2ZQ7A

Apo structure of class a beta-lactamase toho-1 e166a/r274n/r276n triple mutant
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase Toho-1
publication title Improvement of the Crystal Quality by the Surface Mutations on a Beta-Lactamase Toho-1
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 96
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2zq7A00
2H0YA 3N4IA 1L0FA 2R9WA 2J9OA 4OQHA 3PBNA 5FATA 4H8RA 2VGJA 5E43A 3Q7VA 1EROA 4DXCA 4Y0OA 5G18A 2WKEA 3AGEA 5FA7A 1K55C 4BQMA 3UDIA 1PI5A 3M2KA 3FKVA 1L2SA 3CZDA 3HLWA 4UA6A 4PM5A 1N4OA 2XH9A 1RGYA 1PW1A 4IVIA 4S2OA 1MWRA 4P0MA 4DKIA 2XR0A 4JXSA 2OV5A 4RYEA 3PBSA 4LV3A 4BLMA 1KVLA 2ZC3B 4XUXA 5L2FA 1GCEA 5E2GA 5HAPA 5GHYA 4B4XA 2XD5A 3O3VA 4N9KA 5CHMA 2Y4AA 4YFMA 3ZVWA 1JVJA 3SH7A 4MEZA 2Y2LA 3TOIA 2A49A 1ZG4A 5CTMA 1GHMA 1H5XA 3ZNTA 1ONHA 3NY4A 5FDHA 1PWDA 1PWGA 3VSKA 3ZG7B 4R4RA 5A93A 4GDBA 1S0WA 1FCMA 2EX9A 3D4FA 1J9MA 1KGEA 1MBLA 3E2LA 4GDNA 1ERMA 3SOIA 2C5WB 5A92A 3IT9A 4LCMA 4PM6A 3P98A 4ZAMA 1K54A 5HW3A 1O7EA 4N1HA 1YQSA 3G30A 4S2KA 1JWVA 1G68A 1YM1A 2Y2IA 5EECA 4BJPA 4S2LA 3ZG8B 1K4EA 1Q2QA 1FR1A 3W4PA 2HPBA 3HREA 5FAPA 2Y2NA 2WZXA 3QNBA 4X68A 1K56A 1ES4A 4K91A 1QMEA 5TFQA 3G35A 3G4PA 3M2JA 4FD8A 1KDSA 4JBFA 1E4DA 4LV0A 3HL9A 1ES3A 5U47A 4MNRA 3MXRA 2JC7A 4EBPA 3ZDJA 3NBLA 2IWDA 1FQGA 3HLGA 4OP8A 4QY6A 3GR2A 4BD0A 3VOZA 4GZBA 4DDYA 4F94A 1TVFA 2Y59A 1XX2A 3OPHA 5IHVA 3ZG9B 4B4ZA 1BUEA 5CHJA 1YLTA 2XDMA 1PIOA 4QU3A 1DJAA 2HDUA 4JLFA 2Y2GA 2Q9MA 3MZFA 4BENA 2WADA 4IBXA 4OPQA 2HP5A 1PZOA 1RGZA 3FWLA 3SH8A 2HP9A 4HEFA 1G6AA 4XXRA 3BLMA 3LO7A 3UNWA 1K4FA 3VMAA 3DWZA 5A91A 3ZHHA 2WKHA 2Z2LB 3N8LA 1HZOA 1LL5A 2V20A 4JF4A 4OONA 5FQKA 3VSLA 5E2HA 4JXVA 3UE1A 5FQ9A 5CGWA 3WS1A 4DDSA 3BLSA 1YLZA 2Z2MB 3TSGA 2X71A 1GHPA 4WZ5A 5F1FA 1W79A 1EWZA 1TDGA 1FSYA 1ESUA 2XEPA 3S4XA 3VOYA 3MKEA 1QMFA 4IBRA 4ZJ3A 4A5RA 3MKFA 4WZ4A 4E3MA 4KZ9A 3PBRA 4Q8IA 4C75A 1MWSA 3DTMA 3O88A 3HLBA 4QJGA 4R0QA 3OC2A 4GN2A 2XGNA 3GVBA 5EVIB 3BFFA 4OPYA 3GMWA 3SS3A 5D3OA 4EBNA 1DY6A 4OLDA 1IELA 3OPRA 5E2EA 2HDRA 4S2NC 4N9LA 1AXBA 3MZDA 1K57C 1K6RA 2Y2JA 3GTCA 1CEGA 2ZM2A 3LY4A 4JKTA 5F82A 3NDEA 3PAGA 1ERQA 5GLBA 1I5QA 1NY0A 3MXSA 3UN7A 2ZC7A 4QY5A 2XLNA 2ZC6B 2WK0A 2P9VB 1E3UD 5GL9A 5GLAA 1KVMA 2J8YA 1HVBA 4UA9A 4EQIA 1DJCA 4OOYA 4E6XA 4EUZA 5KSHA 3UE3A 4KZ6A 5FSRA 1IYPA 3IQAA 3Q81A 4WBGA 5FI2A 4LCLA 3UDFA 1CEFA 1JWZA 1OMEA 3QHYA 3HLDA 5KZHA 1BSGA 1SDNA 4U0XA 3A3EA 4PM8A 4QB8A 1IKGA 4C6YA 5DF8A 3A3JA 4HBUA 4RX3A 1Z6FA 3ISGA 3IWOA 4Y7PA 4DXBA 3NC8A 1LI9A 2ZQCA 4KZAA 3IF5A 2ZQAA 3ZG0A 4E6WA 4X56A 4CPKA 1FOFA 2R9XA 1L0GA 1MXOA 4MBHA 1FCOA 4UAAA 2WYXA 5CERA 4OOMA 4D2OA 2Y2KA 5FI7A 1ZKJA 4M3KA 2QMIA 2Y2PA 4LENA 1KE3A 2XFSA 2Y2OA 3Q7VB 4CJNA 2ZM8A 1IYOA 1KGGA 1LLBA 3IXGA 4OQGA 5AQ9A 3IF6A 4X53A 1YLWA 1WYBA 2ZMAA 4R3BA 1KGFA 1Q2PA 4QD4A 5DTKA 3IH9A 3RXWA 4OPRA 1I2WA 2EFXA 2Q9NA 4JPMA 3GQZA 1IEMA 5CEBA 4B88A 2G2WA 3HUMA 5EVID 5FQQA 5HL1A 2JCHA 4GOGA 1W8QA 1GA0A 3C5AA 3I7JA 1MWUA 2Y55A 3Q82A 3M6BA 5AQ7A 4U3TA 4EBLA 1BLPA 3BFEA 3LCEA 3VFFA 2ZQDA 1K54C 3V39A 4NETA 2ZM0A 2BG1A 4Z9QA 3PAEA 5EE8A 3IXHA 1JWPA 1SCWA 3S22A 3VP4A 3UE0A 1PI4A 2PU2A 3IH8A 3WWXA 4KZ8A 1BLCA 3DW0A 5TR7A 2ZQ8A 4YINA 3OCNA 5CEDA 1NJ4A 4KQQA 5F83A 3V50A 4Y0TA 1S6RA 2PBYA 4N1XA 3HLEA 3UY6A 1C3BA 3HLCA 4ZJ1A 4L0LA 3VP1A 1XPBA 4X69A 1H8YA 5J8XA 1IYSA 4DE3A 4ZDXA 1HD8A 2XF3A 1DJBA 2Y2QA 2DRWA 2IWCA 3Q1FA 4X55A 5GLDA 4GD8A 1IYQA 1XGJA 4P87A 1LI0A 4OLGA 5DVAA 4JXGA 1E25A 1U60A 2HDQA 3BM6A 3N6IA 3IF6B 1TDLA 3W4QA 3N8RA 3WRTA 3ZCZA 1MPLA 4BL2A 1BZAA 1BTLA 4FH4A 3UPOA 3SH9A 3BFCA 3FZCA 5EVIC 3A3DA 4E3JA 5HAQA 1SDEA 1ALQA 1ESIA 4EWFA 1CI8A 5AQBA 1MY8A 1PW8A 1PWCA 1NZUA 2H0TA 2OLVA 5DF9A 1LL9A 4MLLA 1PZPA 2RL3A 1Y54A 2A3UA 1VM1A 2EXBA 1MWTA 4FSFA 3MBZA 1NXYA 2EX8A 5CGXA 2H5SA 2XFTA 3NDGA 2EX2A 5HFOA 1ES2A 1JTGA 1YMSA 4E3LA 4S2MA 3FYZA 5TGFA 2WAEA 3TG9A 3LY3A 1SKFA 2JBFA 3S1YA 4DF6A 4EV4A 4GB7A 4KQRA 3PTEA 3VP3A 2FFYA 2WGWA 4WZ5C 1HTZA 4C3QA 4WEKA 5CRFA 2Y2MA 2G2UA 3DWKA 3NCKA 2WUQA 2WAFA 4OP5A 4PM7A 5E2FA 5AQAA 1VQQA 2WKIA 5JYOA 4U0TA 3GRJA 2CC1A 3PBTA 3IWQA 4X6TA 4S2IA 3WRZA 5FASA 3ITBA 2GDNA 4HBTA 1ZC2A 1K55A 2RCXA 4O7DA 3V3RA 1I2SA 1TEMA 4KG5A 4E3OA 3B3XA 3C7UA 1WYCA 4IEDA 5DTTA 1YLJA 2WGVA 5HX9A 3ZG5A 4FH2A 2FFFB 1H8ZA 2ZJ9A 1YLPA 1KDWA 5CECA 2UWXA 4R23A 1BLHA 3PBOA 4QHCA 5CXWA 4KQOA 4WM9A 4JF6A 2V2FF 2QZ6A 3LEZA 3BECA 3QNCA 1ONGA 4DE0A 3C7VA 4GNUA 4RA7A 4WMCA 4P85A 2EXAA 5A90A 3O87A 3IXDA 3N7WA 1XXMA 4GD6A 3GV9A 3HUNA 3P09A 3AGFA 5EOOA 3IXBA 3FKWA 1ZG6A 4ZTKA 3WS4A 4MBFA 4KZ7A 2J7VA 2WGWB 1XKZA 4OPZA 3V5MA 5HAIA 1K56D 4WYYA 4XUZA 1GA9A 3OZHA 5FQIA 1GHIA 3ITAA 2H10A 1BT5A 1BLSA 2X02A 2Y91A 1E3UA 3WS5A 5DF7A 1N9BA 2I72A 3M6HA 3MFDA 3G34A 3HBRA 4S2JA 3OPPA 2DCFA 3A3FA 1W5DA 2QPNA 2ZD8A 4LV2A 2Y2HA 5EVLA 4E3IA 3W8KA 4Y0UA 1IKIA 1JTDA 2WGIA 5GHXA 1PYYA 3NIAA 3HUOA 2BLSA 2ZQ7A 3IHAA 3JYIA 2J9PA 4ID4A 4JXWA 4PM9A 4UHUA 3GSGA 2HP6A 1BULA 2XK1A 4K0XA 2PU4A 2WZZA 3OPLA 4PMAA 3G31A 1YLYA 2VGKA 1K38A 3CG5A 3HLFA 3BYDA 4S2PA 4UA7A 3IF6C 1NYMA 5HARA 4P6BA 3G2YA 4ZJ2A 3ZGAB 5FAQA 4KENB 5FQJA 4E3KA 4ZBEA 3BFGA 3RJUA 2V1ZA 3C4OA 1K6SA 1MKIA 3MZEA 5FAOA 2X01A 1K25A 3NI9A 4LV1A 3N8SA 4KZ4A 3VFHA 3HVFA 2ZLYA 5CGSA 5EOEA 3SS4A 3PBQA 2HDSA 1KE4A 3EQVA 2B5RA 3IWIA 3C4PA 5CTNA 1KE0A 3UDXA 3UPPA 4KZ5A 2EX6A 3BFDA 5M19A 1O07A 4DE2A 4DE1A 3E2KA 4K0WA 3CJMA 1RCJA 1XA1A 4MBKA 1RP5A 1M40A 4NK3A 4OQ0A 5EUAA 3OCLA 5EVIA 2ZC4B 4GKUA 2EFUA 4FCFA 3Q07A 4KG2A 4OH0A 2ZC5B 4BL3A 4R3JA 3FV7A 4R4SA 1NZOA 1YT4A 4JF5A 1LHYA 2ZQ9A 4OVDA 5F1GA 5GHZA 3RXXA 4KG6A 4RX2A 1CI9A 4KZ3A 2JE5A 3W4OA 3EQUA 2IWBA 5FI6A 1XA7A 2P9VA 3UO9A 3VP2A 1FR6A 3ZVTA 2C6WB 4OOLA 1NYYA 2P74A 5EPHA 3UPNA 2OLUA 1EI5A 3G2ZA 3BEBA 3ZFZA 3A3IA 1NRFA 4RVAA 1M6KA 4E3NA 5M1AA 3ZNYA 1W7FA 1L0EA 4WEJA 3G32A 3V3SA 4S2NA 3WS0A 4BD1A 1CK3A 1SHVA 1FCNA 5KMWA 5M18A 4DRTA 5I94A 4R1GA 4OQIA 3WS2A 1K57A 3SS5A 1W8YA 4PPRA 2XQZA 4N92A 2XD1A 3O86A 5JYPA 2OSUA 5DTSA 5CHUA 3CMZA 4WMCD 3AGDA 1XP4A 3BRMA 3Q7ZA 1XGIA 5BOHA 4WELA 5FQMA 1WE4A 1FSWA 3VP0A 4KZBA 3IHBA 1ES5A 1YMXA 4HESA 5GLCA 1L0DA 5KSCA 2DNSA 2E8IA 4OKPA 4IVKA
chains in the Genus database with same CATH superfamily
4I3JA 3N4IA 2R9WA 4BBTA 3IS2B 3KSFA 1H8MA 3PBNA 5FATA 3Q7VA 1YAXA 3P01A 4EEUA 2Y8HA 1K55C 2J80A 1VETA 3CZDA 1J3WA 5HD3A 4IVIA 4S2OA 2XR0A 4DN0A 2CMNA 4LV3A 5L2FA 1S4SA 5E2GA 2JKRM 3O3VA 4N9KA 1NLYA 3SH7A 1OTIA 1ZG4A 1H5XA 1XJ2A 3BQAA 1PWGA 4BMWA 2EX9A 4EQ1A 1J9MA 3DTKA 3GECA 5A92A 4LCMA 5F68A 4ZAMA 3DTEA 2P08A 1YQSA 3G30A 4S2KA 1JWVA 2Y2IA 4EERA 2HZ5A 1FR1A 3HREA 4GHIB 3QP1A 3D72A 2V1BA 1TS6A 2BASA 4K91A 1QMEA 4M4XA 3G35A 4JBFA 1E4DA 3FC7A 5HWWA 4MNRA 4D60A 3MFXA 2Y79A 1STZA 3KSGA 3O5YA 4GW9A 2IWDA 1FQGA 4OP8A 3VE4A 4FUWA 2W3GA 4F94A 3T1QB 3KYZA 2XDMA 2Y2GA 4I5SA 3MZFA 4IBXA 4OPQA 3FWLA 4HEFA 3LO7A 3RTYA 3MJQA 3ZHHA 2V8FA 2WKHA 2LB9A 1LL5A 3UE1A 2OAQ1 4DDSA 3V67A 1G28A 2IA2A 2NUTC 2X71A 1FSYA 3S4XA 3VOYA 2GX5A 4ZJ3A 4II7A 4WZ4A 3BY8A 3O88A 4GN2A 2XGNA 1DY6A 1BYWA 1IELA 3E98A 3MZDA 2XA7M 1K57C 3GTCA 1CEGA 2ZM2A 3F1NA 3PAGA 2YKFA 1NY0A 4L9EA 2XLNA 2WK0A 2P9VB 2PHYA 5GLAA 1FILA 4UA9A 4HP4A 4HIAA 4KZ6A 3Q81A 3IQAA 1VEUA 2JKGA 2H28A 5FL3A 1CEFA 1OMEA 1ODVA 4HJ3A 4PM8A 3NECA 1IKGA 4C6YA 4P6ZM 3ISGA 3IWOA 4WUJA 3IX4A 3LEQA 4KZAA 2ZMFA 4E6WA 1OTAA 5G4ZA 3DAVA 4MBHA 1DP9A 4HNBA 1EW0A 4D2OA 3IBRA 5FI7A 3HJIA 2Y2PA 3CHWP 4LENA 1KE3A 1IYOA 1KGGA 4OQGA 5AVFA 3IF6A 1YLWA 3B33A 2V1AA 4QD4A 5DTKA 4ARZA 2PRFA 4O8GA 3RXWA 1I2WA 1H0MA 4EU0A 3M6BA 4U3TA 3VFFA 2ZQDA 1K54C 4NETA 2ZM0A 4Z9QA 1XJ6A 3KSIA 3IBJA 3S22A 1PI4A 3OCNA 4GLQA 1S6RA 2PBYA 5G4YA 3FPWA 1C3BA 3LGOA 5C5KA 3VP1A 4X1MA 1H8YA 1IYSA 1HD8A 2XF3A 3Q1FA 2DRWA 5GLDA 4X55A 4BWIA 4R38A 4P87A 5DVAA 4JXGA 4BL2A 1TDLA 3N8RA 1MPLA 4X25A 3CLOA 5EVIC 4HI4A 4FTXA 1GSVA 4G3KA 1S66L 3JVVA 5DF9A 2EXBA 3LIFA 3K3CA 2EX8A 2XFTA 1JTGA 1YMSA 4S2MA 2WAEA 4EV4A 3PTEA 3VP3A 4WZ5C 3DWKA 2WUQA 5AQAA 5E2FA 1VQQA 5JYOA 3UB8A 2GDNA 4O7DA 3B3XA 3C7UA 3RH8B 5DTTA 1YLJA 1CF0A 2VGLM 4QHCA 4WM9A 2QZ6A 2A24B 3BECA 1ONGA 1T19A 2QHKA 4DMZA 4EW7A 3UE6A 1XJ3A 1P97A 3TRCA 3FKWA 4CQHA 3BW6A 1GA9A 1BLSA 1W63M 2D01A 1N9BA 1OTEA 2QPNA 3W8KA 3LIEA 2ZQ7A 5HPFA 3FG8A 3OPLA 1K38A 3BYDA 2XROA 5J4EA 1D1JA 2M1CA 4KENB 2V1ZA 3MZEA 1K6SA 2X01A 1S4RA 5EOEA 2ZOIA 3EQVA 2B5RA 3IWIA 3C4PA 5TJJA 4AFIA 1PRQA 2GJ3A 4KZ5A 4B9OA 1MKMA 2EX6A 3BFDA 1L3LA 4DE2A 3CJMA 1XA1A 5EVIA 4PKYG 4CLCC 4F3LB 3MF0A 4OH0A 2ZC5B 4BL3A 2AVXA 3NULA 1XA7A 3PR6A 4E3NA 3ZNYA 1W63Q 3G32A 3BJNA 4QWOA 2PYRA 5M18A 5I94A 3WS2A 5AVEA 3SS5A 3JVUA 2HF6A 4MN5A 5DKLA 3Q7ZA 1XGIA 5BOHA 3T4QA 5KSCA 2L1MA 2DNSA 4P6ZS 4H8RA 1LSWA 4WF0A 1PI5A 4HH3A 3HLWA 4UA6A 4PM5A 1RGYA 3H82B 4P0MA 4BLMA 1KVLA 1GCEA 5HAPA 2L4RA 3T4OA 2VA0A 3TOIA 2A49A 1GHMA 5FDHA 1PWDA 5L07A 1UWNX 5A93A 2JKFA 4GDBA 1S0WA 1FCMA 3CITA 3NJAA 3MR0A 3SOIA 3F1PA 3IT9A 5F6AA 4PM6A 3P98A 4N1HA 1TS0A 2ZL1B 4GCZA 1T1CA 4S2LA 1K4EA 1VETB 3W4PA 5FAPA 2J3TC 3NHQA 2BTFP 4FD8A 1TS7A 4RQ9A 4EXOA 4MMNA 3NBLA 3CWFA 2V0WA 4QY6A 3GR2A 4BD0A 3UMEA 4PKYA 1G6OA 3T1RA 3ZG9B 1BUEA 5CHJA 1YLTA 2VKSA 5HZHA 4QU3A 2HDUA 1H3QA 3LFVA 4BENA 1P9WA 3TE8A 2HP9A 4XXRA 1K4FA 5E2HA 5CGWA 2GNXA 3EEHA 3WS1A 3ULFA 3BLSA 1YLZA 1EWZA 1ESUA 2XEPA 4IBRA 4KQDA 1GSXA 3MKFA 5AJGA 4C75A 1MWSA 1DRMA 2VV6A 5I5LA 3GVBA 1HLUP 3GMWA 2J3WA 3E4OA 5E2EA 2HDRA 4N9LA 1UWPX 1K6RA 4JKTA 5F82A 4I38A 2ZC7A 3OLOA 5GL9A 1D7EA 3QP6A 4EQIA 3MMHA 1A0KA 1DJCA 4E6XA 4EUZA 2K2NA 4NKPA 5KZHA 3NOUC 4H6JB 4QB8A 4HBUA 4RX3A 1YKDA 4Y7PA 2VK3A 3D3OA 3ZG0A 2YKHA 4X56A 4CPKA 2O0YA 2R9XA 5CERA 2Y2KA 4HJ6A 2KDKA 2L0WA 2XFSA 1N9NA 2ZM8A 3PHYA 4LFUA 2ZMAA 4R3BA 3OOVA 2A2LA 2EFXA 3JPUA 1IEMA 2G2WA 1TS8A 1VEUB 2PR6A 2PBDP 3I7JA 1MWUA 2Y55A 4EBLA 1BLPA 3BFEA 3LCEA 2BG1A 5EE8A 5TBMA 1ZHHB 3UE0A 2W0NA 1IFQA 2W3HA 2QJ7A 4YINA 1NJ4A 1MZUA 3HLCA 4NXBA 2R78A 5HDDA 1U60A 2PAVP 3N6IA 3IF6B 5MC7A 3ZCZA 1BZAA 1BTLA 3UPOA 3L9KA 1MC0A 3SH9A 2KOIA 2Q0OA 5J3WA 1ALQA 1PWCA 3SZTA 1NZUA 2H0TA 1LL9A 2OWHA 4MLLA 1PZPA 2RL3A 1Y54A 2A3UA 2V9AA 3C2WA 5L8MA 1MWTA 4FSFA 3MBZA 5CGXA 1DP8A 2H5SA 3NDGA 2EX2A 5HFOA 3T4TA 1SKFA 1S67L 4KQRA 3K2NA 2PD7A 2FFYA 2WGWA 4NXEA 1HTZA 3MQ0A 4WEKA 2Y2MA 2G2UA 2O99A 3QP8A 4OP5A 4PM7A 1SZVA 2CC1A 3WRZA 4S2IA 2EA9A 1K55A 1WYCA 2WGVA 4FH2A 1H8ZA 1YLPA 3DBAA 4R23A 3PBOA 3KYEA 3LEZA 4RA7A 4ETZA 3O87A 5K5BA 4GHIA 2FH5A 2OOLA 3IXBA 4ZTKA 3T1XA 3WS4A 4MBFA 3A0RA 4OPZA 3R4KA 4XUZA 3OZHA 5FQIA 2B02A 2H10A 2Y91A 1VHMA 1E3UA 5DF7A 2GZAA 3MFDA 3A3FA 1W5DA 5EVLA 4O0PA 3A0SA 1IKIA 1PYYA 3JYIA 4PM9A 3GSGA 1BULA 5HL6A 3T4JA 2PU4A 3F1OA 3R7WA 2WZZA 4PMAA 4R3AA 1YLYA 4P6BA 3RJUA 5FAOA 1K25A 3NI9A 1P9RA 4KZ4A 3HVFA 4LRXC 3PBQA 2HDSA 1KE4A 1CJFA 5CTNA 4Y17A 3UB7A 3UPPA 2D02A 3E2KA 4K0WA 5EVEA 4MBKA 4NXGA 1M40A 1F98A 3OCLA 1S1ZA 2ZC4B 2UV0E 4GKUA 2EFUA 4FCFA 3Q07A 4R3JA 3FV7A 1NZOA 1YT4A 2FZ0A 4KUOA 1F5MA 3VV4A 3VP2A 2P9VA 3UO9A 4OOLA 2P74A 3UPNA 3BEBA 1N9LA 1NRFA 2PR5A 4DJ3A 5M1AA 2V8CA 3D9YA 3RFBA 4R1GA 4OQIA 4BBUA 1K57A 1W8YA 3B42A 4ETXA 4PPRA 2XD1A 5LBRA 3T4SA 3BRMA 1P0ZA 4WELA 1WE4A 4MN6A 1FSWA 2O9AA 1YMXA 2QWSA 2VJWA 1L0DA 1NYYA 2H0YA 1UGUA 2VGJA 1EROA 5FA7A 3UDIA 1L2SA 4LPZA 4PHTA 1OJGA 1MWRA 4JXSA 4RYEA 2ZC3B 4XUXA 3CUEC 2V0UA 1XJ4A 5GHYA 4B4XA 5CHMA 2XSSA 4YFMA 4MEZA 2Y2LA 4JGOA 3NY4A 3VSKA 4HJ4A 2HJEA 1KGEA 1MBLA 4GDNA 3BY9A 1K54A 1O7EA 2DMWA 1K0KA 5HWVA 3ZG8B 1OTDA 1Q2QA 2MJ6A 2Y2NA 3QNBA 1K56A 1ES4A 1T18A 3M2JA 1KDSA 3HL9A 5U47A 2QYBA 3H7WA 1NWZA 3A0VA 3ZDJA 1ZTUA 3HLGA 2WKPA 3LIAA 4GZBA 2Y59A 4B4ZA 1PIOA 3SH8A 1PZOA 1RGZA 3BLMA 3UNWA 3DWZA 2Z2LB 4OONA 3LR4A 5FQ9A 4HH2A 4LRYC 5KIZA 1IOUA 1JNUA 2Z2MB 3TSGA 4WZ5A 1W79A 2EWWA 1TDGA 2ZBBA 3C38A 3MKEA 1QMFA 4ME4A 5IU1A 4E3MA 4KZ9A 5DJUA 3PBRA 1LL8A 3GDIA 3HLBA 3OC2A 4Y2FA 3BFFA 3SS3A 3H9WA 2JKTI 4I3AA 5EV0A 4GS9B 4S2NC 1KOUA 4Y13A 3NDEA 1I5QA 3MXSA 4MN7A 4QY5A 4CLCE 2ZC6B 1KVMA 2J8YA 2WKQA 4OOYA 5KSHA 2B18A 3UE3A 3EOIA 5FSRA 1IYPA 4WBGA 1V9ZA 4LCLA 3QHYA 1BSGA 2W1TA 1TD5A 4EETB 4DXBA 2ZQCA 2ZQAA 5HDCA 3CPTA 1FOFA 4UAAA 2WYXA 1OT6A 4OOMA 5DFYA 1ZKJA 3T12B 1LT0A 2Y2OA 3Q7VB 3IXGA 5AQ9A 4XT2A 4OPRA 5CEBA 4EEPA 3GQZA 4F3LA 4B88A 5EVID 5FQQA 5HL1A 4LLOB 2JCHA 1D06A 1GA0A 1NRJA 3Q82A 5FEGA 3V39A 5FDSA 4YWZA 4X1LA 3IXHA 4WN5A 1SCWA 4NG2A 2QKPA 3IH8A 3DW0A 5TR7A 4KQQA 4I39A 4CLCA 3HLEA 4L0LA 5A8BA 4DE3A 4ZDXA 1DJBA 4GD8A 4OLGA 3BM6A 4JGPA 3WRTA 5F69A 2Z6DA 2LB5A 3FZCA 5HAQA 4E3JA 2ZOHA 1SDEA 4LGWA 1CI8A 1MY8A 3ZQ5A 3QP4A 1VM1A 1S1YA 1NXYA 3UB5P 3E4PA 1ES2A 4E3LA 5FEFA 3FYZA 3TG9A 2JBFA 1OJ5A 2EWVA 3TJZC 4C3QA 5CRFA 5DFXA 2WAFA 2WKIA 4EUVA 3GRJA 3PBTA 3IWQA 4X6TA 1ZC2A 3V3RA 4E04A 1I2SA 1TEMA 4KG5A 3LI9A 4FOFA 4Q0IA 5HX9A 2FFFB 2ZJ9A 2UWXA 1BLHA 5CXWA 3MQOA 4DE0A 3QNCA 3C7VA 4GNUA 3T4LA 4PAUA 3TW8A 2EXAA 5A90A 2JKTM 2ZL1A 3IXDA 4GD6A 2VEAA 3IX3A 3AGFA 5EOOA 5HSQA 1ZG6A 2WGWB 3OBFA 4WYYA 2I9VA 3ITAA 1BT5A 3F1NB 2X02A 3LYXA 2HV1A 1FIKA 3M6HA 4S2JA 3OPPA 2ZD8A 3LICA 1SKOA 4Y0UA 4CLCD 1JTDA 2WGIA 5EM1A 2BLSA 4ID4A 2J9PA 4HOIA 3EGDC 2HP6A 2W3DA 2XK1A 4K08A 3HJKA 3G31A 2VGKA 3CG5A 3HLFA 4ESPA 4S2PA 3IF6C 3S7PA 5HWTA 3G2YA 4ZJ2A 5FAQA 5L10A 4ZBEA 3BFGA 2QJ5A 1MKIA 4LV1A 3VFHA 2K7SA 2ZLYA 2W1RA 1KE0A 5DKKA 3UDXA 5HDSA 1OT9A 2OAP1 5M19A 3U4LP 4DE1A 4R6LA 1RCJA 4ARZB 1RP5A 2W27A 4NK3A 4OQ0A 1Z09A 4UQIM 3KYQA 1PFLA 4R4SA 4JF5A 4NXFA 1LHYA 3IS2A 3F1OB 3R7WB 2ZQ9A 2INWA 5F1GA 5GHZA 5CX7A 4IHQA 4KG6A 1CI9A 4KZ3A 3W4OA 3EQUA 1FR6A 3ZVTA 3ZFZA 3A3IA 1M6KA 4GJ4A 3MQQA 5KMWA 4BD1A 2VX8A 1SHVA 4DRTA 4H6JA 2XQZA 3CMZA 3AGDA 1XP4A 2W3EA 5FQMA 4MCWA 3VP0A 3IHBA 1ES5A 4HESA 4IVKA 1L0FA 2J9OA 4OQHA 5E43A 4DXCA 4Y0OA 5G18A 2WKEA 3AGEA 4BQMA 3UB9A 3M2KA 3HCYA 3FKVA 2K31A 1N4OA 2XH9A 2J3TD 1PW1A 4DKIA 2OV5A 3PBSA 1Y4OA 2VZWA 2XD5A 2Y4AA 3ZVWA 1JVJA 3LIBA 5CTMA 3T4KA 4HQAA 3ZNTA 1ONHA 3ZG7B 4R4RA 3LR5A 3D4FA 4JGRA 3E2LA 1ERMA 2C5WB 3EWKA 2JN7A 5HW3A 3LR0A 1YM1A 1G68A 2HGVA 5EECA 4BJPA 1N9OA 3C30A 3W2ZA 2HPBA 2WZXA 4X68A 5TFQA 3G4PA 1T1AA 4LV0A 1ES3A 1LSVA 3MXRA 4L9GA 3ICYA 2JC7A 4EBPA 1GSWA 3LR3A 2KX6A 2ZMVA 3QP2A 3VOZA 4DDYA 3EEAA 1TVFA 2M7VA 1XX2A 3OPHA 5IHVA 3NOPC 4I3IA 1DJAA 4JLFA 5HPIA 2Q9MA 2WADA 2HP5A 2Z6CA 1G6AA 2KLIA 3VMAA 5A91A 4G3WA 5L09A 1ACFA 3N8LA 1YPRA 1HZOA 2V20A 4JF4A 5FQKA 3VSLA 4JXVA 3DTIA 4MDZA 1XFNA 1GHPA 2WKRA 4IUKA 5F1FA 3PXPA 3L7HA 4A5RA 3H7WB 4Q8IA 3DTMA 2P04A 3CAXA 4QJGA 4R0QA 5EVIB 4OPYA 5D3OA 4OLDA 3OPRA 4Y3IA 1AWIA 1AXBA 4HY8A 2O9BA 2Y2JA 4KUKA 1OTBA 3LY4A 4L9FA 1ERQA 5GLBA 1YSQA 3UN7A 3MSHA 1E3UD 1VB6A 3BWLA 1HVBA 1F9IA 2NUPC 1T1BA 5FI2A 1WA9A 4YOFA 3UDFA 1JWZA 3HLDA 3BQ8A 1SDNA 4U0XA 4UEYA 3A3EA 3MXQA 5DF8A 3A3JA 3KX0X 1Z6FA 3NC8A 1DP6A 1LI9A 4JGQA 4WL9A 3IF5A 3P7NA 3PYPA 3K3DA 1V9YA 3LIDA 2B95A 1L0GA 1MXOA 1FCOA 1LSXA 4M3KA 2QMIA 4NEED 4CJNA 3KO6A 1LLBA 4X53A 1WYBA 1KGFA 1Q2PA 3IH9A 2Q9NA 4JPMA 4HP9A 3HUMA 4GOGA 1NLZA 4Z1WA 1W8QA 3C5AA 5AQ7A 3E4QA 2W1TB 3SW1A 3S7OA 3PAEA 1JWPA 3VP4A 2PU2A 3WWXA 4KZ8A 1BLCA 2ZQ8A 4WLAA 5CEDA 3V50A 5F83A 4Y0TA 4N1XA 3UMDA 3UY6A 4UQIS 2P7JA 3U2AA 3CPTB 4ZJ1A 1XPBA 4X69A 5J8XA 2Y2QA 2IWCA 2VV8A 5HD5A 4BBVA 3F1PB 1IYQA 1XGJA 1LI0A 1E25A 2HDQA 3W4QA 4XT2B 2OWJA 2ACGA 5IT5A 4FH4A 3BFCA 3A3DA 1PNEA 1ESIA 4EWFA 5AQBA 1PW8A 1X0OA 2OLVA 3LUQA 3G6OA 2A24A 3LI8A 4B93A 3VE3A 4IJGA 5TGFA 2E8JA 4CLCB 3NOTC 3S1YA 4DF6A 4GB7A 2PT7A 2XA7S 1Y28A 3NCKA 4U0TA 2W3FA 5FASA 2JHEA 3B47A 3ITBA 4HBTA 3C8CA 2RCXA 4E3OA 3VOLA 3UB6A 4IEDA 2JKRI 3ZG5A 4QPRA 1KDWA 5CECA 2VLGA 4KQOA 5F5YA 4JF6A 2V2FF 4Y5FA 3CUEA 4WMCA 4P85A 5EFWA 1OPXA 3N7WA 3S7NA 1XXMA 3GV9A 3HUNA 3P09A 4YNRA 4KZ7A 2J7VA 1XKZA 3V5MA 5HAIA 1K56D 3T50A 4DJ2A 5J7EA 1F2KA 3MS6A 1GHIA 3E0YA 3ZYTA 3WS5A 2I72A 3G34A 3HBRA 1TF1A 2DCFA 4LV2A 4E3IA 2Y2HA 2PYPA 1G5UA 2PDRA 5GHXA 3NIAA 3HUOA 3IHAA 2VV7A 4UHUA 4JXWA 4EBNA 4Q0JA 4K0XA 3S7QA 4Y15A 4UA7A 4IUHA 3ZGAB 1NYMA 5HARA 5FQJA 4E3KA 3C4OA 2O9CA 3N8SA 2HJ9C 2M7UA 4G3VA 5CGSA 3SS4A 2XRNA 3T1SA 5EM0A 1O07A 5EUAA 2G7UA 4R70A 4LRZE 1SKOB 3FPVA 3IX8A 4ZRRA 4KG2A 4GS9A 3KSHA 3QP5A 4OVDA 3RXXA 4RX2A 5TBMB 2JE5A 2IWBA 5FI6A 2C6WB 5EPHA 1XFQA 2OLUA 1EI5A 3G2ZA 2PD8A 4RVAA 1W7FA 4WEJA 1L0EA 3H82A 3V3SA 4S2NA 3WS0A 1CK3A 1FCNA 4Q0HA 4N92A 3O86A 5JYPA 2OSUA 5DTSA 4HHDA 5CHUA 4WMCD 5DJTA 3EGXC 1YSPA 1CQAA 4O01A 5IS1A 4KZBA 3CI6A 2E8IA 2VGLS 5GLCA 3LY3A 4OKPA 4EESA
chains in the Genus database with same CATH topology
2H0YA 3N4IA 1L0FA 2R9WA 2J9OA 4OQHA 3PBNA 5FATA 4H8RA 2VGJA 5E43A 3Q7VA 1EROA 4DXCA 4Y0OA 5G18A 2WKEA 3AGEA 5FA7A 1K55C 4BQMA 3UDIA 1PI5A 3M2KA 3FKVA 1L2SA 3CZDA 3HLWA 4UA6A 4PM5A 1N4OA 2XH9A 1RGYA 1PW1A 4IVIA 4S2OA 1MWRA 4P0MA 4DKIA 2XR0A 4JXSA 2OV5A 4RYEA 3PBSA 4LV3A 4BLMA 1KVLA 2ZC3B 4XUXA 5L2FA 1GCEA 5E2GA 5HAPA 5GHYA 4B4XA 2XD5A 3O3VA 4N9KA 5CHMA 2Y4AA 4YFMA 3ZVWA 1JVJA 3SH7A 4MEZA 2Y2LA 3TOIA 2A49A 1ZG4A 5CTMA 1GHMA 1H5XA 3ZNTA 1ONHA 3NY4A 5FDHA 1PWDA 1PWGA 3VSKA 3ZG7B 4R4RA 5A93A 4GDBA 1S0WA 1FCMA 2EX9A 3D4FA 1J9MA 1KGEA 1MBLA 3E2LA 4GDNA 1ERMA 3SOIA 2C5WB 5A92A 3IT9A 4LCMA 4PM6A 3P98A 4ZAMA 1K54A 5HW3A 1O7EA 4N1HA 1YQSA 3G30A 4S2KA 1JWVA 1G68A 1YM1A 2Y2IA 5EECA 4BJPA 4S2LA 3ZG8B 1K4EA 1Q2QA 1FR1A 3W4PA 2HPBA 3HREA 5FAPA 2Y2NA 2WZXA 3QNBA 4X68A 1K56A 1ES4A 4K91A 1QMEA 5TFQA 3G35A 3G4PA 3M2JA 4FD8A 1KDSA 4JBFA 1E4DA 4LV0A 3HL9A 1ES3A 5U47A 4MNRA 3MXRA 2JC7A 4EBPA 3ZDJA 3NBLA 2IWDA 1FQGA 3HLGA 4OP8A 4QY6A 3GR2A 4BD0A 3VOZA 4GZBA 4DDYA 4F94A 1TVFA 2Y59A 1XX2A 3OPHA 5IHVA 3ZG9B 4B4ZA 1BUEA 5CHJA 1YLTA 2XDMA 1PIOA 4QU3A 1DJAA 2HDUA 4JLFA 2Y2GA 2Q9MA 3MZFA 4BENA 2WADA 4IBXA 4OPQA 2HP5A 1PZOA 1RGZA 3FWLA 3SH8A 2HP9A 4HEFA 1G6AA 4XXRA 3BLMA 3LO7A 3UNWA 1K4FA 3VMAA 3DWZA 5A91A 3ZHHA 2WKHA 2Z2LB 3N8LA 1HZOA 1LL5A 2V20A 4JF4A 4OONA 5FQKA 3VSLA 5E2HA 4JXVA 3UE1A 5FQ9A 5CGWA 3WS1A 4DDSA 3BLSA 1YLZA 2Z2MB 3TSGA 2X71A 1GHPA 4WZ5A 5F1FA 1W79A 1EWZA 1TDGA 1FSYA 1ESUA 2XEPA 3S4XA 3VOYA 3MKEA 1QMFA 4IBRA 4ZJ3A 4A5RA 3MKFA 4WZ4A 4E3MA 4KZ9A 3PBRA 4Q8IA 4C75A 1MWSA 3DTMA 3O88A 3HLBA 4QJGA 4R0QA 3OC2A 4GN2A 2XGNA 3GVBA 5EVIB 3BFFA 4OPYA 3GMWA 3SS3A 5D3OA 4EBNA 1DY6A 4OLDA 1IELA 3OPRA 5E2EA 2HDRA 4S2NC 4N9LA 1AXBA 3MZDA 1K57C 1K6RA 2Y2JA 3GTCA 1CEGA 2ZM2A 3LY4A 4JKTA 5F82A 3NDEA 3PAGA 1ERQA 5GLBA 1I5QA 1NY0A 3MXSA 3UN7A 2ZC7A 4QY5A 2XLNA 2ZC6B 2WK0A 2P9VB 1E3UD 5GL9A 5GLAA 1KVMA 2J8YA 1HVBA 4UA9A 4EQIA 1DJCA 4OOYA 4E6XA 4EUZA 5KSHA 3UE3A 4KZ6A 5FSRA 1IYPA 3IQAA 3Q81A 4WBGA 5FI2A 4LCLA 3UDFA 1CEFA 1JWZA 1OMEA 3QHYA 3HLDA 5KZHA 1BSGA 1SDNA 4U0XA 3A3EA 4PM8A 4QB8A 1IKGA 4C6YA 5DF8A 3A3JA 4HBUA 4RX3A 1Z6FA 3ISGA 3IWOA 4Y7PA 4DXBA 3NC8A 1LI9A 2ZQCA 4KZAA 3IF5A 2ZQAA 3ZG0A 4E6WA 4X56A 4CPKA 1FOFA 2R9XA 1L0GA 1MXOA 4MBHA 1FCOA 4UAAA 2WYXA 5CERA 4OOMA 4D2OA 2Y2KA 5FI7A 1ZKJA 4M3KA 2QMIA 2Y2PA 4LENA 1KE3A 2XFSA 2Y2OA 3Q7VB 4CJNA 2ZM8A 1IYOA 1KGGA 1LLBA 3IXGA 4OQGA 5AQ9A 3IF6A 4X53A 1YLWA 1WYBA 2ZMAA 4R3BA 1KGFA 1Q2PA 4QD4A 5DTKA 3IH9A 3RXWA 4OPRA 1I2WA 2EFXA 2Q9NA 4JPMA 3GQZA 1IEMA 5CEBA 4B88A 2G2WA 3HUMA 5EVID 5FQQA 5HL1A 2JCHA 4GOGA 1W8QA 1GA0A 3C5AA 3I7JA 1MWUA 2Y55A 3Q82A 3M6BA 5AQ7A 4U3TA 4EBLA 1BLPA 3BFEA 3LCEA 3VFFA 2ZQDA 1K54C 3V39A 4NETA 2ZM0A 2BG1A 4Z9QA 3PAEA 5EE8A 3IXHA 1JWPA 1SCWA 3S22A 3VP4A 3UE0A 1PI4A 2PU2A 3IH8A 3WWXA 4KZ8A 1BLCA 3DW0A 5TR7A 2ZQ8A 4YINA 3OCNA 5CEDA 1NJ4A 4KQQA 5F83A 3V50A 4Y0TA 1S6RA 2PBYA 4N1XA 3HLEA 3UY6A 1C3BA 3HLCA 4ZJ1A 4L0LA 3VP1A 1XPBA 4X69A 1H8YA 5J8XA 1IYSA 4DE3A 4ZDXA 1HD8A 2XF3A 1DJBA 2Y2QA 2DRWA 2IWCA 3Q1FA 4X55A 5GLDA 4GD8A 1IYQA 1XGJA 4P87A 1LI0A 4OLGA 5DVAA 4JXGA 1E25A 1U60A 2HDQA 3BM6A 3N6IA 3IF6B 1TDLA 3W4QA 3N8RA 3WRTA 3ZCZA 1MPLA 4BL2A 1BZAA 1BTLA 4FH4A 3UPOA 3SH9A 3BFCA 3FZCA 5EVIC 3A3DA 4E3JA 5HAQA 1SDEA 1ALQA 1ESIA 4EWFA 1CI8A 5AQBA 1MY8A 1PW8A 1PWCA 1NZUA 2H0TA 2OLVA 5DF9A 1LL9A 4MLLA 1PZPA 2RL3A 1Y54A 2A3UA 1VM1A 2EXBA 1MWTA 4FSFA 3MBZA 1NXYA 2EX8A 5CGXA 2H5SA 2XFTA 3NDGA 2EX2A 5HFOA 1ES2A 1JTGA 1YMSA 4E3LA 4S2MA 3FYZA 5TGFA 2WAEA 3TG9A 3LY3A 1SKFA 2JBFA 3S1YA 4DF6A 4EV4A 4GB7A 4KQRA 3PTEA 3VP3A 2FFYA 2WGWA 4WZ5C 1HTZA 4C3QA 4WEKA 5CRFA 2Y2MA 2G2UA 3DWKA 3NCKA 2WUQA 2WAFA 4OP5A 4PM7A 5E2FA 5AQAA 1VQQA 2WKIA 5JYOA 4U0TA 3GRJA 2CC1A 3PBTA 3IWQA 4X6TA 4S2IA 3WRZA 5FASA 3ITBA 2GDNA 4HBTA 1ZC2A 1K55A 2RCXA 4O7DA 3V3RA 1I2SA 1TEMA 4KG5A 4E3OA 3B3XA 3C7UA 1WYCA 4IEDA 5DTTA 1YLJA 2WGVA 5HX9A 3ZG5A 4FH2A 2FFFB 1H8ZA 2ZJ9A 1YLPA 1KDWA 5CECA 2UWXA 4R23A 1BLHA 3PBOA 4QHCA 5CXWA 4KQOA 4WM9A 4JF6A 2V2FF 2QZ6A 3LEZA 3BECA 3QNCA 1ONGA 4DE0A 3C7VA 4GNUA 4RA7A 4WMCA 4P85A 2EXAA 5A90A 3O87A 3IXDA 3N7WA 1XXMA 4GD6A 3GV9A 3HUNA 3P09A 3AGFA 5EOOA 3IXBA 3FKWA 1ZG6A 4ZTKA 3WS4A 4MBFA 4KZ7A 2J7VA 2WGWB 1XKZA 4OPZA 3V5MA 5HAIA 1K56D 4WYYA 4XUZA 1GA9A 3OZHA 5FQIA 1GHIA 3ITAA 2H10A 1BT5A 1BLSA 2X02A 2Y91A 1E3UA 3WS5A 5DF7A 1N9BA 2I72A 3M6HA 3MFDA 3G34A 3HBRA 4S2JA 3OPPA 2DCFA 3A3FA 1W5DA 2QPNA 2ZD8A 4LV2A 2Y2HA 5EVLA 4E3IA 3W8KA 4Y0UA 1IKIA 1JTDA 2WGIA 5GHXA 1PYYA 3NIAA 3HUOA 2BLSA 2ZQ7A 3IHAA 3JYIA 2J9PA 4ID4A 4JXWA 4PM9A 4UHUA 3GSGA 2HP6A 1BULA 2XK1A 4K0XA 2PU4A 2WZZA 3OPLA 4PMAA 3G31A 1YLYA 2VGKA 1K38A 3CG5A 3HLFA 3BYDA 4S2PA 4UA7A 3IF6C 1NYMA 5HARA 4P6BA 3G2YA 4ZJ2A 3ZGAB 5FAQA 4KENB 5FQJA 4E3KA 4ZBEA 3BFGA 3RJUA 2V1ZA 3C4OA 1K6SA 1MKIA 3MZEA 5FAOA 2X01A 1K25A 3NI9A 4LV1A 3N8SA 4KZ4A 3VFHA 3HVFA 2ZLYA 5CGSA 5EOEA 3SS4A 3PBQA 2HDSA 1KE4A 3EQVA 2B5RA 3IWIA 3C4PA 5CTNA 1KE0A 3UDXA 3UPPA 4KZ5A 2EX6A 3BFDA 5M19A 1O07A 4DE2A 4DE1A 3E2KA 4K0WA 3CJMA 1RCJA 1XA1A 4MBKA 1RP5A 1M40A 4NK3A 4OQ0A 5EUAA 3OCLA 5EVIA 2ZC4B 4GKUA 2EFUA 4FCFA 3Q07A 4KG2A 4OH0A 2ZC5B 4BL3A 4R3JA 3FV7A 4R4SA 1NZOA 1YT4A 4JF5A 1LHYA 2ZQ9A 4OVDA 5F1GA 5GHZA 3RXXA 4KG6A 4RX2A 1CI9A 4KZ3A 2JE5A 3W4OA 3EQUA 2IWBA 5FI6A 1XA7A 2P9VA 3UO9A 3VP2A 1FR6A 3ZVTA 2C6WB 4OOLA 1NYYA 2P74A 5EPHA 3UPNA 2OLUA 1EI5A 3G2ZA 3BEBA 3ZFZA 3A3IA 1NRFA 4RVAA 1M6KA 4E3NA 5M1AA 3ZNYA 1W7FA 1L0EA 4WEJA 3G32A 3V3SA 4S2NA 3WS0A 4BD1A 1CK3A 1SHVA 1FCNA 5KMWA 5M18A 4DRTA 5I94A 4R1GA 4OQIA 3WS2A 1K57A 3SS5A 1W8YA 4PPRA 2XQZA 4N92A 2XD1A 3O86A 5JYPA 2OSUA 5DTSA 5CHUA 3CMZA 4WMCD 3AGDA 1XP4A 3BRMA 3Q7ZA 1XGIA 5BOHA 4WELA 5FQMA 1WE4A 1FSWA 3VP0A 4KZBA 3IHBA 1ES5A 1YMXA 4HESA 5GLCA 1L0DA 5KSCA 2DNSA 2E8IA 4OKPA 4IVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H0Y A;  3N4I A;  1L0F A;  2R9W A;  2J9O A;  4OQH A;  3PBN A;  5FAT A;  4H8R A;  2VGJ A;  5E43 A;  3Q7V A;  1ERO A;  4DXC A;  4Y0O A;  5G18 A;  2WKE A;  3AGE A;  5FA7 A;  1K55 C;  4BQM A;  3UDI A;  1PI5 A;  3M2K A;  3FKV A;  1L2S A;  3CZD A;  3HLW A;  4UA6 A;  4PM5 A;  1N4O A;  2XH9 A;  1RGY A;  1PW1 A;  4IVI A;  4S2O A;  1MWR A;  4P0M A;  4DKI A;  2XR0 A;  4JXS A;  2OV5 A;  4RYE A;  3PBS A;  4LV3 A;  4BLM A;  1KVL A;  2ZC3 B;  4XUX A;  5L2F A;  1GCE A;  5E2G A;  5HAP A;  5GHY A;  4B4X A;  2XD5 A;  3O3V A;  4N9K A;  5CHM A;  2Y4A A;  4YFM A;  3ZVW A;  1JVJ A;  3SH7 A;  4MEZ A;  2Y2L A;  3TOI A;  2A49 A;  1ZG4 A;  5CTM A;  1GHM A;  1H5X A;  3ZNT A;  1ONH A;  3NY4 A;  5FDH A;  1PWD A;  1PWG A;  3VSK A;  3ZG7 B;  4R4R A;  5A93 A;  4GDB A;  1S0W A;  1FCM A;  2EX9 A;  3D4F A;  1J9M A;  1KGE A;  1MBL A;  3E2L A;  4GDN A;  1ERM A;  3SOI A;  2C5W B;  5A92 A;  3IT9 A;  4LCM A;  4PM6 A;  3P98 A;  4ZAM A;  1K54 A;  5HW3 A;  1O7E A;  4N1H A;  1YQS A;  3G30 A;  4S2K A;  1JWV A;  1G68 A;  1YM1 A;  2Y2I A;  5EEC A;  4BJP A;  4S2L A;  3ZG8 B;  1K4E A;  1Q2Q A;  1FR1 A;  3W4P A;  2HPB A;  3HRE A;  5FAP A;  2Y2N A;  2WZX A;  3QNB A;  4X68 A;  1K56 A;  1ES4 A;  4K91 A;  1QME A;  5TFQ A;  3G35 A;  3G4P A;  3M2J A;  4FD8 A;  1KDS A;  4JBF A;  1E4D A;  4LV0 A;  3HL9 A;  1ES3 A;  5U47 A;  4MNR A;  3MXR A;  2JC7 A;  4EBP A;  3ZDJ A;  3NBL A;  2IWD A;  1FQG A;  3HLG A;  4OP8 A;  4QY6 A;  3GR2 A;  4BD0 A;  3VOZ A;  4GZB A;  4DDY A;  4F94 A;  1TVF A;  2Y59 A;  1XX2 A;  3OPH A;  5IHV A;  3ZG9 B;  4B4Z A;  1BUE A;  5CHJ A;  1YLT A;  2XDM A;  1PIO A;  4QU3 A;  1DJA A;  2HDU A;  4JLF A;  2Y2G A;  2Q9M A;  3MZF A;  4BEN A;  2WAD A;  4IBX A;  4OPQ A;  2HP5 A;  1PZO A;  1RGZ A;  3FWL A;  3SH8 A;  2HP9 A;  4HEF A;  1G6A A;  4XXR A;  3BLM A;  3LO7 A;  3UNW A;  1K4F A;  3VMA A;  3DWZ A;  5A91 A;  3ZHH A;  2WKH A;  2Z2L B;  3N8L A;  1HZO A;  1LL5 A;  2V20 A;  4JF4 A;  4OON A;  5FQK A;  3VSL A;  5E2H A;  4JXV A;  3UE1 A;  5FQ9 A;  5CGW A;  3WS1 A;  4DDS A;  3BLS A;  1YLZ A;  2Z2M B;  3TSG A;  2X71 A;  1GHP A;  4WZ5 A;  5F1F A;  1W79 A;  1EWZ A;  1TDG A;  1FSY A;  1ESU A;  2XEP A;  3S4X A;  3VOY A;  3MKE A;  1QMF A;  4IBR A;  4ZJ3 A;  4A5R A;  3MKF A;  4WZ4 A;  4E3M A;  4KZ9 A;  3PBR A;  4Q8I A;  4C75 A;  1MWS A;  3DTM A;  3O88 A;  3HLB A;  4QJG A;  4R0Q A;  3OC2 A;  4GN2 A;  2XGN A;  3GVB A;  5EVI B;  3BFF A;  4OPY A;  3GMW A;  3SS3 A;  5D3O A;  4EBN A;  1DY6 A;  4OLD A;  1IEL A;  3OPR A;  5E2E A;  2HDR A;  4S2N C;  4N9L A;  1AXB A;  3MZD A;  1K57 C;  1K6R A;  2Y2J A;  3GTC A;  1CEG A;  2ZM2 A;  3LY4 A;  4JKT A;  5F82 A;  3NDE A;  3PAG A;  1ERQ A;  5GLB A;  1I5Q A;  1NY0 A;  3MXS A;  3UN7 A;  2ZC7 A;  4QY5 A;  2XLN A;  2ZC6 B;  2WK0 A;  2P9V B;  1E3U D;  5GL9 A;  5GLA A;  1KVM A;  2J8Y A;  1HVB A;  4UA9 A;  4EQI A;  1DJC A;  4OOY A;  4E6X A;  4EUZ A;  5KSH A;  3UE3 A;  4KZ6 A;  5FSR A;  1IYP A;  3IQA A;  3Q81 A;  4WBG A;  5FI2 A;  4LCL A;  3UDF A;  1CEF A;  1JWZ A;  1OME A;  3QHY A;  3HLD A;  5KZH A;  1BSG A;  1SDN A;  4U0X A;  3A3E A;  4PM8 A;  4QB8 A;  1IKG A;  4C6Y A;  5DF8 A;  3A3J A;  4HBU A;  4RX3 A;  1Z6F A;  3ISG A;  3IWO A;  4Y7P A;  4DXB A;  3NC8 A;  1LI9 A;  2ZQC A;  4KZA A;  3IF5 A;  2ZQA A;  3ZG0 A;  4E6W A;  4X56 A;  4CPK A;  1FOF A;  2R9X A;  1L0G A;  1MXO A;  4MBH A;  1FCO A;  4UAA A;  2WYX A;  5CER A;  4OOM A;  4D2O A;  2Y2K A;  5FI7 A;  1ZKJ A;  4M3K A;  2QMI A;  2Y2P A;  4LEN A;  1KE3 A;  2XFS A;  2Y2O A;  3Q7V B;  4CJN A;  2ZM8 A;  1IYO A;  1KGG A;  1LLB A;  3IXG A;  4OQG A;  5AQ9 A;  3IF6 A;  4X53 A;  1YLW A;  1WYB A;  2ZMA A;  4R3B A;  1KGF A;  1Q2P A;  4QD4 A;  5DTK A;  3IH9 A;  3RXW A;  4OPR A;  1I2W A;  2EFX A;  2Q9N A;  4JPM A;  3GQZ A;  1IEM A;  5CEB A;  4B88 A;  2G2W A;  3HUM A;  5EVI D;  5FQQ A;  5HL1 A;  2JCH A;  4GOG A;  1W8Q A;  1GA0 A;  3C5A A;  3I7J A;  1MWU A;  2Y55 A;  3Q82 A;  3M6B A;  5AQ7 A;  4U3T A;  4EBL A;  1BLP A;  3BFE A;  3LCE A;  3VFF A;  2ZQD A;  1K54 C;  3V39 A;  4NET A;  2ZM0 A;  2BG1 A;  4Z9Q A;  3PAE A;  5EE8 A;  3IXH A;  1JWP A;  1SCW A;  3S22 A;  3VP4 A;  3UE0 A;  1PI4 A;  2PU2 A;  3IH8 A;  3WWX A;  4KZ8 A;  1BLC A;  3DW0 A;  5TR7 A;  2ZQ8 A;  4YIN A;  3OCN A;  5CED A;  1NJ4 A;  4KQQ A;  5F83 A;  3V50 A;  4Y0T A;  1S6R A;  2PBY A;  4N1X A;  3HLE A;  3UY6 A;  1C3B A;  3HLC A;  4ZJ1 A;  4L0L A;  3VP1 A;  1XPB A;  4X69 A;  1H8Y A;  5J8X A;  1IYS A;  4DE3 A;  4ZDX A;  1HD8 A;  2XF3 A;  1DJB A;  2Y2Q A;  2DRW A;  2IWC A;  3Q1F A;  4X55 A;  5GLD A;  4GD8 A;  1IYQ A;  1XGJ A;  4P87 A;  1LI0 A;  4OLG A;  5DVA A;  4JXG A;  1E25 A;  1U60 A;  2HDQ A;  3BM6 A;  3N6I A;  3IF6 B;  1TDL A;  3W4Q A;  3N8R A;  3WRT A;  3ZCZ A;  1MPL A;  4BL2 A;  1BZA A;  1BTL A;  4FH4 A;  3UPO A;  3SH9 A;  3BFC A;  3FZC A;  5EVI C;  3A3D A;  4E3J A;  5HAQ A;  1SDE A;  1ALQ A;  1ESI A;  4EWF A;  1CI8 A;  5AQB A;  1MY8 A;  1PW8 A;  1PWC A;  1NZU A;  2H0T A;  2OLV A;  5DF9 A;  1LL9 A;  4MLL A;  1PZP A;  2RL3 A;  1Y54 A;  2A3U A;  1VM1 A;  2EXB A;  1MWT A;  4FSF A;  3MBZ A;  1NXY A;  2EX8 A;  5CGX A;  2H5S A;  2XFT A;  3NDG A;  2EX2 A;  5HFO A;  1ES2 A;  1JTG A;  1YMS A;  4E3L A;  4S2M A;  3FYZ A;  5TGF A;  2WAE A;  3TG9 A;  3LY3 A;  1SKF A;  2JBF A;  3S1Y A;  4DF6 A;  4EV4 A;  4GB7 A;  4KQR A;  3PTE A;  3VP3 A;  2FFY A;  2WGW A;  4WZ5 C;  1HTZ A;  4C3Q A;  4WEK A;  5CRF A;  2Y2M A;  2G2U A;  3DWK A;  3NCK A;  2WUQ A;  2WAF A;  4OP5 A;  4PM7 A;  5E2F A;  5AQA A;  1VQQ A;  2WKI A;  5JYO A;  4U0T A;  3GRJ A;  2CC1 A;  3PBT A;  3IWQ A;  4X6T A;  4S2I A;  3WRZ A;  5FAS A;  3ITB A;  2GDN A;  4HBT A;  1ZC2 A;  1K55 A;  2RCX A;  4O7D A;  3V3R A;  1I2S A;  1TEM A;  4KG5 A;  4E3O A;  3B3X A;  3C7U A;  1WYC A;  4IED A;  5DTT A;  1YLJ A;  2WGV A;  5HX9 A;  3ZG5 A;  4FH2 A;  2FFF B;  1H8Z A;  2ZJ9 A;  1YLP A;  1KDW A;  5CEC A;  2UWX A;  4R23 A;  1BLH A;  3PBO A;  4QHC A;  5CXW A;  4KQO A;  4WM9 A;  4JF6 A;  2V2F F;  2QZ6 A;  3LEZ A;  3BEC A;  3QNC A;  1ONG A;  4DE0 A;  3C7V A;  4GNU A;  4RA7 A;  4WMC A;  4P85 A;  2EXA A;  5A90 A;  3O87 A;  3IXD A;  3N7W A;  1XXM A;  4GD6 A;  3GV9 A;  3HUN A;  3P09 A;  3AGF A;  5EOO A;  3IXB A;  3FKW A;  1ZG6 A;  4ZTK A;  3WS4 A;  4MBF A;  4KZ7 A;  2J7V A;  2WGW B;  1XKZ A;  4OPZ A;  3V5M A;  5HAI A;  1K56 D;  4WYY A;  4XUZ A;  1GA9 A;  3OZH A;  5FQI A;  1GHI A;  3ITA A;  2H10 A;  1BT5 A;  1BLS A;  2X02 A;  2Y91 A;  1E3U A;  3WS5 A;  5DF7 A;  1N9B A;  2I72 A;  3M6H A;  3MFD A;  3G34 A;  3HBR A;  4S2J A;  3OPP A;  2DCF A;  3A3F A;  1W5D A;  2QPN A;  2ZD8 A;  4LV2 A;  2Y2H A;  5EVL A;  4E3I A;  3W8K A;  4Y0U A;  1IKI A;  1JTD A;  2WGI A;  5GHX A;  1PYY A;  3NIA A;  3HUO A;  2BLS A;  2ZQ7 A;  3IHA A;  3JYI A;  2J9P A;  4ID4 A;  4JXW A;  4PM9 A;  4UHU A;  3GSG A;  2HP6 A;  1BUL A;  2XK1 A;  4K0X A;  2PU4 A;  2WZZ A;  3OPL A;  4PMA A;  3G31 A;  1YLY A;  2VGK A;  1K38 A;  3CG5 A;  3HLF A;  3BYD A;  4S2P A;  4UA7 A;  3IF6 C;  1NYM A;  5HAR A;  4P6B A;  3G2Y A;  4ZJ2 A;  3ZGA B;  5FAQ A;  4KEN B;  5FQJ A;  4E3K A;  4ZBE A;  3BFG A;  3RJU A;  2V1Z A;  3C4O A;  1K6S A;  1MKI A;  3MZE A;  5FAO A;  2X01 A;  1K25 A;  3NI9 A;  4LV1 A;  3N8S A;  4KZ4 A;  3VFH A;  3HVF A;  2ZLY A;  5CGS A;  5EOE A;  3SS4 A;  3PBQ A;  2HDS A;  1KE4 A;  3EQV A;  2B5R A;  3IWI A;  3C4P A;  5CTN A;  1KE0 A;  3UDX A;  3UPP A;  4KZ5 A;  2EX6 A;  3BFD A;  5M19 A;  1O07 A;  4DE2 A;  4DE1 A;  3E2K A;  4K0W A;  3CJM A;  1RCJ A;  1XA1 A;  4MBK A;  1RP5 A;  1M40 A;  4NK3 A;  4OQ0 A;  5EUA A;  3OCL A;  5EVI A;  2ZC4 B;  4GKU A;  2EFU A;  4FCF A;  3Q07 A;  4KG2 A;  4OH0 A;  2ZC5 B;  4BL3 A;  4R3J A;  3FV7 A;  4R4S A;  1NZO A;  1YT4 A;  4JF5 A;  1LHY A;  2ZQ9 A;  4OVD A;  5F1G A;  5GHZ A;  3RXX A;  4KG6 A;  4RX2 A;  1CI9 A;  4KZ3 A;  2JE5 A;  3W4O A;  3EQU A;  2IWB A;  5FI6 A;  1XA7 A;  2P9V A;  3UO9 A;  3VP2 A;  1FR6 A;  3ZVT A;  2C6W B;  4OOL A;  1NYY A;  2P74 A;  5EPH A;  3UPN A;  2OLU A;  1EI5 A;  3G2Z A;  3BEB A;  3ZFZ A;  3A3I A;  1NRF A;  4RVA A;  1M6K A;  4E3N A;  5M1A A;  3ZNY A;  1W7F A;  1L0E A;  4WEJ A;  3G32 A;  3V3S A;  4S2N A;  3WS0 A;  4BD1 A;  1CK3 A;  1SHV A;  1FCN A;  5KMW A;  5M18 A;  4DRT A;  5I94 A;  4R1G A;  4OQI A;  3WS2 A;  1K57 A;  3SS5 A;  1W8Y A;  4PPR A;  2XQZ A;  4N92 A;  2XD1 A;  3O86 A;  5JYP A;  2OSU A;  5DTS A;  5CHU A;  3CMZ A;  4WMC D;  3AGD A;  1XP4 A;  3BRM A;  3Q7Z A;  1XGI A;  5BOH A;  4WEL A;  5FQM A;  1WE4 A;  1FSW A;  3VP0 A;  4KZB A;  3IHB A;  1ES5 A;  1YMX A;  4HES A;  5GLC A;  1L0D A;  5KSC A;  2DNS A;  2E8I A;  4OKP A;  4IVK A; 
#chains in the Genus database with same CATH topology
 4I3J A;  3N4I A;  2R9W A;  4BBT A;  3IS2 B;  3KSF A;  1H8M A;  3PBN A;  5FAT A;  3Q7V A;  1YAX A;  3P01 A;  4EEU A;  2Y8H A;  1K55 C;  2J80 A;  1VET A;  3CZD A;  1J3W A;  5HD3 A;  4IVI A;  4S2O A;  2XR0 A;  4DN0 A;  2CMN A;  4LV3 A;  5L2F A;  1S4S A;  5E2G A;  2JKR M;  3O3V A;  4N9K A;  1NLY A;  3SH7 A;  1OTI A;  1ZG4 A;  1H5X A;  1XJ2 A;  3BQA A;  1PWG A;  4BMW A;  2EX9 A;  4EQ1 A;  1J9M A;  3DTK A;  3GEC A;  5A92 A;  4LCM A;  5F68 A;  4ZAM A;  3DTE A;  2P08 A;  1YQS A;  3G30 A;  4S2K A;  1JWV A;  2Y2I A;  4EER A;  2HZ5 A;  1FR1 A;  3HRE A;  4GHI B;  3QP1 A;  3D72 A;  2V1B A;  1TS6 A;  2BAS A;  4K91 A;  1QME A;  4M4X A;  3G35 A;  4JBF A;  1E4D A;  3FC7 A;  5HWW A;  4MNR A;  4D60 A;  3MFX A;  2Y79 A;  1STZ A;  3KSG A;  3O5Y A;  4GW9 A;  2IWD A;  1FQG A;  4OP8 A;  3VE4 A;  4FUW A;  2W3G A;  4F94 A;  3T1Q B;  3KYZ A;  2XDM A;  2Y2G A;  4I5S A;  3MZF A;  4IBX A;  4OPQ A;  3FWL A;  4HEF A;  3LO7 A;  3RTY A;  3MJQ A;  3ZHH A;  2V8F A;  2WKH A;  2LB9 A;  1LL5 A;  3UE1 A;  2OAQ 1;  4DDS A;  3V67 A;  1G28 A;  2IA2 A;  2NUT C;  2X71 A;  1FSY A;  3S4X A;  3VOY A;  2GX5 A;  4ZJ3 A;  4II7 A;  4WZ4 A;  3BY8 A;  3O88 A;  4GN2 A;  2XGN A;  1DY6 A;  1BYW A;  1IEL A;  3E98 A;  3MZD A;  2XA7 M;  1K57 C;  3GTC A;  1CEG A;  2ZM2 A;  3F1N A;  3PAG A;  2YKF A;  1NY0 A;  4L9E A;  2XLN A;  2WK0 A;  2P9V B;  2PHY A;  5GLA A;  1FIL A;  4UA9 A;  4HP4 A;  4HIA A;  4KZ6 A;  3Q81 A;  3IQA A;  1VEU A;  2JKG A;  2H28 A;  5FL3 A;  1CEF A;  1OME A;  1ODV A;  4HJ3 A;  4PM8 A;  3NEC A;  1IKG A;  4C6Y A;  4P6Z M;  3ISG A;  3IWO A;  4WUJ A;  3IX4 A;  3LEQ A;  4KZA A;  2ZMF A;  4E6W A;  1OTA A;  5G4Z A;  3DAV A;  4MBH A;  1DP9 A;  4HNB A;  1EW0 A;  4D2O A;  3IBR A;  5FI7 A;  3HJI A;  2Y2P A;  3CHW P;  4LEN A;  1KE3 A;  1IYO A;  1KGG A;  4OQG A;  5AVF A;  3IF6 A;  1YLW A;  3B33 A;  2V1A A;  4QD4 A;  5DTK A;  4ARZ A;  2PRF A;  4O8G A;  3RXW A;  1I2W A;  1H0M A;  4EU0 A;  3M6B A;  4U3T A;  3VFF A;  2ZQD A;  1K54 C;  4NET A;  2ZM0 A;  4Z9Q A;  1XJ6 A;  3KSI A;  3IBJ A;  3S22 A;  1PI4 A;  3OCN A;  4GLQ A;  1S6R A;  2PBY A;  5G4Y A;  3FPW A;  1C3B A;  3LGO A;  5C5K A;  3VP1 A;  4X1M A;  1H8Y A;  1IYS A;  1HD8 A;  2XF3 A;  3Q1F A;  2DRW A;  5GLD A;  4X55 A;  4BWI A;  4R38 A;  4P87 A;  5DVA A;  4JXG A;  4BL2 A;  1TDL A;  3N8R A;  1MPL A;  4X25 A;  3CLO A;  5EVI C;  4HI4 A;  4FTX A;  1GSV A;  4G3K A;  1S66 L;  3JVV A;  5DF9 A;  2EXB A;  3LIF A;  3K3C A;  2EX8 A;  2XFT A;  1JTG A;  1YMS A;  4S2M A;  2WAE A;  4EV4 A;  3PTE A;  3VP3 A;  4WZ5 C;  3DWK A;  2WUQ A;  5AQA A;  5E2F A;  1VQQ A;  5JYO A;  3UB8 A;  2GDN A;  4O7D A;  3B3X A;  3C7U A;  3RH8 B;  5DTT A;  1YLJ A;  1CF0 A;  2VGL M;  4QHC A;  4WM9 A;  2QZ6 A;  2A24 B;  3BEC A;  1ONG A;  1T19 A;  2QHK A;  4DMZ A;  4EW7 A;  3UE6 A;  1XJ3 A;  1P97 A;  3TRC A;  3FKW A;  4CQH A;  3BW6 A;  1GA9 A;  1BLS A;  1W63 M;  2D01 A;  1N9B A;  1OTE A;  2QPN A;  3W8K A;  3LIE A;  2ZQ7 A;  5HPF A;  3FG8 A;  3OPL A;  1K38 A;  3BYD A;  2XRO A;  5J4E A;  1D1J A;  2M1C A;  4KEN B;  2V1Z A;  3MZE A;  1K6S A;  2X01 A;  1S4R A;  5EOE A;  2ZOI A;  3EQV A;  2B5R A;  3IWI A;  3C4P A;  5TJJ A;  4AFI A;  1PRQ A;  2GJ3 A;  4KZ5 A;  4B9O A;  1MKM A;  2EX6 A;  3BFD A;  1L3L A;  4DE2 A;  3CJM A;  1XA1 A;  5EVI A;  4PKY G;  4CLC C;  4F3L B;  3MF0 A;  4OH0 A;  2ZC5 B;  4BL3 A;  2AVX A;  3NUL A;  1XA7 A;  3PR6 A;  4E3N A;  3ZNY A;  1W63 Q;  3G32 A;  3BJN A;  4QWO A;  2PYR A;  5M18 A;  5I94 A;  3WS2 A;  5AVE A;  3SS5 A;  3JVU A;  2HF6 A;  4MN5 A;  5DKL A;  3Q7Z A;  1XGI A;  5BOH A;  3T4Q A;  5KSC A;  2L1M A;  2DNS A;  4P6Z S;  4H8R A;  1LSW A;  4WF0 A;  1PI5 A;  4HH3 A;  3HLW A;  4UA6 A;  4PM5 A;  1RGY A;  3H82 B;  4P0M A;  4BLM A;  1KVL A;  1GCE A;  5HAP A;  2L4R A;  3T4O A;  2VA0 A;  3TOI A;  2A49 A;  1GHM A;  5FDH A;  1PWD A;  5L07 A;  1UWN X;  5A93 A;  2JKF A;  4GDB A;  1S0W A;  1FCM A;  3CIT A;  3NJA A;  3MR0 A;  3SOI A;  3F1P A;  3IT9 A;  5F6A A;  4PM6 A;  3P98 A;  4N1H A;  1TS0 A;  2ZL1 B;  4GCZ A;  1T1C A;  4S2L A;  1K4E A;  1VET B;  3W4P A;  5FAP A;  2J3T C;  3NHQ A;  2BTF P;  4FD8 A;  1TS7 A;  4RQ9 A;  4EXO A;  4MMN A;  3NBL A;  3CWF A;  2V0W A;  4QY6 A;  3GR2 A;  4BD0 A;  3UME A;  4PKY A;  1G6O A;  3T1R A;  3ZG9 B;  1BUE A;  5CHJ A;  1YLT A;  2VKS A;  5HZH A;  4QU3 A;  2HDU A;  1H3Q A;  3LFV A;  4BEN A;  1P9W A;  3TE8 A;  2HP9 A;  4XXR A;  1K4F A;  5E2H A;  5CGW A;  2GNX A;  3EEH A;  3WS1 A;  3ULF A;  3BLS A;  1YLZ A;  1EWZ A;  1ESU A;  2XEP A;  4IBR A;  4KQD A;  1GSX A;  3MKF A;  5AJG A;  4C75 A;  1MWS A;  1DRM A;  2VV6 A;  5I5L A;  3GVB A;  1HLU P;  3GMW A;  2J3W A;  3E4O A;  5E2E A;  2HDR A;  4N9L A;  1UWP X;  1K6R A;  4JKT A;  5F82 A;  4I38 A;  2ZC7 A;  3OLO A;  5GL9 A;  1D7E A;  3QP6 A;  4EQI A;  3MMH A;  1A0K A;  1DJC A;  4E6X A;  4EUZ A;  2K2N A;  4NKP A;  5KZH A;  3NOU C;  4H6J B;  4QB8 A;  4HBU A;  4RX3 A;  1YKD A;  4Y7P A;  2VK3 A;  3D3O A;  3ZG0 A;  2YKH A;  4X56 A;  4CPK A;  2O0Y A;  2R9X A;  5CER A;  2Y2K A;  4HJ6 A;  2KDK A;  2L0W A;  2XFS A;  1N9N A;  2ZM8 A;  3PHY A;  4LFU A;  2ZMA A;  4R3B A;  3OOV A;  2A2L A;  2EFX A;  3JPU A;  1IEM A;  2G2W A;  1TS8 A;  1VEU B;  2PR6 A;  2PBD P;  3I7J A;  1MWU A;  2Y55 A;  4EBL A;  1BLP A;  3BFE A;  3LCE A;  2BG1 A;  5EE8 A;  5TBM A;  1ZHH B;  3UE0 A;  2W0N A;  1IFQ A;  2W3H A;  2QJ7 A;  4YIN A;  1NJ4 A;  1MZU A;  3HLC A;  4NXB A;  2R78 A;  5HDD A;  1U60 A;  2PAV P;  3N6I A;  3IF6 B;  5MC7 A;  3ZCZ A;  1BZA A;  1BTL A;  3UPO A;  3L9K A;  1MC0 A;  3SH9 A;  2KOI A;  2Q0O A;  5J3W A;  1ALQ A;  1PWC A;  3SZT A;  1NZU A;  2H0T A;  1LL9 A;  2OWH A;  4MLL A;  1PZP A;  2RL3 A;  1Y54 A;  2A3U A;  2V9A A;  3C2W A;  5L8M A;  1MWT A;  4FSF A;  3MBZ A;  5CGX A;  1DP8 A;  2H5S A;  3NDG A;  2EX2 A;  5HFO A;  3T4T A;  1SKF A;  1S67 L;  4KQR A;  3K2N A;  2PD7 A;  2FFY A;  2WGW A;  4NXE A;  1HTZ A;  3MQ0 A;  4WEK A;  2Y2M A;  2G2U A;  2O99 A;  3QP8 A;  4OP5 A;  4PM7 A;  1SZV A;  2CC1 A;  3WRZ A;  4S2I A;  2EA9 A;  1K55 A;  1WYC A;  2WGV A;  4FH2 A;  1H8Z A;  1YLP A;  3DBA A;  4R23 A;  3PBO A;  3KYE A;  3LEZ A;  4RA7 A;  4ETZ A;  3O87 A;  5K5B A;  4GHI A;  2FH5 A;  2OOL A;  3IXB A;  4ZTK A;  3T1X A;  3WS4 A;  4MBF A;  3A0R A;  4OPZ A;  3R4K A;  4XUZ A;  3OZH A;  5FQI A;  2B02 A;  2H10 A;  2Y91 A;  1VHM A;  1E3U A;  5DF7 A;  2GZA A;  3MFD A;  3A3F A;  1W5D A;  5EVL A;  4O0P A;  3A0S A;  1IKI A;  1PYY A;  3JYI A;  4PM9 A;  3GSG A;  1BUL A;  5HL6 A;  3T4J A;  2PU4 A;  3F1O A;  3R7W A;  2WZZ A;  4PMA A;  4R3A A;  1YLY A;  4P6B A;  3RJU A;  5FAO A;  1K25 A;  3NI9 A;  1P9R A;  4KZ4 A;  3HVF A;  4LRX C;  3PBQ A;  2HDS A;  1KE4 A;  1CJF A;  5CTN A;  4Y17 A;  3UB7 A;  3UPP A;  2D02 A;  3E2K A;  4K0W A;  5EVE A;  4MBK A;  4NXG A;  1M40 A;  1F98 A;  3OCL A;  1S1Z A;  2ZC4 B;  2UV0 E;  4GKU A;  2EFU A;  4FCF A;  3Q07 A;  4R3J A;  3FV7 A;  1NZO A;  1YT4 A;  2FZ0 A;  4KUO A;  1F5M A;  3VV4 A;  3VP2 A;  2P9V A;  3UO9 A;  4OOL A;  2P74 A;  3UPN A;  3BEB A;  1N9L A;  1NRF A;  2PR5 A;  4DJ3 A;  5M1A A;  2V8C A;  3D9Y A;  3RFB A;  4R1G A;  4OQI A;  4BBU A;  1K57 A;  1W8Y A;  3B42 A;  4ETX A;  4PPR A;  2XD1 A;  5LBR A;  3T4S A;  3BRM A;  1P0Z A;  4WEL A;  1WE4 A;  4MN6 A;  1FSW A;  2O9A A;  1YMX A;  2QWS A;  2VJW A;  1L0D A;  1NYY A;  2H0Y A;  1UGU A;  2VGJ A;  1ERO A;  5FA7 A;  3UDI A;  1L2S A;  4LPZ A;  4PHT A;  1OJG A;  1MWR A;  4JXS A;  4RYE A;  2ZC3 B;  4XUX A;  3CUE C;  2V0U A;  1XJ4 A;  5GHY A;  4B4X A;  5CHM A;  2XSS A;  4YFM A;  4MEZ A;  2Y2L A;  4JGO A;  3NY4 A;  3VSK A;  4HJ4 A;  2HJE A;  1KGE A;  1MBL A;  4GDN A;  3BY9 A;  1K54 A;  1O7E A;  2DMW A;  1K0K A;  5HWV A;  3ZG8 B;  1OTD A;  1Q2Q A;  2MJ6 A;  2Y2N A;  3QNB A;  1K56 A;  1ES4 A;  1T18 A;  3M2J A;  1KDS A;  3HL9 A;  5U47 A;  2QYB A;  3H7W A;  1NWZ A;  3A0V A;  3ZDJ A;  1ZTU A;  3HLG A;  2WKP A;  3LIA A;  4GZB A;  2Y59 A;  4B4Z A;  1PIO A;  3SH8 A;  1PZO A;  1RGZ A;  3BLM A;  3UNW A;  3DWZ A;  2Z2L B;  4OON A;  3LR4 A;  5FQ9 A;  4HH2 A;  4LRY C;  5KIZ A;  1IOU A;  1JNU A;  2Z2M B;  3TSG A;  4WZ5 A;  1W79 A;  2EWW A;  1TDG A;  2ZBB A;  3C38 A;  3MKE A;  1QMF A;  4ME4 A;  5IU1 A;  4E3M A;  4KZ9 A;  5DJU A;  3PBR A;  1LL8 A;  3GDI A;  3HLB A;  3OC2 A;  4Y2F A;  3BFF A;  3SS3 A;  3H9W A;  2JKT I;  4I3A A;  5EV0 A;  4GS9 B;  4S2N C;  1KOU A;  4Y13 A;  3NDE A;  1I5Q A;  3MXS A;  4MN7 A;  4QY5 A;  4CLC E;  2ZC6 B;  1KVM A;  2J8Y A;  2WKQ A;  4OOY A;  5KSH A;  2B18 A;  3UE3 A;  3EOI A;  5FSR A;  1IYP A;  4WBG A;  1V9Z A;  4LCL A;  3QHY A;  1BSG A;  2W1T A;  1TD5 A;  4EET B;  4DXB A;  2ZQC A;  2ZQA A;  5HDC A;  3CPT A;  1FOF A;  4UAA A;  2WYX A;  1OT6 A;  4OOM A;  5DFY A;  1ZKJ A;  3T12 B;  1LT0 A;  2Y2O A;  3Q7V B;  3IXG A;  5AQ9 A;  4XT2 A;  4OPR A;  5CEB A;  4EEP A;  3GQZ A;  4F3L A;  4B88 A;  5EVI D;  5FQQ A;  5HL1 A;  4LLO B;  2JCH A;  1D06 A;  1GA0 A;  1NRJ A;  3Q82 A;  5FEG A;  3V39 A;  5FDS A;  4YWZ A;  4X1L A;  3IXH A;  4WN5 A;  1SCW A;  4NG2 A;  2QKP A;  3IH8 A;  3DW0 A;  5TR7 A;  4KQQ A;  4I39 A;  4CLC A;  3HLE A;  4L0L A;  5A8B A;  4DE3 A;  4ZDX A;  1DJB A;  4GD8 A;  4OLG A;  3BM6 A;  4JGP A;  3WRT A;  5F69 A;  2Z6D A;  2LB5 A;  3FZC A;  5HAQ A;  4E3J A;  2ZOH A;  1SDE A;  4LGW A;  1CI8 A;  1MY8 A;  3ZQ5 A;  3QP4 A;  1VM1 A;  1S1Y A;  1NXY A;  3UB5 P;  3E4P A;  1ES2 A;  4E3L A;  5FEF A;  3FYZ A;  3TG9 A;  2JBF A;  1OJ5 A;  2EWV A;  3TJZ C;  4C3Q A;  5CRF A;  5DFX A;  2WAF A;  2WKI A;  4EUV A;  3GRJ A;  3PBT A;  3IWQ A;  4X6T A;  1ZC2 A;  3V3R A;  4E04 A;  1I2S A;  1TEM A;  4KG5 A;  3LI9 A;  4FOF A;  4Q0I A;  5HX9 A;  2FFF B;  2ZJ9 A;  2UWX A;  1BLH A;  5CXW A;  3MQO A;  4DE0 A;  3QNC A;  3C7V A;  4GNU A;  3T4L A;  4PAU A;  3TW8 A;  2EXA A;  5A90 A;  2JKT M;  2ZL1 A;  3IXD A;  4GD6 A;  2VEA A;  3IX3 A;  3AGF A;  5EOO A;  5HSQ A;  1ZG6 A;  2WGW B;  3OBF A;  4WYY A;  2I9V A;  3ITA A;  1BT5 A;  3F1N B;  2X02 A;  3LYX A;  2HV1 A;  1FIK A;  3M6H A;  4S2J A;  3OPP A;  2ZD8 A;  3LIC A;  1SKO A;  4Y0U A;  4CLC D;  1JTD A;  2WGI A;  5EM1 A;  2BLS A;  4ID4 A;  2J9P A;  4HOI A;  3EGD C;  2HP6 A;  2W3D A;  2XK1 A;  4K08 A;  3HJK A;  3G31 A;  2VGK A;  3CG5 A;  3HLF A;  4ESP A;  4S2P A;  3IF6 C;  3S7P A;  5HWT A;  3G2Y A;  4ZJ2 A;  5FAQ A;  5L10 A;  4ZBE A;  3BFG A;  2QJ5 A;  1MKI A;  4LV1 A;  3VFH A;  2K7S A;  2ZLY A;  2W1R A;  1KE0 A;  5DKK A;  3UDX A;  5HDS A;  1OT9 A;  2OAP 1;  5M19 A;  3U4L P;  4DE1 A;  4R6L A;  1RCJ A;  4ARZ B;  1RP5 A;  2W27 A;  4NK3 A;  4OQ0 A;  1Z09 A;  4UQI M;  3KYQ A;  1PFL A;  4R4S A;  4JF5 A;  4NXF A;  1LHY A;  3IS2 A;  3F1O B;  3R7W B;  2ZQ9 A;  2INW A;  5F1G A;  5GHZ A;  5CX7 A;  4IHQ A;  4KG6 A;  1CI9 A;  4KZ3 A;  3W4O A;  3EQU A;  1FR6 A;  3ZVT A;  3ZFZ A;  3A3I A;  1M6K A;  4GJ4 A;  3MQQ A;  5KMW A;  4BD1 A;  2VX8 A;  1SHV A;  4DRT A;  4H6J A;  2XQZ A;  3CMZ A;  3AGD A;  1XP4 A;  2W3E A;  5FQM A;  4MCW A;  3VP0 A;  3IHB A;  1ES5 A;  4HES A;  4IVK A;  1L0F A;  2J9O A;  4OQH A;  5E43 A;  4DXC A;  4Y0O A;  5G18 A;  2WKE A;  3AGE A;  4BQM A;  3UB9 A;  3M2K A;  3HCY A;  3FKV A;  2K31 A;  1N4O A;  2XH9 A;  2J3T D;  1PW1 A;  4DKI A;  2OV5 A;  3PBS A;  1Y4O A;  2VZW A;  2XD5 A;  2Y4A A;  3ZVW A;  1JVJ A;  3LIB A;  5CTM A;  3T4K A;  4HQA A;  3ZNT A;  1ONH A;  3ZG7 B;  4R4R A;  3LR5 A;  3D4F A;  4JGR A;  3E2L A;  1ERM A;  2C5W B;  3EWK A;  2JN7 A;  5HW3 A;  3LR0 A;  1YM1 A;  1G68 A;  2HGV A;  5EEC A;  4BJP A;  1N9O A;  3C30 A;  3W2Z A;  2HPB A;  2WZX A;  4X68 A;  5TFQ A;  3G4P A;  1T1A A;  4LV0 A;  1ES3 A;  1LSV A;  3MXR A;  4L9G A;  3ICY A;  2JC7 A;  4EBP A;  1GSW A;  3LR3 A;  2KX6 A;  2ZMV A;  3QP2 A;  3VOZ A;  4DDY A;  3EEA A;  1TVF A;  2M7V A;  1XX2 A;  3OPH A;  5IHV A;  3NOP C;  4I3I A;  1DJA A;  4JLF A;  5HPI A;  2Q9M A;  2WAD A;  2HP5 A;  2Z6C A;  1G6A A;  2KLI A;  3VMA A;  5A91 A;  4G3W A;  5L09 A;  1ACF A;  3N8L A;  1YPR A;  1HZO A;  2V20 A;  4JF4 A;  5FQK A;  3VSL A;  4JXV A;  3DTI A;  4MDZ A;  1XFN A;  1GHP A;  2WKR A;  4IUK A;  5F1F A;  3PXP A;  3L7H A;  4A5R A;  3H7W B;  4Q8I A;  3DTM A;  2P04 A;  3CAX A;  4QJG A;  4R0Q A;  5EVI B;  4OPY A;  5D3O A;  4OLD A;  3OPR A;  4Y3I A;  1AWI A;  1AXB A;  4HY8 A;  2O9B A;  2Y2J A;  4KUK A;  1OTB A;  3LY4 A;  4L9F A;  1ERQ A;  5GLB A;  1YSQ A;  3UN7 A;  3MSH A;  1E3U D;  1VB6 A;  3BWL A;  1HVB A;  1F9I A;  2NUP C;  1T1B A;  5FI2 A;  1WA9 A;  4YOF A;  3UDF A;  1JWZ A;  3HLD A;  3BQ8 A;  1SDN A;  4U0X A;  4UEY A;  3A3E A;  3MXQ A;  5DF8 A;  3A3J A;  3KX0 X;  1Z6F A;  3NC8 A;  1DP6 A;  1LI9 A;  4JGQ A;  4WL9 A;  3IF5 A;  3P7N A;  3PYP A;  3K3D A;  1V9Y A;  3LID A;  2B95 A;  1L0G A;  1MXO A;  1FCO A;  1LSX A;  4M3K A;  2QMI A;  4NEE D;  4CJN A;  3KO6 A;  1LLB A;  4X53 A;  1WYB A;  1KGF A;  1Q2P A;  3IH9 A;  2Q9N A;  4JPM A;  4HP9 A;  3HUM A;  4GOG A;  1NLZ A;  4Z1W A;  1W8Q A;  3C5A A;  5AQ7 A;  3E4Q A;  2W1T B;  3SW1 A;  3S7O A;  3PAE A;  1JWP A;  3VP4 A;  2PU2 A;  3WWX A;  4KZ8 A;  1BLC A;  2ZQ8 A;  4WLA A;  5CED A;  3V50 A;  5F83 A;  4Y0T A;  4N1X A;  3UMD A;  3UY6 A;  4UQI S;  2P7J A;  3U2A A;  3CPT B;  4ZJ1 A;  1XPB A;  4X69 A;  5J8X A;  2Y2Q A;  2IWC A;  2VV8 A;  5HD5 A;  4BBV A;  3F1P B;  1IYQ A;  1XGJ A;  1LI0 A;  1E25 A;  2HDQ A;  3W4Q A;  4XT2 B;  2OWJ A;  2ACG A;  5IT5 A;  4FH4 A;  3BFC A;  3A3D A;  1PNE A;  1ESI A;  4EWF A;  5AQB A;  1PW8 A;  1X0O A;  2OLV A;  3LUQ A;  3G6O A;  2A24 A;  3LI8 A;  4B93 A;  3VE3 A;  4IJG A;  5TGF A;  2E8J A;  4CLC B;  3NOT C;  3S1Y A;  4DF6 A;  4GB7 A;  2PT7 A;  2XA7 S;  1Y28 A;  3NCK A;  4U0T A;  2W3F A;  5FAS A;  2JHE A;  3B47 A;  3ITB A;  4HBT A;  3C8C A;  2RCX A;  4E3O A;  3VOL A;  3UB6 A;  4IED A;  2JKR I;  3ZG5 A;  4QPR A;  1KDW A;  5CEC A;  2VLG A;  4KQO A;  5F5Y A;  4JF6 A;  2V2F F;  4Y5F A;  3CUE A;  4WMC A;  4P85 A;  5EFW A;  1OPX A;  3N7W A;  3S7N A;  1XXM A;  3GV9 A;  3HUN A;  3P09 A;  4YNR A;  4KZ7 A;  2J7V A;  1XKZ A;  3V5M A;  5HAI A;  1K56 D;  3T50 A;  4DJ2 A;  5J7E A;  1F2K A;  3MS6 A;  1GHI A;  3E0Y A;  3ZYT A;  3WS5 A;  2I72 A;  3G34 A;  3HBR A;  1TF1 A;  2DCF A;  4LV2 A;  4E3I A;  2Y2H A;  2PYP A;  1G5U A;  2PDR A;  5GHX A;  3NIA A;  3HUO A;  3IHA A;  2VV7 A;  4UHU A;  4JXW A;  4EBN A;  4Q0J A;  4K0X A;  3S7Q A;  4Y15 A;  4UA7 A;  4IUH A;  3ZGA B;  1NYM A;  5HAR A;  5FQJ A;  4E3K A;  3C4O A;  2O9C A;  3N8S A;  2HJ9 C;  2M7U A;  4G3V A;  5CGS A;  3SS4 A;  2XRN A;  3T1S A;  5EM0 A;  1O07 A;  5EUA A;  2G7U A;  4R70 A;  4LRZ E;  1SKO B;  3FPV A;  3IX8 A;  4ZRR A;  4KG2 A;  4GS9 A;  3KSH A;  3QP5 A;  4OVD A;  3RXX A;  4RX2 A;  5TBM B;  2JE5 A;  2IWB A;  5FI6 A;  2C6W B;  5EPH A;  1XFQ A;  2OLU A;  1EI5 A;  3G2Z A;  2PD8 A;  4RVA A;  1W7F A;  4WEJ A;  1L0E A;  3H82 A;  3V3S A;  4S2N A;  3WS0 A;  1CK3 A;  1FCN A;  4Q0H A;  4N92 A;  3O86 A;  5JYP A;  2OSU A;  5DTS A;  4HHD A;  5CHU A;  4WMC D;  5DJT A;  3EGX C;  1YSP A;  1CQA A;  4O01 A;  5IS1 A;  4KZB A;  3CI6 A;  2E8I A;  2VGL S;  5GLC A;  3LY3 A;  4OKP A;  4EES A; 
#chains in the Genus database with same CATH homology
 2H0Y A;  3N4I A;  1L0F A;  2R9W A;  2J9O A;  4OQH A;  3PBN A;  5FAT A;  4H8R A;  2VGJ A;  5E43 A;  3Q7V A;  1ERO A;  4DXC A;  4Y0O A;  5G18 A;  2WKE A;  3AGE A;  5FA7 A;  1K55 C;  4BQM A;  3UDI A;  1PI5 A;  3M2K A;  3FKV A;  1L2S A;  3CZD A;  3HLW A;  4UA6 A;  4PM5 A;  1N4O A;  2XH9 A;  1RGY A;  1PW1 A;  4IVI A;  4S2O A;  1MWR A;  4P0M A;  4DKI A;  2XR0 A;  4JXS A;  2OV5 A;  4RYE A;  3PBS A;  4LV3 A;  4BLM A;  1KVL A;  2ZC3 B;  4XUX A;  5L2F A;  1GCE A;  5E2G A;  5HAP A;  5GHY A;  4B4X A;  2XD5 A;  3O3V A;  4N9K A;  5CHM A;  2Y4A A;  4YFM A;  3ZVW A;  1JVJ A;  3SH7 A;  4MEZ A;  2Y2L A;  3TOI A;  2A49 A;  1ZG4 A;  5CTM A;  1GHM A;  1H5X A;  3ZNT A;  1ONH A;  3NY4 A;  5FDH A;  1PWD A;  1PWG A;  3VSK A;  3ZG7 B;  4R4R A;  5A93 A;  4GDB A;  1S0W A;  1FCM A;  2EX9 A;  3D4F A;  1J9M A;  1KGE A;  1MBL A;  3E2L A;  4GDN A;  1ERM A;  3SOI A;  2C5W B;  5A92 A;  3IT9 A;  4LCM A;  4PM6 A;  3P98 A;  4ZAM A;  1K54 A;  5HW3 A;  1O7E A;  4N1H A;  1YQS A;  3G30 A;  4S2K A;  1JWV A;  1G68 A;  1YM1 A;  2Y2I A;  5EEC A;  4BJP A;  4S2L A;  3ZG8 B;  1K4E A;  1Q2Q A;  1FR1 A;  3W4P A;  2HPB A;  3HRE A;  5FAP A;  2Y2N A;  2WZX A;  3QNB A;  4X68 A;  1K56 A;  1ES4 A;  4K91 A;  1QME A;  5TFQ A;  3G35 A;  3G4P A;  3M2J A;  4FD8 A;  1KDS A;  4JBF A;  1E4D A;  4LV0 A;  3HL9 A;  1ES3 A;  5U47 A;  4MNR A;  3MXR A;  2JC7 A;  4EBP A;  3ZDJ A;  3NBL A;  2IWD A;  1FQG A;  3HLG A;  4OP8 A;  4QY6 A;  3GR2 A;  4BD0 A;  3VOZ A;  4GZB A;  4DDY A;  4F94 A;  1TVF A;  2Y59 A;  1XX2 A;  3OPH A;  5IHV A;  3ZG9 B;  4B4Z A;  1BUE A;  5CHJ A;  1YLT A;  2XDM A;  1PIO A;  4QU3 A;  1DJA A;  2HDU A;  4JLF A;  2Y2G A;  2Q9M A;  3MZF A;  4BEN A;  2WAD A;  4IBX A;  4OPQ A;  2HP5 A;  1PZO A;  1RGZ A;  3FWL A;  3SH8 A;  2HP9 A;  4HEF A;  1G6A A;  4XXR A;  3BLM A;  3LO7 A;  3UNW A;  1K4F A;  3VMA A;  3DWZ A;  5A91 A;  3ZHH A;  2WKH A;  2Z2L B;  3N8L A;  1HZO A;  1LL5 A;  2V20 A;  4JF4 A;  4OON A;  5FQK A;  3VSL A;  5E2H A;  4JXV A;  3UE1 A;  5FQ9 A;  5CGW A;  3WS1 A;  4DDS A;  3BLS A;  1YLZ A;  2Z2M B;  3TSG A;  2X71 A;  1GHP A;  4WZ5 A;  5F1F A;  1W79 A;  1EWZ A;  1TDG A;  1FSY A;  1ESU A;  2XEP A;  3S4X A;  3VOY A;  3MKE A;  1QMF A;  4IBR A;  4ZJ3 A;  4A5R A;  3MKF A;  4WZ4 A;  4E3M A;  4KZ9 A;  3PBR A;  4Q8I A;  4C75 A;  1MWS A;  3DTM A;  3O88 A;  3HLB A;  4QJG A;  4R0Q A;  3OC2 A;  4GN2 A;  2XGN A;  3GVB A;  5EVI B;  3BFF A;  4OPY A;  3GMW A;  3SS3 A;  5D3O A;  4EBN A;  1DY6 A;  4OLD A;  1IEL A;  3OPR A;  5E2E A;  2HDR A;  4S2N C;  4N9L A;  1AXB A;  3MZD A;  1K57 C;  1K6R A;  2Y2J A;  3GTC A;  1CEG A;  2ZM2 A;  3LY4 A;  4JKT A;  5F82 A;  3NDE A;  3PAG A;  1ERQ A;  5GLB A;  1I5Q A;  1NY0 A;  3MXS A;  3UN7 A;  2ZC7 A;  4QY5 A;  2XLN A;  2ZC6 B;  2WK0 A;  2P9V B;  1E3U D;  5GL9 A;  5GLA A;  1KVM A;  2J8Y A;  1HVB A;  4UA9 A;  4EQI A;  1DJC A;  4OOY A;  4E6X A;  4EUZ A;  5KSH A;  3UE3 A;  4KZ6 A;  5FSR A;  1IYP A;  3IQA A;  3Q81 A;  4WBG A;  5FI2 A;  4LCL A;  3UDF A;  1CEF A;  1JWZ A;  1OME A;  3QHY A;  3HLD A;  5KZH A;  1BSG A;  1SDN A;  4U0X A;  3A3E A;  4PM8 A;  4QB8 A;  1IKG A;  4C6Y A;  5DF8 A;  3A3J A;  4HBU A;  4RX3 A;  1Z6F A;  3ISG A;  3IWO A;  4Y7P A;  4DXB A;  3NC8 A;  1LI9 A;  2ZQC A;  4KZA A;  3IF5 A;  2ZQA A;  3ZG0 A;  4E6W A;  4X56 A;  4CPK A;  1FOF A;  2R9X A;  1L0G A;  1MXO A;  4MBH A;  1FCO A;  4UAA A;  2WYX A;  5CER A;  4OOM A;  4D2O A;  2Y2K A;  5FI7 A;  1ZKJ A;  4M3K A;  2QMI A;  2Y2P A;  4LEN A;  1KE3 A;  2XFS A;  2Y2O A;  3Q7V B;  4CJN A;  2ZM8 A;  1IYO A;  1KGG A;  1LLB A;  3IXG A;  4OQG A;  5AQ9 A;  3IF6 A;  4X53 A;  1YLW A;  1WYB A;  2ZMA A;  4R3B A;  1KGF A;  1Q2P A;  4QD4 A;  5DTK A;  3IH9 A;  3RXW A;  4OPR A;  1I2W A;  2EFX A;  2Q9N A;  4JPM A;  3GQZ A;  1IEM A;  5CEB A;  4B88 A;  2G2W A;  3HUM A;  5EVI D;  5FQQ A;  5HL1 A;  2JCH A;  4GOG A;  1W8Q A;  1GA0 A;  3C5A A;  3I7J A;  1MWU A;  2Y55 A;  3Q82 A;  3M6B A;  5AQ7 A;  4U3T A;  4EBL A;  1BLP A;  3BFE A;  3LCE A;  3VFF A;  2ZQD A;  1K54 C;  3V39 A;  4NET A;  2ZM0 A;  2BG1 A;  4Z9Q A;  3PAE A;  5EE8 A;  3IXH A;  1JWP A;  1SCW A;  3S22 A;  3VP4 A;  3UE0 A;  1PI4 A;  2PU2 A;  3IH8 A;  3WWX A;  4KZ8 A;  1BLC A;  3DW0 A;  5TR7 A;  2ZQ8 A;  4YIN A;  3OCN A;  5CED A;  1NJ4 A;  4KQQ A;  5F83 A;  3V50 A;  4Y0T A;  1S6R A;  2PBY A;  4N1X A;  3HLE A;  3UY6 A;  1C3B A;  3HLC A;  4ZJ1 A;  4L0L A;  3VP1 A;  1XPB A;  4X69 A;  1H8Y A;  5J8X A;  1IYS A;  4DE3 A;  4ZDX A;  1HD8 A;  2XF3 A;  1DJB A;  2Y2Q A;  2DRW A;  2IWC A;  3Q1F A;  4X55 A;  5GLD A;  4GD8 A;  1IYQ A;  1XGJ A;  4P87 A;  1LI0 A;  4OLG A;  5DVA A;  4JXG A;  1E25 A;  1U60 A;  2HDQ A;  3BM6 A;  3N6I A;  3IF6 B;  1TDL A;  3W4Q A;  3N8R A;  3WRT A;  3ZCZ A;  1MPL A;  4BL2 A;  1BZA A;  1BTL A;  4FH4 A;  3UPO A;  3SH9 A;  3BFC A;  3FZC A;  5EVI C;  3A3D A;  4E3J A;  5HAQ A;  1SDE A;  1ALQ A;  1ESI A;  4EWF A;  1CI8 A;  5AQB A;  1MY8 A;  1PW8 A;  1PWC A;  1NZU A;  2H0T A;  2OLV A;  5DF9 A;  1LL9 A;  4MLL A;  1PZP A;  2RL3 A;  1Y54 A;  2A3U A;  1VM1 A;  2EXB A;  1MWT A;  4FSF A;  3MBZ A;  1NXY A;  2EX8 A;  5CGX A;  2H5S A;  2XFT A;  3NDG A;  2EX2 A;  5HFO A;  1ES2 A;  1JTG A;  1YMS A;  4E3L A;  4S2M A;  3FYZ A;  5TGF A;  2WAE A;  3TG9 A;  3LY3 A;  1SKF A;  2JBF A;  3S1Y A;  4DF6 A;  4EV4 A;  4GB7 A;  4KQR A;  3PTE A;  3VP3 A;  2FFY A;  2WGW A;  4WZ5 C;  1HTZ A;  4C3Q A;  4WEK A;  5CRF A;  2Y2M A;  2G2U A;  3DWK A;  3NCK A;  2WUQ A;  2WAF A;  4OP5 A;  4PM7 A;  5E2F A;  5AQA A;  1VQQ A;  2WKI A;  5JYO A;  4U0T A;  3GRJ A;  2CC1 A;  3PBT A;  3IWQ A;  4X6T A;  4S2I A;  3WRZ A;  5FAS A;  3ITB A;  2GDN A;  4HBT A;  1ZC2 A;  1K55 A;  2RCX A;  4O7D A;  3V3R A;  1I2S A;  1TEM A;  4KG5 A;  4E3O A;  3B3X A;  3C7U A;  1WYC A;  4IED A;  5DTT A;  1YLJ A;  2WGV A;  5HX9 A;  3ZG5 A;  4FH2 A;  2FFF B;  1H8Z A;  2ZJ9 A;  1YLP A;  1KDW A;  5CEC A;  2UWX A;  4R23 A;  1BLH A;  3PBO A;  4QHC A;  5CXW A;  4KQO A;  4WM9 A;  4JF6 A;  2V2F F;  2QZ6 A;  3LEZ A;  3BEC A;  3QNC A;  1ONG A;  4DE0 A;  3C7V A;  4GNU A;  4RA7 A;  4WMC A;  4P85 A;  2EXA A;  5A90 A;  3O87 A;  3IXD A;  3N7W A;  1XXM A;  4GD6 A;  3GV9 A;  3HUN A;  3P09 A;  3AGF A;  5EOO A;  3IXB A;  3FKW A;  1ZG6 A;  4ZTK A;  3WS4 A;  4MBF A;  4KZ7 A;  2J7V A;  2WGW B;  1XKZ A;  4OPZ A;  3V5M A;  5HAI A;  1K56 D;  4WYY A;  4XUZ A;  1GA9 A;  3OZH A;  5FQI A;  1GHI A;  3ITA A;  2H10 A;  1BT5 A;  1BLS A;  2X02 A;  2Y91 A;  1E3U A;  3WS5 A;  5DF7 A;  1N9B A;  2I72 A;  3M6H A;  3MFD A;  3G34 A;  3HBR A;  4S2J A;  3OPP A;  2DCF A;  3A3F A;  1W5D A;  2QPN A;  2ZD8 A;  4LV2 A;  2Y2H A;  5EVL A;  4E3I A;  3W8K A;  4Y0U A;  1IKI A;  1JTD A;  2WGI A;  5GHX A;  1PYY A;  3NIA A;  3HUO A;  2BLS A;  2ZQ7 A;  3IHA A;  3JYI A;  2J9P A;  4ID4 A;  4JXW A;  4PM9 A;  4UHU A;  3GSG A;  2HP6 A;  1BUL A;  2XK1 A;  4K0X A;  2PU4 A;  2WZZ A;  3OPL A;  4PMA A;  3G31 A;  1YLY A;  2VGK A;  1K38 A;  3CG5 A;  3HLF A;  3BYD A;  4S2P A;  4UA7 A;  3IF6 C;  1NYM A;  5HAR A;  4P6B A;  3G2Y A;  4ZJ2 A;  3ZGA B;  5FAQ A;  4KEN B;  5FQJ A;  4E3K A;  4ZBE A;  3BFG A;  3RJU A;  2V1Z A;  3C4O A;  1K6S A;  1MKI A;  3MZE A;  5FAO A;  2X01 A;  1K25 A;  3NI9 A;  4LV1 A;  3N8S A;  4KZ4 A;  3VFH A;  3HVF A;  2ZLY A;  5CGS A;  5EOE A;  3SS4 A;  3PBQ A;  2HDS A;  1KE4 A;  3EQV A;  2B5R A;  3IWI A;  3C4P A;  5CTN A;  1KE0 A;  3UDX A;  3UPP A;  4KZ5 A;  2EX6 A;  3BFD A;  5M19 A;  1O07 A;  4DE2 A;  4DE1 A;  3E2K A;  4K0W A;  3CJM A;  1RCJ A;  1XA1 A;  4MBK A;  1RP5 A;  1M40 A;  4NK3 A;  4OQ0 A;  5EUA A;  3OCL A;  5EVI A;  2ZC4 B;  4GKU A;  2EFU A;  4FCF A;  3Q07 A;  4KG2 A;  4OH0 A;  2ZC5 B;  4BL3 A;  4R3J A;  3FV7 A;  4R4S A;  1NZO A;  1YT4 A;  4JF5 A;  1LHY A;  2ZQ9 A;  4OVD A;  5F1G A;  5GHZ A;  3RXX A;  4KG6 A;  4RX2 A;  1CI9 A;  4KZ3 A;  2JE5 A;  3W4O A;  3EQU A;  2IWB A;  5FI6 A;  1XA7 A;  2P9V A;  3UO9 A;  3VP2 A;  1FR6 A;  3ZVT A;  2C6W B;  4OOL A;  1NYY A;  2P74 A;  5EPH A;  3UPN A;  2OLU A;  1EI5 A;  3G2Z A;  3BEB A;  3ZFZ A;  3A3I A;  1NRF A;  4RVA A;  1M6K A;  4E3N A;  5M1A A;  3ZNY A;  1W7F A;  1L0E A;  4WEJ A;  3G32 A;  3V3S A;  4S2N A;  3WS0 A;  4BD1 A;  1CK3 A;  1SHV A;  1FCN A;  5KMW A;  5M18 A;  4DRT A;  5I94 A;  4R1G A;  4OQI A;  3WS2 A;  1K57 A;  3SS5 A;  1W8Y A;  4PPR A;  2XQZ A;  4N92 A;  2XD1 A;  3O86 A;  5JYP A;  2OSU A;  5DTS A;  5CHU A;  3CMZ A;  4WMC D;  3AGD A;  1XP4 A;  3BRM A;  3Q7Z A;  1XGI A;  5BOH A;  4WEL A;  5FQM A;  1WE4 A;  1FSW A;  3VP0 A;  4KZB A;  3IHB A;  1ES5 A;  1YMX A;  4HES A;  5GLC A;  1L0D A;  5KSC A;  2DNS A;  2E8I A;  4OKP A;  4IVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...