3C5AA

Crystal structure of the c-terminal deleted mutant of the class a carbapenemase kpc-2 at 1.23 angstrom
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
264
structure length
264
Chain Sequence
b'TNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class A carbapenemase KPC-2
publication title Genetic and structural insights into the dissemination potential of the extremely-broad-spectrum class A {beta}-lactamase (EBSBL) KPC-2 identified in two strains of Escherichia coli and Enterobacter cloacae isolated from the same patient in France
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 97
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2008-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3c5aA00
4R3BA 1ALQA 1FCMA 1HZOA 4LENA 4KG6A 1AXBA 2C5WB 4WBGA 2JC7A 2ZQ9A 3CG5A 2XEPA 3OPRA 4S2LA 5L2FA 4OVDA 4KZ4A 3VP2A 2JCHA 5FQ9A 3UPPA 3W4QA 1MWTA 3WRZA 1BT5A 3CZDA 2H10A 1CK3A 4GDNA 3NC8A 4KZ3A 3ZNYA 1G68A 3G4PA 2FFYA 5IHVA 3VSLA 1CEGA 1IKIA 3LY4A 2R9WA 3LO7A 4X69A 4GN2A 4WM9A 2DCFA 4NETA 5FAPA 1O7EA 3MFDA 4JXWA 1IYOA 5CTNA 4KZ8A 3G35A 5JYOA 1NRFA 4WZ4A 4OQ0A 3VSKA 2WADA 3AGDA 4P6BA 5EVIC 5FI7A 5CGXA 1K55A 5A93A 3A3JA 4YINA 1W5DA 3UPNA 3ZDJA 1YT4A 3N8LA 4BL3A 4U0XA 4DE3A 1EROA 4S2KA 1N9BA 4U3TA 5A91A 2EFUA 2IWDA 1LL5A 1M40A 3ZGAB 3IHAA 5TGFA 2XQZA 4Y0OA 4ZBEA 4MBKA 1L0FA 5GLBA 4D2OA 1K54A 4EBNA 3IH8A 5FI6A 1KDWA 2CC1A 4A5RA 3HLEA 1E3UD 5GHZA 4GD6A 4IVIA 4P0MA 3OPLA 2ZQAA 4QU3A 3VOZA 2VGJA 1U60A 1GA9A 1FSYA 2DNSA 3IF6B 2XH9A 4EBLA 4WZ5A 4KZ7A 2OLUA 5M19A 3CJMA 2IWBA 5FI2A 4JPMA 3FWLA 3IQAA 4JF5A 1GHMA 3G31A 4B4ZA 1K4FA 1FOFA 3ZG9B 2P74A 3FKVA 1TDGA 3ZVTA 4E6XA 3UN7A 3MKFA 4BL2A 5HAPA 2ZM8A 1K25A 5HFOA 1DY6A 1GA0A 4N1HA 1MWSA 2EXBA 3UO9A 2VGKA 2XR0A 3BLMA 3PAGA 4WMCD 4OQGA 1ERQA 2OSUA 3C5AA 1W8QA 1BUEA 1E3UA 4KZ5A 4KQRA 2J8YA 5EECA 5CRFA 3TG9A 3HUOA 1FR1A 3OPPA 4QD4A 1JWPA 4K0WA 3BEBA 1Q2PA 3IHBA 1NY0A 1BLSA 2C6WB 4JXGA 4KZBA 4OOMA 3PBQA 4K91A 1K6SA 1RCJA 1HVBA 3MXRA 5DVAA 2ZLYA 4E3LA 3MKEA 4QY5A 1EWZA 4LV1A 4KQOA 4UA6A 3LEZA 1XP4A 2HDUA 3MZFA 4C6YA 1I2SA 4HBUA 1VM1A 5CXWA 2G2UA 1RGYA 4JXVA 5F1FA 2Y2LA 5CECA 1VQQA 4DDYA 2WAFA 4OLDA 2XD1A 5AQBA 1BLHA 1K57A 4IEDA 5HARA 4GOGA 3NBLA 3DTMA 3G34A 3GQZA 1PW8A 3NY4A 4KQQA 2QPNA 3IXDA 4P87A 3C7VA 2A49A 1XA1A 4GD8A 4UA9A 3Q7VA 5AQ7A 3VP1A 5M18A 5CGWA 5F82A 2ZQCA 5FQQA 1HD8A 5FA7A 2Y2MA 2ZQ8A 1PIOA 1PZPA 4QY6A 1BULA 3UPOA 3VFHA 5EPHA 5HX9A 3O3VA 3WS2A 3HLCA 1RGZA 4Y7PA 4U0TA 5EVID 2Y2JA 1SDEA 1E25A 4OPQA 1JWZA 3BFFA 4LCLA 3UY6A 1PWGA 4JF4A 4MLLA 4ZJ3A 3SS5A 1KGEA 4JF6A 3VP4A 4WYYA 4RVAA 5F1GA 1WYCA 2ZMAA 2OLVA 2WGVA 5FATA 5JYPA 2Y2IA 3HLBA 4WELA 2ZD8A 4UA7A 3SH9A 1PI4A 1IYPA 3VOYA 2EX2A 1PWCA 1NYYA 4JLFA 3ZG8B 2Y2KA 4DE1A 2BLSA 2Y2QA 2WYXA 3C4PA 3GTCA 5CHMA 3BFGA 4PM7A 1YLWA 5FQKA 3ZVWA 1SDNA 4RA7A 1ERMA 1C3BA 4F94A 3Q07A 5GLAA 3IF6C 1YLYA 4N1XA 3IH9A 1ESUA 2J9PA 4DE2A 5KMWA 2H5SA 1BLPA 3WS4A 3SH8A 3S22A 3N8RA 2WKIA 4DXBA 3Q1FA 2EX8A 2ZC4B 3HLGA 2RL3A 5HL1A 4ZTKA 3C7UA 5E2FA 4GDBA 3HLWA 2EFXA 1L2SA 2J9OA 1NZOA 1E4DA 2Y2PA 3A3DA 4HESA 5GL9A 3A3IA 1EI5A 3G32A 3V50A 4KZ9A 4S2NC 5U47A 2J7VA 4FSFA 4WEKA 4PM6A 3WRTA 1NZUA 3DW0A 3PTEA 3N7WA 4ZDXA 4R23A 1DJAA 1FSWA 3I7JA 1KDSA 4LV2A 1BSGA 4JKTA 3PBRA 2PBYA 4ID4A 5EOOA 4ZJ2A 3EQUA 1QMEA 5FASA 4UHUA 3AGEA 3Q7VB 3V3RA 4BD0A 3HVFA 2HDSA 3G30A 3WWXA 3HLDA 1ES5A 4KENB 4S2MA 5FDHA 3ZG0A 1XX2A 4X56A 3OPHA 3HUNA 2JBFA 4R4RA 3GSGA 5DF9A 5M1AA 3MZDA 4GB7A 2XF3A 4XXRA 1M6KA 1XGJA 3FKWA 3MXSA 4FD8A 4EV4A 1BLCA 3BFDA 4PMAA 3V39A 3UE1A 4C3QA 4DRTA 5CEBA 1K55C 1MWRA 1CI8A 4E3MA 1J9MA 1YLJA 3QNBA 3OCLA 4LCMA 3A3FA 1LLBA 3HL9A 3UDIA 4R4SA 1WE4A 3N8SA 3ZCZA 5GLCA 2E8IA 1K54C 5AQ9A 3E2LA 2ZM2A 2EX9A 4UAAA 5HAQA 3Q7ZA 3PAEA 1I5QA 2Y2OA 3CMZA 3IXBA 4OLGA 3VP0A 1O07A 5TFQA 2PU4A 1KVMA 3IWQA 2Q9MA 3NIAA 4QB8A 1K4EA 4C75A 3IWOA 5DTTA 1XXMA 4E6WA 1W79A 3OZHA 2ZJ9A 4WMCA 5EOEA 4HEFA 1LHYA 4CJNA 1DJBA 4JXSA 2Y55A 4E3NA 4KZ6A 2B5RA 3A3EA 5DF7A 1KE4A 4H8RA 5FQMA 3HUMA 4LV0A 1ZKJA 4KG2A 4OQHA 5I94A 3IXGA 4MBHA 1XKZA 5TR7A 5E43A 1MBLA 1L0GA 2HDRA 5E2HA 1CI9A 2V20A 3ZHHA 5FQJA 1MXOA 4B88A 2HDQA 3SH7A 1YLTA 3ITAA 4E3IA 1ES4A 1S0WA 1YLPA 2WKEA 1K56D 4EBPA 3PBSA 4X68A 4S2PA 3HBRA 5A92A 3IWIA 4M3KA 1KGFA 1S6RA 1K38A 1IKGA 3BECA 5CHJA 1MY8A 3SOIA 3M2KA 4DXCA 2XDMA 1MPLA 3ISGA 3GMWA 2ZQ7A 3SS4A 3S1YA 1OMEA 1Q2QA 5GHYA 2WKHA 4DKIA 1IYSA 1KE3A 1QMFA 3HLFA 1IEMA 2WAEA 3N4IA 4N9LA 1TDLA 4OPYA 3SS3A 4OOYA 1GHIA 1JWVA 1NXYA 3M2JA 3GV9A 5FQIA 1K57C 2A3UA 5HAIA 3W4OA 4Q8IA 2JE5A 4IVKA 3RXWA 3UDFA 1H8ZA 1ZG6A 4JBFA 3P98A 3HREA 3NI9A 1K6RA 2ZM0A 4LV3A 5EVIA 2WUQA 2Y2NA 3VP3A 4E3JA 4EQIA 1WYBA 5KZHA 2EX6A 4E3KA 3O87A 4EUZA 1JTDA 1G6AA 3OCNA 3S4XA 5D3OA 2XFTA 3DWKA 2Y59A 2WZZA 1MKIA 4OPZA 2H0TA 3QHYA 2Z2LB 3NDEA 1I2WA 4XUXA 3MZEA 1XA7A 4FCFA 3BRMA 4QJGA 1IELA 5EVLA 2ZC7A 5F83A 4GKUA 2FFFB 1PW1A 3AGFA 4OONA 2BG1A 3WS0A 5J8XA 1IYQA 2HP9A 4N92A 1PI5A 5E2GA 2Y4AA 3O86A 4RX3A 1NYMA 2X02A 3ZG7B 5FAQA 5KSCA 3V3SA 2UWXA 4MEZA 5CEDA 4KG5A 1PZOA 2QMIA 4HBTA 4Y0TA 3ZNTA 3W4PA 4PPRA 2G2WA 2H0YA 2WZXA 5CTMA 3MBZA 1W7FA 5EUAA 3BM6A 3M6HA 2DRWA 3GR2A 3VFFA 1TVFA 1YMXA 4X6TA 4ZAMA 1ES3A 5DTSA 4R1GA 3E2KA 5CHUA 3LY3A 3UDXA 4FH4A 1KE0A 5CERA 3FV7A 3IT9A 3TSGA 2Y2GA 1BZAA 4O7DA 3IXHA 3FZCA 5BOHA 1PWDA 2WGWA 2I72A 2P9VA 2QZ6A 1YLZA 2RCXA 3D4FA 2R9XA 1ONHA 4ZJ1A 4L0LA 1FR6A 1SKFA 2X71A 1L0DA 3PBNA 3G2ZA 4YFMA 5HW3A 1ONGA 1XGIA 1PYYA 2ZC3B 3PBOA 5FSRA 4R0QA 2HP5A 2Y91A 3QNCA 2XD5A 4PM5A 5DTKA 2HP6A 3DWZA 1SHVA 2Q9NA 3N6IA 4BQMA 3NCKA 3FYZA 2V2FF 4OP8A 3LCEA 4NK3A 4QHCA 1GCEA 4Y0UA 2ZC6B 3OC2A 1Y54A 3V5MA 3Q81A 2X01A 1YM1A 4S2IA 2V1ZA 4Z9QA 5EVIB 4BLMA 1ESIA 1KVLA 4PM8A 2ZC5B 4WZ5C 3UE3A 2IWCA 3UE0A 1ES2A 1ZC2A 1SCWA 1Z6FA 4OP5A 2WGIA 2XLNA 1CEFA 2XGNA 1BTLA 1DJCA 2XFSA 3O88A 4KZAA 4BD1A 4K0XA 1LI9A 4OH0A 1YMSA 5GHXA 4BJPA 2PU2A 2Z2MB 4E3OA 2XK1A 3IF5A 1N4OA 3VMAA 4OPRA 1LL9A 1KGGA 5FAOA 3EQVA 4RX2A 5EE8A 4DDSA 4PM9A 3RJUA 3C4OA 4CPKA 1W8YA 4BENA 4IBXA 4P85A 2ZQDA 4R3JA 1L0EA 2Y2HA 1ZG4A 5DF8A 2GDNA 1LI0A 3BFEA 5G18A 3B3XA 4X55A 1JVJA 3WS5A 4OQIA 1NJ4A 3BYDA 1TEMA 4S2JA 4IBRA 1H8YA 5E2EA 1FCOA 1HTZA 3RXXA 4DF6A 3P09A 3IF6A 4N9KA 2HPBA 3GVBA 1YQSA 3GRJA 1FCNA 3ZG5A 4FH2A 4DE0A 4GZBA 3TOIA 3ZFZA 1H5XA 1FQGA 3Q82A 3UNWA 1XPBA 5A90A 3NDGA 1JTGA 3WS1A 5GLDA 4XUZA 4B4XA 2WGWB 2P9VB 3G2YA 3ITBA 1GHPA 5AQAA 4GNUA 1MWUA 5CGSA 4X53A 4WEJA 3JYIA 1K56A 3PBTA 1RP5A 3M6BA 4MBFA 4OOLA 4OKPA 4RYEA 3W8KA 3BLSA 4S2OA 4MNRA 4S2NA 5KSHA 3BFCA 2WK0A 2OV5A 4EWFA 2EXAA
chains in the Genus database with same CATH superfamily
3FC7A 1HZOA 2ZQ9A 1K0KA 2XEPA 4S2LA 5L2FA 2JN7A 4KZ4A 5FQ9A 3WRZA 3W4QA 5EFWA 4DJ2A 1ACFA 1CK3A 3NC8A 4KZ3A 2FFYA 1CEGA 4GN2A 2GJ3A 4WM9A 5CTNA 4ME4A 3G35A 3VSKA 2WADA 3ZQ5A 5HD3A 1MZUA 3PXPA 3L9KA 1YT4A 3FG8A 1TD5A 3IS2B 4U3TA 2KX6A 5TGFA 1CJFA 4ZBEA 4EBNA 4MBKA 4NXGA 1KDWA 4A5RA 2VV6A 3KO6A 4QU3A 1GA9A 3IF6B 4KZ7A 2OLUA 4JPMA 3ZG9B 3NECA 3FKVA 4E04A 3UN7A 1T1BA 2ZM8A 5HFOA 1DY6A 3PYPA 3UO9A 3CAXA 4HP4A 4WMCD 1ERQA 1W8QA 5HDCA 2J8YA 5HPFA 5CRFA 3FPVA 3U2AA 1NY0A 2C6WB 4JXGA 4KZBA 3TW8A 1HVBA 4EERA 1J3WA 2HF6A 4KQOA 3LEZA 4C6YA 5AVFA 2QYBA 4HBUA 1VM1A 2G2UA 2JHEA 2Y2LA 1VQQA 3E0YA 2WAFA 2XD1A 1K57A 4IEDA 3DTMA 2H28A 3GQZA 4KQQA 2B18A 2A49A 3VP1A 3TRCA 5CGWA 4L9EA 4XT2A 4I38A 5FA7A 3KYEA 2Y2MA 4QY6A 4GJ4A 1BULA 3O3VA 4Y7PA 2VZWA 1E25A 2J80A 3UY6A 2JKRI 4L9FA 1N9LA 3K2NA 3HLBA 3EEAA 4WELA 3LUQA 4LRYC 3ZG8B 5IT5A 2P04A 4ETZA 1DP9A 2Y2KA 4MCWA 3NOTC 4CQHA 2WYXA 3UB8A 4PM7A 1YLWA 1YLYA 2HJEA 4NG2A 2J9PA 2H5SA 1BLPA 3N8RA 1N9NA 3Q1FA 2EX8A 3HLGA 1OTAA 3K3CA 3T4QA 1OTBA 3A3DA 2JKGA 1EI5A 2PYPA 5U47A 4X1MA 3LIEA 2HGVA 4R23A 1FSWA 3I7JA 1KDSA 4LV2A 3PBRA 2PBYA 4I3JA 3EQUA 1GSWA 3KX0X 3HJIA 3WWXA 1S4RA 5MC7A 4KENB 1VEUA 4X25A 1XX2A 4X56A 3HUNA 4II7A 3MZDA 4XXRA 1M6KA 3MXSA 4DRTA 3T1RA 1CI8A 1J9MA 1NRJA 4LCMA 3UE6A 1W63M 4H6JB 3HL9A 4R4SA 3UMEA 2G7UA 2E8IA 2W1TB 2UV0E 3Q7ZA 1I5QA 2HJ9C 3IWQA 3NIAA 4QB8A 4C75A 5DTTA 1XXMA 1W79A 4HEFA 2J3TC 4E3NA 2YKFA 4RQ9A 4H8RA 1ZKJA 4MBHA 3U4LP 3E4PA 1L0GA 5DFYA 1CI9A 4GHIB 5FQJA 3LR3A 3SH7A 3ITAA 4I39A 1YLPA 1K56D 1UWNX 1Y4OA 4I3IA 3IWIA 3HCYA 1KGFA 1K38A 4GS9B 4DXCA 2XDMA 1MPLA 3ISGA 2ZQ7A 3OBFA 1IYSA 1QMFA 3M2JA 4IVKA 3ULFA 2ZBBA 4JBFA 1HLUP 2W3FA 3C8CA 1K6RA 2ZM0A 4LV3A 5EVIA 4EQIA 4E3JA 1WYBA 2ZL1A 4CLCA 1TS0A 5HDDA 4Q0JA 3S4XA 5D3OA 1L3LA 4B9OA 2Z2LB 1I2WA 1XA7A 4FCFA 3CHWP 2W3GA 2FFFB 2Y8HA 3AGFA 2W3EA 1IYQA 2Y4AA 2X02A 2UWXA 5CEDA 1NLYA 2WZXA 3IX3A 2VV7A 3T4LA 5EUAA 3VFFA 1A0KA 4X6TA 4ZAMA 1ES3A 3LR0A 4YWZA 2J3TD 5CERA 3IT9A 1BZAA 4O7DA 3FZCA 1PWDA 2P9VA 3H82A 3D4FA 4ZJ1A 3G2ZA 4YFMA 1ONGA 1PYYA 1S67L 4R0QA 2Y91A 2Q9NA 3NCKA 2KOIA 3FYZA 2L0WA 2V2FF 2VEAA 2VK3A 3LCEA 4NK3A 4Y0UA 3R4KA 5K5BA 3KSIA 2ZC5B 3UE3A 2XLNA 2XFSA 5AVEA 1LI9A 2EA9A 2PU2A 4EETB 5HWTA 4E3OA 1Y28A 1LL9A 1KGGA 4JGQA 5EE8A 4HJ6A 4CLCE 4BENA 1SKOA 2ZQDA 1L0EA 5G4ZA 2XA7S 4UQIM 4HIAA 1JVJA 4B93A 3CUEA 3RH8B 1TEMA 4S2JA 2BASA 4F3LA 1HTZA 3T4SA 3P09A 4N9KA 4AFIA 3GRJA 4GZBA 2NUTC 2V8CA 5CX7A 3ZFZA 4HHDA 3C30A 1JTGA 4B4XA 4XUZA 2WGWB 3G2YA 3ITBA 4L9GA 4X53A 4H6JA 4Y3IA 4S2NA 2WK0A 4GW9A 4YOFA 4EWFA 3S7NA 4KG6A 2C5WB 3CG5A 3BY8A 3UPPA 1OJ5A 3VSLA 4LPZA 3T4TA 2JKTI 4NETA 4JXWA 4PKYA 2PD7A 4IUKA 4OQ0A 3MS6A 3AGDA 1VETB 1VHMA 3QP5A 1H0MA 5TBMA 5A93A 3ZDJA 4BMWA 3F1NA 1N9BA 1LL5A 3IHAA 2AVXA 4Y0OA 1L0FA 1K54A 3MQQA 1E3UD 4IVIA 1PFLA 4KQDA 3OPLA 2W3HA 1U60A 2DNSA 2XH9A 4WZ5A 5M19A 2IWBA 3OLOA 4JF5A 1DP8A 3G31A 4B4ZA 1FOFA 2P74A 1TDGA 2Y79A 4BL2A 3IX8A 3LFVA 3F1PA 5F68A 4N1HA 1MC0A 2OWJA 2OSUA 4KQRA 5EECA 1STZA 3HUOA 1FR1A 1JWPA 1Q2PA 4OOMA 4K91A 2XROA 1K6SA 1RCJA 3QP2A 4EEUA 3MKEA 3C38A 4QY5A 1EWZA 2HDUA 4ETXA 1I2SA 3GDIA 3T4JA 4NXBA 5CECA 1SZVA 3R7WA 5AQBA 4GOGA 2VV8A 4MN6A 2L4RA 3D9YA 3SZTA 4O01A 4GD8A 3Q7VA 5M18A 5F82A 1PIOA 5J7EA 3UPOA 3VFHA 5EPHA 5HX9A 3FPWA 1RGZA 2Y2JA 4OPQA 4LCLA 3A0RA 4ZJ3A 1KGEA 3VP4A 5F1GA 2ZMAA 2OLVA 5FATA 3SH9A 2EX2A 4JLFA 4PAUA 4DE1A 2BLSA 5CHMA 3C4PA 1SDNA 4RA7A 1C3BA 3Q07A 5GLAA 4N1XA 2ZMFA 4DE2A 4BWIA 2WKIA 3O5YA 2RL3A 5HL1A 3IBJA 4GDBA 4R6LA 1VB6A 2W1RA 5GL9A 3CPTA 3A3IA 2VGLS 3V50A 4WEKA 2CMNA 1NZUA 4KUKA 4HQAA 1D7EA 2L1MA 4ID4A 2ZMVA 5EOOA 2IA2A 4S2MA 5FDHA 2JBFA 4GB7A 1G6OA 2XF3A 3T50A 3T1XA 1MWRA 3UDIA 4ARZA 1WE4A 4JGOA 4YNRA 4NXFA 5GLCA 1V9ZA 3LIDA 3E2LA 2EX9A 2Y2OA 3IXBA 3UB9A 5DJTA 1KVMA 2Q9MA 2O0YA 1CQAA 3T4KA 3S7OA 2XRNA 4E6WA 4CJNA 4JXSA 2Y55A 2B5RA 3A3EA 1KE4A 4Y15A 3HUMA 4LV0A 4GCZA 5I94A 3F1OA 1XKZA 5TR7A 2HDRA 5E2HA 2VLGA 2V20A 3ZHHA 4B88A 2O9BA 4E3IA 1ES4A 2INWA 2O9AA 3HBRA 5A92A 4NEED 5A8BA 1NWZA 3SOIA 2QJ7A 2K7SA 3S1YA 5FASA 4DKIA 3N4IA 4N9LA 3SS3A 4OOYA 1JWVA 5L10A 1K57C 5HAIA 1ZG6A 3HREA 5FL3A 2VKSA 2WUQA 2A24B 3QP8A 4E3KA 3O87A 4EUZA 2WZZA 1MKIA 4OPZA 2HZ5A 3VE4A 4XUXA 2JKFA 3MZEA 3G6OA 2PR6A 3BRMA 3HJKA 4QJGA 2ZC7A 5HPIA 3E4QA 1PW1A 5J8XA 3A0SA 2BG1A 3T1QB 2GZAA 3H7WB 5E2GA 3PR6A 4G3WA 5J4EA 5KSCA 4MEZA 3C2WA 4KG5A 2G2WA 2Q0OA 4WF0A 2V1BA 1W7FA 4HNBA 2DRWA 4P6ZM 5DJUA 3E2KA 3UDXA 1KE0A 2R78A 3TSGA 5BOHA 1YLZA 2RCXA 2R9XA 4L0LA 1FR6A 4HY8A 4EXOA 5HW3A 3LGOA 3QNCA 2XD5A 1D1JA 3DWZA 3N6IA 5FEFA 1H3QA 1GCEA 1Y54A 3CITA 3LYXA 3V5MA 1YM1A 3JVVA 4PM8A 5HSQA 1ZC2A 2OAP1 1SCWA 1GSXA 2ZOHA 1DJCA 3IF5A 3MF0A 4PM9A 3RJUA 1OT6A 4WUJA 4R3JA 3RTYA 3P7NA 3IS2A 2GDNA 5G18A 4X55A 3WS5A 4BBUA 1NLZA 5FDSA 1H8YA 2HV1A 1FCOA 2PT7A 2Z6DA 3IF6A 2HPBA 1XJ2A 1Z09A 1GSVA 4DE0A 3VV4A 3TOIA 1FQGA 2GX5A 3NOUC 4O8GA 3KYZA 3UB5P 3WS1A 1GHPA 2V0WA 4BBTA 4GNUA 5CGSA 4WEJA 3JYIA 3M6BA 4M4XA 4MBFA 4RYEA 5HD5A 3BLSA 3BFCA 2OV5A 1DRMA 1FCMA 4LENA 1AXBA 3VP2A 2K31A 1MWTA 2VA0A 2H10A 4GDNA 3ZNYA 1G68A 3G4PA 5IHVA 2R9WA 4R38A 2DCFA 2OWHA 1IYOA 4KZ8A 5IU1A 1NRFA 4WZ4A 4P6BA 5EVIC 5CGXA 1K55A 3IX4A 1W5DA 3UPNA 1LSWA 3N8LA 4U0XA 4CLCC 4S2KA 3T4OA 2LB5A 5A91A 2XQZA 3IH8A 5FI6A 3TE8A 2CC1A 3DBAA 2ZQAA 3VOZA 2VGJA 3BQAA 3BJNA 3CJMA 3FWLA 1EW0A 1K4FA 4X1LA 3MKFA 4QWOA 1GA0A 2ZOIA 1MWSA 2EXBA 2VGKA 3BLMA 3PAGA 3MR0A 2A24A 3OOVA 4OQGA 1BUEA 1E3UA 4KZ5A 5TJJA 3OPPA 4QD4A 2FZ0A 5EV0A 5I5LA 4JGPA 2ZLYA 4E3LA 4EEPA 1XP4A 5CXWA 4DMZA 1RGYA 5F1FA 1XFNA 2XSSA 1BLHA 4K08A 1PW8A 3NY4A 1YSQA 2QPNA 3IXDA 3MQOA 5KIZA 4QPRA 3C7VA 4HJ4A 2ACGA 5FQQA 1HD8A 2K2NA 2ZQ8A 1PZPA 3WS2A 5EVID 2VJWA 3BFFA 4CLCD 4MLLA 4WYYA 4RVAA 2WGVA 5JYPA 2Y2IA 1UGUA 1PI4A 1IYPA 3VOYA 1PWCA 1NYYA 5EM1A 3D3OA 3CUEC 2MJ6A 2W1TA 4HJ3A 4ZRRA 3GTCA 3BFGA 2QJ5A 1OPXA 3P01A 1ERMA 4F94A 3IH9A 3LIAA 2PR5A 1S66L 3WS4A 4DXBA 2ZC4B 3C7UA 2M7UA 3TJZC 4HH2A 3VE3A 1NZOA 4HESA 2BTFP 2JKRM 4KZ9A 4S2NC 3A0VA 3D72A 4GHIA 4PM6A 3WRTA 3DW0A 2P7JA 1P9RA 3LI9A 1DJAA 1BSGA 4ZJ2A 4GS9A 4UHUA 3AGEA 3V3RA 4FOFA 3B42A 2HDSA 4XT2B 1YKDA 3HLDA 5EVEA 3ZG0A 1T19A 4R4RA 5DF9A 1XGJA 4EV4A 1BLCA 4G3VA 4PMAA 3V39A 3UE1A 5CEBA 1LL8A 4E3MA 1YLJA 3QNBA 3A3FA 4I5SA 3N8SA 3NJAA 3RFBA 2V9AA 1K54C 3BQ8A 2ZM2A 3S7PA 3CMZA 3MFXA 3T1SA 5TFQA 2PU4A 3T12B 3MXQA 1K4EA 2M7VA 2ZJ9A 4WMCA 4EQ1A 1LHYA 5L09A 3KSFA 1F9IA 4KG2A 2WKQA 1CF0A 1TF1A 2WKPA 1MXOA 1YLTA 5HL6A 4X68A 4EBPA 4S2PA 2VX8A 4M3KA 4DJ3A 1S6RA 1IKGA 3BECA 1MY8A 3GMWA 1OMEA 1Q2QA 2WKHA 3HLFA 2WAEA 2QKPA 1VEUB 1NXYA 3QP6A 3RXWA 3UDFA 1T1AA 3NI9A 2QWSA 2Y2NA 3VP3A 2EX6A 5LBRA 1JTDA 3KYQA 3OCNA 3QHYA 1P9WA 1S1ZA 1IELA 5F83A 4GKUA 4N92A 1PI5A 3E4OA 5L8MA 4Q0HA 3ZG7B 5FAQA 3W2ZA 4HBTA 3ZNTA 4R70A 3W4PA 4PPRA 2H0YA 4HH3A 5CTMA 4Y5FA 3M6HA 3GR2A 1BYWA 1TVFA 1YMXA 5DTSA 3LY3A 4FH4A 3FV7A 3DAVA 2Y2GA 2KLIA 2WGWA 2I72A 1D06A 1SKFA 2X71A 1L0DA 3GECA 2LB9A 3LIBA 2ZC3B 3PBOA 3DTEA 5FSRA 2V1AA 4PM5A 3B47A 5DTKA 4BQMA 3OC2A 5FEGA 2X01A 4EESA 4S2IA 2B95A 5EVIB 4BLMA 1ESIA 3UE0A 2ZL1B 1ES2A 3QP4A 2EWVA 4CLCB 1Z6FA 2WGIA 3NHQA 1CEFA 2W27A 1BTLA 1LSVA 4IUHA 4KZAA 5EM0A 4OH0A 1YMSA 3LR5A 4Y2FA 4UQIS 2XK1A 3DTIA 1VETA 4DDSA 4RX2A 1W8YA 4IBXA 4P85A 2Y2HA 1ZG4A 2PBDP 1LI0A 5DFXA 1NJ4A 2QHKA 2PD8A 3BW6A 4DF6A 2XA7M 3GVBA 1FCNA 2D02A 3MMHA 2PHYA 1H5XA 3EEHA 5A90A 3NDGA 2P9VB 3H82B 4MN5A 5AQAA 4IJGA 1K56A 3PBTA 4S2OA 4MNRA 5F6AA 2GNXA 4R3BA 4IHQA 1ALQA 4WBGA 2JC7A 3OPRA 1T1CA 2O9CA 2NUPC 4OVDA 1PRQA 2JCHA 1BT5A 3CZDA 1IKIA 3LY4A 3LO7A 4X69A 1W63Q 5FAPA 4HI4A 1O7EA 3MFDA 5JYOA 5FI7A 3QP1A 1TS7A 3JVUA 3A3JA 4YINA 4BL3A 1SKOB 4DE3A 1EROA 2EFUA 2IWDA 1M40A 3ZGAB 4Z1WA 3LICA 4MMNA 5GLBA 4D2OA 3ZYTA 3HLEA 4Y17A 5GHZA 4GD6A 4P0MA 4F3LB 4NXEA 1FSYA 4O0PA 4EBLA 5FI2A 3IQAA 1GHMA 4E6XA 2JKTM 3ZVTA 5HAPA 1LSXA 1K25A 4MDZA 2XR0A 2Z6CA 2A2LA 3C5AA 4WL9A 3KSHA 3TG9A 3VOLA 4K0WA 4FTXA 3BEBA 2P08A 3IHBA 2W3DA 1BLSA 2FH5A 3PBQA 4FUWA 5DVAA 3MXRA 4LV1A 4UA6A 3L7HA 3MZFA 1MKMA 1YAXA 4JXVA 1V9YA 2E8JA 4DDYA 4OLDA 4R3AA 5HARA 3NBLA 3G34A 2PDRA 3EWKA 4P87A 2OOLA 1FILA 3BWLA 1XFQA 5TBMB 1XA1A 4UA9A 5AQ7A 1KOUA 5G4YA 3F1NB 2ZQCA 4EU0A 2WKRA 4DN0A 3KSGA 3HLCA 4U0TA 1SDEA 1JWZA 1PNEA 1PWGA 4JF4A 3SS5A 4JF6A 1WYCA 3LIFA 1ODVA 2ZD8A 4UA7A 3BY9A 2Y2QA 5FQKA 3ZVWA 3F1PB 3MQ0A 3IF6C 5C5KA 1ESUA 5KMWA 5HDSA 3CWFA 3SH8A 3S22A 1AWIA 4ZTKA 5E2FA 2PRFA 1XJ4A 3HLWA 2EFXA 1L2SA 3EGDC 1H8MA 2J9OA 1E4DA 2Y2PA 3G32A 2J7VA 4FSFA 5HZHA 4Y13A 3PTEA 1OJGA 3N7WA 3R7WB 4ZDXA 1S4SA 4JKTA 3LEQA 3UB6A 1DP6A 2VGLM 1QMEA 3NOPC 4BD0A 3Q7VB 3HVFA 3G30A 2I9VA 1ES5A 4KUOA 3OPHA 3H9WA 2D01A 2M1CA 3GSGA 1OTIA 5M1AA 1P97A 1LT0A 3FKWA 4FD8A 1WA9A 3BFDA 4C3QA 1K55C 3E98A 2PYRA 3UB7A 3OCLA 1LLBA 3ZCZA 3EGXC 4PKYG 5HWWA 5AQ9A 3UMDA 4G3KA 4JGRA 1OTEA 4UAAA 5HAQA 3PAEA 2YKHA 4OLGA 3VP0A 1O07A 5DKLA 3V67A 3H7WA 3IWOA 3OZHA 5EOEA 1DJBA 1ZHHB 4KZ6A 5DF7A 4MN7A 5FQMA 1P0ZA 4OQHA 4EW7A 4BBVA 2W0NA 3IXGA 5AJGA 4HOIA 3CPTB 5E43A 2J3WA 2V0UA 1MBLA 3NULA 1ZTUA 1TS8A 2HDQA 1S0WA 2WKEA 1F98A 3PBSA 4LGWA 1YSPA 5CHJA 3M2KA 3SS4A 5GHYA 1KE3A 1IEMA 4OPYA 1TDLA 1XJ6A 3EOIA 1GHIA 5FQIA 3GV9A 2A3UA 4Q8IA 3W4OA 2JE5A 1H8ZA 4EUVA 3P98A 3SW1A 3MSHA 1G28A 3B33A 3ICYA 5KZHA 2V8FA 4ARZB 1G6AA 2XFTA 3DWKA 2Y59A 2H0TA 3NDEA 4I3AA 5EVLA 4OONA 2B02A 4LRXC 3WS0A 2HP9A 4LFUA 4P6ZS 3O86A 4RX3A 1NYMA 3V3SA 1IFQA 1PZOA 2QMIA 4Y0TA 5F5YA 3LI8A 4UEYA 3MBZA 3BM6A 1OT9A 1YPRA 3F1OB 4WN5A 2KDKA 4WLAA 4R1GA 5CHUA 4HP9A 1FIKA 1OTDA 1X0OA 3S7QA 3IXHA 1JNUA 2QZ6A 1ONHA 5J3WA 3PBNA 4PHTA 1F5MA 1XGIA 5DKKA 2HP5A 4Q0IA 2HP6A 2OAQ1 1SHVA 4LRZE 4OP8A 3DTKA 4QHCA 3CI6A 2PAVP 2ZC6B 1IOUA 4GLQA 3Q81A 2V1ZA 4Z9QA 1KVLA 4WZ5C 2IWCA 1N9OA 4OP5A 4LLOB 3O88A 2XGNA 4BD1A 1TS6A 4NKPA 4K0XA 5GHXA 4BJPA 1T18A 2Z2MB 3VMAA 1N4OA 4OPRA 5FAOA 3EQVA 4CPKA 3C4OA 1XJ3A 3JPUA 5DF8A 3BFEA 3B3XA 4OQIA 3BYDA 1F2KA 4IBRA 5E2EA 1G5UA 3RXXA 4ESPA 1YQSA 3ZG5A 2O99A 4FH2A 3CLOA 3K3DA 5HWVA 2DMWA 3Q82A 3LR4A 5L07A 3PHYA 3UNWA 1XPBA 2EWWA 3MJQA 5IS1A 4D60A 5GLDA 1UWPX 3IBRA 1MWUA 1S1YA 1RP5A 4OOLA 4OKPA 3W8KA 5KSHA 5F69A 2EXAA
chains in the Genus database with same CATH topology
4R3BA 1ALQA 1FCMA 1HZOA 4LENA 4KG6A 1AXBA 2C5WB 4WBGA 2JC7A 2ZQ9A 3CG5A 2XEPA 3OPRA 4S2LA 5L2FA 4OVDA 4KZ4A 3VP2A 2JCHA 5FQ9A 3UPPA 3W4QA 1MWTA 3WRZA 1BT5A 3CZDA 2H10A 1CK3A 4GDNA 3NC8A 4KZ3A 3ZNYA 1G68A 3G4PA 2FFYA 5IHVA 3VSLA 1CEGA 1IKIA 3LY4A 2R9WA 3LO7A 4X69A 4GN2A 4WM9A 2DCFA 4NETA 5FAPA 1O7EA 3MFDA 4JXWA 1IYOA 5CTNA 4KZ8A 3G35A 5JYOA 1NRFA 4WZ4A 4OQ0A 3VSKA 2WADA 3AGDA 4P6BA 5EVIC 5FI7A 5CGXA 1K55A 5A93A 3A3JA 4YINA 1W5DA 3UPNA 3ZDJA 1YT4A 3N8LA 4BL3A 4U0XA 4DE3A 1EROA 4S2KA 1N9BA 4U3TA 5A91A 2EFUA 2IWDA 1LL5A 1M40A 3ZGAB 3IHAA 5TGFA 2XQZA 4Y0OA 4ZBEA 4MBKA 1L0FA 5GLBA 4D2OA 1K54A 4EBNA 3IH8A 5FI6A 1KDWA 2CC1A 4A5RA 3HLEA 1E3UD 5GHZA 4GD6A 4IVIA 4P0MA 3OPLA 2ZQAA 4QU3A 3VOZA 2VGJA 1U60A 1GA9A 1FSYA 2DNSA 3IF6B 2XH9A 4EBLA 4WZ5A 4KZ7A 2OLUA 5M19A 3CJMA 2IWBA 5FI2A 4JPMA 3FWLA 3IQAA 4JF5A 1GHMA 3G31A 4B4ZA 1K4FA 1FOFA 3ZG9B 2P74A 3FKVA 1TDGA 3ZVTA 4E6XA 3UN7A 3MKFA 4BL2A 5HAPA 2ZM8A 1K25A 5HFOA 1DY6A 1GA0A 4N1HA 1MWSA 2EXBA 3UO9A 2VGKA 2XR0A 3BLMA 3PAGA 4WMCD 4OQGA 1ERQA 2OSUA 3C5AA 1W8QA 1BUEA 1E3UA 4KZ5A 4KQRA 2J8YA 5EECA 5CRFA 3TG9A 3HUOA 1FR1A 3OPPA 4QD4A 1JWPA 4K0WA 3BEBA 1Q2PA 3IHBA 1NY0A 1BLSA 2C6WB 4JXGA 4KZBA 4OOMA 3PBQA 4K91A 1K6SA 1RCJA 1HVBA 3MXRA 5DVAA 2ZLYA 4E3LA 3MKEA 4QY5A 1EWZA 4LV1A 4KQOA 4UA6A 3LEZA 1XP4A 2HDUA 3MZFA 4C6YA 1I2SA 4HBUA 1VM1A 5CXWA 2G2UA 1RGYA 4JXVA 5F1FA 2Y2LA 5CECA 1VQQA 4DDYA 2WAFA 4OLDA 2XD1A 5AQBA 1BLHA 1K57A 4IEDA 5HARA 4GOGA 3NBLA 3DTMA 3G34A 3GQZA 1PW8A 3NY4A 4KQQA 2QPNA 3IXDA 4P87A 3C7VA 2A49A 1XA1A 4GD8A 4UA9A 3Q7VA 5AQ7A 3VP1A 5M18A 5CGWA 5F82A 2ZQCA 5FQQA 1HD8A 5FA7A 2Y2MA 2ZQ8A 1PIOA 1PZPA 4QY6A 1BULA 3UPOA 3VFHA 5EPHA 5HX9A 3O3VA 3WS2A 3HLCA 1RGZA 4Y7PA 4U0TA 5EVID 2Y2JA 1SDEA 1E25A 4OPQA 1JWZA 3BFFA 4LCLA 3UY6A 1PWGA 4JF4A 4MLLA 4ZJ3A 3SS5A 1KGEA 4JF6A 3VP4A 4WYYA 4RVAA 5F1GA 1WYCA 2ZMAA 2OLVA 2WGVA 5FATA 5JYPA 2Y2IA 3HLBA 4WELA 2ZD8A 4UA7A 3SH9A 1PI4A 1IYPA 3VOYA 2EX2A 1PWCA 1NYYA 4JLFA 3ZG8B 2Y2KA 4DE1A 2BLSA 2Y2QA 2WYXA 3C4PA 3GTCA 5CHMA 3BFGA 4PM7A 1YLWA 5FQKA 3ZVWA 1SDNA 4RA7A 1ERMA 1C3BA 4F94A 3Q07A 5GLAA 3IF6C 1YLYA 4N1XA 3IH9A 1ESUA 2J9PA 4DE2A 5KMWA 2H5SA 1BLPA 3WS4A 3SH8A 3S22A 3N8RA 2WKIA 4DXBA 3Q1FA 2EX8A 2ZC4B 3HLGA 2RL3A 5HL1A 4ZTKA 3C7UA 5E2FA 4GDBA 3HLWA 2EFXA 1L2SA 2J9OA 1NZOA 1E4DA 2Y2PA 3A3DA 4HESA 5GL9A 3A3IA 1EI5A 3G32A 3V50A 4KZ9A 4S2NC 5U47A 2J7VA 4FSFA 4WEKA 4PM6A 3WRTA 1NZUA 3DW0A 3PTEA 3N7WA 4ZDXA 4R23A 1DJAA 1FSWA 3I7JA 1KDSA 4LV2A 1BSGA 4JKTA 3PBRA 2PBYA 4ID4A 5EOOA 4ZJ2A 3EQUA 1QMEA 5FASA 4UHUA 3AGEA 3Q7VB 3V3RA 4BD0A 3HVFA 2HDSA 3G30A 3WWXA 3HLDA 1ES5A 4KENB 4S2MA 5FDHA 3ZG0A 1XX2A 4X56A 3OPHA 3HUNA 2JBFA 4R4RA 3GSGA 5DF9A 5M1AA 3MZDA 4GB7A 2XF3A 4XXRA 1M6KA 1XGJA 3FKWA 3MXSA 4FD8A 4EV4A 1BLCA 3BFDA 4PMAA 3V39A 3UE1A 4C3QA 4DRTA 5CEBA 1K55C 1MWRA 1CI8A 4E3MA 1J9MA 1YLJA 3QNBA 3OCLA 4LCMA 3A3FA 1LLBA 3HL9A 3UDIA 4R4SA 1WE4A 3N8SA 3ZCZA 5GLCA 2E8IA 1K54C 5AQ9A 3E2LA 2ZM2A 2EX9A 4UAAA 5HAQA 3Q7ZA 3PAEA 1I5QA 2Y2OA 3CMZA 3IXBA 4OLGA 3VP0A 1O07A 5TFQA 2PU4A 1KVMA 3IWQA 2Q9MA 3NIAA 4QB8A 1K4EA 4C75A 3IWOA 5DTTA 1XXMA 4E6WA 1W79A 3OZHA 2ZJ9A 4WMCA 5EOEA 4HEFA 1LHYA 4CJNA 1DJBA 4JXSA 2Y55A 4E3NA 4KZ6A 2B5RA 3A3EA 5DF7A 1KE4A 4H8RA 5FQMA 3HUMA 4LV0A 1ZKJA 4KG2A 4OQHA 5I94A 3IXGA 4MBHA 1XKZA 5TR7A 5E43A 1MBLA 1L0GA 2HDRA 5E2HA 1CI9A 2V20A 3ZHHA 5FQJA 1MXOA 4B88A 2HDQA 3SH7A 1YLTA 3ITAA 4E3IA 1ES4A 1S0WA 1YLPA 2WKEA 1K56D 4EBPA 3PBSA 4X68A 4S2PA 3HBRA 5A92A 3IWIA 4M3KA 1KGFA 1S6RA 1K38A 1IKGA 3BECA 5CHJA 1MY8A 3SOIA 3M2KA 4DXCA 2XDMA 1MPLA 3ISGA 3GMWA 2ZQ7A 3SS4A 3S1YA 1OMEA 1Q2QA 5GHYA 2WKHA 4DKIA 1IYSA 1KE3A 1QMFA 3HLFA 1IEMA 2WAEA 3N4IA 4N9LA 1TDLA 4OPYA 3SS3A 4OOYA 1GHIA 1JWVA 1NXYA 3M2JA 3GV9A 5FQIA 1K57C 2A3UA 5HAIA 3W4OA 4Q8IA 2JE5A 4IVKA 3RXWA 3UDFA 1H8ZA 1ZG6A 4JBFA 3P98A 3HREA 3NI9A 1K6RA 2ZM0A 4LV3A 5EVIA 2WUQA 2Y2NA 3VP3A 4E3JA 4EQIA 1WYBA 5KZHA 2EX6A 4E3KA 3O87A 4EUZA 1JTDA 1G6AA 3OCNA 3S4XA 5D3OA 2XFTA 3DWKA 2Y59A 2WZZA 1MKIA 4OPZA 2H0TA 3QHYA 2Z2LB 3NDEA 1I2WA 4XUXA 3MZEA 1XA7A 4FCFA 3BRMA 4QJGA 1IELA 5EVLA 2ZC7A 5F83A 4GKUA 2FFFB 1PW1A 3AGFA 4OONA 2BG1A 3WS0A 5J8XA 1IYQA 2HP9A 4N92A 1PI5A 5E2GA 2Y4AA 3O86A 4RX3A 1NYMA 2X02A 3ZG7B 5FAQA 5KSCA 3V3SA 2UWXA 4MEZA 5CEDA 4KG5A 1PZOA 2QMIA 4HBTA 4Y0TA 3ZNTA 3W4PA 4PPRA 2G2WA 2H0YA 2WZXA 5CTMA 3MBZA 1W7FA 5EUAA 3BM6A 3M6HA 2DRWA 3GR2A 3VFFA 1TVFA 1YMXA 4X6TA 4ZAMA 1ES3A 5DTSA 4R1GA 3E2KA 5CHUA 3LY3A 3UDXA 4FH4A 1KE0A 5CERA 3FV7A 3IT9A 3TSGA 2Y2GA 1BZAA 4O7DA 3IXHA 3FZCA 5BOHA 1PWDA 2WGWA 2I72A 2P9VA 2QZ6A 1YLZA 2RCXA 3D4FA 2R9XA 1ONHA 4ZJ1A 4L0LA 1FR6A 1SKFA 2X71A 1L0DA 3PBNA 3G2ZA 4YFMA 5HW3A 1ONGA 1XGIA 1PYYA 2ZC3B 3PBOA 5FSRA 4R0QA 2HP5A 2Y91A 3QNCA 2XD5A 4PM5A 5DTKA 2HP6A 3DWZA 1SHVA 2Q9NA 3N6IA 4BQMA 3NCKA 3FYZA 2V2FF 4OP8A 3LCEA 4NK3A 4QHCA 1GCEA 4Y0UA 2ZC6B 3OC2A 1Y54A 3V5MA 3Q81A 2X01A 1YM1A 4S2IA 2V1ZA 4Z9QA 5EVIB 4BLMA 1ESIA 1KVLA 4PM8A 2ZC5B 4WZ5C 3UE3A 2IWCA 3UE0A 1ES2A 1ZC2A 1SCWA 1Z6FA 4OP5A 2WGIA 2XLNA 1CEFA 2XGNA 1BTLA 1DJCA 2XFSA 3O88A 4KZAA 4BD1A 4K0XA 1LI9A 4OH0A 1YMSA 5GHXA 4BJPA 2PU2A 2Z2MB 4E3OA 2XK1A 3IF5A 1N4OA 3VMAA 4OPRA 1LL9A 1KGGA 5FAOA 3EQVA 4RX2A 5EE8A 4DDSA 4PM9A 3RJUA 3C4OA 4CPKA 1W8YA 4BENA 4IBXA 4P85A 2ZQDA 4R3JA 1L0EA 2Y2HA 1ZG4A 5DF8A 2GDNA 1LI0A 3BFEA 5G18A 3B3XA 4X55A 1JVJA 3WS5A 4OQIA 1NJ4A 3BYDA 1TEMA 4S2JA 4IBRA 1H8YA 5E2EA 1FCOA 1HTZA 3RXXA 4DF6A 3P09A 3IF6A 4N9KA 2HPBA 3GVBA 1YQSA 3GRJA 1FCNA 3ZG5A 4FH2A 4DE0A 4GZBA 3TOIA 3ZFZA 1H5XA 1FQGA 3Q82A 3UNWA 1XPBA 5A90A 3NDGA 1JTGA 3WS1A 5GLDA 4XUZA 4B4XA 2WGWB 2P9VB 3G2YA 3ITBA 1GHPA 5AQAA 4GNUA 1MWUA 5CGSA 4X53A 4WEJA 3JYIA 1K56A 3PBTA 1RP5A 3M6BA 4MBFA 4OOLA 4OKPA 4RYEA 3W8KA 3BLSA 4S2OA 4MNRA 4S2NA 5KSHA 3BFCA 2WK0A 2OV5A 4EWFA 2EXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R3B A;  1ALQ A;  1FCM A;  1HZO A;  4LEN A;  4KG6 A;  1AXB A;  2C5W B;  4WBG A;  2JC7 A;  2ZQ9 A;  3CG5 A;  2XEP A;  3OPR A;  4S2L A;  5L2F A;  4OVD A;  4KZ4 A;  3VP2 A;  2JCH A;  5FQ9 A;  3UPP A;  3W4Q A;  1MWT A;  3WRZ A;  1BT5 A;  3CZD A;  2H10 A;  1CK3 A;  4GDN A;  3NC8 A;  4KZ3 A;  3ZNY A;  1G68 A;  3G4P A;  2FFY A;  5IHV A;  3VSL A;  1CEG A;  1IKI A;  3LY4 A;  2R9W A;  3LO7 A;  4X69 A;  4GN2 A;  4WM9 A;  2DCF A;  4NET A;  5FAP A;  1O7E A;  3MFD A;  4JXW A;  1IYO A;  5CTN A;  4KZ8 A;  3G35 A;  5JYO A;  1NRF A;  4WZ4 A;  4OQ0 A;  3VSK A;  2WAD A;  3AGD A;  4P6B A;  5EVI C;  5FI7 A;  5CGX A;  1K55 A;  5A93 A;  3A3J A;  4YIN A;  1W5D A;  3UPN A;  3ZDJ A;  1YT4 A;  3N8L A;  4BL3 A;  4U0X A;  4DE3 A;  1ERO A;  4S2K A;  1N9B A;  4U3T A;  5A91 A;  2EFU A;  2IWD A;  1LL5 A;  1M40 A;  3ZGA B;  3IHA A;  5TGF A;  2XQZ A;  4Y0O A;  4ZBE A;  4MBK A;  1L0F A;  5GLB A;  4D2O A;  1K54 A;  4EBN A;  3IH8 A;  5FI6 A;  1KDW A;  2CC1 A;  4A5R A;  3HLE A;  1E3U D;  5GHZ A;  4GD6 A;  4IVI A;  4P0M A;  3OPL A;  2ZQA A;  4QU3 A;  3VOZ A;  2VGJ A;  1U60 A;  1GA9 A;  1FSY A;  2DNS A;  3IF6 B;  2XH9 A;  4EBL A;  4WZ5 A;  4KZ7 A;  2OLU A;  5M19 A;  3CJM A;  2IWB A;  5FI2 A;  4JPM A;  3FWL A;  3IQA A;  4JF5 A;  1GHM A;  3G31 A;  4B4Z A;  1K4F A;  1FOF A;  3ZG9 B;  2P74 A;  3FKV A;  1TDG A;  3ZVT A;  4E6X A;  3UN7 A;  3MKF A;  4BL2 A;  5HAP A;  2ZM8 A;  1K25 A;  5HFO A;  1DY6 A;  1GA0 A;  4N1H A;  1MWS A;  2EXB A;  3UO9 A;  2VGK A;  2XR0 A;  3BLM A;  3PAG A;  4WMC D;  4OQG A;  1ERQ A;  2OSU A;  3C5A A;  1W8Q A;  1BUE A;  1E3U A;  4KZ5 A;  4KQR A;  2J8Y A;  5EEC A;  5CRF A;  3TG9 A;  3HUO A;  1FR1 A;  3OPP A;  4QD4 A;  1JWP A;  4K0W A;  3BEB A;  1Q2P A;  3IHB A;  1NY0 A;  1BLS A;  2C6W B;  4JXG A;  4KZB A;  4OOM A;  3PBQ A;  4K91 A;  1K6S A;  1RCJ A;  1HVB A;  3MXR A;  5DVA A;  2ZLY A;  4E3L A;  3MKE A;  4QY5 A;  1EWZ A;  4LV1 A;  4KQO A;  4UA6 A;  3LEZ A;  1XP4 A;  2HDU A;  3MZF A;  4C6Y A;  1I2S A;  4HBU A;  1VM1 A;  5CXW A;  2G2U A;  1RGY A;  4JXV A;  5F1F A;  2Y2L A;  5CEC A;  1VQQ A;  4DDY A;  2WAF A;  4OLD A;  2XD1 A;  5AQB A;  1BLH A;  1K57 A;  4IED A;  5HAR A;  4GOG A;  3NBL A;  3DTM A;  3G34 A;  3GQZ A;  1PW8 A;  3NY4 A;  4KQQ A;  2QPN A;  3IXD A;  4P87 A;  3C7V A;  2A49 A;  1XA1 A;  4GD8 A;  4UA9 A;  3Q7V A;  5AQ7 A;  3VP1 A;  5M18 A;  5CGW A;  5F82 A;  2ZQC A;  5FQQ A;  1HD8 A;  5FA7 A;  2Y2M A;  2ZQ8 A;  1PIO A;  1PZP A;  4QY6 A;  1BUL A;  3UPO A;  3VFH A;  5EPH A;  5HX9 A;  3O3V A;  3WS2 A;  3HLC A;  1RGZ A;  4Y7P A;  4U0T A;  5EVI D;  2Y2J A;  1SDE A;  1E25 A;  4OPQ A;  1JWZ A;  3BFF A;  4LCL A;  3UY6 A;  1PWG A;  4JF4 A;  4MLL A;  4ZJ3 A;  3SS5 A;  1KGE A;  4JF6 A;  3VP4 A;  4WYY A;  4RVA A;  5F1G A;  1WYC A;  2ZMA A;  2OLV A;  2WGV A;  5FAT A;  5JYP A;  2Y2I A;  3HLB A;  4WEL A;  2ZD8 A;  4UA7 A;  3SH9 A;  1PI4 A;  1IYP A;  3VOY A;  2EX2 A;  1PWC A;  1NYY A;  4JLF A;  3ZG8 B;  2Y2K A;  4DE1 A;  2BLS A;  2Y2Q A;  2WYX A;  3C4P A;  3GTC A;  5CHM A;  3BFG A;  4PM7 A;  1YLW A;  5FQK A;  3ZVW A;  1SDN A;  4RA7 A;  1ERM A;  1C3B A;  4F94 A;  3Q07 A;  5GLA A;  3IF6 C;  1YLY A;  4N1X A;  3IH9 A;  1ESU A;  2J9P A;  4DE2 A;  5KMW A;  2H5S A;  1BLP A;  3WS4 A;  3SH8 A;  3S22 A;  3N8R A;  2WKI A;  4DXB A;  3Q1F A;  2EX8 A;  2ZC4 B;  3HLG A;  2RL3 A;  5HL1 A;  4ZTK A;  3C7U A;  5E2F A;  4GDB A;  3HLW A;  2EFX A;  1L2S A;  2J9O A;  1NZO A;  1E4D A;  2Y2P A;  3A3D A;  4HES A;  5GL9 A;  3A3I A;  1EI5 A;  3G32 A;  3V50 A;  4KZ9 A;  4S2N C;  5U47 A;  2J7V A;  4FSF A;  4WEK A;  4PM6 A;  3WRT A;  1NZU A;  3DW0 A;  3PTE A;  3N7W A;  4ZDX A;  4R23 A;  1DJA A;  1FSW A;  3I7J A;  1KDS A;  4LV2 A;  1BSG A;  4JKT A;  3PBR A;  2PBY A;  4ID4 A;  5EOO A;  4ZJ2 A;  3EQU A;  1QME A;  5FAS A;  4UHU A;  3AGE A;  3Q7V B;  3V3R A;  4BD0 A;  3HVF A;  2HDS A;  3G30 A;  3WWX A;  3HLD A;  1ES5 A;  4KEN B;  4S2M A;  5FDH A;  3ZG0 A;  1XX2 A;  4X56 A;  3OPH A;  3HUN A;  2JBF A;  4R4R A;  3GSG A;  5DF9 A;  5M1A A;  3MZD A;  4GB7 A;  2XF3 A;  4XXR A;  1M6K A;  1XGJ A;  3FKW A;  3MXS A;  4FD8 A;  4EV4 A;  1BLC A;  3BFD A;  4PMA A;  3V39 A;  3UE1 A;  4C3Q A;  4DRT A;  5CEB A;  1K55 C;  1MWR A;  1CI8 A;  4E3M A;  1J9M A;  1YLJ A;  3QNB A;  3OCL A;  4LCM A;  3A3F A;  1LLB A;  3HL9 A;  3UDI A;  4R4S A;  1WE4 A;  3N8S A;  3ZCZ A;  5GLC A;  2E8I A;  1K54 C;  5AQ9 A;  3E2L A;  2ZM2 A;  2EX9 A;  4UAA A;  5HAQ A;  3Q7Z A;  3PAE A;  1I5Q A;  2Y2O A;  3CMZ A;  3IXB A;  4OLG A;  3VP0 A;  1O07 A;  5TFQ A;  2PU4 A;  1KVM A;  3IWQ A;  2Q9M A;  3NIA A;  4QB8 A;  1K4E A;  4C75 A;  3IWO A;  5DTT A;  1XXM A;  4E6W A;  1W79 A;  3OZH A;  2ZJ9 A;  4WMC A;  5EOE A;  4HEF A;  1LHY A;  4CJN A;  1DJB A;  4JXS A;  2Y55 A;  4E3N A;  4KZ6 A;  2B5R A;  3A3E A;  5DF7 A;  1KE4 A;  4H8R A;  5FQM A;  3HUM A;  4LV0 A;  1ZKJ A;  4KG2 A;  4OQH A;  5I94 A;  3IXG A;  4MBH A;  1XKZ A;  5TR7 A;  5E43 A;  1MBL A;  1L0G A;  2HDR A;  5E2H A;  1CI9 A;  2V20 A;  3ZHH A;  5FQJ A;  1MXO A;  4B88 A;  2HDQ A;  3SH7 A;  1YLT A;  3ITA A;  4E3I A;  1ES4 A;  1S0W A;  1YLP A;  2WKE A;  1K56 D;  4EBP A;  3PBS A;  4X68 A;  4S2P A;  3HBR A;  5A92 A;  3IWI A;  4M3K A;  1KGF A;  1S6R A;  1K38 A;  1IKG A;  3BEC A;  5CHJ A;  1MY8 A;  3SOI A;  3M2K A;  4DXC A;  2XDM A;  1MPL A;  3ISG A;  3GMW A;  2ZQ7 A;  3SS4 A;  3S1Y A;  1OME A;  1Q2Q A;  5GHY A;  2WKH A;  4DKI A;  1IYS A;  1KE3 A;  1QMF A;  3HLF A;  1IEM A;  2WAE A;  3N4I A;  4N9L A;  1TDL A;  4OPY A;  3SS3 A;  4OOY A;  1GHI A;  1JWV A;  1NXY A;  3M2J A;  3GV9 A;  5FQI A;  1K57 C;  2A3U A;  5HAI A;  3W4O A;  4Q8I A;  2JE5 A;  4IVK A;  3RXW A;  3UDF A;  1H8Z A;  1ZG6 A;  4JBF A;  3P98 A;  3HRE A;  3NI9 A;  1K6R A;  2ZM0 A;  4LV3 A;  5EVI A;  2WUQ A;  2Y2N A;  3VP3 A;  4E3J A;  4EQI A;  1WYB A;  5KZH A;  2EX6 A;  4E3K A;  3O87 A;  4EUZ A;  1JTD A;  1G6A A;  3OCN A;  3S4X A;  5D3O A;  2XFT A;  3DWK A;  2Y59 A;  2WZZ A;  1MKI A;  4OPZ A;  2H0T A;  3QHY A;  2Z2L B;  3NDE A;  1I2W A;  4XUX A;  3MZE A;  1XA7 A;  4FCF A;  3BRM A;  4QJG A;  1IEL A;  5EVL A;  2ZC7 A;  5F83 A;  4GKU A;  2FFF B;  1PW1 A;  3AGF A;  4OON A;  2BG1 A;  3WS0 A;  5J8X A;  1IYQ A;  2HP9 A;  4N92 A;  1PI5 A;  5E2G A;  2Y4A A;  3O86 A;  4RX3 A;  1NYM A;  2X02 A;  3ZG7 B;  5FAQ A;  5KSC A;  3V3S A;  2UWX A;  4MEZ A;  5CED A;  4KG5 A;  1PZO A;  2QMI A;  4HBT A;  4Y0T A;  3ZNT A;  3W4P A;  4PPR A;  2G2W A;  2H0Y A;  2WZX A;  5CTM A;  3MBZ A;  1W7F A;  5EUA A;  3BM6 A;  3M6H A;  2DRW A;  3GR2 A;  3VFF A;  1TVF A;  1YMX A;  4X6T A;  4ZAM A;  1ES3 A;  5DTS A;  4R1G A;  3E2K A;  5CHU A;  3LY3 A;  3UDX A;  4FH4 A;  1KE0 A;  5CER A;  3FV7 A;  3IT9 A;  3TSG A;  2Y2G A;  1BZA A;  4O7D A;  3IXH A;  3FZC A;  5BOH A;  1PWD A;  2WGW A;  2I72 A;  2P9V A;  2QZ6 A;  1YLZ A;  2RCX A;  3D4F A;  2R9X A;  1ONH A;  4ZJ1 A;  4L0L A;  1FR6 A;  1SKF A;  2X71 A;  1L0D A;  3PBN A;  3G2Z A;  4YFM A;  5HW3 A;  1ONG A;  1XGI A;  1PYY A;  2ZC3 B;  3PBO A;  5FSR A;  4R0Q A;  2HP5 A;  2Y91 A;  3QNC A;  2XD5 A;  4PM5 A;  5DTK A;  2HP6 A;  3DWZ A;  1SHV A;  2Q9N A;  3N6I A;  4BQM A;  3NCK A;  3FYZ A;  2V2F F;  4OP8 A;  3LCE A;  4NK3 A;  4QHC A;  1GCE A;  4Y0U A;  2ZC6 B;  3OC2 A;  1Y54 A;  3V5M A;  3Q81 A;  2X01 A;  1YM1 A;  4S2I A;  2V1Z A;  4Z9Q A;  5EVI B;  4BLM A;  1ESI A;  1KVL A;  4PM8 A;  2ZC5 B;  4WZ5 C;  3UE3 A;  2IWC A;  3UE0 A;  1ES2 A;  1ZC2 A;  1SCW A;  1Z6F A;  4OP5 A;  2WGI A;  2XLN A;  1CEF A;  2XGN A;  1BTL A;  1DJC A;  2XFS A;  3O88 A;  4KZA A;  4BD1 A;  4K0X A;  1LI9 A;  4OH0 A;  1YMS A;  5GHX A;  4BJP A;  2PU2 A;  2Z2M B;  4E3O A;  2XK1 A;  3IF5 A;  1N4O A;  3VMA A;  4OPR A;  1LL9 A;  1KGG A;  5FAO A;  3EQV A;  4RX2 A;  5EE8 A;  4DDS A;  4PM9 A;  3RJU A;  3C4O A;  4CPK A;  1W8Y A;  4BEN A;  4IBX A;  4P85 A;  2ZQD A;  4R3J A;  1L0E A;  2Y2H A;  1ZG4 A;  5DF8 A;  2GDN A;  1LI0 A;  3BFE A;  5G18 A;  3B3X A;  4X55 A;  1JVJ A;  3WS5 A;  4OQI A;  1NJ4 A;  3BYD A;  1TEM A;  4S2J A;  4IBR A;  1H8Y A;  5E2E A;  1FCO A;  1HTZ A;  3RXX A;  4DF6 A;  3P09 A;  3IF6 A;  4N9K A;  2HPB A;  3GVB A;  1YQS A;  3GRJ A;  1FCN A;  3ZG5 A;  4FH2 A;  4DE0 A;  4GZB A;  3TOI A;  3ZFZ A;  1H5X A;  1FQG A;  3Q82 A;  3UNW A;  1XPB A;  5A90 A;  3NDG A;  1JTG A;  3WS1 A;  5GLD A;  4XUZ A;  4B4X A;  2WGW B;  2P9V B;  3G2Y A;  3ITB A;  1GHP A;  5AQA A;  4GNU A;  1MWU A;  5CGS A;  4X53 A;  4WEJ A;  3JYI A;  1K56 A;  3PBT A;  1RP5 A;  3M6B A;  4MBF A;  4OOL A;  4OKP A;  4RYE A;  3W8K A;  3BLS A;  4S2O A;  4MNR A;  4S2N A;  5KSH A;  3BFC A;  2WK0 A;  2OV5 A;  4EWF A;  2EXA A; 
#chains in the Genus database with same CATH topology
 3FC7 A;  1HZO A;  2ZQ9 A;  1K0K A;  2XEP A;  4S2L A;  5L2F A;  2JN7 A;  4KZ4 A;  5FQ9 A;  3WRZ A;  3W4Q A;  5EFW A;  4DJ2 A;  1ACF A;  1CK3 A;  3NC8 A;  4KZ3 A;  2FFY A;  1CEG A;  4GN2 A;  2GJ3 A;  4WM9 A;  5CTN A;  4ME4 A;  3G35 A;  3VSK A;  2WAD A;  3ZQ5 A;  5HD3 A;  1MZU A;  3PXP A;  3L9K A;  1YT4 A;  3FG8 A;  1TD5 A;  3IS2 B;  4U3T A;  2KX6 A;  5TGF A;  1CJF A;  4ZBE A;  4EBN A;  4MBK A;  4NXG A;  1KDW A;  4A5R A;  2VV6 A;  3KO6 A;  4QU3 A;  1GA9 A;  3IF6 B;  4KZ7 A;  2OLU A;  4JPM A;  3ZG9 B;  3NEC A;  3FKV A;  4E04 A;  3UN7 A;  1T1B A;  2ZM8 A;  5HFO A;  1DY6 A;  3PYP A;  3UO9 A;  3CAX A;  4HP4 A;  4WMC D;  1ERQ A;  1W8Q A;  5HDC A;  2J8Y A;  5HPF A;  5CRF A;  3FPV A;  3U2A A;  1NY0 A;  2C6W B;  4JXG A;  4KZB A;  3TW8 A;  1HVB A;  4EER A;  1J3W A;  2HF6 A;  4KQO A;  3LEZ A;  4C6Y A;  5AVF A;  2QYB A;  4HBU A;  1VM1 A;  2G2U A;  2JHE A;  2Y2L A;  1VQQ A;  3E0Y A;  2WAF A;  2XD1 A;  1K57 A;  4IED A;  3DTM A;  2H28 A;  3GQZ A;  4KQQ A;  2B18 A;  2A49 A;  3VP1 A;  3TRC A;  5CGW A;  4L9E A;  4XT2 A;  4I38 A;  5FA7 A;  3KYE A;  2Y2M A;  4QY6 A;  4GJ4 A;  1BUL A;  3O3V A;  4Y7P A;  2VZW A;  1E25 A;  2J80 A;  3UY6 A;  2JKR I;  4L9F A;  1N9L A;  3K2N A;  3HLB A;  3EEA A;  4WEL A;  3LUQ A;  4LRY C;  3ZG8 B;  5IT5 A;  2P04 A;  4ETZ A;  1DP9 A;  2Y2K A;  4MCW A;  3NOT C;  4CQH A;  2WYX A;  3UB8 A;  4PM7 A;  1YLW A;  1YLY A;  2HJE A;  4NG2 A;  2J9P A;  2H5S A;  1BLP A;  3N8R A;  1N9N A;  3Q1F A;  2EX8 A;  3HLG A;  1OTA A;  3K3C A;  3T4Q A;  1OTB A;  3A3D A;  2JKG A;  1EI5 A;  2PYP A;  5U47 A;  4X1M A;  3LIE A;  2HGV A;  4R23 A;  1FSW A;  3I7J A;  1KDS A;  4LV2 A;  3PBR A;  2PBY A;  4I3J A;  3EQU A;  1GSW A;  3KX0 X;  3HJI A;  3WWX A;  1S4R A;  5MC7 A;  4KEN B;  1VEU A;  4X25 A;  1XX2 A;  4X56 A;  3HUN A;  4II7 A;  3MZD A;  4XXR A;  1M6K A;  3MXS A;  4DRT A;  3T1R A;  1CI8 A;  1J9M A;  1NRJ A;  4LCM A;  3UE6 A;  1W63 M;  4H6J B;  3HL9 A;  4R4S A;  3UME A;  2G7U A;  2E8I A;  2W1T B;  2UV0 E;  3Q7Z A;  1I5Q A;  2HJ9 C;  3IWQ A;  3NIA A;  4QB8 A;  4C75 A;  5DTT A;  1XXM A;  1W79 A;  4HEF A;  2J3T C;  4E3N A;  2YKF A;  4RQ9 A;  4H8R A;  1ZKJ A;  4MBH A;  3U4L P;  3E4P A;  1L0G A;  5DFY A;  1CI9 A;  4GHI B;  5FQJ A;  3LR3 A;  3SH7 A;  3ITA A;  4I39 A;  1YLP A;  1K56 D;  1UWN X;  1Y4O A;  4I3I A;  3IWI A;  3HCY A;  1KGF A;  1K38 A;  4GS9 B;  4DXC A;  2XDM A;  1MPL A;  3ISG A;  2ZQ7 A;  3OBF A;  1IYS A;  1QMF A;  3M2J A;  4IVK A;  3ULF A;  2ZBB A;  4JBF A;  1HLU P;  2W3F A;  3C8C A;  1K6R A;  2ZM0 A;  4LV3 A;  5EVI A;  4EQI A;  4E3J A;  1WYB A;  2ZL1 A;  4CLC A;  1TS0 A;  5HDD A;  4Q0J A;  3S4X A;  5D3O A;  1L3L A;  4B9O A;  2Z2L B;  1I2W A;  1XA7 A;  4FCF A;  3CHW P;  2W3G A;  2FFF B;  2Y8H A;  3AGF A;  2W3E A;  1IYQ A;  2Y4A A;  2X02 A;  2UWX A;  5CED A;  1NLY A;  2WZX A;  3IX3 A;  2VV7 A;  3T4L A;  5EUA A;  3VFF A;  1A0K A;  4X6T A;  4ZAM A;  1ES3 A;  3LR0 A;  4YWZ A;  2J3T D;  5CER A;  3IT9 A;  1BZA A;  4O7D A;  3FZC A;  1PWD A;  2P9V A;  3H82 A;  3D4F A;  4ZJ1 A;  3G2Z A;  4YFM A;  1ONG A;  1PYY A;  1S67 L;  4R0Q A;  2Y91 A;  2Q9N A;  3NCK A;  2KOI A;  3FYZ A;  2L0W A;  2V2F F;  2VEA A;  2VK3 A;  3LCE A;  4NK3 A;  4Y0U A;  3R4K A;  5K5B A;  3KSI A;  2ZC5 B;  3UE3 A;  2XLN A;  2XFS A;  5AVE A;  1LI9 A;  2EA9 A;  2PU2 A;  4EET B;  5HWT A;  4E3O A;  1Y28 A;  1LL9 A;  1KGG A;  4JGQ A;  5EE8 A;  4HJ6 A;  4CLC E;  4BEN A;  1SKO A;  2ZQD A;  1L0E A;  5G4Z A;  2XA7 S;  4UQI M;  4HIA A;  1JVJ A;  4B93 A;  3CUE A;  3RH8 B;  1TEM A;  4S2J A;  2BAS A;  4F3L A;  1HTZ A;  3T4S A;  3P09 A;  4N9K A;  4AFI A;  3GRJ A;  4GZB A;  2NUT C;  2V8C A;  5CX7 A;  3ZFZ A;  4HHD A;  3C30 A;  1JTG A;  4B4X A;  4XUZ A;  2WGW B;  3G2Y A;  3ITB A;  4L9G A;  4X53 A;  4H6J A;  4Y3I A;  4S2N A;  2WK0 A;  4GW9 A;  4YOF A;  4EWF A;  3S7N A;  4KG6 A;  2C5W B;  3CG5 A;  3BY8 A;  3UPP A;  1OJ5 A;  3VSL A;  4LPZ A;  3T4T A;  2JKT I;  4NET A;  4JXW A;  4PKY A;  2PD7 A;  4IUK A;  4OQ0 A;  3MS6 A;  3AGD A;  1VET B;  1VHM A;  3QP5 A;  1H0M A;  5TBM A;  5A93 A;  3ZDJ A;  4BMW A;  3F1N A;  1N9B A;  1LL5 A;  3IHA A;  2AVX A;  4Y0O A;  1L0F A;  1K54 A;  3MQQ A;  1E3U D;  4IVI A;  1PFL A;  4KQD A;  3OPL A;  2W3H A;  1U60 A;  2DNS A;  2XH9 A;  4WZ5 A;  5M19 A;  2IWB A;  3OLO A;  4JF5 A;  1DP8 A;  3G31 A;  4B4Z A;  1FOF A;  2P74 A;  1TDG A;  2Y79 A;  4BL2 A;  3IX8 A;  3LFV A;  3F1P A;  5F68 A;  4N1H A;  1MC0 A;  2OWJ A;  2OSU A;  4KQR A;  5EEC A;  1STZ A;  3HUO A;  1FR1 A;  1JWP A;  1Q2P A;  4OOM A;  4K91 A;  2XRO A;  1K6S A;  1RCJ A;  3QP2 A;  4EEU A;  3MKE A;  3C38 A;  4QY5 A;  1EWZ A;  2HDU A;  4ETX A;  1I2S A;  3GDI A;  3T4J A;  4NXB A;  5CEC A;  1SZV A;  3R7W A;  5AQB A;  4GOG A;  2VV8 A;  4MN6 A;  2L4R A;  3D9Y A;  3SZT A;  4O01 A;  4GD8 A;  3Q7V A;  5M18 A;  5F82 A;  1PIO A;  5J7E A;  3UPO A;  3VFH A;  5EPH A;  5HX9 A;  3FPW A;  1RGZ A;  2Y2J A;  4OPQ A;  4LCL A;  3A0R A;  4ZJ3 A;  1KGE A;  3VP4 A;  5F1G A;  2ZMA A;  2OLV A;  5FAT A;  3SH9 A;  2EX2 A;  4JLF A;  4PAU A;  4DE1 A;  2BLS A;  5CHM A;  3C4P A;  1SDN A;  4RA7 A;  1C3B A;  3Q07 A;  5GLA A;  4N1X A;  2ZMF A;  4DE2 A;  4BWI A;  2WKI A;  3O5Y A;  2RL3 A;  5HL1 A;  3IBJ A;  4GDB A;  4R6L A;  1VB6 A;  2W1R A;  5GL9 A;  3CPT A;  3A3I A;  2VGL S;  3V50 A;  4WEK A;  2CMN A;  1NZU A;  4KUK A;  4HQA A;  1D7E A;  2L1M A;  4ID4 A;  2ZMV A;  5EOO A;  2IA2 A;  4S2M A;  5FDH A;  2JBF A;  4GB7 A;  1G6O A;  2XF3 A;  3T50 A;  3T1X A;  1MWR A;  3UDI A;  4ARZ A;  1WE4 A;  4JGO A;  4YNR A;  4NXF A;  5GLC A;  1V9Z A;  3LID A;  3E2L A;  2EX9 A;  2Y2O A;  3IXB A;  3UB9 A;  5DJT A;  1KVM A;  2Q9M A;  2O0Y A;  1CQA A;  3T4K A;  3S7O A;  2XRN A;  4E6W A;  4CJN A;  4JXS A;  2Y55 A;  2B5R A;  3A3E A;  1KE4 A;  4Y15 A;  3HUM A;  4LV0 A;  4GCZ A;  5I94 A;  3F1O A;  1XKZ A;  5TR7 A;  2HDR A;  5E2H A;  2VLG A;  2V20 A;  3ZHH A;  4B88 A;  2O9B A;  4E3I A;  1ES4 A;  2INW A;  2O9A A;  3HBR A;  5A92 A;  4NEE D;  5A8B A;  1NWZ A;  3SOI A;  2QJ7 A;  2K7S A;  3S1Y A;  5FAS A;  4DKI A;  3N4I A;  4N9L A;  3SS3 A;  4OOY A;  1JWV A;  5L10 A;  1K57 C;  5HAI A;  1ZG6 A;  3HRE A;  5FL3 A;  2VKS A;  2WUQ A;  2A24 B;  3QP8 A;  4E3K A;  3O87 A;  4EUZ A;  2WZZ A;  1MKI A;  4OPZ A;  2HZ5 A;  3VE4 A;  4XUX A;  2JKF A;  3MZE A;  3G6O A;  2PR6 A;  3BRM A;  3HJK A;  4QJG A;  2ZC7 A;  5HPI A;  3E4Q A;  1PW1 A;  5J8X A;  3A0S A;  2BG1 A;  3T1Q B;  2GZA A;  3H7W B;  5E2G A;  3PR6 A;  4G3W A;  5J4E A;  5KSC A;  4MEZ A;  3C2W A;  4KG5 A;  2G2W A;  2Q0O A;  4WF0 A;  2V1B A;  1W7F A;  4HNB A;  2DRW A;  4P6Z M;  5DJU A;  3E2K A;  3UDX A;  1KE0 A;  2R78 A;  3TSG A;  5BOH A;  1YLZ A;  2RCX A;  2R9X A;  4L0L A;  1FR6 A;  4HY8 A;  4EXO A;  5HW3 A;  3LGO A;  3QNC A;  2XD5 A;  1D1J A;  3DWZ A;  3N6I A;  5FEF A;  1H3Q A;  1GCE A;  1Y54 A;  3CIT A;  3LYX A;  3V5M A;  1YM1 A;  3JVV A;  4PM8 A;  5HSQ A;  1ZC2 A;  2OAP 1;  1SCW A;  1GSX A;  2ZOH A;  1DJC A;  3IF5 A;  3MF0 A;  4PM9 A;  3RJU A;  1OT6 A;  4WUJ A;  4R3J A;  3RTY A;  3P7N A;  3IS2 A;  2GDN A;  5G18 A;  4X55 A;  3WS5 A;  4BBU A;  1NLZ A;  5FDS A;  1H8Y A;  2HV1 A;  1FCO A;  2PT7 A;  2Z6D A;  3IF6 A;  2HPB A;  1XJ2 A;  1Z09 A;  1GSV A;  4DE0 A;  3VV4 A;  3TOI A;  1FQG A;  2GX5 A;  3NOU C;  4O8G A;  3KYZ A;  3UB5 P;  3WS1 A;  1GHP A;  2V0W A;  4BBT A;  4GNU A;  5CGS A;  4WEJ A;  3JYI A;  3M6B A;  4M4X A;  4MBF A;  4RYE A;  5HD5 A;  3BLS A;  3BFC A;  2OV5 A;  1DRM A;  1FCM A;  4LEN A;  1AXB A;  3VP2 A;  2K31 A;  1MWT A;  2VA0 A;  2H10 A;  4GDN A;  3ZNY A;  1G68 A;  3G4P A;  5IHV A;  2R9W A;  4R38 A;  2DCF A;  2OWH A;  1IYO A;  4KZ8 A;  5IU1 A;  1NRF A;  4WZ4 A;  4P6B A;  5EVI C;  5CGX A;  1K55 A;  3IX4 A;  1W5D A;  3UPN A;  1LSW A;  3N8L A;  4U0X A;  4CLC C;  4S2K A;  3T4O A;  2LB5 A;  5A91 A;  2XQZ A;  3IH8 A;  5FI6 A;  3TE8 A;  2CC1 A;  3DBA A;  2ZQA A;  3VOZ A;  2VGJ A;  3BQA A;  3BJN A;  3CJM A;  3FWL A;  1EW0 A;  1K4F A;  4X1L A;  3MKF A;  4QWO A;  1GA0 A;  2ZOI A;  1MWS A;  2EXB A;  2VGK A;  3BLM A;  3PAG A;  3MR0 A;  2A24 A;  3OOV A;  4OQG A;  1BUE A;  1E3U A;  4KZ5 A;  5TJJ A;  3OPP A;  4QD4 A;  2FZ0 A;  5EV0 A;  5I5L A;  4JGP A;  2ZLY A;  4E3L A;  4EEP A;  1XP4 A;  5CXW A;  4DMZ A;  1RGY A;  5F1F A;  1XFN A;  2XSS A;  1BLH A;  4K08 A;  1PW8 A;  3NY4 A;  1YSQ A;  2QPN A;  3IXD A;  3MQO A;  5KIZ A;  4QPR A;  3C7V A;  4HJ4 A;  2ACG A;  5FQQ A;  1HD8 A;  2K2N A;  2ZQ8 A;  1PZP A;  3WS2 A;  5EVI D;  2VJW A;  3BFF A;  4CLC D;  4MLL A;  4WYY A;  4RVA A;  2WGV A;  5JYP A;  2Y2I A;  1UGU A;  1PI4 A;  1IYP A;  3VOY A;  1PWC A;  1NYY A;  5EM1 A;  3D3O A;  3CUE C;  2MJ6 A;  2W1T A;  4HJ3 A;  4ZRR A;  3GTC A;  3BFG A;  2QJ5 A;  1OPX A;  3P01 A;  1ERM A;  4F94 A;  3IH9 A;  3LIA A;  2PR5 A;  1S66 L;  3WS4 A;  4DXB A;  2ZC4 B;  3C7U A;  2M7U A;  3TJZ C;  4HH2 A;  3VE3 A;  1NZO A;  4HES A;  2BTF P;  2JKR M;  4KZ9 A;  4S2N C;  3A0V A;  3D72 A;  4GHI A;  4PM6 A;  3WRT A;  3DW0 A;  2P7J A;  1P9R A;  3LI9 A;  1DJA A;  1BSG A;  4ZJ2 A;  4GS9 A;  4UHU A;  3AGE A;  3V3R A;  4FOF A;  3B42 A;  2HDS A;  4XT2 B;  1YKD A;  3HLD A;  5EVE A;  3ZG0 A;  1T19 A;  4R4R A;  5DF9 A;  1XGJ A;  4EV4 A;  1BLC A;  4G3V A;  4PMA A;  3V39 A;  3UE1 A;  5CEB A;  1LL8 A;  4E3M A;  1YLJ A;  3QNB A;  3A3F A;  4I5S A;  3N8S A;  3NJA A;  3RFB A;  2V9A A;  1K54 C;  3BQ8 A;  2ZM2 A;  3S7P A;  3CMZ A;  3MFX A;  3T1S A;  5TFQ A;  2PU4 A;  3T12 B;  3MXQ A;  1K4E A;  2M7V A;  2ZJ9 A;  4WMC A;  4EQ1 A;  1LHY A;  5L09 A;  3KSF A;  1F9I A;  4KG2 A;  2WKQ A;  1CF0 A;  1TF1 A;  2WKP A;  1MXO A;  1YLT A;  5HL6 A;  4X68 A;  4EBP A;  4S2P A;  2VX8 A;  4M3K A;  4DJ3 A;  1S6R A;  1IKG A;  3BEC A;  1MY8 A;  3GMW A;  1OME A;  1Q2Q A;  2WKH A;  3HLF A;  2WAE A;  2QKP A;  1VEU B;  1NXY A;  3QP6 A;  3RXW A;  3UDF A;  1T1A A;  3NI9 A;  2QWS A;  2Y2N A;  3VP3 A;  2EX6 A;  5LBR A;  1JTD A;  3KYQ A;  3OCN A;  3QHY A;  1P9W A;  1S1Z A;  1IEL A;  5F83 A;  4GKU A;  4N92 A;  1PI5 A;  3E4O A;  5L8M A;  4Q0H A;  3ZG7 B;  5FAQ A;  3W2Z A;  4HBT A;  3ZNT A;  4R70 A;  3W4P A;  4PPR A;  2H0Y A;  4HH3 A;  5CTM A;  4Y5F A;  3M6H A;  3GR2 A;  1BYW A;  1TVF A;  1YMX A;  5DTS A;  3LY3 A;  4FH4 A;  3FV7 A;  3DAV A;  2Y2G A;  2KLI A;  2WGW A;  2I72 A;  1D06 A;  1SKF A;  2X71 A;  1L0D A;  3GEC A;  2LB9 A;  3LIB A;  2ZC3 B;  3PBO A;  3DTE A;  5FSR A;  2V1A A;  4PM5 A;  3B47 A;  5DTK A;  4BQM A;  3OC2 A;  5FEG A;  2X01 A;  4EES A;  4S2I A;  2B95 A;  5EVI B;  4BLM A;  1ESI A;  3UE0 A;  2ZL1 B;  1ES2 A;  3QP4 A;  2EWV A;  4CLC B;  1Z6F A;  2WGI A;  3NHQ A;  1CEF A;  2W27 A;  1BTL A;  1LSV A;  4IUH A;  4KZA A;  5EM0 A;  4OH0 A;  1YMS A;  3LR5 A;  4Y2F A;  4UQI S;  2XK1 A;  3DTI A;  1VET A;  4DDS A;  4RX2 A;  1W8Y A;  4IBX A;  4P85 A;  2Y2H A;  1ZG4 A;  2PBD P;  1LI0 A;  5DFX A;  1NJ4 A;  2QHK A;  2PD8 A;  3BW6 A;  4DF6 A;  2XA7 M;  3GVB A;  1FCN A;  2D02 A;  3MMH A;  2PHY A;  1H5X A;  3EEH A;  5A90 A;  3NDG A;  2P9V B;  3H82 B;  4MN5 A;  5AQA A;  4IJG A;  1K56 A;  3PBT A;  4S2O A;  4MNR A;  5F6A A;  2GNX A;  4R3B A;  4IHQ A;  1ALQ A;  4WBG A;  2JC7 A;  3OPR A;  1T1C A;  2O9C A;  2NUP C;  4OVD A;  1PRQ A;  2JCH A;  1BT5 A;  3CZD A;  1IKI A;  3LY4 A;  3LO7 A;  4X69 A;  1W63 Q;  5FAP A;  4HI4 A;  1O7E A;  3MFD A;  5JYO A;  5FI7 A;  3QP1 A;  1TS7 A;  3JVU A;  3A3J A;  4YIN A;  4BL3 A;  1SKO B;  4DE3 A;  1ERO A;  2EFU A;  2IWD A;  1M40 A;  3ZGA B;  4Z1W A;  3LIC A;  4MMN A;  5GLB A;  4D2O A;  3ZYT A;  3HLE A;  4Y17 A;  5GHZ A;  4GD6 A;  4P0M A;  4F3L B;  4NXE A;  1FSY A;  4O0P A;  4EBL A;  5FI2 A;  3IQA A;  1GHM A;  4E6X A;  2JKT M;  3ZVT A;  5HAP A;  1LSX A;  1K25 A;  4MDZ A;  2XR0 A;  2Z6C A;  2A2L A;  3C5A A;  4WL9 A;  3KSH A;  3TG9 A;  3VOL A;  4K0W A;  4FTX A;  3BEB A;  2P08 A;  3IHB A;  2W3D A;  1BLS A;  2FH5 A;  3PBQ A;  4FUW A;  5DVA A;  3MXR A;  4LV1 A;  4UA6 A;  3L7H A;  3MZF A;  1MKM A;  1YAX A;  4JXV A;  1V9Y A;  2E8J A;  4DDY A;  4OLD A;  4R3A A;  5HAR A;  3NBL A;  3G34 A;  2PDR A;  3EWK A;  4P87 A;  2OOL A;  1FIL A;  3BWL A;  1XFQ A;  5TBM B;  1XA1 A;  4UA9 A;  5AQ7 A;  1KOU A;  5G4Y A;  3F1N B;  2ZQC A;  4EU0 A;  2WKR A;  4DN0 A;  3KSG A;  3HLC A;  4U0T A;  1SDE A;  1JWZ A;  1PNE A;  1PWG A;  4JF4 A;  3SS5 A;  4JF6 A;  1WYC A;  3LIF A;  1ODV A;  2ZD8 A;  4UA7 A;  3BY9 A;  2Y2Q A;  5FQK A;  3ZVW A;  3F1P B;  3MQ0 A;  3IF6 C;  5C5K A;  1ESU A;  5KMW A;  5HDS A;  3CWF A;  3SH8 A;  3S22 A;  1AWI A;  4ZTK A;  5E2F A;  2PRF A;  1XJ4 A;  3HLW A;  2EFX A;  1L2S A;  3EGD C;  1H8M A;  2J9O A;  1E4D A;  2Y2P A;  3G32 A;  2J7V A;  4FSF A;  5HZH A;  4Y13 A;  3PTE A;  1OJG A;  3N7W A;  3R7W B;  4ZDX A;  1S4S A;  4JKT A;  3LEQ A;  3UB6 A;  1DP6 A;  2VGL M;  1QME A;  3NOP C;  4BD0 A;  3Q7V B;  3HVF A;  3G30 A;  2I9V A;  1ES5 A;  4KUO A;  3OPH A;  3H9W A;  2D01 A;  2M1C A;  3GSG A;  1OTI A;  5M1A A;  1P97 A;  1LT0 A;  3FKW A;  4FD8 A;  1WA9 A;  3BFD A;  4C3Q A;  1K55 C;  3E98 A;  2PYR A;  3UB7 A;  3OCL A;  1LLB A;  3ZCZ A;  3EGX C;  4PKY G;  5HWW A;  5AQ9 A;  3UMD A;  4G3K A;  4JGR A;  1OTE A;  4UAA A;  5HAQ A;  3PAE A;  2YKH A;  4OLG A;  3VP0 A;  1O07 A;  5DKL A;  3V67 A;  3H7W A;  3IWO A;  3OZH A;  5EOE A;  1DJB A;  1ZHH B;  4KZ6 A;  5DF7 A;  4MN7 A;  5FQM A;  1P0Z A;  4OQH A;  4EW7 A;  4BBV A;  2W0N A;  3IXG A;  5AJG A;  4HOI A;  3CPT B;  5E43 A;  2J3W A;  2V0U A;  1MBL A;  3NUL A;  1ZTU A;  1TS8 A;  2HDQ A;  1S0W A;  2WKE A;  1F98 A;  3PBS A;  4LGW A;  1YSP A;  5CHJ A;  3M2K A;  3SS4 A;  5GHY A;  1KE3 A;  1IEM A;  4OPY A;  1TDL A;  1XJ6 A;  3EOI A;  1GHI A;  5FQI A;  3GV9 A;  2A3U A;  4Q8I A;  3W4O A;  2JE5 A;  1H8Z A;  4EUV A;  3P98 A;  3SW1 A;  3MSH A;  1G28 A;  3B33 A;  3ICY A;  5KZH A;  2V8F A;  4ARZ B;  1G6A A;  2XFT A;  3DWK A;  2Y59 A;  2H0T A;  3NDE A;  4I3A A;  5EVL A;  4OON A;  2B02 A;  4LRX C;  3WS0 A;  2HP9 A;  4LFU A;  4P6Z S;  3O86 A;  4RX3 A;  1NYM A;  3V3S A;  1IFQ A;  1PZO A;  2QMI A;  4Y0T A;  5F5Y A;  3LI8 A;  4UEY A;  3MBZ A;  3BM6 A;  1OT9 A;  1YPR A;  3F1O B;  4WN5 A;  2KDK A;  4WLA A;  4R1G A;  5CHU A;  4HP9 A;  1FIK A;  1OTD A;  1X0O A;  3S7Q A;  3IXH A;  1JNU A;  2QZ6 A;  1ONH A;  5J3W A;  3PBN A;  4PHT A;  1F5M A;  1XGI A;  5DKK A;  2HP5 A;  4Q0I A;  2HP6 A;  2OAQ 1;  1SHV A;  4LRZ E;  4OP8 A;  3DTK A;  4QHC A;  3CI6 A;  2PAV P;  2ZC6 B;  1IOU A;  4GLQ A;  3Q81 A;  2V1Z A;  4Z9Q A;  1KVL A;  4WZ5 C;  2IWC A;  1N9O A;  4OP5 A;  4LLO B;  3O88 A;  2XGN A;  4BD1 A;  1TS6 A;  4NKP A;  4K0X A;  5GHX A;  4BJP A;  1T18 A;  2Z2M B;  3VMA A;  1N4O A;  4OPR A;  5FAO A;  3EQV A;  4CPK A;  3C4O A;  1XJ3 A;  3JPU A;  5DF8 A;  3BFE A;  3B3X A;  4OQI A;  3BYD A;  1F2K A;  4IBR A;  5E2E A;  1G5U A;  3RXX A;  4ESP A;  1YQS A;  3ZG5 A;  2O99 A;  4FH2 A;  3CLO A;  3K3D A;  5HWV A;  2DMW A;  3Q82 A;  3LR4 A;  5L07 A;  3PHY A;  3UNW A;  1XPB A;  2EWW A;  3MJQ A;  5IS1 A;  4D60 A;  5GLD A;  1UWP X;  3IBR A;  1MWU A;  1S1Y A;  1RP5 A;  4OOL A;  4OKP A;  3W8K A;  5KSH A;  5F69 A;  2EXA A; 
#chains in the Genus database with same CATH homology
 4R3B A;  1ALQ A;  1FCM A;  1HZO A;  4LEN A;  4KG6 A;  1AXB A;  2C5W B;  4WBG A;  2JC7 A;  2ZQ9 A;  3CG5 A;  2XEP A;  3OPR A;  4S2L A;  5L2F A;  4OVD A;  4KZ4 A;  3VP2 A;  2JCH A;  5FQ9 A;  3UPP A;  3W4Q A;  1MWT A;  3WRZ A;  1BT5 A;  3CZD A;  2H10 A;  1CK3 A;  4GDN A;  3NC8 A;  4KZ3 A;  3ZNY A;  1G68 A;  3G4P A;  2FFY A;  5IHV A;  3VSL A;  1CEG A;  1IKI A;  3LY4 A;  2R9W A;  3LO7 A;  4X69 A;  4GN2 A;  4WM9 A;  2DCF A;  4NET A;  5FAP A;  1O7E A;  3MFD A;  4JXW A;  1IYO A;  5CTN A;  4KZ8 A;  3G35 A;  5JYO A;  1NRF A;  4WZ4 A;  4OQ0 A;  3VSK A;  2WAD A;  3AGD A;  4P6B A;  5EVI C;  5FI7 A;  5CGX A;  1K55 A;  5A93 A;  3A3J A;  4YIN A;  1W5D A;  3UPN A;  3ZDJ A;  1YT4 A;  3N8L A;  4BL3 A;  4U0X A;  4DE3 A;  1ERO A;  4S2K A;  1N9B A;  4U3T A;  5A91 A;  2EFU A;  2IWD A;  1LL5 A;  1M40 A;  3ZGA B;  3IHA A;  5TGF A;  2XQZ A;  4Y0O A;  4ZBE A;  4MBK A;  1L0F A;  5GLB A;  4D2O A;  1K54 A;  4EBN A;  3IH8 A;  5FI6 A;  1KDW A;  2CC1 A;  4A5R A;  3HLE A;  1E3U D;  5GHZ A;  4GD6 A;  4IVI A;  4P0M A;  3OPL A;  2ZQA A;  4QU3 A;  3VOZ A;  2VGJ A;  1U60 A;  1GA9 A;  1FSY A;  2DNS A;  3IF6 B;  2XH9 A;  4EBL A;  4WZ5 A;  4KZ7 A;  2OLU A;  5M19 A;  3CJM A;  2IWB A;  5FI2 A;  4JPM A;  3FWL A;  3IQA A;  4JF5 A;  1GHM A;  3G31 A;  4B4Z A;  1K4F A;  1FOF A;  3ZG9 B;  2P74 A;  3FKV A;  1TDG A;  3ZVT A;  4E6X A;  3UN7 A;  3MKF A;  4BL2 A;  5HAP A;  2ZM8 A;  1K25 A;  5HFO A;  1DY6 A;  1GA0 A;  4N1H A;  1MWS A;  2EXB A;  3UO9 A;  2VGK A;  2XR0 A;  3BLM A;  3PAG A;  4WMC D;  4OQG A;  1ERQ A;  2OSU A;  3C5A A;  1W8Q A;  1BUE A;  1E3U A;  4KZ5 A;  4KQR A;  2J8Y A;  5EEC A;  5CRF A;  3TG9 A;  3HUO A;  1FR1 A;  3OPP A;  4QD4 A;  1JWP A;  4K0W A;  3BEB A;  1Q2P A;  3IHB A;  1NY0 A;  1BLS A;  2C6W B;  4JXG A;  4KZB A;  4OOM A;  3PBQ A;  4K91 A;  1K6S A;  1RCJ A;  1HVB A;  3MXR A;  5DVA A;  2ZLY A;  4E3L A;  3MKE A;  4QY5 A;  1EWZ A;  4LV1 A;  4KQO A;  4UA6 A;  3LEZ A;  1XP4 A;  2HDU A;  3MZF A;  4C6Y A;  1I2S A;  4HBU A;  1VM1 A;  5CXW A;  2G2U A;  1RGY A;  4JXV A;  5F1F A;  2Y2L A;  5CEC A;  1VQQ A;  4DDY A;  2WAF A;  4OLD A;  2XD1 A;  5AQB A;  1BLH A;  1K57 A;  4IED A;  5HAR A;  4GOG A;  3NBL A;  3DTM A;  3G34 A;  3GQZ A;  1PW8 A;  3NY4 A;  4KQQ A;  2QPN A;  3IXD A;  4P87 A;  3C7V A;  2A49 A;  1XA1 A;  4GD8 A;  4UA9 A;  3Q7V A;  5AQ7 A;  3VP1 A;  5M18 A;  5CGW A;  5F82 A;  2ZQC A;  5FQQ A;  1HD8 A;  5FA7 A;  2Y2M A;  2ZQ8 A;  1PIO A;  1PZP A;  4QY6 A;  1BUL A;  3UPO A;  3VFH A;  5EPH A;  5HX9 A;  3O3V A;  3WS2 A;  3HLC A;  1RGZ A;  4Y7P A;  4U0T A;  5EVI D;  2Y2J A;  1SDE A;  1E25 A;  4OPQ A;  1JWZ A;  3BFF A;  4LCL A;  3UY6 A;  1PWG A;  4JF4 A;  4MLL A;  4ZJ3 A;  3SS5 A;  1KGE A;  4JF6 A;  3VP4 A;  4WYY A;  4RVA A;  5F1G A;  1WYC A;  2ZMA A;  2OLV A;  2WGV A;  5FAT A;  5JYP A;  2Y2I A;  3HLB A;  4WEL A;  2ZD8 A;  4UA7 A;  3SH9 A;  1PI4 A;  1IYP A;  3VOY A;  2EX2 A;  1PWC A;  1NYY A;  4JLF A;  3ZG8 B;  2Y2K A;  4DE1 A;  2BLS A;  2Y2Q A;  2WYX A;  3C4P A;  3GTC A;  5CHM A;  3BFG A;  4PM7 A;  1YLW A;  5FQK A;  3ZVW A;  1SDN A;  4RA7 A;  1ERM A;  1C3B A;  4F94 A;  3Q07 A;  5GLA A;  3IF6 C;  1YLY A;  4N1X A;  3IH9 A;  1ESU A;  2J9P A;  4DE2 A;  5KMW A;  2H5S A;  1BLP A;  3WS4 A;  3SH8 A;  3S22 A;  3N8R A;  2WKI A;  4DXB A;  3Q1F A;  2EX8 A;  2ZC4 B;  3HLG A;  2RL3 A;  5HL1 A;  4ZTK A;  3C7U A;  5E2F A;  4GDB A;  3HLW A;  2EFX A;  1L2S A;  2J9O A;  1NZO A;  1E4D A;  2Y2P A;  3A3D A;  4HES A;  5GL9 A;  3A3I A;  1EI5 A;  3G32 A;  3V50 A;  4KZ9 A;  4S2N C;  5U47 A;  2J7V A;  4FSF A;  4WEK A;  4PM6 A;  3WRT A;  1NZU A;  3DW0 A;  3PTE A;  3N7W A;  4ZDX A;  4R23 A;  1DJA A;  1FSW A;  3I7J A;  1KDS A;  4LV2 A;  1BSG A;  4JKT A;  3PBR A;  2PBY A;  4ID4 A;  5EOO A;  4ZJ2 A;  3EQU A;  1QME A;  5FAS A;  4UHU A;  3AGE A;  3Q7V B;  3V3R A;  4BD0 A;  3HVF A;  2HDS A;  3G30 A;  3WWX A;  3HLD A;  1ES5 A;  4KEN B;  4S2M A;  5FDH A;  3ZG0 A;  1XX2 A;  4X56 A;  3OPH A;  3HUN A;  2JBF A;  4R4R A;  3GSG A;  5DF9 A;  5M1A A;  3MZD A;  4GB7 A;  2XF3 A;  4XXR A;  1M6K A;  1XGJ A;  3FKW A;  3MXS A;  4FD8 A;  4EV4 A;  1BLC A;  3BFD A;  4PMA A;  3V39 A;  3UE1 A;  4C3Q A;  4DRT A;  5CEB A;  1K55 C;  1MWR A;  1CI8 A;  4E3M A;  1J9M A;  1YLJ A;  3QNB A;  3OCL A;  4LCM A;  3A3F A;  1LLB A;  3HL9 A;  3UDI A;  4R4S A;  1WE4 A;  3N8S A;  3ZCZ A;  5GLC A;  2E8I A;  1K54 C;  5AQ9 A;  3E2L A;  2ZM2 A;  2EX9 A;  4UAA A;  5HAQ A;  3Q7Z A;  3PAE A;  1I5Q A;  2Y2O A;  3CMZ A;  3IXB A;  4OLG A;  3VP0 A;  1O07 A;  5TFQ A;  2PU4 A;  1KVM A;  3IWQ A;  2Q9M A;  3NIA A;  4QB8 A;  1K4E A;  4C75 A;  3IWO A;  5DTT A;  1XXM A;  4E6W A;  1W79 A;  3OZH A;  2ZJ9 A;  4WMC A;  5EOE A;  4HEF A;  1LHY A;  4CJN A;  1DJB A;  4JXS A;  2Y55 A;  4E3N A;  4KZ6 A;  2B5R A;  3A3E A;  5DF7 A;  1KE4 A;  4H8R A;  5FQM A;  3HUM A;  4LV0 A;  1ZKJ A;  4KG2 A;  4OQH A;  5I94 A;  3IXG A;  4MBH A;  1XKZ A;  5TR7 A;  5E43 A;  1MBL A;  1L0G A;  2HDR A;  5E2H A;  1CI9 A;  2V20 A;  3ZHH A;  5FQJ A;  1MXO A;  4B88 A;  2HDQ A;  3SH7 A;  1YLT A;  3ITA A;  4E3I A;  1ES4 A;  1S0W A;  1YLP A;  2WKE A;  1K56 D;  4EBP A;  3PBS A;  4X68 A;  4S2P A;  3HBR A;  5A92 A;  3IWI A;  4M3K A;  1KGF A;  1S6R A;  1K38 A;  1IKG A;  3BEC A;  5CHJ A;  1MY8 A;  3SOI A;  3M2K A;  4DXC A;  2XDM A;  1MPL A;  3ISG A;  3GMW A;  2ZQ7 A;  3SS4 A;  3S1Y A;  1OME A;  1Q2Q A;  5GHY A;  2WKH A;  4DKI A;  1IYS A;  1KE3 A;  1QMF A;  3HLF A;  1IEM A;  2WAE A;  3N4I A;  4N9L A;  1TDL A;  4OPY A;  3SS3 A;  4OOY A;  1GHI A;  1JWV A;  1NXY A;  3M2J A;  3GV9 A;  5FQI A;  1K57 C;  2A3U A;  5HAI A;  3W4O A;  4Q8I A;  2JE5 A;  4IVK A;  3RXW A;  3UDF A;  1H8Z A;  1ZG6 A;  4JBF A;  3P98 A;  3HRE A;  3NI9 A;  1K6R A;  2ZM0 A;  4LV3 A;  5EVI A;  2WUQ A;  2Y2N A;  3VP3 A;  4E3J A;  4EQI A;  1WYB A;  5KZH A;  2EX6 A;  4E3K A;  3O87 A;  4EUZ A;  1JTD A;  1G6A A;  3OCN A;  3S4X A;  5D3O A;  2XFT A;  3DWK A;  2Y59 A;  2WZZ A;  1MKI A;  4OPZ A;  2H0T A;  3QHY A;  2Z2L B;  3NDE A;  1I2W A;  4XUX A;  3MZE A;  1XA7 A;  4FCF A;  3BRM A;  4QJG A;  1IEL A;  5EVL A;  2ZC7 A;  5F83 A;  4GKU A;  2FFF B;  1PW1 A;  3AGF A;  4OON A;  2BG1 A;  3WS0 A;  5J8X A;  1IYQ A;  2HP9 A;  4N92 A;  1PI5 A;  5E2G A;  2Y4A A;  3O86 A;  4RX3 A;  1NYM A;  2X02 A;  3ZG7 B;  5FAQ A;  5KSC A;  3V3S A;  2UWX A;  4MEZ A;  5CED A;  4KG5 A;  1PZO A;  2QMI A;  4HBT A;  4Y0T A;  3ZNT A;  3W4P A;  4PPR A;  2G2W A;  2H0Y A;  2WZX A;  5CTM A;  3MBZ A;  1W7F A;  5EUA A;  3BM6 A;  3M6H A;  2DRW A;  3GR2 A;  3VFF A;  1TVF A;  1YMX A;  4X6T A;  4ZAM A;  1ES3 A;  5DTS A;  4R1G A;  3E2K A;  5CHU A;  3LY3 A;  3UDX A;  4FH4 A;  1KE0 A;  5CER A;  3FV7 A;  3IT9 A;  3TSG A;  2Y2G A;  1BZA A;  4O7D A;  3IXH A;  3FZC A;  5BOH A;  1PWD A;  2WGW A;  2I72 A;  2P9V A;  2QZ6 A;  1YLZ A;  2RCX A;  3D4F A;  2R9X A;  1ONH A;  4ZJ1 A;  4L0L A;  1FR6 A;  1SKF A;  2X71 A;  1L0D A;  3PBN A;  3G2Z A;  4YFM A;  5HW3 A;  1ONG A;  1XGI A;  1PYY A;  2ZC3 B;  3PBO A;  5FSR A;  4R0Q A;  2HP5 A;  2Y91 A;  3QNC A;  2XD5 A;  4PM5 A;  5DTK A;  2HP6 A;  3DWZ A;  1SHV A;  2Q9N A;  3N6I A;  4BQM A;  3NCK A;  3FYZ A;  2V2F F;  4OP8 A;  3LCE A;  4NK3 A;  4QHC A;  1GCE A;  4Y0U A;  2ZC6 B;  3OC2 A;  1Y54 A;  3V5M A;  3Q81 A;  2X01 A;  1YM1 A;  4S2I A;  2V1Z A;  4Z9Q A;  5EVI B;  4BLM A;  1ESI A;  1KVL A;  4PM8 A;  2ZC5 B;  4WZ5 C;  3UE3 A;  2IWC A;  3UE0 A;  1ES2 A;  1ZC2 A;  1SCW A;  1Z6F A;  4OP5 A;  2WGI A;  2XLN A;  1CEF A;  2XGN A;  1BTL A;  1DJC A;  2XFS A;  3O88 A;  4KZA A;  4BD1 A;  4K0X A;  1LI9 A;  4OH0 A;  1YMS A;  5GHX A;  4BJP A;  2PU2 A;  2Z2M B;  4E3O A;  2XK1 A;  3IF5 A;  1N4O A;  3VMA A;  4OPR A;  1LL9 A;  1KGG A;  5FAO A;  3EQV A;  4RX2 A;  5EE8 A;  4DDS A;  4PM9 A;  3RJU A;  3C4O A;  4CPK A;  1W8Y A;  4BEN A;  4IBX A;  4P85 A;  2ZQD A;  4R3J A;  1L0E A;  2Y2H A;  1ZG4 A;  5DF8 A;  2GDN A;  1LI0 A;  3BFE A;  5G18 A;  3B3X A;  4X55 A;  1JVJ A;  3WS5 A;  4OQI A;  1NJ4 A;  3BYD A;  1TEM A;  4S2J A;  4IBR A;  1H8Y A;  5E2E A;  1FCO A;  1HTZ A;  3RXX A;  4DF6 A;  3P09 A;  3IF6 A;  4N9K A;  2HPB A;  3GVB A;  1YQS A;  3GRJ A;  1FCN A;  3ZG5 A;  4FH2 A;  4DE0 A;  4GZB A;  3TOI A;  3ZFZ A;  1H5X A;  1FQG A;  3Q82 A;  3UNW A;  1XPB A;  5A90 A;  3NDG A;  1JTG A;  3WS1 A;  5GLD A;  4XUZ A;  4B4X A;  2WGW B;  2P9V B;  3G2Y A;  3ITB A;  1GHP A;  5AQA A;  4GNU A;  1MWU A;  5CGS A;  4X53 A;  4WEJ A;  3JYI A;  1K56 A;  3PBT A;  1RP5 A;  3M6B A;  4MBF A;  4OOL A;  4OKP A;  4RYE A;  3W8K A;  3BLS A;  4S2O A;  4MNR A;  4S2N A;  5KSH A;  3BFC A;  2WK0 A;  2OV5 A;  4EWF A;  2EXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...