3C5AA

Crystal structure of the c-terminal deleted mutant of the class a carbapenemase kpc-2 at 1.23 angstrom
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
264
structure length
264
Chain Sequence
TNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Class A carbapenemase KPC-2
publication title Genetic and structural insights into the dissemination potential of the extremely-broad-spectrum class A {beta}-lactamase (EBSBL) KPC-2 identified in two strains of Escherichia coli and Enterobacter cloacae isolated from the same patient in France
rcsb
source organism Escherichia coli
total genus 97
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2008-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3c5aA00
1CI9A 1H5XA 4MNRA 1JTDA 5EVIB 2ZC6B 5FQKA 3VFFA 5CEDA 2WYXA 1L0DA 5DF9A 1LHYA 2WZXA 3DTMA 1XGJA 3ZG7B 3IHBA 3V39A 4JLFA 4Y0UA 2EX8A 2ZD8A 4O7DA 4OPQA 3M2KA 4UAAA 1GCEA 2EFXA 4OQIA 1JTGA 1L2SA 2DNSA 1K4FA 5CTMA 3GR2A 5F82A 5TFQA 2XD1A 3OPRA 1FOFA 5CHJA 2UWXA 5DF7A 3VP0A 4OLGA 2H10A 1ZC2A 3IHAA 1N9BA 1YLPA 2ZC3B 4RX3A 5GHXA 4GDBA 3ZGAB 4OQ0A 5FQ9A 3O3VA 3M6BA 3C4PA 1N4OA 3FV7A 1RGZA 1K55C 4FCFA 4OPRA 4PM6A 5E2HA 2Y2GA 3TG9A 4BLMA 2XDMA 3S4XA 2WKHA 3NI9A 4NETA 1SCWA 4JF4A 2OV5A 1O7EA 2XF3A 2A49A 2WUQA 1E3UA 4KG2A 3PAEA 4JF6A 1SDNA 3BEBA 1KE4A 1BT5A 2WGWA 1O07A 2P9VA 3BYDA 2PU4A 2C5WB 5DF8A 1Y54A 4JXWA 3P98A 2EXBA 2ZLYA 3C7UA 3GQZA 2XFTA 4IVKA 4MBKA 4DE1A 1NYYA 5HAPA 2RL3A 1K6RA 4DE0A 1HD8A 1PW8A 3EQVA 1YMXA 4LCLA 1KGEA 1BLCA 2VGKA 1NZOA 1LL9A 1PI4A 3PBRA 4IBRA 4KENB 3DWZA 4P0MA 1ESIA 4R4RA 2XQZA 4S2OA 1GHPA 4N1XA 5E43A 2JCHA 5DTKA 4ZJ1A 3UY6A 3LY3A 3SS4A 3VP2A 4GOGA 2ZQAA 4E3IA 2WAEA 2Q9NA 4E3NA 4QU3A 1LI0A 2Y2JA 4X56A 1XGIA 5FQMA 2ZQCA 2WKIA 2OLVA 1KVMA 3DWKA 4KZ5A 4WBGA 3PAGA 1MKIA 2QPNA 3ZNYA 1KVLA 4B88A 1I2WA 3CZDA 5FAOA 1MPLA 3IXHA 4GN2A 3BFFA 4ID4A 2Y2MA 4N92A 4R3JA 3UO9A 4EBNA 2ZQDA 4JXSA 2Y91A 3BLSA 2Y55A 4S2NA 3A3FA 1CI8A 4OP8A 2QZ6A 1KDWA 3GRJA 4XXRA 3C4OA 4MBHA 4P85A 5JYOA 3NY4A 1BLSA 3FYZA 1VM1A 2H0YA 3Q1FA 3V50A 1YLJA 5M19A 1KDSA 3SOIA 1YT4A 5JYPA 1JWVA 4GDNA 4NK3A 3NBLA 2BLSA 4Y7PA 3N8RA 3BFCA 4Z9QA 1MWRA 4IEDA 1G6AA 3QNBA 5FASA 3PBQA 2Y2PA 1W8YA 1YMSA 1BULA 4DF6A 4MBFA 1EI5A 3UN7A 2XFSA 2P9VB 4LV3A 1ERMA 3G2ZA 4HBTA 3SS3A 3IWIA 5DTSA 3M2JA 2EFUA 4XUXA 3ZHHA 4E6XA 1IKGA 3MXSA 4GKUA 4UHUA 1FCOA 1DJAA 4KZ3A 3S1YA 3PBTA 1FSYA 3MXRA 4RVAA 4WZ4A 3WS1A 2HDUA 3MFDA 4PM8A 5KSHA 1K6SA 3NIAA 4EV4A 3HLBA 3NDEA 3W8KA 5CHMA 2Y2LA 3ZDJA 3NDGA 3TOIA 4EWFA 4JXVA 3A3IA 1XP4A 3N6IA 1K55A 1XKZA 3MKFA 3G2YA 4HBUA 4KG6A 2Z2LB 3OCNA 4FSFA 2XGNA 4C75A 4QHCA 4PM5A 1I5QA 2B5RA 3HVFA 1FCMA 4PM7A 5TGFA 1K56D 2H5SA 4S2MA 2E8IA 4LV0A 3LY4A 5CGSA 3ITBA 3UPPA 1IKIA 2WZZA 3G32A 1I2SA 3Q07A 5GLAA 5KSCA 3FWLA 5GLCA 5AQBA 3BLMA 3AGEA 3VP1A 4S2PA 1HVBA 3HREA 1K4EA 4OQHA 5CHUA 1SDEA 1W7FA 2GDNA 2Y59A 1E25A 3OPLA 3VMAA 4RA7A 1CK3A 3OPHA 5CGWA 3UDIA 3VSLA 3IXDA 3E2LA 1KE3A 4QD4A 3IF6B 3IXBA 5CECA 5HAIA 5D3OA 2IWDA 3VSKA 2HDRA 2C6WB 2HPBA 1H8ZA 5EOOA 3SH7A 2WADA 5EE8A 3Q7ZA 2CC1A 1DJCA 1PI5A 3M6HA 1FSWA 3S22A 3GV9A 2OLUA 4BL3A 3IT9A 2XD5A 1YM1A 2I72A 3Q7VA 1OMEA 2Y2NA 4DDYA 3D4FA 4E3MA 3IH9A 3FKWA 2JE5A 3G30A 3O87A 5J8XA 1IYSA 1EWZA 4KQQA 4UA6A 1IYPA 3I7JA 1MBLA 1PZOA 3NCKA 1U60A 3GMWA 3JYIA 1IYQA 4KQOA 5AQ7A 4D2OA 4N1HA 1TEMA 4L0LA 1JWPA 2X71A 4LV1A 5EECA 3WS4A 3HLGA 4U3TA 3UDXA 4RYEA 5E2EA 1PW1A 4LCMA 5HX9A 4FH2A 2R9WA 3UE3A 2IWBA 5FQQA 3O88A 5U47A 5A93A 3EQUA 3Q82A 4GD6A 4WM9A 1ES2A 2EX9A 3PBNA 4UA7A 3SH8A 4OVDA 3WRTA 3PBOA 4S2KA 4A5RA 4E3LA 3IH8A 1XPBA 4X55A 1WYCA 4ZAMA 3HLCA 1IELA 1JVJA 1BLPA 1XXMA 4OPYA 2ZC7A 4OLDA 3OCLA 4K0XA 2Y2QA 1L0FA 4MEZA 4KZ7A 5HARA 4OONA 4FH4A 3BFDA 3IWQA 1E3UD 1LI9A 3G4PA 1EROA 1WE4A 4BD0A 5FI6A 5FATA 2ZM0A 3UPNA 4R0QA 1QMEA 4KZ9A 3AGDA 4KZ4A 2WKEA 5EUAA 2ZQ7A 4JBFA 3HLWA 4JKTA 1ES4A 2HP9A 1PWGA 3V3SA 1GHIA 4CPKA 4R23A 4KQRA 2ZJ9A 5L2FA 1LL5A 4E6WA 5FSRA 1BSGA 3N4IA 4QY6A 1W8QA 2R9XA 4OKPA 4C3QA 3MZDA 3FKVA 2ZC5B 5FAPA 2XH9A 1VQQA 2VGJA 4HESA 4PPRA 3VOYA 4BENA 1K56A 4P87A 5F1GA 4WYYA 2WGWB 4ZJ2A 1K54C 1JWZA 4GD8A 2Y2HA 3PBSA 5EVIC 5EVID 3UPOA 1PWDA 4B4ZA 5CTNA 4KG5A 1ALQA 3MBZA 1TVFA 1CEGA 1K57C 3E2KA 1ZG4A 3IWOA 3ZCZA 3V5MA 2FFFB 5AQAA 4DXBA 5EPHA 1DY6A 5FQJA 2HP5A 4RX2A 4JXGA 3IXGA 1ZKJA 1FR6A 3WWXA 3ZG9B 4QY5A 2Y2KA 4C6YA 3TSGA 1NXYA 4LV2A 4F94A 1K25A 4MLLA 1W79A 1DJBA 2X02A 5KMWA 3W4PA 4K0WA 2ZQ9A 3GTCA 3HLEA 4S2LA 4H8RA 4S2JA 3CJMA 4N9LA 2J9PA 2WK0A 4WEJA 3OPPA 4OPZA 1Q2QA 3N8LA 4FD8A 5GHYA 5DTTA 3NC8A 3OZHA 5I94A 1BLHA 3RXXA 1HZOA 1ES3A 3DW0A 4EUZA 5FQIA 1PIOA 5HL1A 2Z2MB 4ZJ3A 1YLZA 2EX6A 2RCXA 4YFMA 4X68A 5G18A 5GL9A 3G34A 3HUMA 4Y0TA 3ZG5A 1BUEA 4WMCD 3P09A 3VP3A 1MWSA 3MZFA 5F83A 3W4QA 3C7VA 2PBYA 1TDGA 4KZ8A 3B3XA 4Y0OA 5AQ9A 1KGGA 1ERQA 2ZQ8A 4KZBA 2Y2OA 4UA9A 1NJ4A 4DXCA 4EQIA 3FZCA 4X53A 2JBFA 4QJGA 2WGVA 3GVBA 3BECA 3N8SA 2XK1A 5GLDA 2HP6A 3ZFZA 4ZBEA 4CJNA 5KZHA 1K38A 1S0WA 4S2IA 1IYOA 3LCEA 3QNCA 1KE0A 4R1GA 1YQSA 2G2WA 3UE0A 1ONHA 4OP5A 1RCJA 3WRZA 1FCNA 5CRFA 1GA0A 2J7VA 3Q81A 1G68A 4OOMA 3GSGA 5E2GA 1L0GA 3WS5A 3PTEA 3WS0A 1C3BA 2XLNA 3BRMA 4QB8A 2J8YA 1HTZA 5M18A 4DE2A 4E3OA 5FAQA 4K91A 4B4XA 4GNUA 3ZNTA 5A92A 1CEFA 5HAQA 1M6KA 1YLTA 2QMIA 3BM6A 4WZ5A 5IHVA 1J9MA 1BZAA 1YLWA 4DDSA 3LEZA 5TR7A 4DE3A 1MWUA 2A3UA 5FA7A 3VOZA 2Y4AA 2EXAA 1NZUA 3V3RA 1MY8A 3QHYA 4YINA 5DVAA 2V1ZA 3UE1A 3O86A 1AXBA 1GHMA 4OH0A 1M40A 3C5AA 1Z6FA 2HDSA 4HEFA 4DKIA 1RP5A 2J9OA 4R4SA 5EVLA 1H8YA 1MXOA 5E2FA 4X69A 3HBRA 1LLBA 3ZG0A 4Q8IA 3HLDA 1K54A 4GZBA 1FQGA 5CXWA 5BOHA 1ZG6A 5EVIA 3A3JA 3ZVWA 5HW3A 3A3EA 4PMAA 1NY0A 3N7WA 4N9KA 5FI7A 1PZPA 1SKFA 4WZ5C 1W5DA 1ES5A 2IWCA 4P6BA 4IBXA 5FI2A 1K57A 2WGIA 2V20A 4XUZA 4ZDXA 4DRTA 3RXWA 2V2FF 2PU2A 3G35A 5HFOA 4IVIA 4OOLA 3MKEA 1BTLA 3RJUA 4KZ6A 3ZVTA 1IEMA 2ZMAA 3BFEA 2BG1A 4OQGA 1GA9A 3IF6A 4ZTKA 4BD1A 4E3JA 4BQMA 1KGFA 3WS2A 1YLYA 3SH9A 1NRFA 5F1FA 5CEBA 2XR0A 5A90A 3IF5A 4PM9A 5EOEA 3OC2A 3UDFA 3AGFA 4WELA 4E3KA 1XA1A 3Q7VB 3VP4A 1WYBA 4EBPA 4JPMA 2JC7A 3HL9A 5GHZA 3HUOA 2Q9MA 2WAFA 5FDHA 3UNWA 3HLFA 5GLBA 3VFHA 3CMZA 2X01A 1FR1A 4R3BA 2HDQA 3W4OA 3IQAA 1ESUA 1S6RA 4JF5A 4X6TA 3CG5A 4BJPA 1Q2PA 3LO7A 1ONGA 3ITAA 2H0TA 3SS5A 4EBLA 2P74A 1SHVA 3BFGA 3MZEA 5CGXA 1QMFA 2DRWA 4S2NC 4WMCA 1PWCA 4U0TA 4GB7A 3IF6C 2DCFA 2Y2IA 1L0EA 2FFYA 4WEKA 2EX2A 1NYMA 2OSUA 4M3KA 3A3DA 3HUNA 1XX2A 5CERA 2ZM2A 1E4DA 5A91A 4BL2A 2ZC4B 2ZM8A 3G31A 5M1AA 3ISGA 4U0XA 1TDLA 4KZAA 3ZG8B 4OOYA 4LENA 1RGYA 1XA7A 2G2UA 1MWTA 2XEPA 1PYYA
chains in the Genus database with same CATH superfamily
5EVIB 3DTKA 3K2NA 3VFFA 3H9WA 5DF9A 4HOIA 2OAQ1 4O7DA 2OAP1 3A0RA 4UAAA 5TFQA 2G7UA 3GR2A 3F1PA 1FOFA 1ZC2A 1YLPA 4RX3A 1PNEA 3ZGAB 5FQ9A 3K3DA 5HDSA 3C4PA 2Y2GA 2XDMA 2D02A 2ZOHA 2A49A 3PAEA 4HNBA 1KE4A 1BT5A 2WGWA 5IT5A 2PU4A 2VGLM 4I3IA 4CLCA 1Y54A 4JXWA 3P98A 4MBKA 3CITA 4Y13A 1HD8A 3EQVA 3FPWA 4LCLA 1KGEA 5HPFA 2XRNA 4AFIA 4IBRA 4P0MA 2VGKA 1PI4A 3PBRA 5FDSA 1ESIA 4R4RA 4HJ3A 5G4ZA 4K08A 5DTKA 1D06A 3MQQA 3LY3A 2Q9NA 2KOIA 3S7OA 4QU3A 1LI0A 4G3VA 5IS1A 5FQMA 4L9GA 2ZQCA 4GS9B 2OLVA 1KVMA 3ZNYA 1KVLA 1I2WA 3CZDA 5FAOA 4QWOA 3KYZA 4R3JA 4JXSA 2Y91A 5HWTA 1DRMA 3A3FA 1X0OA 3PXPA 2QZ6A 3GRJA 3T1QB 4XXRA 2VKSA 1GSWA 4LPZA 4NXGA 4R6LA 4Y15A 3V50A 1YLJA 5M19A 1S4RA 1YT4A 4NK3A 3N8RA 4IEDA 5FASA 1W8YA 1YMSA 4DF6A 3UB6A 2PYRA 3T4QA 1T19A 3RH8B 3ZHHA 4R70A 3MXSA 3MXRA 4WZ4A 2HDUA 3HLBA 1SKOA 3ZDJA 3MMHA 3N6IA 4E3MA 5AVEA 1I5QA 3HVFA 1P9WA 3ITBA 2GJ3A 3Q07A 5DJUA 5GLCA 3VP1A 4S2PA 4BWIA 5CHUA 1TF1A 5HD5A 1CQAA 3VMAA 1CK3A 2MJ6A 5L10A 4HJ4A 1KE3A 2W3GA 5D3OA 5AVFA 4B93A 1OTAA 2HPBA 3SH7A 2WKPA 3LR4A 1PI5A 3P01A 4EQ1A 3GV9A 2OLUA 3IT9A 2XD5A 3Q7VA 4NXEA 2OWHA 3NJAA 3I7JA 1MBLA 3NCKA 2LB9A 3JYIA 1IYQA 4N1HA 3O88A 4WLAA 3Q82A 4H6JB 3SH8A 4A5RA 3WRTA 3KSGA 3PBOA 1WYCA 2BASA 2PHYA 4OPYA 4K0XA 3F1NA 4MEZA 3B42A 3GECA 2NUTC 4EEPA 1LI9A 1EROA 3E98A 4MDZA 3UPNA 1STZA 3HLWA 4JKTA 1XJ4A 1PWGA 4F3LA 3V3SA 1GHIA 1BSGA 3N4IA 2R9XA 4OKPA 4C3QA 1VQQA 4HP9A 1K56A 4HH2A 4XT2B 4Q0IA 4WYYA 4ZJ2A 3UPOA 4DJ2A 1ALQA 3E2KA 1ZG4A 3PR6A 3ZCZA 5AQAA 2O99A 1YAXA 2VEAA 3IXGA 1ZKJA 3ZG9B 2Y2KA 2V1AA 3IBJA 1NXYA 1TD5A 3HLEA 1VHMA 5GHYA 3NC8A 3OZHA 3RXXA 1PIOA 4PKYA 2EX6A 2RCXA 3QP1A 5G18A 1Y4OA 3HUMA 4R3AA 3LR3A 3P09A 4D60A 5FEGA 1TDGA 3B3XA 1ERQA 2ZQ8A 3E0YA 5IU1A 4X53A 4QJGA 2XK1A 5TBMB 3OLOA 3QNCA 4R1GA 1YQSA 4OP5A 1FCNA 5CRFA 1L0GA 3PTEA 3WS0A 1C3BA 3BRMA 2PD8A 1MKMA 2V8CA 5F68A 4B4XA 3EEAA 4LRYC 4DDSA 3LEZA 2A3UA 3VOZA 1GHMA 3C5AA 4HEFA 5J4EA 1RP5A 3T12B 1MXOA 4NXFA 5HD3A 3ZG0A 4Q8IA 5BOHA 1OTBA 2H28A 5HW3A 4Z1WA 3N7WA 4WZ5C 3LR5A 5FI2A 1XJ6A 2WGIA 2V20A 2Z6DA 4DRTA 3RXWA 1NRJA 2PU2A 5HFOA 3CLOA 3ZVTA 2Z6CA 2EWWA 4BD1A 2M1CA 1NRFA 4PM9A 4EXOA 3AGFA 1XA1A 4JPMA 2O9CA 3JVVA 1OTEA 5GLBA 3LIFA 3CMZA 2X01A 1FR1A 3W4OA 1ESUA 4JF5A 1NLZA 4NKPA 1Q2PA 1OT6A 2DRWA 4WMCA 2OOLA 4WEKA 3A3DA 3HUNA 5CERA 1E4DA 1DP6A 2ZC4B 3T4LA 3ISGA 1TDLA 3FPVA 4KZAA 4LENA 1RGYA 1MWTA 1PFLA 5G4YA 4DJ3A 5CEDA 3O5YA 4DMZA 1XGJA 2EX8A 2ZD8A 5A8BA 5DKKA 4OQIA 5F82A 2DNSA 5CHJA 1S66L 2UWXA 3VP0A 4OLGA 2W3DA 5GHXA 3LIBA 4GDBA 3EWKA 1RGZA 5E2HA 4BLMA 3S4XA 1SCWA 4WF0A 1A0KA 3PHYA 1O07A 2P9VA 4WN5A 4KUKA 2EXBA 3DBAA 4MN6A 4IHQA 5F69A 2O9AA 4NEED 4DE1A 4DE0A 2W1TB 1PW8A 1YMXA 3S7NA 1NZOA 1LL9A 4KENB 4EETB 3B47A 5MC7A 1J3WA 5J7EA 3SS4A 3VP2A 3L9KA 4X56A 1XGIA 5TJJA 4X1LA 5AJGA 2QPNA 1CF0A 2D01A 4FTXA 3IXHA 4GN2A 3BFFA 4ID4A 2ZQDA 5KIZA 3R4KA 4OP8A 1KDWA 3C4OA 5JYOA 2PR6A 1FIKA 3FYZA 1KDSA 5JYPA 1JWVA 4GLQA 5TBMA 4Y7PA 4Z9QA 3QNBA 2Y2PA 4MBFA 3PYPA 4II7A 1ACFA 2XFSA 4HBTA 5DTSA 5FL3A 2OWJA 1IKGA 4GKUA 4UHUA 1FCOA 4KZ3A 3PBTA 1VEUA 3W2ZA 3WS1A 4PM8A 1K6SA 1OTIA 2JKGA 3TOIA 4JXVA 5DJTA 4HBUA 3MKFA 1XKZA 3G2YA 4C75A 3OCNA 1V9ZA 4I3AA 4PM5A 2B5RA 1FCMA 1K56D 2H5SA 1F98A 5EFWA 3S7QA 3LY4A 3CPTA 1I2SA 5KSCA 5AQBA 4BBUA 1LL8A 3BLMA 1W7FA 2GDNA 3ICYA 4WUJA 3OPHA 4EEUA 1JNUA 3VSLA 2QJ5A 2QWSA 3IF6B 3IXBA 5FEFA 5CECA 1T1BA 5HAIA 3VSKA 2HDRA 2C6WB 5EE8A 3Q7ZA 3M6HA 1P97A 2I72A 1NWZA 3IH9A 3FKWA 4GCZA 2JE5A 3O87A 5J8XA 1IYSA 4UA6A 1LSXA 5HWWA 5AQ7A 3A0VA 1TEMA 3QP2A 4LV1A 3WS4A 4ESPA 3LFVA 4WL9A 1YSQA 2IWBA 5FQQA 3PBNA 3BW6A 4UA7A 3LIEA 4OVDA 1IOUA 1XPBA 2J3WA 1BLPA 2NUPC 4OLDA 3OCLA 4EW7A 1XJ2A 1GSVA 2JKFA 2J3TC 4KZ7A 4OONA 4FH4A 3G4PA 1T1AA 1WE4A 3S7PA 2LB5A 3E4OA 4X25A 4KZ9A 3AGDA 4KZ4A 2VA0A 5EUAA 2V0WA 2ZQ7A 3UB8A 4JBFA 1ES4A 4PHTA 4G3KA 4CPKA 3VE3A 4KUOA 4YNRA 4HP4A 2ZC5B 5FAPA 4ARZB 4HESA 4BENA 5DFXA 4UQIS 1JWZA 4GD8A 5EVIC 4DN0A 3T4KA 2W3HA 4KG5A 1TVFA 1LT0A 1K57C 4Q0JA 3V5MA 3RFBA 2K2NA 1TS0A 4MN5A 2Y8HA 3TSGA 4LV2A 2W1TA 4MLLA 3DTEA 4YOFA 2J9PA 3D72A 2WK0A 3N8LA 2XSSA 5I94A 3DW0A 1H0MA 4HY8A 5HPIA 2Z2MB 2W1RA 4ZJ3A 3E4PA 2PD7A 5GL9A 3G34A 3ZG5A 4WMCD 2PBYA 1KGGA 2ZMFA 4KZBA 4EQIA 1NJ4A 2WGVA 3BECA 3N8SA 2HP6A 4ZBEA 1K38A 1S0WA 4S2IA 1IYOA 1FILA 3R7WA 2CMNA 2G2WA 3UE0A 3ZQ5A 1RCJA 2YKFA 1GA0A 3Q81A 3JVUA 4OOMA 4HHDA 4BBVA 3QP5A 2PBDP 5M18A 4K91A 3ZNTA 3F1OA 1BZAA 1YLWA 5TR7A 4DE3A 5FA7A 2Y4AA 1NZUA 3UE1A 5DVAA 3EGXC 2HDSA 2J9OA 5EVLA 4L9FA 3HBRA 2IA2A 2GNXA 1P0ZA 5EVIA 3ZVWA 4PMAA 4ETZA 2HF6A 4P6BA 2IWCA 1S1ZA 4IBXA 1K57A 3EOIA 4XUZA 4ZDXA 1LSVA 3G35A 4IVIA 1H8MA 1IEMA 2ZMAA 4ZTKA 4E3JA 3IF6A 1D1JA 3IX3A 5EV0A 3SH9A 5F1FA 5CEBA 5A90A 4E3KA 3OC2A 2JC7A 3VV4A 5FDHA 3QP8A 3IQAA 4BJPA 4O8GA 3SS5A 2H0TA 2P74A 1SHVA 3MZEA 2Y2IA 2FFYA 2ZBBA 1NYMA 2B02A 3BY9A 4MN7A 1K0KA 2EA9A 4U0XA 4GS9A 1XA7A 3IS2B 1H5XA 3BQ8A 4MNRA 2ZC6B 5FQKA 3U4LP 2WYXA 1L0DA 1LHYA 2ACGA 2WZXA 4JLFA 4Y0UA 3ULFA 2A24B 2QKPA 1JTGA 1HLUP 2XD1A 3OPRA 1F9IA 2ZC3B 4OQ0A 3TW8A 3FV7A 3MJQA 4FCFA 4OPRA 4PM6A 1LSWA 3NI9A 2OV5A 1O7EA 2XF3A 2WUQA 4ARZA 2HZ5A 2JHEA 3BEBA 1T1CA 1T18A 2C5WB 5DF8A 2ZLYA 5DKLA 2KLIA 3GQZA 4IVKA 1VETB 4GHIB 2R78A 1NYYA 2RL3A 1S67L 1OJGA 3FC7A 1GHPA 4N1XA 3UY6A 5EM1A 4GOGA 2W0NA 4Y17A 4LRXC 4RQ9A 2Y2JA 3DWKA 3LR0A 1MKIA 1PRQA 4QPRA 2Y2MA 4N92A 3TJZC 3UO9A 4EBNA 3BLSA 2Y55A 2PDRA 3CWFA 1CI8A 4JGOA 4MBHA 1TS7A 2HJ9C 3NY4A 5DFYA 2H0YA 3Q1FA 2VZWA 3SOIA 4B9OA 2UV0E 3E4QA 1W63M 4GDNA 3NBLA 2BLSA 2VLGA 3BFCA 1MWRA 1G6AA 1UGUA 1IFQA 3MR0A 3UN7A 4LV3A 1NLYA 2KX6A 3M2JA 2EFUA 3QP4A 4CLCB 4E6XA 3S1YA 4RVAA 1XFQA 3MFDA 2O9BA 5KSHA 3LI9A 3NIAA 4H6JA 2KDKA 3NDEA 3W8KA 4ETXA 5CHMA 4EWFA 3A3IA 4KG6A 3LYXA 1OPXA 4LLOB 5L07A 4QHCA 5TGFA 2FZ0A 2E8IA 3UPPA 2V1BA 1IKIA 2WZZA 3FWLA 3SZTA 5HDDA 4EESA 3HREA 1SDEA 3OPLA 4RA7A 5CGWA 1GSXA 3IXDA 1S4SA 2V9AA 2GX5A 2WADA 2CC1A 3CHWP 1DJCA 4XT2A 5EM0A 2VV7A 1FSWA 2GZAA 4BL3A 5CX7A 5K5BA 4DDYA 3D4FA 2W3FA 3G30A 4GJ4A 4EERA 1EWZA 3OBFA 2M7VA 2P7JA 2L4RA 3GMWA 4D2OA 4KQOA 4IUHA 2X71A 3D9YA 3HLGA 5HDCA 3UDXA 4RYEA 5E2EA 3CAXA 2Q0OA 4FH2A 2R9WA 3UE3A 4Y3IA 2ZOIA 5U47A 4NXBA 1Y28A 1ES2A 2EX9A 1SKOB 1OTDA 4S2KA 3IH8A 4X55A 4ZAMA 4PKYG 3TE8A 2L0WA 3LGOA 2J3TD 5HARA 3MQOA 1ZHHB 3BFDA 1E3UD 4BD0A 1OT9A 5FATA 1VB6A 3LICA 4L9EA 2A24A 2HP9A 4R23A 2ZJ9A 5L2FA 1LL5A 4E6WA 5FSRA 3H7WB 3KYEA 4QY6A 3LIAA 1EW0A 3T4TA 1Z09A 5LBRA 3KSIA 3MXQA 3K3CA 3VOYA 4HJ6A 4P87A 3C8CA 1K54C 2VJWA 2Y2HA 3PBSA 5EVID 3MF0A 1PWDA 1F5MA 5J3WA 3MBZA 3UB5P 4I39A 2FFFB 2VX8A 1DY6A 5FQJA 4JXGA 4QY5A 4C6YA 2W3EA 1DJBA 3T4JA 3GTCA 4S2JA 2XA7S 3FG8A 4N9LA 2JKTM 5C5KA 4FD8A 3UE6A 5DTTA 1BLHA 1HZOA 3F1NB 4EUZA 1YLZA 4HH3A 4X68A 2AVXA 3VP3A 3MZFA 5F83A 3T1XA 3H82B 4F3LB 2Y2OA 4DXCA 3FZCA 2JBFA 3B33A 3GVBA 5GLDA 3ZFZA 4CJNA 5KZHA 3C2WA 1KE0A 2PAVP 3WRZA 3GSGA 2XLNA 2JKRM 2J8YA 3T4SA 5FAQA 2A2LA 4GNUA 5A92A 1CEFA 5HAQA 4P6ZS 2QMIA 5IHVA 2PRFA 3BM6A 4UQIM 3KX0X 3NOUC 3V3RA 2V1ZA 3O86A 1AXBA 2J80A 3NOTC 4OH0A 4PAUA 1Z6FA 4DKIA 3G6OA 4R4SA 1H8YA 5E2FA 4X69A 1SZVA 4HQAA 4GZBA 1K54A 5CXWA 1FQGA 3A3JA 3A3EA 3VOLA 3SW1A 3NHQA 3IX8A 4ZRRA 1W5DA 4OOLA 4KZ6A 2BG1A 4OQGA 1GA9A 4I38A 2VGLS 1YLYA 4LGWA 3NECA 3HJIA 2XR0A 3IF5A 5EOEA 3UDFA 3VP4A 3A0SA 4EBPA 5GHZA 3HUOA 2WAFA 3HLFA 2V8FA 4FUWA 2B95A 3CUEC 1S6RA 4X6TA 3ITAA 4EUVA 3BFGA 5CGXA 1QMFA 4S2NC 1PWCA 4U0TA 2QHKA 3IF6C 4GB7A 1L0EA 2OSUA 4M3KA 1WA9A 1XX2A 3LEQA 2ZM2A 3OOVA 3T50A 5A91A 3G31A 5M1AA 1XFNA 2K31A 4LFUA 2G2UA 2XEPA 1PYYA 2JN7A 1CI9A 2VV8A 1JTDA 1MZUA 5HZHA 3ZG7B 3DTMA 3QP6A 3EGDC 3IHBA 3V39A 4OPQA 3M2KA 1GCEA 2EFXA 1L2SA 1K4FA 5CTMA 1F2KA 4IJGA 5DF7A 4HI4A 2H10A 3IHAA 1N9BA 3LI8A 3O3VA 3M6BA 1N4OA 3TG9A 1K55C 3H7WA 2WKHA 4NETA 4JF4A 1E3UA 4KG2A 4JF6A 1SDNA 2P08A 1TS6A 3BYDA 3T4OA 4HIAA 3C7UA 2XFTA 4I3JA 3EEHA 2P04A 5HAPA 1K6RA 2QJ7A 4E04A 3V67A 1BLCA 3DWZA 2XQZA 3IX4A 4S2OA 5E43A 3NULA 3CI6A 2I9VA 2JCHA 4ZJ1A 4E3IA 2ZQAA 3MQ0A 2WAEA 4E3NA 5L09A 2ZL1B 2PR5A 4UEYA 4GW9A 2WKIA 4KZ5A 4WBGA 3PAGA 3CUEA 1P9RA 4B88A 1MPLA 1OJ5A 2XROA 1TS8A 3ZYTA 4S2NA 4P85A 5EVEA 3RTYA 1BLSA 3DAVA 1VM1A 3VE4A 3H82A 5HSQA 2Y79A 3BJNA 1YPRA 3PBQA 1BULA 1EI5A 2P9VB 1ERMA 3G2ZA 3SS3A 3IWIA 1ZTUA 4XUXA 4IUKA 4MCWA 2BTFP 1DJAA 1FSYA 4EV4A 2Y2LA 3NDGA 1XP4A 1K55A 2Z2LB 4FSFA 1H3QA 2XGNA 4O0PA 4PM7A 4S2MA 4LV0A 5CGSA 2K7SA 3G32A 5GLAA 1G28A 3AGEA 1KOUA 2EWVA 1HVBA 1K4EA 4OQHA 1N9LA 2Y59A 1E25A 3UDIA 3E2LA 4QD4A 2JKTI 2IWDA 2PYPA 1H8ZA 5EOOA 3LUQA 3UB7A 2INWA 3S22A 1YM1A 2DMWA 4X1MA 1OMEA 4CLCE 2Y2NA 3MFXA 4O01A 4KQQA 1IYPA 4FOFA 1G5UA 1PZOA 1U60A 4L0LA 1JWPA 5EECA 4U3TA 1YKDA 1PW1A 3KO6A 4LCMA 5HX9A 3JPUA 5A93A 3EQUA 1VEUB 4GD6A 4WM9A 1N9OA 2O0YA 4E3LA 3TRCA 4I5SA 3HLCA 1IELA 1JVJA 2JKRI 1XXMA 2ZC7A 1UWPX 2Y2QA 1L0FA 1BYWA 3CPTB 2HV1A 1UWNX 3IWQA 4R38A 2VK3A 5FI6A 2ZM0A 4BMWA 4Q0HA 3F1PB 4R0QA 1QMEA 2WKEA 4CLCD 2E8JA 3BWLA 4KQRA 4M4XA 1W8QA 3MZDA 1CJFA 3FKVA 2XH9A 2VV6A 1AWIA 2VGJA 4PPRA 3UMEA 3HJKA 5F1GA 2WGWB 4B4ZA 4Y2FA 5CTNA 4YWZA 1CEGA 5HL6A 3UMDA 3IWOA 4JGPA 4DXBA 5EPHA 3D3OA 2HP5A 4RX2A 3L7HA 1FR6A 3MS6A 3WWXA 4F94A 1K25A 5F5YA 1W79A 2X02A 5KMWA 3W4PA 2ZMVA 2WKQA 2ZQ9A 3BY8A 4K0WA 3NOPC 3U2AA 2FH5A 4MMNA 4S2LA 1YSPA 4H8RA 5L8MA 3CJMA 4JGRA 4LRZE 4WEJA 3OPPA 4OPZA 1Q2QA 2M7UA 1ES3A 1XJ3A 5FQIA 2ZL1A 5HL1A 1DP8A 4YFMA 1DP9A 3MSHA 4Y0TA 1BUEA 1MWSA 3W4QA 2W27A 1W63Q 3C7VA 4KZ8A 5AQ9A 4Y0OA 4UA9A 1N9NA 2YKHA 3GDIA 2B18A 1G6OA 4ME4A 3LCEA 4KQDA 4BBTA 1ONHA 2J7VA 5E2GA 1G68A 1L3LA 1ODVA 3WS5A 1D7EA 4QB8A 1HTZA 3KSFA 4DE2A 4E3OA 3KSHA 1M6KA 1YLTA 4WZ5A 5HWVA 1J9MA 1V9YA 1MWUA 2EXAA 1MY8A 3QHYA 4YINA 1M40A 3KYQA 2HJEA 1LLBA 3IS2A 3HLDA 4CQHA 1ZG6A 4NG2A 3T1SA 2L1MA 1NY0A 4N9KA 5FI7A 1PZPA 1SKFA 4CLCC 4EU0A 3UB9A 1ES5A 2XA7M 2V2FF 3C30A 1MC0A 4JGQA 5F6AA 1S1YA 2PT7A 3MKEA 1BTLA 3T1RA 3RJUA 2WKRA 2HGVA 3BFEA 4BQMA 1KGFA 3WS2A 5I5LA 3LIDA 4WELA 3Q7VB 1WYBA 3HL9A 3R7WB 2Q9MA 3UNWA 3DTIA 3VFHA 4G3WA 4R3BA 2HDQA 3P7NA 3CG5A 1VETA 3HCYA 3LO7A 1ONGA 4GHIA 4EBLA 3C38A 3F1OB 2DCFA 2QYBA 2EX2A 3BQAA 3IBRA 2V0UA 4BL2A 4P6ZM 3ZG8B 4Y5FA 4OOYA 2ZM8A
chains in the Genus database with same CATH topology
1CI9A 1H5XA 4MNRA 1JTDA 5EVIB 2ZC6B 5FQKA 3VFFA 5CEDA 2WYXA 1L0DA 5DF9A 1LHYA 2WZXA 3DTMA 1XGJA 3ZG7B 3IHBA 3V39A 4JLFA 4Y0UA 2EX8A 2ZD8A 4O7DA 4OPQA 3M2KA 4UAAA 1GCEA 2EFXA 4OQIA 1JTGA 1L2SA 2DNSA 1K4FA 5CTMA 3GR2A 5F82A 5TFQA 2XD1A 3OPRA 1FOFA 5CHJA 2UWXA 5DF7A 3VP0A 4OLGA 2H10A 1ZC2A 3IHAA 1N9BA 1YLPA 2ZC3B 4RX3A 5GHXA 4GDBA 3ZGAB 4OQ0A 5FQ9A 3O3VA 3M6BA 3C4PA 1N4OA 3FV7A 1RGZA 1K55C 4FCFA 4OPRA 4PM6A 5E2HA 2Y2GA 3TG9A 4BLMA 2XDMA 3S4XA 2WKHA 3NI9A 4NETA 1SCWA 4JF4A 2OV5A 1O7EA 2XF3A 2A49A 2WUQA 1E3UA 4KG2A 3PAEA 4JF6A 1SDNA 3BEBA 1KE4A 1BT5A 2WGWA 1O07A 2P9VA 3BYDA 2PU4A 2C5WB 5DF8A 1Y54A 4JXWA 3P98A 2EXBA 2ZLYA 3C7UA 3GQZA 2XFTA 4IVKA 4MBKA 4DE1A 1NYYA 5HAPA 2RL3A 1K6RA 4DE0A 1HD8A 1PW8A 3EQVA 1YMXA 4LCLA 1KGEA 1BLCA 2VGKA 1NZOA 1LL9A 1PI4A 3PBRA 4IBRA 4KENB 3DWZA 4P0MA 1ESIA 4R4RA 2XQZA 4S2OA 1GHPA 4N1XA 5E43A 2JCHA 5DTKA 4ZJ1A 3UY6A 3LY3A 3SS4A 3VP2A 4GOGA 2ZQAA 4E3IA 2WAEA 2Q9NA 4E3NA 4QU3A 1LI0A 2Y2JA 4X56A 1XGIA 5FQMA 2ZQCA 2WKIA 2OLVA 1KVMA 3DWKA 4KZ5A 4WBGA 3PAGA 1MKIA 2QPNA 3ZNYA 1KVLA 4B88A 1I2WA 3CZDA 5FAOA 1MPLA 3IXHA 4GN2A 3BFFA 4ID4A 2Y2MA 4N92A 4R3JA 3UO9A 4EBNA 2ZQDA 4JXSA 2Y91A 3BLSA 2Y55A 4S2NA 3A3FA 1CI8A 4OP8A 2QZ6A 1KDWA 3GRJA 4XXRA 3C4OA 4MBHA 4P85A 5JYOA 3NY4A 1BLSA 3FYZA 1VM1A 2H0YA 3Q1FA 3V50A 1YLJA 5M19A 1KDSA 3SOIA 1YT4A 5JYPA 1JWVA 4GDNA 4NK3A 3NBLA 2BLSA 4Y7PA 3N8RA 3BFCA 4Z9QA 1MWRA 4IEDA 1G6AA 3QNBA 5FASA 3PBQA 2Y2PA 1W8YA 1YMSA 1BULA 4DF6A 4MBFA 1EI5A 3UN7A 2XFSA 2P9VB 4LV3A 1ERMA 3G2ZA 4HBTA 3SS3A 3IWIA 5DTSA 3M2JA 2EFUA 4XUXA 3ZHHA 4E6XA 1IKGA 3MXSA 4GKUA 4UHUA 1FCOA 1DJAA 4KZ3A 3S1YA 3PBTA 1FSYA 3MXRA 4RVAA 4WZ4A 3WS1A 2HDUA 3MFDA 4PM8A 5KSHA 1K6SA 3NIAA 4EV4A 3HLBA 3NDEA 3W8KA 5CHMA 2Y2LA 3ZDJA 3NDGA 3TOIA 4EWFA 4JXVA 3A3IA 1XP4A 3N6IA 1K55A 1XKZA 3MKFA 3G2YA 4HBUA 4KG6A 2Z2LB 3OCNA 4FSFA 2XGNA 4C75A 4QHCA 4PM5A 1I5QA 2B5RA 3HVFA 1FCMA 4PM7A 5TGFA 1K56D 2H5SA 4S2MA 2E8IA 4LV0A 3LY4A 5CGSA 3ITBA 3UPPA 1IKIA 2WZZA 3G32A 1I2SA 3Q07A 5GLAA 5KSCA 3FWLA 5GLCA 5AQBA 3BLMA 3AGEA 3VP1A 4S2PA 1HVBA 3HREA 1K4EA 4OQHA 5CHUA 1SDEA 1W7FA 2GDNA 2Y59A 1E25A 3OPLA 3VMAA 4RA7A 1CK3A 3OPHA 5CGWA 3UDIA 3VSLA 3IXDA 3E2LA 1KE3A 4QD4A 3IF6B 3IXBA 5CECA 5HAIA 5D3OA 2IWDA 3VSKA 2HDRA 2C6WB 2HPBA 1H8ZA 5EOOA 3SH7A 2WADA 5EE8A 3Q7ZA 2CC1A 1DJCA 1PI5A 3M6HA 1FSWA 3S22A 3GV9A 2OLUA 4BL3A 3IT9A 2XD5A 1YM1A 2I72A 3Q7VA 1OMEA 2Y2NA 4DDYA 3D4FA 4E3MA 3IH9A 3FKWA 2JE5A 3G30A 3O87A 5J8XA 1IYSA 1EWZA 4KQQA 4UA6A 1IYPA 3I7JA 1MBLA 1PZOA 3NCKA 1U60A 3GMWA 3JYIA 1IYQA 4KQOA 5AQ7A 4D2OA 4N1HA 1TEMA 4L0LA 1JWPA 2X71A 4LV1A 5EECA 3WS4A 3HLGA 4U3TA 3UDXA 4RYEA 5E2EA 1PW1A 4LCMA 5HX9A 4FH2A 2R9WA 3UE3A 2IWBA 5FQQA 3O88A 5U47A 5A93A 3EQUA 3Q82A 4GD6A 4WM9A 1ES2A 2EX9A 3PBNA 4UA7A 3SH8A 4OVDA 3WRTA 3PBOA 4S2KA 4A5RA 4E3LA 3IH8A 1XPBA 4X55A 1WYCA 4ZAMA 3HLCA 1IELA 1JVJA 1BLPA 1XXMA 4OPYA 2ZC7A 4OLDA 3OCLA 4K0XA 2Y2QA 1L0FA 4MEZA 4KZ7A 5HARA 4OONA 4FH4A 3BFDA 3IWQA 1E3UD 1LI9A 3G4PA 1EROA 1WE4A 4BD0A 5FI6A 5FATA 2ZM0A 3UPNA 4R0QA 1QMEA 4KZ9A 3AGDA 4KZ4A 2WKEA 5EUAA 2ZQ7A 4JBFA 3HLWA 4JKTA 1ES4A 2HP9A 1PWGA 3V3SA 1GHIA 4CPKA 4R23A 4KQRA 2ZJ9A 5L2FA 1LL5A 4E6WA 5FSRA 1BSGA 3N4IA 4QY6A 1W8QA 2R9XA 4OKPA 4C3QA 3MZDA 3FKVA 2ZC5B 5FAPA 2XH9A 1VQQA 2VGJA 4HESA 4PPRA 3VOYA 4BENA 1K56A 4P87A 5F1GA 4WYYA 2WGWB 4ZJ2A 1K54C 1JWZA 4GD8A 2Y2HA 3PBSA 5EVIC 5EVID 3UPOA 1PWDA 4B4ZA 5CTNA 4KG5A 1ALQA 3MBZA 1TVFA 1CEGA 1K57C 3E2KA 1ZG4A 3IWOA 3ZCZA 3V5MA 2FFFB 5AQAA 4DXBA 5EPHA 1DY6A 5FQJA 2HP5A 4RX2A 4JXGA 3IXGA 1ZKJA 1FR6A 3WWXA 3ZG9B 4QY5A 2Y2KA 4C6YA 3TSGA 1NXYA 4LV2A 4F94A 1K25A 4MLLA 1W79A 1DJBA 2X02A 5KMWA 3W4PA 4K0WA 2ZQ9A 3GTCA 3HLEA 4S2LA 4H8RA 4S2JA 3CJMA 4N9LA 2J9PA 2WK0A 4WEJA 3OPPA 4OPZA 1Q2QA 3N8LA 4FD8A 5GHYA 5DTTA 3NC8A 3OZHA 5I94A 1BLHA 3RXXA 1HZOA 1ES3A 3DW0A 4EUZA 5FQIA 1PIOA 5HL1A 2Z2MB 4ZJ3A 1YLZA 2EX6A 2RCXA 4YFMA 4X68A 5G18A 5GL9A 3G34A 3HUMA 4Y0TA 3ZG5A 1BUEA 4WMCD 3P09A 3VP3A 1MWSA 3MZFA 5F83A 3W4QA 3C7VA 2PBYA 1TDGA 4KZ8A 3B3XA 4Y0OA 5AQ9A 1KGGA 1ERQA 2ZQ8A 4KZBA 2Y2OA 4UA9A 1NJ4A 4DXCA 4EQIA 3FZCA 4X53A 2JBFA 4QJGA 2WGVA 3GVBA 3BECA 3N8SA 2XK1A 5GLDA 2HP6A 3ZFZA 4ZBEA 4CJNA 5KZHA 1K38A 1S0WA 4S2IA 1IYOA 3LCEA 3QNCA 1KE0A 4R1GA 1YQSA 2G2WA 3UE0A 1ONHA 4OP5A 1RCJA 3WRZA 1FCNA 5CRFA 1GA0A 2J7VA 3Q81A 1G68A 4OOMA 3GSGA 5E2GA 1L0GA 3WS5A 3PTEA 3WS0A 1C3BA 2XLNA 3BRMA 4QB8A 2J8YA 1HTZA 5M18A 4DE2A 4E3OA 5FAQA 4K91A 4B4XA 4GNUA 3ZNTA 5A92A 1CEFA 5HAQA 1M6KA 1YLTA 2QMIA 3BM6A 4WZ5A 5IHVA 1J9MA 1BZAA 1YLWA 4DDSA 3LEZA 5TR7A 4DE3A 1MWUA 2A3UA 5FA7A 3VOZA 2Y4AA 2EXAA 1NZUA 3V3RA 1MY8A 3QHYA 4YINA 5DVAA 2V1ZA 3UE1A 3O86A 1AXBA 1GHMA 4OH0A 1M40A 3C5AA 1Z6FA 2HDSA 4HEFA 4DKIA 1RP5A 2J9OA 4R4SA 5EVLA 1H8YA 1MXOA 5E2FA 4X69A 3HBRA 1LLBA 3ZG0A 4Q8IA 3HLDA 1K54A 4GZBA 1FQGA 5CXWA 5BOHA 1ZG6A 5EVIA 3A3JA 3ZVWA 5HW3A 3A3EA 4PMAA 1NY0A 3N7WA 4N9KA 5FI7A 1PZPA 1SKFA 4WZ5C 1W5DA 1ES5A 2IWCA 4P6BA 4IBXA 5FI2A 1K57A 2WGIA 2V20A 4XUZA 4ZDXA 4DRTA 3RXWA 2V2FF 2PU2A 3G35A 5HFOA 4IVIA 4OOLA 3MKEA 1BTLA 3RJUA 4KZ6A 3ZVTA 1IEMA 2ZMAA 3BFEA 2BG1A 4OQGA 1GA9A 3IF6A 4ZTKA 4BD1A 4E3JA 4BQMA 1KGFA 3WS2A 1YLYA 3SH9A 1NRFA 5F1FA 5CEBA 2XR0A 5A90A 3IF5A 4PM9A 5EOEA 3OC2A 3UDFA 3AGFA 4WELA 4E3KA 1XA1A 3Q7VB 3VP4A 1WYBA 4EBPA 4JPMA 2JC7A 3HL9A 5GHZA 3HUOA 2Q9MA 2WAFA 5FDHA 3UNWA 3HLFA 5GLBA 3VFHA 3CMZA 2X01A 1FR1A 4R3BA 2HDQA 3W4OA 3IQAA 1ESUA 1S6RA 4JF5A 4X6TA 3CG5A 4BJPA 1Q2PA 3LO7A 1ONGA 3ITAA 2H0TA 3SS5A 4EBLA 2P74A 1SHVA 3BFGA 3MZEA 5CGXA 1QMFA 2DRWA 4S2NC 4WMCA 1PWCA 4U0TA 4GB7A 3IF6C 2DCFA 2Y2IA 1L0EA 2FFYA 4WEKA 2EX2A 1NYMA 2OSUA 4M3KA 3A3DA 3HUNA 1XX2A 5CERA 2ZM2A 1E4DA 5A91A 4BL2A 2ZC4B 2ZM8A 3G31A 5M1AA 3ISGA 4U0XA 1TDLA 4KZAA 3ZG8B 4OOYA 4LENA 1RGYA 1XA7A 2G2UA 1MWTA 2XEPA 1PYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CI9 A;  1H5X A;  4MNR A;  1JTD A;  5EVI B;  2ZC6 B;  5FQK A;  3VFF A;  5CED A;  2WYX A;  1L0D A;  5DF9 A;  1LHY A;  2WZX A;  3DTM A;  1XGJ A;  3ZG7 B;  3IHB A;  3V39 A;  4JLF A;  4Y0U A;  2EX8 A;  2ZD8 A;  4O7D A;  4OPQ A;  3M2K A;  4UAA A;  1GCE A;  2EFX A;  4OQI A;  1JTG A;  1L2S A;  2DNS A;  1K4F A;  5CTM A;  3GR2 A;  5F82 A;  5TFQ A;  2XD1 A;  3OPR A;  1FOF A;  5CHJ A;  2UWX A;  5DF7 A;  3VP0 A;  4OLG A;  2H10 A;  1ZC2 A;  3IHA A;  1N9B A;  1YLP A;  2ZC3 B;  4RX3 A;  5GHX A;  4GDB A;  3ZGA B;  4OQ0 A;  5FQ9 A;  3O3V A;  3M6B A;  3C4P A;  1N4O A;  3FV7 A;  1RGZ A;  1K55 C;  4FCF A;  4OPR A;  4PM6 A;  5E2H A;  2Y2G A;  3TG9 A;  4BLM A;  2XDM A;  3S4X A;  2WKH A;  3NI9 A;  4NET A;  1SCW A;  4JF4 A;  2OV5 A;  1O7E A;  2XF3 A;  2A49 A;  2WUQ A;  1E3U A;  4KG2 A;  3PAE A;  4JF6 A;  1SDN A;  3BEB A;  1KE4 A;  1BT5 A;  2WGW A;  1O07 A;  2P9V A;  3BYD A;  2PU4 A;  2C5W B;  5DF8 A;  1Y54 A;  4JXW A;  3P98 A;  2EXB A;  2ZLY A;  3C7U A;  3GQZ A;  2XFT A;  4IVK A;  4MBK A;  4DE1 A;  1NYY A;  5HAP A;  2RL3 A;  1K6R A;  4DE0 A;  1HD8 A;  1PW8 A;  3EQV A;  1YMX A;  4LCL A;  1KGE A;  1BLC A;  2VGK A;  1NZO A;  1LL9 A;  1PI4 A;  3PBR A;  4IBR A;  4KEN B;  3DWZ A;  4P0M A;  1ESI A;  4R4R A;  2XQZ A;  4S2O A;  1GHP A;  4N1X A;  5E43 A;  2JCH A;  5DTK A;  4ZJ1 A;  3UY6 A;  3LY3 A;  3SS4 A;  3VP2 A;  4GOG A;  2ZQA A;  4E3I A;  2WAE A;  2Q9N A;  4E3N A;  4QU3 A;  1LI0 A;  2Y2J A;  4X56 A;  1XGI A;  5FQM A;  2ZQC A;  2WKI A;  2OLV A;  1KVM A;  3DWK A;  4KZ5 A;  4WBG A;  3PAG A;  1MKI A;  2QPN A;  3ZNY A;  1KVL A;  4B88 A;  1I2W A;  3CZD A;  5FAO A;  1MPL A;  3IXH A;  4GN2 A;  3BFF A;  4ID4 A;  2Y2M A;  4N92 A;  4R3J A;  3UO9 A;  4EBN A;  2ZQD A;  4JXS A;  2Y91 A;  3BLS A;  2Y55 A;  4S2N A;  3A3F A;  1CI8 A;  4OP8 A;  2QZ6 A;  1KDW A;  3GRJ A;  4XXR A;  3C4O A;  4MBH A;  4P85 A;  5JYO A;  3NY4 A;  1BLS A;  3FYZ A;  1VM1 A;  2H0Y A;  3Q1F A;  3V50 A;  1YLJ A;  5M19 A;  1KDS A;  3SOI A;  1YT4 A;  5JYP A;  1JWV A;  4GDN A;  4NK3 A;  3NBL A;  2BLS A;  4Y7P A;  3N8R A;  3BFC A;  4Z9Q A;  1MWR A;  4IED A;  1G6A A;  3QNB A;  5FAS A;  3PBQ A;  2Y2P A;  1W8Y A;  1YMS A;  1BUL A;  4DF6 A;  4MBF A;  1EI5 A;  3UN7 A;  2XFS A;  2P9V B;  4LV3 A;  1ERM A;  3G2Z A;  4HBT A;  3SS3 A;  3IWI A;  5DTS A;  3M2J A;  2EFU A;  4XUX A;  3ZHH A;  4E6X A;  1IKG A;  3MXS A;  4GKU A;  4UHU A;  1FCO A;  1DJA A;  4KZ3 A;  3S1Y A;  3PBT A;  1FSY A;  3MXR A;  4RVA A;  4WZ4 A;  3WS1 A;  2HDU A;  3MFD A;  4PM8 A;  5KSH A;  1K6S A;  3NIA A;  4EV4 A;  3HLB A;  3NDE A;  3W8K A;  5CHM A;  2Y2L A;  3ZDJ A;  3NDG A;  3TOI A;  4EWF A;  4JXV A;  3A3I A;  1XP4 A;  3N6I A;  1K55 A;  1XKZ A;  3MKF A;  3G2Y A;  4HBU A;  4KG6 A;  2Z2L B;  3OCN A;  4FSF A;  2XGN A;  4C75 A;  4QHC A;  4PM5 A;  1I5Q A;  2B5R A;  3HVF A;  1FCM A;  4PM7 A;  5TGF A;  1K56 D;  2H5S A;  4S2M A;  2E8I A;  4LV0 A;  3LY4 A;  5CGS A;  3ITB A;  3UPP A;  1IKI A;  2WZZ A;  3G32 A;  1I2S A;  3Q07 A;  5GLA A;  5KSC A;  3FWL A;  5GLC A;  5AQB A;  3BLM A;  3AGE A;  3VP1 A;  4S2P A;  1HVB A;  3HRE A;  1K4E A;  4OQH A;  5CHU A;  1SDE A;  1W7F A;  2GDN A;  2Y59 A;  1E25 A;  3OPL A;  3VMA A;  4RA7 A;  1CK3 A;  3OPH A;  5CGW A;  3UDI A;  3VSL A;  3IXD A;  3E2L A;  1KE3 A;  4QD4 A;  3IF6 B;  3IXB A;  5CEC A;  5HAI A;  5D3O A;  2IWD A;  3VSK A;  2HDR A;  2C6W B;  2HPB A;  1H8Z A;  5EOO A;  3SH7 A;  2WAD A;  5EE8 A;  3Q7Z A;  2CC1 A;  1DJC A;  1PI5 A;  3M6H A;  1FSW A;  3S22 A;  3GV9 A;  2OLU A;  4BL3 A;  3IT9 A;  2XD5 A;  1YM1 A;  2I72 A;  3Q7V A;  1OME A;  2Y2N A;  4DDY A;  3D4F A;  4E3M A;  3IH9 A;  3FKW A;  2JE5 A;  3G30 A;  3O87 A;  5J8X A;  1IYS A;  1EWZ A;  4KQQ A;  4UA6 A;  1IYP A;  3I7J A;  1MBL A;  1PZO A;  3NCK A;  1U60 A;  3GMW A;  3JYI A;  1IYQ A;  4KQO A;  5AQ7 A;  4D2O A;  4N1H A;  1TEM A;  4L0L A;  1JWP A;  2X71 A;  4LV1 A;  5EEC A;  3WS4 A;  3HLG A;  4U3T A;  3UDX A;  4RYE A;  5E2E A;  1PW1 A;  4LCM A;  5HX9 A;  4FH2 A;  2R9W A;  3UE3 A;  2IWB A;  5FQQ A;  3O88 A;  5U47 A;  5A93 A;  3EQU A;  3Q82 A;  4GD6 A;  4WM9 A;  1ES2 A;  2EX9 A;  3PBN A;  4UA7 A;  3SH8 A;  4OVD A;  3WRT A;  3PBO A;  4S2K A;  4A5R A;  4E3L A;  3IH8 A;  1XPB A;  4X55 A;  1WYC A;  4ZAM A;  3HLC A;  1IEL A;  1JVJ A;  1BLP A;  1XXM A;  4OPY A;  2ZC7 A;  4OLD A;  3OCL A;  4K0X A;  2Y2Q A;  1L0F A;  4MEZ A;  4KZ7 A;  5HAR A;  4OON A;  4FH4 A;  3BFD A;  3IWQ A;  1E3U D;  1LI9 A;  3G4P A;  1ERO A;  1WE4 A;  4BD0 A;  5FI6 A;  5FAT A;  2ZM0 A;  3UPN A;  4R0Q A;  1QME A;  4KZ9 A;  3AGD A;  4KZ4 A;  2WKE A;  5EUA A;  2ZQ7 A;  4JBF A;  3HLW A;  4JKT A;  1ES4 A;  2HP9 A;  1PWG A;  3V3S A;  1GHI A;  4CPK A;  4R23 A;  4KQR A;  2ZJ9 A;  5L2F A;  1LL5 A;  4E6W A;  5FSR A;  1BSG A;  3N4I A;  4QY6 A;  1W8Q A;  2R9X A;  4OKP A;  4C3Q A;  3MZD A;  3FKV A;  2ZC5 B;  5FAP A;  2XH9 A;  1VQQ A;  2VGJ A;  4HES A;  4PPR A;  3VOY A;  4BEN A;  1K56 A;  4P87 A;  5F1G A;  4WYY A;  2WGW B;  4ZJ2 A;  1K54 C;  1JWZ A;  4GD8 A;  2Y2H A;  3PBS A;  5EVI C;  5EVI D;  3UPO A;  1PWD A;  4B4Z A;  5CTN A;  4KG5 A;  1ALQ A;  3MBZ A;  1TVF A;  1CEG A;  1K57 C;  3E2K A;  1ZG4 A;  3IWO A;  3ZCZ A;  3V5M A;  2FFF B;  5AQA A;  4DXB A;  5EPH A;  1DY6 A;  5FQJ A;  2HP5 A;  4RX2 A;  4JXG A;  3IXG A;  1ZKJ A;  1FR6 A;  3WWX A;  3ZG9 B;  4QY5 A;  2Y2K A;  4C6Y A;  3TSG A;  1NXY A;  4LV2 A;  4F94 A;  1K25 A;  4MLL A;  1W79 A;  1DJB A;  2X02 A;  5KMW A;  3W4P A;  4K0W A;  2ZQ9 A;  3GTC A;  3HLE A;  4S2L A;  4H8R A;  4S2J A;  3CJM A;  4N9L A;  2J9P A;  2WK0 A;  4WEJ A;  3OPP A;  4OPZ A;  1Q2Q A;  3N8L A;  4FD8 A;  5GHY A;  5DTT A;  3NC8 A;  3OZH A;  5I94 A;  1BLH A;  3RXX A;  1HZO A;  1ES3 A;  3DW0 A;  4EUZ A;  5FQI A;  1PIO A;  5HL1 A;  2Z2M B;  4ZJ3 A;  1YLZ A;  2EX6 A;  2RCX A;  4YFM A;  4X68 A;  5G18 A;  5GL9 A;  3G34 A;  3HUM A;  4Y0T A;  3ZG5 A;  1BUE A;  4WMC D;  3P09 A;  3VP3 A;  1MWS A;  3MZF A;  5F83 A;  3W4Q A;  3C7V A;  2PBY A;  1TDG A;  4KZ8 A;  3B3X A;  4Y0O A;  5AQ9 A;  1KGG A;  1ERQ A;  2ZQ8 A;  4KZB A;  2Y2O A;  4UA9 A;  1NJ4 A;  4DXC A;  4EQI A;  3FZC A;  4X53 A;  2JBF A;  4QJG A;  2WGV A;  3GVB A;  3BEC A;  3N8S A;  2XK1 A;  5GLD A;  2HP6 A;  3ZFZ A;  4ZBE A;  4CJN A;  5KZH A;  1K38 A;  1S0W A;  4S2I A;  1IYO A;  3LCE A;  3QNC A;  1KE0 A;  4R1G A;  1YQS A;  2G2W A;  3UE0 A;  1ONH A;  4OP5 A;  1RCJ A;  3WRZ A;  1FCN A;  5CRF A;  1GA0 A;  2J7V A;  3Q81 A;  1G68 A;  4OOM A;  3GSG A;  5E2G A;  1L0G A;  3WS5 A;  3PTE A;  3WS0 A;  1C3B A;  2XLN A;  3BRM A;  4QB8 A;  2J8Y A;  1HTZ A;  5M18 A;  4DE2 A;  4E3O A;  5FAQ A;  4K91 A;  4B4X A;  4GNU A;  3ZNT A;  5A92 A;  1CEF A;  5HAQ A;  1M6K A;  1YLT A;  2QMI A;  3BM6 A;  4WZ5 A;  5IHV A;  1J9M A;  1BZA A;  1YLW A;  4DDS A;  3LEZ A;  5TR7 A;  4DE3 A;  1MWU A;  2A3U A;  5FA7 A;  3VOZ A;  2Y4A A;  2EXA A;  1NZU A;  3V3R A;  1MY8 A;  3QHY A;  4YIN A;  5DVA A;  2V1Z A;  3UE1 A;  3O86 A;  1AXB A;  1GHM A;  4OH0 A;  1M40 A;  3C5A A;  1Z6F A;  2HDS A;  4HEF A;  4DKI A;  1RP5 A;  2J9O A;  4R4S A;  5EVL A;  1H8Y A;  1MXO A;  5E2F A;  4X69 A;  3HBR A;  1LLB A;  3ZG0 A;  4Q8I A;  3HLD A;  1K54 A;  4GZB A;  1FQG A;  5CXW A;  5BOH A;  1ZG6 A;  5EVI A;  3A3J A;  3ZVW A;  5HW3 A;  3A3E A;  4PMA A;  1NY0 A;  3N7W A;  4N9K A;  5FI7 A;  1PZP A;  1SKF A;  4WZ5 C;  1W5D A;  1ES5 A;  2IWC A;  4P6B A;  4IBX A;  5FI2 A;  1K57 A;  2WGI A;  2V20 A;  4XUZ A;  4ZDX A;  4DRT A;  3RXW A;  2V2F F;  2PU2 A;  3G35 A;  5HFO A;  4IVI A;  4OOL A;  3MKE A;  1BTL A;  3RJU A;  4KZ6 A;  3ZVT A;  1IEM A;  2ZMA A;  3BFE A;  2BG1 A;  4OQG A;  1GA9 A;  3IF6 A;  4ZTK A;  4BD1 A;  4E3J A;  4BQM A;  1KGF A;  3WS2 A;  1YLY A;  3SH9 A;  1NRF A;  5F1F A;  5CEB A;  2XR0 A;  5A90 A;  3IF5 A;  4PM9 A;  5EOE A;  3OC2 A;  3UDF A;  3AGF A;  4WEL A;  4E3K A;  1XA1 A;  3Q7V B;  3VP4 A;  1WYB A;  4EBP A;  4JPM A;  2JC7 A;  3HL9 A;  5GHZ A;  3HUO A;  2Q9M A;  2WAF A;  5FDH A;  3UNW A;  3HLF A;  5GLB A;  3VFH A;  3CMZ A;  2X01 A;  1FR1 A;  4R3B A;  2HDQ A;  3W4O A;  3IQA A;  1ESU A;  1S6R A;  4JF5 A;  4X6T A;  3CG5 A;  4BJP A;  1Q2P A;  3LO7 A;  1ONG A;  3ITA A;  2H0T A;  3SS5 A;  4EBL A;  2P74 A;  1SHV A;  3BFG A;  3MZE A;  5CGX A;  1QMF A;  2DRW A;  4S2N C;  4WMC A;  1PWC A;  4U0T A;  4GB7 A;  3IF6 C;  2DCF A;  2Y2I A;  1L0E A;  2FFY A;  4WEK A;  2EX2 A;  1NYM A;  2OSU A;  4M3K A;  3A3D A;  3HUN A;  1XX2 A;  5CER A;  2ZM2 A;  1E4D A;  5A91 A;  4BL2 A;  2ZC4 B;  2ZM8 A;  3G31 A;  5M1A A;  3ISG A;  4U0X A;  1TDL A;  4KZA A;  3ZG8 B;  4OOY A;  4LEN A;  1RGY A;  1XA7 A;  2G2U A;  1MWT A;  2XEP A;  1PYY A; 
#chains in the Genus database with same CATH topology
 5EVI B;  3DTK A;  3K2N A;  3VFF A;  3H9W A;  5DF9 A;  4HOI A;  2OAQ 1;  4O7D A;  2OAP 1;  3A0R A;  4UAA A;  5TFQ A;  2G7U A;  3GR2 A;  3F1P A;  1FOF A;  1ZC2 A;  1YLP A;  4RX3 A;  1PNE A;  3ZGA B;  5FQ9 A;  3K3D A;  5HDS A;  3C4P A;  2Y2G A;  2XDM A;  2D02 A;  2ZOH A;  2A49 A;  3PAE A;  4HNB A;  1KE4 A;  1BT5 A;  2WGW A;  5IT5 A;  2PU4 A;  2VGL M;  4I3I A;  4CLC A;  1Y54 A;  4JXW A;  3P98 A;  4MBK A;  3CIT A;  4Y13 A;  1HD8 A;  3EQV A;  3FPW A;  4LCL A;  1KGE A;  5HPF A;  2XRN A;  4AFI A;  4IBR A;  4P0M A;  2VGK A;  1PI4 A;  3PBR A;  5FDS A;  1ESI A;  4R4R A;  4HJ3 A;  5G4Z A;  4K08 A;  5DTK A;  1D06 A;  3MQQ A;  3LY3 A;  2Q9N A;  2KOI A;  3S7O A;  4QU3 A;  1LI0 A;  4G3V A;  5IS1 A;  5FQM A;  4L9G A;  2ZQC A;  4GS9 B;  2OLV A;  1KVM A;  3ZNY A;  1KVL A;  1I2W A;  3CZD A;  5FAO A;  4QWO A;  3KYZ A;  4R3J A;  4JXS A;  2Y91 A;  5HWT A;  1DRM A;  3A3F A;  1X0O A;  3PXP A;  2QZ6 A;  3GRJ A;  3T1Q B;  4XXR A;  2VKS A;  1GSW A;  4LPZ A;  4NXG A;  4R6L A;  4Y15 A;  3V50 A;  1YLJ A;  5M19 A;  1S4R A;  1YT4 A;  4NK3 A;  3N8R A;  4IED A;  5FAS A;  1W8Y A;  1YMS A;  4DF6 A;  3UB6 A;  2PYR A;  3T4Q A;  1T19 A;  3RH8 B;  3ZHH A;  4R70 A;  3MXS A;  3MXR A;  4WZ4 A;  2HDU A;  3HLB A;  1SKO A;  3ZDJ A;  3MMH A;  3N6I A;  4E3M A;  5AVE A;  1I5Q A;  3HVF A;  1P9W A;  3ITB A;  2GJ3 A;  3Q07 A;  5DJU A;  5GLC A;  3VP1 A;  4S2P A;  4BWI A;  5CHU A;  1TF1 A;  5HD5 A;  1CQA A;  3VMA A;  1CK3 A;  2MJ6 A;  5L10 A;  4HJ4 A;  1KE3 A;  2W3G A;  5D3O A;  5AVF A;  4B93 A;  1OTA A;  2HPB A;  3SH7 A;  2WKP A;  3LR4 A;  1PI5 A;  3P01 A;  4EQ1 A;  3GV9 A;  2OLU A;  3IT9 A;  2XD5 A;  3Q7V A;  4NXE A;  2OWH A;  3NJA A;  3I7J A;  1MBL A;  3NCK A;  2LB9 A;  3JYI A;  1IYQ A;  4N1H A;  3O88 A;  4WLA A;  3Q82 A;  4H6J B;  3SH8 A;  4A5R A;  3WRT A;  3KSG A;  3PBO A;  1WYC A;  2BAS A;  2PHY A;  4OPY A;  4K0X A;  3F1N A;  4MEZ A;  3B42 A;  3GEC A;  2NUT C;  4EEP A;  1LI9 A;  1ERO A;  3E98 A;  4MDZ A;  3UPN A;  1STZ A;  3HLW A;  4JKT A;  1XJ4 A;  1PWG A;  4F3L A;  3V3S A;  1GHI A;  1BSG A;  3N4I A;  2R9X A;  4OKP A;  4C3Q A;  1VQQ A;  4HP9 A;  1K56 A;  4HH2 A;  4XT2 B;  4Q0I A;  4WYY A;  4ZJ2 A;  3UPO A;  4DJ2 A;  1ALQ A;  3E2K A;  1ZG4 A;  3PR6 A;  3ZCZ A;  5AQA A;  2O99 A;  1YAX A;  2VEA A;  3IXG A;  1ZKJ A;  3ZG9 B;  2Y2K A;  2V1A A;  3IBJ A;  1NXY A;  1TD5 A;  3HLE A;  1VHM A;  5GHY A;  3NC8 A;  3OZH A;  3RXX A;  1PIO A;  4PKY A;  2EX6 A;  2RCX A;  3QP1 A;  5G18 A;  1Y4O A;  3HUM A;  4R3A A;  3LR3 A;  3P09 A;  4D60 A;  5FEG A;  1TDG A;  3B3X A;  1ERQ A;  2ZQ8 A;  3E0Y A;  5IU1 A;  4X53 A;  4QJG A;  2XK1 A;  5TBM B;  3OLO A;  3QNC A;  4R1G A;  1YQS A;  4OP5 A;  1FCN A;  5CRF A;  1L0G A;  3PTE A;  3WS0 A;  1C3B A;  3BRM A;  2PD8 A;  1MKM A;  2V8C A;  5F68 A;  4B4X A;  3EEA A;  4LRY C;  4DDS A;  3LEZ A;  2A3U A;  3VOZ A;  1GHM A;  3C5A A;  4HEF A;  5J4E A;  1RP5 A;  3T12 B;  1MXO A;  4NXF A;  5HD3 A;  3ZG0 A;  4Q8I A;  5BOH A;  1OTB A;  2H28 A;  5HW3 A;  4Z1W A;  3N7W A;  4WZ5 C;  3LR5 A;  5FI2 A;  1XJ6 A;  2WGI A;  2V20 A;  2Z6D A;  4DRT A;  3RXW A;  1NRJ A;  2PU2 A;  5HFO A;  3CLO A;  3ZVT A;  2Z6C A;  2EWW A;  4BD1 A;  2M1C A;  1NRF A;  4PM9 A;  4EXO A;  3AGF A;  1XA1 A;  4JPM A;  2O9C A;  3JVV A;  1OTE A;  5GLB A;  3LIF A;  3CMZ A;  2X01 A;  1FR1 A;  3W4O A;  1ESU A;  4JF5 A;  1NLZ A;  4NKP A;  1Q2P A;  1OT6 A;  2DRW A;  4WMC A;  2OOL A;  4WEK A;  3A3D A;  3HUN A;  5CER A;  1E4D A;  1DP6 A;  2ZC4 B;  3T4L A;  3ISG A;  1TDL A;  3FPV A;  4KZA A;  4LEN A;  1RGY A;  1MWT A;  1PFL A;  5G4Y A;  4DJ3 A;  5CED A;  3O5Y A;  4DMZ A;  1XGJ A;  2EX8 A;  2ZD8 A;  5A8B A;  5DKK A;  4OQI A;  5F82 A;  2DNS A;  5CHJ A;  1S66 L;  2UWX A;  3VP0 A;  4OLG A;  2W3D A;  5GHX A;  3LIB A;  4GDB A;  3EWK A;  1RGZ A;  5E2H A;  4BLM A;  3S4X A;  1SCW A;  4WF0 A;  1A0K A;  3PHY A;  1O07 A;  2P9V A;  4WN5 A;  4KUK A;  2EXB A;  3DBA A;  4MN6 A;  4IHQ A;  5F69 A;  2O9A A;  4NEE D;  4DE1 A;  4DE0 A;  2W1T B;  1PW8 A;  1YMX A;  3S7N A;  1NZO A;  1LL9 A;  4KEN B;  4EET B;  3B47 A;  5MC7 A;  1J3W A;  5J7E A;  3SS4 A;  3VP2 A;  3L9K A;  4X56 A;  1XGI A;  5TJJ A;  4X1L A;  5AJG A;  2QPN A;  1CF0 A;  2D01 A;  4FTX A;  3IXH A;  4GN2 A;  3BFF A;  4ID4 A;  2ZQD A;  5KIZ A;  3R4K A;  4OP8 A;  1KDW A;  3C4O A;  5JYO A;  2PR6 A;  1FIK A;  3FYZ A;  1KDS A;  5JYP A;  1JWV A;  4GLQ A;  5TBM A;  4Y7P A;  4Z9Q A;  3QNB A;  2Y2P A;  4MBF A;  3PYP A;  4II7 A;  1ACF A;  2XFS A;  4HBT A;  5DTS A;  5FL3 A;  2OWJ A;  1IKG A;  4GKU A;  4UHU A;  1FCO A;  4KZ3 A;  3PBT A;  1VEU A;  3W2Z A;  3WS1 A;  4PM8 A;  1K6S A;  1OTI A;  2JKG A;  3TOI A;  4JXV A;  5DJT A;  4HBU A;  3MKF A;  1XKZ A;  3G2Y A;  4C75 A;  3OCN A;  1V9Z A;  4I3A A;  4PM5 A;  2B5R A;  1FCM A;  1K56 D;  2H5S A;  1F98 A;  5EFW A;  3S7Q A;  3LY4 A;  3CPT A;  1I2S A;  5KSC A;  5AQB A;  4BBU A;  1LL8 A;  3BLM A;  1W7F A;  2GDN A;  3ICY A;  4WUJ A;  3OPH A;  4EEU A;  1JNU A;  3VSL A;  2QJ5 A;  2QWS A;  3IF6 B;  3IXB A;  5FEF A;  5CEC A;  1T1B A;  5HAI A;  3VSK A;  2HDR A;  2C6W B;  5EE8 A;  3Q7Z A;  3M6H A;  1P97 A;  2I72 A;  1NWZ A;  3IH9 A;  3FKW A;  4GCZ A;  2JE5 A;  3O87 A;  5J8X A;  1IYS A;  4UA6 A;  1LSX A;  5HWW A;  5AQ7 A;  3A0V A;  1TEM A;  3QP2 A;  4LV1 A;  3WS4 A;  4ESP A;  3LFV A;  4WL9 A;  1YSQ A;  2IWB A;  5FQQ A;  3PBN A;  3BW6 A;  4UA7 A;  3LIE A;  4OVD A;  1IOU A;  1XPB A;  2J3W A;  1BLP A;  2NUP C;  4OLD A;  3OCL A;  4EW7 A;  1XJ2 A;  1GSV A;  2JKF A;  2J3T C;  4KZ7 A;  4OON A;  4FH4 A;  3G4P A;  1T1A A;  1WE4 A;  3S7P A;  2LB5 A;  3E4O A;  4X25 A;  4KZ9 A;  3AGD A;  4KZ4 A;  2VA0 A;  5EUA A;  2V0W A;  2ZQ7 A;  3UB8 A;  4JBF A;  1ES4 A;  4PHT A;  4G3K A;  4CPK A;  3VE3 A;  4KUO A;  4YNR A;  4HP4 A;  2ZC5 B;  5FAP A;  4ARZ B;  4HES A;  4BEN A;  5DFX A;  4UQI S;  1JWZ A;  4GD8 A;  5EVI C;  4DN0 A;  3T4K A;  2W3H A;  4KG5 A;  1TVF A;  1LT0 A;  1K57 C;  4Q0J A;  3V5M A;  3RFB A;  2K2N A;  1TS0 A;  4MN5 A;  2Y8H A;  3TSG A;  4LV2 A;  2W1T A;  4MLL A;  3DTE A;  4YOF A;  2J9P A;  3D72 A;  2WK0 A;  3N8L A;  2XSS A;  5I94 A;  3DW0 A;  1H0M A;  4HY8 A;  5HPI A;  2Z2M B;  2W1R A;  4ZJ3 A;  3E4P A;  2PD7 A;  5GL9 A;  3G34 A;  3ZG5 A;  4WMC D;  2PBY A;  1KGG A;  2ZMF A;  4KZB A;  4EQI A;  1NJ4 A;  2WGV A;  3BEC A;  3N8S A;  2HP6 A;  4ZBE A;  1K38 A;  1S0W A;  4S2I A;  1IYO A;  1FIL A;  3R7W A;  2CMN A;  2G2W A;  3UE0 A;  3ZQ5 A;  1RCJ A;  2YKF A;  1GA0 A;  3Q81 A;  3JVU A;  4OOM A;  4HHD A;  4BBV A;  3QP5 A;  2PBD P;  5M18 A;  4K91 A;  3ZNT A;  3F1O A;  1BZA A;  1YLW A;  5TR7 A;  4DE3 A;  5FA7 A;  2Y4A A;  1NZU A;  3UE1 A;  5DVA A;  3EGX C;  2HDS A;  2J9O A;  5EVL A;  4L9F A;  3HBR A;  2IA2 A;  2GNX A;  1P0Z A;  5EVI A;  3ZVW A;  4PMA A;  4ETZ A;  2HF6 A;  4P6B A;  2IWC A;  1S1Z A;  4IBX A;  1K57 A;  3EOI A;  4XUZ A;  4ZDX A;  1LSV A;  3G35 A;  4IVI A;  1H8M A;  1IEM A;  2ZMA A;  4ZTK A;  4E3J A;  3IF6 A;  1D1J A;  3IX3 A;  5EV0 A;  3SH9 A;  5F1F A;  5CEB A;  5A90 A;  4E3K A;  3OC2 A;  2JC7 A;  3VV4 A;  5FDH A;  3QP8 A;  3IQA A;  4BJP A;  4O8G A;  3SS5 A;  2H0T A;  2P74 A;  1SHV A;  3MZE A;  2Y2I A;  2FFY A;  2ZBB A;  1NYM A;  2B02 A;  3BY9 A;  4MN7 A;  1K0K A;  2EA9 A;  4U0X A;  4GS9 A;  1XA7 A;  3IS2 B;  1H5X A;  3BQ8 A;  4MNR A;  2ZC6 B;  5FQK A;  3U4L P;  2WYX A;  1L0D A;  1LHY A;  2ACG A;  2WZX A;  4JLF A;  4Y0U A;  3ULF A;  2A24 B;  2QKP A;  1JTG A;  1HLU P;  2XD1 A;  3OPR A;  1F9I A;  2ZC3 B;  4OQ0 A;  3TW8 A;  3FV7 A;  3MJQ A;  4FCF A;  4OPR A;  4PM6 A;  1LSW A;  3NI9 A;  2OV5 A;  1O7E A;  2XF3 A;  2WUQ A;  4ARZ A;  2HZ5 A;  2JHE A;  3BEB A;  1T1C A;  1T18 A;  2C5W B;  5DF8 A;  2ZLY A;  5DKL A;  2KLI A;  3GQZ A;  4IVK A;  1VET B;  4GHI B;  2R78 A;  1NYY A;  2RL3 A;  1S67 L;  1OJG A;  3FC7 A;  1GHP A;  4N1X A;  3UY6 A;  5EM1 A;  4GOG A;  2W0N A;  4Y17 A;  4LRX C;  4RQ9 A;  2Y2J A;  3DWK A;  3LR0 A;  1MKI A;  1PRQ A;  4QPR A;  2Y2M A;  4N92 A;  3TJZ C;  3UO9 A;  4EBN A;  3BLS A;  2Y55 A;  2PDR A;  3CWF A;  1CI8 A;  4JGO A;  4MBH A;  1TS7 A;  2HJ9 C;  3NY4 A;  5DFY A;  2H0Y A;  3Q1F A;  2VZW A;  3SOI A;  4B9O A;  2UV0 E;  3E4Q A;  1W63 M;  4GDN A;  3NBL A;  2BLS A;  2VLG A;  3BFC A;  1MWR A;  1G6A A;  1UGU A;  1IFQ A;  3MR0 A;  3UN7 A;  4LV3 A;  1NLY A;  2KX6 A;  3M2J A;  2EFU A;  3QP4 A;  4CLC B;  4E6X A;  3S1Y A;  4RVA A;  1XFQ A;  3MFD A;  2O9B A;  5KSH A;  3LI9 A;  3NIA A;  4H6J A;  2KDK A;  3NDE A;  3W8K A;  4ETX A;  5CHM A;  4EWF A;  3A3I A;  4KG6 A;  3LYX A;  1OPX A;  4LLO B;  5L07 A;  4QHC A;  5TGF A;  2FZ0 A;  2E8I A;  3UPP A;  2V1B A;  1IKI A;  2WZZ A;  3FWL A;  3SZT A;  5HDD A;  4EES A;  3HRE A;  1SDE A;  3OPL A;  4RA7 A;  5CGW A;  1GSX A;  3IXD A;  1S4S A;  2V9A A;  2GX5 A;  2WAD A;  2CC1 A;  3CHW P;  1DJC A;  4XT2 A;  5EM0 A;  2VV7 A;  1FSW A;  2GZA A;  4BL3 A;  5CX7 A;  5K5B A;  4DDY A;  3D4F A;  2W3F A;  3G30 A;  4GJ4 A;  4EER A;  1EWZ A;  3OBF A;  2M7V A;  2P7J A;  2L4R A;  3GMW A;  4D2O A;  4KQO A;  4IUH A;  2X71 A;  3D9Y A;  3HLG A;  5HDC A;  3UDX A;  4RYE A;  5E2E A;  3CAX A;  2Q0O A;  4FH2 A;  2R9W A;  3UE3 A;  4Y3I A;  2ZOI A;  5U47 A;  4NXB A;  1Y28 A;  1ES2 A;  2EX9 A;  1SKO B;  1OTD A;  4S2K A;  3IH8 A;  4X55 A;  4ZAM A;  4PKY G;  3TE8 A;  2L0W A;  3LGO A;  2J3T D;  5HAR A;  3MQO A;  1ZHH B;  3BFD A;  1E3U D;  4BD0 A;  1OT9 A;  5FAT A;  1VB6 A;  3LIC A;  4L9E A;  2A24 A;  2HP9 A;  4R23 A;  2ZJ9 A;  5L2F A;  1LL5 A;  4E6W A;  5FSR A;  3H7W B;  3KYE A;  4QY6 A;  3LIA A;  1EW0 A;  3T4T A;  1Z09 A;  5LBR A;  3KSI A;  3MXQ A;  3K3C A;  3VOY A;  4HJ6 A;  4P87 A;  3C8C A;  1K54 C;  2VJW A;  2Y2H A;  3PBS A;  5EVI D;  3MF0 A;  1PWD A;  1F5M A;  5J3W A;  3MBZ A;  3UB5 P;  4I39 A;  2FFF B;  2VX8 A;  1DY6 A;  5FQJ A;  4JXG A;  4QY5 A;  4C6Y A;  2W3E A;  1DJB A;  3T4J A;  3GTC A;  4S2J A;  2XA7 S;  3FG8 A;  4N9L A;  2JKT M;  5C5K A;  4FD8 A;  3UE6 A;  5DTT A;  1BLH A;  1HZO A;  3F1N B;  4EUZ A;  1YLZ A;  4HH3 A;  4X68 A;  2AVX A;  3VP3 A;  3MZF A;  5F83 A;  3T1X A;  3H82 B;  4F3L B;  2Y2O A;  4DXC A;  3FZC A;  2JBF A;  3B33 A;  3GVB A;  5GLD A;  3ZFZ A;  4CJN A;  5KZH A;  3C2W A;  1KE0 A;  2PAV P;  3WRZ A;  3GSG A;  2XLN A;  2JKR M;  2J8Y A;  3T4S A;  5FAQ A;  2A2L A;  4GNU A;  5A92 A;  1CEF A;  5HAQ A;  4P6Z S;  2QMI A;  5IHV A;  2PRF A;  3BM6 A;  4UQI M;  3KX0 X;  3NOU C;  3V3R A;  2V1Z A;  3O86 A;  1AXB A;  2J80 A;  3NOT C;  4OH0 A;  4PAU A;  1Z6F A;  4DKI A;  3G6O A;  4R4S A;  1H8Y A;  5E2F A;  4X69 A;  1SZV A;  4HQA A;  4GZB A;  1K54 A;  5CXW A;  1FQG A;  3A3J A;  3A3E A;  3VOL A;  3SW1 A;  3NHQ A;  3IX8 A;  4ZRR A;  1W5D A;  4OOL A;  4KZ6 A;  2BG1 A;  4OQG A;  1GA9 A;  4I38 A;  2VGL S;  1YLY A;  4LGW A;  3NEC A;  3HJI A;  2XR0 A;  3IF5 A;  5EOE A;  3UDF A;  3VP4 A;  3A0S A;  4EBP A;  5GHZ A;  3HUO A;  2WAF A;  3HLF A;  2V8F A;  4FUW A;  2B95 A;  3CUE C;  1S6R A;  4X6T A;  3ITA A;  4EUV A;  3BFG A;  5CGX A;  1QMF A;  4S2N C;  1PWC A;  4U0T A;  2QHK A;  3IF6 C;  4GB7 A;  1L0E A;  2OSU A;  4M3K A;  1WA9 A;  1XX2 A;  3LEQ A;  2ZM2 A;  3OOV A;  3T50 A;  5A91 A;  3G31 A;  5M1A A;  1XFN A;  2K31 A;  4LFU A;  2G2U A;  2XEP A;  1PYY A;  2JN7 A;  1CI9 A;  2VV8 A;  1JTD A;  1MZU A;  5HZH A;  3ZG7 B;  3DTM A;  3QP6 A;  3EGD C;  3IHB A;  3V39 A;  4OPQ A;  3M2K A;  1GCE A;  2EFX A;  1L2S A;  1K4F A;  5CTM A;  1F2K A;  4IJG A;  5DF7 A;  4HI4 A;  2H10 A;  3IHA A;  1N9B A;  3LI8 A;  3O3V A;  3M6B A;  1N4O A;  3TG9 A;  1K55 C;  3H7W A;  2WKH A;  4NET A;  4JF4 A;  1E3U A;  4KG2 A;  4JF6 A;  1SDN A;  2P08 A;  1TS6 A;  3BYD A;  3T4O A;  4HIA A;  3C7U A;  2XFT A;  4I3J A;  3EEH A;  2P04 A;  5HAP A;  1K6R A;  2QJ7 A;  4E04 A;  3V67 A;  1BLC A;  3DWZ A;  2XQZ A;  3IX4 A;  4S2O A;  5E43 A;  3NUL A;  3CI6 A;  2I9V A;  2JCH A;  4ZJ1 A;  4E3I A;  2ZQA A;  3MQ0 A;  2WAE A;  4E3N A;  5L09 A;  2ZL1 B;  2PR5 A;  4UEY A;  4GW9 A;  2WKI A;  4KZ5 A;  4WBG A;  3PAG A;  3CUE A;  1P9R A;  4B88 A;  1MPL A;  1OJ5 A;  2XRO A;  1TS8 A;  3ZYT A;  4S2N A;  4P85 A;  5EVE A;  3RTY A;  1BLS A;  3DAV A;  1VM1 A;  3VE4 A;  3H82 A;  5HSQ A;  2Y79 A;  3BJN A;  1YPR A;  3PBQ A;  1BUL A;  1EI5 A;  2P9V B;  1ERM A;  3G2Z A;  3SS3 A;  3IWI A;  1ZTU A;  4XUX A;  4IUK A;  4MCW A;  2BTF P;  1DJA A;  1FSY A;  4EV4 A;  2Y2L A;  3NDG A;  1XP4 A;  1K55 A;  2Z2L B;  4FSF A;  1H3Q A;  2XGN A;  4O0P A;  4PM7 A;  4S2M A;  4LV0 A;  5CGS A;  2K7S A;  3G32 A;  5GLA A;  1G28 A;  3AGE A;  1KOU A;  2EWV A;  1HVB A;  1K4E A;  4OQH A;  1N9L A;  2Y59 A;  1E25 A;  3UDI A;  3E2L A;  4QD4 A;  2JKT I;  2IWD A;  2PYP A;  1H8Z A;  5EOO A;  3LUQ A;  3UB7 A;  2INW A;  3S22 A;  1YM1 A;  2DMW A;  4X1M A;  1OME A;  4CLC E;  2Y2N A;  3MFX A;  4O01 A;  4KQQ A;  1IYP A;  4FOF A;  1G5U A;  1PZO A;  1U60 A;  4L0L A;  1JWP A;  5EEC A;  4U3T A;  1YKD A;  1PW1 A;  3KO6 A;  4LCM A;  5HX9 A;  3JPU A;  5A93 A;  3EQU A;  1VEU B;  4GD6 A;  4WM9 A;  1N9O A;  2O0Y A;  4E3L A;  3TRC A;  4I5S A;  3HLC A;  1IEL A;  1JVJ A;  2JKR I;  1XXM A;  2ZC7 A;  1UWP X;  2Y2Q A;  1L0F A;  1BYW A;  3CPT B;  2HV1 A;  1UWN X;  3IWQ A;  4R38 A;  2VK3 A;  5FI6 A;  2ZM0 A;  4BMW A;  4Q0H A;  3F1P B;  4R0Q A;  1QME A;  2WKE A;  4CLC D;  2E8J A;  3BWL A;  4KQR A;  4M4X A;  1W8Q A;  3MZD A;  1CJF A;  3FKV A;  2XH9 A;  2VV6 A;  1AWI A;  2VGJ A;  4PPR A;  3UME A;  3HJK A;  5F1G A;  2WGW B;  4B4Z A;  4Y2F A;  5CTN A;  4YWZ A;  1CEG A;  5HL6 A;  3UMD A;  3IWO A;  4JGP A;  4DXB A;  5EPH A;  3D3O A;  2HP5 A;  4RX2 A;  3L7H A;  1FR6 A;  3MS6 A;  3WWX A;  4F94 A;  1K25 A;  5F5Y A;  1W79 A;  2X02 A;  5KMW A;  3W4P A;  2ZMV A;  2WKQ A;  2ZQ9 A;  3BY8 A;  4K0W A;  3NOP C;  3U2A A;  2FH5 A;  4MMN A;  4S2L A;  1YSP A;  4H8R A;  5L8M A;  3CJM A;  4JGR A;  4LRZ E;  4WEJ A;  3OPP A;  4OPZ A;  1Q2Q A;  2M7U A;  1ES3 A;  1XJ3 A;  5FQI A;  2ZL1 A;  5HL1 A;  1DP8 A;  4YFM A;  1DP9 A;  3MSH A;  4Y0T A;  1BUE A;  1MWS A;  3W4Q A;  2W27 A;  1W63 Q;  3C7V A;  4KZ8 A;  5AQ9 A;  4Y0O A;  4UA9 A;  1N9N A;  2YKH A;  3GDI A;  2B18 A;  1G6O A;  4ME4 A;  3LCE A;  4KQD A;  4BBT A;  1ONH A;  2J7V A;  5E2G A;  1G68 A;  1L3L A;  1ODV A;  3WS5 A;  1D7E A;  4QB8 A;  1HTZ A;  3KSF A;  4DE2 A;  4E3O A;  3KSH A;  1M6K A;  1YLT A;  4WZ5 A;  5HWV A;  1J9M A;  1V9Y A;  1MWU A;  2EXA A;  1MY8 A;  3QHY A;  4YIN A;  1M40 A;  3KYQ A;  2HJE A;  1LLB A;  3IS2 A;  3HLD A;  4CQH A;  1ZG6 A;  4NG2 A;  3T1S A;  2L1M A;  1NY0 A;  4N9K A;  5FI7 A;  1PZP A;  1SKF A;  4CLC C;  4EU0 A;  3UB9 A;  1ES5 A;  2XA7 M;  2V2F F;  3C30 A;  1MC0 A;  4JGQ A;  5F6A A;  1S1Y A;  2PT7 A;  3MKE A;  1BTL A;  3T1R A;  3RJU A;  2WKR A;  2HGV A;  3BFE A;  4BQM A;  1KGF A;  3WS2 A;  5I5L A;  3LID A;  4WEL A;  3Q7V B;  1WYB A;  3HL9 A;  3R7W B;  2Q9M A;  3UNW A;  3DTI A;  3VFH A;  4G3W A;  4R3B A;  2HDQ A;  3P7N A;  3CG5 A;  1VET A;  3HCY A;  3LO7 A;  1ONG A;  4GHI A;  4EBL A;  3C38 A;  3F1O B;  2DCF A;  2QYB A;  2EX2 A;  3BQA A;  3IBR A;  2V0U A;  4BL2 A;  4P6Z M;  3ZG8 B;  4Y5F A;  4OOY A;  2ZM8 A; 
#chains in the Genus database with same CATH homology
 1CI9 A;  1H5X A;  4MNR A;  1JTD A;  5EVI B;  2ZC6 B;  5FQK A;  3VFF A;  5CED A;  2WYX A;  1L0D A;  5DF9 A;  1LHY A;  2WZX A;  3DTM A;  1XGJ A;  3ZG7 B;  3IHB A;  3V39 A;  4JLF A;  4Y0U A;  2EX8 A;  2ZD8 A;  4O7D A;  4OPQ A;  3M2K A;  4UAA A;  1GCE A;  2EFX A;  4OQI A;  1JTG A;  1L2S A;  2DNS A;  1K4F A;  5CTM A;  3GR2 A;  5F82 A;  5TFQ A;  2XD1 A;  3OPR A;  1FOF A;  5CHJ A;  2UWX A;  5DF7 A;  3VP0 A;  4OLG A;  2H10 A;  1ZC2 A;  3IHA A;  1N9B A;  1YLP A;  2ZC3 B;  4RX3 A;  5GHX A;  4GDB A;  3ZGA B;  4OQ0 A;  5FQ9 A;  3O3V A;  3M6B A;  3C4P A;  1N4O A;  3FV7 A;  1RGZ A;  1K55 C;  4FCF A;  4OPR A;  4PM6 A;  5E2H A;  2Y2G A;  3TG9 A;  4BLM A;  2XDM A;  3S4X A;  2WKH A;  3NI9 A;  4NET A;  1SCW A;  4JF4 A;  2OV5 A;  1O7E A;  2XF3 A;  2A49 A;  2WUQ A;  1E3U A;  4KG2 A;  3PAE A;  4JF6 A;  1SDN A;  3BEB A;  1KE4 A;  1BT5 A;  2WGW A;  1O07 A;  2P9V A;  3BYD A;  2PU4 A;  2C5W B;  5DF8 A;  1Y54 A;  4JXW A;  3P98 A;  2EXB A;  2ZLY A;  3C7U A;  3GQZ A;  2XFT A;  4IVK A;  4MBK A;  4DE1 A;  1NYY A;  5HAP A;  2RL3 A;  1K6R A;  4DE0 A;  1HD8 A;  1PW8 A;  3EQV A;  1YMX A;  4LCL A;  1KGE A;  1BLC A;  2VGK A;  1NZO A;  1LL9 A;  1PI4 A;  3PBR A;  4IBR A;  4KEN B;  3DWZ A;  4P0M A;  1ESI A;  4R4R A;  2XQZ A;  4S2O A;  1GHP A;  4N1X A;  5E43 A;  2JCH A;  5DTK A;  4ZJ1 A;  3UY6 A;  3LY3 A;  3SS4 A;  3VP2 A;  4GOG A;  2ZQA A;  4E3I A;  2WAE A;  2Q9N A;  4E3N A;  4QU3 A;  1LI0 A;  2Y2J A;  4X56 A;  1XGI A;  5FQM A;  2ZQC A;  2WKI A;  2OLV A;  1KVM A;  3DWK A;  4KZ5 A;  4WBG A;  3PAG A;  1MKI A;  2QPN A;  3ZNY A;  1KVL A;  4B88 A;  1I2W A;  3CZD A;  5FAO A;  1MPL A;  3IXH A;  4GN2 A;  3BFF A;  4ID4 A;  2Y2M A;  4N92 A;  4R3J A;  3UO9 A;  4EBN A;  2ZQD A;  4JXS A;  2Y91 A;  3BLS A;  2Y55 A;  4S2N A;  3A3F A;  1CI8 A;  4OP8 A;  2QZ6 A;  1KDW A;  3GRJ A;  4XXR A;  3C4O A;  4MBH A;  4P85 A;  5JYO A;  3NY4 A;  1BLS A;  3FYZ A;  1VM1 A;  2H0Y A;  3Q1F A;  3V50 A;  1YLJ A;  5M19 A;  1KDS A;  3SOI A;  1YT4 A;  5JYP A;  1JWV A;  4GDN A;  4NK3 A;  3NBL A;  2BLS A;  4Y7P A;  3N8R A;  3BFC A;  4Z9Q A;  1MWR A;  4IED A;  1G6A A;  3QNB A;  5FAS A;  3PBQ A;  2Y2P A;  1W8Y A;  1YMS A;  1BUL A;  4DF6 A;  4MBF A;  1EI5 A;  3UN7 A;  2XFS A;  2P9V B;  4LV3 A;  1ERM A;  3G2Z A;  4HBT A;  3SS3 A;  3IWI A;  5DTS A;  3M2J A;  2EFU A;  4XUX A;  3ZHH A;  4E6X A;  1IKG A;  3MXS A;  4GKU A;  4UHU A;  1FCO A;  1DJA A;  4KZ3 A;  3S1Y A;  3PBT A;  1FSY A;  3MXR A;  4RVA A;  4WZ4 A;  3WS1 A;  2HDU A;  3MFD A;  4PM8 A;  5KSH A;  1K6S A;  3NIA A;  4EV4 A;  3HLB A;  3NDE A;  3W8K A;  5CHM A;  2Y2L A;  3ZDJ A;  3NDG A;  3TOI A;  4EWF A;  4JXV A;  3A3I A;  1XP4 A;  3N6I A;  1K55 A;  1XKZ A;  3MKF A;  3G2Y A;  4HBU A;  4KG6 A;  2Z2L B;  3OCN A;  4FSF A;  2XGN A;  4C75 A;  4QHC A;  4PM5 A;  1I5Q A;  2B5R A;  3HVF A;  1FCM A;  4PM7 A;  5TGF A;  1K56 D;  2H5S A;  4S2M A;  2E8I A;  4LV0 A;  3LY4 A;  5CGS A;  3ITB A;  3UPP A;  1IKI A;  2WZZ A;  3G32 A;  1I2S A;  3Q07 A;  5GLA A;  5KSC A;  3FWL A;  5GLC A;  5AQB A;  3BLM A;  3AGE A;  3VP1 A;  4S2P A;  1HVB A;  3HRE A;  1K4E A;  4OQH A;  5CHU A;  1SDE A;  1W7F A;  2GDN A;  2Y59 A;  1E25 A;  3OPL A;  3VMA A;  4RA7 A;  1CK3 A;  3OPH A;  5CGW A;  3UDI A;  3VSL A;  3IXD A;  3E2L A;  1KE3 A;  4QD4 A;  3IF6 B;  3IXB A;  5CEC A;  5HAI A;  5D3O A;  2IWD A;  3VSK A;  2HDR A;  2C6W B;  2HPB A;  1H8Z A;  5EOO A;  3SH7 A;  2WAD A;  5EE8 A;  3Q7Z A;  2CC1 A;  1DJC A;  1PI5 A;  3M6H A;  1FSW A;  3S22 A;  3GV9 A;  2OLU A;  4BL3 A;  3IT9 A;  2XD5 A;  1YM1 A;  2I72 A;  3Q7V A;  1OME A;  2Y2N A;  4DDY A;  3D4F A;  4E3M A;  3IH9 A;  3FKW A;  2JE5 A;  3G30 A;  3O87 A;  5J8X A;  1IYS A;  1EWZ A;  4KQQ A;  4UA6 A;  1IYP A;  3I7J A;  1MBL A;  1PZO A;  3NCK A;  1U60 A;  3GMW A;  3JYI A;  1IYQ A;  4KQO A;  5AQ7 A;  4D2O A;  4N1H A;  1TEM A;  4L0L A;  1JWP A;  2X71 A;  4LV1 A;  5EEC A;  3WS4 A;  3HLG A;  4U3T A;  3UDX A;  4RYE A;  5E2E A;  1PW1 A;  4LCM A;  5HX9 A;  4FH2 A;  2R9W A;  3UE3 A;  2IWB A;  5FQQ A;  3O88 A;  5U47 A;  5A93 A;  3EQU A;  3Q82 A;  4GD6 A;  4WM9 A;  1ES2 A;  2EX9 A;  3PBN A;  4UA7 A;  3SH8 A;  4OVD A;  3WRT A;  3PBO A;  4S2K A;  4A5R A;  4E3L A;  3IH8 A;  1XPB A;  4X55 A;  1WYC A;  4ZAM A;  3HLC A;  1IEL A;  1JVJ A;  1BLP A;  1XXM A;  4OPY A;  2ZC7 A;  4OLD A;  3OCL A;  4K0X A;  2Y2Q A;  1L0F A;  4MEZ A;  4KZ7 A;  5HAR A;  4OON A;  4FH4 A;  3BFD A;  3IWQ A;  1E3U D;  1LI9 A;  3G4P A;  1ERO A;  1WE4 A;  4BD0 A;  5FI6 A;  5FAT A;  2ZM0 A;  3UPN A;  4R0Q A;  1QME A;  4KZ9 A;  3AGD A;  4KZ4 A;  2WKE A;  5EUA A;  2ZQ7 A;  4JBF A;  3HLW A;  4JKT A;  1ES4 A;  2HP9 A;  1PWG A;  3V3S A;  1GHI A;  4CPK A;  4R23 A;  4KQR A;  2ZJ9 A;  5L2F A;  1LL5 A;  4E6W A;  5FSR A;  1BSG A;  3N4I A;  4QY6 A;  1W8Q A;  2R9X A;  4OKP A;  4C3Q A;  3MZD A;  3FKV A;  2ZC5 B;  5FAP A;  2XH9 A;  1VQQ A;  2VGJ A;  4HES A;  4PPR A;  3VOY A;  4BEN A;  1K56 A;  4P87 A;  5F1G A;  4WYY A;  2WGW B;  4ZJ2 A;  1K54 C;  1JWZ A;  4GD8 A;  2Y2H A;  3PBS A;  5EVI C;  5EVI D;  3UPO A;  1PWD A;  4B4Z A;  5CTN A;  4KG5 A;  1ALQ A;  3MBZ A;  1TVF A;  1CEG A;  1K57 C;  3E2K A;  1ZG4 A;  3IWO A;  3ZCZ A;  3V5M A;  2FFF B;  5AQA A;  4DXB A;  5EPH A;  1DY6 A;  5FQJ A;  2HP5 A;  4RX2 A;  4JXG A;  3IXG A;  1ZKJ A;  1FR6 A;  3WWX A;  3ZG9 B;  4QY5 A;  2Y2K A;  4C6Y A;  3TSG A;  1NXY A;  4LV2 A;  4F94 A;  1K25 A;  4MLL A;  1W79 A;  1DJB A;  2X02 A;  5KMW A;  3W4P A;  4K0W A;  2ZQ9 A;  3GTC A;  3HLE A;  4S2L A;  4H8R A;  4S2J A;  3CJM A;  4N9L A;  2J9P A;  2WK0 A;  4WEJ A;  3OPP A;  4OPZ A;  1Q2Q A;  3N8L A;  4FD8 A;  5GHY A;  5DTT A;  3NC8 A;  3OZH A;  5I94 A;  1BLH A;  3RXX A;  1HZO A;  1ES3 A;  3DW0 A;  4EUZ A;  5FQI A;  1PIO A;  5HL1 A;  2Z2M B;  4ZJ3 A;  1YLZ A;  2EX6 A;  2RCX A;  4YFM A;  4X68 A;  5G18 A;  5GL9 A;  3G34 A;  3HUM A;  4Y0T A;  3ZG5 A;  1BUE A;  4WMC D;  3P09 A;  3VP3 A;  1MWS A;  3MZF A;  5F83 A;  3W4Q A;  3C7V A;  2PBY A;  1TDG A;  4KZ8 A;  3B3X A;  4Y0O A;  5AQ9 A;  1KGG A;  1ERQ A;  2ZQ8 A;  4KZB A;  2Y2O A;  4UA9 A;  1NJ4 A;  4DXC A;  4EQI A;  3FZC A;  4X53 A;  2JBF A;  4QJG A;  2WGV A;  3GVB A;  3BEC A;  3N8S A;  2XK1 A;  5GLD A;  2HP6 A;  3ZFZ A;  4ZBE A;  4CJN A;  5KZH A;  1K38 A;  1S0W A;  4S2I A;  1IYO A;  3LCE A;  3QNC A;  1KE0 A;  4R1G A;  1YQS A;  2G2W A;  3UE0 A;  1ONH A;  4OP5 A;  1RCJ A;  3WRZ A;  1FCN A;  5CRF A;  1GA0 A;  2J7V A;  3Q81 A;  1G68 A;  4OOM A;  3GSG A;  5E2G A;  1L0G A;  3WS5 A;  3PTE A;  3WS0 A;  1C3B A;  2XLN A;  3BRM A;  4QB8 A;  2J8Y A;  1HTZ A;  5M18 A;  4DE2 A;  4E3O A;  5FAQ A;  4K91 A;  4B4X A;  4GNU A;  3ZNT A;  5A92 A;  1CEF A;  5HAQ A;  1M6K A;  1YLT A;  2QMI A;  3BM6 A;  4WZ5 A;  5IHV A;  1J9M A;  1BZA A;  1YLW A;  4DDS A;  3LEZ A;  5TR7 A;  4DE3 A;  1MWU A;  2A3U A;  5FA7 A;  3VOZ A;  2Y4A A;  2EXA A;  1NZU A;  3V3R A;  1MY8 A;  3QHY A;  4YIN A;  5DVA A;  2V1Z A;  3UE1 A;  3O86 A;  1AXB A;  1GHM A;  4OH0 A;  1M40 A;  3C5A A;  1Z6F A;  2HDS A;  4HEF A;  4DKI A;  1RP5 A;  2J9O A;  4R4S A;  5EVL A;  1H8Y A;  1MXO A;  5E2F A;  4X69 A;  3HBR A;  1LLB A;  3ZG0 A;  4Q8I A;  3HLD A;  1K54 A;  4GZB A;  1FQG A;  5CXW A;  5BOH A;  1ZG6 A;  5EVI A;  3A3J A;  3ZVW A;  5HW3 A;  3A3E A;  4PMA A;  1NY0 A;  3N7W A;  4N9K A;  5FI7 A;  1PZP A;  1SKF A;  4WZ5 C;  1W5D A;  1ES5 A;  2IWC A;  4P6B A;  4IBX A;  5FI2 A;  1K57 A;  2WGI A;  2V20 A;  4XUZ A;  4ZDX A;  4DRT A;  3RXW A;  2V2F F;  2PU2 A;  3G35 A;  5HFO A;  4IVI A;  4OOL A;  3MKE A;  1BTL A;  3RJU A;  4KZ6 A;  3ZVT A;  1IEM A;  2ZMA A;  3BFE A;  2BG1 A;  4OQG A;  1GA9 A;  3IF6 A;  4ZTK A;  4BD1 A;  4E3J A;  4BQM A;  1KGF A;  3WS2 A;  1YLY A;  3SH9 A;  1NRF A;  5F1F A;  5CEB A;  2XR0 A;  5A90 A;  3IF5 A;  4PM9 A;  5EOE A;  3OC2 A;  3UDF A;  3AGF A;  4WEL A;  4E3K A;  1XA1 A;  3Q7V B;  3VP4 A;  1WYB A;  4EBP A;  4JPM A;  2JC7 A;  3HL9 A;  5GHZ A;  3HUO A;  2Q9M A;  2WAF A;  5FDH A;  3UNW A;  3HLF A;  5GLB A;  3VFH A;  3CMZ A;  2X01 A;  1FR1 A;  4R3B A;  2HDQ A;  3W4O A;  3IQA A;  1ESU A;  1S6R A;  4JF5 A;  4X6T A;  3CG5 A;  4BJP A;  1Q2P A;  3LO7 A;  1ONG A;  3ITA A;  2H0T A;  3SS5 A;  4EBL A;  2P74 A;  1SHV A;  3BFG A;  3MZE A;  5CGX A;  1QMF A;  2DRW A;  4S2N C;  4WMC A;  1PWC A;  4U0T A;  4GB7 A;  3IF6 C;  2DCF A;  2Y2I A;  1L0E A;  2FFY A;  4WEK A;  2EX2 A;  1NYM A;  2OSU A;  4M3K A;  3A3D A;  3HUN A;  1XX2 A;  5CER A;  2ZM2 A;  1E4D A;  5A91 A;  4BL2 A;  2ZC4 B;  2ZM8 A;  3G31 A;  5M1A A;  3ISG A;  4U0X A;  1TDL A;  4KZA A;  3ZG8 B;  4OOY A;  4LEN A;  1RGY A;  1XA7 A;  2G2U A;  1MWT A;  2XEP A;  1PYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...