2HGVA

N-terminal gaf domain of transcriptional pleiotropic repressor cody
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
155
structure length
155
Chain Sequence
MALLQKTRIINSMLQAAAGKPVNFKEMAETLRDVIDSNIFVVSRRGKLLGYSINQQIENDRMKKMLEDRQFPEEYTKNLFNVPETSSNLDINSEYTAFPVENRDLFQAGLTTIVPIIGGGERLGTLILSRLQDQFNDDDLILAEYGATVVGMEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords GTP-sensing transcriptional pleiotropic repressor codY
publication title The Structure of CodY, a GTP- and Isoleucine-responsive Regulator of Stationary Phase and Virulence in Gram-positive Bacteria
pubmed doi rcsb
source organism Bacillus subtilis
total genus 41
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2006-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2hgvA00
4YOFA 3NOPC 4R6LA 4MMNA 4LRZE 4DMZA 1MKMA 2LB9A 4LRYC 2M7VA 3RFBA 1YKDA 1STZA 4ETXA 3KSHA 4Q0IA 2LB5A 1ZTUA 2VEAA 3CI6A 3KSGA 3MQ0A 4CQHA 4O0PA 4G3VA 4QPRA 5AJGA 4FOFA 3NOTC 3ZQ5A 3O5YA 4IUKA 2W3EA 2W3GA 3K2NA 3KO6A 4G3KA 4ME4A 5TJJA 3KSFA 5L8MA 4EUVA 3IBRA 3LFVA 3BJNA 4EU0A 4Q0HA 2XROA 3HCYA 4MN7A 4YNRA 3S7NA 3G6OA 2W3DA 4ZRRA 3OBFA 4GLQA 3E98A 2K2NA 4Y3IA 2K31A 3E0YA 1YSPA 4GW9A 3S7QA 5HPFA 3IBJA 1MC0A 2W3HA 5I5LA 4O8GA 5HSQA 2OOLA 2G7UA 4Q0JA 4IUHA 2KLIA 4PAUA 5HPIA 4Y2FA 2W3FA 2O99A 2VKSA 2O9CA 2B18A 2Y8HA 1TD5A 5DFYA 4MDZA 1YSQA 2W1RA 2W1TA 3CITA 3MF0A 3W2ZA 2VJWA 2O9AA 4ETZA 3S7OA 3KSIA 1F5MA 1TF1A 3NOUC 2M7UA 4G3WA 5DFXA 1VHMA 4IJGA 3DBAA 2QYBA 2ZMFA 2W1TB 4Z1WA 3EEAA 4DN0A 5HL6A 3MMHA 2Y79A 3C2WA 4MCWA 3NHQA 4BWIA 5C5KA 2XSSA 3D3OA 5LBRA 3S7PA 2VZWA 4R70A 2KOIA 2XRNA 3R4KA 4LRXC 4Y5FA 4E04A 3VV4A 2O0YA 2HGVA 4O01A 2IA2A 2O9BA 3TRCA 5K5BA 2GX5A 3OOVA 4RQ9A
chains in the Genus database with same CATH superfamily
2VGLM 3NOPC 3OPHA 3QNCA 2JKFA 3A3FA 2Y2PA 2QHKA 1NLYA 4KQDA 1W63Q 1JTGA 3N4IA 4PM6A 3MR0A 3Q7VB 1HZOA 4ARZB 3E2KA 3DWZA 3BJNA 3RH8B 2DNSA 3IF6B 3ZVTA 3G6OA 1IYPA 3Q07A 1PWCA 3OLOA 2QZ6A 1NY0A 4LV1A 4LFUA 3E0YA 4H8RA 2G7UA 2XA7M 4WELA 4Q0JA 3UB8A 4S2LA 5CERA 3IX3A 2KLIA 3R7WB 2Y2GA 2HP5A 3NY4A 1NYMA 2Y2HA 1ODVA 5FA7A 3A3DA 2HDQA 3MQOA 3MMHA 1NRFA 5HDSA 3QP8A 4JF4A 5EM0A 1YM1A 4S2KA 1W7FA 4HP9A 3T4QA 4E3LA 4IEDA 4OPQA 1XJ2A 4ZDXA 3FV7A 5HAPA 2XRNA 1CI9A 4DRTA 1KGEA 5KSCA 5HL1A 2PU2A 2D01A 1DP6A 4LLOB 1XKZA 3PBRA 4WZ5C 1M40A 2VEAA 4PM5A 2WKPA 2JKRM 4PHTA 3LGOA 1L3LA 4CQHA 2BTFP 2EX9A 5DF7A 5AJGA 3UN7A 4X69A 1CI8A 5F1GA 4OPYA 3ZGAB 3K2NA 1BULA 3RXWA 2Y2LA 4EEPA 2XROA 3HCYA 1LLBA 5DVAA 3KX0X 4KG5A 2CMNA 3G4PA 3WS0A 4BD0A 1SDNA 4E3MA 3MFXA 4GN2A 4EESA 4LV2A 3GRJA 1I5QA 3TSGA 2PR6A 2Y91A 4CLCA 3G30A 1K55A 2GNXA 4OKPA 2FFFB 4HY8A 4OQ0A 3OZHA 3V67A 3T1SA 4OONA 1G28A 2PDRA 1L0DA 5HZHA 3CG5A 5IT5A 1DJBA 3FWLA 3HLFA 2EX6A 4KUOA 1VETA 3PBQA 4ZTKA 2HP9A 5E2FA 1N9BA 2L0WA 3HJIA 4QWOA 1O07A 2OWHA 2PR5A 4S2IA 4JLFA 1LL5A 5HAQA 5G4YA 1EI5A 2PBDP 4GKUA 3NIAA 5M1AA 3G32A 4EERA 4R70A 4X1LA 4XUXA 2R9XA 4ZBEA 3HBRA 1H8MA 1MY8A 3A3EA 2Z6CA 1PFLA 4P6ZM 3UO9A 1K54A 4WL9A 2C5WB 3MKEA 4RQ9A 4YOFA 2WGIA 4MMNA 3H82A 3M6HA 3DTEA 4QY6A 2Z2MB 3P01A 3N8SA 4BL2A 2QKPA 3UMDA 1CJFA 1IYOA 3CUEC 5TJJA 1N9LA 1N9OA 3MXSA 1KDWA 4OOYA 4ZRRA 3WS4A 3BQAA 3VP3A 2WKRA 4JXWA 1SHVA 3FPWA 4LCLA 3WRTA 4OQGA 2OOLA 1ESUA 2GDNA 4HHDA 3MQQA 4WN5A 2IWDA 1ONGA 5A8BA 2ZM8A 3PYPA 4GS9A 1YLPA 3SS5A 1DP9A 4UAAA 4LV3A 1WE4A 3QP5A 1YSQA 3VOYA 3MF0A 3W2ZA 1VM1A 4R3JA 5MC7A 4M4XA 4ETZA 3CHWP 4CPKA 5CEBA 5A93A 1P0ZA 4Q8IA 3T4KA 1MKIA 4FH2A 3C4PA 3IXGA 4OVDA 4RX2A 1DY6A 3LCEA 5FAQA 2DCFA 3UMEA 1EW0A 5HWWA 1FSWA 3C38A 4BWIA 3S1YA 5FSRA 3LI8A 3R4KA 5HAIA 5A90A 2OWJA 4DXBA 1AWIA 1SKOB 3V5MA 4WMCA 4P0MA 3C4OA 3LEQA 5GHZA 1KDSA 4WZ5A 4GDNA 3T12B 3ZG7B 5FEGA 1CEFA 3LIEA 1MWTA 2WADA 5L8MA 2R78A 3RXXA 3LFVA 3UB6A 1RCJA 4WEKA 1P9WA 1KGGA 2WAEA 4QU3A 3S7QA 5U47A 2L1MA 5GLAA 3DWKA 4KG6A 4HBUA 4O8GA 1FILA 3PTEA 4IVKA 4MNRA 5CTMA 2W0NA 3B33A 3LR0A 4R0QA 4R38A 4BLMA 4DJ2A 4X1MA 3MS6A 3ZG5A 1OPXA 1WYBA 3O87A 1S4SA 2B18A 1PYYA 1PIOA 3UDXA 2W1RA 2W1TA 3EGXC 4OPZA 5HDDA 2HJ9C 5DKLA 1NLZA 4MLLA 4R1GA 3O88A 1PW8A 1TEMA 3CLOA 3V3RA 3JVUA 5FEFA 3N8LA 4FD8A 3NHQA 3F1PB 1MWUA 3U2AA 4FCFA 3T4SA 1TS0A 2VZWA 5J8XA 3HLDA 4NG2A 5L2FA 4NXBA 5HARA 4BQMA 4MN6A 1G6OA 3LIFA 4O01A 2ZQDA 2EX8A 3MZDA 3RJUA 1CQAA 3MBZA 4DMZA 5EOOA 2HPBA 2LB9A 3GSGA 1AXBA 2PHYA 3FYZA 3A3IA 3OCNA 3V39A 4BJPA 2QJ7A 1IEMA 1I2WA 1P9RA 3ZQ5A 3CUEA 2ZLYA 2Y59A 2V0UA 3M2JA 2A3UA 1KE0A 2ZQ8A 5BOHA 1Q2PA 2J8YA 4ZJ1A 2ZL1B 4Y3IA 1OTIA 5F69A 3TE8A 3G2YA 1ACFA 4PM7A 2Y2JA 3MZFA 2V1ZA 5DFYA 2XFSA 4KQOA 4QJGA 5FI7A 1TF1A 1T1CA 3D9YA 1CK3A 3P09A 4XT2A 2RCXA 1XGIA 3Q1FA 4CLCC 1TVFA 4FUWA 3FKWA 1T1BA 3LEZA 3EEHA 4QY5A 3OCLA 3JVVA 5CEDA 2X01A 4AFIA 1K6RA 1JVJA 3VP0A 3F1PA 2AVXA 4KZ8A 1OMEA 2XGNA 3F1OA 1H8ZA 1ES5A 1XX2A 3IX4A 2XD1A 2XQZA 1ERMA 2Y2MA 4EETB 4WZ4A 4R23A 2WGWA 2ZBBA 4UA6A 2LB5A 3L9KA 4KZ3A 4GB7A 1D06A 3CJMA 1KE4A 4O0PA 3LR5A 4Y7PA 2RL3A 1S6RA 2VV6A 4IUKA 4NXFA 5M19A 1BLCA 2ZQ9A 2Y2OA 4EU0A 1L0EA 3SH9A 2EA9A 3SZTA 2ZJ9A 2R9WA 2W3DA 4HQAA 3VMAA 4HI4A 3V3SA 4NKPA 4WF0A 1SZVA 4JKTA 4MN5A 1QMFA 5FAOA 4HJ4A 2G2WA 4OLGA 4WUJA 1C3BA 5KMWA 2IWBA 4F3LA 1WA9A 2ZL1A 4JBFA 3BFCA 3F1NB 4OOMA 1NRJA 3QP4A 3C7UA 1K6SA 1TD5A 2QPNA 1NZUA 2MJ6A 3G2ZA 4CLCB 1EROA 1OT9A 1D1JA 3TJZC 2Z6DA 2JKGA 3DAVA 5CRFA 4UA7A 4DN0A 2OAP1 3UDFA 3IXDA 4OPRA 1VETB 4ZAMA 1PWGA 3D3OA 5LBRA 4UQIM 1MXOA 1CF0A 1YMXA 1XFNA 3W4QA 1J9MA 3IS2A 1LL8A 3UB9A 3T4TA 2VV8A 1W63M 3ZCZA 1XXMA 1PWDA 2DRWA 4YWZA 3BM6A 1HTZA 2BLSA 2E8JA 4CLCD 1STZA 1XFQA 5TR7A 3CI6A 3HLGA 3B3XA 1K56D 2WKQA 4EUZA 3BLMA 3PBNA 3BFFA 2W3EA 4R3BA 1DJAA 1IELA 3ZDJA 3H82B 1S66L 3Q7ZA 3BW6A 3ZHHA 4EUVA 3NDEA 2HDRA 4GJ4A 5AQBA 5TFQA 1M6KA 4Y0UA 5EVLA 3IQAA 3NECA 2K7SA 4KZ6A 1MPLA 3M6BA 5D3OA 1L2SA 3E4QA 4GD6A 5FQMA 2ZMAA 1X0OA 2PT7A 4BMWA 3SOIA 1OT6A 4PAUA 2W3FA 3D4FA 5EOEA 4C6YA 2O9CA 4YINA 5FASA 2WGVA 3AGDA 2FZ0A 3F1NA 2V1AA 1GSXA 3HL9A 4L9EA 3S7OA 3HLWA 4GS9B 5A91A 3GDIA 3LICA 4ESPA 2H0YA 4UHUA 1J3WA 3G31A 3DTIA 3T4OA 4HESA 4KZ4A 1LSXA 2KDKA 1K56A 3CWFA 2XSSA 1NWZA 1H5XA 3BY8A 1G5UA 5DKKA 5JYOA 4E04A 4L9GA 4F94A 1JWPA 4HIAA 4IVIA 4DJ3A 3IHAA 3AGEA 2PAVP 5EVIA 4B93A 3RFBA 3E4PA 4PMAA 4ETXA 4OOLA 1OTBA 4EEUA 1PNEA 4X55A 3PBOA 3O5YA 3EWKA 1YLTA 1H3QA 3KO6A 3H7WA 3SH7A 3T50A 3CAXA 3BFGA 4X53A 5DTKA 3OBFA 5FDSA 2EXBA 1V9YA 2ZC3B 2K31A 2HV1A 2H0TA 1IFQA 3VE3A 1YQSA 5I5LA 5HSQA 1VQQA 2A24B 5A92A 1H0MA 4MEZA 3LR4A 4A5RA 2Q9NA 3UE6A 1LL9A 4JPMA 2Y55A 2ZQ7A 1GHMA 4P87A 4MDZA 4WMCD 3PBTA 1E3UA 5FQKA 1RP5A 4Y0TA 4X6TA 5F82A 3BECA 1TS8A 4QB8A 4E6XA 1BTLA 3VFFA 4GHIA 2JKTI 2W1TB 1LI0A 1DP8A 1VB6A 4L0LA 3C2WA 1ZC2A 2JC7A 3T1QB 3WS2A 1YLZA 3OPLA 2A49A 3S7PA 2ZM2A 1UGUA 2WYXA 2VGKA 2ZD8A 3DW0A 4WEJA 4KQQA 1N9NA 5E2HA 3MJQA 1FCMA 1BZAA 2YKHA 1FR1A 1MKMA 5EPHA 1N4OA 4HH3A 5IS1A 3VP2A 3KSHA 1ZTUA 3S4XA 1ES4A 2D02A 1UWPX 1S1YA 1BSGA 2WKIA 4FOFA 3HVFA 3HUMA 5TBMA 3BFDA 4D60A 1H8YA 4WLAA 4RX3A 2IWCA 4NXGA 3BWLA 4S2NC 4PKYA 1KE3A 1GSWA 2BG1A 5E43A 4Y13A 5HPFA 2HJEA 1K4FA 3NJAA 2UWXA 5DTSA 4GDBA 3ZFZA 4E3IA 2O99A 3HJKA 2A24A 5AQ7A 2ZMVA 3E2LA 3S22A 1LT0A 2XF3A 2INWA 2PU4A 4K91A 5KZHA 4IBXA 1OTAA 4IJGA 1ZG6A 4N9KA 3UB7A 2QYBA 2M1CA 1NXYA 3K3CA 4Z1WA 4EQ1A 2J7VA 4B88A 4MBHA 1KVMA 4LCMA 4WYYA 2J9OA 1KOUA 3SH8A 3W4OA 3GTCA 4H6JA 3K3DA 4XT2B 2P9VA 3EQVA 1YMSA 5C5KA 1BUEA 2OV5A 4OQIA 1LI9A 2XD5A 3HLEA 5FQ9A 4XXRA 3T1XA 3MKFA 5EECA 2O9BA 4JXGA 5K5BA 3P98A 1RGZA 5J4EA 4U0XA 3FPVA 2H10A 2XDMA 5FI6A 3UPNA 4R6LA 2PYPA 4L9FA 1F2KA 1SDEA 3KYZA 3F1OB 3NULA 4FH4A 2W27A 4D2OA 1ESIA 3NC8A 2J3WA 1F98A 4G3VA 1A0KA 3A0SA 3IWIA 4DXCA 2GJ3A 2WGWB 3IBRA 5HWVA 4II7A 5EFWA 3HLCA 4YNRA 1PZPA 3IF5A 5CXWA 4EXOA 3V50A 5AQ9A 1HD8A 2ACGA 1MC0A 4I3AA 2ZC7A 4JGRA 2HDSA 1OTEA 2VGLS 4F3LB 1F9IA 4WBGA 4LENA 1F5MA 4PM9A 4HOIA 1FR6A 4KQRA 1VEUB 4FSFA 2XK1A 4QHCA 4EBLA 4M3KA 4GNUA 3IWQA 2EWVA 5GHYA 4MCWA 2I9VA 2VX8A 2JN7A 2WKEA 3ICYA 3IX8A 5IHVA 1W8YA 3UE1A 1FCOA 5FQQA 1PI4A 4K0WA 4B4ZA 3WWXA 2ZOIA 4GCZA 2XA7S 3D72A 4N9LA 5FI2A 3BRMA 5F5YA 1XPBA 4LRZE 1YT4A 4YFMA 3CPTB 1YLJA 5DTTA 2ZC4B 3IS2B 4Y15A 3KSGA 4DKIA 1S1ZA 3IF6C 3W8KA 3GQZA 3UE0A 1FOFA 1FCNA 3GECA 3IH8A 4I5SA 2Y2NA 2OLUA 2XH9A 1IYQA 3HREA 1BLSA 3LUQA 4S2MA 4HEFA 3S7NA 2X02A 1SCWA 4R4RA 4S2NA 1PW1A 5EVIC 3ZG8B 4B4XA 4P85A 1JNUA 5DJUA 1ONHA 2W3HA 1FQGA 4R3AA 2OSUA 2VA0A 5JYPA 4KUKA 3FG8A 3IWOA 3UPPA 2EXAA 4E3JA 1G68A 5CGSA 3LY3A 5CECA 1GA0A 4C3QA 3RTYA 3B42A 3OPPA 1PRQA 4KZ7A 3LYXA 4K08A 2OLVA 2P04A 2QWSA 4NETA 1ES2A 3SS3A 3IXBA 3PBSA 3VP4A 3A3JA 4EV4A 2VV7A 5EM1A 2WUQA 2Q0OA 5HDCA 1VEUA 2Y4AA 3MSHA 1E4DA 3VE4A 4BL3A 1GSVA 4IHQA 2JKTM 1LSWA 3AGFA 1LSVA 2G2UA 5EV0A 1FSYA 2V2FF 4K0XA 1JWZA 4KG2A 3ZYTA 3CMZA 1DRMA 1Y54A 3C5AA 1K25A 4LRYC 2M7VA 4OH0A 1GHIA 3NDGA 2KX6A 2H28A 3UY6A 3ZNTA 3MQ0A 1MBLA 1XP4A 2VK3A 5FL3A 4ID4A 3LO7A 3CPTA 5EVIB 4ME4A 5GHXA 4ZJ3A 5CHMA 2PRFA 3HLBA 5CHUA 1EWZA 1OJGA 1JTDA 4Y17A 2Q9MA 2HP6A 5J7EA 4GLQA 2Z2LB 1PI5A 3KYEA 1YSPA 3H7WB 3LIAA 3BQ8A 4JGPA 4WM9A 2VLGA 3T4LA 2DMWA 3PAEA 1I2SA 4E3KA 4S2PA 2JBFA 4E3NA 3BYDA 3JPUA 2FFYA 1SKFA 5HPIA 4Y2FA 4P6ZS 3QP6A 4KZ5A 3Q81A 2VJWA 3E4OA 3Q82A 3ISGA 1G6AA 3IH9A 3LI9A 1JWVA 1MWRA 3W4PA 1K57A 5EVID 5DFXA 2XFTA 4I39A 3WS5A 3QNBA 5HW3A 4EBPA 4HJ3A 1NZOA 4EW7A 3P7NA 2J3TC 3PAGA 4GHIB 1MWSA 2J9PA 4B9OA 4RYEA 1CEGA 2KOIA 5GL9A 4QD4A 2WK0A 1WYCA 1NJ4A 2B95A 4I3IA 5EUAA 2ZC6B 4GZBA 3O3VA 2IA2A 1U60A 3LIDA 3GVBA 1LHYA 1ES3A 5F1FA 3Q7VA 4ARZA 1YKDA 3IXHA 5EVEA 3IF6A 3PXPA 4MBFA 1XJ4A 4DE2A 5HD5A 5HD3A 1E3UD 3N7WA 3NOTC 4BBVA 4JGQA 3TW8A 1IKIA 3VOZA 2PD7A 3QP2A 1V9ZA 2GZAA 5I94A 3HUNA 3M2KA 3R7WA 5TBMB 3G35A 2BASA 2P08A 1T18A 5HFOA 1Z6FA 3FKVA 3G34A 4S2OA 3ZVWA 2NUTC 4MBKA 3PHYA 5HWTA 3NBLA 2OAQ1 4IUHA 5L09A 2XLNA 3DTKA 1ZHHB 2VKSA 5F6AA 4RVAA 3CITA 4E6WA 2ZC5B 1ZG4A 3MXQA 1XA7A 2HF6A 4O7DA 1E25A 5G18A 2ZQCA 3NOUC 1K0KA 4JF5A 5IU1A 2M7UA 1VHMA 5GLBA 2PD8A 3MXRA 4P6BA 4XUZA 2Y2KA 2ZMFA 5FATA 5E2EA 1K38A 2J80A 2Y79A 3BY9A 4CJNA 1PZOA 5E2GA 2FH5A 3LR3A 2EFXA 5M18A 1W79A 3IT9A 1TS6A 1IOUA 2Y2IA 4H6JB 1ERQA 4DE3A 2ZQAA 2HGVA 3TRCA 4IBRA 2P9VB 3IHBA 3MFDA 2VGJA 4X68A 1XJ3A 3B47A 2B02A 4JGOA 5FQJA 3OC2A 4OP8A 2J3TD 2EFUA 4DE1A 1ALQA 1Y4OA 2W3GA 5J3WA 1FIKA 1DJCA 1P97A 1TS7A 2I72A 4UA9A 3ULFA 2HDUA 2B5RA 3VSKA 1OJ5A 2XR0A 1TDGA 3ZG9B 1BT5A 4BENA 2YKFA 3UDIA 3IBJA 4LGWA 3QP1A 4GD8A 4LV0A 4UEYA 5EE8A 3T1RA 1YAXA 1TDLA 3TG9A 3FZCA 5AVFA 2JCHA 5L07A 4JXVA 5AVEA 4DDSA 3KSIA 3WRZA 5DF8A 4HJ6A 4X25A 5FDHA 3VFHA 4OP5A 5CTNA 4HP4A 2P74A 4KZ9A 2JE5A 3SS4A 5AQAA 3GMWA 3O86A 1HVBA 4DF6A 5KIZA 2V8FA 4Y5FA 1GA9A 1L0FA 2ZM0A 3VV4A 4OQHA 1MZUA 2JKRI 2EX2A 1YLWA 1Q2QA 4OLDA 2WZXA 1IKGA 1GCEA 3HUOA 3OPRA 1YPRA 2V1BA 3VSLA 4N92A 2QMIA 1Z09A 5L10A 4HNBA 3BFEA 4QPRA 3BLSA 5CHJA 1W8QA 3UE3A 3DTMA 3NI9A 3ZNYA 4KZBA 3EOIA 1BYWA 4MN7A 3A0VA 3CZDA 4JF6A 3E98A 2K2NA 4CLCE 2QJ5A 5F83A 1T19A 3T4JA 1ZKJA 4C75A 1L0GA 2NUPC 1Y28A 1K4EA 2PBYA 2Y8HA 1NYYA 4HBTA 4KZAA 2V9AA 4FTXA 3EGDC 1OTDA 4GOGA 3ITBA 3GV9A 2EWWA 1S67L 4Z9QA 3ZG0A 4G3WA 1KVLA 5FAPA 4I3JA 1S4RA 1XGJA 3VOLA 3EEAA 1S0WA 5HL6A 4EBNA 1O7EA 1SKOA 3PR6A 1YLYA 4BD1A 3SW1A 5G4ZA 3NCKA 4HH2A 4Y0OA 3QHYA 2X71A 1K57C 2A2LA 2XEPA 4ZJ2A 2H5SA 4NEED 2GX5A 2Y2QA 3OOVA 2V0WA 1T1AA 1GHPA 4RA7A 5GLCA 3C7VA 2PYRA 4LPZA 4Q0IA 4U3TA 1XJ6A 4NK3A 3L7HA 4I38A 1D7EA 5DF9A 3U4LP 3UPOA 3VP1A 5GLDA 5HX9A 3C8CA 4G3KA 2ZOHA 1QMEA 3KSFA 1XA1A 5KSHA 1HLUP 3ITAA 4Q0HA 2JHEA 3A0RA 4DE0A 4EQIA 1KGFA 2V20A 4KENB 1BLPA 4EWFA 2UV0E 3UNWA 3MZEA 4GW9A 1BLHA 4N1XA 4UQIS 2E8IA 3JYIA 2V8CA 3UB5P 3LY4A 1W5DA 1K55C 4PKYG 4R4SA 2CC1A 2WKHA 2O9AA 3N8RA 5FQIA 2C6WB 5TGFA 3FC7A 4DDYA 4NXEA 3I7JA 4BBTA 3H9WA 3DBAA 4S2JA 3LIBA 1UWNX 3KYQA 4E3OA 3EQUA 5DJTA 3GR2A 4U0TA 5CGWA 2L4RA 3WS1A 5F68A 4BBUA 2P7JA 3N6IA 2WZZA 1RGYA 3TOIA 4PPRA 4LRXC 4PM8A 2HZ5A 4JXSA 2O0YA 3BEBA 4X56A 2WAFA 5CX7A 3C30A 5CGXA 4N1HA 1K54C 1IYSA
chains in the Genus database with same CATH topology
3LIDA 2VGLM 3NOPC 4DMZA 2YKHA 1MKMA 2LB9A 4ARZA 4HH3A 1YKDA 5IS1A 3KSHA 2PHYA 2QHKA 1NLYA 1ZTUA 4KQDA 3OCNA 2D02A 3PXPA 1UWPX 1W63Q 1XJ4A 4BJPA 1S1YA 2QJ7A 5HD5A 5HD3A 4FOFA 3MR0A 1P9RA 3NOTC 4BBVA 3ZQ5A 4JGQA 3CUEA 5TBMA 4ARZB 3TW8A 4WLAA 2V0UA 3BJNA 3RH8B 2PD7A 3G6OA 4NXGA 3BWLA 3OLOA 1V9ZA 4PKYA 4Y3IA 1GSWA 2GZAA 3R7WA 5TBMB 3E0YA 1OTIA 2BASA 5HPFA 2P08A 1T18A 2HJEA 3NJAA 2NUTC 3PHYA 5HWTA 5F69A 2G7UA 2XA7M 4WELA 4Q0JA 3UB8A 3TE8A 2OAQ1 4IUHA 2KLIA 3R7WB 1ZHHB 2O99A 2VKSA 3HJKA 5F6AA 2A24A 5DFYA 2ZMVA 4KQOA 3CITA 1LT0A 2INWA 3MXQA 2HF6A 1TF1A 1T1CA 3NOUC 5IU1A 2M7UA 1ODVA 1VHMA 1OTAA 2PD8A 4IJGA 3UB7A 2QYBA 4XT2A 2ZMFA 2M1CA 3K3CA 4Z1WA 4EQ1A 3MQOA 3MMHA 4CLCC 2J80A 5HDSA 2Y79A 1KOUA 4HP9A 1T1BA 3EEHA 4H6JA 3T4QA 3BY9A 3K3DA 1XJ2A 3JVVA 2FH5A 3OCLA 4XT2B 3EQVA 3LR3A 5C5KA 4AFIA 2XRNA 1TS6A 1IOUA 3F1PA 3F1OA 2D01A 4H6JB 1DP6A 4LLOB 2HGVA 2O9BA 3TRCA 5K5BA 5J4EA 4EETB 3PBRA 3FPVA 4R6LA 1XJ3A 2PYPA 4L9FA 3B47A 2B02A 2ZBBA 4JGOA 3KYZA 3F1OB 2LB5A 2VEAA 3OC2A 2WKPA 2J3TD 1D06A 2JKRM 4PHTA 2W27A 4CQHA 2J3WA 4O0PA 1F98A 3LR5A 4G3VA 5AJGA 3A0SA 2VV6A 4IUKA 4NXFA 2W3GA 5J3WA 2GJ3A 3K2NA 1P97A 1TS7A 3ULFA 3IBRA 4EEPA 4EU0A 5HWVA 2XROA 4II7A 3HCYA 2EA9A 5EFWA 4YNRA 3KX0X 2W3DA 1OJ5A 4HQAA 4HI4A 2CMNA 4NKPA 4EXOA 4WF0A 4MN5A 2YKFA 3IBJA 3MFXA 1MC0A 4HJ4A 4I3AA 4EESA 4WUJA 2PR6A 4F3LA 1WA9A 4JGRA 4CLCA 3F1NB 4OOMA 4UEYA 2GNXA 1NRJA 1YAXA 5AVFA 1TD5A 4HY8A 1OTEA 2VGLS 2MJ6A 4F3LB 1F9IA 5AVEA 3V67A 1G28A 3KSIA 2PDRA 4CLCB 1F5MA 5HZHA 4HOIA 1OT9A 4HJ6A 5IT5A 3TJZC 2Z6DA 4KUOA 4FSFA 3PBQA 2L0WA 3HJIA 4DN0A 2OAP1 2OWHA 2EWVA 4HP4A 2PR5A 4MCWA 2I9VA 2VX8A 5G4YA 2JN7A 3ICYA 3D3OA 5LBRA 4EERA 4R70A 4UQIM 5KIZA 4Y5FA 1XFNA 3VV4A 1H8MA 2Z6CA 3IS2A 1LL8A 4P6ZM 1MZUA 3UB9A 2JKRI 2ZOIA 4GCZA 3T4TA 2VV8A 2XA7S 1W63M 3D72A 4RQ9A 4WL9A 4YWZA 4YOFA 5F5YA 4MMNA 4LRZE 4CLCD 2V1BA 3H82A 1STZA 1XFQA 3CI6A 3IS2B 4HNBA 3KSGA 3P01A 1S1ZA 2QKPA 4QPRA 2WKQA 3PBNA 2W3EA 3UMDA 3UE3A 3CUEC 5TJJA 3H82B 1S66L 3GECA 3BW6A 4I5SA 4EUVA 1N9LA 3EOIA 3LUQA 4GJ4A 1N9OA 1BYWA 4MN7A 3S7NA 3A0VA 4ZRRA 3E98A 2K2NA 3BQAA 2K7SA 4CLCE 2WKRA 2QJ5A 1JNUA 5DJUA 3FPWA 2W3HA 1T19A 3T4JA 2OOLA 3E4QA 4R3AA 4HHDA 3MQQA 4WN5A 2VA0A 4KUKA 1X0OA 2PT7A 3FG8A 5A8BA 4BMWA 3PYPA 1OT6A 4GS9A 4PAUA 2NUPC 1Y28A 2W3FA 1DP9A 2O9CA 2Y8HA 1YSQA 3RTYA 3B42A 2V9AA 3MF0A 3W2ZA 2FZ0A 5MC7A 3F1NA 2V1AA 1GSXA 4L9EA 4M4XA 3EGDC 4ETZA 3S7OA 1OTDA 3LYXA 4GS9B 2EWWA 1S67L 3GDIA 3LICA 4K08A 2P04A 2QWSA 4G3WA 3PBSA 1P0ZA 3T4KA 4I3JA 1S4RA 2VV7A 3VOLA 3EEAA 5HL6A 5HDCA 3T4OA 1LSXA 3UMEA 2KDKA 1EW0A 3PR6A 3VE4A 1GSVA 4IHQA 5HWWA 2JKTM 3C38A 1LSWA 3CWFA 4BWIA 2XSSA 3SW1A 1NWZA 5G4ZA 3BY8A 1LSVA 4HH2A 3LI8A 3R4KA 5DKKA 2OWJA 2A2LA 4E04A 4L9GA 3ZYTA 4NEED 2GX5A 3OOVA 4HIAA 1DRMA 4DJ3A 2V0WA 1T1AA 4B93A 4LRYC 2M7VA 2PYRA 3RFBA 3E4PA 4LPZA 2KX6A 4Q0IA 4ETXA 2H28A 1XJ6A 4OOLA 1OTBA 4I38A 4EEUA 3MQ0A 1D7EA 5DF9A 5FL3A 3LIEA 3PBOA 3O5YA 3EWKA 1H3QA 3C8CA 3KO6A 4G3KA 4ME4A 3H7WA 3T50A 2ZOHA 3CAXA 3KSFA 5L8MA 2R78A 3LFVA 5KSHA 3UB6A 4Q0HA 1OJGA 2JHEA 4WEKA 3A0RA 1P9WA 3OBFA 5J7EA 4GLQA 1V9YA 2K31A 2HV1A 4GW9A 1YSPA 3H7WB 3S7QA 2L1MA 1IFQA 3LIAA 3BQ8A 3VE3A 4JGPA 2VLGA 5I5LA 2DMWA 4O8GA 3T4LA 5HSQA 2A24B 2W0NA 3B33A 3LR0A 4UQIS 3LR4A 4R38A 4DJ2A 3UE6A 5HPIA 4Y2FA 4PKYG 1OPXA 4P6ZS 1S4SA 2B18A 4MDZA 3PBTA 2W1RA 2W1TA 2VJWA 2O9AA 3E4OA 3LI9A 3EGXC 3FC7A 5HDDA 2HJ9C 5DKLA 1TS8A 1NLZA 4NXEA 4BBTA 5DFXA 4I39A 3H9WA 4GHIA 3DBAA 2JKTI 2W1TB 3CLOA 3LIBA 1UWNX 1DP8A 3KYQA 1VB6A 4L0LA 3EQUA 3JVUA 3C2WA 4HJ3A 5DJTA 4EW7A 3P7NA 2J3TC 3NHQA 2L4RA 3F1PB 4GHIB 5F68A 2P7JA 4BBUA 3U2AA 4B9OA 3T4SA 3S7PA 1TS0A 1UGUA 2VZWA 2KOIA 4LRXC 4I3IA 4NXBA 4WEJA 4MN6A 2O0YA 1G6OA 3LIFA 4O01A 2IA2A 5CX7A 3C30A 1N9NA 3MJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YOF A;  3NOP C;  4R6L A;  4MMN A;  4LRZ E;  4DMZ A;  1MKM A;  2LB9 A;  4LRY C;  2M7V A;  3RFB A;  1YKD A;  1STZ A;  4ETX A;  3KSH A;  4Q0I A;  2LB5 A;  1ZTU A;  2VEA A;  3CI6 A;  3KSG A;  3MQ0 A;  4CQH A;  4O0P A;  4G3V A;  4QPR A;  5AJG A;  4FOF A;  3NOT C;  3ZQ5 A;  3O5Y A;  4IUK A;  2W3E A;  2W3G A;  3K2N A;  3KO6 A;  4G3K A;  4ME4 A;  5TJJ A;  3KSF A;  5L8M A;  4EUV A;  3IBR A;  3LFV A;  3BJN A;  4EU0 A;  4Q0H A;  2XRO A;  3HCY A;  4MN7 A;  4YNR A;  3S7N A;  3G6O A;  2W3D A;  4ZRR A;  3OBF A;  4GLQ A;  3E98 A;  2K2N A;  4Y3I A;  2K31 A;  3E0Y A;  1YSP A;  4GW9 A;  3S7Q A;  5HPF A;  3IBJ A;  1MC0 A;  2W3H A;  5I5L A;  4O8G A;  5HSQ A;  2OOL A;  2G7U A;  4Q0J A;  4IUH A;  2KLI A;  4PAU A;  5HPI A;  4Y2F A;  2W3F A;  2O99 A;  2VKS A;  2O9C A;  2B18 A;  2Y8H A;  1TD5 A;  5DFY A;  4MDZ A;  1YSQ A;  2W1R A;  2W1T A;  3CIT A;  3MF0 A;  3W2Z A;  2VJW A;  2O9A A;  4ETZ A;  3S7O A;  3KSI A;  1F5M A;  1TF1 A;  3NOU C;  2M7U A;  4G3W A;  5DFX A;  1VHM A;  4IJG A;  3DBA A;  2QYB A;  2ZMF A;  2W1T B;  4Z1W A;  3EEA A;  4DN0 A;  5HL6 A;  3MMH A;  2Y79 A;  3C2W A;  4MCW A;  3NHQ A;  4BWI A;  5C5K A;  2XSS A;  3D3O A;  5LBR A;  3S7P A;  2VZW A;  4R70 A;  2KOI A;  2XRN A;  3R4K A;  4LRX C;  4Y5F A;  4E04 A;  3VV4 A;  2O0Y A;  2HGV A;  4O01 A;  2IA2 A;  2O9B A;  3TRC A;  5K5B A;  2GX5 A;  3OOV A;  4RQ9 A; 
#chains in the Genus database with same CATH topology
 2VGL M;  3NOP C;  3OPH A;  3QNC A;  2JKF A;  3A3F A;  2Y2P A;  2QHK A;  1NLY A;  4KQD A;  1W63 Q;  1JTG A;  3N4I A;  4PM6 A;  3MR0 A;  3Q7V B;  1HZO A;  4ARZ B;  3E2K A;  3DWZ A;  3BJN A;  3RH8 B;  2DNS A;  3IF6 B;  3ZVT A;  3G6O A;  1IYP A;  3Q07 A;  1PWC A;  3OLO A;  2QZ6 A;  1NY0 A;  4LV1 A;  4LFU A;  3E0Y A;  4H8R A;  2G7U A;  2XA7 M;  4WEL A;  4Q0J A;  3UB8 A;  4S2L A;  5CER A;  3IX3 A;  2KLI A;  3R7W B;  2Y2G A;  2HP5 A;  3NY4 A;  1NYM A;  2Y2H A;  1ODV A;  5FA7 A;  3A3D A;  2HDQ A;  3MQO A;  3MMH A;  1NRF A;  5HDS A;  3QP8 A;  4JF4 A;  5EM0 A;  1YM1 A;  4S2K A;  1W7F A;  4HP9 A;  3T4Q A;  4E3L A;  4IED A;  4OPQ A;  1XJ2 A;  4ZDX A;  3FV7 A;  5HAP A;  2XRN A;  1CI9 A;  4DRT A;  1KGE A;  5KSC A;  5HL1 A;  2PU2 A;  2D01 A;  1DP6 A;  4LLO B;  1XKZ A;  3PBR A;  4WZ5 C;  1M40 A;  2VEA A;  4PM5 A;  2WKP A;  2JKR M;  4PHT A;  3LGO A;  1L3L A;  4CQH A;  2BTF P;  2EX9 A;  5DF7 A;  5AJG A;  3UN7 A;  4X69 A;  1CI8 A;  5F1G A;  4OPY A;  3ZGA B;  3K2N A;  1BUL A;  3RXW A;  2Y2L A;  4EEP A;  2XRO A;  3HCY A;  1LLB A;  5DVA A;  3KX0 X;  4KG5 A;  2CMN A;  3G4P A;  3WS0 A;  4BD0 A;  1SDN A;  4E3M A;  3MFX A;  4GN2 A;  4EES A;  4LV2 A;  3GRJ A;  1I5Q A;  3TSG A;  2PR6 A;  2Y91 A;  4CLC A;  3G30 A;  1K55 A;  2GNX A;  4OKP A;  2FFF B;  4HY8 A;  4OQ0 A;  3OZH A;  3V67 A;  3T1S A;  4OON A;  1G28 A;  2PDR A;  1L0D A;  5HZH A;  3CG5 A;  5IT5 A;  1DJB A;  3FWL A;  3HLF A;  2EX6 A;  4KUO A;  1VET A;  3PBQ A;  4ZTK A;  2HP9 A;  5E2F A;  1N9B A;  2L0W A;  3HJI A;  4QWO A;  1O07 A;  2OWH A;  2PR5 A;  4S2I A;  4JLF A;  1LL5 A;  5HAQ A;  5G4Y A;  1EI5 A;  2PBD P;  4GKU A;  3NIA A;  5M1A A;  3G32 A;  4EER A;  4R70 A;  4X1L A;  4XUX A;  2R9X A;  4ZBE A;  3HBR A;  1H8M A;  1MY8 A;  3A3E A;  2Z6C A;  1PFL A;  4P6Z M;  3UO9 A;  1K54 A;  4WL9 A;  2C5W B;  3MKE A;  4RQ9 A;  4YOF A;  2WGI A;  4MMN A;  3H82 A;  3M6H A;  3DTE A;  4QY6 A;  2Z2M B;  3P01 A;  3N8S A;  4BL2 A;  2QKP A;  3UMD A;  1CJF A;  1IYO A;  3CUE C;  5TJJ A;  1N9L A;  1N9O A;  3MXS A;  1KDW A;  4OOY A;  4ZRR A;  3WS4 A;  3BQA A;  3VP3 A;  2WKR A;  4JXW A;  1SHV A;  3FPW A;  4LCL A;  3WRT A;  4OQG A;  2OOL A;  1ESU A;  2GDN A;  4HHD A;  3MQQ A;  4WN5 A;  2IWD A;  1ONG A;  5A8B A;  2ZM8 A;  3PYP A;  4GS9 A;  1YLP A;  3SS5 A;  1DP9 A;  4UAA A;  4LV3 A;  1WE4 A;  3QP5 A;  1YSQ A;  3VOY A;  3MF0 A;  3W2Z A;  1VM1 A;  4R3J A;  5MC7 A;  4M4X A;  4ETZ A;  3CHW P;  4CPK A;  5CEB A;  5A93 A;  1P0Z A;  4Q8I A;  3T4K A;  1MKI A;  4FH2 A;  3C4P A;  3IXG A;  4OVD A;  4RX2 A;  1DY6 A;  3LCE A;  5FAQ A;  2DCF A;  3UME A;  1EW0 A;  5HWW A;  1FSW A;  3C38 A;  4BWI A;  3S1Y A;  5FSR A;  3LI8 A;  3R4K A;  5HAI A;  5A90 A;  2OWJ A;  4DXB A;  1AWI A;  1SKO B;  3V5M A;  4WMC A;  4P0M A;  3C4O A;  3LEQ A;  5GHZ A;  1KDS A;  4WZ5 A;  4GDN A;  3T12 B;  3ZG7 B;  5FEG A;  1CEF A;  3LIE A;  1MWT A;  2WAD A;  5L8M A;  2R78 A;  3RXX A;  3LFV A;  3UB6 A;  1RCJ A;  4WEK A;  1P9W A;  1KGG A;  2WAE A;  4QU3 A;  3S7Q A;  5U47 A;  2L1M A;  5GLA A;  3DWK A;  4KG6 A;  4HBU A;  4O8G A;  1FIL A;  3PTE A;  4IVK A;  4MNR A;  5CTM A;  2W0N A;  3B33 A;  3LR0 A;  4R0Q A;  4R38 A;  4BLM A;  4DJ2 A;  4X1M A;  3MS6 A;  3ZG5 A;  1OPX A;  1WYB A;  3O87 A;  1S4S A;  2B18 A;  1PYY A;  1PIO A;  3UDX A;  2W1R A;  2W1T A;  3EGX C;  4OPZ A;  5HDD A;  2HJ9 C;  5DKL A;  1NLZ A;  4MLL A;  4R1G A;  3O88 A;  1PW8 A;  1TEM A;  3CLO A;  3V3R A;  3JVU A;  5FEF A;  3N8L A;  4FD8 A;  3NHQ A;  3F1P B;  1MWU A;  3U2A A;  4FCF A;  3T4S A;  1TS0 A;  2VZW A;  5J8X A;  3HLD A;  4NG2 A;  5L2F A;  4NXB A;  5HAR A;  4BQM A;  4MN6 A;  1G6O A;  3LIF A;  4O01 A;  2ZQD A;  2EX8 A;  3MZD A;  3RJU A;  1CQA A;  3MBZ A;  4DMZ A;  5EOO A;  2HPB A;  2LB9 A;  3GSG A;  1AXB A;  2PHY A;  3FYZ A;  3A3I A;  3OCN A;  3V39 A;  4BJP A;  2QJ7 A;  1IEM A;  1I2W A;  1P9R A;  3ZQ5 A;  3CUE A;  2ZLY A;  2Y59 A;  2V0U A;  3M2J A;  2A3U A;  1KE0 A;  2ZQ8 A;  5BOH A;  1Q2P A;  2J8Y A;  4ZJ1 A;  2ZL1 B;  4Y3I A;  1OTI A;  5F69 A;  3TE8 A;  3G2Y A;  1ACF A;  4PM7 A;  2Y2J A;  3MZF A;  2V1Z A;  5DFY A;  2XFS A;  4KQO A;  4QJG A;  5FI7 A;  1TF1 A;  1T1C A;  3D9Y A;  1CK3 A;  3P09 A;  4XT2 A;  2RCX A;  1XGI A;  3Q1F A;  4CLC C;  1TVF A;  4FUW A;  3FKW A;  1T1B A;  3LEZ A;  3EEH A;  4QY5 A;  3OCL A;  3JVV A;  5CED A;  2X01 A;  4AFI A;  1K6R A;  1JVJ A;  3VP0 A;  3F1P A;  2AVX A;  4KZ8 A;  1OME A;  2XGN A;  3F1O A;  1H8Z A;  1ES5 A;  1XX2 A;  3IX4 A;  2XD1 A;  2XQZ A;  1ERM A;  2Y2M A;  4EET B;  4WZ4 A;  4R23 A;  2WGW A;  2ZBB A;  4UA6 A;  2LB5 A;  3L9K A;  4KZ3 A;  4GB7 A;  1D06 A;  3CJM A;  1KE4 A;  4O0P A;  3LR5 A;  4Y7P A;  2RL3 A;  1S6R A;  2VV6 A;  4IUK A;  4NXF A;  5M19 A;  1BLC A;  2ZQ9 A;  2Y2O A;  4EU0 A;  1L0E A;  3SH9 A;  2EA9 A;  3SZT A;  2ZJ9 A;  2R9W A;  2W3D A;  4HQA A;  3VMA A;  4HI4 A;  3V3S A;  4NKP A;  4WF0 A;  1SZV A;  4JKT A;  4MN5 A;  1QMF A;  5FAO A;  4HJ4 A;  2G2W A;  4OLG A;  4WUJ A;  1C3B A;  5KMW A;  2IWB A;  4F3L A;  1WA9 A;  2ZL1 A;  4JBF A;  3BFC A;  3F1N B;  4OOM A;  1NRJ A;  3QP4 A;  3C7U A;  1K6S A;  1TD5 A;  2QPN A;  1NZU A;  2MJ6 A;  3G2Z A;  4CLC B;  1ERO A;  1OT9 A;  1D1J A;  3TJZ C;  2Z6D A;  2JKG A;  3DAV A;  5CRF A;  4UA7 A;  4DN0 A;  2OAP 1;  3UDF A;  3IXD A;  4OPR A;  1VET B;  4ZAM A;  1PWG A;  3D3O A;  5LBR A;  4UQI M;  1MXO A;  1CF0 A;  1YMX A;  1XFN A;  3W4Q A;  1J9M A;  3IS2 A;  1LL8 A;  3UB9 A;  3T4T A;  2VV8 A;  1W63 M;  3ZCZ A;  1XXM A;  1PWD A;  2DRW A;  4YWZ A;  3BM6 A;  1HTZ A;  2BLS A;  2E8J A;  4CLC D;  1STZ A;  1XFQ A;  5TR7 A;  3CI6 A;  3HLG A;  3B3X A;  1K56 D;  2WKQ A;  4EUZ A;  3BLM A;  3PBN A;  3BFF A;  2W3E A;  4R3B A;  1DJA A;  1IEL A;  3ZDJ A;  3H82 B;  1S66 L;  3Q7Z A;  3BW6 A;  3ZHH A;  4EUV A;  3NDE A;  2HDR A;  4GJ4 A;  5AQB A;  5TFQ A;  1M6K A;  4Y0U A;  5EVL A;  3IQA A;  3NEC A;  2K7S A;  4KZ6 A;  1MPL A;  3M6B A;  5D3O A;  1L2S A;  3E4Q A;  4GD6 A;  5FQM A;  2ZMA A;  1X0O A;  2PT7 A;  4BMW A;  3SOI A;  1OT6 A;  4PAU A;  2W3F A;  3D4F A;  5EOE A;  4C6Y A;  2O9C A;  4YIN A;  5FAS A;  2WGV A;  3AGD A;  2FZ0 A;  3F1N A;  2V1A A;  1GSX A;  3HL9 A;  4L9E A;  3S7O A;  3HLW A;  4GS9 B;  5A91 A;  3GDI A;  3LIC A;  4ESP A;  2H0Y A;  4UHU A;  1J3W A;  3G31 A;  3DTI A;  3T4O A;  4HES A;  4KZ4 A;  1LSX A;  2KDK A;  1K56 A;  3CWF A;  2XSS A;  1NWZ A;  1H5X A;  3BY8 A;  1G5U A;  5DKK A;  5JYO A;  4E04 A;  4L9G A;  4F94 A;  1JWP A;  4HIA A;  4IVI A;  4DJ3 A;  3IHA A;  3AGE A;  2PAV P;  5EVI A;  4B93 A;  3RFB A;  3E4P A;  4PMA A;  4ETX A;  4OOL A;  1OTB A;  4EEU A;  1PNE A;  4X55 A;  3PBO A;  3O5Y A;  3EWK A;  1YLT A;  1H3Q A;  3KO6 A;  3H7W A;  3SH7 A;  3T50 A;  3CAX A;  3BFG A;  4X53 A;  5DTK A;  3OBF A;  5FDS A;  2EXB A;  1V9Y A;  2ZC3 B;  2K31 A;  2HV1 A;  2H0T A;  1IFQ A;  3VE3 A;  1YQS A;  5I5L A;  5HSQ A;  1VQQ A;  2A24 B;  5A92 A;  1H0M A;  4MEZ A;  3LR4 A;  4A5R A;  2Q9N A;  3UE6 A;  1LL9 A;  4JPM A;  2Y55 A;  2ZQ7 A;  1GHM A;  4P87 A;  4MDZ A;  4WMC D;  3PBT A;  1E3U A;  5FQK A;  1RP5 A;  4Y0T A;  4X6T A;  5F82 A;  3BEC A;  1TS8 A;  4QB8 A;  4E6X A;  1BTL A;  3VFF A;  4GHI A;  2JKT I;  2W1T B;  1LI0 A;  1DP8 A;  1VB6 A;  4L0L A;  3C2W A;  1ZC2 A;  2JC7 A;  3T1Q B;  3WS2 A;  1YLZ A;  3OPL A;  2A49 A;  3S7P A;  2ZM2 A;  1UGU A;  2WYX A;  2VGK A;  2ZD8 A;  3DW0 A;  4WEJ A;  4KQQ A;  1N9N A;  5E2H A;  3MJQ A;  1FCM A;  1BZA A;  2YKH A;  1FR1 A;  1MKM A;  5EPH A;  1N4O A;  4HH3 A;  5IS1 A;  3VP2 A;  3KSH A;  1ZTU A;  3S4X A;  1ES4 A;  2D02 A;  1UWP X;  1S1Y A;  1BSG A;  2WKI A;  4FOF A;  3HVF A;  3HUM A;  5TBM A;  3BFD A;  4D60 A;  1H8Y A;  4WLA A;  4RX3 A;  2IWC A;  4NXG A;  3BWL A;  4S2N C;  4PKY A;  1KE3 A;  1GSW A;  2BG1 A;  5E43 A;  4Y13 A;  5HPF A;  2HJE A;  1K4F A;  3NJA A;  2UWX A;  5DTS A;  4GDB A;  3ZFZ A;  4E3I A;  2O99 A;  3HJK A;  2A24 A;  5AQ7 A;  2ZMV A;  3E2L A;  3S22 A;  1LT0 A;  2XF3 A;  2INW A;  2PU4 A;  4K91 A;  5KZH A;  4IBX A;  1OTA A;  4IJG A;  1ZG6 A;  4N9K A;  3UB7 A;  2QYB A;  2M1C A;  1NXY A;  3K3C A;  4Z1W A;  4EQ1 A;  2J7V A;  4B88 A;  4MBH A;  1KVM A;  4LCM A;  4WYY A;  2J9O A;  1KOU A;  3SH8 A;  3W4O A;  3GTC A;  4H6J A;  3K3D A;  4XT2 B;  2P9V A;  3EQV A;  1YMS A;  5C5K A;  1BUE A;  2OV5 A;  4OQI A;  1LI9 A;  2XD5 A;  3HLE A;  5FQ9 A;  4XXR A;  3T1X A;  3MKF A;  5EEC A;  2O9B A;  4JXG A;  5K5B A;  3P98 A;  1RGZ A;  5J4E A;  4U0X A;  3FPV A;  2H10 A;  2XDM A;  5FI6 A;  3UPN A;  4R6L A;  2PYP A;  4L9F A;  1F2K A;  1SDE A;  3KYZ A;  3F1O B;  3NUL A;  4FH4 A;  2W27 A;  4D2O A;  1ESI A;  3NC8 A;  2J3W A;  1F98 A;  4G3V A;  1A0K A;  3A0S A;  3IWI A;  4DXC A;  2GJ3 A;  2WGW B;  3IBR A;  5HWV A;  4II7 A;  5EFW A;  3HLC A;  4YNR A;  1PZP A;  3IF5 A;  5CXW A;  4EXO A;  3V50 A;  5AQ9 A;  1HD8 A;  2ACG A;  1MC0 A;  4I3A A;  2ZC7 A;  4JGR A;  2HDS A;  1OTE A;  2VGL S;  4F3L B;  1F9I A;  4WBG A;  4LEN A;  1F5M A;  4PM9 A;  4HOI A;  1FR6 A;  4KQR A;  1VEU B;  4FSF A;  2XK1 A;  4QHC A;  4EBL A;  4M3K A;  4GNU A;  3IWQ A;  2EWV A;  5GHY A;  4MCW A;  2I9V A;  2VX8 A;  2JN7 A;  2WKE A;  3ICY A;  3IX8 A;  5IHV A;  1W8Y A;  3UE1 A;  1FCO A;  5FQQ A;  1PI4 A;  4K0W A;  4B4Z A;  3WWX A;  2ZOI A;  4GCZ A;  2XA7 S;  3D72 A;  4N9L A;  5FI2 A;  3BRM A;  5F5Y A;  1XPB A;  4LRZ E;  1YT4 A;  4YFM A;  3CPT B;  1YLJ A;  5DTT A;  2ZC4 B;  3IS2 B;  4Y15 A;  3KSG A;  4DKI A;  1S1Z A;  3IF6 C;  3W8K A;  3GQZ A;  3UE0 A;  1FOF A;  1FCN A;  3GEC A;  3IH8 A;  4I5S A;  2Y2N A;  2OLU A;  2XH9 A;  1IYQ A;  3HRE A;  1BLS A;  3LUQ A;  4S2M A;  4HEF A;  3S7N A;  2X02 A;  1SCW A;  4R4R A;  4S2N A;  1PW1 A;  5EVI C;  3ZG8 B;  4B4X A;  4P85 A;  1JNU A;  5DJU A;  1ONH A;  2W3H A;  1FQG A;  4R3A A;  2OSU A;  2VA0 A;  5JYP A;  4KUK A;  3FG8 A;  3IWO A;  3UPP A;  2EXA A;  4E3J A;  1G68 A;  5CGS A;  3LY3 A;  5CEC A;  1GA0 A;  4C3Q A;  3RTY A;  3B42 A;  3OPP A;  1PRQ A;  4KZ7 A;  3LYX A;  4K08 A;  2OLV A;  2P04 A;  2QWS A;  4NET A;  1ES2 A;  3SS3 A;  3IXB A;  3PBS A;  3VP4 A;  3A3J A;  4EV4 A;  2VV7 A;  5EM1 A;  2WUQ A;  2Q0O A;  5HDC A;  1VEU A;  2Y4A A;  3MSH A;  1E4D A;  3VE4 A;  4BL3 A;  1GSV A;  4IHQ A;  2JKT M;  1LSW A;  3AGF A;  1LSV A;  2G2U A;  5EV0 A;  1FSY A;  2V2F F;  4K0X A;  1JWZ A;  4KG2 A;  3ZYT A;  3CMZ A;  1DRM A;  1Y54 A;  3C5A A;  1K25 A;  4LRY C;  2M7V A;  4OH0 A;  1GHI A;  3NDG A;  2KX6 A;  2H28 A;  3UY6 A;  3ZNT A;  3MQ0 A;  1MBL A;  1XP4 A;  2VK3 A;  5FL3 A;  4ID4 A;  3LO7 A;  3CPT A;  5EVI B;  4ME4 A;  5GHX A;  4ZJ3 A;  5CHM A;  2PRF A;  3HLB A;  5CHU A;  1EWZ A;  1OJG A;  1JTD A;  4Y17 A;  2Q9M A;  2HP6 A;  5J7E A;  4GLQ A;  2Z2L B;  1PI5 A;  3KYE A;  1YSP A;  3H7W B;  3LIA A;  3BQ8 A;  4JGP A;  4WM9 A;  2VLG A;  3T4L A;  2DMW A;  3PAE A;  1I2S A;  4E3K A;  4S2P A;  2JBF A;  4E3N A;  3BYD A;  3JPU A;  2FFY A;  1SKF A;  5HPI A;  4Y2F A;  4P6Z S;  3QP6 A;  4KZ5 A;  3Q81 A;  2VJW A;  3E4O A;  3Q82 A;  3ISG A;  1G6A A;  3IH9 A;  3LI9 A;  1JWV A;  1MWR A;  3W4P A;  1K57 A;  5EVI D;  5DFX A;  2XFT A;  4I39 A;  3WS5 A;  3QNB A;  5HW3 A;  4EBP A;  4HJ3 A;  1NZO A;  4EW7 A;  3P7N A;  2J3T C;  3PAG A;  4GHI B;  1MWS A;  2J9P A;  4B9O A;  4RYE A;  1CEG A;  2KOI A;  5GL9 A;  4QD4 A;  2WK0 A;  1WYC A;  1NJ4 A;  2B95 A;  4I3I A;  5EUA A;  2ZC6 B;  4GZB A;  3O3V A;  2IA2 A;  1U60 A;  3LID A;  3GVB A;  1LHY A;  1ES3 A;  5F1F A;  3Q7V A;  4ARZ A;  1YKD A;  3IXH A;  5EVE A;  3IF6 A;  3PXP A;  4MBF A;  1XJ4 A;  4DE2 A;  5HD5 A;  5HD3 A;  1E3U D;  3N7W A;  3NOT C;  4BBV A;  4JGQ A;  3TW8 A;  1IKI A;  3VOZ A;  2PD7 A;  3QP2 A;  1V9Z A;  2GZA A;  5I94 A;  3HUN A;  3M2K A;  3R7W A;  5TBM B;  3G35 A;  2BAS A;  2P08 A;  1T18 A;  5HFO A;  1Z6F A;  3FKV A;  3G34 A;  4S2O A;  3ZVW A;  2NUT C;  4MBK A;  3PHY A;  5HWT A;  3NBL A;  2OAQ 1;  4IUH A;  5L09 A;  2XLN A;  3DTK A;  1ZHH B;  2VKS A;  5F6A A;  4RVA A;  3CIT A;  4E6W A;  2ZC5 B;  1ZG4 A;  3MXQ A;  1XA7 A;  2HF6 A;  4O7D A;  1E25 A;  5G18 A;  2ZQC A;  3NOU C;  1K0K A;  4JF5 A;  5IU1 A;  2M7U A;  1VHM A;  5GLB A;  2PD8 A;  3MXR A;  4P6B A;  4XUZ A;  2Y2K A;  2ZMF A;  5FAT A;  5E2E A;  1K38 A;  2J80 A;  2Y79 A;  3BY9 A;  4CJN A;  1PZO A;  5E2G A;  2FH5 A;  3LR3 A;  2EFX A;  5M18 A;  1W79 A;  3IT9 A;  1TS6 A;  1IOU A;  2Y2I A;  4H6J B;  1ERQ A;  4DE3 A;  2ZQA A;  2HGV A;  3TRC A;  4IBR A;  2P9V B;  3IHB A;  3MFD A;  2VGJ A;  4X68 A;  1XJ3 A;  3B47 A;  2B02 A;  4JGO A;  5FQJ A;  3OC2 A;  4OP8 A;  2J3T D;  2EFU A;  4DE1 A;  1ALQ A;  1Y4O A;  2W3G A;  5J3W A;  1FIK A;  1DJC A;  1P97 A;  1TS7 A;  2I72 A;  4UA9 A;  3ULF A;  2HDU A;  2B5R A;  3VSK A;  1OJ5 A;  2XR0 A;  1TDG A;  3ZG9 B;  1BT5 A;  4BEN A;  2YKF A;  3UDI A;  3IBJ A;  4LGW A;  3QP1 A;  4GD8 A;  4LV0 A;  4UEY A;  5EE8 A;  3T1R A;  1YAX A;  1TDL A;  3TG9 A;  3FZC A;  5AVF A;  2JCH A;  5L07 A;  4JXV A;  5AVE A;  4DDS A;  3KSI A;  3WRZ A;  5DF8 A;  4HJ6 A;  4X25 A;  5FDH A;  3VFH A;  4OP5 A;  5CTN A;  4HP4 A;  2P74 A;  4KZ9 A;  2JE5 A;  3SS4 A;  5AQA A;  3GMW A;  3O86 A;  1HVB A;  4DF6 A;  5KIZ A;  2V8F A;  4Y5F A;  1GA9 A;  1L0F A;  2ZM0 A;  3VV4 A;  4OQH A;  1MZU A;  2JKR I;  2EX2 A;  1YLW A;  1Q2Q A;  4OLD A;  2WZX A;  1IKG A;  1GCE A;  3HUO A;  3OPR A;  1YPR A;  2V1B A;  3VSL A;  4N92 A;  2QMI A;  1Z09 A;  5L10 A;  4HNB A;  3BFE A;  4QPR A;  3BLS A;  5CHJ A;  1W8Q A;  3UE3 A;  3DTM A;  3NI9 A;  3ZNY A;  4KZB A;  3EOI A;  1BYW A;  4MN7 A;  3A0V A;  3CZD A;  4JF6 A;  3E98 A;  2K2N A;  4CLC E;  2QJ5 A;  5F83 A;  1T19 A;  3T4J A;  1ZKJ A;  4C75 A;  1L0G A;  2NUP C;  1Y28 A;  1K4E A;  2PBY A;  2Y8H A;  1NYY A;  4HBT A;  4KZA A;  2V9A A;  4FTX A;  3EGD C;  1OTD A;  4GOG A;  3ITB A;  3GV9 A;  2EWW A;  1S67 L;  4Z9Q A;  3ZG0 A;  4G3W A;  1KVL A;  5FAP A;  4I3J A;  1S4R A;  1XGJ A;  3VOL A;  3EEA A;  1S0W A;  5HL6 A;  4EBN A;  1O7E A;  1SKO A;  3PR6 A;  1YLY A;  4BD1 A;  3SW1 A;  5G4Z A;  3NCK A;  4HH2 A;  4Y0O A;  3QHY A;  2X71 A;  1K57 C;  2A2L A;  2XEP A;  4ZJ2 A;  2H5S A;  4NEE D;  2GX5 A;  2Y2Q A;  3OOV A;  2V0W A;  1T1A A;  1GHP A;  4RA7 A;  5GLC A;  3C7V A;  2PYR A;  4LPZ A;  4Q0I A;  4U3T A;  1XJ6 A;  4NK3 A;  3L7H A;  4I38 A;  1D7E A;  5DF9 A;  3U4L P;  3UPO A;  3VP1 A;  5GLD A;  5HX9 A;  3C8C A;  4G3K A;  2ZOH A;  1QME A;  3KSF A;  1XA1 A;  5KSH A;  1HLU P;  3ITA A;  4Q0H A;  2JHE A;  3A0R A;  4DE0 A;  4EQI A;  1KGF A;  2V20 A;  4KEN B;  1BLP A;  4EWF A;  2UV0 E;  3UNW A;  3MZE A;  4GW9 A;  1BLH A;  4N1X A;  4UQI S;  2E8I A;  3JYI A;  2V8C A;  3UB5 P;  3LY4 A;  1W5D A;  1K55 C;  4PKY G;  4R4S A;  2CC1 A;  2WKH A;  2O9A A;  3N8R A;  5FQI A;  2C6W B;  5TGF A;  3FC7 A;  4DDY A;  4NXE A;  3I7J A;  4BBT A;  3H9W A;  3DBA A;  4S2J A;  3LIB A;  1UWN X;  3KYQ A;  4E3O A;  3EQU A;  5DJT A;  3GR2 A;  4U0T A;  5CGW A;  2L4R A;  3WS1 A;  5F68 A;  4BBU A;  2P7J A;  3N6I A;  2WZZ A;  1RGY A;  3TOI A;  4PPR A;  4LRX C;  4PM8 A;  2HZ5 A;  4JXS A;  2O0Y A;  3BEB A;  4X56 A;  2WAF A;  5CX7 A;  3C30 A;  5CGX A;  4N1H A;  1K54 C;  1IYS A; 
#chains in the Genus database with same CATH homology
 3LID A;  2VGL M;  3NOP C;  4DMZ A;  2YKH A;  1MKM A;  2LB9 A;  4ARZ A;  4HH3 A;  1YKD A;  5IS1 A;  3KSH A;  2PHY A;  2QHK A;  1NLY A;  1ZTU A;  4KQD A;  3OCN A;  2D02 A;  3PXP A;  1UWP X;  1W63 Q;  1XJ4 A;  4BJP A;  1S1Y A;  2QJ7 A;  5HD5 A;  5HD3 A;  4FOF A;  3MR0 A;  1P9R A;  3NOT C;  4BBV A;  3ZQ5 A;  4JGQ A;  3CUE A;  5TBM A;  4ARZ B;  3TW8 A;  4WLA A;  2V0U A;  3BJN A;  3RH8 B;  2PD7 A;  3G6O A;  4NXG A;  3BWL A;  3OLO A;  1V9Z A;  4PKY A;  4Y3I A;  1GSW A;  2GZA A;  3R7W A;  5TBM B;  3E0Y A;  1OTI A;  2BAS A;  5HPF A;  2P08 A;  1T18 A;  2HJE A;  3NJA A;  2NUT C;  3PHY A;  5HWT A;  5F69 A;  2G7U A;  2XA7 M;  4WEL A;  4Q0J A;  3UB8 A;  3TE8 A;  2OAQ 1;  4IUH A;  2KLI A;  3R7W B;  1ZHH B;  2O99 A;  2VKS A;  3HJK A;  5F6A A;  2A24 A;  5DFY A;  2ZMV A;  4KQO A;  3CIT A;  1LT0 A;  2INW A;  3MXQ A;  2HF6 A;  1TF1 A;  1T1C A;  3NOU C;  5IU1 A;  2M7U A;  1ODV A;  1VHM A;  1OTA A;  2PD8 A;  4IJG A;  3UB7 A;  2QYB A;  4XT2 A;  2ZMF A;  2M1C A;  3K3C A;  4Z1W A;  4EQ1 A;  3MQO A;  3MMH A;  4CLC C;  2J80 A;  5HDS A;  2Y79 A;  1KOU A;  4HP9 A;  1T1B A;  3EEH A;  4H6J A;  3T4Q A;  3BY9 A;  3K3D A;  1XJ2 A;  3JVV A;  2FH5 A;  3OCL A;  4XT2 B;  3EQV A;  3LR3 A;  5C5K A;  4AFI A;  2XRN A;  1TS6 A;  1IOU A;  3F1P A;  3F1O A;  2D01 A;  4H6J B;  1DP6 A;  4LLO B;  2HGV A;  2O9B A;  3TRC A;  5K5B A;  5J4E A;  4EET B;  3PBR A;  3FPV A;  4R6L A;  1XJ3 A;  2PYP A;  4L9F A;  3B47 A;  2B02 A;  2ZBB A;  4JGO A;  3KYZ A;  3F1O B;  2LB5 A;  2VEA A;  3OC2 A;  2WKP A;  2J3T D;  1D06 A;  2JKR M;  4PHT A;  2W27 A;  4CQH A;  2J3W A;  4O0P A;  1F98 A;  3LR5 A;  4G3V A;  5AJG A;  3A0S A;  2VV6 A;  4IUK A;  4NXF A;  2W3G A;  5J3W A;  2GJ3 A;  3K2N A;  1P97 A;  1TS7 A;  3ULF A;  3IBR A;  4EEP A;  4EU0 A;  5HWV A;  2XRO A;  4II7 A;  3HCY A;  2EA9 A;  5EFW A;  4YNR A;  3KX0 X;  2W3D A;  1OJ5 A;  4HQA A;  4HI4 A;  2CMN A;  4NKP A;  4EXO A;  4WF0 A;  4MN5 A;  2YKF A;  3IBJ A;  3MFX A;  1MC0 A;  4HJ4 A;  4I3A A;  4EES A;  4WUJ A;  2PR6 A;  4F3L A;  1WA9 A;  4JGR A;  4CLC A;  3F1N B;  4OOM A;  4UEY A;  2GNX A;  1NRJ A;  1YAX A;  5AVF A;  1TD5 A;  4HY8 A;  1OTE A;  2VGL S;  2MJ6 A;  4F3L B;  1F9I A;  5AVE A;  3V67 A;  1G28 A;  3KSI A;  2PDR A;  4CLC B;  1F5M A;  5HZH A;  4HOI A;  1OT9 A;  4HJ6 A;  5IT5 A;  3TJZ C;  2Z6D A;  4KUO A;  4FSF A;  3PBQ A;  2L0W A;  3HJI A;  4DN0 A;  2OAP 1;  2OWH A;  2EWV A;  4HP4 A;  2PR5 A;  4MCW A;  2I9V A;  2VX8 A;  5G4Y A;  2JN7 A;  3ICY A;  3D3O A;  5LBR A;  4EER A;  4R70 A;  4UQI M;  5KIZ A;  4Y5F A;  1XFN A;  3VV4 A;  1H8M A;  2Z6C A;  3IS2 A;  1LL8 A;  4P6Z M;  1MZU A;  3UB9 A;  2JKR I;  2ZOI A;  4GCZ A;  3T4T A;  2VV8 A;  2XA7 S;  1W63 M;  3D72 A;  4RQ9 A;  4WL9 A;  4YWZ A;  4YOF A;  5F5Y A;  4MMN A;  4LRZ E;  4CLC D;  2V1B A;  3H82 A;  1STZ A;  1XFQ A;  3CI6 A;  3IS2 B;  4HNB A;  3KSG A;  3P01 A;  1S1Z A;  2QKP A;  4QPR A;  2WKQ A;  3PBN A;  2W3E A;  3UMD A;  3UE3 A;  3CUE C;  5TJJ A;  3H82 B;  1S66 L;  3GEC A;  3BW6 A;  4I5S A;  4EUV A;  1N9L A;  3EOI A;  3LUQ A;  4GJ4 A;  1N9O A;  1BYW A;  4MN7 A;  3S7N A;  3A0V A;  4ZRR A;  3E98 A;  2K2N A;  3BQA A;  2K7S A;  4CLC E;  2WKR A;  2QJ5 A;  1JNU A;  5DJU A;  3FPW A;  2W3H A;  1T19 A;  3T4J A;  2OOL A;  3E4Q A;  4R3A A;  4HHD A;  3MQQ A;  4WN5 A;  2VA0 A;  4KUK A;  1X0O A;  2PT7 A;  3FG8 A;  5A8B A;  4BMW A;  3PYP A;  1OT6 A;  4GS9 A;  4PAU A;  2NUP C;  1Y28 A;  2W3F A;  1DP9 A;  2O9C A;  2Y8H A;  1YSQ A;  3RTY A;  3B42 A;  2V9A A;  3MF0 A;  3W2Z A;  2FZ0 A;  5MC7 A;  3F1N A;  2V1A A;  1GSX A;  4L9E A;  4M4X A;  3EGD C;  4ETZ A;  3S7O A;  1OTD A;  3LYX A;  4GS9 B;  2EWW A;  1S67 L;  3GDI A;  3LIC A;  4K08 A;  2P04 A;  2QWS A;  4G3W A;  3PBS A;  1P0Z A;  3T4K A;  4I3J A;  1S4R A;  2VV7 A;  3VOL A;  3EEA A;  5HL6 A;  5HDC A;  3T4O A;  1LSX A;  3UME A;  2KDK A;  1EW0 A;  3PR6 A;  3VE4 A;  1GSV A;  4IHQ A;  5HWW A;  2JKT M;  3C38 A;  1LSW A;  3CWF A;  4BWI A;  2XSS A;  3SW1 A;  1NWZ A;  5G4Z A;  3BY8 A;  1LSV A;  4HH2 A;  3LI8 A;  3R4K A;  5DKK A;  2OWJ A;  2A2L A;  4E04 A;  4L9G A;  3ZYT A;  4NEE D;  2GX5 A;  3OOV A;  4HIA A;  1DRM A;  4DJ3 A;  2V0W A;  1T1A A;  4B93 A;  4LRY C;  2M7V A;  2PYR A;  3RFB A;  3E4P A;  4LPZ A;  2KX6 A;  4Q0I A;  4ETX A;  2H28 A;  1XJ6 A;  4OOL A;  1OTB A;  4I38 A;  4EEU A;  3MQ0 A;  1D7E A;  5DF9 A;  5FL3 A;  3LIE A;  3PBO A;  3O5Y A;  3EWK A;  1H3Q A;  3C8C A;  3KO6 A;  4G3K A;  4ME4 A;  3H7W A;  3T50 A;  2ZOH A;  3CAX A;  3KSF A;  5L8M A;  2R78 A;  3LFV A;  5KSH A;  3UB6 A;  4Q0H A;  1OJG A;  2JHE A;  4WEK A;  3A0R A;  1P9W A;  3OBF A;  5J7E A;  4GLQ A;  1V9Y A;  2K31 A;  2HV1 A;  4GW9 A;  1YSP A;  3H7W B;  3S7Q A;  2L1M A;  1IFQ A;  3LIA A;  3BQ8 A;  3VE3 A;  4JGP A;  2VLG A;  5I5L A;  2DMW A;  4O8G A;  3T4L A;  5HSQ A;  2A24 B;  2W0N A;  3B33 A;  3LR0 A;  4UQI S;  3LR4 A;  4R38 A;  4DJ2 A;  3UE6 A;  5HPI A;  4Y2F A;  4PKY G;  1OPX A;  4P6Z S;  1S4S A;  2B18 A;  4MDZ A;  3PBT A;  2W1R A;  2W1T A;  2VJW A;  2O9A A;  3E4O A;  3LI9 A;  3EGX C;  3FC7 A;  5HDD A;  2HJ9 C;  5DKL A;  1TS8 A;  1NLZ A;  4NXE A;  4BBT A;  5DFX A;  4I39 A;  3H9W A;  4GHI A;  3DBA A;  2JKT I;  2W1T B;  3CLO A;  3LIB A;  1UWN X;  1DP8 A;  3KYQ A;  1VB6 A;  4L0L A;  3EQU A;  3JVU A;  3C2W A;  4HJ3 A;  5DJT A;  4EW7 A;  3P7N A;  2J3T C;  3NHQ A;  2L4R A;  3F1P B;  4GHI B;  5F68 A;  2P7J A;  4BBU A;  3U2A A;  4B9O A;  3T4S A;  3S7P A;  1TS0 A;  1UGU A;  2VZW A;  2KOI A;  4LRX C;  4I3I A;  4NXB A;  4WEJ A;  4MN6 A;  2O0Y A;  1G6O A;  3LIF A;  4O01 A;  2IA2 A;  5CX7 A;  3C30 A;  1N9N A;  3MJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...