2ZQ7A

Apo structure of class a beta-lactamase toho-1 e166a/r274n/r276n triple mutant
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase Toho-1
publication title Improvement of the Crystal Quality by the Surface Mutations on a Beta-Lactamase Toho-1
rcsb
source organism Escherichia coli
total genus 96
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2zq7A00
2X02A 1H8YA 4IBRA 4S2LA 3E2LA 5E2HA 3HUNA 3O87A 5M18A 1N9BA 1Y54A 1MPLA 1HTZA 4P0MA 5F1FA 1I5QA 3O88A 5GL9A 1IKGA 4XUZA 4MBKA 2X71A 1J9MA 3UN7A 3ZCZA 4EBNA 4JLFA 5A90A 3IWOA 4S2OA 2WADA 4MNRA 3BFEA 4GD6A 5A92A 1NY0A 3A3EA 2HDQA 3MXRA 3V50A 3N8LA 1KE0A 4KQQA 1BZAA 4KENB 1DJCA 1FSYA 5EVID 1DJAA 2ZM0A 4H8RA 1H5XA 4B4XA 4OQGA 4BQMA 2ZJ9A 4CPKA 2P9VA 3GVBA 1K6RA 5FA7A 3G35A 5I94A 1FSWA 4KZ3A 3WS1A 1W7FA 3RXXA 3V5MA 1YT4A 1NYMA 3NIAA 4E3NA 4PM5A 1CEGA 2Y2GA 1IYOA 1LL5A 2FFFB 1VQQA 2ZC7A 1K6SA 1SHVA 3HBRA 4PM8A 4YINA 3VMAA 3BFGA 5CECA 3BFCA 4WYYA 1IELA 1JWZA 4KZBA 2Y55A 1K38A 4B4ZA 1Z6FA 1PW8A 2H0TA 4R3JA 5IHVA 5GLBA 3SS3A 2EX2A 2PBYA 3MZFA 4E3LA 4R4RA 5GLAA 5D3OA 4HBTA 4K91A 1FCNA 4FH2A 3Q82A 1EROA 4KZ4A 4KZ7A 3ZGAB 3TG9A 1E3UA 5AQ9A 3UDFA 2R9XA 4E3IA 2J8YA 2WZXA 2DNSA 1KVLA 2HPBA 5GLCA 1ES5A 3WRTA 2Z2LB 1FCMA 2QMIA 4ZBEA 2PU4A 4D2OA 1PZOA 3PBSA 3IQAA 4NETA 4E3JA 3A3DA 3LO7A 1CK3A 3S22A 3PAEA 4QU3A 3G4PA 2WGWA 3VP0A 2EX6A 4EV4A 1RGZA 2IWDA 2P9VB 3QNCA 1IKIA 4RYEA 4WZ5C 1K56A 4MLLA 5CTMA 5FI6A 3IF6C 1K57C 3BLSA 3SS5A 1ZG6A 5HAPA 1IYPA 3DWKA 4WEKA 1YM1A 1BLSA 3M2JA 3JYIA 1CI8A 3RJUA 1GHPA 3QHYA 2JCHA 5G18A 3IH8A 5FATA 4DE2A 4ZJ1A 5CGSA 3HLWA 2WAFA 2Y2LA 5FQIA 1PI4A 1XGIA 4JBFA 4P87A 5EECA 4ZJ2A 2XGNA 4OQIA 3HUOA 2OSUA 2I72A 3UPNA 4JXVA 1FQGA 2QPNA 4GDBA 1TEMA 3G32A 4ZAMA 3UE0A 3OPHA 3ZNYA 5HL1A 1XP4A 3OZHA 3GQZA 1TVFA 2Q9MA 4Y7PA 3HL9A 4CJNA 5AQAA 3WS0A 2Z2MB 4EBPA 4UAAA 3C4OA 4YFMA 1BLPA 1W8YA 4IEDA 3BEBA 4DDYA 4QHCA 1XA7A 2WGVA 3IHBA 1NYYA 3W8KA 3RXWA 3GV9A 3SOIA 2ZM8A 3ZDJA 4E3MA 2WAEA 3CZDA 4S2NA 2JBFA 3MFDA 1L0FA 2R9WA 1PW1A 5BOHA 1ONGA 1SDNA 3OPLA 4KZ6A 1C3BA 4WZ5A 4Y0UA 3ZVTA 1LL9A 2EXAA 2Q9NA 1K54C 3GMWA 3S4XA 3IF6A 3IXHA 4OPQA 1K4FA 3P09A 2XD5A 4WMCD 1YLWA 2Y59A 5KMWA 3W4OA 2G2WA 3E2KA 4HBUA 3PBTA 2ZQ8A 1XA1A 4S2KA 5FQMA 1BLHA 3ZG0A 5EOEA 1MWTA 1ES2A 4GKUA 1YMSA 1G68A 4QD4A 4DDSA 4LV3A 1M40A 3OCNA 4LCLA 2Y2NA 1L0GA 3V3SA 3BRMA 3S1YA 5A93A 2ZQ9A 4NK3A 3OPRA 1PWDA 2XH9A 4KG2A 4WM9A 2V2FF 3A3IA 3EQVA 4FCFA 4ZTKA 2WKIA 1PI5A 2ZQAA 3VP3A 5HX9A 4GNUA 1BTLA 3BLMA 4E6XA 2WGIA 1K4EA 5HAIA 2XDMA 2XR0A 2WYXA 1ERQA 4ZDXA 3G34A 3G31A 4DRTA 4PM9A 5AQ7A 3FWLA 4RA7A 4FSFA 3NC8A 4BJPA 1HD8A 3WS5A 4X6TA 3BFFA 3FKVA 4K0XA 4C3QA 5KSCA 1E4DA 1I2SA 4C75A 1CI9A 1PWGA 5EVIC 1K54A 3HLEA 2PU2A 1YLTA 3VP4A 2ZQCA 3BM6A 1QMFA 4RVAA 2IWCA 2ZLYA 3IF6B 4ZJ3A 4LCMA 2ZQDA 4R23A 2ZC5B 4R3BA 4UA7A 4X68A 4N9KA 1YLYA 2WKEA 1KDWA 2XF3A 1MXOA 5FI2A 5E2EA 4GB7A 1KE3A 1GHIA 3HVFA 3PAGA 2HP5A 3WRZA 2P74A 4QB8A 5FQ9A 1RCJA 3OPPA 1KGGA 5GHZA 4IVKA 1SDEA 4X69A 3ISGA 4RX3A 1XGJA 1EWZA 2BG1A 2XK1A 3MZEA 4RX2A 4OOYA 3ZNTA 4BENA 2C5WB 5FI7A 3TOIA 1W79A 1OMEA 1QMEA 3WS4A 5FASA 3BYDA 3ZG9B 1AXBA 2FFYA 2B5RA 1H8ZA 4JF4A 1LHYA 3ZG7B 4DE3A 4OPZA 1TDGA 4S2NC 5CRFA 3NI9A 5F82A 1ALQA 1XX2A 1CEFA 3EQUA 3VP1A 3FKWA 3N4IA 1YLJA 5FQQA 4EWFA 4E6WA 3LCEA 3UY6A 2Y2IA 5EVIA 2XEPA 1W8QA 3VFHA 2CC1A 3HLDA 1L0EA 3GTCA 1JVJA 3MXSA 4OQ0A 2J9OA 3IXGA 1GA0A 3V3RA 2Y91A 3Q7VA 2H10A 3IH9A 3FYZA 5EUAA 1K25A 4JF6A 2X01A 5CERA 4OONA 4R1GA 3ZVWA 2C6WB 3ZG5A 4KZAA 1BULA 4B88A 2EFXA 5E43A 5TGFA 3NY4A 1PWCA 1GA9A 3GR2A 4WELA 4EBLA 1SCWA 2XFTA 4MEZA 1O07A 1Q2PA 1KVMA 1NZOA 4OOMA 5GHXA 3UDIA 3GRJA 1ESUA 4PM6A 4OQHA 3D4FA 4EUZA 5HAQA 4PM7A 4BD0A 3PTEA 3UDXA 3CG5A 4O7DA 2ZC4B 1MKIA 3HREA 4OVDA 4DKIA 1MBLA 3M6BA 3VP2A 2HDSA 4OKPA 1EI5A 4ID4A 4KG5A 2Y2JA 1BUEA 4OLDA 1BLCA 2OLUA 3G2YA 5FDHA 4GOGA 3AGDA 3TSGA 5EVLA 4BL2A 1JWVA 1K55A 4E3KA 2GDNA 4UA9A 4F94A 1XKZA 1KGEA 2WGWB 5CTNA 1XPBA 3O3VA 1KGFA 2EX8A 4S2MA 4UA6A 4FD8A 2Y2PA 3IXBA 4KQOA 4QY6A 5EVIB 3VSLA 3I7JA 4U0TA 1BSGA 1ZG4A 2BLSA 5DF8A 3GSGA 2Y4AA 3DW0A 3Q81A 4Y0OA 3Q1FA 4DXBA 4X55A 4DF6A 5L2FA 1W5DA 3AGFA 4WZ4A 3Q7VB 2HP9A 3A3FA 4OP8A 4LV0A 1FCOA 4HEFA 1Q2QA 3ZG8B 5CHUA 3C7UA 5J8XA 5DVAA 4L0LA 4OOLA 4PPRA 2WK0A 2EXBA 5AQBA 3VFFA 2VGKA 2G2UA 2H0YA 1MY8A 1MWSA 2E8IA 4LV2A 3VSKA 3LY4A 2VGJA 4X56A 1S6RA 1WYCA 2Y2KA 1E3UD 5TFQA 3V39A 1NJ4A 5EPHA 4XXRA 5HW3A 2J9PA 2WKHA 1IYQA 5E2GA 2IWBA 5TR7A 2QZ6A 2HDUA 3IWIA 2DCFA 3SH8A 3PBNA 1NXYA 3MBZA 2ZC3B 1ESIA 3B3XA 3W4QA 4OPRA 1JTDA 1LLBA 1YLPA 3C4PA 3OCLA 3W4PA 4BLMA 5U47A 5F83A 1ES3A 4N1XA 5DTKA 2HP6A 4BL3A 4LENA 2RL3A 5KZHA 1XXMA 1K56D 4WBGA 4JXWA 3IF5A 4OH0A 4Z9QA 3SS4A 5GHYA 3NDGA 3SH9A 4GD8A 4N1HA 5DF7A 5CGWA 1WE4A 1DJBA 2Y2OA 4S2JA 1NRFA 1RP5A 2DRWA 2XD1A 5DTTA 3HLCA 4KQRA 4Y0TA 1KDSA 5FSRA 3FV7A 4P6BA 1S0WA 4QJGA 3DWZA 4IVIA 5M19A 2V1ZA 4WMCA 2Y2QA 3HLBA 4JXGA 4XUXA 1VM1A 4KZ5A 1TDLA 3AGEA 4IBXA 3ZHHA 3WWXA 4DE1A 4KZ9A 5FAPA 2Y2HA 3ITAA 3O86A 3UPPA 3P98A 3MKFA 4JPMA 2ZD8A 4QY5A 3IHAA 3HLFA 2WZZA 1U60A 3CMZA 1FR6A 5GLDA 2H5SA 4BD1A 1GHMA 2XQZA 3IXDA 2XLNA 1K55C 1JTGA 1L2SA 5FAOA 3UE1A 1NZUA 1SKFA 3G30A 3UPOA 4C6YA 1HZOA 4DE0A 4JF5A 2ZC6B 3QNBA 4KG6A 1YLZA 4HESA 3DTMA 5CXWA 3C5AA 3PBOA 3ZFZA 2JE5A 4M3KA 2WUQA 1MWRA 1HVBA 5DF9A 3C7VA 3A3JA 3BFDA 3UE3A 3UNWA 2ZM2A 3FZCA 3HUMA 4Q8IA 2V20A 3LY3A 4JXSA 4E3OA 3HLGA 3IWQA 1MWUA 5CHMA 4JKTA 3M6HA 1FOFA 4OP5A 3N8SA 1LI0A 1KE4A 3Q7ZA 4KZ8A 5CGXA 2OV5A 3IT9A 2OLVA 1PIOA 5EE8A 2A3UA 3OC2A 4K0WA 5KSHA 5JYPA 3PBRA 2RCXA 2UWXA 1BT5A 3Q07A 3NBLA 4A5RA 2J7VA 3N6IA 4P85A 3PBQA 3VOZA 3M2KA 4R4SA 4S2PA 3UO9A 2HDRA 3BECA 2A49A 1N4OA 1ZC2A 3LEZA 1PYYA 2JC7A 4X53A 4LV1A 5CHJA 4OLGA 5F1GA 1ERMA 1YQSA 1ES4A 5A91A 3ITBA 3N8RA 2ZQ7A 1IYSA 4N92A 4U3TA 4DXCA 4GDNA 5CEDA 1M6KA 3N7WA 1FR1A 3WS2A 4MBFA 3MZDA 4PMAA 3MKEA 3VOYA 1WYBA 1LI9A 4U0XA 2XFSA 1JWPA 5FQKA 5JYOA 1PZPA 5M1AA 2EFUA 5E2FA 4UHUA 4GZBA 1IEMA 4WEJA 5FQJA 4N9LA 4GN2A 1DY6A 1L0DA 5DTSA 5HFOA 1ZKJA 4R0QA 3NDEA 1O7EA 4FH4A 4OPYA 5FAQA 1GCEA 3CJMA 3G2ZA 4MBHA 1I2WA 1E25A 1RGYA 1K57A 1YMXA 3NCKA 4S2IA 1G6AA 1ONHA 5EOOA 5HARA 4EQIA 2ZMAA 5CEBA 3SH7A 2Y2MA 2EX9A
chains in the Genus database with same CATH superfamily
1H8YA 4IBRA 5C5KA 5F6AA 3UB7A 1XJ3A 4GS9B 3IS2A 1N9BA 1MPLA 2QKPA 1I5QA 3T50A 4MBKA 3ZCZA 4JLFA 3IWOA 2WADA 2VZWA 2HDQA 4Y3IA 3N8LA 2J3TD 4KQQA 4KENB 2MJ6A 4X1MA 4BQMA 2P9VA 1W7FA 3LIBA 3V5MA 4DJ3A 1NYMA 1S67L 2Y2GA 1IYOA 2FFFB 2ZC7A 3EEAA 1XFNA 4YINA 2XROA 1JWZA 4KZBA 1K38A 2GX5A 4Q0IA 5GLBA 2ZBBA 2AVXA 5GLAA 3L7HA 1FCNA 1LSVA 3E4QA 3Q82A 4KZ4A 4LPZA 2J8YA 1D06A 2WZXA 2DNSA 1FCMA 3MQQA 1OJGA 1PZOA 3A3DA 1KOUA 2QYBA 4LFUA 4MN6A 1RGZA 4XT2A 1IKIA 3KSIA 1ZG6A 5HAPA 2QJ7A 4G3KA 1YM1A 5DFXA 1GHPA 3QHYA 4DE2A 2Y2LA 1GSVA 4OQIA 4NXEA 2I72A 4NXBA 3F1NB 3G32A 3UE0A 3CPTB 3QP8A 3OZHA 3CUEA 2M7UA 3WS0A 3C8CA 3C4OA 4YFMA 4ARZB 4QHCA 1XA7A 4L9EA 2JN7A 4WLAA 2PDRA 3CZDA 4S2NA 2VEAA 3OPLA 4KZ6A 1C3BA 3ZVTA 3IXHA 2VGLS 1YLWA 4HI4A 3W4OA 4HBUA 2ZQ8A 1XA1A 5FQMA 3ZG0A 3PYPA 5HWVA 1YMSA 4QD4A 4LV3A 4DJ2A 2Y2NA 1L0GA 3V67A 1EW0A 1V9YA 3A3IA 4FCFA 4F3LB 2ACGA 3B33A 4GNUA 3BLMA 3CITA 1GSWA 2XDMA 3G34A 3FWLA 4FSFA 2H28A 4K0XA 4C75A 4UQIM 2YKHA 4Z1WA 3VP4A 1PFLA 4RQ9A 4RVAA 2IWCA 3IF6B 4L9FA 2JKFA 2LB9A 3NOUC 2VGLM 2WKEA 3LYXA 3G6OA 4GB7A 1KE3A 1GHIA 2O99A 4QB8A 1KGGA 1SDEA 1XGJA 2YKFA 4P6ZS 3D72A 5FI7A 3WS4A 3ZG9B 3IX4A 5HPIA 5HD5A 4EEPA 1LHYA 3ZG7B 1TDGA 3VP1A 3BQAA 1ALQA 1XX2A 3EQUA 3LR4A 1YLJA 4EWFA 2Y2IA 5EVIA 2I9VA 1W8QA 1L0EA 1JVJA 3IH9A 3FYZA 5LBRA 4CLCA 2NUPC 2EWWA 1BULA 4B88A 1PWCA 1GA9A 4WELA 1SCWA 1O07A 3GRJA 3OLOA 5AVFA 1ESUA 4OQHA 4EUZA 4BD0A 1GSXA 1DP9A 4EUVA 4BBVA 3VP2A 5J7EA 1EI5A 4KG5A 1NLZA 3PR6A 1H8MA 4P6ZM 3AGDA 3H7WB 5J4EA 2GDNA 3C2WA 1XPBA 4S2MA 4KQOA 3VSLA 3ZYTA 3Q81A 4DXBA 3LGOA 1W5DA 4OP8A 4LV0A 3ZG8B 5J8XA 5DVAA 4OOLA 3CLOA 2EXBA 3IX8A 2H0YA 3VSKA 1Y28A 3H82B 2OWJA 5EPHA 2V1AA 1F2KA 2QZ6A 4HH3A 4X25A 2DCFA 3SH8A 2VX8A 2DMWA 2ZC3B 3R7WA 1LLBA 3W4PA 2J3TC 4N1XA 5DTKA 2RL3A 1K56D 3IF5A 2VV8A 3NDGA 4JGRA 2WKQA 1NRFA 2DRWA 2XD1A 5DTTA 3K2NA 1N9OA 3DBAA 4Y0TA 1D1JA 3LR5A 3FV7A 1S0WA 2V1ZA 4WMCA 4NXGA 3HLBA 2V1BA 1VM1A 4IBXA 4LRYC 3HJKA 3IX3A 3O86A 4QY5A 3HLFA 1FR6A 2JKGA 1GHMA 2XLNA 1JTGA 3LUQA 1VHMA 4KUOA 1HZOA 3P01A 4JF5A 4KG6A 1YLZA 4HESA 4EXOA 3DTIA 3PBOA 3EWKA 1A0KA 3LI8A 3FZCA 2BASA 4JXSA 3IWQA 1MWUA 1UGUA 3MSHA 5IT5A 3Q7ZA 4KZ8A 2J3WA 3IT9A 5EE8A 3OC2A 4K0WA 4II7A 1BT5A 4A5RA 5FEFA 5HD3A 3F1OB 3PBQA 3M2KA 5EV0A 3ULFA 1ZC2A 3LEZA 4LGWA 3BWLA 2XA7S 4R3AA 4OLGA 1ERMA 5A91A 2ZQ7A 3RFBA 4U3TA 4GDNA 4EERA 1M6KA 3N7WA 4E04A 3C30A 3WS2A 4PMAA 3MKEA 1WYBA 1OTDA 2A24B 4BBUA 5F68A 4IHQA 1ZKJA 1YMXA 1G6AA 5EOOA 2ZOHA 5CEBA 2EX9A 2X02A 3E0YA 5DJUA 3QP1A 4S2LA 2PR5A 5E2HA 5HZHA 3O87A 5M18A 2K7SA 2VV7A 5GL9A 1IKGA 3UB6A 1J9MA 3E98A 4EEUA 3BFEA 5A92A 2XA7M 2L0WA 3MXRA 1KE0A 1DJCA 1FSYA 2W1RA 2PYRA 1DJAA 4I5SA 1H5XA 4B4XA 4OQGA 2VK3A 3SZTA 2W3EA 3GVBA 4M4XA 1K6RA 5FA7A 3G35A 3A0SA 5I94A 1FSWA 4KZ3A 3WS1A 1BYWA 5HDCA 2ZMVA 4E3NA 1VETA 1G6OA 4PM8A 5I5LA 3ZQ5A 4WUJA 4WYYA 1IELA 2GJ3A 3CHWP 2H0TA 5IHVA 3BY9A 3DTEA 3MZFA 1YSQA 4K91A 3CI6A 3ZGAB 4QWOA 1E3UA 3UDFA 2HPBA 3WRTA 2Z2LB 2QMIA 4ZBEA 1FILA 4CQHA 3D9YA 3G4PA 2WGWA 2EX6A 5CTMA 2IWDA 2P9VB 2W27A 2O0YA 4MLLA 1HLUP 3IF6C 3SS5A 1IYPA 4WEKA 4BMWA 3M2JA 3RJUA 3IH8A 4G3VA 4ZJ1A 3VE3A 3EEHA 5CGSA 2WAFA 1PI4A 4P87A 5J3WA 4B9OA 4EU0A 4G3WA 2INWA 1FQGA 4GDBA 4ZAMA 5HL1A 3ZNYA 4KQDA 4B93A 4FUWA 3MMHA 2VKSA 5L09A 4UAAA 1BLPA 2L1MA 4IEDA 3BEBA 2IA2A 3IHBA 1NYYA 3RXWA 3ZDJA 4E3MA 3MFDA 1F5MA 4WZ5A 1LL9A 3GMWA 2Q9NA 1K54C 3P09A 4XT2B 3E2KA 1X0OA 1MWTA 4GKUA 1G68A 3SW1A 5IS1A 1S1ZA 3S1YA 3KO6A 2WKRA 3EGDC 3EQVA 1PI5A 1H3QA 1IFQA 2W1TA 2XR0A 4DRTA 5TBMA 5F5YA 3NC8A 2QHKA 4C3QA 3NJAA 1T18A 1PWGA 1YLTA 4IUKA 4LCMA 4PKYG 2ZL1A 4R23A 4EETB 4X68A 1YLYA 3IBRA 1KDWA 2XF3A 5FI2A 3HVFA 3VV4A 4ETZA 2P74A 1RCJA 2FZ0A 5GHZA 4X69A 3ISGA 4RX2A 3ICYA 2C5WB 4YWZA 1OMEA 5FASA 3BYDA 2FFYA 3T1XA 2O9AA 4OPZA 3F1PA 4WL9A 4GW9A 5F82A 1H0MA 3FKWA 3LCEA 3E4OA 1CJFA 2VA0A 2XEPA 3VFHA 2EWVA 3MXSA 4OQ0A 3H9WA 3P7NA 3Q7VA 2X01A 1K25A 4JF6A 3ZVWA 4OONA 4KZAA 3TW8A 2EFXA 2XFTA 1Q2PA 1KVMA 3UDIA 4OOMA 3CG5A 2ZC4B 5EM1A 1MKIA 3HREA 4MN7A 4DKIA 1MBLA 3M6BA 1OT9A 4NKPA 4ID4A 2Y2JA 4UQIS 1BLCA 2OLUA 4GOGA 3S7NA 4GHIA 3LEQA 4Y13A 1KGEA 2K2NA 4FD8A 2Y2PA 3IXBA 5EVIB 2OV5A 2BLSA 5DF8A 3UB9A 3GSGA 2Y79A 4X55A 4DF6A 4CLCB 4HEFA 1S4SA 4MN5A 4IUHA 1P9RA 2VGKA 1MY8A 1MWSA 2M7VA 3LY4A 2VGJA 1S6RA 1WYCA 3V39A 1NJ4A 2PD8A 2WKHA 5E2GA 5TR7A 4YOFA 3PBNA 4WN5A 1TS7A 5U47A 5F83A 2HP6A 4BL3A 1XXMA 4Z9QA 3MQOA 2Q0OA 1S4RA 4R38A 4O0PA 3R4KA 1WE4A 2W3HA 4S2JA 3MQ0A 3S7OA 1KDSA 2VV6A 3HJIA 2Y2QA 1SZVA 4KZ5A 1TDLA 3WWXA 2Y2HA 1DP8A 5L07A 4JPMA 2WZZA 1U60A 4I3JA 3OOVA 5HSQA 3UE1A 1W63M 1DRMA 3K3CA 3R7WB 4HOIA 3ZFZA 4M3KA 4PHTA 1MWRA 1HVBA 3UE3A 3C7VA 3A3JA 3BFDA 2V20A 3LY3A 3DAVA 4MCWA 5CHMA 4JKTA 1FOFA 4OP5A 1LI0A 2A3UA 5KSHA 3PBRA 2RCXA 2W3FA 1YSPA 4K08A 2HJEA 3MS6A 4NEED 1N4OA 4H6JB 1PYYA 4LRXC 1P97A 3MF0A 3IBJA 3N8RA 3B42A 1FR1A 5EM0A 3MZDA 4HP4A 1JWPA 5IU1A 3KX0X 1PZPA 5M1AA 4N9LA 3LR3A 1L0DA 5DTSA 4FH4A 5FAQA 3G2ZA 1E25A 5HARA 4Y2FA 2Y2MA 3NOPC 5F1FA 4P0MA 4XUZA 4ME4A 2X71A 4JGQA 3D3OA 5A90A 4S2OA 3LIEA 4GD6A 1OPXA 3V50A 3QP5A 2D01A 2PD7A 3PHYA 4LLOB 2GNXA 2ZJ9A 3QP2A 3PXPA 3RXXA 5DJTA 4PM5A 1CEGA 1LL5A 2E8JA 3O5YA 1VQQA 4HHDA 1K6SA 1LL8A 1SHVA 3VMAA 3BFGA 3BFCA 2Y55A 2PRFA 1VEUA 4E3LA 4R4RA 3VOLA 5D3OA 4HBTA 3FC7A 1EROA 3CUEC 4BBTA 1G5UA 3TG9A 5AQ9A 2R9XA 3TJZC 4HJ4A 4PKYA 2OAQ1 2PU4A 4D2OA 2JKRI 1T1BA 2R78A 1P0ZA 3PAEA 4QU3A 2JKTI 3QNCA 4RYEA 1K56A 3MR0A 5FI6A 3BLSA 5KIZA 3DWKA 1VETB 1BLSA 3JYIA 1CI8A 2EA9A 2JCHA 1ACFA 3A0RA 4HQAA 3HLWA 4ZJ2A 5FQIA 4JBFA 5EECA 2XGNA 2OSUA 3UPNA 1SKOA 2QJ5A 3H82A 1TVFA 2LB5A 4HIAA 4CJNA 4NXFA 2WGVA 2JHEA 4HJ3A 1N9LA 4JGPA 2ZM8A 2WAEA 3T4LA 1PW1A 5BOHA 1SDNA 4CLCE 4Y0UA 3S4XA 2UV0E 2Y59A 5KMWA 1ODVA 3PBTA 5EOEA 2P04A 1ES2A 5G4ZA 4DDSA 3T4OA 4LCLA 3V3SA 2XH9A 2P7JA 4KG2A 4WM9A 2V2FF 2WKIA 1PRQA 3VP3A 2WKPA 1T1CA 3NECA 1OTEA 4E6XA 2WGIA 1K4EA 1YKDA 1ERQA 1T19A 4ESPA 4PM9A 4RA7A 3W2ZA 1HD8A 4X6TA 3FKVA 1E4DA 1CI9A 5EVIC 2PU2A 3BM6A 4ZJ3A 3T4JA 4R3BA 4UA7A 4N9KA 5HWTA 2VJWA 5E2EA 3PAGA 3WRZA 3IS2B 4D60A 4EQ1A 3T1QB 4RX3A 1XJ2A 1EWZA 2BG1A 3MZEA 4DN0A 2JKRM 4OOYA 3ZNTA 1Z09A 3TOIA 1QMEA 2JKTM 2B5RA 1H8ZA 4JF4A 2W1TB 3FPVA 5CRFA 3NI9A 3N4IA 5EFWA 5TBMB 5FQQA 4YNRA 2CC1A 3HLDA 2O9CA 3GTCA 2PAVP 2J9OA 2Y91A 2H10A 1LT0A 5EUAA 5CERA 4R1GA 4HJ6A 2C6WB 3BQ8A 2ZL1B 3ZG5A 1CF0A 5TGFA 2HZ5A 2CMNA 3MFXA 4MEZA 1NZOA 4PM6A 3D4FA 5MC7A 5HAQA 4PM7A 3PTEA 4OVDA 2HDSA 4OKPA 2W0NA 3G2YA 3TSGA 5EVLA 2Z6DA 3QP6A 3TRCA 4BL2A 4E3KA 3F1PB 2HJ9C 5CTNA 3O3VA 2NUTC 4FOFA 3RTYA 1KGFA 4UA6A 4QY6A 3I7JA 4U0TA 1BSGA 1ZG4A 3DW0A 3KSGA 3AGFA 4WZ4A 3Q7VB 3A3FA 5CHUA 3C7UA 4PPRA 2WK0A 3MJQA 5AQBA 3VFFA 4X56A 5FEGA 2Y2KA 1XFQA 5HW3A 2J9PA 1IYQA 2IWBA 2HDUA 2PT7A 3IWIA 1NXYA 2A2LA 4HH2A 3W4QA 4OPRA 1JTDA 3C4PA 4BLMA 1ES3A 4GHIB 3LFVA 5KZHA 3LIFA 4WBGA 4JXWA 3SS4A 4I39A 3SH9A 1F98A 3T4QA 4GD8A 2O9BA 2W3GA 1DJBA 5L8MA 2Y2OA 4KQRA 4HP9A 5FSRA 3DWZA 4IVIA 5M19A 4XUXA 1W63Q 3CWFA 3A0VA 1MKMA 4KZ9A 5FAPA 1MC0A 2PHYA 3UPPA 3MKFA 2ZD8A 3CMZA 1OJ5A 3E4PA 5GLDA 2OAP1 2H5SA 4BD1A 3T1SA 1NLYA 1K55C 5FAOA 1SKFA 3G30A 3UPOA 1TS6A 2KLIA 3DTMA 5CXWA 3FPWA 3T1RA 3C5AA 1OTIA 2JE5A 2WUQA 3UNWA 2ZM2A 3UE6A 3HUMA 3GECA 4Q8IA 4E3OA 2M1CA 3DTKA 3N8SA 1KE4A 3OBFA 3C38A 4PAUA 2UWXA 3NBLA 3N6IA 4GS9A 3VOZA 4S2PA 3UO9A 2A49A 2K31A 3BY8A 2FH5A 3JVUA 2JC7A 4X53A 1YQSA 4UEYA 3BJNA 3VE4A 1IYSA 4DXCA 1YAXA 4MBFA 4KUKA 5HDSA 2KOIA 1V9ZA 5JYOA 4R6LA 5DKLA 2EFUA 5E2FA 4UHUA 4GZBA 1IEMA 4WEJA 5FQJA 1L3LA 4R0QA 2B02A 1O7EA 4OPYA 4MBHA 1XJ4A 1I2WA 4S2IA 3NHQA 3SH7A 4DMZA 4MDZA 1D7EA 3E2LA 4O01A 3HUNA 4IJGA 1Y54A 1HTZA 4Y5FA 3O88A 3L9KA 3UN7A 3T4TA 4EBNA 4MNRA 5G4YA 1NY0A 3A3EA 2G7UA 1LSXA 1BZAA 5EVID 3UB8A 2ZM0A 4H8RA 4GLQA 4CPKA 4CLCD 4R70A 1FIKA 1YT4A 1MZUA 3NIAA 3HBRA 1G28A 3KYEA 1J3WA 2HF6A 5CECA 3NOTC 4WF0A 4B4ZA 1Z6FA 1PW8A 3F1NA 4R3JA 3SS3A 2EX2A 2PBYA 3CPTA 4FH2A 4KZ7A 3LICA 4E3IA 3MXQA 4ARZA 1KVLA 5GLCA 1ES5A 3FG8A 3PBSA 3IQAA 4NETA 4E3JA 3LO7A 1CK3A 3S22A 4Q0HA 3VP0A 4HNBA 4EV4A 4WZ5C 1K57C 4LRZE 2KX6A 4ZRRA 1LSWA 5G18A 1OT6A 5FATA 1XGIA 3HUOA 3GDIA 4JXVA 2QPNA 4F3LA 1TEMA 1VEUB 2Z6CA 3OPHA 1XP4A 2OWHA 3GQZA 2PYPA 2Q9MA 4Y7PA 3HL9A 5AQAA 2Z2MB 4EBPA 5A8BA 1ZTUA 5L10A 1TS0A 1W8YA 4DDYA 2XSSA 2ZMFA 3W8KA 3GV9A 3SOIA 2JBFA 1L0FA 2R9WA 1N9NA 1ONGA 5EVEA 2EXAA 3TE8A 3IF6A 4OPQA 1K4FA 2XD5A 4WMCD 2G2WA 1OTAA 4S2KA 1BLHA 5HL6A 2B95A 2HGVA 1M40A 3OCNA 5A93A 3BRMA 2ZQ9A 4NK3A 3OPRA 1PWDA 1SKOB 3JVVA 4ZTKA 1WA9A 2ZQAA 3UB5P 5HX9A 3LI9A 1BTLA 5HAIA 2V0WA 2WYXA 1TD5A 4ZDXA 3G31A 5AQ7A 4I3IA 4BJPA 3WS5A 3BFFA 4I38A 5KSCA 1I2SA 3KSHA 1K54A 3HLEA 2ZQCA 2V0UA 1QMFA 1UWNX 2ZLYA 3BW6A 2ZQDA 2ZC5B 1NRJA 1MXOA 5HDDA 2HP5A 5FQ9A 3OPPA 4IVKA 3KYQA 2XK1A 4BENA 1W79A 4HY8A 4H6JA 1AXBA 1JNUA 3H7WA 4DE3A 1IOUA 4S2NC 4NG2A 1CEFA 4E6WA 3UY6A 1TS8A 4BWIA 1TF1A 2GZAA 3U4LP 3IXGA 1GA0A 3RH8B 3V3RA 2PBDP 1AWIA 4I3AA 5E43A 3NY4A 3GR2A 4EBLA 5GHXA 1NWZA 3UDXA 4O7DA 3B47A 5F69A 1UWPX 2J80A 1BUEA 4OLDA 5FDHA 1S66L 1JWVA 1K55A 4UA9A 1XKZA 2VLGA 2WGWB 4MMNA 5HWWA 2EX8A 3CAXA 3S7PA 2Y4AA 4Y0OA 3Q1FA 2XRNA 5L2FA 2HP9A 1FCOA 1Q2QA 4EESA 1DP6A 4L0LA 5TJJA 4LV2A 2G2UA 2OOLA 2QWSA 2E8IA 5FL3A 1E3UD 5TFQA 1Y4OA 4XXRA 2W3DA 1XJ6A 3MBZA 1ESIA 3B3XA 4GCZA 1YLPA 3OCLA 1S1YA 4LENA 2KDKA 5CX7A 1VB6A 1F9IA 4OH0A 5GHYA 2V8CA 3LIDA 4N1HA 5DF7A 5CGWA 4CLCC 1RP5A 4O8GA 2Y8HA 3HLCA 3QP4A 5DFYA 4P6BA 4QJGA 4FTXA 2D02A 4JXGA 3F1OA 3T4SA 3JPUA 3AGEA 3UMDA 3ZHHA 4DE1A 3UMEA 3LR0A 4GJ4A 3ITAA 3P98A 3IHAA 4X1LA 2XQZA 3IXDA 2PR6A 5AVEA 1L2SA 1NZUA 4C6YA 4DE0A 2ZC6B 3QNBA 2V9AA 5AJGA 1STZA 4Y15A 5DF9A 2V8FA 3EGXC 2A24A 5DKKA 4Q0JA 3HLGA 3T4KA 4AFIA 3M6HA 1YPRA 3HCYA 4ETXA 5CGXA 3S7QA 2OLVA 1PIOA 4QPRA 4EW7A 5JYPA 3Q07A 2ZOIA 2J7VA 3K3DA 3LIAA 4P85A 1K0KA 2HV1A 4R4SA 2BTFP 1PNEA 2HDRA 3BECA 4Y17A 1OTBA 4LV1A 5CHJA 4JGOA 5F1GA 5HPFA 1ES4A 3ITBA 3T12B 1CQAA 4N92A 5CEDA 2L4RA 3VOYA 3KSFA 3KYZA 1LI9A 4U0XA 2B18A 2XFSA 5K5BA 5FQKA 1ZHHB 4L9GA 1T1AA 4GN2A 1DY6A 5FDSA 5HFOA 3U2AA 3NDEA 1GCEA 3CJMA 3EOIA 3NULA 1P9WA 1RGYA 1K57A 3NCKA 1ONHA 4EQIA 2ZMAA 2P08A 4F94A
chains in the Genus database with same CATH topology
2X02A 1H8YA 4IBRA 4S2LA 3E2LA 5E2HA 3HUNA 3O87A 5M18A 1N9BA 1Y54A 1MPLA 1HTZA 4P0MA 5F1FA 1I5QA 3O88A 5GL9A 1IKGA 4XUZA 4MBKA 2X71A 1J9MA 3UN7A 3ZCZA 4EBNA 4JLFA 5A90A 3IWOA 4S2OA 2WADA 4MNRA 3BFEA 4GD6A 5A92A 1NY0A 3A3EA 2HDQA 3MXRA 3V50A 3N8LA 1KE0A 4KQQA 1BZAA 4KENB 1DJCA 1FSYA 5EVID 1DJAA 2ZM0A 4H8RA 1H5XA 4B4XA 4OQGA 4BQMA 2ZJ9A 4CPKA 2P9VA 3GVBA 1K6RA 5FA7A 3G35A 5I94A 1FSWA 4KZ3A 3WS1A 1W7FA 3RXXA 3V5MA 1YT4A 1NYMA 3NIAA 4E3NA 4PM5A 1CEGA 2Y2GA 1IYOA 1LL5A 2FFFB 1VQQA 2ZC7A 1K6SA 1SHVA 3HBRA 4PM8A 4YINA 3VMAA 3BFGA 5CECA 3BFCA 4WYYA 1IELA 1JWZA 4KZBA 2Y55A 1K38A 4B4ZA 1Z6FA 1PW8A 2H0TA 4R3JA 5IHVA 5GLBA 3SS3A 2EX2A 2PBYA 3MZFA 4E3LA 4R4RA 5GLAA 5D3OA 4HBTA 4K91A 1FCNA 4FH2A 3Q82A 1EROA 4KZ4A 4KZ7A 3ZGAB 3TG9A 1E3UA 5AQ9A 3UDFA 2R9XA 4E3IA 2J8YA 2WZXA 2DNSA 1KVLA 2HPBA 5GLCA 1ES5A 3WRTA 2Z2LB 1FCMA 2QMIA 4ZBEA 2PU4A 4D2OA 1PZOA 3PBSA 3IQAA 4NETA 4E3JA 3A3DA 3LO7A 1CK3A 3S22A 3PAEA 4QU3A 3G4PA 2WGWA 3VP0A 2EX6A 4EV4A 1RGZA 2IWDA 2P9VB 3QNCA 1IKIA 4RYEA 4WZ5C 1K56A 4MLLA 5CTMA 5FI6A 3IF6C 1K57C 3BLSA 3SS5A 1ZG6A 5HAPA 1IYPA 3DWKA 4WEKA 1YM1A 1BLSA 3M2JA 3JYIA 1CI8A 3RJUA 1GHPA 3QHYA 2JCHA 5G18A 3IH8A 5FATA 4DE2A 4ZJ1A 5CGSA 3HLWA 2WAFA 2Y2LA 5FQIA 1PI4A 1XGIA 4JBFA 4P87A 5EECA 4ZJ2A 2XGNA 4OQIA 3HUOA 2OSUA 2I72A 3UPNA 4JXVA 1FQGA 2QPNA 4GDBA 1TEMA 3G32A 4ZAMA 3UE0A 3OPHA 3ZNYA 5HL1A 1XP4A 3OZHA 3GQZA 1TVFA 2Q9MA 4Y7PA 3HL9A 4CJNA 5AQAA 3WS0A 2Z2MB 4EBPA 4UAAA 3C4OA 4YFMA 1BLPA 1W8YA 4IEDA 3BEBA 4DDYA 4QHCA 1XA7A 2WGVA 3IHBA 1NYYA 3W8KA 3RXWA 3GV9A 3SOIA 2ZM8A 3ZDJA 4E3MA 2WAEA 3CZDA 4S2NA 2JBFA 3MFDA 1L0FA 2R9WA 1PW1A 5BOHA 1ONGA 1SDNA 3OPLA 4KZ6A 1C3BA 4WZ5A 4Y0UA 3ZVTA 1LL9A 2EXAA 2Q9NA 1K54C 3GMWA 3S4XA 3IF6A 3IXHA 4OPQA 1K4FA 3P09A 2XD5A 4WMCD 1YLWA 2Y59A 5KMWA 3W4OA 2G2WA 3E2KA 4HBUA 3PBTA 2ZQ8A 1XA1A 4S2KA 5FQMA 1BLHA 3ZG0A 5EOEA 1MWTA 1ES2A 4GKUA 1YMSA 1G68A 4QD4A 4DDSA 4LV3A 1M40A 3OCNA 4LCLA 2Y2NA 1L0GA 3V3SA 3BRMA 3S1YA 5A93A 2ZQ9A 4NK3A 3OPRA 1PWDA 2XH9A 4KG2A 4WM9A 2V2FF 3A3IA 3EQVA 4FCFA 4ZTKA 2WKIA 1PI5A 2ZQAA 3VP3A 5HX9A 4GNUA 1BTLA 3BLMA 4E6XA 2WGIA 1K4EA 5HAIA 2XDMA 2XR0A 2WYXA 1ERQA 4ZDXA 3G34A 3G31A 4DRTA 4PM9A 5AQ7A 3FWLA 4RA7A 4FSFA 3NC8A 4BJPA 1HD8A 3WS5A 4X6TA 3BFFA 3FKVA 4K0XA 4C3QA 5KSCA 1E4DA 1I2SA 4C75A 1CI9A 1PWGA 5EVIC 1K54A 3HLEA 2PU2A 1YLTA 3VP4A 2ZQCA 3BM6A 1QMFA 4RVAA 2IWCA 2ZLYA 3IF6B 4ZJ3A 4LCMA 2ZQDA 4R23A 2ZC5B 4R3BA 4UA7A 4X68A 4N9KA 1YLYA 2WKEA 1KDWA 2XF3A 1MXOA 5FI2A 5E2EA 4GB7A 1KE3A 1GHIA 3HVFA 3PAGA 2HP5A 3WRZA 2P74A 4QB8A 5FQ9A 1RCJA 3OPPA 1KGGA 5GHZA 4IVKA 1SDEA 4X69A 3ISGA 4RX3A 1XGJA 1EWZA 2BG1A 2XK1A 3MZEA 4RX2A 4OOYA 3ZNTA 4BENA 2C5WB 5FI7A 3TOIA 1W79A 1OMEA 1QMEA 3WS4A 5FASA 3BYDA 3ZG9B 1AXBA 2FFYA 2B5RA 1H8ZA 4JF4A 1LHYA 3ZG7B 4DE3A 4OPZA 1TDGA 4S2NC 5CRFA 3NI9A 5F82A 1ALQA 1XX2A 1CEFA 3EQUA 3VP1A 3FKWA 3N4IA 1YLJA 5FQQA 4EWFA 4E6WA 3LCEA 3UY6A 2Y2IA 5EVIA 2XEPA 1W8QA 3VFHA 2CC1A 3HLDA 1L0EA 3GTCA 1JVJA 3MXSA 4OQ0A 2J9OA 3IXGA 1GA0A 3V3RA 2Y91A 3Q7VA 2H10A 3IH9A 3FYZA 5EUAA 1K25A 4JF6A 2X01A 5CERA 4OONA 4R1GA 3ZVWA 2C6WB 3ZG5A 4KZAA 1BULA 4B88A 2EFXA 5E43A 5TGFA 3NY4A 1PWCA 1GA9A 3GR2A 4WELA 4EBLA 1SCWA 2XFTA 4MEZA 1O07A 1Q2PA 1KVMA 1NZOA 4OOMA 5GHXA 3UDIA 3GRJA 1ESUA 4PM6A 4OQHA 3D4FA 4EUZA 5HAQA 4PM7A 4BD0A 3PTEA 3UDXA 3CG5A 4O7DA 2ZC4B 1MKIA 3HREA 4OVDA 4DKIA 1MBLA 3M6BA 3VP2A 2HDSA 4OKPA 1EI5A 4ID4A 4KG5A 2Y2JA 1BUEA 4OLDA 1BLCA 2OLUA 3G2YA 5FDHA 4GOGA 3AGDA 3TSGA 5EVLA 4BL2A 1JWVA 1K55A 4E3KA 2GDNA 4UA9A 4F94A 1XKZA 1KGEA 2WGWB 5CTNA 1XPBA 3O3VA 1KGFA 2EX8A 4S2MA 4UA6A 4FD8A 2Y2PA 3IXBA 4KQOA 4QY6A 5EVIB 3VSLA 3I7JA 4U0TA 1BSGA 1ZG4A 2BLSA 5DF8A 3GSGA 2Y4AA 3DW0A 3Q81A 4Y0OA 3Q1FA 4DXBA 4X55A 4DF6A 5L2FA 1W5DA 3AGFA 4WZ4A 3Q7VB 2HP9A 3A3FA 4OP8A 4LV0A 1FCOA 4HEFA 1Q2QA 3ZG8B 5CHUA 3C7UA 5J8XA 5DVAA 4L0LA 4OOLA 4PPRA 2WK0A 2EXBA 5AQBA 3VFFA 2VGKA 2G2UA 2H0YA 1MY8A 1MWSA 2E8IA 4LV2A 3VSKA 3LY4A 2VGJA 4X56A 1S6RA 1WYCA 2Y2KA 1E3UD 5TFQA 3V39A 1NJ4A 5EPHA 4XXRA 5HW3A 2J9PA 2WKHA 1IYQA 5E2GA 2IWBA 5TR7A 2QZ6A 2HDUA 3IWIA 2DCFA 3SH8A 3PBNA 1NXYA 3MBZA 2ZC3B 1ESIA 3B3XA 3W4QA 4OPRA 1JTDA 1LLBA 1YLPA 3C4PA 3OCLA 3W4PA 4BLMA 5U47A 5F83A 1ES3A 4N1XA 5DTKA 2HP6A 4BL3A 4LENA 2RL3A 5KZHA 1XXMA 1K56D 4WBGA 4JXWA 3IF5A 4OH0A 4Z9QA 3SS4A 5GHYA 3NDGA 3SH9A 4GD8A 4N1HA 5DF7A 5CGWA 1WE4A 1DJBA 2Y2OA 4S2JA 1NRFA 1RP5A 2DRWA 2XD1A 5DTTA 3HLCA 4KQRA 4Y0TA 1KDSA 5FSRA 3FV7A 4P6BA 1S0WA 4QJGA 3DWZA 4IVIA 5M19A 2V1ZA 4WMCA 2Y2QA 3HLBA 4JXGA 4XUXA 1VM1A 4KZ5A 1TDLA 3AGEA 4IBXA 3ZHHA 3WWXA 4DE1A 4KZ9A 5FAPA 2Y2HA 3ITAA 3O86A 3UPPA 3P98A 3MKFA 4JPMA 2ZD8A 4QY5A 3IHAA 3HLFA 2WZZA 1U60A 3CMZA 1FR6A 5GLDA 2H5SA 4BD1A 1GHMA 2XQZA 3IXDA 2XLNA 1K55C 1JTGA 1L2SA 5FAOA 3UE1A 1NZUA 1SKFA 3G30A 3UPOA 4C6YA 1HZOA 4DE0A 4JF5A 2ZC6B 3QNBA 4KG6A 1YLZA 4HESA 3DTMA 5CXWA 3C5AA 3PBOA 3ZFZA 2JE5A 4M3KA 2WUQA 1MWRA 1HVBA 5DF9A 3C7VA 3A3JA 3BFDA 3UE3A 3UNWA 2ZM2A 3FZCA 3HUMA 4Q8IA 2V20A 3LY3A 4JXSA 4E3OA 3HLGA 3IWQA 1MWUA 5CHMA 4JKTA 3M6HA 1FOFA 4OP5A 3N8SA 1LI0A 1KE4A 3Q7ZA 4KZ8A 5CGXA 2OV5A 3IT9A 2OLVA 1PIOA 5EE8A 2A3UA 3OC2A 4K0WA 5KSHA 5JYPA 3PBRA 2RCXA 2UWXA 1BT5A 3Q07A 3NBLA 4A5RA 2J7VA 3N6IA 4P85A 3PBQA 3VOZA 3M2KA 4R4SA 4S2PA 3UO9A 2HDRA 3BECA 2A49A 1N4OA 1ZC2A 3LEZA 1PYYA 2JC7A 4X53A 4LV1A 5CHJA 4OLGA 5F1GA 1ERMA 1YQSA 1ES4A 5A91A 3ITBA 3N8RA 2ZQ7A 1IYSA 4N92A 4U3TA 4DXCA 4GDNA 5CEDA 1M6KA 3N7WA 1FR1A 3WS2A 4MBFA 3MZDA 4PMAA 3MKEA 3VOYA 1WYBA 1LI9A 4U0XA 2XFSA 1JWPA 5FQKA 5JYOA 1PZPA 5M1AA 2EFUA 5E2FA 4UHUA 4GZBA 1IEMA 4WEJA 5FQJA 4N9LA 4GN2A 1DY6A 1L0DA 5DTSA 5HFOA 1ZKJA 4R0QA 3NDEA 1O7EA 4FH4A 4OPYA 5FAQA 1GCEA 3CJMA 3G2ZA 4MBHA 1I2WA 1E25A 1RGYA 1K57A 1YMXA 3NCKA 4S2IA 1G6AA 1ONHA 5EOOA 5HARA 4EQIA 2ZMAA 5CEBA 3SH7A 2Y2MA 2EX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X02 A;  1H8Y A;  4IBR A;  4S2L A;  3E2L A;  5E2H A;  3HUN A;  3O87 A;  5M18 A;  1N9B A;  1Y54 A;  1MPL A;  1HTZ A;  4P0M A;  5F1F A;  1I5Q A;  3O88 A;  5GL9 A;  1IKG A;  4XUZ A;  4MBK A;  2X71 A;  1J9M A;  3UN7 A;  3ZCZ A;  4EBN A;  4JLF A;  5A90 A;  3IWO A;  4S2O A;  2WAD A;  4MNR A;  3BFE A;  4GD6 A;  5A92 A;  1NY0 A;  3A3E A;  2HDQ A;  3MXR A;  3V50 A;  3N8L A;  1KE0 A;  4KQQ A;  1BZA A;  4KEN B;  1DJC A;  1FSY A;  5EVI D;  1DJA A;  2ZM0 A;  4H8R A;  1H5X A;  4B4X A;  4OQG A;  4BQM A;  2ZJ9 A;  4CPK A;  2P9V A;  3GVB A;  1K6R A;  5FA7 A;  3G35 A;  5I94 A;  1FSW A;  4KZ3 A;  3WS1 A;  1W7F A;  3RXX A;  3V5M A;  1YT4 A;  1NYM A;  3NIA A;  4E3N A;  4PM5 A;  1CEG A;  2Y2G A;  1IYO A;  1LL5 A;  2FFF B;  1VQQ A;  2ZC7 A;  1K6S A;  1SHV A;  3HBR A;  4PM8 A;  4YIN A;  3VMA A;  3BFG A;  5CEC A;  3BFC A;  4WYY A;  1IEL A;  1JWZ A;  4KZB A;  2Y55 A;  1K38 A;  4B4Z A;  1Z6F A;  1PW8 A;  2H0T A;  4R3J A;  5IHV A;  5GLB A;  3SS3 A;  2EX2 A;  2PBY A;  3MZF A;  4E3L A;  4R4R A;  5GLA A;  5D3O A;  4HBT A;  4K91 A;  1FCN A;  4FH2 A;  3Q82 A;  1ERO A;  4KZ4 A;  4KZ7 A;  3ZGA B;  3TG9 A;  1E3U A;  5AQ9 A;  3UDF A;  2R9X A;  4E3I A;  2J8Y A;  2WZX A;  2DNS A;  1KVL A;  2HPB A;  5GLC A;  1ES5 A;  3WRT A;  2Z2L B;  1FCM A;  2QMI A;  4ZBE A;  2PU4 A;  4D2O A;  1PZO A;  3PBS A;  3IQA A;  4NET A;  4E3J A;  3A3D A;  3LO7 A;  1CK3 A;  3S22 A;  3PAE A;  4QU3 A;  3G4P A;  2WGW A;  3VP0 A;  2EX6 A;  4EV4 A;  1RGZ A;  2IWD A;  2P9V B;  3QNC A;  1IKI A;  4RYE A;  4WZ5 C;  1K56 A;  4MLL A;  5CTM A;  5FI6 A;  3IF6 C;  1K57 C;  3BLS A;  3SS5 A;  1ZG6 A;  5HAP A;  1IYP A;  3DWK A;  4WEK A;  1YM1 A;  1BLS A;  3M2J A;  3JYI A;  1CI8 A;  3RJU A;  1GHP A;  3QHY A;  2JCH A;  5G18 A;  3IH8 A;  5FAT A;  4DE2 A;  4ZJ1 A;  5CGS A;  3HLW A;  2WAF A;  2Y2L A;  5FQI A;  1PI4 A;  1XGI A;  4JBF A;  4P87 A;  5EEC A;  4ZJ2 A;  2XGN A;  4OQI A;  3HUO A;  2OSU A;  2I72 A;  3UPN A;  4JXV A;  1FQG A;  2QPN A;  4GDB A;  1TEM A;  3G32 A;  4ZAM A;  3UE0 A;  3OPH A;  3ZNY A;  5HL1 A;  1XP4 A;  3OZH A;  3GQZ A;  1TVF A;  2Q9M A;  4Y7P A;  3HL9 A;  4CJN A;  5AQA A;  3WS0 A;  2Z2M B;  4EBP A;  4UAA A;  3C4O A;  4YFM A;  1BLP A;  1W8Y A;  4IED A;  3BEB A;  4DDY A;  4QHC A;  1XA7 A;  2WGV A;  3IHB A;  1NYY A;  3W8K A;  3RXW A;  3GV9 A;  3SOI A;  2ZM8 A;  3ZDJ A;  4E3M A;  2WAE A;  3CZD A;  4S2N A;  2JBF A;  3MFD A;  1L0F A;  2R9W A;  1PW1 A;  5BOH A;  1ONG A;  1SDN A;  3OPL A;  4KZ6 A;  1C3B A;  4WZ5 A;  4Y0U A;  3ZVT A;  1LL9 A;  2EXA A;  2Q9N A;  1K54 C;  3GMW A;  3S4X A;  3IF6 A;  3IXH A;  4OPQ A;  1K4F A;  3P09 A;  2XD5 A;  4WMC D;  1YLW A;  2Y59 A;  5KMW A;  3W4O A;  2G2W A;  3E2K A;  4HBU A;  3PBT A;  2ZQ8 A;  1XA1 A;  4S2K A;  5FQM A;  1BLH A;  3ZG0 A;  5EOE A;  1MWT A;  1ES2 A;  4GKU A;  1YMS A;  1G68 A;  4QD4 A;  4DDS A;  4LV3 A;  1M40 A;  3OCN A;  4LCL A;  2Y2N A;  1L0G A;  3V3S A;  3BRM A;  3S1Y A;  5A93 A;  2ZQ9 A;  4NK3 A;  3OPR A;  1PWD A;  2XH9 A;  4KG2 A;  4WM9 A;  2V2F F;  3A3I A;  3EQV A;  4FCF A;  4ZTK A;  2WKI A;  1PI5 A;  2ZQA A;  3VP3 A;  5HX9 A;  4GNU A;  1BTL A;  3BLM A;  4E6X A;  2WGI A;  1K4E A;  5HAI A;  2XDM A;  2XR0 A;  2WYX A;  1ERQ A;  4ZDX A;  3G34 A;  3G31 A;  4DRT A;  4PM9 A;  5AQ7 A;  3FWL A;  4RA7 A;  4FSF A;  3NC8 A;  4BJP A;  1HD8 A;  3WS5 A;  4X6T A;  3BFF A;  3FKV A;  4K0X A;  4C3Q A;  5KSC A;  1E4D A;  1I2S A;  4C75 A;  1CI9 A;  1PWG A;  5EVI C;  1K54 A;  3HLE A;  2PU2 A;  1YLT A;  3VP4 A;  2ZQC A;  3BM6 A;  1QMF A;  4RVA A;  2IWC A;  2ZLY A;  3IF6 B;  4ZJ3 A;  4LCM A;  2ZQD A;  4R23 A;  2ZC5 B;  4R3B A;  4UA7 A;  4X68 A;  4N9K A;  1YLY A;  2WKE A;  1KDW A;  2XF3 A;  1MXO A;  5FI2 A;  5E2E A;  4GB7 A;  1KE3 A;  1GHI A;  3HVF A;  3PAG A;  2HP5 A;  3WRZ A;  2P74 A;  4QB8 A;  5FQ9 A;  1RCJ A;  3OPP A;  1KGG A;  5GHZ A;  4IVK A;  1SDE A;  4X69 A;  3ISG A;  4RX3 A;  1XGJ A;  1EWZ A;  2BG1 A;  2XK1 A;  3MZE A;  4RX2 A;  4OOY A;  3ZNT A;  4BEN A;  2C5W B;  5FI7 A;  3TOI A;  1W79 A;  1OME A;  1QME A;  3WS4 A;  5FAS A;  3BYD A;  3ZG9 B;  1AXB A;  2FFY A;  2B5R A;  1H8Z A;  4JF4 A;  1LHY A;  3ZG7 B;  4DE3 A;  4OPZ A;  1TDG A;  4S2N C;  5CRF A;  3NI9 A;  5F82 A;  1ALQ A;  1XX2 A;  1CEF A;  3EQU A;  3VP1 A;  3FKW A;  3N4I A;  1YLJ A;  5FQQ A;  4EWF A;  4E6W A;  3LCE A;  3UY6 A;  2Y2I A;  5EVI A;  2XEP A;  1W8Q A;  3VFH A;  2CC1 A;  3HLD A;  1L0E A;  3GTC A;  1JVJ A;  3MXS A;  4OQ0 A;  2J9O A;  3IXG A;  1GA0 A;  3V3R A;  2Y91 A;  3Q7V A;  2H10 A;  3IH9 A;  3FYZ A;  5EUA A;  1K25 A;  4JF6 A;  2X01 A;  5CER A;  4OON A;  4R1G A;  3ZVW A;  2C6W B;  3ZG5 A;  4KZA A;  1BUL A;  4B88 A;  2EFX A;  5E43 A;  5TGF A;  3NY4 A;  1PWC A;  1GA9 A;  3GR2 A;  4WEL A;  4EBL A;  1SCW A;  2XFT A;  4MEZ A;  1O07 A;  1Q2P A;  1KVM A;  1NZO A;  4OOM A;  5GHX A;  3UDI A;  3GRJ A;  1ESU A;  4PM6 A;  4OQH A;  3D4F A;  4EUZ A;  5HAQ A;  4PM7 A;  4BD0 A;  3PTE A;  3UDX A;  3CG5 A;  4O7D A;  2ZC4 B;  1MKI A;  3HRE A;  4OVD A;  4DKI A;  1MBL A;  3M6B A;  3VP2 A;  2HDS A;  4OKP A;  1EI5 A;  4ID4 A;  4KG5 A;  2Y2J A;  1BUE A;  4OLD A;  1BLC A;  2OLU A;  3G2Y A;  5FDH A;  4GOG A;  3AGD A;  3TSG A;  5EVL A;  4BL2 A;  1JWV A;  1K55 A;  4E3K A;  2GDN A;  4UA9 A;  4F94 A;  1XKZ A;  1KGE A;  2WGW B;  5CTN A;  1XPB A;  3O3V A;  1KGF A;  2EX8 A;  4S2M A;  4UA6 A;  4FD8 A;  2Y2P A;  3IXB A;  4KQO A;  4QY6 A;  5EVI B;  3VSL A;  3I7J A;  4U0T A;  1BSG A;  1ZG4 A;  2BLS A;  5DF8 A;  3GSG A;  2Y4A A;  3DW0 A;  3Q81 A;  4Y0O A;  3Q1F A;  4DXB A;  4X55 A;  4DF6 A;  5L2F A;  1W5D A;  3AGF A;  4WZ4 A;  3Q7V B;  2HP9 A;  3A3F A;  4OP8 A;  4LV0 A;  1FCO A;  4HEF A;  1Q2Q A;  3ZG8 B;  5CHU A;  3C7U A;  5J8X A;  5DVA A;  4L0L A;  4OOL A;  4PPR A;  2WK0 A;  2EXB A;  5AQB A;  3VFF A;  2VGK A;  2G2U A;  2H0Y A;  1MY8 A;  1MWS A;  2E8I A;  4LV2 A;  3VSK A;  3LY4 A;  2VGJ A;  4X56 A;  1S6R A;  1WYC A;  2Y2K A;  1E3U D;  5TFQ A;  3V39 A;  1NJ4 A;  5EPH A;  4XXR A;  5HW3 A;  2J9P A;  2WKH A;  1IYQ A;  5E2G A;  2IWB A;  5TR7 A;  2QZ6 A;  2HDU A;  3IWI A;  2DCF A;  3SH8 A;  3PBN A;  1NXY A;  3MBZ A;  2ZC3 B;  1ESI A;  3B3X A;  3W4Q A;  4OPR A;  1JTD A;  1LLB A;  1YLP A;  3C4P A;  3OCL A;  3W4P A;  4BLM A;  5U47 A;  5F83 A;  1ES3 A;  4N1X A;  5DTK A;  2HP6 A;  4BL3 A;  4LEN A;  2RL3 A;  5KZH A;  1XXM A;  1K56 D;  4WBG A;  4JXW A;  3IF5 A;  4OH0 A;  4Z9Q A;  3SS4 A;  5GHY A;  3NDG A;  3SH9 A;  4GD8 A;  4N1H A;  5DF7 A;  5CGW A;  1WE4 A;  1DJB A;  2Y2O A;  4S2J A;  1NRF A;  1RP5 A;  2DRW A;  2XD1 A;  5DTT A;  3HLC A;  4KQR A;  4Y0T A;  1KDS A;  5FSR A;  3FV7 A;  4P6B A;  1S0W A;  4QJG A;  3DWZ A;  4IVI A;  5M19 A;  2V1Z A;  4WMC A;  2Y2Q A;  3HLB A;  4JXG A;  4XUX A;  1VM1 A;  4KZ5 A;  1TDL A;  3AGE A;  4IBX A;  3ZHH A;  3WWX A;  4DE1 A;  4KZ9 A;  5FAP A;  2Y2H A;  3ITA A;  3O86 A;  3UPP A;  3P98 A;  3MKF A;  4JPM A;  2ZD8 A;  4QY5 A;  3IHA A;  3HLF A;  2WZZ A;  1U60 A;  3CMZ A;  1FR6 A;  5GLD A;  2H5S A;  4BD1 A;  1GHM A;  2XQZ A;  3IXD A;  2XLN A;  1K55 C;  1JTG A;  1L2S A;  5FAO A;  3UE1 A;  1NZU A;  1SKF A;  3G30 A;  3UPO A;  4C6Y A;  1HZO A;  4DE0 A;  4JF5 A;  2ZC6 B;  3QNB A;  4KG6 A;  1YLZ A;  4HES A;  3DTM A;  5CXW A;  3C5A A;  3PBO A;  3ZFZ A;  2JE5 A;  4M3K A;  2WUQ A;  1MWR A;  1HVB A;  5DF9 A;  3C7V A;  3A3J A;  3BFD A;  3UE3 A;  3UNW A;  2ZM2 A;  3FZC A;  3HUM A;  4Q8I A;  2V20 A;  3LY3 A;  4JXS A;  4E3O A;  3HLG A;  3IWQ A;  1MWU A;  5CHM A;  4JKT A;  3M6H A;  1FOF A;  4OP5 A;  3N8S A;  1LI0 A;  1KE4 A;  3Q7Z A;  4KZ8 A;  5CGX A;  2OV5 A;  3IT9 A;  2OLV A;  1PIO A;  5EE8 A;  2A3U A;  3OC2 A;  4K0W A;  5KSH A;  5JYP A;  3PBR A;  2RCX A;  2UWX A;  1BT5 A;  3Q07 A;  3NBL A;  4A5R A;  2J7V A;  3N6I A;  4P85 A;  3PBQ A;  3VOZ A;  3M2K A;  4R4S A;  4S2P A;  3UO9 A;  2HDR A;  3BEC A;  2A49 A;  1N4O A;  1ZC2 A;  3LEZ A;  1PYY A;  2JC7 A;  4X53 A;  4LV1 A;  5CHJ A;  4OLG A;  5F1G A;  1ERM A;  1YQS A;  1ES4 A;  5A91 A;  3ITB A;  3N8R A;  2ZQ7 A;  1IYS A;  4N92 A;  4U3T A;  4DXC A;  4GDN A;  5CED A;  1M6K A;  3N7W A;  1FR1 A;  3WS2 A;  4MBF A;  3MZD A;  4PMA A;  3MKE A;  3VOY A;  1WYB A;  1LI9 A;  4U0X A;  2XFS A;  1JWP A;  5FQK A;  5JYO A;  1PZP A;  5M1A A;  2EFU A;  5E2F A;  4UHU A;  4GZB A;  1IEM A;  4WEJ A;  5FQJ A;  4N9L A;  4GN2 A;  1DY6 A;  1L0D A;  5DTS A;  5HFO A;  1ZKJ A;  4R0Q A;  3NDE A;  1O7E A;  4FH4 A;  4OPY A;  5FAQ A;  1GCE A;  3CJM A;  3G2Z A;  4MBH A;  1I2W A;  1E25 A;  1RGY A;  1K57 A;  1YMX A;  3NCK A;  4S2I A;  1G6A A;  1ONH A;  5EOO A;  5HAR A;  4EQI A;  2ZMA A;  5CEB A;  3SH7 A;  2Y2M A;  2EX9 A; 
#chains in the Genus database with same CATH topology
 1H8Y A;  4IBR A;  5C5K A;  5F6A A;  3UB7 A;  1XJ3 A;  4GS9 B;  3IS2 A;  1N9B A;  1MPL A;  2QKP A;  1I5Q A;  3T50 A;  4MBK A;  3ZCZ A;  4JLF A;  3IWO A;  2WAD A;  2VZW A;  2HDQ A;  4Y3I A;  3N8L A;  2J3T D;  4KQQ A;  4KEN B;  2MJ6 A;  4X1M A;  4BQM A;  2P9V A;  1W7F A;  3LIB A;  3V5M A;  4DJ3 A;  1NYM A;  1S67 L;  2Y2G A;  1IYO A;  2FFF B;  2ZC7 A;  3EEA A;  1XFN A;  4YIN A;  2XRO A;  1JWZ A;  4KZB A;  1K38 A;  2GX5 A;  4Q0I A;  5GLB A;  2ZBB A;  2AVX A;  5GLA A;  3L7H A;  1FCN A;  1LSV A;  3E4Q A;  3Q82 A;  4KZ4 A;  4LPZ A;  2J8Y A;  1D06 A;  2WZX A;  2DNS A;  1FCM A;  3MQQ A;  1OJG A;  1PZO A;  3A3D A;  1KOU A;  2QYB A;  4LFU A;  4MN6 A;  1RGZ A;  4XT2 A;  1IKI A;  3KSI A;  1ZG6 A;  5HAP A;  2QJ7 A;  4G3K A;  1YM1 A;  5DFX A;  1GHP A;  3QHY A;  4DE2 A;  2Y2L A;  1GSV A;  4OQI A;  4NXE A;  2I72 A;  4NXB A;  3F1N B;  3G32 A;  3UE0 A;  3CPT B;  3QP8 A;  3OZH A;  3CUE A;  2M7U A;  3WS0 A;  3C8C A;  3C4O A;  4YFM A;  4ARZ B;  4QHC A;  1XA7 A;  4L9E A;  2JN7 A;  4WLA A;  2PDR A;  3CZD A;  4S2N A;  2VEA A;  3OPL A;  4KZ6 A;  1C3B A;  3ZVT A;  3IXH A;  2VGL S;  1YLW A;  4HI4 A;  3W4O A;  4HBU A;  2ZQ8 A;  1XA1 A;  5FQM A;  3ZG0 A;  3PYP A;  5HWV A;  1YMS A;  4QD4 A;  4LV3 A;  4DJ2 A;  2Y2N A;  1L0G A;  3V67 A;  1EW0 A;  1V9Y A;  3A3I A;  4FCF A;  4F3L B;  2ACG A;  3B33 A;  4GNU A;  3BLM A;  3CIT A;  1GSW A;  2XDM A;  3G34 A;  3FWL A;  4FSF A;  2H28 A;  4K0X A;  4C75 A;  4UQI M;  2YKH A;  4Z1W A;  3VP4 A;  1PFL A;  4RQ9 A;  4RVA A;  2IWC A;  3IF6 B;  4L9F A;  2JKF A;  2LB9 A;  3NOU C;  2VGL M;  2WKE A;  3LYX A;  3G6O A;  4GB7 A;  1KE3 A;  1GHI A;  2O99 A;  4QB8 A;  1KGG A;  1SDE A;  1XGJ A;  2YKF A;  4P6Z S;  3D72 A;  5FI7 A;  3WS4 A;  3ZG9 B;  3IX4 A;  5HPI A;  5HD5 A;  4EEP A;  1LHY A;  3ZG7 B;  1TDG A;  3VP1 A;  3BQA A;  1ALQ A;  1XX2 A;  3EQU A;  3LR4 A;  1YLJ A;  4EWF A;  2Y2I A;  5EVI A;  2I9V A;  1W8Q A;  1L0E A;  1JVJ A;  3IH9 A;  3FYZ A;  5LBR A;  4CLC A;  2NUP C;  2EWW A;  1BUL A;  4B88 A;  1PWC A;  1GA9 A;  4WEL A;  1SCW A;  1O07 A;  3GRJ A;  3OLO A;  5AVF A;  1ESU A;  4OQH A;  4EUZ A;  4BD0 A;  1GSX A;  1DP9 A;  4EUV A;  4BBV A;  3VP2 A;  5J7E A;  1EI5 A;  4KG5 A;  1NLZ A;  3PR6 A;  1H8M A;  4P6Z M;  3AGD A;  3H7W B;  5J4E A;  2GDN A;  3C2W A;  1XPB A;  4S2M A;  4KQO A;  3VSL A;  3ZYT A;  3Q81 A;  4DXB A;  3LGO A;  1W5D A;  4OP8 A;  4LV0 A;  3ZG8 B;  5J8X A;  5DVA A;  4OOL A;  3CLO A;  2EXB A;  3IX8 A;  2H0Y A;  3VSK A;  1Y28 A;  3H82 B;  2OWJ A;  5EPH A;  2V1A A;  1F2K A;  2QZ6 A;  4HH3 A;  4X25 A;  2DCF A;  3SH8 A;  2VX8 A;  2DMW A;  2ZC3 B;  3R7W A;  1LLB A;  3W4P A;  2J3T C;  4N1X A;  5DTK A;  2RL3 A;  1K56 D;  3IF5 A;  2VV8 A;  3NDG A;  4JGR A;  2WKQ A;  1NRF A;  2DRW A;  2XD1 A;  5DTT A;  3K2N A;  1N9O A;  3DBA A;  4Y0T A;  1D1J A;  3LR5 A;  3FV7 A;  1S0W A;  2V1Z A;  4WMC A;  4NXG A;  3HLB A;  2V1B A;  1VM1 A;  4IBX A;  4LRY C;  3HJK A;  3IX3 A;  3O86 A;  4QY5 A;  3HLF A;  1FR6 A;  2JKG A;  1GHM A;  2XLN A;  1JTG A;  3LUQ A;  1VHM A;  4KUO A;  1HZO A;  3P01 A;  4JF5 A;  4KG6 A;  1YLZ A;  4HES A;  4EXO A;  3DTI A;  3PBO A;  3EWK A;  1A0K A;  3LI8 A;  3FZC A;  2BAS A;  4JXS A;  3IWQ A;  1MWU A;  1UGU A;  3MSH A;  5IT5 A;  3Q7Z A;  4KZ8 A;  2J3W A;  3IT9 A;  5EE8 A;  3OC2 A;  4K0W A;  4II7 A;  1BT5 A;  4A5R A;  5FEF A;  5HD3 A;  3F1O B;  3PBQ A;  3M2K A;  5EV0 A;  3ULF A;  1ZC2 A;  3LEZ A;  4LGW A;  3BWL A;  2XA7 S;  4R3A A;  4OLG A;  1ERM A;  5A91 A;  2ZQ7 A;  3RFB A;  4U3T A;  4GDN A;  4EER A;  1M6K A;  3N7W A;  4E04 A;  3C30 A;  3WS2 A;  4PMA A;  3MKE A;  1WYB A;  1OTD A;  2A24 B;  4BBU A;  5F68 A;  4IHQ A;  1ZKJ A;  1YMX A;  1G6A A;  5EOO A;  2ZOH A;  5CEB A;  2EX9 A;  2X02 A;  3E0Y A;  5DJU A;  3QP1 A;  4S2L A;  2PR5 A;  5E2H A;  5HZH A;  3O87 A;  5M18 A;  2K7S A;  2VV7 A;  5GL9 A;  1IKG A;  3UB6 A;  1J9M A;  3E98 A;  4EEU A;  3BFE A;  5A92 A;  2XA7 M;  2L0W A;  3MXR A;  1KE0 A;  1DJC A;  1FSY A;  2W1R A;  2PYR A;  1DJA A;  4I5S A;  1H5X A;  4B4X A;  4OQG A;  2VK3 A;  3SZT A;  2W3E A;  3GVB A;  4M4X A;  1K6R A;  5FA7 A;  3G35 A;  3A0S A;  5I94 A;  1FSW A;  4KZ3 A;  3WS1 A;  1BYW A;  5HDC A;  2ZMV A;  4E3N A;  1VET A;  1G6O A;  4PM8 A;  5I5L A;  3ZQ5 A;  4WUJ A;  4WYY A;  1IEL A;  2GJ3 A;  3CHW P;  2H0T A;  5IHV A;  3BY9 A;  3DTE A;  3MZF A;  1YSQ A;  4K91 A;  3CI6 A;  3ZGA B;  4QWO A;  1E3U A;  3UDF A;  2HPB A;  3WRT A;  2Z2L B;  2QMI A;  4ZBE A;  1FIL A;  4CQH A;  3D9Y A;  3G4P A;  2WGW A;  2EX6 A;  5CTM A;  2IWD A;  2P9V B;  2W27 A;  2O0Y A;  4MLL A;  1HLU P;  3IF6 C;  3SS5 A;  1IYP A;  4WEK A;  4BMW A;  3M2J A;  3RJU A;  3IH8 A;  4G3V A;  4ZJ1 A;  3VE3 A;  3EEH A;  5CGS A;  2WAF A;  1PI4 A;  4P87 A;  5J3W A;  4B9O A;  4EU0 A;  4G3W A;  2INW A;  1FQG A;  4GDB A;  4ZAM A;  5HL1 A;  3ZNY A;  4KQD A;  4B93 A;  4FUW A;  3MMH A;  2VKS A;  5L09 A;  4UAA A;  1BLP A;  2L1M A;  4IED A;  3BEB A;  2IA2 A;  3IHB A;  1NYY A;  3RXW A;  3ZDJ A;  4E3M A;  3MFD A;  1F5M A;  4WZ5 A;  1LL9 A;  3GMW A;  2Q9N A;  1K54 C;  3P09 A;  4XT2 B;  3E2K A;  1X0O A;  1MWT A;  4GKU A;  1G68 A;  3SW1 A;  5IS1 A;  1S1Z A;  3S1Y A;  3KO6 A;  2WKR A;  3EGD C;  3EQV A;  1PI5 A;  1H3Q A;  1IFQ A;  2W1T A;  2XR0 A;  4DRT A;  5TBM A;  5F5Y A;  3NC8 A;  2QHK A;  4C3Q A;  3NJA A;  1T18 A;  1PWG A;  1YLT A;  4IUK A;  4LCM A;  4PKY G;  2ZL1 A;  4R23 A;  4EET B;  4X68 A;  1YLY A;  3IBR A;  1KDW A;  2XF3 A;  5FI2 A;  3HVF A;  3VV4 A;  4ETZ A;  2P74 A;  1RCJ A;  2FZ0 A;  5GHZ A;  4X69 A;  3ISG A;  4RX2 A;  3ICY A;  2C5W B;  4YWZ A;  1OME A;  5FAS A;  3BYD A;  2FFY A;  3T1X A;  2O9A A;  4OPZ A;  3F1P A;  4WL9 A;  4GW9 A;  5F82 A;  1H0M A;  3FKW A;  3LCE A;  3E4O A;  1CJF A;  2VA0 A;  2XEP A;  3VFH A;  2EWV A;  3MXS A;  4OQ0 A;  3H9W A;  3P7N A;  3Q7V A;  2X01 A;  1K25 A;  4JF6 A;  3ZVW A;  4OON A;  4KZA A;  3TW8 A;  2EFX A;  2XFT A;  1Q2P A;  1KVM A;  3UDI A;  4OOM A;  3CG5 A;  2ZC4 B;  5EM1 A;  1MKI A;  3HRE A;  4MN7 A;  4DKI A;  1MBL A;  3M6B A;  1OT9 A;  4NKP A;  4ID4 A;  2Y2J A;  4UQI S;  1BLC A;  2OLU A;  4GOG A;  3S7N A;  4GHI A;  3LEQ A;  4Y13 A;  1KGE A;  2K2N A;  4FD8 A;  2Y2P A;  3IXB A;  5EVI B;  2OV5 A;  2BLS A;  5DF8 A;  3UB9 A;  3GSG A;  2Y79 A;  4X55 A;  4DF6 A;  4CLC B;  4HEF A;  1S4S A;  4MN5 A;  4IUH A;  1P9R A;  2VGK A;  1MY8 A;  1MWS A;  2M7V A;  3LY4 A;  2VGJ A;  1S6R A;  1WYC A;  3V39 A;  1NJ4 A;  2PD8 A;  2WKH A;  5E2G A;  5TR7 A;  4YOF A;  3PBN A;  4WN5 A;  1TS7 A;  5U47 A;  5F83 A;  2HP6 A;  4BL3 A;  1XXM A;  4Z9Q A;  3MQO A;  2Q0O A;  1S4R A;  4R38 A;  4O0P A;  3R4K A;  1WE4 A;  2W3H A;  4S2J A;  3MQ0 A;  3S7O A;  1KDS A;  2VV6 A;  3HJI A;  2Y2Q A;  1SZV A;  4KZ5 A;  1TDL A;  3WWX A;  2Y2H A;  1DP8 A;  5L07 A;  4JPM A;  2WZZ A;  1U60 A;  4I3J A;  3OOV A;  5HSQ A;  3UE1 A;  1W63 M;  1DRM A;  3K3C A;  3R7W B;  4HOI A;  3ZFZ A;  4M3K A;  4PHT A;  1MWR A;  1HVB A;  3UE3 A;  3C7V A;  3A3J A;  3BFD A;  2V20 A;  3LY3 A;  3DAV A;  4MCW A;  5CHM A;  4JKT A;  1FOF A;  4OP5 A;  1LI0 A;  2A3U A;  5KSH A;  3PBR A;  2RCX A;  2W3F A;  1YSP A;  4K08 A;  2HJE A;  3MS6 A;  4NEE D;  1N4O A;  4H6J B;  1PYY A;  4LRX C;  1P97 A;  3MF0 A;  3IBJ A;  3N8R A;  3B42 A;  1FR1 A;  5EM0 A;  3MZD A;  4HP4 A;  1JWP A;  5IU1 A;  3KX0 X;  1PZP A;  5M1A A;  4N9L A;  3LR3 A;  1L0D A;  5DTS A;  4FH4 A;  5FAQ A;  3G2Z A;  1E25 A;  5HAR A;  4Y2F A;  2Y2M A;  3NOP C;  5F1F A;  4P0M A;  4XUZ A;  4ME4 A;  2X71 A;  4JGQ A;  3D3O A;  5A90 A;  4S2O A;  3LIE A;  4GD6 A;  1OPX A;  3V50 A;  3QP5 A;  2D01 A;  2PD7 A;  3PHY A;  4LLO B;  2GNX A;  2ZJ9 A;  3QP2 A;  3PXP A;  3RXX A;  5DJT A;  4PM5 A;  1CEG A;  1LL5 A;  2E8J A;  3O5Y A;  1VQQ A;  4HHD A;  1K6S A;  1LL8 A;  1SHV A;  3VMA A;  3BFG A;  3BFC A;  2Y55 A;  2PRF A;  1VEU A;  4E3L A;  4R4R A;  3VOL A;  5D3O A;  4HBT A;  3FC7 A;  1ERO A;  3CUE C;  4BBT A;  1G5U A;  3TG9 A;  5AQ9 A;  2R9X A;  3TJZ C;  4HJ4 A;  4PKY A;  2OAQ 1;  2PU4 A;  4D2O A;  2JKR I;  1T1B A;  2R78 A;  1P0Z A;  3PAE A;  4QU3 A;  2JKT I;  3QNC A;  4RYE A;  1K56 A;  3MR0 A;  5FI6 A;  3BLS A;  5KIZ A;  3DWK A;  1VET B;  1BLS A;  3JYI A;  1CI8 A;  2EA9 A;  2JCH A;  1ACF A;  3A0R A;  4HQA A;  3HLW A;  4ZJ2 A;  5FQI A;  4JBF A;  5EEC A;  2XGN A;  2OSU A;  3UPN A;  1SKO A;  2QJ5 A;  3H82 A;  1TVF A;  2LB5 A;  4HIA A;  4CJN A;  4NXF A;  2WGV A;  2JHE A;  4HJ3 A;  1N9L A;  4JGP A;  2ZM8 A;  2WAE A;  3T4L A;  1PW1 A;  5BOH A;  1SDN A;  4CLC E;  4Y0U A;  3S4X A;  2UV0 E;  2Y59 A;  5KMW A;  1ODV A;  3PBT A;  5EOE A;  2P04 A;  1ES2 A;  5G4Z A;  4DDS A;  3T4O A;  4LCL A;  3V3S A;  2XH9 A;  2P7J A;  4KG2 A;  4WM9 A;  2V2F F;  2WKI A;  1PRQ A;  3VP3 A;  2WKP A;  1T1C A;  3NEC A;  1OTE A;  4E6X A;  2WGI A;  1K4E A;  1YKD A;  1ERQ A;  1T19 A;  4ESP A;  4PM9 A;  4RA7 A;  3W2Z A;  1HD8 A;  4X6T A;  3FKV A;  1E4D A;  1CI9 A;  5EVI C;  2PU2 A;  3BM6 A;  4ZJ3 A;  3T4J A;  4R3B A;  4UA7 A;  4N9K A;  5HWT A;  2VJW A;  5E2E A;  3PAG A;  3WRZ A;  3IS2 B;  4D60 A;  4EQ1 A;  3T1Q B;  4RX3 A;  1XJ2 A;  1EWZ A;  2BG1 A;  3MZE A;  4DN0 A;  2JKR M;  4OOY A;  3ZNT A;  1Z09 A;  3TOI A;  1QME A;  2JKT M;  2B5R A;  1H8Z A;  4JF4 A;  2W1T B;  3FPV A;  5CRF A;  3NI9 A;  3N4I A;  5EFW A;  5TBM B;  5FQQ A;  4YNR A;  2CC1 A;  3HLD A;  2O9C A;  3GTC A;  2PAV P;  2J9O A;  2Y91 A;  2H10 A;  1LT0 A;  5EUA A;  5CER A;  4R1G A;  4HJ6 A;  2C6W B;  3BQ8 A;  2ZL1 B;  3ZG5 A;  1CF0 A;  5TGF A;  2HZ5 A;  2CMN A;  3MFX A;  4MEZ A;  1NZO A;  4PM6 A;  3D4F A;  5MC7 A;  5HAQ A;  4PM7 A;  3PTE A;  4OVD A;  2HDS A;  4OKP A;  2W0N A;  3G2Y A;  3TSG A;  5EVL A;  2Z6D A;  3QP6 A;  3TRC A;  4BL2 A;  4E3K A;  3F1P B;  2HJ9 C;  5CTN A;  3O3V A;  2NUT C;  4FOF A;  3RTY A;  1KGF A;  4UA6 A;  4QY6 A;  3I7J A;  4U0T A;  1BSG A;  1ZG4 A;  3DW0 A;  3KSG A;  3AGF A;  4WZ4 A;  3Q7V B;  3A3F A;  5CHU A;  3C7U A;  4PPR A;  2WK0 A;  3MJQ A;  5AQB A;  3VFF A;  4X56 A;  5FEG A;  2Y2K A;  1XFQ A;  5HW3 A;  2J9P A;  1IYQ A;  2IWB A;  2HDU A;  2PT7 A;  3IWI A;  1NXY A;  2A2L A;  4HH2 A;  3W4Q A;  4OPR A;  1JTD A;  3C4P A;  4BLM A;  1ES3 A;  4GHI B;  3LFV A;  5KZH A;  3LIF A;  4WBG A;  4JXW A;  3SS4 A;  4I39 A;  3SH9 A;  1F98 A;  3T4Q A;  4GD8 A;  2O9B A;  2W3G A;  1DJB A;  5L8M A;  2Y2O A;  4KQR A;  4HP9 A;  5FSR A;  3DWZ A;  4IVI A;  5M19 A;  4XUX A;  1W63 Q;  3CWF A;  3A0V A;  1MKM A;  4KZ9 A;  5FAP A;  1MC0 A;  2PHY A;  3UPP A;  3MKF A;  2ZD8 A;  3CMZ A;  1OJ5 A;  3E4P A;  5GLD A;  2OAP 1;  2H5S A;  4BD1 A;  3T1S A;  1NLY A;  1K55 C;  5FAO A;  1SKF A;  3G30 A;  3UPO A;  1TS6 A;  2KLI A;  3DTM A;  5CXW A;  3FPW A;  3T1R A;  3C5A A;  1OTI A;  2JE5 A;  2WUQ A;  3UNW A;  2ZM2 A;  3UE6 A;  3HUM A;  3GEC A;  4Q8I A;  4E3O A;  2M1C A;  3DTK A;  3N8S A;  1KE4 A;  3OBF A;  3C38 A;  4PAU A;  2UWX A;  3NBL A;  3N6I A;  4GS9 A;  3VOZ A;  4S2P A;  3UO9 A;  2A49 A;  2K31 A;  3BY8 A;  2FH5 A;  3JVU A;  2JC7 A;  4X53 A;  1YQS A;  4UEY A;  3BJN A;  3VE4 A;  1IYS A;  4DXC A;  1YAX A;  4MBF A;  4KUK A;  5HDS A;  2KOI A;  1V9Z A;  5JYO A;  4R6L A;  5DKL A;  2EFU A;  5E2F A;  4UHU A;  4GZB A;  1IEM A;  4WEJ A;  5FQJ A;  1L3L A;  4R0Q A;  2B02 A;  1O7E A;  4OPY A;  4MBH A;  1XJ4 A;  1I2W A;  4S2I A;  3NHQ A;  3SH7 A;  4DMZ A;  4MDZ A;  1D7E A;  3E2L A;  4O01 A;  3HUN A;  4IJG A;  1Y54 A;  1HTZ A;  4Y5F A;  3O88 A;  3L9K A;  3UN7 A;  3T4T A;  4EBN A;  4MNR A;  5G4Y A;  1NY0 A;  3A3E A;  2G7U A;  1LSX A;  1BZA A;  5EVI D;  3UB8 A;  2ZM0 A;  4H8R A;  4GLQ A;  4CPK A;  4CLC D;  4R70 A;  1FIK A;  1YT4 A;  1MZU A;  3NIA A;  3HBR A;  1G28 A;  3KYE A;  1J3W A;  2HF6 A;  5CEC A;  3NOT C;  4WF0 A;  4B4Z A;  1Z6F A;  1PW8 A;  3F1N A;  4R3J A;  3SS3 A;  2EX2 A;  2PBY A;  3CPT A;  4FH2 A;  4KZ7 A;  3LIC A;  4E3I A;  3MXQ A;  4ARZ A;  1KVL A;  5GLC A;  1ES5 A;  3FG8 A;  3PBS A;  3IQA A;  4NET A;  4E3J A;  3LO7 A;  1CK3 A;  3S22 A;  4Q0H A;  3VP0 A;  4HNB A;  4EV4 A;  4WZ5 C;  1K57 C;  4LRZ E;  2KX6 A;  4ZRR A;  1LSW A;  5G18 A;  1OT6 A;  5FAT A;  1XGI A;  3HUO A;  3GDI A;  4JXV A;  2QPN A;  4F3L A;  1TEM A;  1VEU B;  2Z6C A;  3OPH A;  1XP4 A;  2OWH A;  3GQZ A;  2PYP A;  2Q9M A;  4Y7P A;  3HL9 A;  5AQA A;  2Z2M B;  4EBP A;  5A8B A;  1ZTU A;  5L10 A;  1TS0 A;  1W8Y A;  4DDY A;  2XSS A;  2ZMF A;  3W8K A;  3GV9 A;  3SOI A;  2JBF A;  1L0F A;  2R9W A;  1N9N A;  1ONG A;  5EVE A;  2EXA A;  3TE8 A;  3IF6 A;  4OPQ A;  1K4F A;  2XD5 A;  4WMC D;  2G2W A;  1OTA A;  4S2K A;  1BLH A;  5HL6 A;  2B95 A;  2HGV A;  1M40 A;  3OCN A;  5A93 A;  3BRM A;  2ZQ9 A;  4NK3 A;  3OPR A;  1PWD A;  1SKO B;  3JVV A;  4ZTK A;  1WA9 A;  2ZQA A;  3UB5 P;  5HX9 A;  3LI9 A;  1BTL A;  5HAI A;  2V0W A;  2WYX A;  1TD5 A;  4ZDX A;  3G31 A;  5AQ7 A;  4I3I A;  4BJP A;  3WS5 A;  3BFF A;  4I38 A;  5KSC A;  1I2S A;  3KSH A;  1K54 A;  3HLE A;  2ZQC A;  2V0U A;  1QMF A;  1UWN X;  2ZLY A;  3BW6 A;  2ZQD A;  2ZC5 B;  1NRJ A;  1MXO A;  5HDD A;  2HP5 A;  5FQ9 A;  3OPP A;  4IVK A;  3KYQ A;  2XK1 A;  4BEN A;  1W79 A;  4HY8 A;  4H6J A;  1AXB A;  1JNU A;  3H7W A;  4DE3 A;  1IOU A;  4S2N C;  4NG2 A;  1CEF A;  4E6W A;  3UY6 A;  1TS8 A;  4BWI A;  1TF1 A;  2GZA A;  3U4L P;  3IXG A;  1GA0 A;  3RH8 B;  3V3R A;  2PBD P;  1AWI A;  4I3A A;  5E43 A;  3NY4 A;  3GR2 A;  4EBL A;  5GHX A;  1NWZ A;  3UDX A;  4O7D A;  3B47 A;  5F69 A;  1UWP X;  2J80 A;  1BUE A;  4OLD A;  5FDH A;  1S66 L;  1JWV A;  1K55 A;  4UA9 A;  1XKZ A;  2VLG A;  2WGW B;  4MMN A;  5HWW A;  2EX8 A;  3CAX A;  3S7P A;  2Y4A A;  4Y0O A;  3Q1F A;  2XRN A;  5L2F A;  2HP9 A;  1FCO A;  1Q2Q A;  4EES A;  1DP6 A;  4L0L A;  5TJJ A;  4LV2 A;  2G2U A;  2OOL A;  2QWS A;  2E8I A;  5FL3 A;  1E3U D;  5TFQ A;  1Y4O A;  4XXR A;  2W3D A;  1XJ6 A;  3MBZ A;  1ESI A;  3B3X A;  4GCZ A;  1YLP A;  3OCL A;  1S1Y A;  4LEN A;  2KDK A;  5CX7 A;  1VB6 A;  1F9I A;  4OH0 A;  5GHY A;  2V8C A;  3LID A;  4N1H A;  5DF7 A;  5CGW A;  4CLC C;  1RP5 A;  4O8G A;  2Y8H A;  3HLC A;  3QP4 A;  5DFY A;  4P6B A;  4QJG A;  4FTX A;  2D02 A;  4JXG A;  3F1O A;  3T4S A;  3JPU A;  3AGE A;  3UMD A;  3ZHH A;  4DE1 A;  3UME A;  3LR0 A;  4GJ4 A;  3ITA A;  3P98 A;  3IHA A;  4X1L A;  2XQZ A;  3IXD A;  2PR6 A;  5AVE A;  1L2S A;  1NZU A;  4C6Y A;  4DE0 A;  2ZC6 B;  3QNB A;  2V9A A;  5AJG A;  1STZ A;  4Y15 A;  5DF9 A;  2V8F A;  3EGX C;  2A24 A;  5DKK A;  4Q0J A;  3HLG A;  3T4K A;  4AFI A;  3M6H A;  1YPR A;  3HCY A;  4ETX A;  5CGX A;  3S7Q A;  2OLV A;  1PIO A;  4QPR A;  4EW7 A;  5JYP A;  3Q07 A;  2ZOI A;  2J7V A;  3K3D A;  3LIA A;  4P85 A;  1K0K A;  2HV1 A;  4R4S A;  2BTF P;  1PNE A;  2HDR A;  3BEC A;  4Y17 A;  1OTB A;  4LV1 A;  5CHJ A;  4JGO A;  5F1G A;  5HPF A;  1ES4 A;  3ITB A;  3T12 B;  1CQA A;  4N92 A;  5CED A;  2L4R A;  3VOY A;  3KSF A;  3KYZ A;  1LI9 A;  4U0X A;  2B18 A;  2XFS A;  5K5B A;  5FQK A;  1ZHH B;  4L9G A;  1T1A A;  4GN2 A;  1DY6 A;  5FDS A;  5HFO A;  3U2A A;  3NDE A;  1GCE A;  3CJM A;  3EOI A;  3NUL A;  1P9W A;  1RGY A;  1K57 A;  3NCK A;  1ONH A;  4EQI A;  2ZMA A;  2P08 A;  4F94 A; 
#chains in the Genus database with same CATH homology
 2X02 A;  1H8Y A;  4IBR A;  4S2L A;  3E2L A;  5E2H A;  3HUN A;  3O87 A;  5M18 A;  1N9B A;  1Y54 A;  1MPL A;  1HTZ A;  4P0M A;  5F1F A;  1I5Q A;  3O88 A;  5GL9 A;  1IKG A;  4XUZ A;  4MBK A;  2X71 A;  1J9M A;  3UN7 A;  3ZCZ A;  4EBN A;  4JLF A;  5A90 A;  3IWO A;  4S2O A;  2WAD A;  4MNR A;  3BFE A;  4GD6 A;  5A92 A;  1NY0 A;  3A3E A;  2HDQ A;  3MXR A;  3V50 A;  3N8L A;  1KE0 A;  4KQQ A;  1BZA A;  4KEN B;  1DJC A;  1FSY A;  5EVI D;  1DJA A;  2ZM0 A;  4H8R A;  1H5X A;  4B4X A;  4OQG A;  4BQM A;  2ZJ9 A;  4CPK A;  2P9V A;  3GVB A;  1K6R A;  5FA7 A;  3G35 A;  5I94 A;  1FSW A;  4KZ3 A;  3WS1 A;  1W7F A;  3RXX A;  3V5M A;  1YT4 A;  1NYM A;  3NIA A;  4E3N A;  4PM5 A;  1CEG A;  2Y2G A;  1IYO A;  1LL5 A;  2FFF B;  1VQQ A;  2ZC7 A;  1K6S A;  1SHV A;  3HBR A;  4PM8 A;  4YIN A;  3VMA A;  3BFG A;  5CEC A;  3BFC A;  4WYY A;  1IEL A;  1JWZ A;  4KZB A;  2Y55 A;  1K38 A;  4B4Z A;  1Z6F A;  1PW8 A;  2H0T A;  4R3J A;  5IHV A;  5GLB A;  3SS3 A;  2EX2 A;  2PBY A;  3MZF A;  4E3L A;  4R4R A;  5GLA A;  5D3O A;  4HBT A;  4K91 A;  1FCN A;  4FH2 A;  3Q82 A;  1ERO A;  4KZ4 A;  4KZ7 A;  3ZGA B;  3TG9 A;  1E3U A;  5AQ9 A;  3UDF A;  2R9X A;  4E3I A;  2J8Y A;  2WZX A;  2DNS A;  1KVL A;  2HPB A;  5GLC A;  1ES5 A;  3WRT A;  2Z2L B;  1FCM A;  2QMI A;  4ZBE A;  2PU4 A;  4D2O A;  1PZO A;  3PBS A;  3IQA A;  4NET A;  4E3J A;  3A3D A;  3LO7 A;  1CK3 A;  3S22 A;  3PAE A;  4QU3 A;  3G4P A;  2WGW A;  3VP0 A;  2EX6 A;  4EV4 A;  1RGZ A;  2IWD A;  2P9V B;  3QNC A;  1IKI A;  4RYE A;  4WZ5 C;  1K56 A;  4MLL A;  5CTM A;  5FI6 A;  3IF6 C;  1K57 C;  3BLS A;  3SS5 A;  1ZG6 A;  5HAP A;  1IYP A;  3DWK A;  4WEK A;  1YM1 A;  1BLS A;  3M2J A;  3JYI A;  1CI8 A;  3RJU A;  1GHP A;  3QHY A;  2JCH A;  5G18 A;  3IH8 A;  5FAT A;  4DE2 A;  4ZJ1 A;  5CGS A;  3HLW A;  2WAF A;  2Y2L A;  5FQI A;  1PI4 A;  1XGI A;  4JBF A;  4P87 A;  5EEC A;  4ZJ2 A;  2XGN A;  4OQI A;  3HUO A;  2OSU A;  2I72 A;  3UPN A;  4JXV A;  1FQG A;  2QPN A;  4GDB A;  1TEM A;  3G32 A;  4ZAM A;  3UE0 A;  3OPH A;  3ZNY A;  5HL1 A;  1XP4 A;  3OZH A;  3GQZ A;  1TVF A;  2Q9M A;  4Y7P A;  3HL9 A;  4CJN A;  5AQA A;  3WS0 A;  2Z2M B;  4EBP A;  4UAA A;  3C4O A;  4YFM A;  1BLP A;  1W8Y A;  4IED A;  3BEB A;  4DDY A;  4QHC A;  1XA7 A;  2WGV A;  3IHB A;  1NYY A;  3W8K A;  3RXW A;  3GV9 A;  3SOI A;  2ZM8 A;  3ZDJ A;  4E3M A;  2WAE A;  3CZD A;  4S2N A;  2JBF A;  3MFD A;  1L0F A;  2R9W A;  1PW1 A;  5BOH A;  1ONG A;  1SDN A;  3OPL A;  4KZ6 A;  1C3B A;  4WZ5 A;  4Y0U A;  3ZVT A;  1LL9 A;  2EXA A;  2Q9N A;  1K54 C;  3GMW A;  3S4X A;  3IF6 A;  3IXH A;  4OPQ A;  1K4F A;  3P09 A;  2XD5 A;  4WMC D;  1YLW A;  2Y59 A;  5KMW A;  3W4O A;  2G2W A;  3E2K A;  4HBU A;  3PBT A;  2ZQ8 A;  1XA1 A;  4S2K A;  5FQM A;  1BLH A;  3ZG0 A;  5EOE A;  1MWT A;  1ES2 A;  4GKU A;  1YMS A;  1G68 A;  4QD4 A;  4DDS A;  4LV3 A;  1M40 A;  3OCN A;  4LCL A;  2Y2N A;  1L0G A;  3V3S A;  3BRM A;  3S1Y A;  5A93 A;  2ZQ9 A;  4NK3 A;  3OPR A;  1PWD A;  2XH9 A;  4KG2 A;  4WM9 A;  2V2F F;  3A3I A;  3EQV A;  4FCF A;  4ZTK A;  2WKI A;  1PI5 A;  2ZQA A;  3VP3 A;  5HX9 A;  4GNU A;  1BTL A;  3BLM A;  4E6X A;  2WGI A;  1K4E A;  5HAI A;  2XDM A;  2XR0 A;  2WYX A;  1ERQ A;  4ZDX A;  3G34 A;  3G31 A;  4DRT A;  4PM9 A;  5AQ7 A;  3FWL A;  4RA7 A;  4FSF A;  3NC8 A;  4BJP A;  1HD8 A;  3WS5 A;  4X6T A;  3BFF A;  3FKV A;  4K0X A;  4C3Q A;  5KSC A;  1E4D A;  1I2S A;  4C75 A;  1CI9 A;  1PWG A;  5EVI C;  1K54 A;  3HLE A;  2PU2 A;  1YLT A;  3VP4 A;  2ZQC A;  3BM6 A;  1QMF A;  4RVA A;  2IWC A;  2ZLY A;  3IF6 B;  4ZJ3 A;  4LCM A;  2ZQD A;  4R23 A;  2ZC5 B;  4R3B A;  4UA7 A;  4X68 A;  4N9K A;  1YLY A;  2WKE A;  1KDW A;  2XF3 A;  1MXO A;  5FI2 A;  5E2E A;  4GB7 A;  1KE3 A;  1GHI A;  3HVF A;  3PAG A;  2HP5 A;  3WRZ A;  2P74 A;  4QB8 A;  5FQ9 A;  1RCJ A;  3OPP A;  1KGG A;  5GHZ A;  4IVK A;  1SDE A;  4X69 A;  3ISG A;  4RX3 A;  1XGJ A;  1EWZ A;  2BG1 A;  2XK1 A;  3MZE A;  4RX2 A;  4OOY A;  3ZNT A;  4BEN A;  2C5W B;  5FI7 A;  3TOI A;  1W79 A;  1OME A;  1QME A;  3WS4 A;  5FAS A;  3BYD A;  3ZG9 B;  1AXB A;  2FFY A;  2B5R A;  1H8Z A;  4JF4 A;  1LHY A;  3ZG7 B;  4DE3 A;  4OPZ A;  1TDG A;  4S2N C;  5CRF A;  3NI9 A;  5F82 A;  1ALQ A;  1XX2 A;  1CEF A;  3EQU A;  3VP1 A;  3FKW A;  3N4I A;  1YLJ A;  5FQQ A;  4EWF A;  4E6W A;  3LCE A;  3UY6 A;  2Y2I A;  5EVI A;  2XEP A;  1W8Q A;  3VFH A;  2CC1 A;  3HLD A;  1L0E A;  3GTC A;  1JVJ A;  3MXS A;  4OQ0 A;  2J9O A;  3IXG A;  1GA0 A;  3V3R A;  2Y91 A;  3Q7V A;  2H10 A;  3IH9 A;  3FYZ A;  5EUA A;  1K25 A;  4JF6 A;  2X01 A;  5CER A;  4OON A;  4R1G A;  3ZVW A;  2C6W B;  3ZG5 A;  4KZA A;  1BUL A;  4B88 A;  2EFX A;  5E43 A;  5TGF A;  3NY4 A;  1PWC A;  1GA9 A;  3GR2 A;  4WEL A;  4EBL A;  1SCW A;  2XFT A;  4MEZ A;  1O07 A;  1Q2P A;  1KVM A;  1NZO A;  4OOM A;  5GHX A;  3UDI A;  3GRJ A;  1ESU A;  4PM6 A;  4OQH A;  3D4F A;  4EUZ A;  5HAQ A;  4PM7 A;  4BD0 A;  3PTE A;  3UDX A;  3CG5 A;  4O7D A;  2ZC4 B;  1MKI A;  3HRE A;  4OVD A;  4DKI A;  1MBL A;  3M6B A;  3VP2 A;  2HDS A;  4OKP A;  1EI5 A;  4ID4 A;  4KG5 A;  2Y2J A;  1BUE A;  4OLD A;  1BLC A;  2OLU A;  3G2Y A;  5FDH A;  4GOG A;  3AGD A;  3TSG A;  5EVL A;  4BL2 A;  1JWV A;  1K55 A;  4E3K A;  2GDN A;  4UA9 A;  4F94 A;  1XKZ A;  1KGE A;  2WGW B;  5CTN A;  1XPB A;  3O3V A;  1KGF A;  2EX8 A;  4S2M A;  4UA6 A;  4FD8 A;  2Y2P A;  3IXB A;  4KQO A;  4QY6 A;  5EVI B;  3VSL A;  3I7J A;  4U0T A;  1BSG A;  1ZG4 A;  2BLS A;  5DF8 A;  3GSG A;  2Y4A A;  3DW0 A;  3Q81 A;  4Y0O A;  3Q1F A;  4DXB A;  4X55 A;  4DF6 A;  5L2F A;  1W5D A;  3AGF A;  4WZ4 A;  3Q7V B;  2HP9 A;  3A3F A;  4OP8 A;  4LV0 A;  1FCO A;  4HEF A;  1Q2Q A;  3ZG8 B;  5CHU A;  3C7U A;  5J8X A;  5DVA A;  4L0L A;  4OOL A;  4PPR A;  2WK0 A;  2EXB A;  5AQB A;  3VFF A;  2VGK A;  2G2U A;  2H0Y A;  1MY8 A;  1MWS A;  2E8I A;  4LV2 A;  3VSK A;  3LY4 A;  2VGJ A;  4X56 A;  1S6R A;  1WYC A;  2Y2K A;  1E3U D;  5TFQ A;  3V39 A;  1NJ4 A;  5EPH A;  4XXR A;  5HW3 A;  2J9P A;  2WKH A;  1IYQ A;  5E2G A;  2IWB A;  5TR7 A;  2QZ6 A;  2HDU A;  3IWI A;  2DCF A;  3SH8 A;  3PBN A;  1NXY A;  3MBZ A;  2ZC3 B;  1ESI A;  3B3X A;  3W4Q A;  4OPR A;  1JTD A;  1LLB A;  1YLP A;  3C4P A;  3OCL A;  3W4P A;  4BLM A;  5U47 A;  5F83 A;  1ES3 A;  4N1X A;  5DTK A;  2HP6 A;  4BL3 A;  4LEN A;  2RL3 A;  5KZH A;  1XXM A;  1K56 D;  4WBG A;  4JXW A;  3IF5 A;  4OH0 A;  4Z9Q A;  3SS4 A;  5GHY A;  3NDG A;  3SH9 A;  4GD8 A;  4N1H A;  5DF7 A;  5CGW A;  1WE4 A;  1DJB A;  2Y2O A;  4S2J A;  1NRF A;  1RP5 A;  2DRW A;  2XD1 A;  5DTT A;  3HLC A;  4KQR A;  4Y0T A;  1KDS A;  5FSR A;  3FV7 A;  4P6B A;  1S0W A;  4QJG A;  3DWZ A;  4IVI A;  5M19 A;  2V1Z A;  4WMC A;  2Y2Q A;  3HLB A;  4JXG A;  4XUX A;  1VM1 A;  4KZ5 A;  1TDL A;  3AGE A;  4IBX A;  3ZHH A;  3WWX A;  4DE1 A;  4KZ9 A;  5FAP A;  2Y2H A;  3ITA A;  3O86 A;  3UPP A;  3P98 A;  3MKF A;  4JPM A;  2ZD8 A;  4QY5 A;  3IHA A;  3HLF A;  2WZZ A;  1U60 A;  3CMZ A;  1FR6 A;  5GLD A;  2H5S A;  4BD1 A;  1GHM A;  2XQZ A;  3IXD A;  2XLN A;  1K55 C;  1JTG A;  1L2S A;  5FAO A;  3UE1 A;  1NZU A;  1SKF A;  3G30 A;  3UPO A;  4C6Y A;  1HZO A;  4DE0 A;  4JF5 A;  2ZC6 B;  3QNB A;  4KG6 A;  1YLZ A;  4HES A;  3DTM A;  5CXW A;  3C5A A;  3PBO A;  3ZFZ A;  2JE5 A;  4M3K A;  2WUQ A;  1MWR A;  1HVB A;  5DF9 A;  3C7V A;  3A3J A;  3BFD A;  3UE3 A;  3UNW A;  2ZM2 A;  3FZC A;  3HUM A;  4Q8I A;  2V20 A;  3LY3 A;  4JXS A;  4E3O A;  3HLG A;  3IWQ A;  1MWU A;  5CHM A;  4JKT A;  3M6H A;  1FOF A;  4OP5 A;  3N8S A;  1LI0 A;  1KE4 A;  3Q7Z A;  4KZ8 A;  5CGX A;  2OV5 A;  3IT9 A;  2OLV A;  1PIO A;  5EE8 A;  2A3U A;  3OC2 A;  4K0W A;  5KSH A;  5JYP A;  3PBR A;  2RCX A;  2UWX A;  1BT5 A;  3Q07 A;  3NBL A;  4A5R A;  2J7V A;  3N6I A;  4P85 A;  3PBQ A;  3VOZ A;  3M2K A;  4R4S A;  4S2P A;  3UO9 A;  2HDR A;  3BEC A;  2A49 A;  1N4O A;  1ZC2 A;  3LEZ A;  1PYY A;  2JC7 A;  4X53 A;  4LV1 A;  5CHJ A;  4OLG A;  5F1G A;  1ERM A;  1YQS A;  1ES4 A;  5A91 A;  3ITB A;  3N8R A;  2ZQ7 A;  1IYS A;  4N92 A;  4U3T A;  4DXC A;  4GDN A;  5CED A;  1M6K A;  3N7W A;  1FR1 A;  3WS2 A;  4MBF A;  3MZD A;  4PMA A;  3MKE A;  3VOY A;  1WYB A;  1LI9 A;  4U0X A;  2XFS A;  1JWP A;  5FQK A;  5JYO A;  1PZP A;  5M1A A;  2EFU A;  5E2F A;  4UHU A;  4GZB A;  1IEM A;  4WEJ A;  5FQJ A;  4N9L A;  4GN2 A;  1DY6 A;  1L0D A;  5DTS A;  5HFO A;  1ZKJ A;  4R0Q A;  3NDE A;  1O7E A;  4FH4 A;  4OPY A;  5FAQ A;  1GCE A;  3CJM A;  3G2Z A;  4MBH A;  1I2W A;  1E25 A;  1RGY A;  1K57 A;  1YMX A;  3NCK A;  4S2I A;  1G6A A;  1ONH A;  5EOO A;  5HAR A;  4EQI A;  2ZMA A;  5CEB A;  3SH7 A;  2Y2M A;  2EX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...