2HGVA

N-terminal gaf domain of transcriptional pleiotropic repressor cody
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
155
structure length
155
Chain Sequence
MALLQKTRIINSMLQAAAGKPVNFKEMAETLRDVIDSNIFVVSRRGKLLGYSINQQIENDRMKKMLEDRQFPEEYTKNLFNVPETSSNLDINSEYTAFPVENRDLFQAGLTTIVPIIGGGERLGTLILSRLQDQFNDDDLILAEYGATVVGMEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-sensing transcriptional pleiotropic repressor codY
publication title The Structure of CodY, a GTP- and Isoleucine-responsive Regulator of Stationary Phase and Virulence in Gram-positive Bacteria
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
total genus 41
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2006-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2hgvA00
2W3HA 2B18A 2XROA 3KSIA 2W1TB 2XSSA 4IUKA 1YSQA 3K2NA 3TRCA 5I5LA 2O0YA 4YOFA 3D3OA 3E0YA 4ETXA 1MKMA 5DFXA 4IJGA 4DN0A 2VJWA 3S7QA 1STZA 3E98A 3BJNA 3KSGA 2O9AA 2VEAA 4Z1WA 4Y5FA 3NHQA 4O01A 1ZTUA 4Y3IA 5HSQA 1VHMA 3OBFA 2Y8HA 2GX5A 2KOIA 3CI6A 2LB9A 3KO6A 5L8MA 2W1TA 5HL6A 3MMHA 2LB5A 2O99A 3KSFA 3HCYA 5LBRA 3S7NA 4LRXC 1TD5A 2IA2A 4GW9A 3NOTC 2W3DA 4R6LA 4RQ9A 2K2NA 4Q0IA 5HPIA 4ZRRA 4GLQA 2VKSA 5HPFA 1TF1A 4MMNA 4G3WA 3G6OA 3DBAA 4Q0HA 2K31A 2QYBA 4LRYC 3W2ZA 2OOLA 4DMZA 1MC0A 4BWIA 4O8GA 5AJGA 3MQ0A 2O9BA 4FOFA 4LRZE 2KLIA 4E04A 3R4KA 4MCWA 4IUHA 3NOUC 4CQHA 4YNRA 4EU0A 3IBRA 2W3FA 4R70A 1YSPA 4MDZA 3O5YA 4ETZA 2M7VA 3CITA 2M7UA 1F5MA 3LFVA 2VZWA 2HGVA 2O9CA 3S7PA 2W3EA 4ME4A 3C2WA 3MF0A 4EUVA 2Y79A 5DFYA 4PAUA 3EEAA 4O0PA 2ZMFA 3NOPC 4G3KA 4Q0JA 4QPRA 4MN7A 2W3GA 3KSHA 2XRNA 3OOVA 5C5KA 3S7OA 4Y2FA 3RFBA 4G3VA 3VV4A 5TJJA 3ZQ5A 5K5BA 1YKDA 3IBJA 2G7UA 2W1RA
chains in the Genus database with same CATH superfamily
2WUQA 2XSSA 3LYXA 2X71A 3LIFA 1SDEA 3K2NA 4BENA 2O0YA 4WBGA 3F1PA 4B4XA 1L3LA 2WAEA 4R3JA 1XGJA 1MY8A 4EXOA 2ZC6B 1GA0A 3A0VA 1AWIA 3A3JA 3QP2A 5HSQA 3MR0A 3UN7A 1NZUA 1PZOA 1H8YA 3D72A 3S7NA 2EWVA 3HUNA 1JTDA 3K3DA 3CJMA 2W3DA 3IH9A 4R6LA 1VETA 2VV8A 2HP6A 1NWZA 3DBAA 2V9AA 1DJAA 1OTIA 2PBDP 1YLPA 2WK0A 1IYQA 2JKGA 5FDHA 4O8GA 4LRZE 3PBRA 3CPTA 3LY4A 4F3LB 2HJEA 1MKIA 1JVJA 3IHBA 2EX9A 1JWPA 1S67L 4UQIM 4P6BA 1F5MA 2QHKA 1TS7A 3PAEA 5DKKA 5FQKA 1XFNA 3HBRA 1ZG4A 3EEAA 2VGLS 4X55A 3HUMA 3QP4A 2G2WA 5F6AA 3AGEA 4WYYA 2V8CA 1Y4OA 4KZ4A 3BLSA 1N9BA 1GHIA 3P01A 1LL8A 3DWZA 3NBLA 3ZNYA 2Z6CA 5EOOA 3QP8A 4KUKA 4DE3A 3D3OA 2WKPA 5CGXA 1XKZA 5CTNA 1J9MA 1MKMA 3M6BA 4DN0A 1GCEA 4DDSA 2H10A 2WKIA 2IWBA 1DP8A 5MC7A 3N8SA 3DAVA 3UB8A 2J9PA 1ZC2A 3A3FA 3E2LA 4R23A 2EXBA 4Y3IA 3S1YA 3WWXA 1K56D 2EWWA 4EW7A 1HTZA 4NG2A 1IYPA 2J7VA 2W0NA 2V1AA 4KQQA 5AQ7A 4Y17A 4KUOA 4UA9A 5DF7A 3VP4A 4S2PA 3UPOA 2ZOHA 2PD8A 1JWZA 3H7WB 5FAQA 4CPKA 2HP9A 4LPZA 3BFEA 5IU1A 1XJ2A 2JKTM 4RX2A 2XK1A 3FKWA 2V8FA 3UNWA 2DNSA 3UPPA 4LV2A 3C7UA 4I38A 3GECA 3BY9A 3BYDA 1WE4A 3S22A 1PW8A 1IFQA 1XA1A 3IF5A 2W3EA 2XD5A 2Y2PA 5HZHA 3IQAA 4MN7A 3S7OA 4BLMA 1VEUA 1P0ZA 4EUZA 3CUEA 2EX6A 2PBYA 4D60A 2JC7A 4M4XA 3OZHA 3SOIA 2PYPA 1ACFA 1BLHA 1K57C 3CLOA 3H9WA 2WZZA 2W27A 3BJNA 3S4XA 3MSHA 1ODVA 4JF5A 3TJZC 1BZAA 2Y2HA 4P6ZM 4XXRA 2A2LA 3LO7A 1E3UD 4UHUA 3AGFA 3HCYA 4N9LA 2J3TC 3EGDC 5F1GA 3NOTC 2A49A 4ARZA 4OPYA 4P85A 3IXHA 4RQ9A 4P87A 4OP8A 1LL9A 5HPIA 4ZRRA 5M1AA 1FSYA 5FI6A 1YLJA 3K3CA 5IT5A 3R7WA 1CQAA 1FR1A 4MN5A 2K31A 4NK3A 2XA7S 2VGJA 1TS0A 4R3AA 1K4FA 2QPNA 3IX3A 1LSVA 1XJ4A 3NY4A 5HAIA 2ZQCA 3UE0A 1XP4A 2WYXA 4JF6A 1H3QA 4MBKA 4X1MA 4R70A 4EEPA 1OT9A 3UE6A 2OSUA 2M7UA 5EVIC 1HVBA 2WKEA 3VP1A 3QNCA 2DCFA 3DWKA 1VETB 4JKTA 3BEBA 2D02A 5D3OA 3NOPC 2HJ9C 2V1ZA 1IYSA 3O87A 5EUAA 1TEMA 4OPQA 4KG5A 1VB6A 1PNEA 3EWKA 1Q2QA 5TJJA 4FSFA 1D06A 4EBLA 1K54C 2W3HA 3KSIA 4GZBA 1PWGA 4C75A 3ZDJA 4YOFA 1ESIA 4FTXA 1U60A 3E0YA 4X1LA 5G18A 4ESPA 1KE3A 1IOUA 4F94A 4DJ3A 2VEAA 3RXWA 4RYEA 4IVKA 3OBFA 1N9LA 2GDNA 3V3SA 2GX5A 1I2WA 4DJ2A 4PHTA 3G2ZA 3ZCZA 2ZM8A 4HNBA 3E4OA 3IF6A 1HD8A 3WS2A 2K7SA 2P74A 3HUOA 3OCLA 4CLCE 4U0TA 4K08A 4GDBA 3ZNTA 2GZAA 2Z2MB 3B3XA 2QYBA 5GLDA 1OMEA 1W8YA 2VGLM 3GVBA 4E3MA 3Q1FA 2R78A 2XR0A 1CF0A 3HLBA 2WADA 5EVIA 4ZDXA 1S4RA 3ZG8B 4GHIB 3F1OB 2X01A 4EBNA 4JGQA 4M3KA 5FI2A 3I7JA 3BFGA 3IT9A 4KZBA 3E2KA 2WGWA 3T4SA 4QHCA 4EERA 3HLWA 2OV5A 2B5RA 1K54A 4GD6A 1GA9A 3CWFA 2H5SA 5FATA 4R0QA 2PAVP 3MXQA 4IHQA 3EOIA 3OPPA 3O86A 3DTMA 2XROA 2W1TB 3ZG5A 4PM5A 4CLCD 1ONGA 4S2MA 2PR6A 5DFXA 2E8JA 4LFUA 4X6TA 4JPMA 2P7JA 5E2HA 2ACGA 3EQUA 3PXPA 2E8IA 3QP6A 4LCMA 4ZAMA 3RXXA 4CJNA 4PM8A 1ONHA 3BQ8A 3T4QA 4PPRA 2VA0A 3BLMA 3MXSA 3N8LA 3MBZA 4DE2A 1VEUB 3PTEA 2Y2IA 4GLQA 2VKSA 5FAOA 2HDRA 2P9VA 3A3IA 3IX8A 3G2YA 3TSGA 2GJ3A 3NDGA 3SZTA 1SKFA 2VGKA 3ZGAB 1ES2A 5CEBA 1WYBA 2Q9MA 2WKRA 2QZ6A 3H82A 4P0MA 5HL1A 3IXBA 2EA9A 3AGDA 4PM9A 5DTSA 2Y4AA 3BWLA 3ZFZA 5DTKA 2HGVA 2O9CA 2QKPA 3BECA 1NYYA 3DTEA 4ARZB 5DJTA 5DF8A 4PAUA 1E3UA 3JVUA 1G6AA 1YMXA 2JBFA 2JKRM 4MBFA 5F1FA 1KGFA 3BY8A 5GL9A 5K5BA 2G7UA 4II7A 4H8RA 2IWDA 3TG9A 1HLUP 5U47A 1LT0A 4Y15A 5A92A 4ETXA 1STZA 3BM6A 5DF9A 2RCXA 1PFLA 4H6JB 5HW3A 4S2JA 3A0SA 2XA7M 3CI6A 2XQZA 4RA7A 3KO6A 2ZMVA 3KSFA 3FPVA 4LRXC 5F5YA 3V5MA 2L1MA 3W4QA 1KGEA 4GNUA 1S66L 4Q0IA 4PMAA 5FL3A 4BMWA 5HWVA 1ZHHB 4N92A 5CXWA 1BYWA 3IS2B 1F98A 1TS6A 1EROA 3FWLA 1LLBA 3G6OA 1KE0A 3C5AA 4E3LA 2VLGA 4GCZA 4OLGA 4MNRA 1KE4A 3VP2A 2O9BA 3B47A 2M1CA 1FIKA 3CHWP 3R4KA 2QWSA 3NOUC 4B93A 3QP1A 4JGOA 3VOZA 4GKUA 5DTTA 4ETZA 1EWZA 3V50A 2BG1A 5E2FA 2PR5A 4OQHA 4S2KA 5TFQA 4BD1A 4I3AA 1FOFA 1NLZA 1Y28A 2ZMFA 4JGRA 3UO9A 3M2JA 1O7EA 1LI0A 4OONA 5EECA 4IUHA 3WS4A 4GDNA 4KZ9A 4E3NA 1GSVA 4R1GA 4KENB 4QY6A 4IVIA 1CI8A 4DKIA 1D7EA 5EVIB 2JKFA 1PI5A 2Y2OA 3FZCA 2EX8A 4LCLA 3NJAA 2Y2KA 4NXEA 5J7EA 5HDSA 2Y2NA 4EBPA 1YM1A 3D4FA 5L07A 2WGWB 3LIAA 2C6WB 2LB5A 5A90A 2PU4A 3G32A 3CUEC 5L10A 3LR4A 1M40A 4Q0HA 3M2KA 3MFXA 2OWJA 1E25A 4LRYC 1SKOA 1NYMA 4HHDA 1YPRA 1MC0A 3UE3A 2ZBBA 4CLCA 1ES4A 1L2SA 1FCOA 1J3WA 1RP5A 3WRZA 4LGWA 2XLNA 3GR2A 5AVFA 2DMWA 5GLCA 1IELA 3SS4A 4HQAA 1K0KA 3PBTA 5FQ9A 2R9WA 2XF3A 4WZ5A 4DF6A 5A91A 3MFDA 3PBNA 5CHJA 5C5KA 1TVFA 2P9VB 3TW8A 3RFBA 3HLCA 5FQMA 3VE4A 3SH8A 4BBUA 4DRTA 4DDYA 1VM1A 2VX8A 4BL2A 1XPBA 1ERQA 1XJ3A 2J8YA 1PWCA 3GTCA 5L2FA 4E6XA 2MJ6A 3SH7A 1MWSA 1M6KA 3LIDA 1S0WA 1ES5A 3OPLA 5EVEA 1DJCA 3PR6A 5KSCA 3VSKA 4Y5FA 2OLUA 5FQJA 3BFFA 2I72A 3RH8B 3UDFA 4E3JA 4WEKA 3QHYA 2ZD8A 1OTBA 1TD5A 2IA2A 3NCKA 1FSWA 4WZ4A 5GLAA 2ZLYA 3LIBA 5E2GA 4HH3A 4UA7A 4U3TA 1BTLA 4S2LA 3HLEA 1N9NA 1W63Q 3GQZA 1OTDA 3F1NA 5AJGA 3W4OA 1XFQA 3V3RA 4FH2A 3O3VA 5CEDA 1RCJA 4BBVA 1T1BA 4YNRA 1T1CA 1PZPA 5JYPA 3VOYA 4QB8A 3Q7ZA 1CJFA 1YLYA 3O5YA 4YWZA 2YKFA 3VSLA 2VZWA 3IF6C 4A5RA 4Y0UA 4OPZA 1L0GA 3LR5A 3F1PB 2H0YA 1A0KA 4KZAA 5IS1A 1CEGA 2Z2LB 2Z6DA 5FQIA 2P04A 4QY5A 4AFIA 4HP4A 2AVXA 1P9WA 1YMSA 4QD4A 1JTGA 3RTYA 2FH5A 4DE0A 4JGPA 2WGVA 3LEQA 1KDSA 2B18A 4KZ8A 3MZEA 2V1BA 5HARA 3NI9A 5FSRA 5KIZA 5EV0A 3EQVA 4BJPA 4IJGA 1W5DA 3C8CA 1ZKJA 2VJWA 3HL9A 3CZDA 3JYIA 4WF0A 3NHQA 3P7NA 4HJ6A 1BULA 3N4IA 2WKHA 2KOIA 4OP5A 1L0FA 3VP0A 3PHYA 5HL6A 5TR7A 2J3WA 1OTAA 1OPXA 4X25A 3CPTB 1YT4A 4BL3A 2ZQ9A 2R9XA 4KG2A 3NECA 3MXRA 4K91A 5HDDA 3MZFA 1CI9A 5HAPA 1TF1A 3LEZA 4XUZA 5TBMA 3VFHA 3CG5A 3LR3A 5EM1A 3IWQA 3T50A 2WZXA 4I5SA 4IBRA 2B95A 1DY6A 3C38A 2C5WB 4GN2A 1NZOA 3KYQA 2HPBA 3PBQA 2P08A 4HOIA 4HI4A 3T4OA 2XH9A 3UB7A 3ISGA 1BSGA 3DW0A 4JF4A 1K55A 2J80A 4O7DA 4UQIS 4HJ3A 1MPLA 1XXMA 1H8MA 1DJBA 3C2WA 5DFYA 3OPHA 5CERA 3G35A 2XGNA 5CRFA 5M19A 3LI9A 4DXCA 2XEPA 2OWHA 1N4OA 1YKDA 2A3UA 2KX6A 3T1RA 2Y2MA 3ITAA 4WLAA 4MN6A 4NXGA 1K56A 4CLCB 4NKPA 3MZDA 2UV0E 2ZQDA 2BTFP 2PD7A 5J3WA 1KDWA 3IX4A 5CGSA 2QJ5A 5E2EA 3GDIA 3N6IA 1X0OA 3GMWA 3IXGA 4GJ4A 5L09A 1LI9A 2XFTA 2Y59A 4MBHA 1K6SA 5KMWA 1RGZA 3D9YA 4OVDA 2K2NA 4HBUA 2XFSA 2V0WA 4KG6A 3HLDA 4WELA 1FQGA 1K4EA 4NXFA 2DRWA 3HLFA 2XDMA 4MLLA 1BLCA 4BWIA 3IH8A 2HP5A 5EOEA 2FFYA 3FG8A 5F68A 4QJGA 1H0MA 1LSXA 5FA7A 4EU0A 2EXAA 1KVMA 3OC2A 1XA7A 4DXBA 4K0XA 3LCEA 2Q9NA 3ZG0A 3LFVA 3CMZA 3OLOA 1JNUA 1CEFA 3MJQA 3UMDA 5TGFA 3MS6A 5CTMA 2BLSA 5FEFA 1TS8A 4Q0JA 4QPRA 1W7FA 3T4TA 4FD8A 3HVFA 5HD3A 4BBTA 1I5QA 1YAXA 3VV4A 3ZVWA 3T1QB 5F82A 2PHYA 3IBJA 2W1RA 3WS1A 4HJ4A 1YLZA 3F1NB 4QWOA 4U0XA 1SHVA 1NRFA 3NDEA 2WKQA 4L9FA 3E98A 4EETB 4HEFA 3KSGA 2VV7A 5E43A 1NJ4A 5GHYA 4LLOB 3R7WB 4L0LA 4LV0A 1TDLA 1LL5A 4WMCD 5DKLA 2V2FF 4R3BA 4ZJ3A 3MMHA 3L7HA 3V39A 5EVLA 3FKVA 5HFOA 4X53A 2HF6A 3IHAA 4Y0TA 4X56A 4MMNA 1S6RA 4G3WA 1ZG6A 3C4PA 4EESA 5GLBA 2PDRA 1MXOA 4DMZA 3UB6A 4ZBEA 3OPRA 4RVAA 2Y91A 4JBFA 3JVVA 2KDKA 3IWOA 4MCWA 2FFFB 4BQMA 3BW6A 3JPUA 3E4PA 3PBSA 4E3KA 2M7VA 1ALQA 4PKYA 4KZ5A 4S2NA 3B33A 4ME4A 5F83A 4WM9A 3EGXC 3UB9A 4EUVA 4HP9A 2JE5A 3T1XA 3UMEA 4BD0A 4G3KA 3T4KA 3NIAA 3KSHA 4HESA 5TBMB 2Y2GA 4WL9A 1ERMA 3ZQ5A 3ZVTA 4CLCC 4LENA 1BLSA 3MQOA 4EQ1A 4HBTA 1N9OA 3Q82A 3P98A 1F9IA 1GSWA 3UB5P 3Q7VA 4EEUA 3IF6B 3EEHA 4E3IA 1Z6FA 1AXBA 1VQQA 4WZ5C 5M18A 1ESUA 1UWNX 1FCNA 3ULFA 1CK3A 2O99A 1XX2A 2OAQ1 3L9KA 1KGGA 4Y0OA 2J3TD 2L0WA 4LV3A 2ZM2A 5KSHA 4PM7A 3SS5A 3T4LA 5DJUA 1SCWA 3UDIA 3G34A 3BFCA 1W63M 4Q8IA 5FEGA 4OOLA 2ZC7A 4C6YA 1XJ6A 4E3OA 3RJUA 3IWIA 4I39A 3V67A 4FOFA 4XT2A 4B4ZA 1BUEA 4Y7PA 1NRJA 1V9ZA 2XD1A 4K0WA 4GS9A 1Z09A 2QJ7A 3LUQA 1YSPA 4NETA 4MDZA 1K38A 5AVEA 1NLYA 3G30A 2H28A 3PAGA 3ZYTA 5F69A 3QP5A 4JXWA 3GSGA 3MF0A 2ZL1A 5EVID 5GHXA 2W3GA 4Y2FA 4G3VA 3VOLA 2J9OA 4GHIA 3F1OA 1W79A 3N8RA 2B02A 4XUXA 1PW1A 4HY8A 1FR6A 1Y54A 5I5LA 4UEYA 3VP3A 1H8ZA 2INWA 4OQ0A 3S7QA 2JKRI 2PT7A 1YLWA 5HWTA 2CMNA 4JXVA 1V9YA 2ZQAA 3ZHHA 2VK3A 4O01A 5EE8A 1BLPA 5J4EA 4OH0A 1VHMA 2Y8HA 1GHMA 2UWXA 2PU2A 2W1TA 1SDNA 3FPWA 1XGIA 3H82B 2ZOIA 4KZ6A 5BOHA 4LV1A 2IWCA 4X68A 5FI7A 3KYEA 4ZJ1A 1IYOA 1L0EA 1PRQA 3P09A 1BT5A 4OPRA 3UDXA 1MWRA 3U4LP 1P97A 1G5UA 3FC7A 1HZOA 3UY6A 1PI4A 3G4PA 3BFDA 4X69A 3MQ0A 4WUJA 4OLDA 4E04A 4CQHA 5CHUA 4N1HA 4GOGA 1QMEA 4KZ3A 4KZ7A 3CITA 1RGYA 3S7PA 2JCHA 3WS0A 2X02A 3BQAA 3O88A 4WMCA 3LR0A 3OCNA 4MEZA 1MBLA 4HH2A 3B42A 1WA9A 1LHYA 1KVLA 5CECA 2ZQ8A 1Q2PA 4OOMA 1DRMA 4NXBA 1MWUA 3A0RA 3SH9A 4FUWA 4IUKA 1YSQA 4EWFA 3TRCA 3W8KA 4S2OA 2I9VA 3IXDA 4N9KA 3A3EA 1K55C 5A93A 2EFUA 2ZC3B 4D2OA 1DP9A 4JLFA 3DTIA 1MWTA 2O9AA 3MQQA 3MKFA 5CGWA 1IKGA 4HIAA 2L4RA 3ITBA 2EX2A 1LSWA 5L8MA 1PIOA 2Y2LA 1G6OA 4WN5A 4OQIA 5LBRA 4OQGA 2NUTC 2Q0OA 1UWPX 4GW9A 1S4SA 3VFFA 1S1YA 3VE3A 4C3QA 5EFWA 1G28A 5AQ9A 5DVAA 2CC1A 3WRTA 2OAP1 5AQBA 4FCFA 5JYOA 3LIEA 4H6JA 1FILA 4YFMA 3HLGA 2A24A 2OLVA 3W2ZA 2HV1A 4UAAA 4GB7A 3G31A 3Q7VB 3ZG7B 5HWWA 2V20A 3LI8A 2KLIA 1T1AA 4IEDA 2PRFA 4E6WA 1C3BA 3ICYA 2H0TA 5A8BA 3IS2A 1K57A 4KQRA 3SS3A 3T1SA 5AQAA 5FDSA 2Y79A 2JHEA 4O0PA 2WGIA 3GV9A 4EV4A 3TOIA 4B88A 3LY3A 1SZVA 4JXSA 2BASA 3HREA 1E4DA 5EPHA 1IEMA 5CHMA 3W4PA 2JKTI 3M6HA 4I3JA 4XT2B 3DTKA 1T18A 3UE1A 3PBOA 5G4YA 2ZJ9A 3HJIA 1K6RA 4GS9B 4F3LA 1MZUA 4IBXA 4L9GA 4UA6A 4Z1WA 5CX7A 4YINA 1YQSA 2ZC5B 2ZQ7A 4ZTKA 3T4JA 4B9OA 2EFXA 1SKOB 3Q81A 2ZL1B 5FQQA 4OOYA 3T12B 2Y2JA 3FV7A 3MKEA 4GD8A 1TDGA 4Y13A 5J8XA 2OOLA 5FASA 4ID4A 3LICA 3FYZA 5FAPA 1OJ5A 5HD5A 2QMIA 2Y55A 4PKYG 4R38A 4JXGA 3QNBA 5G4ZA 4PM6A 2D01A 4S2IA 3ZG9B 5HAQA 3NC8A 3KYZA 1EW0A 3TE8A 2ZM0A 1O07A 3C7VA 1OJGA 3N7WA 1NXYA 3H7WA 3NULA 3Q07A 4KQOA 4EQIA 1PYYA 3U2AA 1L0DA 2Y2QA 4N1XA 4WEJA 1T19A 3C30A 2ZMAA 4I3IA 4Z9QA 3E4QA 5HDCA 2G2UA 5GHZA 1PWDA 4S2NC 2ZC4B 3KX0X 3HJKA 1OTEA 4R4RA 4OKPA 4KQDA 1ZTUA 1D1JA 4DE1A 2HDUA 1KOUA 3UPNA 2LB9A 1OT6A 3A3DA 2YKHA 2HDQA 1YLTA 5KZHA 1JWVA 3SW1A 4QU3A 5HPFA 4RX3A 2FZ0A 3BRMA 3PYPA 4FH4A 5IHVA 4ZJ2A 1GSXA 1NY0A 1P9RA 1ES3A 5I94A 1FCMA 1F2KA 4P6ZS 2PYRA 2RL3A 2JN7A 1S1ZA 1IKIA 2NUPC 2V0UA 1K25A 1EI5A 1I2SA 4NEED 5EM0A 2WAFA 2HZ5A 3C4OA 3IBRA 2W3FA 1UGUA 1W8QA 1G68A 3LGOA 2VV6A 2HDSA 1DP6A 4R4SA 4L9EA 1H5XA 2GNXA 3VMAA 2XRNA 1QMFA 3WS5A 3OOVA 1GHPA 3GRJA 1WYCA 2A24B 3CAXA 5HX9A
chains in the Genus database with same CATH topology
2B18A 3F1OA 2XROA 2W1TB 2B02A 2XSSA 3LYXA 2V1BA 3LIFA 3K2NA 4HY8A 4CLCD 5I5LA 2O0YA 4UEYA 3F1PA 5KIZA 2PR6A 3EQVA 4BJPA 5DFXA 4IJGA 2INWA 3C8CA 2VJWA 3S7QA 2JKRI 2PT7A 5HWTA 2CMNA 4EXOA 1V9YA 2P7JA 3A0VA 4WF0A 3NHQA 4O01A 3P7NA 4HJ6A 3EQUA 3PXPA 5J4EA 5HSQA 1VHMA 2Y8HA 2KOIA 3MR0A 3PHYA 2W1TA 5HL6A 3FPWA 2J3WA 3BQ8A 1OTAA 3D72A 1OPXA 3S7NA 3H82B 3T4QA 2EWVA 2ZOIA 3K3DA 2W3DA 2VA0A 4R6LA 2VV8A 4GLQA 2VKSA 1TF1A 1NWZA 5TBMA 3DBAA 2V9AA 3LR3A 2GJ3A 3T50A 1OTIA 1P97A 4I5SA 3FC7A 2WKRA 3C38A 4O8GA 3MQ0A 3H82A 3PBRA 4LRZE 4WUJA 4E04A 4F3LB 2HJEA 3KYQA 3PBQA 2P08A 4HOIA 4HI4A 3T4OA 3UB7A 4CQHA 2EA9A 1S67L 2J80A 4UQIM 3BWLA 3CITA 1F5MA 4UQIS 2HGVA 2O9CA 2QHKA 4HJ3A 3S7PA 2QKPA 1H8MA 1TS7A 3C2WA 5DKKA 3BQAA 4ARZB 5DJTA 5DFYA 1XFNA 3LR0A 3OCNA 4PAUA 3EEAA 4HH2A 2VGLS 3B42A 3JVUA 1WA9A 2JKRM 3LI9A 5F6AA 4OOMA 3BY8A 2OWHA 5K5BA 1YKDA 1DRMA 2KX6A 2G7UA 4NXBA 4II7A 3A0RA 3P01A 1LL8A 4IUKA 1YSQA 4WLAA 3TRCA 4MN6A 4NXGA 2Z6CA 4KUKA 1LT0A 2I9VA 3D3OA 4CLCB 2WKPA 4NKPA 4ETXA 1MKMA 4DN0A 2PD7A 5J3WA 1DP9A 1STZA 1DP8A 5MC7A 2O9AA 2QJ5A 5DF9A 3MQQA 3UB8A 3GDIA 4H6JB 1X0OA 4Y3IA 3A0SA 4HIAA 2L4RA 2EWWA 2XA7M 4GJ4A 4EW7A 3CI6A 1LSWA 3KO6A 5L8MA 2W0NA 1G6OA 2V1AA 4WN5A 2ZMVA 3KSFA 3FPVA 5LBRA 4LRXC 2NUTC 5F5YA 1UWPX 2L1MA 4GW9A 1S4SA 4KUOA 1S1YA 1S66L 3VE3A 2K2NA 5EFWA 4Q0IA 1G28A 2ZOHA 2PD8A 5FL3A 3H7WB 4BMWA 5HWVA 2OAP1 2V0WA 1ZHHB 4WELA 1BYWA 3LIEA 3IS2B 4H6JA 1F98A 1TS6A 3G6OA 4NXFA 4LPZA 2VLGA 5IU1A 2A24A 4GCZA 1XJ2A 2JKTM 3W2ZA 2HV1A 4BWIA 5HWWA 2O9BA 3LI8A 2KLIA 3B47A 2M1CA 3FG8A 5F68A 1T1AA 3R4KA 2QWSA 3NOUC 4B93A 1LSXA 3ICYA 4JGOA 4EU0A 4I38A 3OC2A 5A8BA 3GECA 3IS2A 3BY9A 4ETZA 3LFVA 2PR5A 1IFQA 3OLOA 2W3EA 1JNUA 4I3AA 1NLZA 1Y28A 3MJQA 3UMDA 2Y79A 2JHEA 4O0PA 2ZMFA 1TS8A 4Q0JA 4QPRA 5HZHA 4MN7A 3T4TA 4JGRA 5HD3A 4BBTA 2BASA 3S7OA 1YAXA 3VV4A 2PHYA 3IBJA 1P0ZA 2W1RA 4IUHA 4HJ4A 3CUEA 2JKTI 3F1NB 1GSVA 4I3JA 4M4XA 4XT2B 2PYPA 1T18A 1D7EA 2WKQA 4L9FA 3CLOA 3H9WA 3PBOA 5G4YA 3HJIA 3E98A 4EETB 2W27A 3BJNA 3KSGA 2VV7A 4GS9B 4F3LA 1MZUA 4L9GA 4LLOB 3NJAA 3R7WB 4Z1WA 1ODVA 4L0LA 4NXEA 5CX7A 5J7EA 5HDSA 3TJZC 3T4JA 4P6ZM 4B9OA 5DKLA 2A2LA 3LIAA 3MMHA 2LB5A 3HCYA 2J3TC 3EGDC 3NOTC 4ARZA 4RQ9A 2HF6A 3CUEC 5HPIA 4ZRRA 4MMNA 3K3CA 3LR4A 4G3WA 3R7WA 5IT5A 4MN5A 4Q0HA 3MFXA 2K31A 4EESA 2OWJA 2XA7S 2PDRA 4LRYC 2OOLA 1TS0A 4DMZA 3UB6A 4HHDA 4R3AA 1MC0A 3LICA 3UE3A 2ZBBA 3JVVA 4CLCA 1LSVA 1OJ5A 1XJ4A 2KDKA 5HD5A 4MCWA 4PKYG 4R38A 1H3QA 5G4ZA 4EEPA 3BW6A 4R70A 2D01A 5AVFA 3E4PA 1OT9A 3PBSA 3UE6A 2M7VA 4PKYA 2M7UA 2DMWA 3B33A 4ME4A 4HQAA 3KYZA 3EGXC 3UB9A 3PBTA 4EUVA 4HP9A 1EW0A 2D02A 3UMEA 3NOPC 4G3KA 3TE8A 2HJ9C 3PBNA 3T4KA 3KSHA 5C5KA 1OJGA 3TW8A 5TBMB 1VB6A 3RFBA 4WL9A 3EWKA 3H7WA 5TJJA 4FSFA 3ZQ5A 4KQOA 1D06A 4CLCC 3VE4A 2W3HA 3U2AA 3KSIA 3MQOA 4BBUA 4EQ1A 1N9OA 1T19A 2VX8A 3C30A 4I3IA 4WEJA 3E4QA 1XJ3A 5HDCA 4YOFA 1F9IA 1GSWA 3E0YA 2MJ6A 3LIDA 4EEUA 1IOUA 4DJ3A 2VEAA 3EEHA 3KX0X 3HJKA 1OTEA 3PR6A 4Y5FA 4KQDA 1ZTUA 3OBFA 1N9LA 2GX5A 3RH8B 1KOUA 1UWNX 2LB9A 4WEKA 1OT6A 3ULFA 4DJ2A 2O99A 2YKHA 1OTBA 4PHTA 1TD5A 2IA2A 2OAQ1 4HNBA 3E4OA 2J3TD 2L0WA 3LIBA 5KSHA 3SW1A 3T4LA 5DJUA 5HPFA 4HH3A 2K7SA 2FZ0A 3OCLA 1W63M 4OOLA 4CLCE 3PYPA 4K08A 1GSXA 1XJ6A 1N9NA 1P9RA 2GZAA 1W63Q 2QYBA 4P6ZS 1OTDA 2PYRA 3F1NA 2JN7A 1S1ZA 4I39A 5AJGA 3V67A 2VGLM 4FOFA 1XFQA 2NUPC 2V0UA 4XT2A 2R78A 4BBVA 1T1BA 1NRJA 1V9ZA 4NEED 4YNRA 1S4RA 1T1CA 4GS9A 2QJ7A 3LUQA 3IBRA 2W3FA 1YSPA 4GHIB 3F1OB 4MDZA 1UGUA 3O5YA 4JGQA 5AVEA 1NLYA 4YWZA 2H28A 2VV6A 2YKFA 2VZWA 3ZYTA 1DP6A 5F69A 3LR5A 3F1PB 3MF0A 5IS1A 4L9EA 2Z6DA 3T4SA 2P04A 4AFIA 4HP4A 4EERA 2GNXA 1P9WA 2W3GA 3CWFA 2XRNA 3OOVA 4Y2FA 3RTYA 2FH5A 4G3VA 3MXQA 3VOLA 4JGPA 4IHQA 3EOIA 5HDDA 2A24B 3CAXA 4GHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W3H A;  2B18 A;  2XRO A;  3KSI A;  2W1T B;  2XSS A;  4IUK A;  1YSQ A;  3K2N A;  3TRC A;  5I5L A;  2O0Y A;  4YOF A;  3D3O A;  3E0Y A;  4ETX A;  1MKM A;  5DFX A;  4IJG A;  4DN0 A;  2VJW A;  3S7Q A;  1STZ A;  3E98 A;  3BJN A;  3KSG A;  2O9A A;  2VEA A;  4Z1W A;  4Y5F A;  3NHQ A;  4O01 A;  1ZTU A;  4Y3I A;  5HSQ A;  1VHM A;  3OBF A;  2Y8H A;  2GX5 A;  2KOI A;  3CI6 A;  2LB9 A;  3KO6 A;  5L8M A;  2W1T A;  5HL6 A;  3MMH A;  2LB5 A;  2O99 A;  3KSF A;  3HCY A;  5LBR A;  3S7N A;  4LRX C;  1TD5 A;  2IA2 A;  4GW9 A;  3NOT C;  2W3D A;  4R6L A;  4RQ9 A;  2K2N A;  4Q0I A;  5HPI A;  4ZRR A;  4GLQ A;  2VKS A;  5HPF A;  1TF1 A;  4MMN A;  4G3W A;  3G6O A;  3DBA A;  4Q0H A;  2K31 A;  2QYB A;  4LRY C;  3W2Z A;  2OOL A;  4DMZ A;  1MC0 A;  4BWI A;  4O8G A;  5AJG A;  3MQ0 A;  2O9B A;  4FOF A;  4LRZ E;  2KLI A;  4E04 A;  3R4K A;  4MCW A;  4IUH A;  3NOU C;  4CQH A;  4YNR A;  4EU0 A;  3IBR A;  2W3F A;  4R70 A;  1YSP A;  4MDZ A;  3O5Y A;  4ETZ A;  2M7V A;  3CIT A;  2M7U A;  1F5M A;  3LFV A;  2VZW A;  2HGV A;  2O9C A;  3S7P A;  2W3E A;  4ME4 A;  3C2W A;  3MF0 A;  4EUV A;  2Y79 A;  5DFY A;  4PAU A;  3EEA A;  4O0P A;  2ZMF A;  3NOP C;  4G3K A;  4Q0J A;  4QPR A;  4MN7 A;  2W3G A;  3KSH A;  2XRN A;  3OOV A;  5C5K A;  3S7O A;  4Y2F A;  3RFB A;  4G3V A;  3VV4 A;  5TJJ A;  3ZQ5 A;  5K5B A;  1YKD A;  3IBJ A;  2G7U A;  2W1R A; 
#chains in the Genus database with same CATH topology
 2WUQ A;  2XSS A;  3LYX A;  2X71 A;  3LIF A;  1SDE A;  3K2N A;  4BEN A;  2O0Y A;  4WBG A;  3F1P A;  4B4X A;  1L3L A;  2WAE A;  4R3J A;  1XGJ A;  1MY8 A;  4EXO A;  2ZC6 B;  1GA0 A;  3A0V A;  1AWI A;  3A3J A;  3QP2 A;  5HSQ A;  3MR0 A;  3UN7 A;  1NZU A;  1PZO A;  1H8Y A;  3D72 A;  3S7N A;  2EWV A;  3HUN A;  1JTD A;  3K3D A;  3CJM A;  2W3D A;  3IH9 A;  4R6L A;  1VET A;  2VV8 A;  2HP6 A;  1NWZ A;  3DBA A;  2V9A A;  1DJA A;  1OTI A;  2PBD P;  1YLP A;  2WK0 A;  1IYQ A;  2JKG A;  5FDH A;  4O8G A;  4LRZ E;  3PBR A;  3CPT A;  3LY4 A;  4F3L B;  2HJE A;  1MKI A;  1JVJ A;  3IHB A;  2EX9 A;  1JWP A;  1S67 L;  4UQI M;  4P6B A;  1F5M A;  2QHK A;  1TS7 A;  3PAE A;  5DKK A;  5FQK A;  1XFN A;  3HBR A;  1ZG4 A;  3EEA A;  2VGL S;  4X55 A;  3HUM A;  3QP4 A;  2G2W A;  5F6A A;  3AGE A;  4WYY A;  2V8C A;  1Y4O A;  4KZ4 A;  3BLS A;  1N9B A;  1GHI A;  3P01 A;  1LL8 A;  3DWZ A;  3NBL A;  3ZNY A;  2Z6C A;  5EOO A;  3QP8 A;  4KUK A;  4DE3 A;  3D3O A;  2WKP A;  5CGX A;  1XKZ A;  5CTN A;  1J9M A;  1MKM A;  3M6B A;  4DN0 A;  1GCE A;  4DDS A;  2H10 A;  2WKI A;  2IWB A;  1DP8 A;  5MC7 A;  3N8S A;  3DAV A;  3UB8 A;  2J9P A;  1ZC2 A;  3A3F A;  3E2L A;  4R23 A;  2EXB A;  4Y3I A;  3S1Y A;  3WWX A;  1K56 D;  2EWW A;  4EW7 A;  1HTZ A;  4NG2 A;  1IYP A;  2J7V A;  2W0N A;  2V1A A;  4KQQ A;  5AQ7 A;  4Y17 A;  4KUO A;  4UA9 A;  5DF7 A;  3VP4 A;  4S2P A;  3UPO A;  2ZOH A;  2PD8 A;  1JWZ A;  3H7W B;  5FAQ A;  4CPK A;  2HP9 A;  4LPZ A;  3BFE A;  5IU1 A;  1XJ2 A;  2JKT M;  4RX2 A;  2XK1 A;  3FKW A;  2V8F A;  3UNW A;  2DNS A;  3UPP A;  4LV2 A;  3C7U A;  4I38 A;  3GEC A;  3BY9 A;  3BYD A;  1WE4 A;  3S22 A;  1PW8 A;  1IFQ A;  1XA1 A;  3IF5 A;  2W3E A;  2XD5 A;  2Y2P A;  5HZH A;  3IQA A;  4MN7 A;  3S7O A;  4BLM A;  1VEU A;  1P0Z A;  4EUZ A;  3CUE A;  2EX6 A;  2PBY A;  4D60 A;  2JC7 A;  4M4X A;  3OZH A;  3SOI A;  2PYP A;  1ACF A;  1BLH A;  1K57 C;  3CLO A;  3H9W A;  2WZZ A;  2W27 A;  3BJN A;  3S4X A;  3MSH A;  1ODV A;  4JF5 A;  3TJZ C;  1BZA A;  2Y2H A;  4P6Z M;  4XXR A;  2A2L A;  3LO7 A;  1E3U D;  4UHU A;  3AGF A;  3HCY A;  4N9L A;  2J3T C;  3EGD C;  5F1G A;  3NOT C;  2A49 A;  4ARZ A;  4OPY A;  4P85 A;  3IXH A;  4RQ9 A;  4P87 A;  4OP8 A;  1LL9 A;  5HPI A;  4ZRR A;  5M1A A;  1FSY A;  5FI6 A;  1YLJ A;  3K3C A;  5IT5 A;  3R7W A;  1CQA A;  1FR1 A;  4MN5 A;  2K31 A;  4NK3 A;  2XA7 S;  2VGJ A;  1TS0 A;  4R3A A;  1K4F A;  2QPN A;  3IX3 A;  1LSV A;  1XJ4 A;  3NY4 A;  5HAI A;  2ZQC A;  3UE0 A;  1XP4 A;  2WYX A;  4JF6 A;  1H3Q A;  4MBK A;  4X1M A;  4R70 A;  4EEP A;  1OT9 A;  3UE6 A;  2OSU A;  2M7U A;  5EVI C;  1HVB A;  2WKE A;  3VP1 A;  3QNC A;  2DCF A;  3DWK A;  1VET B;  4JKT A;  3BEB A;  2D02 A;  5D3O A;  3NOP C;  2HJ9 C;  2V1Z A;  1IYS A;  3O87 A;  5EUA A;  1TEM A;  4OPQ A;  4KG5 A;  1VB6 A;  1PNE A;  3EWK A;  1Q2Q A;  5TJJ A;  4FSF A;  1D06 A;  4EBL A;  1K54 C;  2W3H A;  3KSI A;  4GZB A;  1PWG A;  4C75 A;  3ZDJ A;  4YOF A;  1ESI A;  4FTX A;  1U60 A;  3E0Y A;  4X1L A;  5G18 A;  4ESP A;  1KE3 A;  1IOU A;  4F94 A;  4DJ3 A;  2VEA A;  3RXW A;  4RYE A;  4IVK A;  3OBF A;  1N9L A;  2GDN A;  3V3S A;  2GX5 A;  1I2W A;  4DJ2 A;  4PHT A;  3G2Z A;  3ZCZ A;  2ZM8 A;  4HNB A;  3E4O A;  3IF6 A;  1HD8 A;  3WS2 A;  2K7S A;  2P74 A;  3HUO A;  3OCL A;  4CLC E;  4U0T A;  4K08 A;  4GDB A;  3ZNT A;  2GZA A;  2Z2M B;  3B3X A;  2QYB A;  5GLD A;  1OME A;  1W8Y A;  2VGL M;  3GVB A;  4E3M A;  3Q1F A;  2R78 A;  2XR0 A;  1CF0 A;  3HLB A;  2WAD A;  5EVI A;  4ZDX A;  1S4R A;  3ZG8 B;  4GHI B;  3F1O B;  2X01 A;  4EBN A;  4JGQ A;  4M3K A;  5FI2 A;  3I7J A;  3BFG A;  3IT9 A;  4KZB A;  3E2K A;  2WGW A;  3T4S A;  4QHC A;  4EER A;  3HLW A;  2OV5 A;  2B5R A;  1K54 A;  4GD6 A;  1GA9 A;  3CWF A;  2H5S A;  5FAT A;  4R0Q A;  2PAV P;  3MXQ A;  4IHQ A;  3EOI A;  3OPP A;  3O86 A;  3DTM A;  2XRO A;  2W1T B;  3ZG5 A;  4PM5 A;  4CLC D;  1ONG A;  4S2M A;  2PR6 A;  5DFX A;  2E8J A;  4LFU A;  4X6T A;  4JPM A;  2P7J A;  5E2H A;  2ACG A;  3EQU A;  3PXP A;  2E8I A;  3QP6 A;  4LCM A;  4ZAM A;  3RXX A;  4CJN A;  4PM8 A;  1ONH A;  3BQ8 A;  3T4Q A;  4PPR A;  2VA0 A;  3BLM A;  3MXS A;  3N8L A;  3MBZ A;  4DE2 A;  1VEU B;  3PTE A;  2Y2I A;  4GLQ A;  2VKS A;  5FAO A;  2HDR A;  2P9V A;  3A3I A;  3IX8 A;  3G2Y A;  3TSG A;  2GJ3 A;  3NDG A;  3SZT A;  1SKF A;  2VGK A;  3ZGA B;  1ES2 A;  5CEB A;  1WYB A;  2Q9M A;  2WKR A;  2QZ6 A;  3H82 A;  4P0M A;  5HL1 A;  3IXB A;  2EA9 A;  3AGD A;  4PM9 A;  5DTS A;  2Y4A A;  3BWL A;  3ZFZ A;  5DTK A;  2HGV A;  2O9C A;  2QKP A;  3BEC A;  1NYY A;  3DTE A;  4ARZ B;  5DJT A;  5DF8 A;  4PAU A;  1E3U A;  3JVU A;  1G6A A;  1YMX A;  2JBF A;  2JKR M;  4MBF A;  5F1F A;  1KGF A;  3BY8 A;  5GL9 A;  5K5B A;  2G7U A;  4II7 A;  4H8R A;  2IWD A;  3TG9 A;  1HLU P;  5U47 A;  1LT0 A;  4Y15 A;  5A92 A;  4ETX A;  1STZ A;  3BM6 A;  5DF9 A;  2RCX A;  1PFL A;  4H6J B;  5HW3 A;  4S2J A;  3A0S A;  2XA7 M;  3CI6 A;  2XQZ A;  4RA7 A;  3KO6 A;  2ZMV A;  3KSF A;  3FPV A;  4LRX C;  5F5Y A;  3V5M A;  2L1M A;  3W4Q A;  1KGE A;  4GNU A;  1S66 L;  4Q0I A;  4PMA A;  5FL3 A;  4BMW A;  5HWV A;  1ZHH B;  4N92 A;  5CXW A;  1BYW A;  3IS2 B;  1F98 A;  1TS6 A;  1ERO A;  3FWL A;  1LLB A;  3G6O A;  1KE0 A;  3C5A A;  4E3L A;  2VLG A;  4GCZ A;  4OLG A;  4MNR A;  1KE4 A;  3VP2 A;  2O9B A;  3B47 A;  2M1C A;  1FIK A;  3CHW P;  3R4K A;  2QWS A;  3NOU C;  4B93 A;  3QP1 A;  4JGO A;  3VOZ A;  4GKU A;  5DTT A;  4ETZ A;  1EWZ A;  3V50 A;  2BG1 A;  5E2F A;  2PR5 A;  4OQH A;  4S2K A;  5TFQ A;  4BD1 A;  4I3A A;  1FOF A;  1NLZ A;  1Y28 A;  2ZMF A;  4JGR A;  3UO9 A;  3M2J A;  1O7E A;  1LI0 A;  4OON A;  5EEC A;  4IUH A;  3WS4 A;  4GDN A;  4KZ9 A;  4E3N A;  1GSV A;  4R1G A;  4KEN B;  4QY6 A;  4IVI A;  1CI8 A;  4DKI A;  1D7E A;  5EVI B;  2JKF A;  1PI5 A;  2Y2O A;  3FZC A;  2EX8 A;  4LCL A;  3NJA A;  2Y2K A;  4NXE A;  5J7E A;  5HDS A;  2Y2N A;  4EBP A;  1YM1 A;  3D4F A;  5L07 A;  2WGW B;  3LIA A;  2C6W B;  2LB5 A;  5A90 A;  2PU4 A;  3G32 A;  3CUE C;  5L10 A;  3LR4 A;  1M40 A;  4Q0H A;  3M2K A;  3MFX A;  2OWJ A;  1E25 A;  4LRY C;  1SKO A;  1NYM A;  4HHD A;  1YPR A;  1MC0 A;  3UE3 A;  2ZBB A;  4CLC A;  1ES4 A;  1L2S A;  1FCO A;  1J3W A;  1RP5 A;  3WRZ A;  4LGW A;  2XLN A;  3GR2 A;  5AVF A;  2DMW A;  5GLC A;  1IEL A;  3SS4 A;  4HQA A;  1K0K A;  3PBT A;  5FQ9 A;  2R9W A;  2XF3 A;  4WZ5 A;  4DF6 A;  5A91 A;  3MFD A;  3PBN A;  5CHJ A;  5C5K A;  1TVF A;  2P9V B;  3TW8 A;  3RFB A;  3HLC A;  5FQM A;  3VE4 A;  3SH8 A;  4BBU A;  4DRT A;  4DDY A;  1VM1 A;  2VX8 A;  4BL2 A;  1XPB A;  1ERQ A;  1XJ3 A;  2J8Y A;  1PWC A;  3GTC A;  5L2F A;  4E6X A;  2MJ6 A;  3SH7 A;  1MWS A;  1M6K A;  3LID A;  1S0W A;  1ES5 A;  3OPL A;  5EVE A;  1DJC A;  3PR6 A;  5KSC A;  3VSK A;  4Y5F A;  2OLU A;  5FQJ A;  3BFF A;  2I72 A;  3RH8 B;  3UDF A;  4E3J A;  4WEK A;  3QHY A;  2ZD8 A;  1OTB A;  1TD5 A;  2IA2 A;  3NCK A;  1FSW A;  4WZ4 A;  5GLA A;  2ZLY A;  3LIB A;  5E2G A;  4HH3 A;  4UA7 A;  4U3T A;  1BTL A;  4S2L A;  3HLE A;  1N9N A;  1W63 Q;  3GQZ A;  1OTD A;  3F1N A;  5AJG A;  3W4O A;  1XFQ A;  3V3R A;  4FH2 A;  3O3V A;  5CED A;  1RCJ A;  4BBV A;  1T1B A;  4YNR A;  1T1C A;  1PZP A;  5JYP A;  3VOY A;  4QB8 A;  3Q7Z A;  1CJF A;  1YLY A;  3O5Y A;  4YWZ A;  2YKF A;  3VSL A;  2VZW A;  3IF6 C;  4A5R A;  4Y0U A;  4OPZ A;  1L0G A;  3LR5 A;  3F1P B;  2H0Y A;  1A0K A;  4KZA A;  5IS1 A;  1CEG A;  2Z2L B;  2Z6D A;  5FQI A;  2P04 A;  4QY5 A;  4AFI A;  4HP4 A;  2AVX A;  1P9W A;  1YMS A;  4QD4 A;  1JTG A;  3RTY A;  2FH5 A;  4DE0 A;  4JGP A;  2WGV A;  3LEQ A;  1KDS A;  2B18 A;  4KZ8 A;  3MZE A;  2V1B A;  5HAR A;  3NI9 A;  5FSR A;  5KIZ A;  5EV0 A;  3EQV A;  4BJP A;  4IJG A;  1W5D A;  3C8C A;  1ZKJ A;  2VJW A;  3HL9 A;  3CZD A;  3JYI A;  4WF0 A;  3NHQ A;  3P7N A;  4HJ6 A;  1BUL A;  3N4I A;  2WKH A;  2KOI A;  4OP5 A;  1L0F A;  3VP0 A;  3PHY A;  5HL6 A;  5TR7 A;  2J3W A;  1OTA A;  1OPX A;  4X25 A;  3CPT B;  1YT4 A;  4BL3 A;  2ZQ9 A;  2R9X A;  4KG2 A;  3NEC A;  3MXR A;  4K91 A;  5HDD A;  3MZF A;  1CI9 A;  5HAP A;  1TF1 A;  3LEZ A;  4XUZ A;  5TBM A;  3VFH A;  3CG5 A;  3LR3 A;  5EM1 A;  3IWQ A;  3T50 A;  2WZX A;  4I5S A;  4IBR A;  2B95 A;  1DY6 A;  3C38 A;  2C5W B;  4GN2 A;  1NZO A;  3KYQ A;  2HPB A;  3PBQ A;  2P08 A;  4HOI A;  4HI4 A;  3T4O A;  2XH9 A;  3UB7 A;  3ISG A;  1BSG A;  3DW0 A;  4JF4 A;  1K55 A;  2J80 A;  4O7D A;  4UQI S;  4HJ3 A;  1MPL A;  1XXM A;  1H8M A;  1DJB A;  3C2W A;  5DFY A;  3OPH A;  5CER A;  3G35 A;  2XGN A;  5CRF A;  5M19 A;  3LI9 A;  4DXC A;  2XEP A;  2OWH A;  1N4O A;  1YKD A;  2A3U A;  2KX6 A;  3T1R A;  2Y2M A;  3ITA A;  4WLA A;  4MN6 A;  4NXG A;  1K56 A;  4CLC B;  4NKP A;  3MZD A;  2UV0 E;  2ZQD A;  2BTF P;  2PD7 A;  5J3W A;  1KDW A;  3IX4 A;  5CGS A;  2QJ5 A;  5E2E A;  3GDI A;  3N6I A;  1X0O A;  3GMW A;  3IXG A;  4GJ4 A;  5L09 A;  1LI9 A;  2XFT A;  2Y59 A;  4MBH A;  1K6S A;  5KMW A;  1RGZ A;  3D9Y A;  4OVD A;  2K2N A;  4HBU A;  2XFS A;  2V0W A;  4KG6 A;  3HLD A;  4WEL A;  1FQG A;  1K4E A;  4NXF A;  2DRW A;  3HLF A;  2XDM A;  4MLL A;  1BLC A;  4BWI A;  3IH8 A;  2HP5 A;  5EOE A;  2FFY A;  3FG8 A;  5F68 A;  4QJG A;  1H0M A;  1LSX A;  5FA7 A;  4EU0 A;  2EXA A;  1KVM A;  3OC2 A;  1XA7 A;  4DXB A;  4K0X A;  3LCE A;  2Q9N A;  3ZG0 A;  3LFV A;  3CMZ A;  3OLO A;  1JNU A;  1CEF A;  3MJQ A;  3UMD A;  5TGF A;  3MS6 A;  5CTM A;  2BLS A;  5FEF A;  1TS8 A;  4Q0J A;  4QPR A;  1W7F A;  3T4T A;  4FD8 A;  3HVF A;  5HD3 A;  4BBT A;  1I5Q A;  1YAX A;  3VV4 A;  3ZVW A;  3T1Q B;  5F82 A;  2PHY A;  3IBJ A;  2W1R A;  3WS1 A;  4HJ4 A;  1YLZ A;  3F1N B;  4QWO A;  4U0X A;  1SHV A;  1NRF A;  3NDE A;  2WKQ A;  4L9F A;  3E98 A;  4EET B;  4HEF A;  3KSG A;  2VV7 A;  5E43 A;  1NJ4 A;  5GHY A;  4LLO B;  3R7W B;  4L0L A;  4LV0 A;  1TDL A;  1LL5 A;  4WMC D;  5DKL A;  2V2F F;  4R3B A;  4ZJ3 A;  3MMH A;  3L7H A;  3V39 A;  5EVL A;  3FKV A;  5HFO A;  4X53 A;  2HF6 A;  3IHA A;  4Y0T A;  4X56 A;  4MMN A;  1S6R A;  4G3W A;  1ZG6 A;  3C4P A;  4EES A;  5GLB A;  2PDR A;  1MXO A;  4DMZ A;  3UB6 A;  4ZBE A;  3OPR A;  4RVA A;  2Y91 A;  4JBF A;  3JVV A;  2KDK A;  3IWO A;  4MCW A;  2FFF B;  4BQM A;  3BW6 A;  3JPU A;  3E4P A;  3PBS A;  4E3K A;  2M7V A;  1ALQ A;  4PKY A;  4KZ5 A;  4S2N A;  3B33 A;  4ME4 A;  5F83 A;  4WM9 A;  3EGX C;  3UB9 A;  4EUV A;  4HP9 A;  2JE5 A;  3T1X A;  3UME A;  4BD0 A;  4G3K A;  3T4K A;  3NIA A;  3KSH A;  4HES A;  5TBM B;  2Y2G A;  4WL9 A;  1ERM A;  3ZQ5 A;  3ZVT A;  4CLC C;  4LEN A;  1BLS A;  3MQO A;  4EQ1 A;  4HBT A;  1N9O A;  3Q82 A;  3P98 A;  1F9I A;  1GSW A;  3UB5 P;  3Q7V A;  4EEU A;  3IF6 B;  3EEH A;  4E3I A;  1Z6F A;  1AXB A;  1VQQ A;  4WZ5 C;  5M18 A;  1ESU A;  1UWN X;  1FCN A;  3ULF A;  1CK3 A;  2O99 A;  1XX2 A;  2OAQ 1;  3L9K A;  1KGG A;  4Y0O A;  2J3T D;  2L0W A;  4LV3 A;  2ZM2 A;  5KSH A;  4PM7 A;  3SS5 A;  3T4L A;  5DJU A;  1SCW A;  3UDI A;  3G34 A;  3BFC A;  1W63 M;  4Q8I A;  5FEG A;  4OOL A;  2ZC7 A;  4C6Y A;  1XJ6 A;  4E3O A;  3RJU A;  3IWI A;  4I39 A;  3V67 A;  4FOF A;  4XT2 A;  4B4Z A;  1BUE A;  4Y7P A;  1NRJ A;  1V9Z A;  2XD1 A;  4K0W A;  4GS9 A;  1Z09 A;  2QJ7 A;  3LUQ A;  1YSP A;  4NET A;  4MDZ A;  1K38 A;  5AVE A;  1NLY A;  3G30 A;  2H28 A;  3PAG A;  3ZYT A;  5F69 A;  3QP5 A;  4JXW A;  3GSG A;  3MF0 A;  2ZL1 A;  5EVI D;  5GHX A;  2W3G A;  4Y2F A;  4G3V A;  3VOL A;  2J9O A;  4GHI A;  3F1O A;  1W79 A;  3N8R A;  2B02 A;  4XUX A;  1PW1 A;  4HY8 A;  1FR6 A;  1Y54 A;  5I5L A;  4UEY A;  3VP3 A;  1H8Z A;  2INW A;  4OQ0 A;  3S7Q A;  2JKR I;  2PT7 A;  1YLW A;  5HWT A;  2CMN A;  4JXV A;  1V9Y A;  2ZQA A;  3ZHH A;  2VK3 A;  4O01 A;  5EE8 A;  1BLP A;  5J4E A;  4OH0 A;  1VHM A;  2Y8H A;  1GHM A;  2UWX A;  2PU2 A;  2W1T A;  1SDN A;  3FPW A;  1XGI A;  3H82 B;  2ZOI A;  4KZ6 A;  5BOH A;  4LV1 A;  2IWC A;  4X68 A;  5FI7 A;  3KYE A;  4ZJ1 A;  1IYO A;  1L0E A;  1PRQ A;  3P09 A;  1BT5 A;  4OPR A;  3UDX A;  1MWR A;  3U4L P;  1P97 A;  1G5U A;  3FC7 A;  1HZO A;  3UY6 A;  1PI4 A;  3G4P A;  3BFD A;  4X69 A;  3MQ0 A;  4WUJ A;  4OLD A;  4E04 A;  4CQH A;  5CHU A;  4N1H A;  4GOG A;  1QME A;  4KZ3 A;  4KZ7 A;  3CIT A;  1RGY A;  3S7P A;  2JCH A;  3WS0 A;  2X02 A;  3BQA A;  3O88 A;  4WMC A;  3LR0 A;  3OCN A;  4MEZ A;  1MBL A;  4HH2 A;  3B42 A;  1WA9 A;  1LHY A;  1KVL A;  5CEC A;  2ZQ8 A;  1Q2P A;  4OOM A;  1DRM A;  4NXB A;  1MWU A;  3A0R A;  3SH9 A;  4FUW A;  4IUK A;  1YSQ A;  4EWF A;  3TRC A;  3W8K A;  4S2O A;  2I9V A;  3IXD A;  4N9K A;  3A3E A;  1K55 C;  5A93 A;  2EFU A;  2ZC3 B;  4D2O A;  1DP9 A;  4JLF A;  3DTI A;  1MWT A;  2O9A A;  3MQQ A;  3MKF A;  5CGW A;  1IKG A;  4HIA A;  2L4R A;  3ITB A;  2EX2 A;  1LSW A;  5L8M A;  1PIO A;  2Y2L A;  1G6O A;  4WN5 A;  4OQI A;  5LBR A;  4OQG A;  2NUT C;  2Q0O A;  1UWP X;  4GW9 A;  1S4S A;  3VFF A;  1S1Y A;  3VE3 A;  4C3Q A;  5EFW A;  1G28 A;  5AQ9 A;  5DVA A;  2CC1 A;  3WRT A;  2OAP 1;  5AQB A;  4FCF A;  5JYO A;  3LIE A;  4H6J A;  1FIL A;  4YFM A;  3HLG A;  2A24 A;  2OLV A;  3W2Z A;  2HV1 A;  4UAA A;  4GB7 A;  3G31 A;  3Q7V B;  3ZG7 B;  5HWW A;  2V20 A;  3LI8 A;  2KLI A;  1T1A A;  4IED A;  2PRF A;  4E6W A;  1C3B A;  3ICY A;  2H0T A;  5A8B A;  3IS2 A;  1K57 A;  4KQR A;  3SS3 A;  3T1S A;  5AQA A;  5FDS A;  2Y79 A;  2JHE A;  4O0P A;  2WGI A;  3GV9 A;  4EV4 A;  3TOI A;  4B88 A;  3LY3 A;  1SZV A;  4JXS A;  2BAS A;  3HRE A;  1E4D A;  5EPH A;  1IEM A;  5CHM A;  3W4P A;  2JKT I;  3M6H A;  4I3J A;  4XT2 B;  3DTK A;  1T18 A;  3UE1 A;  3PBO A;  5G4Y A;  2ZJ9 A;  3HJI A;  1K6R A;  4GS9 B;  4F3L A;  1MZU A;  4IBX A;  4L9G A;  4UA6 A;  4Z1W A;  5CX7 A;  4YIN A;  1YQS A;  2ZC5 B;  2ZQ7 A;  4ZTK A;  3T4J A;  4B9O A;  2EFX A;  1SKO B;  3Q81 A;  2ZL1 B;  5FQQ A;  4OOY A;  3T12 B;  2Y2J A;  3FV7 A;  3MKE A;  4GD8 A;  1TDG A;  4Y13 A;  5J8X A;  2OOL A;  5FAS A;  4ID4 A;  3LIC A;  3FYZ A;  5FAP A;  1OJ5 A;  5HD5 A;  2QMI A;  2Y55 A;  4PKY G;  4R38 A;  4JXG A;  3QNB A;  5G4Z A;  4PM6 A;  2D01 A;  4S2I A;  3ZG9 B;  5HAQ A;  3NC8 A;  3KYZ A;  1EW0 A;  3TE8 A;  2ZM0 A;  1O07 A;  3C7V A;  1OJG A;  3N7W A;  1NXY A;  3H7W A;  3NUL A;  3Q07 A;  4KQO A;  4EQI A;  1PYY A;  3U2A A;  1L0D A;  2Y2Q A;  4N1X A;  4WEJ A;  1T19 A;  3C30 A;  2ZMA A;  4I3I A;  4Z9Q A;  3E4Q A;  5HDC A;  2G2U A;  5GHZ A;  1PWD A;  4S2N C;  2ZC4 B;  3KX0 X;  3HJK A;  1OTE A;  4R4R A;  4OKP A;  4KQD A;  1ZTU A;  1D1J A;  4DE1 A;  2HDU A;  1KOU A;  3UPN A;  2LB9 A;  1OT6 A;  3A3D A;  2YKH A;  2HDQ A;  1YLT A;  5KZH A;  1JWV A;  3SW1 A;  4QU3 A;  5HPF A;  4RX3 A;  2FZ0 A;  3BRM A;  3PYP A;  4FH4 A;  5IHV A;  4ZJ2 A;  1GSX A;  1NY0 A;  1P9R A;  1ES3 A;  5I94 A;  1FCM A;  1F2K A;  4P6Z S;  2PYR A;  2RL3 A;  2JN7 A;  1S1Z A;  1IKI A;  2NUP C;  2V0U A;  1K25 A;  1EI5 A;  1I2S A;  4NEE D;  5EM0 A;  2WAF A;  2HZ5 A;  3C4O A;  3IBR A;  2W3F A;  1UGU A;  1W8Q A;  1G68 A;  3LGO A;  2VV6 A;  2HDS A;  1DP6 A;  4R4S A;  4L9E A;  1H5X A;  2GNX A;  3VMA A;  2XRN A;  1QMF A;  3WS5 A;  3OOV A;  1GHP A;  3GRJ A;  1WYC A;  2A24 B;  3CAX A;  5HX9 A; 
#chains in the Genus database with same CATH homology
 2B18 A;  3F1O A;  2XRO A;  2W1T B;  2B02 A;  2XSS A;  3LYX A;  2V1B A;  3LIF A;  3K2N A;  4HY8 A;  4CLC D;  5I5L A;  2O0Y A;  4UEY A;  3F1P A;  5KIZ A;  2PR6 A;  3EQV A;  4BJP A;  5DFX A;  4IJG A;  2INW A;  3C8C A;  2VJW A;  3S7Q A;  2JKR I;  2PT7 A;  5HWT A;  2CMN A;  4EXO A;  1V9Y A;  2P7J A;  3A0V A;  4WF0 A;  3NHQ A;  4O01 A;  3P7N A;  4HJ6 A;  3EQU A;  3PXP A;  5J4E A;  5HSQ A;  1VHM A;  2Y8H A;  2KOI A;  3MR0 A;  3PHY A;  2W1T A;  5HL6 A;  3FPW A;  2J3W A;  3BQ8 A;  1OTA A;  3D72 A;  1OPX A;  3S7N A;  3H82 B;  3T4Q A;  2EWV A;  2ZOI A;  3K3D A;  2W3D A;  2VA0 A;  4R6L A;  2VV8 A;  4GLQ A;  2VKS A;  1TF1 A;  1NWZ A;  5TBM A;  3DBA A;  2V9A A;  3LR3 A;  2GJ3 A;  3T50 A;  1OTI A;  1P97 A;  4I5S A;  3FC7 A;  2WKR A;  3C38 A;  4O8G A;  3MQ0 A;  3H82 A;  3PBR A;  4LRZ E;  4WUJ A;  4E04 A;  4F3L B;  2HJE A;  3KYQ A;  3PBQ A;  2P08 A;  4HOI A;  4HI4 A;  3T4O A;  3UB7 A;  4CQH A;  2EA9 A;  1S67 L;  2J80 A;  4UQI M;  3BWL A;  3CIT A;  1F5M A;  4UQI S;  2HGV A;  2O9C A;  2QHK A;  4HJ3 A;  3S7P A;  2QKP A;  1H8M A;  1TS7 A;  3C2W A;  5DKK A;  3BQA A;  4ARZ B;  5DJT A;  5DFY A;  1XFN A;  3LR0 A;  3OCN A;  4PAU A;  3EEA A;  4HH2 A;  2VGL S;  3B42 A;  3JVU A;  1WA9 A;  2JKR M;  3LI9 A;  5F6A A;  4OOM A;  3BY8 A;  2OWH A;  5K5B A;  1YKD A;  1DRM A;  2KX6 A;  2G7U A;  4NXB A;  4II7 A;  3A0R A;  3P01 A;  1LL8 A;  4IUK A;  1YSQ A;  4WLA A;  3TRC A;  4MN6 A;  4NXG A;  2Z6C A;  4KUK A;  1LT0 A;  2I9V A;  3D3O A;  4CLC B;  2WKP A;  4NKP A;  4ETX A;  1MKM A;  4DN0 A;  2PD7 A;  5J3W A;  1DP9 A;  1STZ A;  1DP8 A;  5MC7 A;  2O9A A;  2QJ5 A;  5DF9 A;  3MQQ A;  3UB8 A;  3GDI A;  4H6J B;  1X0O A;  4Y3I A;  3A0S A;  4HIA A;  2L4R A;  2EWW A;  2XA7 M;  4GJ4 A;  4EW7 A;  3CI6 A;  1LSW A;  3KO6 A;  5L8M A;  2W0N A;  1G6O A;  2V1A A;  4WN5 A;  2ZMV A;  3KSF A;  3FPV A;  5LBR A;  4LRX C;  2NUT C;  5F5Y A;  1UWP X;  2L1M A;  4GW9 A;  1S4S A;  4KUO A;  1S1Y A;  1S66 L;  3VE3 A;  2K2N A;  5EFW A;  4Q0I A;  1G28 A;  2ZOH A;  2PD8 A;  5FL3 A;  3H7W B;  4BMW A;  5HWV A;  2OAP 1;  2V0W A;  1ZHH B;  4WEL A;  1BYW A;  3LIE A;  3IS2 B;  4H6J A;  1F98 A;  1TS6 A;  3G6O A;  4NXF A;  4LPZ A;  2VLG A;  5IU1 A;  2A24 A;  4GCZ A;  1XJ2 A;  2JKT M;  3W2Z A;  2HV1 A;  4BWI A;  5HWW A;  2O9B A;  3LI8 A;  2KLI A;  3B47 A;  2M1C A;  3FG8 A;  5F68 A;  1T1A A;  3R4K A;  2QWS A;  3NOU C;  4B93 A;  1LSX A;  3ICY A;  4JGO A;  4EU0 A;  4I38 A;  3OC2 A;  5A8B A;  3GEC A;  3IS2 A;  3BY9 A;  4ETZ A;  3LFV A;  2PR5 A;  1IFQ A;  3OLO A;  2W3E A;  1JNU A;  4I3A A;  1NLZ A;  1Y28 A;  3MJQ A;  3UMD A;  2Y79 A;  2JHE A;  4O0P A;  2ZMF A;  1TS8 A;  4Q0J A;  4QPR A;  5HZH A;  4MN7 A;  3T4T A;  4JGR A;  5HD3 A;  4BBT A;  2BAS A;  3S7O A;  1YAX A;  3VV4 A;  2PHY A;  3IBJ A;  1P0Z A;  2W1R A;  4IUH A;  4HJ4 A;  3CUE A;  2JKT I;  3F1N B;  1GSV A;  4I3J A;  4M4X A;  4XT2 B;  2PYP A;  1T18 A;  1D7E A;  2WKQ A;  4L9F A;  3CLO A;  3H9W A;  3PBO A;  5G4Y A;  3HJI A;  3E98 A;  4EET B;  2W27 A;  3BJN A;  3KSG A;  2VV7 A;  4GS9 B;  4F3L A;  1MZU A;  4L9G A;  4LLO B;  3NJA A;  3R7W B;  4Z1W A;  1ODV A;  4L0L A;  4NXE A;  5CX7 A;  5J7E A;  5HDS A;  3TJZ C;  3T4J A;  4P6Z M;  4B9O A;  5DKL A;  2A2L A;  3LIA A;  3MMH A;  2LB5 A;  3HCY A;  2J3T C;  3EGD C;  3NOT C;  4ARZ A;  4RQ9 A;  2HF6 A;  3CUE C;  5HPI A;  4ZRR A;  4MMN A;  3K3C A;  3LR4 A;  4G3W A;  3R7W A;  5IT5 A;  4MN5 A;  4Q0H A;  3MFX A;  2K31 A;  4EES A;  2OWJ A;  2XA7 S;  2PDR A;  4LRY C;  2OOL A;  1TS0 A;  4DMZ A;  3UB6 A;  4HHD A;  4R3A A;  1MC0 A;  3LIC A;  3UE3 A;  2ZBB A;  3JVV A;  4CLC A;  1LSV A;  1OJ5 A;  1XJ4 A;  2KDK A;  5HD5 A;  4MCW A;  4PKY G;  4R38 A;  1H3Q A;  5G4Z A;  4EEP A;  3BW6 A;  4R70 A;  2D01 A;  5AVF A;  3E4P A;  1OT9 A;  3PBS A;  3UE6 A;  2M7V A;  4PKY A;  2M7U A;  2DMW A;  3B33 A;  4ME4 A;  4HQA A;  3KYZ A;  3EGX C;  3UB9 A;  3PBT A;  4EUV A;  4HP9 A;  1EW0 A;  2D02 A;  3UME A;  3NOP C;  4G3K A;  3TE8 A;  2HJ9 C;  3PBN A;  3T4K A;  3KSH A;  5C5K A;  1OJG A;  3TW8 A;  5TBM B;  1VB6 A;  3RFB A;  4WL9 A;  3EWK A;  3H7W A;  5TJJ A;  4FSF A;  3ZQ5 A;  4KQO A;  1D06 A;  4CLC C;  3VE4 A;  2W3H A;  3U2A A;  3KSI A;  3MQO A;  4BBU A;  4EQ1 A;  1N9O A;  1T19 A;  2VX8 A;  3C30 A;  4I3I A;  4WEJ A;  3E4Q A;  1XJ3 A;  5HDC A;  4YOF A;  1F9I A;  1GSW A;  3E0Y A;  2MJ6 A;  3LID A;  4EEU A;  1IOU A;  4DJ3 A;  2VEA A;  3EEH A;  3KX0 X;  3HJK A;  1OTE A;  3PR6 A;  4Y5F A;  4KQD A;  1ZTU A;  3OBF A;  1N9L A;  2GX5 A;  3RH8 B;  1KOU A;  1UWN X;  2LB9 A;  4WEK A;  1OT6 A;  3ULF A;  4DJ2 A;  2O99 A;  2YKH A;  1OTB A;  4PHT A;  1TD5 A;  2IA2 A;  2OAQ 1;  4HNB A;  3E4O A;  2J3T D;  2L0W A;  3LIB A;  5KSH A;  3SW1 A;  3T4L A;  5DJU A;  5HPF A;  4HH3 A;  2K7S A;  2FZ0 A;  3OCL A;  1W63 M;  4OOL A;  4CLC E;  3PYP A;  4K08 A;  1GSX A;  1XJ6 A;  1N9N A;  1P9R A;  2GZA A;  1W63 Q;  2QYB A;  4P6Z S;  1OTD A;  2PYR A;  3F1N A;  2JN7 A;  1S1Z A;  4I39 A;  5AJG A;  3V67 A;  2VGL M;  4FOF A;  1XFQ A;  2NUP C;  2V0U A;  4XT2 A;  2R78 A;  4BBV A;  1T1B A;  1NRJ A;  1V9Z A;  4NEE D;  4YNR A;  1S4R A;  1T1C A;  4GS9 A;  2QJ7 A;  3LUQ A;  3IBR A;  2W3F A;  1YSP A;  4GHI B;  3F1O B;  4MDZ A;  1UGU A;  3O5Y A;  4JGQ A;  5AVE A;  1NLY A;  4YWZ A;  2H28 A;  2VV6 A;  2YKF A;  2VZW A;  3ZYT A;  1DP6 A;  5F69 A;  3LR5 A;  3F1P B;  3MF0 A;  5IS1 A;  4L9E A;  2Z6D A;  3T4S A;  2P04 A;  4AFI A;  4HP4 A;  4EER A;  2GNX A;  1P9W A;  2W3G A;  3CWF A;  2XRN A;  3OOV A;  4Y2F A;  3RTY A;  2FH5 A;  4G3V A;  3MXQ A;  3VOL A;  4JGP A;  4IHQ A;  3EOI A;  5HDD A;  2A24 B;  3CAX A;  4GHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...