A;  2XA7 S;  4IJG A;  3E4Q A;  1DP8 A;  5AVE A;  5L8M A;  4EEP A;  3PXP A;  3T4K A;  2Y8H A;  3KSF A;  2YKH A;  3NJA A;  2B02 A;  3MQO A;  5AJG A;  2KX6 A;  4WEJ A;  2XSS A;  2YKF A;  1VB6 A;  2DMW A;  3LID A;  1XFN A;  3JVU A;  2JKR I;  3PHY A;  2J3T D;  3UE6 A;  1S4S A;  2W0N A;  4H6J B;  4L9G A;  1DRM A;  4EER A;  2A24 A;  2WKP A;  5A8B A;  4EET B;  1OTA A;  2W3F A;  5HPF A;  1OTD A;  4XT2 B;  2PYR A;  3H7W A;  3R7W A;  1V9Y A;  3O5Y A;  3LR4 A;  1EW0 A;  4GS9 B;  5HDC A;  1P9W A;  5F69 A;  2JKR M;  3KSI A;  3K3D A;  2FH5 A;  4JGQ A;  1XFQ A;  5F5Y A;  4HNB A;  4PKY A;  2QJ7 A;  4MN6 A;  1GSX A;  1LL8 A;  2VGL M;  3F1O A;  3OLO A;  5HPI A;  5FL3 A;  2PT7 A;  3E0Y A;  1TF1 A;  3LIC A;  5HD3 A;  3LIA A;  2Y79 A;  3W2Z A;  4IUK A;  4R38 A;  1S66 L;  3LI8 A;  2VZW A;  1H8M A;  4JGR A;  4Y3I A;  4Q0I A;  1OJG A;  4JGO A;  1S1Y A;  2GX5 A;  1BYW A;  3EOI A;  2FZ0 A;  3PBQ A;  3RTY A;  3KO6 A;  1UWP X;  2V0U A;  4GHI B;  4I3A A;  2HV1 A;  3V67 A;  3H9W A;  2NUT C;  1IFQ A;  3C2W A;  4K08 A;  3TE8 A;  2PYP A;  3VV4 A;  2VJW A;  4B93 A;  3E4P A;  5KSH A;  5IU1 A;  3T4L A;  5G4Z A;  1F5M A;  2W1R A;  3UME A;  4HJ6 A;  4HH3 A;  2G7U A;  4YOF A;  1TS8 A;  4Q0J A;  5HWV A;  2KLI A;  2QWS A;  3R4K A;  2M7V A;  2A24 B;  1P97 A;  3PBT A;  1DP6 A;  4EXO A;  2VEA A;  1XJ6 A;  3B47 A;  1YAX A;  3JVV A;  3LR0 A;  5IS1 A;  1S1Z A;  4I38 A;  2EWW A;  3H7W B;  5HSQ A;  3R7W B;  5IT5 A;  5G4Y A;  2VV6 A;  1OTI A;  2VV8 A;  4Q0H A;  2W3H A;  3UB6 A;  2QKP A;  3UE3 A;  2OAP 1;  2ZOI A;  2LB9 A;  2PDR A;  5J7E A;  5HL6 A;  3UB8 A;  3ZYT A;  1XJ2 A;  5CX7 A;  3VOL A;  2CMN A;  4GLQ A;  2J3W A;  4EEU A;  1OT9 A;  3MQ0 A;  4NEE D;  3UMD A;  2W3E A;  1IOU A;  2JKT I;  2WKQ A;  3MR0 A;  4DMZ A;  1G28 A;  4I39 A;  1WA9 A;  4PHT A;  2EA9 A;  4O01 A;  4CLC A;  2K7S A;  4UEY A;  3P7N A;  4EU0 A;  3VE3 A;  4ARZ B;  4ZRR A;  3A0V A;  3BW6 A;  4ETZ A;  1GSW A;  4IHQ A;  3FG8 A;  3UB9 A;  2GJ3 A;  3H82 A;  4UQI S;  4WEL A;  4LRX C;  4EW7 A;  2W27 A;  3G6O A;  3NHQ A;  1NLY A;  4HH2 A;  4CQH A;  5DF9 A;  4FOF A;  2VGL S;  3F1N A;  3MQQ A;  2QJ5 A;  2ZMV A;  1MC0 A;  3BQA A;  2B18 A;  3T4Q A;  4EUV A;  2HGV A;  3EQV A;  2O0Y A;  4WUJ A;  3LIE A;  3KYZ A;  5AVF A;  2QYB A;  2V1A A;  4I5S A;  2IA2 A;  4HY8 A;  1YSP A;  1D7E A;  3KYQ A;  4O8G A;  1T1C A;  2P08 A;  3LYX A;  2W1T B;  2O99 A;  4HJ4 A;  4CLC C;  4MN7 A;  5I5L A;  2R78 A;  5J4E A;  4II7 A;  4L9E A;  3KX0 X;  3RH8 B;  1TD5 A;  3LUQ A;  2ZMF A;  3OC2 A;  3C38 A;  4LPZ A;  5HD5 A;  4HOI A;  2PHY A;  1LSV A;  1TS7 A;  2JN7 A;  4Z1W A;  2O9A A;  4WL9 A;  1LT0 A;  3OBF A;  3C30 A;  4P6Z S;  3U2A A;  4CLC B;  4NKP A;  1H3Q A;  4O0P A;  4AFI A;  3B42 A;  3T4J A;  5DFX A;  2INW A;  2H28 A;  5F6A A;  3S7N A;  2NUP C;  4GJ4 A;  2GZA A;  1F9I A;  4PAU A;  4YNR A;  2LB5 A;  3HJK A;  4KQD A;  3EQU A;  3MMH A;  3H82 B;  3LIB A;  1DP9 A;  3PR6 A;  2V0W A;  4LLO B;  1T18 A;  1OPX A;  4BMW A;  3F1N B;  2D02 A;  3IS2 A;  2WKR A;  4EES A;  2KDK A;  1P0Z A;  3BY8 A;  1TS0 A;  2OWJ A;  3KSG A;  2GNX A;  1W63 Q;  5KIZ A;  2O9B A;  5DKL A;  1JNU A;  4KQO A;  3LIF A;  2Z6D A;  4Y2F A;  3MF0 A;  2L4R A;  5EFW A;  3T4S A;  3FPV A;  1NWZ A;  3ICY A;  4MCW A;  4B9O A;  1MKM A;  3CLO A;  2VX8 A;  3EGX C;  4H6J A;  3TJZ C;  3TRC A;  4RQ9 A;  3NOU C;  4BBT A;  1TS6 A;  1F98 A;  2K2N A;  3EGD C;  3P01 A;  5HWT A;  2HJ9 C;  3S7Q A;  4KUO A;  4EQ1 A;  2OOL A;  2ZBB A;  3F1O B;  2QHK A;  3FC7 A;  1NRJ A;  3CAX A;  4GW9 A;  4HQA A;  1T1B A;  5DKK A;  5TJJ A;  4F3L A;  1S67 L;  2KOI A;  4BJP A;  3A0R A;  4WF0 A;  4PKY G;  2V9A A;  3OOV A;  2L1M A;  2JHE A;  2VV7 A;  4DJ2 A;  3C8C A;  1ZTU A;  2M1C A;  4HP4 A;  2MJ6 A;  2XRN A;  4FSF A;  5J3W A;  2J80 A;  3T50 A;  3K3C A;  4E04 A;  5F68 A;  4CLC D;  3HCY A;  3FPW A;  3MFX A;  4NXE A;  5LBR A;  3PBO A;  3E4O A;  4HP9 A;  2OWH A;  4QPR A;  3BJN A;  4R70 A;  1ZHH B;  2L0W A;  1LSW A;  2P7J A;  2JKT M;  3PBR A;  5C5K A;  2M7U A;  4ETX A;  5HWW A;  3LI9 A;  1KOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...