3C5AA

Crystal structure of the c-terminal deleted mutant of the class a carbapenemase kpc-2 at 1.23 angstrom
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
264
structure length
264
Chain Sequence
TNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class A carbapenemase KPC-2
publication title Genetic and structural insights into the dissemination potential of the extremely-broad-spectrum class A {beta}-lactamase (EBSBL) KPC-2 identified in two strains of Escherichia coli and Enterobacter cloacae isolated from the same patient in France
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 97
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2008-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3c5aA00
4E3KA 2ZC6B 1KDSA 1GA0A 1JWZA 1E25A 3N8RA 4QD4A 4BD0A 5EPHA 3Q1FA 2Y2JA 4QHCA 3CJMA 1FOFA 5EVLA 2ZMAA 3IT9A 4LCMA 4S2JA 5EOOA 3WRTA 3UPOA 2I72A 3N8LA 1PIOA 2ZC7A 5FQ9A 3V39A 1G68A 2WZXA 3OPPA 3OCLA 4QU3A 1J9MA 4HESA 5GLCA 1FSYA 4NK3A 3BFGA 3HUNA 3QNCA 4OKPA 5GL9A 4DE2A 5BOHA 1YLJA 4QY6A 1QMEA 2Y4AA 1W8YA 3SH8A 5KMWA 1XXMA 1RGZA 5TR7A 1NZUA 3FV7A 3LY3A 4PM6A 1YLWA 1PWDA 4X53A 5EECA 5KSHA 3LY4A 4EUZA 2G2UA 1LLBA 1SKFA 5HAPA 4XUZA 1K57A 1K54C 3SS3A 3NIAA 4WZ4A 3C7VA 3SOIA 3DW0A 3IWOA 2EXAA 4P6BA 4KZ4A 4C75A 4E3JA 2Q9NA 3A3IA 1PYYA 3MZEA 4P0MA 5M1AA 4ZDXA 2H0YA 3IXHA 1KVMA 4KQRA 1L0DA 2WYXA 4C3QA 4KENB 1PW8A 2A49A 2OV5A 4OVDA 1I5QA 3G2ZA 3MZDA 4OLDA 3VP4A 3HLBA 5A92A 1VQQA 2WGWB 3MKFA 2XD1A 3G34A 4LV2A 2IWDA 2WKIA 3UDIA 3P98A 5HARA 2ZJ9A 2QZ6A 3VFFA 5E2FA 2ZQ9A 4KG6A 3BRMA 4S2MA 2HDSA 5U47A 4N92A 3FWLA 5FAOA 2P9VA 4PPRA 2XGNA 4U0TA 5DTTA 5A93A 1IYOA 3MXSA 3ZG8B 3AGDA 5E2GA 5FAPA 1ERMA 1K55A 2Y2LA 3WS0A 5AQ7A 3DTMA 4CJNA 3IF6C 4Z9QA 3VP2A 1GHIA 1CK3A 4B4XA 1LL9A 5DF7A 1W8QA 2JC7A 2UWXA 4KG2A 1ESUA 5D3OA 3O88A 1ES3A 2P74A 2WADA 2Y2GA 5G18A 2ZC3B 4JLFA 3I7JA 3HVFA 4GB7A 1ZKJA 2HDRA 4S2OA 4PM8A 1PWCA 5CHMA 1MWUA 4N9LA 1YMXA 3RXWA 3BLMA 1BSGA 4GD6A 2XFTA 5E2HA 4MBFA 5E2EA 1ZC2A 2RCXA 1DJCA 4S2NC 1WE4A 1MWRA 4B88A 2BG1A 1MY8A 1U60A 1MWSA 3IHBA 4DE0A 1G6AA 1YQSA 5GLDA 1FR6A 3NY4A 1ONHA 2J9OA 1KVLA 3O3VA 2A3UA 3UDFA 1K54A 2IWCA 3IH9A 5DF9A 2Z2MB 1BLPA 1BT5A 3GMWA 1I2SA 2EXBA 3VOYA 2HDQA 3OZHA 5GLAA 1XA7A 3OPLA 2WZZA 2E8IA 2WAFA 2Y2MA 2PU4A 3W4QA 3UN7A 5CEBA 3B3XA 1W5DA 5FQKA 4KQOA 3IHAA 4FSFA 5EVID 1FSWA 3VP0A 5CECA 1K4EA 1S0WA 1XPBA 1IKIA 4NETA 5A91A 4IBRA 3N8SA 5F1GA 3HL9A 5EVIC 5KZHA 2GDNA 1CI9A 4OQ0A 3WS1A 3A3EA 4WZ5C 1CI8A 3AGFA 2QPNA 3UNWA 1DY6A 3A3DA 5AQBA 3GR2A 5EUAA 5GHXA 4EBLA 3A3JA 3NBLA 3OPHA 3SH7A 4DDSA 4DKIA 4KZAA 2H0TA 1GCEA 3P09A 1I2WA 2Y91A 4IVIA 1YLYA 1K6SA 5FQMA 5I94A 2Y59A 3IF6A 3MZFA 3PBOA 3Q82A 4JBFA 4N1XA 5EOEA 1GHPA 4X55A 1OMEA 4JF4A 5IHVA 4A5RA 4Y0UA 4LCLA 4BL3A 4OONA 1IKGA 2WAEA 5FQIA 3BEBA 1SCWA 1XGJA 4OP8A 4XXRA 2Y2KA 2ZM2A 4X68A 4KZ6A 3VP3A 3GRJA 4UA6A 4WELA 4UAAA 4BL2A 5GHZA 1WYCA 2QMIA 1LL5A 4LENA 1IELA 3ZCZA 5KSCA 4PM9A 1NY0A 4FH2A 3UPPA 1PWGA 3EQVA 4KZ9A 1NRFA 3W4OA 2C6WB 3MKEA 2EX6A 4M3KA 4S2NA 3ZG9B 4JF5A 1GHMA 1BTLA 2X02A 4OOYA 4EWFA 3VSLA 4R1GA 1IEMA 3WWXA 2JE5A 2ZQAA 3OPRA 1EI5A 3CMZA 4JXVA 4OP5A 2DCFA 1AXBA 3NI9A 3BFCA 1SHVA 1N4OA 3IXGA 4BQMA 4ZJ3A 5CEDA 3LO7A 5HL1A 3C4OA 3TOIA 2XH9A 3HLDA 2IWBA 2Y2IA 3S22A 4EQIA 1SDEA 4KZ5A 3V3SA 5AQAA 1KDWA 3HLEA 3CZDA 3G2YA 1LHYA 4ZBEA 5FASA 4DXBA 2C5WB 1HTZA 3N6IA 1FCMA 1ONGA 1O7EA 1XP4A 4H8RA 4OQGA 4OPZA 2WKHA 2RL3A 2H10A 1ZG4A 4O7DA 3M6BA 3FKWA 3JYIA 4GDBA 1IYSA 3MFDA 1K25A 2G2WA 4K91A 4RYEA 1GA9A 1O07A 4HBTA 5CHUA 5EVIA 5GLBA 3UE3A 2V2FF 1KGEA 5FQQA 4WZ5A 2ZQ8A 4OPQA 5AQ9A 3ZG5A 2P9VB 3C5AA 1FQGA 1M6KA 1MKIA 3BYDA 2EFXA 4S2PA 2PU2A 3N4IA 5EE8A 4BD1A 4FD8A 4N1HA 4EBNA 4WEKA 3ZGAB 5CXWA 5CTNA 1NYYA 5HW3A 3IWIA 3G4PA 3WS2A 1CEFA 3WRZA 3NC8A 1IYQA 1PW1A 2JBFA 2XQZA 4KZ7A 5CGSA 3G31A 1EWZA 3GQZA 4DE3A 1FR1A 4B4ZA 2R9XA 2R9WA 1KE3A 1M40A 1JTGA 5HX9A 2EFUA 3IXDA 3WS5A 3V3RA 2EX9A 3TSGA 3NDGA 3D4FA 1DJBA 1L0EA 1LI0A 3BECA 3M6HA 3UY6A 2X01A 3GV9A 4PM7A 1E4DA 3C4PA 4EV4A 3ZVTA 5CRFA 3HUMA 3ZFZA 1HZOA 4E3MA 4WBGA 3Q81A 1K6RA 3G32A 3BM6A 3FZCA 5FI6A 4OOLA 2XFSA 4WYYA 3E2KA 4X6TA 3SH9A 4MEZA 3UDXA 3VOZA 4OLGA 4Y7PA 4R4SA 5FI2A 1YT4A 2FFYA 1VM1A 4YINA 1PI5A 2Z2LB 3C7UA 3PBRA 4RVAA 3ITAA 1YLTA 4L0LA 3VSKA 3Q7VA 3OC2A 1CEGA 3ZNYA 1KGGA 2J7VA 1MWTA 1JWPA 5GHYA 4KQQA 3IH8A 4D2OA 3HLWA 1JTDA 3SS4A 1TDGA 1PZPA 2Y2QA 4GKUA 3PBTA 3SS5A 2H5SA 4YFMA 1ES2A 3IF5A 1XGIA 3IQAA 5CERA 4C6YA 3G35A 5TFQA 2XK1A 4HBUA 1DJAA 4FCFA 3O86A 3S1YA 1XX2A 4JKTA 3RXXA 3TG9A 1W79A 3DWZA 1E3UD 3HUOA 1K56D 1XA1A 4WM9A 4RA7A 1L0FA 1S6RA 2ZC4B 1BZAA 1SDNA 3HBRA 1MPLA 1IYPA 2DNSA 2EX2A 4CPKA 2ZM8A 4OQHA 5HAQA 3QNBA 3IF6B 4XUXA 1NYMA 3V5MA 5CTMA 1JWVA 4LV1A 5DTKA 3AGEA 1YLZA 4ZJ1A 4ZJ2A 3LEZA 1TVFA 3NCKA 3FKVA 1YM1A 3IWQA 3GVBA 4QB8A 2EX8A 4F94A 1HD8A 2Y2OA 3O87A 4R4RA 3UPNA 2XDMA 1ZG6A 3G30A 3Q07A 1PI4A 2HP6A 4LV0A 3RJUA 3WS4A 4EBPA 4GD8A 1C3BA 4N9KA 1YMSA 2BLSA 4E3IA 4WMCD 3VFHA 3ZVWA 4KZBA 5FQJA 2Y2PA 4P87A 3ZG7B 5L2FA 1Q2QA 1H8YA 1TEMA 5TGFA 2Q9MA 3V50A 2XD5A 5F1FA 1LI9A 3ISGA 4IBXA 5DVAA 3VMAA 2J8YA 1BUEA 3W8KA 3BFDA 1YLPA 4GNUA 4E6WA 4IEDA 3UE1A 3BFEA 3GTCA 2WGWA 4S2LA 3HREA 1TDLA 2XF3A 2HDUA 3ITBA 2PBYA 3MXRA 5DF8A 3PAEA 5M18A 1RGYA 4Y0TA 1ERQA 2OLUA 1K4FA 3Q7ZA 3IXBA 1KE0A 1BULA 4UA7A 1PZOA 1KE4A 2ZLYA 4IVKA 5CGXA 3VP1A 3GSGA 3EQUA 4R3BA 5CHJA 1KGFA 4LV3A 3QHYA 2Y55A 3HLFA 1H8ZA 3PTEA 1MBLA 1JVJA 4OOMA 5EVIB 4PM5A 2X71A 3N7WA 3OCNA 3W4PA 2Y2NA 4R3JA 3HLGA 2ZD8A 4MLLA 4UA9A 4ZTKA 4QY5A 5FAQA 4DE1A 1XKZA 1MXOA 4Y0OA 3PAGA 2XEPA 1WYBA 2VGJA 3PBQA 4R0QA 4JPMA 1BLHA 1N9BA 1E3UA 2XR0A 5F83A 1K56A 4E3OA 5J8XA 4GOGA 2B5RA 2WGIA 3M2KA 4RX2A 3ZHHA 4K0XA 5CGWA 4E3LA 1Y54A 5M19A 2ZQCA 2ZQ7A 4ID4A 2HPBA 1Q2PA 4X56A 1Z6FA 3MBZA 5HAIA 2ZQDA 2HP5A 1HVBA 1L0GA 5FATA 5HFOA 2ZC5B 4PMAA 4X69A 5JYOA 4R23A 4DDYA 4E6XA 1L2SA 1NJ4A 3HLCA 4JXWA 4U3TA 4GDNA 3ZDJA 2XLNA 5A90A 1BLSA 4KZ3A 4WEJA 2WUQA 5FSRA 1NXYA 1K38A 1RP5A 2DRWA 4JXGA 2Y2HA 1FCOA 4JXSA 4K0WA 1EROA 3DWKA 4KZ8A 5F82A 5FI7A 3ZNTA 4E3NA 3CG5A 2V20A 1K57C 1QMFA 2FFFB 4BLMA 3BFFA 2JCHA 1ES4A 2WGVA 4MBHA 4S2IA 4Q8IA 1NZOA 4QJGA 4WMCA 5FA7A 4JF6A 1RCJA 2J9PA 3BLSA 2OSUA 4DRTA 5FDHA 1H5XA 4BENA 3FYZA 4OPRA 3ZG0A 1BLCA 4GZBA 2HP9A 4MNRA 4OQIA 1FCNA 2ZM0A 4ZAMA 3S4XA 1ES5A 3NDEA 4OPYA 4RX3A 2OLVA 1ALQA 2WKEA 1W7FA 4BJPA 3E2LA 4DF6A 4UHUA 4KG5A 4FH4A 1ESIA 3M2JA 2WK0A 3PBNA 4S2KA 3Q7VB 5E43A 4U0XA 4GN2A 2VGKA 4MBKA 4OH0A 3A3FA 2CC1A 2V1ZA 4DXCA 3PBSA 5JYPA 1K55C 3UO9A 3LCEA 3UE0A 4HEFA 4P85A 5DTSA
chains in the Genus database with same CATH superfamily
2OAQ1 1GA0A 1E25A 4BD0A 3Q1FA 4S2JA 3IT9A 3WRTA 3CI6A 1S1ZA 1OJ5A 5FQ9A 1ZHHB 5EM0A 4HESA 1FSYA 3BFGA 3HUNA 5GL9A 4BBTA 1K0KA 2B02A 2IA2A 5KMWA 1RGZA 1TS7A 1NZUA 3L7HA 5J3WA 1YLWA 1PWDA 3LY4A 1SKFA 2VEAA 1K57A 5HPFA 4WZ4A 3ZQ5A 4Y13A 3PR6A 4ZDXA 4P0MA 3BW6A 2Z6CA 3E4PA 1L0DA 2OV5A 1I5QA 3C8CA 1OTDA 3HLBA 1X0OA 2J3WA 2IWDA 2ZBBA 3LR4A 4MN6A 5E2FA 2ZQ9A 2V1AA 1XJ3A 3TJZC 4N92A 1A0KA 5DTTA 1IYOA 3MXSA 4I3AA 1IFQA 2PD8A 5E2GA 1K55A 3WS0A 3T4QA 2UWXA 2A24B 4KG2A 5D3OA 3T1XA 4IUKA 2WADA 4JLFA 2HDRA 3EGDC 2PYPA 5CHMA 1D7EA 1MWUA 4NXGA 3RXWA 3L9KA 4ZRRA 3NOUC 2BG1A 1MY8A 1LL8A 3IHBA 1G6AA 5A8BA 5GLDA 1V9YA 4DJ3A 3IH9A 3DTKA 1BLPA 3GMWA 4MDZA 3OPLA 2VV7A 5CEBA 3B3XA 5FQKA 4KQOA 4FSFA 5CECA 4IBRA 5EVIC 5DJUA 5KZHA 2GDNA 3WS1A 4FTXA 3AGFA 5AQBA 3NBLA 4II7A 4DDSA 3DAVA 1Y4OA 4KZAA 1GCEA 4DJ2A 4N1XA 3PBOA 4Y0UA 4LCLA 4OONA 1Y28A 3NJAA 3MSHA 3VP3A 4UAAA 4LENA 1IELA 3ZCZA 2V1BA 3LUQA 2DMWA 4KZ9A 3W4OA 3ZG9B 3FG8A 3VSLA 3T1RA 2H28A 3NOPC 4R38A 3NI9A 5HL1A 3IXGA 5CEDA 3H7WA 2XH9A 2IWBA 2Y2IA 3IX3A 4KZ5A 1LHYA 4DXBA 3EEHA 3LEQA 1ONGA 2RL3A 3FKWA 3JYIA 2D01A 4RYEA 5EVIA 2V8FA 1KGEA 4ME4A 5AQ9A 3F1OB 1FQGA 1M6KA 3T1QB 1V9ZA 3T4SA 5CXWA 3IWIA 5HL6A 4KZ7A 4DE3A 3EGXC 2R9WA 5HX9A 4HP4A 3IXDA 3BY8A 1S4SA 3UY6A 3R4KA 3NECA 4PM7A 3C4PA 3ZVTA 5CRFA 1HZOA 4WBGA 2QKPA 1J3WA 3IS2B 4X6TA 3HJIA 3VOZA 3UDXA 5FI2A 1YT4A 1VM1A 1SZVA 3ITAA 3Q7VA 1XFNA 2J7VA 1JWPA 5GHYA 4KQQA 4Y3IA 3HLWA 1PZPA 2Y2QA 2W0NA 3SS5A 3H9WA 1ES2A 3IF5A 3IQAA 1IOUA 1DJAA 3O86A 3S1YA 3TG9A 5EM1A 1W79A 3T4OA 1K56D 1Z09A 2L1MA 2DNSA 2ZM8A 5HAQA 1NYMA 3FPVA 2FZ0A 3V5MA 2VLGA 5CTMA 1DRMA 5TJJA 3LEZA 3NCKA 3KO6A 5HSQA 1YM1A 3IWQA 4MMNA 2EX8A 2PBDP 1HD8A 3O87A 3T1SA 4R4RA 3JVUA 5AJGA 2QWSA 3Q07A 3RJUA 3WS4A 1C3BA 4E3IA 3B33A 4WMCD 3C2WA 4E04A 1H3QA 1Q2QA 3V50A 2XD5A 1LI9A 3ISGA 2OWHA 4NXFA 1YLPA 2JKFA 3H7WB 5HWVA 4S2LA 5DFXA 4R70A 3ITBA 1AWIA 1W63Q 2WKPA 2OLUA 4LRZE 1F98A 3QP2A 1KE0A 1PZOA 2ZLYA 3GSGA 2JN7A 4LV3A 3QHYA 2Y55A 2JKRI 5EVIB 4HH2A 5FAQA 2W3HA 3PAGA 2XEPA 4JPMA 4LLOB 5J8XA 4E3OA 4GOGA 2B5RA 1YSPA 1YAXA 4E3LA 5M19A 4WF0A 1Q2PA 1Z6FA 3UB8A 1HVBA 5FATA 4PMAA 1NJ4A 4U3TA 5HWWA 1JNUA 3MS6A 5A90A 4KZ3A 5FSRA 2XRNA 4WEKA 4JXSA 1FCOA 3DWKA 4I3JA 5EV0A 3BFFA 2JCHA 2W3DA 4MBHA 1BYWA 2OSUA 4DRTA 4BENA 3FYZA 1FCNA 4ZAMA 2OAP1 4OPYA 4EEUA 2OLVA 4HY8A 2WKEA 4BJPA 4DF6A 2I9VA 3CPTA 1NRJA 2WK0A 2W27A 3Q7VB 2XA7M 5E43A 3TRCA 2CC1A 4DXCA 3PBSA 1T1BA 3UE0A 4HEFA 3QP1A 3F1PA 1KDSA 1JWZA 1GSVA 3MJQA 3IBRA 4QHCA 1L3LA 2I72A 3HJKA 2WZXA 3OCLA 1J9MA 4NK3A 3QNCA 2JKTM 3PHYA 1F9IA 1QMEA 2Y4AA 3R7WA 3JVVA 1XXMA 5TR7A 3LY3A 3FV7A 4PM6A 4WUJA 5HAPA 4XUZA 3SS3A 3NIAA 1T1AA 3NHQA 3C7VA 5KIZA 4P6BA 4KZ4A 3UE6A 4C75A 1PYYA 5M1AA 2H0YA 3IXHA 1KVMA 4GS9A 4KENB 1PW8A 1LT0A 3IX8A 3MZDA 4OLDA 5A92A 4NXBA 1VQQA 4LV2A 2XD1A 2MJ6A 3UDIA 4HHDA 2QZ6A 3LYXA 3VFFA 2HDSA 2K31A 3EEAA 2P9VA 2V0WA 3ZG8B 3AGDA 3E0YA 5AQ7A 4CJNA 4Z9QA 3LI8A 5L10A 3NOTC 5FL3A 4B4XA 2Z6DA 1ESUA 5G18A 2NUTC 3KYEA 4GB7A 3D72A 2XFTA 4MBFA 1G5UA 1DJCA 1WE4A 3CUEC 4DE0A 1YQSA 3NY4A 3UDFA 3FPWA 1BT5A 1I2SA 2HDQA 1XA7A 1N9OA 1W5DA 3G6OA 3QP4A 4NETA 1PRQA 5F1GA 3HL9A 1CI9A 3A3EA 4WN5A 1DP8A 3CPTB 3UNWA 4NKPA 4G3WA 4LFUA 2V0UA 3SH7A 4DKIA 1STZA 2H0TA 4HP9A 2LB9A 1W63M 4Y15A 4B93A 5FQMA 3MZFA 5EOEA 4X55A 1OMEA 4JF4A 5IHVA 3F1PB 5G4ZA 3BQAA 1XGJA 3MXQA 4X68A 4KZ6A 2P04A 3GRJA 4UA6A 4WELA 4BL2A 1LL5A 4FH2A 3UPPA 1PWGA 3E4QA 3MKEA 3CUEA 3R7WB 4EWFA 1IEMA 3WWXA 2VGLS 5DKLA 3CMZA 4I39A 4RQ9A 4M4XA 3BFCA 1SHVA 4BQMA 3LO7A 3C4OA 3TOIA 4F3LA 3HLDA 1KOUA 1SDEA 3ZYTA 1HTZA 4GS9B 4H8RA 1XP4A 4OQGA 4P6ZM 2ZMFA 4O7DA 5I5LA 3MFXA 4GDBA 3F1OA 4I5SA 4HNBA 2G2WA 5CHUA 1MZUA 5GLBA 3HCYA 2QJ7A 3UE3A 4X1MA 5FQQA 4GHIA 1TS0A 1DP6A 2KDKA 2P9VB 3C5AA 1MKIA 3IBJA 2EFXA 4BD1A 3N4IA 4FD8A 2G7UA 1DP9A 5CTNA 4HJ6A 3WS2A 3VE3A 2O99A 1IYQA 3G31A 4B4ZA 2W1TB 1M40A 2EWWA 3BECA 3IS2A 2X01A 4Y5FA 1E4DA 3B42A 3LFVA 5LBRA 4E3MA 5EFWA 3EOIA 5L8MA 4OOLA 2PRFA 2XFSA 3E2KA 3K2NA 4MEZA 1WA9A 1LSVA 3IX4A 4L0LA 1TF1A 3OC2A 3ZNYA 1KGGA 4LGWA 2HF6A 3CITA 1JTDA 3K3DA 3LGOA 1XGIA 3G35A 1XJ2A 4JKTA 4NEED 1E3UD 3HUOA 3ICYA 2O9CA 2D02A 1OTEA 1IYPA 2W3FA 1PFLA 1YLZA 2CMNA 4MN5A 4X25A 4Q0IA 1TVFA 3GVBA 1GSXA 1N9NA 3LIDA 4QPRA 3S7NA 2OWJA 4EBPA 3KSFA 4N9KA 4YOFA 4KZBA 5FQJA 3ZG7B 2VJWA 1XFQA 2Q9MA 3QP5A 4L9EA 3LICA 4BMWA 3BFDA 4GNUA 3LI9A 3UE1A 3BFEA 2W3EA 1TDLA 4F3LB 3UMEA 4HJ3A 3PAEA 1RGYA 1TS6A 4EEPA 3VP1A 1KE4A 1VHMA 3EQUA 4R3BA 5CHJA 1H8ZA 1MBLA 1JVJA 4OOMA 4PAUA 1YKDA 2ZD8A 4GHIB 4MLLA 4ZTKA 4CLCE 5HDSA 1P0ZA 4DE1A 3PBQA 2PAVP 4GW9A 1N9BA 2XR0A 1K56A 1MKMA 4RX2A 1Y54A 3EWKA 5IU1A 4O8GA 4DDYA 4JXWA 3ZDJA 2XLNA 2YKHA 1K38A 4JXGA 2Y2HA 5FI7A 1EROA 1HLUP 3ZNTA 4E3NA 1OTAA 3C38A 3CG5A 1QMFA 2FFFB 4BLMA 3CHWP 4QJGA 4WMCA 5FA7A 1RCJA 3V67A 4UQIM 1D06A 3SZTA 2HGVA 4OPRA 2E8JA 1BLCA 4GZBA 2HP9A 3S4XA 1ES5A 1ALQA 3E2LA 4UHUA 5HZHA 4U0XA 5HWTA 4MBKA 2R78A 4OH0A 3MR0A 3A3FA 2P08A 2QYBA 3BWLA 3S7QA 4EESA 3N8RA 3P7NA 5EPHA 3CJMA 4LCMA 5EOOA 1PIOA 4PKYA 3KSGA 3V39A 1G68A 5GLCA 4QU3A 4OKPA 3ULFA 4DE2A 1YLJA 4QY6A 4X53A 5EECA 5KSHA 4EUZA 1LLBA 1T1CA 2PYRA 2YKFA 1K54C 2HJ9C 2Y8HA 3SOIA 2PDRA 3IWOA 2EXAA 4E3JA 2Q9NA 3A3IA 3MZEA 3F1NA 3U2AA 2A49A 1H0MA 3G2ZA 3VP4A 2KX6A 1VETA 2WKIA 5HARA 4BWIA 5HDDA 2M1CA 3BRMA 5U47A 3FWLA 4U0TA 5F5YA 5FEGA 4CLCD 1ERMA 3TE8A 3DTMA 3IF6C 1GHIA 2GNXA 4EU0A 1LL9A 1SKOA 5DF7A 1W8QA 3OOVA 3O88A 2P74A 3GDIA 2OOLA 3HVFA 3MQ0A 1ZKJA 4S2OA 4PM8A 1PWCA 2XSSA 3BLMA 1BSGA 1OJGA 5E2HA 5E2EA 5L07A 3CLOA 3LIBA 4IJGA 1MWRA 1U60A 3DTIA 4AFIA 1FR6A 1ONHA 3O3VA 2A3UA 1K54A 2IWCA 5DF9A 2VV6A 4HI4A 2EXBA 3OZHA 2K2NA 2VX8A 2WZZA 2WAFA 2PU4A 2B18A 3IHAA 1FSWA 3CWFA 3VP0A 1IKIA 1YPRA 4OQ0A 4R3AA 3RTYA 5J7EA 1CI8A 4EBLA 1DY6A 3GR2A 3OPHA 4Q0HA 4HOIA 4G3VA 1I2WA 3OLOA 4IVIA 2KOIA 5I94A 2Y59A 3IF6A 3Q82A 4JBFA 5GLAA 1OTBA 4A5RA 4BL3A 4FOFA 2HJEA 4KQDA 4HQAA 5FQIA 3BEBA 4OP8A 2ZM2A 1G6OA 2GJ3A 1P9RA 1WYCA 4BBUA 2QHKA 4PM9A 3NULA 3UMDA 2ZOIA 1GHMA 1F5MA 1P9WA 1BTLA 4GCZA 3DBAA 2JE5A 2ZQAA 3QP8A 4JXVA 4OP5A 1N4OA 2VA0A 4ZJ3A 3LIEA 3S22A 4EQIA 4HIAA 3V3SA 3CZDA 1FCMA 4OPZA 3F1NB 2WKHA 2LB5A 2H10A 4R6LA 4EW7A 3M6BA 3MFDA 4K91A 1GA9A 1O07A 5F6AA 1VETB 2V2FF 2M7UA 2JKGA 4S2PA 2PU2A 3LIAA 2W1TA 3KYQA 2INWA 3ZGAB 4EQ1A 4O0PA 3G4PA 1SKOB 1CEFA 1P97A 3WRZA 1OTIA 2GX5A 1PW1A 2JBFA 2XQZA 1EWZA 3GQZA 1NLZA 4BBVA 2R9XA 1OT9A 4EERA 4JGPA 4Q0JA 1H8MA 3WS5A 5F69A 3TSGA 2O0YA 3D4FA 1L0EA 1LI0A 3GV9A 4EV4A 3HUMA 3ZFZA 3H82A 1K6RA 2QJ5A 3G32A 5FI6A 2JKRM 3SH9A 4R4SA 2FFYA 3A0SA 4KUKA 1PI5A 3VV4A 3PBRA 4QWOA 4RVAA 1UWNX 1CEGA 1MWTA 5AVFA 4D2OA 1MC0A 1TDGA 4KUOA 5CX7A 1T19A 5CERA 4C6YA 2XK1A 1XX2A 1XA1A 1L0FA 1SDNA 2EX2A 4CPKA 4XUXA 3IF6B 3KSIA 4D60A 4ZJ1A 4XT2A 3FKVA 5HD3A 2XDMA 4HJ4A 3G30A 1PI4A 4LV0A 1XJ6A 2BLSA 5HD5A 3VFHA 1CF0A 4L9GA 2Y2PA 4P87A 5L2FA 4O01A 5TGFA 3VMAA 5DVAA 2PHYA 2HZ5A 2ZL1B 4IEDA 4E6WA 2WGWA 2XF3A 2HDUA 2J80A 3E98A 2PBYA 3T50A 1NLYA 1BULA 4UA7A 5CGXA 5J4EA 1KGFA 3HLFA 3PTEA 1N9LA 3A0RA 4PM5A 2X71A 3W4PA 4R3JA 3HLGA 4Y2FA 4QY5A 1XKZA 1WYBA 4R0QA 1T18A 1BLHA 1E3UA 2WGIA 4NXEA 2ZQCA 2ZQ7A 2HPBA 5HAIA 1TS8A 1L0GA 5HFOA 5JYOA 4X69A 4R23A 4E6XA 3HLCA 4GDNA 5IT5A 1BLSA 4WEJA 2WUQA 4K0WA 4Y0OA 2J3TD 4MN7A 3PYPA 4EETB 4K08A 2WGVA 4S2IA 5FDSA 2VK3A 3BLSA 3H82B 5FDHA 1H5XA 2HV1A 4MNRA 4OQIA 2ZM0A 3MQOA 4RX3A 3RH8B 5L09A 1W7FA 4KG5A 4FH4A 1ESIA 2XA7S 3O5YA 4GN2A 2VGKA 5K5BA 2V1ZA 4IHQA 1VEUB 5JYPA 3UO9A 3LCEA 3C30A 4P85A 5HDCA 1CJFA 4E3KA 2ZC6B 4QD4A 3LR5A 2Y2JA 5EVLA 1FOFA 2ZMAA 3UPOA 3N8LA 2NUPC 2ZC7A 3OPPA 2V8CA 1S67L 3T4KA 1LSWA 5BOHA 3FC7A 1W8YA 3SH8A 4XT2B 4UEYA 2G2UA 1CQAA 2M7VA 1UGUA 1FIKA 3DW0A 3KX0X 4ARZA 3TW8A 2O9AA 2PT7A 4KQRA 2WYXA 4C3QA 3BJNA 2XROA 4OVDA 3S7PA 1YSQA 3W2ZA 2WGWB 3MKFA 3G34A 3P98A 2ZJ9A 4KG6A 4S2MA 2PD7A 5FAOA 4PPRA 2XGNA 3SW1A 5A93A 5FAPA 2Y2LA 2JHEA 3VP2A 1CK3A 4CLCC 4HH3A 5TBMA 5FEFA 2V9AA 2JC7A 3BQ8A 1ES3A 2Y2GA 2ZC3B 3I7JA 1NWZA 4ESPA 4N9LA 5DKKA 1YMXA 2VV8A 4GD6A 4LPZA 1ZC2A 3VOLA 2RCXA 2PR6A 4S2NC 4B88A 1MWSA 4JGRA 2J9OA 1KVLA 5IS1A 2Z2MB 2JKTI 4CQHA 3VOYA 2E8IA 1XJ4A 2Y2MA 4H6JA 3W4QA 3UN7A 3B47A 5EVID 3CAXA 1K4EA 2KLIA 1S0WA 2EA9A 1XPBA 5A91A 2FH5A 3LIFA 3N8SA 4WZ5C 2QPNA 5EUAA 1G28A 3A3DA 5GHXA 4EXOA 3A3JA 5EVEA 2ZOHA 4IUHA 3P09A 2Y91A 1YLYA 1K6SA 2B95A 2K7SA 3BY9A 1GHPA 4CLCA 1S1YA 1IKGA 2WAEA 4YWZA 1SCWA 4XXRA 2Y2KA 5GHZA 5DJTA 2QMIA 3D9YA 5KSCA 1NY0A 2AVXA 3UB6A 3EQVA 5F68A 3LR0A 3MMHA 1NRFA 2C6WB 2EX6A 4M3KA 4PHTA 4S2NA 4JF5A 2X02A 4OOYA 4WLAA 4R1GA 1VB6A 3OPRA 1EI5A 2VGLM 4FUWA 2DCFA 1AXBA 4ARZB 4B9OA 5AQAA 1KDWA 1GSWA 3HLEA 3G2YA 4PKYG 4ZBEA 5FASA 5MC7A 2C5WB 3N6IA 4P6ZS 1O7EA 1ZG4A 4G3KA 1IYSA 1K25A 4HBTA 4JGOA 2L0WA 2VZWA 4WZ5A 3VE4A 2ZQ8A 4OPQA 4GJ4A 3K3CA 3P01A 3ZG5A 3MF0A 3BYDA 3T4TA 5EE8A 4N1HA 4EBNA 1OPXA 4DMZA 1NYYA 3PXPA 5TBMB 5HW3A 2W3GA 4JGQA 3LR3A 2A2LA 3NC8A 2O9BA 5CGSA 1FR1A 2Q0OA 1KE3A 1JTGA 2EFUA 3T4JA 3V3RA 2EX9A 3NDGA 4EUVA 3M6HA 1DJBA 4MCWA 4DN0A 3Q81A 3T12B 3BM6A 3S7OA 3FZCA 2BTFP 4WYYA 4OLGA 4Y7PA 4YINA 2Z2LB 3C7UA 1F2KA 1ODVA 1UWPX 1YLTA 3VSKA 3KSHA 1FILA 3D3OA 4H6JB 1OT6A 3IH8A 4I38A 3SS4A 4GKUA 3GECA 3PBTA 2H5SA 2ACGA 4YFMA 5TFQA 4HBUA 4FCFA 2BASA 2WKRA 3RXXA 4ETXA 3DWZA 5DFYA 4WM9A 4RA7A 1S6RA 2ZC4B 1BZAA 1S66L 3HBRA 1MPLA 1LSXA 4OQHA 3QNBA 1JWVA 4CLCB 4LV1A 3DTEA 3AGEA 5DTKA 4I3IA 4ZJ2A 2W1RA 5G4YA 4QB8A 4F94A 4WL9A 2Y2OA 2P7JA 1S4RA 3E4OA 3UPNA 3UB5P 1ZG6A 4Z1WA 2HP6A 4GD8A 1YMSA 2ZL1A 3ZVWA 4LRXC 3UB7A 1H8YA 1TEMA 1ZTUA 5F1FA 4IBXA 3QP6A 5C5KA 2J8YA 1BUEA 3W8KA 3UB9A 1TD5A 3GTCA 3HREA 3MXRA 5DF8A 2PR5A 4NG2A 5M18A 4Y0TA 1ERQA 1K4FA 3Q7ZA 3IXBA 2ZMVA 4IVKA 5AVEA 2GZAA 3RFBA 3N7WA 3OCNA 2Y2NA 4YNRA 4UA9A 2A24A 4Y17A 1MXOA 2VGJA 1PNEA 5F83A 3M2KA 2L4RA 4K0XA 5CGWA 2WKQA 4LRYC 4ID4A 4X56A 3MBZA 2ZQDA 2HP5A 2UV0E 4GLQA 3T4LA 2ZC5B 4L9FA 1ACFA 1L2SA 3ZHHA 4ETZA 1NXYA 1RP5A 2DRWA 5F82A 4KZ8A 3MQQA 4X1LA 2V20A 1K57C 1D1JA 3JPUA 1ES4A 2J3TC 4Q8IA 1EW0A 1NZOA 4JF6A 2J9PA 4UQIS 5HPIA 3ZG0A 2Y79A 3OBFA 3NDEA 1VEUA 3M2JA 3PBNA 4S2KA 3U4LP 3KYZA 2VKSA 1K55C 2EWVA 3A0VA 5DTSA
chains in the Genus database with same CATH topology
4E3KA 2ZC6B 1KDSA 1GA0A 1JWZA 1E25A 3N8RA 4QD4A 4BD0A 5EPHA 3Q1FA 2Y2JA 4QHCA 3CJMA 1FOFA 5EVLA 2ZMAA 3IT9A 4LCMA 4S2JA 5EOOA 3WRTA 3UPOA 2I72A 3N8LA 1PIOA 2ZC7A 5FQ9A 3V39A 1G68A 2WZXA 3OPPA 3OCLA 4QU3A 1J9MA 4HESA 5GLCA 1FSYA 4NK3A 3BFGA 3HUNA 3QNCA 4OKPA 5GL9A 4DE2A 5BOHA 1YLJA 4QY6A 1QMEA 2Y4AA 1W8YA 3SH8A 5KMWA 1XXMA 1RGZA 5TR7A 1NZUA 3FV7A 3LY3A 4PM6A 1YLWA 1PWDA 4X53A 5EECA 5KSHA 3LY4A 4EUZA 2G2UA 1LLBA 1SKFA 5HAPA 4XUZA 1K57A 1K54C 3SS3A 3NIAA 4WZ4A 3C7VA 3SOIA 3DW0A 3IWOA 2EXAA 4P6BA 4KZ4A 4C75A 4E3JA 2Q9NA 3A3IA 1PYYA 3MZEA 4P0MA 5M1AA 4ZDXA 2H0YA 3IXHA 1KVMA 4KQRA 1L0DA 2WYXA 4C3QA 4KENB 1PW8A 2A49A 2OV5A 4OVDA 1I5QA 3G2ZA 3MZDA 4OLDA 3VP4A 3HLBA 5A92A 1VQQA 2WGWB 3MKFA 2XD1A 3G34A 4LV2A 2IWDA 2WKIA 3UDIA 3P98A 5HARA 2ZJ9A 2QZ6A 3VFFA 5E2FA 2ZQ9A 4KG6A 3BRMA 4S2MA 2HDSA 5U47A 4N92A 3FWLA 5FAOA 2P9VA 4PPRA 2XGNA 4U0TA 5DTTA 5A93A 1IYOA 3MXSA 3ZG8B 3AGDA 5E2GA 5FAPA 1ERMA 1K55A 2Y2LA 3WS0A 5AQ7A 3DTMA 4CJNA 3IF6C 4Z9QA 3VP2A 1GHIA 1CK3A 4B4XA 1LL9A 5DF7A 1W8QA 2JC7A 2UWXA 4KG2A 1ESUA 5D3OA 3O88A 1ES3A 2P74A 2WADA 2Y2GA 5G18A 2ZC3B 4JLFA 3I7JA 3HVFA 4GB7A 1ZKJA 2HDRA 4S2OA 4PM8A 1PWCA 5CHMA 1MWUA 4N9LA 1YMXA 3RXWA 3BLMA 1BSGA 4GD6A 2XFTA 5E2HA 4MBFA 5E2EA 1ZC2A 2RCXA 1DJCA 4S2NC 1WE4A 1MWRA 4B88A 2BG1A 1MY8A 1U60A 1MWSA 3IHBA 4DE0A 1G6AA 1YQSA 5GLDA 1FR6A 3NY4A 1ONHA 2J9OA 1KVLA 3O3VA 2A3UA 3UDFA 1K54A 2IWCA 3IH9A 5DF9A 2Z2MB 1BLPA 1BT5A 3GMWA 1I2SA 2EXBA 3VOYA 2HDQA 3OZHA 5GLAA 1XA7A 3OPLA 2WZZA 2E8IA 2WAFA 2Y2MA 2PU4A 3W4QA 3UN7A 5CEBA 3B3XA 1W5DA 5FQKA 4KQOA 3IHAA 4FSFA 5EVID 1FSWA 3VP0A 5CECA 1K4EA 1S0WA 1XPBA 1IKIA 4NETA 5A91A 4IBRA 3N8SA 5F1GA 3HL9A 5EVIC 5KZHA 2GDNA 1CI9A 4OQ0A 3WS1A 3A3EA 4WZ5C 1CI8A 3AGFA 2QPNA 3UNWA 1DY6A 3A3DA 5AQBA 3GR2A 5EUAA 5GHXA 4EBLA 3A3JA 3NBLA 3OPHA 3SH7A 4DDSA 4DKIA 4KZAA 2H0TA 1GCEA 3P09A 1I2WA 2Y91A 4IVIA 1YLYA 1K6SA 5FQMA 5I94A 2Y59A 3IF6A 3MZFA 3PBOA 3Q82A 4JBFA 4N1XA 5EOEA 1GHPA 4X55A 1OMEA 4JF4A 5IHVA 4A5RA 4Y0UA 4LCLA 4BL3A 4OONA 1IKGA 2WAEA 5FQIA 3BEBA 1SCWA 1XGJA 4OP8A 4XXRA 2Y2KA 2ZM2A 4X68A 4KZ6A 3VP3A 3GRJA 4UA6A 4WELA 4UAAA 4BL2A 5GHZA 1WYCA 2QMIA 1LL5A 4LENA 1IELA 3ZCZA 5KSCA 4PM9A 1NY0A 4FH2A 3UPPA 1PWGA 3EQVA 4KZ9A 1NRFA 3W4OA 2C6WB 3MKEA 2EX6A 4M3KA 4S2NA 3ZG9B 4JF5A 1GHMA 1BTLA 2X02A 4OOYA 4EWFA 3VSLA 4R1GA 1IEMA 3WWXA 2JE5A 2ZQAA 3OPRA 1EI5A 3CMZA 4JXVA 4OP5A 2DCFA 1AXBA 3NI9A 3BFCA 1SHVA 1N4OA 3IXGA 4BQMA 4ZJ3A 5CEDA 3LO7A 5HL1A 3C4OA 3TOIA 2XH9A 3HLDA 2IWBA 2Y2IA 3S22A 4EQIA 1SDEA 4KZ5A 3V3SA 5AQAA 1KDWA 3HLEA 3CZDA 3G2YA 1LHYA 4ZBEA 5FASA 4DXBA 2C5WB 1HTZA 3N6IA 1FCMA 1ONGA 1O7EA 1XP4A 4H8RA 4OQGA 4OPZA 2WKHA 2RL3A 2H10A 1ZG4A 4O7DA 3M6BA 3FKWA 3JYIA 4GDBA 1IYSA 3MFDA 1K25A 2G2WA 4K91A 4RYEA 1GA9A 1O07A 4HBTA 5CHUA 5EVIA 5GLBA 3UE3A 2V2FF 1KGEA 5FQQA 4WZ5A 2ZQ8A 4OPQA 5AQ9A 3ZG5A 2P9VB 3C5AA 1FQGA 1M6KA 1MKIA 3BYDA 2EFXA 4S2PA 2PU2A 3N4IA 5EE8A 4BD1A 4FD8A 4N1HA 4EBNA 4WEKA 3ZGAB 5CXWA 5CTNA 1NYYA 5HW3A 3IWIA 3G4PA 3WS2A 1CEFA 3WRZA 3NC8A 1IYQA 1PW1A 2JBFA 2XQZA 4KZ7A 5CGSA 3G31A 1EWZA 3GQZA 4DE3A 1FR1A 4B4ZA 2R9XA 2R9WA 1KE3A 1M40A 1JTGA 5HX9A 2EFUA 3IXDA 3WS5A 3V3RA 2EX9A 3TSGA 3NDGA 3D4FA 1DJBA 1L0EA 1LI0A 3BECA 3M6HA 3UY6A 2X01A 3GV9A 4PM7A 1E4DA 3C4PA 4EV4A 3ZVTA 5CRFA 3HUMA 3ZFZA 1HZOA 4E3MA 4WBGA 3Q81A 1K6RA 3G32A 3BM6A 3FZCA 5FI6A 4OOLA 2XFSA 4WYYA 3E2KA 4X6TA 3SH9A 4MEZA 3UDXA 3VOZA 4OLGA 4Y7PA 4R4SA 5FI2A 1YT4A 2FFYA 1VM1A 4YINA 1PI5A 2Z2LB 3C7UA 3PBRA 4RVAA 3ITAA 1YLTA 4L0LA 3VSKA 3Q7VA 3OC2A 1CEGA 3ZNYA 1KGGA 2J7VA 1MWTA 1JWPA 5GHYA 4KQQA 3IH8A 4D2OA 3HLWA 1JTDA 3SS4A 1TDGA 1PZPA 2Y2QA 4GKUA 3PBTA 3SS5A 2H5SA 4YFMA 1ES2A 3IF5A 1XGIA 3IQAA 5CERA 4C6YA 3G35A 5TFQA 2XK1A 4HBUA 1DJAA 4FCFA 3O86A 3S1YA 1XX2A 4JKTA 3RXXA 3TG9A 1W79A 3DWZA 1E3UD 3HUOA 1K56D 1XA1A 4WM9A 4RA7A 1L0FA 1S6RA 2ZC4B 1BZAA 1SDNA 3HBRA 1MPLA 1IYPA 2DNSA 2EX2A 4CPKA 2ZM8A 4OQHA 5HAQA 3QNBA 3IF6B 4XUXA 1NYMA 3V5MA 5CTMA 1JWVA 4LV1A 5DTKA 3AGEA 1YLZA 4ZJ1A 4ZJ2A 3LEZA 1TVFA 3NCKA 3FKVA 1YM1A 3IWQA 3GVBA 4QB8A 2EX8A 4F94A 1HD8A 2Y2OA 3O87A 4R4RA 3UPNA 2XDMA 1ZG6A 3G30A 3Q07A 1PI4A 2HP6A 4LV0A 3RJUA 3WS4A 4EBPA 4GD8A 1C3BA 4N9KA 1YMSA 2BLSA 4E3IA 4WMCD 3VFHA 3ZVWA 4KZBA 5FQJA 2Y2PA 4P87A 3ZG7B 5L2FA 1Q2QA 1H8YA 1TEMA 5TGFA 2Q9MA 3V50A 2XD5A 5F1FA 1LI9A 3ISGA 4IBXA 5DVAA 3VMAA 2J8YA 1BUEA 3W8KA 3BFDA 1YLPA 4GNUA 4E6WA 4IEDA 3UE1A 3BFEA 3GTCA 2WGWA 4S2LA 3HREA 1TDLA 2XF3A 2HDUA 3ITBA 2PBYA 3MXRA 5DF8A 3PAEA 5M18A 1RGYA 4Y0TA 1ERQA 2OLUA 1K4FA 3Q7ZA 3IXBA 1KE0A 1BULA 4UA7A 1PZOA 1KE4A 2ZLYA 4IVKA 5CGXA 3VP1A 3GSGA 3EQUA 4R3BA 5CHJA 1KGFA 4LV3A 3QHYA 2Y55A 3HLFA 1H8ZA 3PTEA 1MBLA 1JVJA 4OOMA 5EVIB 4PM5A 2X71A 3N7WA 3OCNA 3W4PA 2Y2NA 4R3JA 3HLGA 2ZD8A 4MLLA 4UA9A 4ZTKA 4QY5A 5FAQA 4DE1A 1XKZA 1MXOA 4Y0OA 3PAGA 2XEPA 1WYBA 2VGJA 3PBQA 4R0QA 4JPMA 1BLHA 1N9BA 1E3UA 2XR0A 5F83A 1K56A 4E3OA 5J8XA 4GOGA 2B5RA 2WGIA 3M2KA 4RX2A 3ZHHA 4K0XA 5CGWA 4E3LA 1Y54A 5M19A 2ZQCA 2ZQ7A 4ID4A 2HPBA 1Q2PA 4X56A 1Z6FA 3MBZA 5HAIA 2ZQDA 2HP5A 1HVBA 1L0GA 5FATA 5HFOA 2ZC5B 4PMAA 4X69A 5JYOA 4R23A 4DDYA 4E6XA 1L2SA 1NJ4A 3HLCA 4JXWA 4U3TA 4GDNA 3ZDJA 2XLNA 5A90A 1BLSA 4KZ3A 4WEJA 2WUQA 5FSRA 1NXYA 1K38A 1RP5A 2DRWA 4JXGA 2Y2HA 1FCOA 4JXSA 4K0WA 1EROA 3DWKA 4KZ8A 5F82A 5FI7A 3ZNTA 4E3NA 3CG5A 2V20A 1K57C 1QMFA 2FFFB 4BLMA 3BFFA 2JCHA 1ES4A 2WGVA 4MBHA 4S2IA 4Q8IA 1NZOA 4QJGA 4WMCA 5FA7A 4JF6A 1RCJA 2J9PA 3BLSA 2OSUA 4DRTA 5FDHA 1H5XA 4BENA 3FYZA 4OPRA 3ZG0A 1BLCA 4GZBA 2HP9A 4MNRA 4OQIA 1FCNA 2ZM0A 4ZAMA 3S4XA 1ES5A 3NDEA 4OPYA 4RX3A 2OLVA 1ALQA 2WKEA 1W7FA 4BJPA 3E2LA 4DF6A 4UHUA 4KG5A 4FH4A 1ESIA 3M2JA 2WK0A 3PBNA 4S2KA 3Q7VB 5E43A 4U0XA 4GN2A 2VGKA 4MBKA 4OH0A 3A3FA 2CC1A 2V1ZA 4DXCA 3PBSA 5JYPA 1K55C 3UO9A 3LCEA 3UE0A 4HEFA 4P85A 5DTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E3K A;  2ZC6 B;  1KDS A;  1GA0 A;  1JWZ A;  1E25 A;  3N8R A;  4QD4 A;  4BD0 A;  5EPH A;  3Q1F A;  2Y2J A;  4QHC A;  3CJM A;  1FOF A;  5EVL A;  2ZMA A;  3IT9 A;  4LCM A;  4S2J A;  5EOO A;  3WRT A;  3UPO A;  2I72 A;  3N8L A;  1PIO A;  2ZC7 A;  5FQ9 A;  3V39 A;  1G68 A;  2WZX A;  3OPP A;  3OCL A;  4QU3 A;  1J9M A;  4HES A;  5GLC A;  1FSY A;  4NK3 A;  3BFG A;  3HUN A;  3QNC A;  4OKP A;  5GL9 A;  4DE2 A;  5BOH A;  1YLJ A;  4QY6 A;  1QME A;  2Y4A A;  1W8Y A;  3SH8 A;  5KMW A;  1XXM A;  1RGZ A;  5TR7 A;  1NZU A;  3FV7 A;  3LY3 A;  4PM6 A;  1YLW A;  1PWD A;  4X53 A;  5EEC A;  5KSH A;  3LY4 A;  4EUZ A;  2G2U A;  1LLB A;  1SKF A;  5HAP A;  4XUZ A;  1K57 A;  1K54 C;  3SS3 A;  3NIA A;  4WZ4 A;  3C7V A;  3SOI A;  3DW0 A;  3IWO A;  2EXA A;  4P6B A;  4KZ4 A;  4C75 A;  4E3J A;  2Q9N A;  3A3I A;  1PYY A;  3MZE A;  4P0M A;  5M1A A;  4ZDX A;  2H0Y A;  3IXH A;  1KVM A;  4KQR A;  1L0D A;  2WYX A;  4C3Q A;  4KEN B;  1PW8 A;  2A49 A;  2OV5 A;  4OVD A;  1I5Q A;  3G2Z A;  3MZD A;  4OLD A;  3VP4 A;  3HLB A;  5A92 A;  1VQQ A;  2WGW B;  3MKF A;  2XD1 A;  3G34 A;  4LV2 A;  2IWD A;  2WKI A;  3UDI A;  3P98 A;  5HAR A;  2ZJ9 A;  2QZ6 A;  3VFF A;  5E2F A;  2ZQ9 A;  4KG6 A;  3BRM A;  4S2M A;  2HDS A;  5U47 A;  4N92 A;  3FWL A;  5FAO A;  2P9V A;  4PPR A;  2XGN A;  4U0T A;  5DTT A;  5A93 A;  1IYO A;  3MXS A;  3ZG8 B;  3AGD A;  5E2G A;  5FAP A;  1ERM A;  1K55 A;  2Y2L A;  3WS0 A;  5AQ7 A;  3DTM A;  4CJN A;  3IF6 C;  4Z9Q A;  3VP2 A;  1GHI A;  1CK3 A;  4B4X A;  1LL9 A;  5DF7 A;  1W8Q A;  2JC7 A;  2UWX A;  4KG2 A;  1ESU A;  5D3O A;  3O88 A;  1ES3 A;  2P74 A;  2WAD A;  2Y2G A;  5G18 A;  2ZC3 B;  4JLF A;  3I7J A;  3HVF A;  4GB7 A;  1ZKJ A;  2HDR A;  4S2O A;  4PM8 A;  1PWC A;  5CHM A;  1MWU A;  4N9L A;  1YMX A;  3RXW A;  3BLM A;  1BSG A;  4GD6 A;  2XFT A;  5E2H A;  4MBF A;  5E2E A;  1ZC2 A;  2RCX A;  1DJC A;  4S2N C;  1WE4 A;  1MWR A;  4B88 A;  2BG1 A;  1MY8 A;  1U60 A;  1MWS A;  3IHB A;  4DE0 A;  1G6A A;  1YQS A;  5GLD A;  1FR6 A;  3NY4 A;  1ONH A;  2J9O A;  1KVL A;  3O3V A;  2A3U A;  3UDF A;  1K54 A;  2IWC A;  3IH9 A;  5DF9 A;  2Z2M B;  1BLP A;  1BT5 A;  3GMW A;  1I2S A;  2EXB A;  3VOY A;  2HDQ A;  3OZH A;  5GLA A;  1XA7 A;  3OPL A;  2WZZ A;  2E8I A;  2WAF A;  2Y2M A;  2PU4 A;  3W4Q A;  3UN7 A;  5CEB A;  3B3X A;  1W5D A;  5FQK A;  4KQO A;  3IHA A;  4FSF A;  5EVI D;  1FSW A;  3VP0 A;  5CEC A;  1K4E A;  1S0W A;  1XPB A;  1IKI A;  4NET A;  5A91 A;  4IBR A;  3N8S A;  5F1G A;  3HL9 A;  5EVI C;  5KZH A;  2GDN A;  1CI9 A;  4OQ0 A;  3WS1 A;  3A3E A;  4WZ5 C;  1CI8 A;  3AGF A;  2QPN A;  3UNW A;  1DY6 A;  3A3D A;  5AQB A;  3GR2 A;  5EUA A;  5GHX A;  4EBL A;  3A3J A;  3NBL A;  3OPH A;  3SH7 A;  4DDS A;  4DKI A;  4KZA A;  2H0T A;  1GCE A;  3P09 A;  1I2W A;  2Y91 A;  4IVI A;  1YLY A;  1K6S A;  5FQM A;  5I94 A;  2Y59 A;  3IF6 A;  3MZF A;  3PBO A;  3Q82 A;  4JBF A;  4N1X A;  5EOE A;  1GHP A;  4X55 A;  1OME A;  4JF4 A;  5IHV A;  4A5R A;  4Y0U A;  4LCL A;  4BL3 A;  4OON A;  1IKG A;  2WAE A;  5FQI A;  3BEB A;  1SCW A;  1XGJ A;  4OP8 A;  4XXR A;  2Y2K A;  2ZM2 A;  4X68 A;  4KZ6 A;  3VP3 A;  3GRJ A;  4UA6 A;  4WEL A;  4UAA A;  4BL2 A;  5GHZ A;  1WYC A;  2QMI A;  1LL5 A;  4LEN A;  1IEL A;  3ZCZ A;  5KSC A;  4PM9 A;  1NY0 A;  4FH2 A;  3UPP A;  1PWG A;  3EQV A;  4KZ9 A;  1NRF A;  3W4O A;  2C6W B;  3MKE A;  2EX6 A;  4M3K A;  4S2N A;  3ZG9 B;  4JF5 A;  1GHM A;  1BTL A;  2X02 A;  4OOY A;  4EWF A;  3VSL A;  4R1G A;  1IEM A;  3WWX A;  2JE5 A;  2ZQA A;  3OPR A;  1EI5 A;  3CMZ A;  4JXV A;  4OP5 A;  2DCF A;  1AXB A;  3NI9 A;  3BFC A;  1SHV A;  1N4O A;  3IXG A;  4BQM A;  4ZJ3 A;  5CED A;  3LO7 A;  5HL1 A;  3C4O A;  3TOI A;  2XH9 A;  3HLD A;  2IWB A;  2Y2I A;  3S22 A;  4EQI A;  1SDE A;  4KZ5 A;  3V3S A;  5AQA A;  1KDW A;  3HLE A;  3CZD A;  3G2Y A;  1LHY A;  4ZBE A;  5FAS A;  4DXB A;  2C5W B;  1HTZ A;  3N6I A;  1FCM A;  1ONG A;  1O7E A;  1XP4 A;  4H8R A;  4OQG A;  4OPZ A;  2WKH A;  2RL3 A;  2H10 A;  1ZG4 A;  4O7D A;  3M6B A;  3FKW A;  3JYI A;  4GDB A;  1IYS A;  3MFD A;  1K25 A;  2G2W A;  4K91 A;  4RYE A;  1GA9 A;  1O07 A;  4HBT A;  5CHU A;  5EVI A;  5GLB A;  3UE3 A;  2V2F F;  1KGE A;  5FQQ A;  4WZ5 A;  2ZQ8 A;  4OPQ A;  5AQ9 A;  3ZG5 A;  2P9V B;  3C5A A;  1FQG A;  1M6K A;  1MKI A;  3BYD A;  2EFX A;  4S2P A;  2PU2 A;  3N4I A;  5EE8 A;  4BD1 A;  4FD8 A;  4N1H A;  4EBN A;  4WEK A;  3ZGA B;  5CXW A;  5CTN A;  1NYY A;  5HW3 A;  3IWI A;  3G4P A;  3WS2 A;  1CEF A;  3WRZ A;  3NC8 A;  1IYQ A;  1PW1 A;  2JBF A;  2XQZ A;  4KZ7 A;  5CGS A;  3G31 A;  1EWZ A;  3GQZ A;  4DE3 A;  1FR1 A;  4B4Z A;  2R9X A;  2R9W A;  1KE3 A;  1M40 A;  1JTG A;  5HX9 A;  2EFU A;  3IXD A;  3WS5 A;  3V3R A;  2EX9 A;  3TSG A;  3NDG A;  3D4F A;  1DJB A;  1L0E A;  1LI0 A;  3BEC A;  3M6H A;  3UY6 A;  2X01 A;  3GV9 A;  4PM7 A;  1E4D A;  3C4P A;  4EV4 A;  3ZVT A;  5CRF A;  3HUM A;  3ZFZ A;  1HZO A;  4E3M A;  4WBG A;  3Q81 A;  1K6R A;  3G32 A;  3BM6 A;  3FZC A;  5FI6 A;  4OOL A;  2XFS A;  4WYY A;  3E2K A;  4X6T A;  3SH9 A;  4MEZ A;  3UDX A;  3VOZ A;  4OLG A;  4Y7P A;  4R4S A;  5FI2 A;  1YT4 A;  2FFY A;  1VM1 A;  4YIN A;  1PI5 A;  2Z2L B;  3C7U A;  3PBR A;  4RVA A;  3ITA A;  1YLT A;  4L0L A;  3VSK A;  3Q7V A;  3OC2 A;  1CEG A;  3ZNY A;  1KGG A;  2J7V A;  1MWT A;  1JWP A;  5GHY A;  4KQQ A;  3IH8 A;  4D2O A;  3HLW A;  1JTD A;  3SS4 A;  1TDG A;  1PZP A;  2Y2Q A;  4GKU A;  3PBT A;  3SS5 A;  2H5S A;  4YFM A;  1ES2 A;  3IF5 A;  1XGI A;  3IQA A;  5CER A;  4C6Y A;  3G35 A;  5TFQ A;  2XK1 A;  4HBU A;  1DJA A;  4FCF A;  3O86 A;  3S1Y A;  1XX2 A;  4JKT A;  3RXX A;  3TG9 A;  1W79 A;  3DWZ A;  1E3U D;  3HUO A;  1K56 D;  1XA1 A;  4WM9 A;  4RA7 A;  1L0F A;  1S6R A;  2ZC4 B;  1BZA A;  1SDN A;  3HBR A;  1MPL A;  1IYP A;  2DNS A;  2EX2 A;  4CPK A;  2ZM8 A;  4OQH A;  5HAQ A;  3QNB A;  3IF6 B;  4XUX A;  1NYM A;  3V5M A;  5CTM A;  1JWV A;  4LV1 A;  5DTK A;  3AGE A;  1YLZ A;  4ZJ1 A;  4ZJ2 A;  3LEZ A;  1TVF A;  3NCK A;  3FKV A;  1YM1 A;  3IWQ A;  3GVB A;  4QB8 A;  2EX8 A;  4F94 A;  1HD8 A;  2Y2O A;  3O87 A;  4R4R A;  3UPN A;  2XDM A;  1ZG6 A;  3G30 A;  3Q07 A;  1PI4 A;  2HP6 A;  4LV0 A;  3RJU A;  3WS4 A;  4EBP A;  4GD8 A;  1C3B A;  4N9K A;  1YMS A;  2BLS A;  4E3I A;  4WMC D;  3VFH A;  3ZVW A;  4KZB A;  5FQJ A;  2Y2P A;  4P87 A;  3ZG7 B;  5L2F A;  1Q2Q A;  1H8Y A;  1TEM A;  5TGF A;  2Q9M A;  3V50 A;  2XD5 A;  5F1F A;  1LI9 A;  3ISG A;  4IBX A;  5DVA A;  3VMA A;  2J8Y A;  1BUE A;  3W8K A;  3BFD A;  1YLP A;  4GNU A;  4E6W A;  4IED A;  3UE1 A;  3BFE A;  3GTC A;  2WGW A;  4S2L A;  3HRE A;  1TDL A;  2XF3 A;  2HDU A;  3ITB A;  2PBY A;  3MXR A;  5DF8 A;  3PAE A;  5M18 A;  1RGY A;  4Y0T A;  1ERQ A;  2OLU A;  1K4F A;  3Q7Z A;  3IXB A;  1KE0 A;  1BUL A;  4UA7 A;  1PZO A;  1KE4 A;  2ZLY A;  4IVK A;  5CGX A;  3VP1 A;  3GSG A;  3EQU A;  4R3B A;  5CHJ A;  1KGF A;  4LV3 A;  3QHY A;  2Y55 A;  3HLF A;  1H8Z A;  3PTE A;  1MBL A;  1JVJ A;  4OOM A;  5EVI B;  4PM5 A;  2X71 A;  3N7W A;  3OCN A;  3W4P A;  2Y2N A;  4R3J A;  3HLG A;  2ZD8 A;  4MLL A;  4UA9 A;  4ZTK A;  4QY5 A;  5FAQ A;  4DE1 A;  1XKZ A;  1MXO A;  4Y0O A;  3PAG A;  2XEP A;  1WYB A;  2VGJ A;  3PBQ A;  4R0Q A;  4JPM A;  1BLH A;  1N9B A;  1E3U A;  2XR0 A;  5F83 A;  1K56 A;  4E3O A;  5J8X A;  4GOG A;  2B5R A;  2WGI A;  3M2K A;  4RX2 A;  3ZHH A;  4K0X A;  5CGW A;  4E3L A;  1Y54 A;  5M19 A;  2ZQC A;  2ZQ7 A;  4ID4 A;  2HPB A;  1Q2P A;  4X56 A;  1Z6F A;  3MBZ A;  5HAI A;  2ZQD A;  2HP5 A;  1HVB A;  1L0G A;  5FAT A;  5HFO A;  2ZC5 B;  4PMA A;  4X69 A;  5JYO A;  4R23 A;  4DDY A;  4E6X A;  1L2S A;  1NJ4 A;  3HLC A;  4JXW A;  4U3T A;  4GDN A;  3ZDJ A;  2XLN A;  5A90 A;  1BLS A;  4KZ3 A;  4WEJ A;  2WUQ A;  5FSR A;  1NXY A;  1K38 A;  1RP5 A;  2DRW A;  4JXG A;  2Y2H A;  1FCO A;  4JXS A;  4K0W A;  1ERO A;  3DWK A;  4KZ8 A;  5F82 A;  5FI7 A;  3ZNT A;  4E3N A;  3CG5 A;  2V20 A;  1K57 C;  1QMF A;  2FFF B;  4BLM A;  3BFF A;  2JCH A;  1ES4 A;  2WGV A;  4MBH A;  4S2I A;  4Q8I A;  1NZO A;  4QJG A;  4WMC A;  5FA7 A;  4JF6 A;  1RCJ A;  2J9P A;  3BLS A;  2OSU A;  4DRT A;  5FDH A;  1H5X A;  4BEN A;  3FYZ A;  4OPR A;  3ZG0 A;  1BLC A;  4GZB A;  2HP9 A;  4MNR A;  4OQI A;  1FCN A;  2ZM0 A;  4ZAM A;  3S4X A;  1ES5 A;  3NDE A;  4OPY A;  4RX3 A;  2OLV A;  1ALQ A;  2WKE A;  1W7F A;  4BJP A;  3E2L A;  4DF6 A;  4UHU A;  4KG5 A;  4FH4 A;  1ESI A;  3M2J A;  2WK0 A;  3PBN A;  4S2K A;  3Q7V B;  5E43 A;  4U0X A;  4GN2 A;  2VGK A;  4MBK A;  4OH0 A;  3A3F A;  2CC1 A;  2V1Z A;  4DXC A;  3PBS A;  5JYP A;  1K55 C;  3UO9 A;  3LCE A;  3UE0 A;  4HEF A;  4P85 A;  5DTS A; 
#chains in the Genus database with same CATH topology
 2OAQ 1;  1GA0 A;  1E25 A;  4BD0 A;  3Q1F A;  4S2J A;  3IT9 A;  3WRT A;  3CI6 A;  1S1Z A;  1OJ5 A;  5FQ9 A;  1ZHH B;  5EM0 A;  4HES A;  1FSY A;  3BFG A;  3HUN A;  5GL9 A;  4BBT A;  1K0K A;  2B02 A;  2IA2 A;  5KMW A;  1RGZ A;  1TS7 A;  1NZU A;  3L7H A;  5J3W A;  1YLW A;  1PWD A;  3LY4 A;  1SKF A;  2VEA A;  1K57 A;  5HPF A;  4WZ4 A;  3ZQ5 A;  4Y13 A;  3PR6 A;  4ZDX A;  4P0M A;  3BW6 A;  2Z6C A;  3E4P A;  1L0D A;  2OV5 A;  1I5Q A;  3C8C A;  1OTD A;  3HLB A;  1X0O A;  2J3W A;  2IWD A;  2ZBB A;  3LR4 A;  4MN6 A;  5E2F A;  2ZQ9 A;  2V1A A;  1XJ3 A;  3TJZ C;  4N92 A;  1A0K A;  5DTT A;  1IYO A;  3MXS A;  4I3A A;  1IFQ A;  2PD8 A;  5E2G A;  1K55 A;  3WS0 A;  3T4Q A;  2UWX A;  2A24 B;  4KG2 A;  5D3O A;  3T1X A;  4IUK A;  2WAD A;  4JLF A;  2HDR A;  3EGD C;  2PYP A;  5CHM A;  1D7E A;  1MWU A;  4NXG A;  3RXW A;  3L9K A;  4ZRR A;  3NOU C;  2BG1 A;  1MY8 A;  1LL8 A;  3IHB A;  1G6A A;  5A8B A;  5GLD A;  1V9Y A;  4DJ3 A;  3IH9 A;  3DTK A;  1BLP A;  3GMW A;  4MDZ A;  3OPL A;  2VV7 A;  5CEB A;  3B3X A;  5FQK A;  4KQO A;  4FSF A;  5CEC A;  4IBR A;  5EVI C;  5DJU A;  5KZH A;  2GDN A;  3WS1 A;  4FTX A;  3AGF A;  5AQB A;  3NBL A;  4II7 A;  4DDS A;  3DAV A;  1Y4O A;  4KZA A;  1GCE A;  4DJ2 A;  4N1X A;  3PBO A;  4Y0U A;  4LCL A;  4OON A;  1Y28 A;  3NJA A;  3MSH A;  3VP3 A;  4UAA A;  4LEN A;  1IEL A;  3ZCZ A;  2V1B A;  3LUQ A;  2DMW A;  4KZ9 A;  3W4O A;  3ZG9 B;  3FG8 A;  3VSL A;  3T1R A;  2H28 A;  3NOP C;  4R38 A;  3NI9 A;  5HL1 A;  3IXG A;  5CED A;  3H7W A;  2XH9 A;  2IWB A;  2Y2I A;  3IX3 A;  4KZ5 A;  1LHY A;  4DXB A;  3EEH A;  3LEQ A;  1ONG A;  2RL3 A;  3FKW A;  3JYI A;  2D01 A;  4RYE A;  5EVI A;  2V8F A;  1KGE A;  4ME4 A;  5AQ9 A;  3F1O B;  1FQG A;  1M6K A;  3T1Q B;  1V9Z A;  3T4S A;  5CXW A;  3IWI A;  5HL6 A;  4KZ7 A;  4DE3 A;  3EGX C;  2R9W A;  5HX9 A;  4HP4 A;  3IXD A;  3BY8 A;  1S4S A;  3UY6 A;  3R4K A;  3NEC A;  4PM7 A;  3C4P A;  3ZVT A;  5CRF A;  1HZO A;  4WBG A;  2QKP A;  1J3W A;  3IS2 B;  4X6T A;  3HJI A;  3VOZ A;  3UDX A;  5FI2 A;  1YT4 A;  1VM1 A;  1SZV A;  3ITA A;  3Q7V A;  1XFN A;  2J7V A;  1JWP A;  5GHY A;  4KQQ A;  4Y3I A;  3HLW A;  1PZP A;  2Y2Q A;  2W0N A;  3SS5 A;  3H9W A;  1ES2 A;  3IF5 A;  3IQA A;  1IOU A;  1DJA A;  3O86 A;  3S1Y A;  3TG9 A;  5EM1 A;  1W79 A;  3T4O A;  1K56 D;  1Z09 A;  2L1M A;  2DNS A;  2ZM8 A;  5HAQ A;  1NYM A;  3FPV A;  2FZ0 A;  3V5M A;  2VLG A;  5CTM A;  1DRM A;  5TJJ A;  3LEZ A;  3NCK A;  3KO6 A;  5HSQ A;  1YM1 A;  3IWQ A;  4MMN A;  2EX8 A;  2PBD P;  1HD8 A;  3O87 A;  3T1S A;  4R4R A;  3JVU A;  5AJG A;  2QWS A;  3Q07 A;  3RJU A;  3WS4 A;  1C3B A;  4E3I A;  3B33 A;  4WMC D;  3C2W A;  4E04 A;  1H3Q A;  1Q2Q A;  3V50 A;  2XD5 A;  1LI9 A;  3ISG A;  2OWH A;  4NXF A;  1YLP A;  2JKF A;  3H7W B;  5HWV A;  4S2L A;  5DFX A;  4R70 A;  3ITB A;  1AWI A;  1W63 Q;  2WKP A;  2OLU A;  4LRZ E;  1F98 A;  3QP2 A;  1KE0 A;  1PZO A;  2ZLY A;  3GSG A;  2JN7 A;  4LV3 A;  3QHY A;  2Y55 A;  2JKR I;  5EVI B;  4HH2 A;  5FAQ A;  2W3H A;  3PAG A;  2XEP A;  4JPM A;  4LLO B;  5J8X A;  4E3O A;  4GOG A;  2B5R A;  1YSP A;  1YAX A;  4E3L A;  5M19 A;  4WF0 A;  1Q2P A;  1Z6F A;  3UB8 A;  1HVB A;  5FAT A;  4PMA A;  1NJ4 A;  4U3T A;  5HWW A;  1JNU A;  3MS6 A;  5A90 A;  4KZ3 A;  5FSR A;  2XRN A;  4WEK A;  4JXS A;  1FCO A;  3DWK A;  4I3J A;  5EV0 A;  3BFF A;  2JCH A;  2W3D A;  4MBH A;  1BYW A;  2OSU A;  4DRT A;  4BEN A;  3FYZ A;  1FCN A;  4ZAM A;  2OAP 1;  4OPY A;  4EEU A;  2OLV A;  4HY8 A;  2WKE A;  4BJP A;  4DF6 A;  2I9V A;  3CPT A;  1NRJ A;  2WK0 A;  2W27 A;  3Q7V B;  2XA7 M;  5E43 A;  3TRC A;  2CC1 A;  4DXC A;  3PBS A;  1T1B A;  3UE0 A;  4HEF A;  3QP1 A;  3F1P A;  1KDS A;  1JWZ A;  1GSV A;  3MJQ A;  3IBR A;  4QHC A;  1L3L A;  2I72 A;  3HJK A;  2WZX A;  3OCL A;  1J9M A;  4NK3 A;  3QNC A;  2JKT M;  3PHY A;  1F9I A;  1QME A;  2Y4A A;  3R7W A;  3JVV A;  1XXM A;  5TR7 A;  3LY3 A;  3FV7 A;  4PM6 A;  4WUJ A;  5HAP A;  4XUZ A;  3SS3 A;  3NIA A;  1T1A A;  3NHQ A;  3C7V A;  5KIZ A;  4P6B A;  4KZ4 A;  3UE6 A;  4C75 A;  1PYY A;  5M1A A;  2H0Y A;  3IXH A;  1KVM A;  4GS9 A;  4KEN B;  1PW8 A;  1LT0 A;  3IX8 A;  3MZD A;  4OLD A;  5A92 A;  4NXB A;  1VQQ A;  4LV2 A;  2XD1 A;  2MJ6 A;  3UDI A;  4HHD A;  2QZ6 A;  3LYX A;  3VFF A;  2HDS A;  2K31 A;  3EEA A;  2P9V A;  2V0W A;  3ZG8 B;  3AGD A;  3E0Y A;  5AQ7 A;  4CJN A;  4Z9Q A;  3LI8 A;  5L10 A;  3NOT C;  5FL3 A;  4B4X A;  2Z6D A;  1ESU A;  5G18 A;  2NUT C;  3KYE A;  4GB7 A;  3D72 A;  2XFT A;  4MBF A;  1G5U A;  1DJC A;  1WE4 A;  3CUE C;  4DE0 A;  1YQS A;  3NY4 A;  3UDF A;  3FPW A;  1BT5 A;  1I2S A;  2HDQ A;  1XA7 A;  1N9O A;  1W5D A;  3G6O A;  3QP4 A;  4NET A;  1PRQ A;  5F1G A;  3HL9 A;  1CI9 A;  3A3E A;  4WN5 A;  1DP8 A;  3CPT B;  3UNW A;  4NKP A;  4G3W A;  4LFU A;  2V0U A;  3SH7 A;  4DKI A;  1STZ A;  2H0T A;  4HP9 A;  2LB9 A;  1W63 M;  4Y15 A;  4B93 A;  5FQM A;  3MZF A;  5EOE A;  4X55 A;  1OME A;  4JF4 A;  5IHV A;  3F1P B;  5G4Z A;  3BQA A;  1XGJ A;  3MXQ A;  4X68 A;  4KZ6 A;  2P04 A;  3GRJ A;  4UA6 A;  4WEL A;  4BL2 A;  1LL5 A;  4FH2 A;  3UPP A;  1PWG A;  3E4Q A;  3MKE A;  3CUE A;  3R7W B;  4EWF A;  1IEM A;  3WWX A;  2VGL S;  5DKL A;  3CMZ A;  4I39 A;  4RQ9 A;  4M4X A;  3BFC A;  1SHV A;  4BQM A;  3LO7 A;  3C4O A;  3TOI A;  4F3L A;  3HLD A;  1KOU A;  1SDE A;  3ZYT A;  1HTZ A;  4GS9 B;  4H8R A;  1XP4 A;  4OQG A;  4P6Z M;  2ZMF A;  4O7D A;  5I5L A;  3MFX A;  4GDB A;  3F1O A;  4I5S A;  4HNB A;  2G2W A;  5CHU A;  1MZU A;  5GLB A;  3HCY A;  2QJ7 A;  3UE3 A;  4X1M A;  5FQQ A;  4GHI A;  1TS0 A;  1DP6 A;  2KDK A;  2P9V B;  3C5A A;  1MKI A;  3IBJ A;  2EFX A;  4BD1 A;  3N4I A;  4FD8 A;  2G7U A;  1DP9 A;  5CTN A;  4HJ6 A;  3WS2 A;  3VE3 A;  2O99 A;  1IYQ A;  3G31 A;  4B4Z A;  2W1T B;  1M40 A;  2EWW A;  3BEC A;  3IS2 A;  2X01 A;  4Y5F A;  1E4D A;  3B42 A;  3LFV A;  5LBR A;  4E3M A;  5EFW A;  3EOI A;  5L8M A;  4OOL A;  2PRF A;  2XFS A;  3E2K A;  3K2N A;  4MEZ A;  1WA9 A;  1LSV A;  3IX4 A;  4L0L A;  1TF1 A;  3OC2 A;  3ZNY A;  1KGG A;  4LGW A;  2HF6 A;  3CIT A;  1JTD A;  3K3D A;  3LGO A;  1XGI A;  3G35 A;  1XJ2 A;  4JKT A;  4NEE D;  1E3U D;  3HUO A;  3ICY A;  2O9C A;  2D02 A;  1OTE A;  1IYP A;  2W3F A;  1PFL A;  1YLZ A;  2CMN A;  4MN5 A;  4X25 A;  4Q0I A;  1TVF A;  3GVB A;  1GSX A;  1N9N A;  3LID A;  4QPR A;  3S7N A;  2OWJ A;  4EBP A;  3KSF A;  4N9K A;  4YOF A;  4KZB A;  5FQJ A;  3ZG7 B;  2VJW A;  1XFQ A;  2Q9M A;  3QP5 A;  4L9E A;  3LIC A;  4BMW A;  3BFD A;  4GNU A;  3LI9 A;  3UE1 A;  3BFE A;  2W3E A;  1TDL A;  4F3L B;  3UME A;  4HJ3 A;  3PAE A;  1RGY A;  1TS6 A;  4EEP A;  3VP1 A;  1KE4 A;  1VHM A;  3EQU A;  4R3B A;  5CHJ A;  1H8Z A;  1MBL A;  1JVJ A;  4OOM A;  4PAU A;  1YKD A;  2ZD8 A;  4GHI B;  4MLL A;  4ZTK A;  4CLC E;  5HDS A;  1P0Z A;  4DE1 A;  3PBQ A;  2PAV P;  4GW9 A;  1N9B A;  2XR0 A;  1K56 A;  1MKM A;  4RX2 A;  1Y54 A;  3EWK A;  5IU1 A;  4O8G A;  4DDY A;  4JXW A;  3ZDJ A;  2XLN A;  2YKH A;  1K38 A;  4JXG A;  2Y2H A;  5FI7 A;  1ERO A;  1HLU P;  3ZNT A;  4E3N A;  1OTA A;  3C38 A;  3CG5 A;  1QMF A;  2FFF B;  4BLM A;  3CHW P;  4QJG A;  4WMC A;  5FA7 A;  1RCJ A;  3V67 A;  4UQI M;  1D06 A;  3SZT A;  2HGV A;  4OPR A;  2E8J A;  1BLC A;  4GZB A;  2HP9 A;  3S4X A;  1ES5 A;  1ALQ A;  3E2L A;  4UHU A;  5HZH A;  4U0X A;  5HWT A;  4MBK A;  2R78 A;  4OH0 A;  3MR0 A;  3A3F A;  2P08 A;  2QYB A;  3BWL A;  3S7Q A;  4EES A;  3N8R A;  3P7N A;  5EPH A;  3CJM A;  4LCM A;  5EOO A;  1PIO A;  4PKY A;  3KSG A;  3V39 A;  1G68 A;  5GLC A;  4QU3 A;  4OKP A;  3ULF A;  4DE2 A;  1YLJ A;  4QY6 A;  4X53 A;  5EEC A;  5KSH A;  4EUZ A;  1LLB A;  1T1C A;  2PYR A;  2YKF A;  1K54 C;  2HJ9 C;  2Y8H A;  3SOI A;  2PDR A;  3IWO A;  2EXA A;  4E3J A;  2Q9N A;  3A3I A;  3MZE A;  3F1N A;  3U2A A;  2A49 A;  1H0M A;  3G2Z A;  3VP4 A;  2KX6 A;  1VET A;  2WKI A;  5HAR A;  4BWI A;  5HDD A;  2M1C A;  3BRM A;  5U47 A;  3FWL A;  4U0T A;  5F5Y A;  5FEG A;  4CLC D;  1ERM A;  3TE8 A;  3DTM A;  3IF6 C;  1GHI A;  2GNX A;  4EU0 A;  1LL9 A;  1SKO A;  5DF7 A;  1W8Q A;  3OOV A;  3O88 A;  2P74 A;  3GDI A;  2OOL A;  3HVF A;  3MQ0 A;  1ZKJ A;  4S2O A;  4PM8 A;  1PWC A;  2XSS A;  3BLM A;  1BSG A;  1OJG A;  5E2H A;  5E2E A;  5L07 A;  3CLO A;  3LIB A;  4IJG A;  1MWR A;  1U60 A;  3DTI A;  4AFI A;  1FR6 A;  1ONH A;  3O3V A;  2A3U A;  1K54 A;  2IWC A;  5DF9 A;  2VV6 A;  4HI4 A;  2EXB A;  3OZH A;  2K2N A;  2VX8 A;  2WZZ A;  2WAF A;  2PU4 A;  2B18 A;  3IHA A;  1FSW A;  3CWF A;  3VP0 A;  1IKI A;  1YPR A;  4OQ0 A;  4R3A A;  3RTY A;  5J7E A;  1CI8 A;  4EBL A;  1DY6 A;  3GR2 A;  3OPH A;  4Q0H A;  4HOI A;  4G3V A;  1I2W A;  3OLO A;  4IVI A;  2KOI A;  5I94 A;  2Y59 A;  3IF6 A;  3Q82 A;  4JBF A;  5GLA A;  1OTB A;  4A5R A;  4BL3 A;  4FOF A;  2HJE A;  4KQD A;  4HQA A;  5FQI A;  3BEB A;  4OP8 A;  2ZM2 A;  1G6O A;  2GJ3 A;  1P9R A;  1WYC A;  4BBU A;  2QHK A;  4PM9 A;  3NUL A;  3UMD A;  2ZOI A;  1GHM A;  1F5M A;  1P9W A;  1BTL A;  4GCZ A;  3DBA A;  2JE5 A;  2ZQA A;  3QP8 A;  4JXV A;  4OP5 A;  1N4O A;  2VA0 A;  4ZJ3 A;  3LIE A;  3S22 A;  4EQI A;  4HIA A;  3V3S A;  3CZD A;  1FCM A;  4OPZ A;  3F1N B;  2WKH A;  2LB5 A;  2H10 A;  4R6L A;  4EW7 A;  3M6B A;  3MFD A;  4K91 A;  1GA9 A;  1O07 A;  5F6A A;  1VET B;  2V2F F;  2M7U A;  2JKG A;  4S2P A;  2PU2 A;  3LIA A;  2W1T A;  3KYQ A;  2INW A;  3ZGA B;  4EQ1 A;  4O0P A;  3G4P A;  1SKO B;  1CEF A;  1P97 A;  3WRZ A;  1OTI A;  2GX5 A;  1PW1 A;  2JBF A;  2XQZ A;  1EWZ A;  3GQZ A;  1NLZ A;  4BBV A;  2R9X A;  1OT9 A;  4EER A;  4JGP A;  4Q0J A;  1H8M A;  3WS5 A;  5F69 A;  3TSG A;  2O0Y A;  3D4F A;  1L0E A;  1LI0 A;  3GV9 A;  4EV4 A;  3HUM A;  3ZFZ A;  3H82 A;  1K6R A;  2QJ5 A;  3G32 A;  5FI6 A;  2JKR M;  3SH9 A;  4R4S A;  2FFY A;  3A0S A;  4KUK A;  1PI5 A;  3VV4 A;  3PBR A;  4QWO A;  4RVA A;  1UWN X;  1CEG A;  1MWT A;  5AVF A;  4D2O A;  1MC0 A;  1TDG A;  4KUO A;  5CX7 A;  1T19 A;  5CER A;  4C6Y A;  2XK1 A;  1XX2 A;  1XA1 A;  1L0F A;  1SDN A;  2EX2 A;  4CPK A;  4XUX A;  3IF6 B;  3KSI A;  4D60 A;  4ZJ1 A;  4XT2 A;  3FKV A;  5HD3 A;  2XDM A;  4HJ4 A;  3G30 A;  1PI4 A;  4LV0 A;  1XJ6 A;  2BLS A;  5HD5 A;  3VFH A;  1CF0 A;  4L9G A;  2Y2P A;  4P87 A;  5L2F A;  4O01 A;  5TGF A;  3VMA A;  5DVA A;  2PHY A;  2HZ5 A;  2ZL1 B;  4IED A;  4E6W A;  2WGW A;  2XF3 A;  2HDU A;  2J80 A;  3E98 A;  2PBY A;  3T50 A;  1NLY A;  1BUL A;  4UA7 A;  5CGX A;  5J4E A;  1KGF A;  3HLF A;  3PTE A;  1N9L A;  3A0R A;  4PM5 A;  2X71 A;  3W4P A;  4R3J A;  3HLG A;  4Y2F A;  4QY5 A;  1XKZ A;  1WYB A;  4R0Q A;  1T18 A;  1BLH A;  1E3U A;  2WGI A;  4NXE A;  2ZQC A;  2ZQ7 A;  2HPB A;  5HAI A;  1TS8 A;  1L0G A;  5HFO A;  5JYO A;  4X69 A;  4R23 A;  4E6X A;  3HLC A;  4GDN A;  5IT5 A;  1BLS A;  4WEJ A;  2WUQ A;  4K0W A;  4Y0O A;  2J3T D;  4MN7 A;  3PYP A;  4EET B;  4K08 A;  2WGV A;  4S2I A;  5FDS A;  2VK3 A;  3BLS A;  3H82 B;  5FDH A;  1H5X A;  2HV1 A;  4MNR A;  4OQI A;  2ZM0 A;  3MQO A;  4RX3 A;  3RH8 B;  5L09 A;  1W7F A;  4KG5 A;  4FH4 A;  1ESI A;  2XA7 S;  3O5Y A;  4GN2 A;  2VGK A;  5K5B A;  2V1Z A;  4IHQ A;  1VEU B;  5JYP A;  3UO9 A;  3LCE A;  3C30 A;  4P85 A;  5HDC A;  1CJF A;  4E3K A;  2ZC6 B;  4QD4 A;  3LR5 A;  2Y2J A;  5EVL A;  1FOF A;  2ZMA A;  3UPO A;  3N8L A;  2NUP C;  2ZC7 A;  3OPP A;  2V8C A;  1S67 L;  3T4K A;  1LSW A;  5BOH A;  3FC7 A;  1W8Y A;  3SH8 A;  4XT2 B;  4UEY A;  2G2U A;  1CQA A;  2M7V A;  1UGU A;  1FIK A;  3DW0 A;  3KX0 X;  4ARZ A;  3TW8 A;  2O9A A;  2PT7 A;  4KQR A;  2WYX A;  4C3Q A;  3BJN A;  2XRO A;  4OVD A;  3S7P A;  1YSQ A;  3W2Z A;  2WGW B;  3MKF A;  3G34 A;  3P98 A;  2ZJ9 A;  4KG6 A;  4S2M A;  2PD7 A;  5FAO A;  4PPR A;  2XGN A;  3SW1 A;  5A93 A;  5FAP A;  2Y2L A;  2JHE A;  3VP2 A;  1CK3 A;  4CLC C;  4HH3 A;  5TBM A;  5FEF A;  2V9A A;  2JC7 A;  3BQ8 A;  1ES3 A;  2Y2G A;  2ZC3 B;  3I7J A;  1NWZ A;  4ESP A;  4N9L A;  5DKK A;  1YMX A;  2VV8 A;  4GD6 A;  4LPZ A;  1ZC2 A;  3VOL A;  2RCX A;  2PR6 A;  4S2N C;  4B88 A;  1MWS A;  4JGR A;  2J9O A;  1KVL A;  5IS1 A;  2Z2M B;  2JKT I;  4CQH A;  3VOY A;  2E8I A;  1XJ4 A;  2Y2M A;  4H6J A;  3W4Q A;  3UN7 A;  3B47 A;  5EVI D;  3CAX A;  1K4E A;  2KLI A;  1S0W A;  2EA9 A;  1XPB A;  5A91 A;  2FH5 A;  3LIF A;  3N8S A;  4WZ5 C;  2QPN A;  5EUA A;  1G28 A;  3A3D A;  5GHX A;  4EXO A;  3A3J A;  5EVE A;  2ZOH A;  4IUH A;  3P09 A;  2Y91 A;  1YLY A;  1K6S A;  2B95 A;  2K7S A;  3BY9 A;  1GHP A;  4CLC A;  1S1Y A;  1IKG A;  2WAE A;  4YWZ A;  1SCW A;  4XXR A;  2Y2K A;  5GHZ A;  5DJT A;  2QMI A;  3D9Y A;  5KSC A;  1NY0 A;  2AVX A;  3UB6 A;  3EQV A;  5F68 A;  3LR0 A;  3MMH A;  1NRF A;  2C6W B;  2EX6 A;  4M3K A;  4PHT A;  4S2N A;  4JF5 A;  2X02 A;  4OOY A;  4WLA A;  4R1G A;  1VB6 A;  3OPR A;  1EI5 A;  2VGL M;  4FUW A;  2DCF A;  1AXB A;  4ARZ B;  4B9O A;  5AQA A;  1KDW A;  1GSW A;  3HLE A;  3G2Y A;  4PKY G;  4ZBE A;  5FAS A;  5MC7 A;  2C5W B;  3N6I A;  4P6Z S;  1O7E A;  1ZG4 A;  4G3K A;  1IYS A;  1K25 A;  4HBT A;  4JGO A;  2L0W A;  2VZW A;  4WZ5 A;  3VE4 A;  2ZQ8 A;  4OPQ A;  4GJ4 A;  3K3C A;  3P01 A;  3ZG5 A;  3MF0 A;  3BYD A;  3T4T A;  5EE8 A;  4N1H A;  4EBN A;  1OPX A;  4DMZ A;  1NYY A;  3PXP A;  5TBM B;  5HW3 A;  2W3G A;  4JGQ A;  3LR3 A;  2A2L A;  3NC8 A;  2O9B A;  5CGS A;  1FR1 A;  2Q0O A;  1KE3 A;  1JTG A;  2EFU A;  3T4J A;  3V3R A;  2EX9 A;  3NDG A;  4EUV A;  3M6H A;  1DJB A;  4MCW A;  4DN0 A;  3Q81 A;  3T12 B;  3BM6 A;  3S7O A;  3FZC A;  2BTF P;  4WYY A;  4OLG A;  4Y7P A;  4YIN A;  2Z2L B;  3C7U A;  1F2K A;  1ODV A;  1UWP X;  1YLT A;  3VSK A;  3KSH A;  1FIL A;  3D3O A;  4H6J B;  1OT6 A;  3IH8 A;  4I38 A;  3SS4 A;  4GKU A;  3GEC A;  3PBT A;  2H5S A;  2ACG A;  4YFM A;  5TFQ A;  4HBU A;  4FCF A;  2BAS A;  2WKR A;  3RXX A;  4ETX A;  3DWZ A;  5DFY A;  4WM9 A;  4RA7 A;  1S6R A;  2ZC4 B;  1BZA A;  1S66 L;  3HBR A;  1MPL A;  1LSX A;  4OQH A;  3QNB A;  1JWV A;  4CLC B;  4LV1 A;  3DTE A;  3AGE A;  5DTK A;  4I3I A;  4ZJ2 A;  2W1R A;  5G4Y A;  4QB8 A;  4F94 A;  4WL9 A;  2Y2O A;  2P7J A;  1S4R A;  3E4O A;  3UPN A;  3UB5 P;  1ZG6 A;  4Z1W A;  2HP6 A;  4GD8 A;  1YMS A;  2ZL1 A;  3ZVW A;  4LRX C;  3UB7 A;  1H8Y A;  1TEM A;  1ZTU A;  5F1F A;  4IBX A;  3QP6 A;  5C5K A;  2J8Y A;  1BUE A;  3W8K A;  3UB9 A;  1TD5 A;  3GTC A;  3HRE A;  3MXR A;  5DF8 A;  2PR5 A;  4NG2 A;  5M18 A;  4Y0T A;  1ERQ A;  1K4F A;  3Q7Z A;  3IXB A;  2ZMV A;  4IVK A;  5AVE A;  2GZA A;  3RFB A;  3N7W A;  3OCN A;  2Y2N A;  4YNR A;  4UA9 A;  2A24 A;  4Y17 A;  1MXO A;  2VGJ A;  1PNE A;  5F83 A;  3M2K A;  2L4R A;  4K0X A;  5CGW A;  2WKQ A;  4LRY C;  4ID4 A;  4X56 A;  3MBZ A;  2ZQD A;  2HP5 A;  2UV0 E;  4GLQ A;  3T4L A;  2ZC5 B;  4L9F A;  1ACF A;  1L2S A;  3ZHH A;  4ETZ A;  1NXY A;  1RP5 A;  2DRW A;  5F82 A;  4KZ8 A;  3MQQ A;  4X1L A;  2V20 A;  1K57 C;  1D1J A;  3JPU A;  1ES4 A;  2J3T C;  4Q8I A;  1EW0 A;  1NZO A;  4JF6 A;  2J9P A;  4UQI S;  5HPI A;  3ZG0 A;  2Y79 A;  3OBF A;  3NDE A;  1VEU A;  3M2J A;  3PBN A;  4S2K A;  3U4L P;  3KYZ A;  2VKS A;  1K55 C;  2EWV A;  3A0V A;  5DTS A; 
#chains in the Genus database with same CATH homology
 4E3K A;  2ZC6 B;  1KDS A;  1GA0 A;  1JWZ A;  1E25 A;  3N8R A;  4QD4 A;  4BD0 A;  5EPH A;  3Q1F A;  2Y2J A;  4QHC A;  3CJM A;  1FOF A;  5EVL A;  2ZMA A;  3IT9 A;  4LCM A;  4S2J A;  5EOO A;  3WRT A;  3UPO A;  2I72 A;  3N8L A;  1PIO A;  2ZC7 A;  5FQ9 A;  3V39 A;  1G68 A;  2WZX A;  3OPP A;  3OCL A;  4QU3 A;  1J9M A;  4HES A;  5GLC A;  1FSY A;  4NK3 A;  3BFG A;  3HUN A;  3QNC A;  4OKP A;  5GL9 A;  4DE2 A;  5BOH A;  1YLJ A;  4QY6 A;  1QME A;  2Y4A A;  1W8Y A;  3SH8 A;  5KMW A;  1XXM A;  1RGZ A;  5TR7 A;  1NZU A;  3FV7 A;  3LY3 A;  4PM6 A;  1YLW A;  1PWD A;  4X53 A;  5EEC A;  5KSH A;  3LY4 A;  4EUZ A;  2G2U A;  1LLB A;  1SKF A;  5HAP A;  4XUZ A;  1K57 A;  1K54 C;  3SS3 A;  3NIA A;  4WZ4 A;  3C7V A;  3SOI A;  3DW0 A;  3IWO A;  2EXA A;  4P6B A;  4KZ4 A;  4C75 A;  4E3J A;  2Q9N A;  3A3I A;  1PYY A;  3MZE A;  4P0M A;  5M1A A;  4ZDX A;  2H0Y A;  3IXH A;  1KVM A;  4KQR A;  1L0D A;  2WYX A;  4C3Q A;  4KEN B;  1PW8 A;  2A49 A;  2OV5 A;  4OVD A;  1I5Q A;  3G2Z A;  3MZD A;  4OLD A;  3VP4 A;  3HLB A;  5A92 A;  1VQQ A;  2WGW B;  3MKF A;  2XD1 A;  3G34 A;  4LV2 A;  2IWD A;  2WKI A;  3UDI A;  3P98 A;  5HAR A;  2ZJ9 A;  2QZ6 A;  3VFF A;  5E2F A;  2ZQ9 A;  4KG6 A;  3BRM A;  4S2M A;  2HDS A;  5U47 A;  4N92 A;  3FWL A;  5FAO A;  2P9V A;  4PPR A;  2XGN A;  4U0T A;  5DTT A;  5A93 A;  1IYO A;  3MXS A;  3ZG8 B;  3AGD A;  5E2G A;  5FAP A;  1ERM A;  1K55 A;  2Y2L A;  3WS0 A;  5AQ7 A;  3DTM A;  4CJN A;  3IF6 C;  4Z9Q A;  3VP2 A;  1GHI A;  1CK3 A;  4B4X A;  1LL9 A;  5DF7 A;  1W8Q A;  2JC7 A;  2UWX A;  4KG2 A;  1ESU A;  5D3O A;  3O88 A;  1ES3 A;  2P74 A;  2WAD A;  2Y2G A;  5G18 A;  2ZC3 B;  4JLF A;  3I7J A;  3HVF A;  4GB7 A;  1ZKJ A;  2HDR A;  4S2O A;  4PM8 A;  1PWC A;  5CHM A;  1MWU A;  4N9L A;  1YMX A;  3RXW A;  3BLM A;  1BSG A;  4GD6 A;  2XFT A;  5E2H A;  4MBF A;  5E2E A;  1ZC2 A;  2RCX A;  1DJC A;  4S2N C;  1WE4 A;  1MWR A;  4B88 A;  2BG1 A;  1MY8 A;  1U60 A;  1MWS A;  3IHB A;  4DE0 A;  1G6A A;  1YQS A;  5GLD A;  1FR6 A;  3NY4 A;  1ONH A;  2J9O A;  1KVL A;  3O3V A;  2A3U A;  3UDF A;  1K54 A;  2IWC A;  3IH9 A;  5DF9 A;  2Z2M B;  1BLP A;  1BT5 A;  3GMW A;  1I2S A;  2EXB A;  3VOY A;  2HDQ A;  3OZH A;  5GLA A;  1XA7 A;  3OPL A;  2WZZ A;  2E8I A;  2WAF A;  2Y2M A;  2PU4 A;  3W4Q A;  3UN7 A;  5CEB A;  3B3X A;  1W5D A;  5FQK A;  4KQO A;  3IHA A;  4FSF A;  5EVI D;  1FSW A;  3VP0 A;  5CEC A;  1K4E A;  1S0W A;  1XPB A;  1IKI A;  4NET A;  5A91 A;  4IBR A;  3N8S A;  5F1G A;  3HL9 A;  5EVI C;  5KZH A;  2GDN A;  1CI9 A;  4OQ0 A;  3WS1 A;  3A3E A;  4WZ5 C;  1CI8 A;  3AGF A;  2QPN A;  3UNW A;  1DY6 A;  3A3D A;  5AQB A;  3GR2 A;  5EUA A;  5GHX A;  4EBL A;  3A3J A;  3NBL A;  3OPH A;  3SH7 A;  4DDS A;  4DKI A;  4KZA A;  2H0T A;  1GCE A;  3P09 A;  1I2W A;  2Y91 A;  4IVI A;  1YLY A;  1K6S A;  5FQM A;  5I94 A;  2Y59 A;  3IF6 A;  3MZF A;  3PBO A;  3Q82 A;  4JBF A;  4N1X A;  5EOE A;  1GHP A;  4X55 A;  1OME A;  4JF4 A;  5IHV A;  4A5R A;  4Y0U A;  4LCL A;  4BL3 A;  4OON A;  1IKG A;  2WAE A;  5FQI A;  3BEB A;  1SCW A;  1XGJ A;  4OP8 A;  4XXR A;  2Y2K A;  2ZM2 A;  4X68 A;  4KZ6 A;  3VP3 A;  3GRJ A;  4UA6 A;  4WEL A;  4UAA A;  4BL2 A;  5GHZ A;  1WYC A;  2QMI A;  1LL5 A;  4LEN A;  1IEL A;  3ZCZ A;  5KSC A;  4PM9 A;  1NY0 A;  4FH2 A;  3UPP A;  1PWG A;  3EQV A;  4KZ9 A;  1NRF A;  3W4O A;  2C6W B;  3MKE A;  2EX6 A;  4M3K A;  4S2N A;  3ZG9 B;  4JF5 A;  1GHM A;  1BTL A;  2X02 A;  4OOY A;  4EWF A;  3VSL A;  4R1G A;  1IEM A;  3WWX A;  2JE5 A;  2ZQA A;  3OPR A;  1EI5 A;  3CMZ A;  4JXV A;  4OP5 A;  2DCF A;  1AXB A;  3NI9 A;  3BFC A;  1SHV A;  1N4O A;  3IXG A;  4BQM A;  4ZJ3 A;  5CED A;  3LO7 A;  5HL1 A;  3C4O A;  3TOI A;  2XH9 A;  3HLD A;  2IWB A;  2Y2I A;  3S22 A;  4EQI A;  1SDE A;  4KZ5 A;  3V3S A;  5AQA A;  1KDW A;  3HLE A;  3CZD A;  3G2Y A;  1LHY A;  4ZBE A;  5FAS A;  4DXB A;  2C5W B;  1HTZ A;  3N6I A;  1FCM A;  1ONG A;  1O7E A;  1XP4 A;  4H8R A;  4OQG A;  4OPZ A;  2WKH A;  2RL3 A;  2H10 A;  1ZG4 A;  4O7D A;  3M6B A;  3FKW A;  3JYI A;  4GDB A;  1IYS A;  3MFD A;  1K25 A;  2G2W A;  4K91 A;  4RYE A;  1GA9 A;  1O07 A;  4HBT A;  5CHU A;  5EVI A;  5GLB A;  3UE3 A;  2V2F F;  1KGE A;  5FQQ A;  4WZ5 A;  2ZQ8 A;  4OPQ A;  5AQ9 A;  3ZG5 A;  2P9V B;  3C5A A;  1FQG A;  1M6K A;  1MKI A;  3BYD A;  2EFX A;  4S2P A;  2PU2 A;  3N4I A;  5EE8 A;  4BD1 A;  4FD8 A;  4N1H A;  4EBN A;  4WEK A;  3ZGA B;  5CXW A;  5CTN A;  1NYY A;  5HW3 A;  3IWI A;  3G4P A;  3WS2 A;  1CEF A;  3WRZ A;  3NC8 A;  1IYQ A;  1PW1 A;  2JBF A;  2XQZ A;  4KZ7 A;  5CGS A;  3G31 A;  1EWZ A;  3GQZ A;  4DE3 A;  1FR1 A;  4B4Z A;  2R9X A;  2R9W A;  1KE3 A;  1M40 A;  1JTG A;  5HX9 A;  2EFU A;  3IXD A;  3WS5 A;  3V3R A;  2EX9 A;  3TSG A;  3NDG A;  3D4F A;  1DJB A;  1L0E A;  1LI0 A;  3BEC A;  3M6H A;  3UY6 A;  2X01 A;  3GV9 A;  4PM7 A;  1E4D A;  3C4P A;  4EV4 A;  3ZVT A;  5CRF A;  3HUM A;  3ZFZ A;  1HZO A;  4E3M A;  4WBG A;  3Q81 A;  1K6R A;  3G32 A;  3BM6 A;  3FZC A;  5FI6 A;  4OOL A;  2XFS A;  4WYY A;  3E2K A;  4X6T A;  3SH9 A;  4MEZ A;  3UDX A;  3VOZ A;  4OLG A;  4Y7P A;  4R4S A;  5FI2 A;  1YT4 A;  2FFY A;  1VM1 A;  4YIN A;  1PI5 A;  2Z2L B;  3C7U A;  3PBR A;  4RVA A;  3ITA A;  1YLT A;  4L0L A;  3VSK A;  3Q7V A;  3OC2 A;  1CEG A;  3ZNY A;  1KGG A;  2J7V A;  1MWT A;  1JWP A;  5GHY A;  4KQQ A;  3IH8 A;  4D2O A;  3HLW A;  1JTD A;  3SS4 A;  1TDG A;  1PZP A;  2Y2Q A;  4GKU A;  3PBT A;  3SS5 A;  2H5S A;  4YFM A;  1ES2 A;  3IF5 A;  1XGI A;  3IQA A;  5CER A;  4C6Y A;  3G35 A;  5TFQ A;  2XK1 A;  4HBU A;  1DJA A;  4FCF A;  3O86 A;  3S1Y A;  1XX2 A;  4JKT A;  3RXX A;  3TG9 A;  1W79 A;  3DWZ A;  1E3U D;  3HUO A;  1K56 D;  1XA1 A;  4WM9 A;  4RA7 A;  1L0F A;  1S6R A;  2ZC4 B;  1BZA A;  1SDN A;  3HBR A;  1MPL A;  1IYP A;  2DNS A;  2EX2 A;  4CPK A;  2ZM8 A;  4OQH A;  5HAQ A;  3QNB A;  3IF6 B;  4XUX A;  1NYM A;  3V5M A;  5CTM A;  1JWV A;  4LV1 A;  5DTK A;  3AGE A;  1YLZ A;  4ZJ1 A;  4ZJ2 A;  3LEZ A;  1TVF A;  3NCK A;  3FKV A;  1YM1 A;  3IWQ A;  3GVB A;  4QB8 A;  2EX8 A;  4F94 A;  1HD8 A;  2Y2O A;  3O87 A;  4R4R A;  3UPN A;  2XDM A;  1ZG6 A;  3G30 A;  3Q07 A;  1PI4 A;  2HP6 A;  4LV0 A;  3RJU A;  3WS4 A;  4EBP A;  4GD8 A;  1C3B A;  4N9K A;  1YMS A;  2BLS A;  4E3I A;  4WMC D;  3VFH A;  3ZVW A;  4KZB A;  5FQJ A;  2Y2P A;  4P87 A;  3ZG7 B;  5L2F A;  1Q2Q A;  1H8Y A;  1TEM A;  5TGF A;  2Q9M A;  3V50 A;  2XD5 A;  5F1F A;  1LI9 A;  3ISG A;  4IBX A;  5DVA A;  3VMA A;  2J8Y A;  1BUE A;  3W8K A;  3BFD A;  1YLP A;  4GNU A;  4E6W A;  4IED A;  3UE1 A;  3BFE A;  3GTC A;  2WGW A;  4S2L A;  3HRE A;  1TDL A;  2XF3 A;  2HDU A;  3ITB A;  2PBY A;  3MXR A;  5DF8 A;  3PAE A;  5M18 A;  1RGY A;  4Y0T A;  1ERQ A;  2OLU A;  1K4F A;  3Q7Z A;  3IXB A;  1KE0 A;  1BUL A;  4UA7 A;  1PZO A;  1KE4 A;  2ZLY A;  4IVK A;  5CGX A;  3VP1 A;  3GSG A;  3EQU A;  4R3B A;  5CHJ A;  1KGF A;  4LV3 A;  3QHY A;  2Y55 A;  3HLF A;  1H8Z A;  3PTE A;  1MBL A;  1JVJ A;  4OOM A;  5EVI B;  4PM5 A;  2X71 A;  3N7W A;  3OCN A;  3W4P A;  2Y2N A;  4R3J A;  3HLG A;  2ZD8 A;  4MLL A;  4UA9 A;  4ZTK A;  4QY5 A;  5FAQ A;  4DE1 A;  1XKZ A;  1MXO A;  4Y0O A;  3PAG A;  2XEP A;  1WYB A;  2VGJ A;  3PBQ A;  4R0Q A;  4JPM A;  1BLH A;  1N9B A;  1E3U A;  2XR0 A;  5F83 A;  1K56 A;  4E3O A;  5J8X A;  4GOG A;  2B5R A;  2WGI A;  3M2K A;  4RX2 A;  3ZHH A;  4K0X A;  5CGW A;  4E3L A;  1Y54 A;  5M19 A;  2ZQC A;  2ZQ7 A;  4ID4 A;  2HPB A;  1Q2P A;  4X56 A;  1Z6F A;  3MBZ A;  5HAI A;  2ZQD A;  2HP5 A;  1HVB A;  1L0G A;  5FAT A;  5HFO A;  2ZC5 B;  4PMA A;  4X69 A;  5JYO A;  4R23 A;  4DDY A;  4E6X A;  1L2S A;  1NJ4 A;  3HLC A;  4JXW A;  4U3T A;  4GDN A;  3ZDJ A;  2XLN A;  5A90 A;  1BLS A;  4KZ3 A;  4WEJ A;  2WUQ A;  5FSR A;  1NXY A;  1K38 A;  1RP5 A;  2DRW A;  4JXG A;  2Y2H A;  1FCO A;  4JXS A;  4K0W A;  1ERO A;  3DWK A;  4KZ8 A;  5F82 A;  5FI7 A;  3ZNT A;  4E3N A;  3CG5 A;  2V20 A;  1K57 C;  1QMF A;  2FFF B;  4BLM A;  3BFF A;  2JCH A;  1ES4 A;  2WGV A;  4MBH A;  4S2I A;  4Q8I A;  1NZO A;  4QJG A;  4WMC A;  5FA7 A;  4JF6 A;  1RCJ A;  2J9P A;  3BLS A;  2OSU A;  4DRT A;  5FDH A;  1H5X A;  4BEN A;  3FYZ A;  4OPR A;  3ZG0 A;  1BLC A;  4GZB A;  2HP9 A;  4MNR A;  4OQI A;  1FCN A;  2ZM0 A;  4ZAM A;  3S4X A;  1ES5 A;  3NDE A;  4OPY A;  4RX3 A;  2OLV A;  1ALQ A;  2WKE A;  1W7F A;  4BJP A;  3E2L A;  4DF6 A;  4UHU A;  4KG5 A;  4FH4 A;  1ESI A;  3M2J A;  2WK0 A;  3PBN A;  4S2K A;  3Q7V B;  5E43 A;  4U0X A;  4GN2 A;  2VGK A;  4MBK A;  4OH0 A;  3A3F A;  2CC1 A;  2V1Z A;  4DXC A;  3PBS A;  5JYP A;  1K55 C;  3UO9 A;  3LCE A;  3UE0 A;  4HEF A;  4P85 A;  5DTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...