2HGVA

N-terminal gaf domain of transcriptional pleiotropic repressor cody
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
155
structure length
155
Chain Sequence
MALLQKTRIINSMLQAAAGKPVNFKEMAETLRDVIDSNIFVVSRRGKLLGYSINQQIENDRMKKMLEDRQFPEEYTKNLFNVPETSSNLDINSEYTAFPVENRDLFQAGLTTIVPIIGGGERLGTLILSRLQDQFNDDDLILAEYGATVVGMEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-sensing transcriptional pleiotropic repressor codY
publication title The Structure of CodY, a GTP- and Isoleucine-responsive Regulator of Stationary Phase and Virulence in Gram-positive Bacteria
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
total genus 41
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2006-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2hgvA00
5HPFA 2Y79A 3IBJA 4EUVA 5C5KA 5HL6A 4PAUA 3MMHA 3R4KA 2GX5A 5L8MA 3E98A 2W3HA 2KLIA 3W2ZA 3RFBA 3CITA 4Q0IA 4MDZA 2LB9A 4R6LA 3KO6A 3KSHA 4O8GA 4EU0A 5HPIA 4MCWA 3NOUC 4E04A 4IUKA 2LB5A 4ETZA 2O9BA 2K2NA 2VEAA 4LRXC 5TJJA 3G6OA 2KOIA 4Q0HA 2W3EA 4YOFA 2W1TA 2W3FA 3O5YA 4LRZE 5K5BA 4O01A 5AJGA 2O99A 2M7VA 1YSPA 4DMZA 3C2WA 3E0YA 3DBAA 3NHQA 3KSIA 4IJGA 2O0YA 2W3GA 3S7OA 4RQ9A 2VKSA 4YNRA 1YKDA 4QPRA 3EEAA 2ZMFA 4Y2FA 3LFVA 4Y3IA 2XROA 4MMNA 4G3KA 3NOPC 4MN7A 4ME4A 2QYBA 3S7PA 3TRCA 3KSGA 3D3OA 5LBRA 2HGVA 4G3WA 2XSSA 2B18A 3CI6A 1STZA 4G3VA 4Y5FA 3KSFA 4ETXA 4GLQA 2VZWA 2G7UA 1TD5A 3HCYA 4O0PA 2IA2A 2XRNA 3BJNA 1MC0A 4LRYC 3OBFA 4R70A 5I5LA 3IBRA 4CQHA 1TF1A 3OOVA 4GW9A 2O9CA 1ZTUA 1VHMA 1YSQA 2M7UA 3NOTC 3MQ0A 4Q0JA 2OOLA 2VJWA 4ZRRA 2Y8HA 4IUHA 5DFXA 3VV4A 2O9AA 2W3DA 3S7QA 4Z1WA 4DN0A 3ZQ5A 3S7NA 4FOFA 1F5MA 1MKMA 3K2NA 4BWIA 2W1TB 2W1RA 2K31A 5HSQA 5DFYA 3MF0A
chains in the Genus database with same CATH superfamily
1Z6FA 1KVMA 2XA7S 3IH9A 1OTDA 1WE4A 5EPHA 3LICA 1KE4A 1S1YA 3AGEA 1N4OA 4ID4A 2Y91A 1SKOA 1RCJA 3BM6A 4IVKA 5FDSA 1Y4OA 2XLNA 3KSHA 4CPKA 4YFMA 2ZLYA 2BASA 4Q0HA 3NDEA 1FOFA 1HZOA 1FCNA 1IYSA 3LIBA 2HDRA 3BFGA 2ZMVA 1CK3A 2WGWB 2I9VA 2O0YA 1WYCA 2W0NA 1L2SA 3HUNA 4S2KA 3PBNA 3MKFA 3TG9A 2P74A 3HBRA 5A91A 3PBOA 4MN7A 1VQQA 4OONA 3W4OA 1YLTA 2JBFA 2PBYA 2ZC6B 3JVVA 4JF4A 4F3LB 2H5SA 3A0RA 4CLCD 4S2PA 4WZ5A 2VZWA 4H8RA 3FKVA 4O0PA 4CJNA 3ZFZA 5FQIA 3ITAA 1LL5A 2J7VA 5EM0A 1YLPA 3G32A 3OLOA 1PI4A 1ZC2A 3BW6A 2P9VB 1W63M 1W8YA 3TOIA 4DDYA 2FH5A 3WS2A 4FOFA 5I94A 4JF5A 5TBMA 3IX8A 4GHIA 5M1AA 5F69A 3HJKA 4UEYA 3JVUA 3UNWA 2INWA 4N1HA 1OJGA 4GNUA 3W2ZA 4MDZA 4FCFA 4PKYG 3BEBA 3VSKA 4Z9QA 5F68A 3ICYA 3CPTA 4ETZA 5TFQA 5EVID 4E3JA 5J4EA 4RX2A 1VEUB 3CJMA 3DTIA 2W1TA 4QHCA 3LI8A 3EOIA 1F9IA 3QHYA 2A49A 3N4IA 4PHTA 3P7NA 2G2WA 2VGLS 5U47A 4BJPA 1YQSA 2JKRM 2WADA 3LI9A 2ZOIA 4HESA 4S2OA 4OQ0A 3FG8A 3UB8A 3NY4A 4WMCA 2QYBA 2WKHA 4WL9A 3PXPA 3QP5A 5DKKA 2P08A 2ZM2A 3JPUA 1L0GA 1XKZA 4Y0OA 4E3IA 5A93A 5M19A 4R3AA 1NLYA 4DXBA 5IU1A 3HCYA 1YT4A 4LRYC 3IBRA 3OPHA 1H5XA 5L2FA 2ZBBA 1LL9A 2VK3A 3EQVA 4H6JA 4LV2A 5G4YA 3W4PA 4DRTA 4YINA 1MKMA 4JGRA 1L0EA 3FV7A 3FPWA 4X53A 4GD6A 3C7VA 3B47A 3IBJA 3RXWA 1KE3A 4LCLA 4OLDA 3ISGA 3SS5A 3T4JA 3UMDA 3UMEA 1EROA 3P01A 4Q0IA 1SCWA 5EVEA 3ZG9B 3KO6A 3ZCZA 4O8GA 3ITBA 4WELA 2XGNA 5IS1A 1NZUA 2PYRA 3A3JA 4PM8A 4AFIA 3ZVWA 3ZNYA 2XEPA 1DJAA 4NXBA 3M2KA 2HJ9C 1A0KA 1GHMA 2OSUA 1TS8A 4HBTA 3LIDA 3BFFA 3LEZA 3NOPC 2V8FA 1BT5A 1T1BA 1MWSA 2XF3A 2BLSA 2JC7A 5CRFA 1K25A 5E2HA 3A0SA 4WBGA 1N9LA 3TSGA 5FAPA 2AVXA 4GLQA 4KQOA 3BFCA 2QZ6A 1EI5A 3V3SA 1JVJA 2PR5A 3SW1A 4NEED 3O88A 3U2AA 1KGEA 3VFHA 3S7NA 2B5RA 1F5MA 3LIEA 1GA9A 2HP9A 2A24B 2ZL1A 4X68A 2JKGA 2IWBA 3MFDA 4JKTA 5E2FA 1LT0A 5FAOA 2BTFP 1K55A 4EXOA 1NWZA 4BD0A 4JGQA 4KZ4A 3LIFA 3T1SA 1XGJA 4B93A 3ZG7B 4Y0UA 2GJ3A 1TDGA 4DE0A 1LSWA 4NG2A 2Y2KA 4OPZA 3SS4A 1YMSA 4DJ2A 3KYZA 3PYPA 4ESPA 2M7VA 4DMZA 3E0YA 2X71A 2Y2QA 3KSIA 2EFXA 4X55A 4KZ8A 3EGDC 3MXQA 2ZOHA 4N92A 5KZHA 3NJAA 4B9OA 5EOEA 5GLDA 3KSGA 4BQMA 3IF5A 5GLCA 4X6TA 1S0WA 2JE5A 4I5SA 1PWCA 4BBUA 3OCLA 4UHUA 2VV6A 4R1GA 5CHMA 4KUKA 1WA9A 3WRTA 3ZHHA 3T4LA 4K08A 3SH9A 4E3NA 1JTGA 3LR5A 3CLOA 1ZG6A 2OOLA 4ARZB 2A3UA 2RCXA 2V1BA 5GHYA 3M6BA 4OP8A 3N7WA 4DN0A 3MXRA 3T4OA 4P6BA 2PD8A 1Z09A 3BLMA 1PYYA 2K31A 2DNSA 1AWIA 4PM7A 1M6KA 3L7HA 3VOLA 2ZD8A 3C8CA 2W3HA 5DF8A 3H82A 3BY9A 4IVIA 2Q0OA 4EU0A 4HP9A 3OCNA 3UPOA 1W8QA 4MBHA 4IUKA 4GOGA 2O9BA 4OPYA 4OQHA 5TJJA 1I2SA 2HDSA 3G30A 5JYPA 3G6OA 4JPMA 3BLSA 2Z2MB 3B42A 3L9KA 4HP4A 5AJGA 2D01A 4QWOA 3NIAA 1E3UD 5EE8A 2KX6A 2VKSA 5HDCA 4X56A 3TE8A 1SHVA 1LSXA 1KE0A 3LFVA 1G68A 1EW0A 2VGJA 3OPRA 1UGUA 5FDHA 2L0WA 4JXWA 3EEHA 5FQQA 3QNCA 4N1XA 3N8RA 3ZG0A 2R78A 2HP5A 1S1ZA 1TD5A 4HJ4A 2D02A 4EV4A 3QP1A 3GRJA 3OC2A 3HVFA 4GW9A 2O9CA 1K56A 3D72A 1ZTUA 1VHMA 4ZJ3A 4KG5A 3F1OA 2P04A 1UWNX 5G18A 4XT2A 3BQAA 2OWHA 5FAQA 4GS9B 4IUHA 2EWVA 5DFXA 2W3DA 4WM9A 1TS7A 3NULA 2GNXA 3VOZA 3CUEA 4HI4A 1D7EA 1OT9A 5DFYA 5F6AA 3CWFA 1K56D 5C5KA 3VP3A 2WKPA 1J9MA 1PZOA 4DXCA 2WZZA 5F83A 5HD5A 3G2YA 3RFBA 1D06A 4JBFA 1BLCA 5IHVA 5HWVA 5KMWA 3F1PB 3IXBA 4DJ3A 1XX2A 2Y2IA 2QHKA 4DE2A 2VEAA 5DJUA 4LRZE 5FQKA 4WEKA 2ZQ7A 3C2WA 1G5UA 3VFFA 4E3OA 3AGDA 1GSWA 2ZQAA 2WKIA 4QPRA 2CMNA 2XROA 5CGWA 1VETB 5J3WA 2NUPC 2QJ5A 3VSLA 4UA9A 4MN5A 2Q9NA 3D9YA 4KZ3A 4JGPA 3T4TA 2HGVA 4G3WA 1JWPA 2Y2JA 3CHWP 1S6RA 5FL3A 1O07A 3CG5A 1PWGA 4QY6A 3GTCA 3F1NB 3PAEA 2I72A 5DKLA 2VA0A 4PM9A 3KSFA 2R9WA 3GSGA 2ZM8A 2HPBA 4II7A 2WGWA 3HLBA 4CLCE 4MLLA 1T1CA 1CEFA 2XQZA 1YLJA 4MN6A 3IF6B 2ZQ9A 3MSHA 3P98A 4KG2A 2WAEA 5FI2A 5DJTA 2RL3A 4CLCB 4HQAA 5FI6A 5L10A 4R23A 3VOYA 3WS5A 2PAVP 3P09A 2BG1A 3SZTA 4P6ZM 4F3LA 1MXOA 2H0YA 3MF0A 4S2IA 4LV0A 2Y79A 5EVLA 2V0WA 4EQIA 4WYYA 4NXFA 2H10A 4L9GA 2GX5A 2KLIA 2HDUA 1M40A 3CITA 4P6ZS 4R6LA 2P9VA 1DP6A 3UE6A 3OPLA 4B88A 4JLFA 1IKGA 3Q82A 2LB5A 1XFQA 3E2KA 2YKHA 5CECA 2V9AA 3M6HA 5CERA 1OTAA 3FWLA 4HEFA 4OLGA 4IBXA 1GCEA 4RX3A 1G6AA 2PRFA 3LR3A 3HJIA 4GHIB 3LEQA 2W3GA 4XXRA 4RQ9A 4UAAA 3VE3A 5EVIB 4OH0A 3EEAA 5DVAA 4MBKA 3UY6A 1YPRA 1XXMA 5KSCA 4ME4A 2DRWA 3QP4A 1FR1A 1OTBA 3A3EA 3EQUA 1VEUA 1OTEA 3UE0A 3IS2B 3CI6A 1SDEA 1DJBA 2ZQDA 4ETXA 1FCOA 2HDQA 4BENA 2W27A 1K38A 3UDXA 4CQHA 1TF1A 1P9WA 3B3XA 2Y2PA 1T18A 3HLEA 3IXDA 1LSVA 2VJWA 1IELA 2X02A 3KX0X 5EV0A 3ZQ5A 4RA7A 4UA6A 1PZPA 4DKIA 3LYXA 1FQGA 3IXGA 1K55C 2HV1A 4WMCD 2L1MA 4M3KA 4LENA 1XJ3A 3MMHA 1NRJA 2ZC5B 5GLBA 1MWRA 1YMXA 1FILA 3SH8A 2GZAA 4EESA 4LCMA 1P0ZA 3LR4A 4A5RA 1CI8A 1SZVA 4HH2A 3MZDA 2W3FA 5FQ9A 3T1RA 1HVBA 2O99A 3IHBA 4GB7A 1TDLA 4O7DA 3E2LA 4Y2FA 4JF6A 3N8SA 2PT7A 3IWOA 3S7PA 3V5MA 3GDIA 4QY5A 4D60A 5AVFA 3QP8A 2PU2A 4OPRA 1TVFA 4BBVA 1I5QA 1JNUA 3TJZC 3O87A 2IA2A 3H7WB 2Y59A 3OBFA 4KENB 4KZBA 2Y2GA 1G6OA 1ZG4A 4LLOB 3DTKA 3FYZA 3RXXA 4IHQA 3C38A 3N8LA 1BLSA 3PBQA 3PR6A 4R3BA 1NLZA 3VP4A 1Q2PA 3E4QA 1P97A 4HBUA 4KQQA 4WZ4A 4KZ6A 1RGZA 4EUVA 3HLCA 1YLWA 3GV9A 4GDNA 1MPLA 4PAUA 3IX3A 1LHYA 2A2LA 3UB9A 1NXYA 1MY8A 3ZDJA 1NRFA 4JXVA 1K54A 1Y28A 3UB7A 2EXBA 1OT6A 4YOFA 2HZ5A 3LUQA 2IWDA 2ZQCA 1D1JA 4R4RA 4HH3A 1W7FA 2Z6DA 1XP4A 1MWUA 4PMAA 1I2WA 3EGXC 3GVBA 1J3WA 1YKDA 4L9FA 5HFOA 4Y3IA 5FASA 3UPPA 2QKPA 1BTLA 1FSWA 2V0UA 3H9WA 4NK3A 4YWZA 3WRZA 5CGXA 1FR6A 4E3LA 3Q07A 1EWZA 2WK0A 2WYXA 1K6RA 2V1AA 3SS3A 2XD1A 4OKPA 4DE1A 1RP5A 4LGWA 5AQBA 3DTMA 3UPNA 1OJ5A 4DE3A 4KQRA 3CUEC 1G28A 1N9BA 5CHJA 5F5YA 4EERA 4GN2A 4Z1WA 2NUTC 3S7QA 4FD8A 3R7WB 1K4FA 3PHYA 3BECA 4EW7A 3QP6A 4BLMA 1PNEA 2XFSA 5IT5A 4S2NA 3N6IA 3R4KA 4BL3A 3T4KA 3W4QA 3Q7VB 2WKQA 5CTNA 1S66L 4WLAA 1FCMA 4ARZA 3VE4A 2Z6CA 4EEPA 3HUOA 4FH2A 4XUZA 1MBLA 5DF9A 2B02A 4OOLA 3KYQA 4JXGA 1PRQA 1HD8A 1KVLA 3UDFA 4C6YA 3C7UA 3NHQA 5FA7A 3HUMA 3NDGA 3C4PA 4YNRA 1OTIA 3IQAA 3T1QB 1IYPA 2VV7A 2ZJ9A 1O7EA 3WS1A 5F1FA 1TS0A 4FH4A 4Q8IA 3ZNTA 3FPVA 1XA7A 5HAPA 3GECA 3K3DA 2FFYA 4QJGA 4U3TA 5I5LA 5DTSA 4OVDA 4GDBA 2P7JA 3LCEA 3UDIA 5F1GA 5AVEA 2J8YA 1H8ZA 3ZYTA 5CHUA 3QP2A 4F94A 2K7SA 5AQAA 5DTTA 3E4PA 2B95A 4KG6A 5FI7A 3NBLA 2Y4AA 4S2LA 1YM1A 3FKWA 1DY6A 1SDNA 1IYQA 4GJ4A 2EX2A 3MQQA 2FZ0A 2PU4A 2WGIA 1K4EA 3T4QA 3PBRA 1ES2A 1MWTA 2JN7A 1HLUP 4EWFA 3IHAA 5CTMA 4GS9A 2VV8A 2J9PA 2W3EA 3RJUA 1FIKA 5JYOA 4N9LA 3AGFA 5FSRA 3MFXA 2OWJA 2Z2LB 1Y54A 5A92A 1PFLA 2FFFB 2ZC7A 5E2GA 3S7OA 3A3IA 1IOUA 5AQ9A 4R0QA 1LL8A 4MBFA 4MMNA 1ERQA 3FC7A 3VMAA 4G3KA 3F1PA 5A90A 4OP5A 1ERMA 4FSFA 2DMWA 1N9NA 2J3WA 1JTDA 2B18A 2GDNA 2QPNA 2PR6A 4G3VA 3UO9A 1IEMA 3NECA 5FATA 5FEFA 1T1AA 4MEZA 2V2FF 1SKOB 1MKIA 1VETA 1YSQA 3G4PA 1K57C 4GKUA 1VM1A 4KZ9A 4Q0JA 4KZ5A 4B4ZA 2OLVA 2XD5A 3GQZA 5HD3A 3IXHA 1L3LA 5J8XA 2H28A 1T19A 3U4LP 4EBLA 4NXGA 1KDWA 2L4RA 5HW3A 1CF0A 2W1RA 3F1NA 4ZJ2A 4D2OA 5HSQA 5KSHA 1BLHA 1U60A 4R38A 3VP0A 4KZAA 4NETA 4NKPA 5GLAA 5HL6A 3SOIA 1DRMA 3IF6A 3RTYA 3MJQA 4CLCA 1ES3A 4MCWA 5E2EA 4E04A 2UV0E 2DCFA 1BLPA 2J9OA 4HNBA 4LRXC 5CXWA 2EA9A 4X1LA 4ZAMA 3CZDA 4MNRA 2KDKA 4OQGA 1ESIA 2Y2NA 4I3IA 1BUEA 3A0VA 3ULFA 2ZC3B 5CEBA 2YKFA 3DWKA 3CAXA 2EX6A 1TEMA 1MZUA 1AXBA 1E4DA 1H8YA 4Y0TA 3PAGA 5TBMB 4KQDA 1BYWA 4P0MA 4HIAA 4X69A 3C4OA 4Y13A 3ZG5A 2X01A 5GL9A 4WEJA 3BJNA 1MC0A 1KDSA 3NC8A 4X25A 3FZCA 3S1YA 4E3MA 5EVIA 2PYPA 4Y17A 4LV3A 1CEGA 5HWTA 3W8KA 2Y2HA 2PD7A 5AQ7A 5D3OA 3Q1FA 1ZKJA 3CPTB 4K0WA 3IS2A 4DDSA 5E43A 2VGLM 2W1TB 1Q2QA 1UWPX 4I3AA 4GD8A 1KGFA 4QB8A 5A8BA 5KIZA 5HPFA 2QWSA 5GHXA 1E25A 1K54C 5L8MA 2Y2LA 3RH8B 2UWXA 3T12B 2E8IA 3TW8A 3G31A 1H0MA 2LB9A 4PM5A 1K57A 5EFWA 2OLUA 2PHYA 2J3TC 4KUOA 3WWXA 4BL2A 1X0OA 4PKYA 3S22A 3QNBA 2Y2MA 4K91A 3BFEA 4E3KA 1SKFA 1K0KA 2VGKA 3O5YA 4PPRA 3MS6A 5HDDA 1YSPA 2EXAA 1YLZA 4IEDA 3DBAA 3KYEA 1S67L 4EBPA 1XPBA 1GHPA 5HWWA 5HARA 3B33A 2V8CA 3Q7ZA 1ACFA 3UN7A 1GHIA 1PW8A 1ZHHB 3UB6A 1ODVA 3MBZA 2VLGA 4H6JB 2MJ6A 3TRCA 1IFQA 5LBRA 2XSSA 2JHEA 2C6WB 4Y15A 1STZA 3LGOA 1N9OA 2VX8A 3BY8A 3O86A 1IKIA 2G7UA 2ACGA 4E6XA 2XK1A 1BSGA 3MZFA 1QMEA 3IX4A 3OOVA 1XA1A 5EM1A 3MQ0A 5HZHA 2QMIA 3T1XA 3HLWA 2JKFA 1LLBA 3O3VA 4Y7PA 4S2NC 4EUZA 1XJ6A 3LR0A 3DWZA 2WGVA 4R3JA 4HJ6A 4OOMA 4C3QA 3H7WA 3HLDA 4OOYA 4IBRA 4UQIM 2H0TA 3DAVA 3V3RA 3PBTA 3VP1A 5HPIA 3UE3A 3NOUC 4UA7A 1FSYA 1PI5A 1GSXA 1BULA 3NI9A 4UQIS 4HOIA 3V50A 2XFTA 5HL1A 2XR0A 1CJFA 2JCHA 3IWQA 4R4SA 3PTEA 1LI9A 4C75A 4IJGA 2JKTI 4RYEA 2EX9A 4X1MA 2ZMFA 3Q81A 4HHDA 3T4SA 2A24A 3NCKA 1V9YA 4FUWA 3MR0A 3D3OA 4P85A 2ZMAA 5HAIA 1ESUA 3OPPA 4WUJA 4OQIA 2ZL1B 3C5AA 5BOHA 5G4ZA 5HDSA 2XRNA 5CX7A 4QD4A 1BZAA 4DF6A 2WKRA 4L9EA 3PBSA 5GHZA 4LFUA 2WAFA 2M7UA 1PWDA 2QJ7A 3NOTC 2J3TD 2HP6A 2HF6A 4E6WA 1PW1A 4FTXA 1KGGA 5HAQA 3GR2A 3V39A 1RGYA 4I3JA 2Y2OA 1YLYA 3K2NA 1LI0A 2ZQ8A 2ZM0A 3BYDA 1KOUA 1XJ4A 3V67A 3A3DA 3MKEA 1HTZA 2XH9A 1QMFA 1NJ4A 3BQ8A 5DF7A 3A3FA 2XDMA 3LY4A 3DW0A 4K0XA 3WS4A 4ZBEA 3IWIA 1NYMA 1L0FA 2Y55A 5M18A 1CQAA 3R7WA 4U0TA 1W5DA 5L09A 1GA0A 1WYBA 3OZHA 5K5BA 4O01A 3IH8A 4S2JA 2IWCA 1NZOA 3LY3A 4B4XA 3Q7VA 3SH7A 2CC1A 3MXSA 4GCZA 1CI9A 3HL9A 1PIOA 2PBDP 1ES5A 2OAQ1 4EBNA 5MC7A 1DP9A 4XUXA 4RVAA 3MZEA 4JGOA 5EOOA 4L0LA 5L07A 3JYIA 3BFDA 4JXSA 3BWLA 4Y5FA 3MQOA 5CEDA 4U0XA 1H3QA 1K6SA 3UE1A 2HJEA 3BRMA 4EQ1A 4WN5A 4R70A 2Q9MA 3WS0A 1NYYA 2C5WB 2R9XA 1S4SA 4ZTKA 3H82B 4S2MA 5FQJA 1V9ZA 2WKEA 1XFNA 5EECA 3UB5P 1JWZA 2Y8HA 4ZRRA 5F82A 3G34A 4EEUA 2V20A 3C30A 1XGIA 2J80A 1E3UA 4BD1A 2OV5A 1YAXA 3LO7A 4BWIA 4EETB 1VB6A 4OPQA 3IF6C 1W79A 1ONGA 3G2ZA 3LIAA 1ONHA 3HLFA 3ZGAB 4CLCC 2EWWA 3GMWA 4WF0A 1S4RA 3E98A 2JKRI 3DTEA 3K3CA 5EUAA 3HLGA 1ALQA 4LV1A 2V1ZA 4M4XA 4ZDXA 2WUQA 3T50A 5J7EA 3CMZA 4HY8A 5TGFA 2E8JA 1DJCA 5FEGA 4N9KA 4PM6A 2K2NA 4LPZA 2KOIA 1JWVA 1DP8A 4I38A 4HJ3A 4QU3A 4WZ5C 1H8MA 1W63Q 3HREA 3G35A 1NY0A 2M1CA 5HX9A 2EX8A 1L0DA 1F98A 3IT9A 5CGSA 1C3BA 2PDRA 4ZJ1A 3F1OB 5FQMA 4XT2B 4I39A 4P87A 1OMEA 2WZXA 2OAP1 1OPXA 1XJ2A 5EVIC 1TS6A 3ZVTA 2JKTM 3E4OA 1GSVA 2EFUA 1P9RA 4GZBA 5TR7A 5DTKA 1ES4A 3D4FA 2XA7M 3VP2A 3VV4A 2O9AA 2G2UA 1IYOA 2ZC4B 4KZ7A 3S4XA 1F2KA 3ZG8B 4BMWA 3I7JA 3M2JA 4NXEA 3EWKA 4BBTA
chains in the Genus database with same CATH topology
5A8BA 5KIZA 2XA7S 5HPFA 1OTDA 2QWSA 3LICA 4EUVA 1S1YA 3VOLA 4PAUA 5L8MA 3RH8B 3C8CA 2A2LA 2W3HA 3UB9A 3TW8A 3H82A 3BY9A 2LB9A 3KSHA 4EU0A 4HP9A 3OCNA 5EFWA 2PHYA 1Y28A 4IUKA 2J3TC 4KUOA 3UB7A 2O9BA 1X0OA 4PKYA 5TJJA 2BASA 3G6OA 4Q0HA 1OT6A 4YOFA 3B42A 3O5YA 4HP4A 3LUQA 3LIBA 5AJGA 5HDDA 1YSPA 4HH3A 2D01A 2Z6DA 3DBAA 1S67L 2ZMVA 3EGXC 2I9VA 5HWWA 2O0YA 2W0NA 3B33A 2KX6A 2VKSA 1YKDA 4L9FA 5HDCA 3TE8A 3PBNA 4Y3IA 1LSXA 3LFVA 1EW0A 1ZHHB 3UB6A 1ODVA 2QKPA 3PBOA 4MN7A 1UGUA 2VLGA 4H6JB 2V0UA 3H9WA 2MJ6A 3TRCA 4YWZA 1IFQA 2L0WA 3EEHA 5LBRA 3JVVA 2XSSA 2JHEA 1STZA 4F3LB 1N9OA 2VX8A 2R78A 3A0RA 4CLCD 3BY8A 1S1ZA 2V1AA 2VZWA 2G7UA 1TD5A 4O0PA 4HJ4A 2D02A 3OOVA 3OC2A 4GW9A 2O9CA 1OJ5A 3D72A 3OLOA 1ZTUA 1VHMA 3F1OA 3BW6A 2P04A 3CUEC 3MQ0A 1UWNX 1W63M 4XT2A 3BQAA 5HZHA 2OWHA 1G28A 4GS9B 4IUHA 2EWVA 5DFXA 2W3DA 5F5YA 4EERA 1TS7A 2FH5A 2NUTC 4Z1WA 3S7QA 3R7WB 2GNXA 3CUEA 4HI4A 4FOFA 1D7EA 3PHYA 1OT9A 4EW7A 5TBMA 4GHIA 5F69A 3HJKA 4UEYA 5DFYA 5F6AA 1XJ6A 3CWFA 3JVUA 3LR0A 4HJ6A 4OOMA 5C5KA 2WKPA 3H7WA 5IT5A 2INWA 3R4KA 5HD5A 3T4KA 4UQIM 1OJGA 2WKQA 3W2ZA 1S66L 4WLAA 3PBTA 3RFBA 1D06A 4MDZA 4ARZA 5HPIA 4PKYG 3UE3A 5HWVA 3NOUC 3VE4A 3F1PB 2Z6CA 4EEPA 5F68A 3ICYA 4DJ3A 4ETZA 2QHKA 1GSXA 2VEAA 5DF9A 5DJUA 2B02A 5J4EA 4UQIS 2W1TA 4HOIA 4LRZE 3LI8A 4OOLA 3EOIA 3KYQA 4WEKA 1F9IA 3C2WA 3NHQA 4PHTA 3P7NA 1GSWA 4IJGA 2JKTI 2VGLS 4YNRA 4BJPA 2JKRM 4QPRA 1OTIA 2CMNA 2ZMFA 2ZOIA 3LI9A 2VV7A 2XROA 5J3WA 2NUPC 2QJ5A 3FG8A 4MN5A 3UB8A 4HHDA 3T4SA 2QYBA 4JGPA 4WL9A 2A24A 3PXPA 1V9YA 2P08A 3MR0A 1TS0A 3D3OA 5DKKA 3T4TA 2HGVA 4G3WA 3FPVA 5FL3A 4R3AA 3GECA 4WUJA 3K3DA 1NLYA 3F1NB 5DKLA 2VA0A 3KSFA 5IU1A 5G4ZA 3HCYA 5HDSA 2XRNA 5CX7A 4II7A 4CLCE 4LRYC 1T1CA 2WKRA 3IBRA 4L9EA 3PBSA 5I5LA 4MN6A 2ZBBA 2P7JA 2M7UA 2QJ7A 5DJTA 3NOTC 2J3TD 3EQVA 4CLCB 4HQAA 5AVEA 2HF6A 4H6JA 3ZYTA 5G4YA 4I3JA 2K7SA 3E4PA 1MKMA 3K2NA 4JGRA 4P6ZM 4F3LA 3FPWA 1KOUA 1XJ4A 3MF0A 4GJ4A 2Y79A 3B47A 3V67A 3MQQA 2FZ0A 2V0WA 3IBJA 4NXFA 4L9GA 3T4QA 3T4JA 2GX5A 3PBRA 3BQ8A 3UMDA 3UMEA 2KLIA 2JN7A 3CITA 3P01A 4Q0IA 4P6ZS 4R6LA 3KO6A 1DP6A 4O8GA 3UE6A 4GS9A 4WELA 2LB5A 1XFQA 3R7WA 2VV8A 2YKHA 5IS1A 2V9AA 1OTAA 2W3EA 2PYRA 5K5BA 4O01A 3MFXA 2OWJA 4AFIA 3LR3A 3HJIA 4GHIB 3S7OA 2W3GA 4NXBA 4RQ9A 3VE3A 2HJ9C 1IOUA 3EEAA 4GCZA 1LL8A 1TS8A 4MMNA 3LIDA 3FC7A 4G3KA 3NOPC 4ME4A 3F1PA 2K31A 2OAQ1 1T1BA 1OTBA 5MC7A 1DP9A 3EQUA 4FSFA 4JGOA 4L0LA 2DMWA 1N9NA 2J3WA 1OTEA 2B18A 3IS2B 3A0SA 3CI6A 3BWLA 2PR6A 1N9LA 4G3VA 4Y5FA 3MQOA 4ETXA 4GLQA 1H3QA 2HJEA 4KQOA 1T1AA 4EQ1A 4WN5A 4R70A 2W27A 4CQHA 1TF1A 1P9WA 1T18A 1S4SA 1YSQA 3H82B 2PR5A 3SW1A 1LSVA 4Q0JA 2VJWA 1V9ZA 1XFNA 4NEED 3KX0X 2Y8HA 4ZRRA 5HD3A 4EEUA 3C30A 3U2AA 2H28A 3ZQ5A 1T19A 2J80A 1YAXA 3S7NA 3LIEA 1F5MA 4NXGA 4BWIA 2L4RA 3LYXA 2A24B 4EETB 1VB6A 2W1RA 3F1NA 5HSQA 5KSHA 2HV1A 3LIAA 4R38A 2L1MA 4CLCC 4NKPA 2EWWA 5HL6A 1LT0A 1XJ3A 3MMHA 1NRJA 1DRMA 4WF0A 1S4RA 3E98A 1NWZA 2JKRI 4EXOA 3K3CA 4JGQA 2GZAA 3RTYA 3LIFA 4EESA 4B93A 3MJQA 1P0ZA 4M4XA 4CLCA 2GJ3A 4MCWA 3T50A 5J7EA 3LR4A 4HY8A 4E04A 1LSWA 4HH2A 4HNBA 2K2NA 4LRXC 4LPZA 2KOIA 2EA9A 1DP8A 3KYZA 3PYPA 4DJ2A 4I38A 4HJ3A 2KDKA 2W3FA 1H8MA 1W63Q 2O99A 4I3IA 2M7VA 4DMZA 3A0VA 3E0YA 2M1CA 3ULFA 3KSIA 1F98A 2YKFA 4Y2FA 3CAXA 2PDRA 3EGDC 2PT7A 3F1OB 3MXQA 2ZOHA 4XT2B 3NJAA 4B9OA 4I39A 3S7PA 3GDIA 1MZUA 3KSGA 5AVFA 4BBVA 2OAP1 1OPXA 1XJ2A 4I5SA 1JNUA 3TJZC 4BBUA 3OCLA 5TBMB 4KQDA 1BYWA 4HIAA 2VV6A 1TS6A 4KUKA 1WA9A 2IA2A 3BJNA 4WEJA 1MC0A 3H7WB 2JKTM 3OBFA 3E4OA 3T4LA 1GSVA 4K08A 2PYPA 1G6OA 1P9RA 4LLOB 3LR5A 3CLOA 2XA7M 2OOLA 4ARZB 5HWTA 4IHQA 3C38A 2V1BA 2PD7A 3VV4A 2O9AA 3PBQA 3PR6A 4DN0A 1NLZA 3T4OA 3E4QA 4BMWA 1P97A 2PD8A 3IS2A 2VGLM 2W1TB 4NXEA 1UWPX 4I3AA 3EWKA 4BBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HPF A;  2Y79 A;  3IBJ A;  4EUV A;  5C5K A;  5HL6 A;  4PAU A;  3MMH A;  3R4K A;  2GX5 A;  5L8M A;  3E98 A;  2W3H A;  2KLI A;  3W2Z A;  3RFB A;  3CIT A;  4Q0I A;  4MDZ A;  2LB9 A;  4R6L A;  3KO6 A;  3KSH A;  4O8G A;  4EU0 A;  5HPI A;  4MCW A;  3NOU C;  4E04 A;  4IUK A;  2LB5 A;  4ETZ A;  2O9B A;  2K2N A;  2VEA A;  4LRX C;  5TJJ A;  3G6O A;  2KOI A;  4Q0H A;  2W3E A;  4YOF A;  2W1T A;  2W3F A;  3O5Y A;  4LRZ E;  5K5B A;  4O01 A;  5AJG A;  2O99 A;  2M7V A;  1YSP A;  4DMZ A;  3C2W A;  3E0Y A;  3DBA A;  3NHQ A;  3KSI A;  4IJG A;  2O0Y A;  2W3G A;  3S7O A;  4RQ9 A;  2VKS A;  4YNR A;  1YKD A;  4QPR A;  3EEA A;  2ZMF A;  4Y2F A;  3LFV A;  4Y3I A;  2XRO A;  4MMN A;  4G3K A;  3NOP C;  4MN7 A;  4ME4 A;  2QYB A;  3S7P A;  3TRC A;  3KSG A;  3D3O A;  5LBR A;  2HGV A;  4G3W A;  2XSS A;  2B18 A;  3CI6 A;  1STZ A;  4G3V A;  4Y5F A;  3KSF A;  4ETX A;  4GLQ A;  2VZW A;  2G7U A;  1TD5 A;  3HCY A;  4O0P A;  2IA2 A;  2XRN A;  3BJN A;  1MC0 A;  4LRY C;  3OBF A;  4R70 A;  5I5L A;  3IBR A;  4CQH A;  1TF1 A;  3OOV A;  4GW9 A;  2O9C A;  1ZTU A;  1VHM A;  1YSQ A;  2M7U A;  3NOT C;  3MQ0 A;  4Q0J A;  2OOL A;  2VJW A;  4ZRR A;  2Y8H A;  4IUH A;  5DFX A;  3VV4 A;  2O9A A;  2W3D A;  3S7Q A;  4Z1W A;  4DN0 A;  3ZQ5 A;  3S7N A;  4FOF A;  1F5M A;  1MKM A;  3K2N A;  4BWI A;  2W1T B;  2W1R A;  2K31 A;  5HSQ A;  5DFY A;  3MF0 A; 
#chains in the Genus database with same CATH topology
 1Z6F A;  1KVM A;  2XA7 S;  3IH9 A;  1OTD A;  1WE4 A;  5EPH A;  3LIC A;  1KE4 A;  1S1Y A;  3AGE A;  1N4O A;  4ID4 A;  2Y91 A;  1SKO A;  1RCJ A;  3BM6 A;  4IVK A;  5FDS A;  1Y4O A;  2XLN A;  3KSH A;  4CPK A;  4YFM A;  2ZLY A;  2BAS A;  4Q0H A;  3NDE A;  1FOF A;  1HZO A;  1FCN A;  1IYS A;  3LIB A;  2HDR A;  3BFG A;  2ZMV A;  1CK3 A;  2WGW B;  2I9V A;  2O0Y A;  1WYC A;  2W0N A;  1L2S A;  3HUN A;  4S2K A;  3PBN A;  3MKF A;  3TG9 A;  2P74 A;  3HBR A;  5A91 A;  3PBO A;  4MN7 A;  1VQQ A;  4OON A;  3W4O A;  1YLT A;  2JBF A;  2PBY A;  2ZC6 B;  3JVV A;  4JF4 A;  4F3L B;  2H5S A;  3A0R A;  4CLC D;  4S2P A;  4WZ5 A;  2VZW A;  4H8R A;  3FKV A;  4O0P A;  4CJN A;  3ZFZ A;  5FQI A;  3ITA A;  1LL5 A;  2J7V A;  5EM0 A;  1YLP A;  3G32 A;  3OLO A;  1PI4 A;  1ZC2 A;  3BW6 A;  2P9V B;  1W63 M;  1W8Y A;  3TOI A;  4DDY A;  2FH5 A;  3WS2 A;  4FOF A;  5I94 A;  4JF5 A;  5TBM A;  3IX8 A;  4GHI A;  5M1A A;  5F69 A;  3HJK A;  4UEY A;  3JVU A;  3UNW A;  2INW A;  4N1H A;  1OJG A;  4GNU A;  3W2Z A;  4MDZ A;  4FCF A;  4PKY G;  3BEB A;  3VSK A;  4Z9Q A;  5F68 A;  3ICY A;  3CPT A;  4ETZ A;  5TFQ A;  5EVI D;  4E3J A;  5J4E A;  4RX2 A;  1VEU B;  3CJM A;  3DTI A;  2W1T A;  4QHC A;  3LI8 A;  3EOI A;  1F9I A;  3QHY A;  2A49 A;  3N4I A;  4PHT A;  3P7N A;  2G2W A;  2VGL S;  5U47 A;  4BJP A;  1YQS A;  2JKR M;  2WAD A;  3LI9 A;  2ZOI A;  4HES A;  4S2O A;  4OQ0 A;  3FG8 A;  3UB8 A;  3NY4 A;  4WMC A;  2QYB A;  2WKH A;  4WL9 A;  3PXP A;  3QP5 A;  5DKK A;  2P08 A;  2ZM2 A;  3JPU A;  1L0G A;  1XKZ A;  4Y0O A;  4E3I A;  5A93 A;  5M19 A;  4R3A A;  1NLY A;  4DXB A;  5IU1 A;  3HCY A;  1YT4 A;  4LRY C;  3IBR A;  3OPH A;  1H5X A;  5L2F A;  2ZBB A;  1LL9 A;  2VK3 A;  3EQV A;  4H6J A;  4LV2 A;  5G4Y A;  3W4P A;  4DRT A;  4YIN A;  1MKM A;  4JGR A;  1L0E A;  3FV7 A;  3FPW A;  4X53 A;  4GD6 A;  3C7V A;  3B47 A;  3IBJ A;  3RXW A;  1KE3 A;  4LCL A;  4OLD A;  3ISG A;  3SS5 A;  3T4J A;  3UMD A;  3UME A;  1ERO A;  3P01 A;  4Q0I A;  1SCW A;  5EVE A;  3ZG9 B;  3KO6 A;  3ZCZ A;  4O8G A;  3ITB A;  4WEL A;  2XGN A;  5IS1 A;  1NZU A;  2PYR A;  3A3J A;  4PM8 A;  4AFI A;  3ZVW A;  3ZNY A;  2XEP A;  1DJA A;  4NXB A;  3M2K A;  2HJ9 C;  1A0K A;  1GHM A;  2OSU A;  1TS8 A;  4HBT A;  3LID A;  3BFF A;  3LEZ A;  3NOP C;  2V8F A;  1BT5 A;  1T1B A;  1MWS A;  2XF3 A;  2BLS A;  2JC7 A;  5CRF A;  1K25 A;  5E2H A;  3A0S A;  4WBG A;  1N9L A;  3TSG A;  5FAP A;  2AVX A;  4GLQ A;  4KQO A;  3BFC A;  2QZ6 A;  1EI5 A;  3V3S A;  1JVJ A;  2PR5 A;  3SW1 A;  4NEE D;  3O88 A;  3U2A A;  1KGE A;  3VFH A;  3S7N A;  2B5R A;  1F5M A;  3LIE A;  1GA9 A;  2HP9 A;  2A24 B;  2ZL1 A;  4X68 A;  2JKG A;  2IWB A;  3MFD A;  4JKT A;  5E2F A;  1LT0 A;  5FAO A;  2BTF P;  1K55 A;  4EXO A;  1NWZ A;  4BD0 A;  4JGQ A;  4KZ4 A;  3LIF A;  3T1S A;  1XGJ A;  4B93 A;  3ZG7 B;  4Y0U A;  2GJ3 A;  1TDG A;  4DE0 A;  1LSW A;  4NG2 A;  2Y2K A;  4OPZ A;  3SS4 A;  1YMS A;  4DJ2 A;  3KYZ A;  3PYP A;  4ESP A;  2M7V A;  4DMZ A;  3E0Y A;  2X71 A;  2Y2Q A;  3KSI A;  2EFX A;  4X55 A;  4KZ8 A;  3EGD C;  3MXQ A;  2ZOH A;  4N92 A;  5KZH A;  3NJA A;  4B9O A;  5EOE A;  5GLD A;  3KSG A;  4BQM A;  3IF5 A;  5GLC A;  4X6T A;  1S0W A;  2JE5 A;  4I5S A;  1PWC A;  4BBU A;  3OCL A;  4UHU A;  2VV6 A;  4R1G A;  5CHM A;  4KUK A;  1WA9 A;  3WRT A;  3ZHH A;  3T4L A;  4K08 A;  3SH9 A;  4E3N A;  1JTG A;  3LR5 A;  3CLO A;  1ZG6 A;  2OOL A;  4ARZ B;  2A3U A;  2RCX A;  2V1B A;  5GHY A;  3M6B A;  4OP8 A;  3N7W A;  4DN0 A;  3MXR A;  3T4O A;  4P6B A;  2PD8 A;  1Z09 A;  3BLM A;  1PYY A;  2K31 A;  2DNS A;  1AWI A;  4PM7 A;  1M6K A;  3L7H A;  3VOL A;  2ZD8 A;  3C8C A;  2W3H A;  5DF8 A;  3H82 A;  3BY9 A;  4IVI A;  2Q0O A;  4EU0 A;  4HP9 A;  3OCN A;  3UPO A;  1W8Q A;  4MBH A;  4IUK A;  4GOG A;  2O9B A;  4OPY A;  4OQH A;  5TJJ A;  1I2S A;  2HDS A;  3G30 A;  5JYP A;  3G6O A;  4JPM A;  3BLS A;  2Z2M B;  3B42 A;  3L9K A;  4HP4 A;  5AJG A;  2D01 A;  4QWO A;  3NIA A;  1E3U D;  5EE8 A;  2KX6 A;  2VKS A;  5HDC A;  4X56 A;  3TE8 A;  1SHV A;  1LSX A;  1KE0 A;  3LFV A;  1G68 A;  1EW0 A;  2VGJ A;  3OPR A;  1UGU A;  5FDH A;  2L0W A;  4JXW A;  3EEH A;  5FQQ A;  3QNC A;  4N1X A;  3N8R A;  3ZG0 A;  2R78 A;  2HP5 A;  1S1Z A;  1TD5 A;  4HJ4 A;  2D02 A;  4EV4 A;  3QP1 A;  3GRJ A;  3OC2 A;  3HVF A;  4GW9 A;  2O9C A;  1K56 A;  3D72 A;  1ZTU A;  1VHM A;  4ZJ3 A;  4KG5 A;  3F1O A;  2P04 A;  1UWN X;  5G18 A;  4XT2 A;  3BQA A;  2OWH A;  5FAQ A;  4GS9 B;  4IUH A;  2EWV A;  5DFX A;  2W3D A;  4WM9 A;  1TS7 A;  3NUL A;  2GNX A;  3VOZ A;  3CUE A;  4HI4 A;  1D7E A;  1OT9 A;  5DFY A;  5F6A A;  3CWF A;  1K56 D;  5C5K A;  3VP3 A;  2WKP A;  1J9M A;  1PZO A;  4DXC A;  2WZZ A;  5F83 A;  5HD5 A;  3G2Y A;  3RFB A;  1D06 A;  4JBF A;  1BLC A;  5IHV A;  5HWV A;  5KMW A;  3F1P B;  3IXB A;  4DJ3 A;  1XX2 A;  2Y2I A;  2QHK A;  4DE2 A;  2VEA A;  5DJU A;  4LRZ E;  5FQK A;  4WEK A;  2ZQ7 A;  3C2W A;  1G5U A;  3VFF A;  4E3O A;  3AGD A;  1GSW A;  2ZQA A;  2WKI A;  4QPR A;  2CMN A;  2XRO A;  5CGW A;  1VET B;  5J3W A;  2NUP C;  2QJ5 A;  3VSL A;  4UA9 A;  4MN5 A;  2Q9N A;  3D9Y A;  4KZ3 A;  4JGP A;  3T4T A;  2HGV A;  4G3W A;  1JWP A;  2Y2J A;  3CHW P;  1S6R A;  5FL3 A;  1O07 A;  3CG5 A;  1PWG A;  4QY6 A;  3GTC A;  3F1N B;  3PAE A;  2I72 A;  5DKL A;  2VA0 A;  4PM9 A;  3KSF A;  2R9W A;  3GSG A;  2ZM8 A;  2HPB A;  4II7 A;  2WGW A;  3HLB A;  4CLC E;  4MLL A;  1T1C A;  1CEF A;  2XQZ A;  1YLJ A;  4MN6 A;  3IF6 B;  2ZQ9 A;  3MSH A;  3P98 A;  4KG2 A;  2WAE A;  5FI2 A;  5DJT A;  2RL3 A;  4CLC B;  4HQA A;  5FI6 A;  5L10 A;  4R23 A;  3VOY A;  3WS5 A;  2PAV P;  3P09 A;  2BG1 A;  3SZT A;  4P6Z M;  4F3L A;  1MXO A;  2H0Y A;  3MF0 A;  4S2I A;  4LV0 A;  2Y79 A;  5EVL A;  2V0W A;  4EQI A;  4WYY A;  4NXF A;  2H10 A;  4L9G A;  2GX5 A;  2KLI A;  2HDU A;  1M40 A;  3CIT A;  4P6Z S;  4R6L A;  2P9V A;  1DP6 A;  3UE6 A;  3OPL A;  4B88 A;  4JLF A;  1IKG A;  3Q82 A;  2LB5 A;  1XFQ A;  3E2K A;  2YKH A;  5CEC A;  2V9A A;  3M6H A;  5CER A;  1OTA A;  3FWL A;  4HEF A;  4OLG A;  4IBX A;  1GCE A;  4RX3 A;  1G6A A;  2PRF A;  3LR3 A;  3HJI A;  4GHI B;  3LEQ A;  2W3G A;  4XXR A;  4RQ9 A;  4UAA A;  3VE3 A;  5EVI B;  4OH0 A;  3EEA A;  5DVA A;  4MBK A;  3UY6 A;  1YPR A;  1XXM A;  5KSC A;  4ME4 A;  2DRW A;  3QP4 A;  1FR1 A;  1OTB A;  3A3E A;  3EQU A;  1VEU A;  1OTE A;  3UE0 A;  3IS2 B;  3CI6 A;  1SDE A;  1DJB A;  2ZQD A;  4ETX A;  1FCO A;  2HDQ A;  4BEN A;  2W27 A;  1K38 A;  3UDX A;  4CQH A;  1TF1 A;  1P9W A;  3B3X A;  2Y2P A;  1T18 A;  3HLE A;  3IXD A;  1LSV A;  2VJW A;  1IEL A;  2X02 A;  3KX0 X;  5EV0 A;  3ZQ5 A;  4RA7 A;  4UA6 A;  1PZP A;  4DKI A;  3LYX A;  1FQG A;  3IXG A;  1K55 C;  2HV1 A;  4WMC D;  2L1M A;  4M3K A;  4LEN A;  1XJ3 A;  3MMH A;  1NRJ A;  2ZC5 B;  5GLB A;  1MWR A;  1YMX A;  1FIL A;  3SH8 A;  2GZA A;  4EES A;  4LCM A;  1P0Z A;  3LR4 A;  4A5R A;  1CI8 A;  1SZV A;  4HH2 A;  3MZD A;  2W3F A;  5FQ9 A;  3T1R A;  1HVB A;  2O99 A;  3IHB A;  4GB7 A;  1TDL A;  4O7D A;  3E2L A;  4Y2F A;  4JF6 A;  3N8S A;  2PT7 A;  3IWO A;  3S7P A;  3V5M A;  3GDI A;  4QY5 A;  4D60 A;  5AVF A;  3QP8 A;  2PU2 A;  4OPR A;  1TVF A;  4BBV A;  1I5Q A;  1JNU A;  3TJZ C;  3O87 A;  2IA2 A;  3H7W B;  2Y59 A;  3OBF A;  4KEN B;  4KZB A;  2Y2G A;  1G6O A;  1ZG4 A;  4LLO B;  3DTK A;  3FYZ A;  3RXX A;  4IHQ A;  3C38 A;  3N8L A;  1BLS A;  3PBQ A;  3PR6 A;  4R3B A;  1NLZ A;  3VP4 A;  1Q2P A;  3E4Q A;  1P97 A;  4HBU A;  4KQQ A;  4WZ4 A;  4KZ6 A;  1RGZ A;  4EUV A;  3HLC A;  1YLW A;  3GV9 A;  4GDN A;  1MPL A;  4PAU A;  3IX3 A;  1LHY A;  2A2L A;  3UB9 A;  1NXY A;  1MY8 A;  3ZDJ A;  1NRF A;  4JXV A;  1K54 A;  1Y28 A;  3UB7 A;  2EXB A;  1OT6 A;  4YOF A;  2HZ5 A;  3LUQ A;  2IWD A;  2ZQC A;  1D1J A;  4R4R A;  4HH3 A;  1W7F A;  2Z6D A;  1XP4 A;  1MWU A;  4PMA A;  1I2W A;  3EGX C;  3GVB A;  1J3W A;  1YKD A;  4L9F A;  5HFO A;  4Y3I A;  5FAS A;  3UPP A;  2QKP A;  1BTL A;  1FSW A;  2V0U A;  3H9W A;  4NK3 A;  4YWZ A;  3WRZ A;  5CGX A;  1FR6 A;  4E3L A;  3Q07 A;  1EWZ A;  2WK0 A;  2WYX A;  1K6R A;  2V1A A;  3SS3 A;  2XD1 A;  4OKP A;  4DE1 A;  1RP5 A;  4LGW A;  5AQB A;  3DTM A;  3UPN A;  1OJ5 A;  4DE3 A;  4KQR A;  3CUE C;  1G28 A;  1N9B A;  5CHJ A;  5F5Y A;  4EER A;  4GN2 A;  4Z1W A;  2NUT C;  3S7Q A;  4FD8 A;  3R7W B;  1K4F A;  3PHY A;  3BEC A;  4EW7 A;  3QP6 A;  4BLM A;  1PNE A;  2XFS A;  5IT5 A;  4S2N A;  3N6I A;  3R4K A;  4BL3 A;  3T4K A;  3W4Q A;  3Q7V B;  2WKQ A;  5CTN A;  1S66 L;  4WLA A;  1FCM A;  4ARZ A;  3VE4 A;  2Z6C A;  4EEP A;  3HUO A;  4FH2 A;  4XUZ A;  1MBL A;  5DF9 A;  2B02 A;  4OOL A;  3KYQ A;  4JXG A;  1PRQ A;  1HD8 A;  1KVL A;  3UDF A;  4C6Y A;  3C7U A;  3NHQ A;  5FA7 A;  3HUM A;  3NDG A;  3C4P A;  4YNR A;  1OTI A;  3IQA A;  3T1Q B;  1IYP A;  2VV7 A;  2ZJ9 A;  1O7E A;  3WS1 A;  5F1F A;  1TS0 A;  4FH4 A;  4Q8I A;  3ZNT A;  3FPV A;  1XA7 A;  5HAP A;  3GEC A;  3K3D A;  2FFY A;  4QJG A;  4U3T A;  5I5L A;  5DTS A;  4OVD A;  4GDB A;  2P7J A;  3LCE A;  3UDI A;  5F1G A;  5AVE A;  2J8Y A;  1H8Z A;  3ZYT A;  5CHU A;  3QP2 A;  4F94 A;  2K7S A;  5AQA A;  5DTT A;  3E4P A;  2B95 A;  4KG6 A;  5FI7 A;  3NBL A;  2Y4A A;  4S2L A;  1YM1 A;  3FKW A;  1DY6 A;  1SDN A;  1IYQ A;  4GJ4 A;  2EX2 A;  3MQQ A;  2FZ0 A;  2PU4 A;  2WGI A;  1K4E A;  3T4Q A;  3PBR A;  1ES2 A;  1MWT A;  2JN7 A;  1HLU P;  4EWF A;  3IHA A;  5CTM A;  4GS9 A;  2VV8 A;  2J9P A;  2W3E A;  3RJU A;  1FIK A;  5JYO A;  4N9L A;  3AGF A;  5FSR A;  3MFX A;  2OWJ A;  2Z2L B;  1Y54 A;  5A92 A;  1PFL A;  2FFF B;  2ZC7 A;  5E2G A;  3S7O A;  3A3I A;  1IOU A;  5AQ9 A;  4R0Q A;  1LL8 A;  4MBF A;  4MMN A;  1ERQ A;  3FC7 A;  3VMA A;  4G3K A;  3F1P A;  5A90 A;  4OP5 A;  1ERM A;  4FSF A;  2DMW A;  1N9N A;  2J3W A;  1JTD A;  2B18 A;  2GDN A;  2QPN A;  2PR6 A;  4G3V A;  3UO9 A;  1IEM A;  3NEC A;  5FAT A;  5FEF A;  1T1A A;  4MEZ A;  2V2F F;  1SKO B;  1MKI A;  1VET A;  1YSQ A;  3G4P A;  1K57 C;  4GKU A;  1VM1 A;  4KZ9 A;  4Q0J A;  4KZ5 A;  4B4Z A;  2OLV A;  2XD5 A;  3GQZ A;  5HD3 A;  3IXH A;  1L3L A;  5J8X A;  2H28 A;  1T19 A;  3U4L P;  4EBL A;  4NXG A;  1KDW A;  2L4R A;  5HW3 A;  1CF0 A;  2W1R A;  3F1N A;  4ZJ2 A;  4D2O A;  5HSQ A;  5KSH A;  1BLH A;  1U60 A;  4R38 A;  3VP0 A;  4KZA A;  4NET A;  4NKP A;  5GLA A;  5HL6 A;  3SOI A;  1DRM A;  3IF6 A;  3RTY A;  3MJQ A;  4CLC A;  1ES3 A;  4MCW A;  5E2E A;  4E04 A;  2UV0 E;  2DCF A;  1BLP A;  2J9O A;  4HNB A;  4LRX C;  5CXW A;  2EA9 A;  4X1L A;  4ZAM A;  3CZD A;  4MNR A;  2KDK A;  4OQG A;  1ESI A;  2Y2N A;  4I3I A;  1BUE A;  3A0V A;  3ULF A;  2ZC3 B;  5CEB A;  2YKF A;  3DWK A;  3CAX A;  2EX6 A;  1TEM A;  1MZU A;  1AXB A;  1E4D A;  1H8Y A;  4Y0T A;  3PAG A;  5TBM B;  4KQD A;  1BYW A;  4P0M A;  4HIA A;  4X69 A;  3C4O A;  4Y13 A;  3ZG5 A;  2X01 A;  5GL9 A;  4WEJ A;  3BJN A;  1MC0 A;  1KDS A;  3NC8 A;  4X25 A;  3FZC A;  3S1Y A;  4E3M A;  5EVI A;  2PYP A;  4Y17 A;  4LV3 A;  1CEG A;  5HWT A;  3W8K A;  2Y2H A;  2PD7 A;  5AQ7 A;  5D3O A;  3Q1F A;  1ZKJ A;  3CPT B;  4K0W A;  3IS2 A;  4DDS A;  5E43 A;  2VGL M;  2W1T B;  1Q2Q A;  1UWP X;  4I3A A;  4GD8 A;  1KGF A;  4QB8 A;  5A8B A;  5KIZ A;  5HPF A;  2QWS A;  5GHX A;  1E25 A;  1K54 C;  5L8M A;  2Y2L A;  3RH8 B;  2UWX A;  3T12 B;  2E8I A;  3TW8 A;  3G31 A;  1H0M A;  2LB9 A;  4PM5 A;  1K57 A;  5EFW A;  2OLU A;  2PHY A;  2J3T C;  4KUO A;  3WWX A;  4BL2 A;  1X0O A;  4PKY A;  3S22 A;  3QNB A;  2Y2M A;  4K91 A;  3BFE A;  4E3K A;  1SKF A;  1K0K A;  2VGK A;  3O5Y A;  4PPR A;  3MS6 A;  5HDD A;  1YSP A;  2EXA A;  1YLZ A;  4IED A;  3DBA A;  3KYE A;  1S67 L;  4EBP A;  1XPB A;  1GHP A;  5HWW A;  5HAR A;  3B33 A;  2V8C A;  3Q7Z A;  1ACF A;  3UN7 A;  1GHI A;  1PW8 A;  1ZHH B;  3UB6 A;  1ODV A;  3MBZ A;  2VLG A;  4H6J B;  2MJ6 A;  3TRC A;  1IFQ A;  5LBR A;  2XSS A;  2JHE A;  2C6W B;  4Y15 A;  1STZ A;  3LGO A;  1N9O A;  2VX8 A;  3BY8 A;  3O86 A;  1IKI A;  2G7U A;  2ACG A;  4E6X A;  2XK1 A;  1BSG A;  3MZF A;  1QME A;  3IX4 A;  3OOV A;  1XA1 A;  5EM1 A;  3MQ0 A;  5HZH A;  2QMI A;  3T1X A;  3HLW A;  2JKF A;  1LLB A;  3O3V A;  4Y7P A;  4S2N C;  4EUZ A;  1XJ6 A;  3LR0 A;  3DWZ A;  2WGV A;  4R3J A;  4HJ6 A;  4OOM A;  4C3Q A;  3H7W A;  3HLD A;  4OOY A;  4IBR A;  4UQI M;  2H0T A;  3DAV A;  3V3R A;  3PBT A;  3VP1 A;  5HPI A;  3UE3 A;  3NOU C;  4UA7 A;  1FSY A;  1PI5 A;  1GSX A;  1BUL A;  3NI9 A;  4UQI S;  4HOI A;  3V50 A;  2XFT A;  5HL1 A;  2XR0 A;  1CJF A;  2JCH A;  3IWQ A;  4R4S A;  3PTE A;  1LI9 A;  4C75 A;  4IJG A;  2JKT I;  4RYE A;  2EX9 A;  4X1M A;  2ZMF A;  3Q81 A;  4HHD A;  3T4S A;  2A24 A;  3NCK A;  1V9Y A;  4FUW A;  3MR0 A;  3D3O A;  4P85 A;  2ZMA A;  5HAI A;  1ESU A;  3OPP A;  4WUJ A;  4OQI A;  2ZL1 B;  3C5A A;  5BOH A;  5G4Z A;  5HDS A;  2XRN A;  5CX7 A;  4QD4 A;  1BZA A;  4DF6 A;  2WKR A;  4L9E A;  3PBS A;  5GHZ A;  4LFU A;  2WAF A;  2M7U A;  1PWD A;  2QJ7 A;  3NOT C;  2J3T D;  2HP6 A;  2HF6 A;  4E6W A;  1PW1 A;  4FTX A;  1KGG A;  5HAQ A;  3GR2 A;  3V39 A;  1RGY A;  4I3J A;  2Y2O A;  1YLY A;  3K2N A;  1LI0 A;  2ZQ8 A;  2ZM0 A;  3BYD A;  1KOU A;  1XJ4 A;  3V67 A;  3A3D A;  3MKE A;  1HTZ A;  2XH9 A;  1QMF A;  1NJ4 A;  3BQ8 A;  5DF7 A;  3A3F A;  2XDM A;  3LY4 A;  3DW0 A;  4K0X A;  3WS4 A;  4ZBE A;  3IWI A;  1NYM A;  1L0F A;  2Y55 A;  5M18 A;  1CQA A;  3R7W A;  4U0T A;  1W5D A;  5L09 A;  1GA0 A;  1WYB A;  3OZH A;  5K5B A;  4O01 A;  3IH8 A;  4S2J A;  2IWC A;  1NZO A;  3LY3 A;  4B4X A;  3Q7V A;  3SH7 A;  2CC1 A;  3MXS A;  4GCZ A;  1CI9 A;  3HL9 A;  1PIO A;  2PBD P;  1ES5 A;  2OAQ 1;  4EBN A;  5MC7 A;  1DP9 A;  4XUX A;  4RVA A;  3MZE A;  4JGO A;  5EOO A;  4L0L A;  5L07 A;  3JYI A;  3BFD A;  4JXS A;  3BWL A;  4Y5F A;  3MQO A;  5CED A;  4U0X A;  1H3Q A;  1K6S A;  3UE1 A;  2HJE A;  3BRM A;  4EQ1 A;  4WN5 A;  4R70 A;  2Q9M A;  3WS0 A;  1NYY A;  2C5W B;  2R9X A;  1S4S A;  4ZTK A;  3H82 B;  4S2M A;  5FQJ A;  1V9Z A;  2WKE A;  1XFN A;  5EEC A;  3UB5 P;  1JWZ A;  2Y8H A;  4ZRR A;  5F82 A;  3G34 A;  4EEU A;  2V20 A;  3C30 A;  1XGI A;  2J80 A;  1E3U A;  4BD1 A;  2OV5 A;  1YAX A;  3LO7 A;  4BWI A;  4EET B;  1VB6 A;  4OPQ A;  3IF6 C;  1W79 A;  1ONG A;  3G2Z A;  3LIA A;  1ONH A;  3HLF A;  3ZGA B;  4CLC C;  2EWW A;  3GMW A;  4WF0 A;  1S4R A;  3E98 A;  2JKR I;  3DTE A;  3K3C A;  5EUA A;  3HLG A;  1ALQ A;  4LV1 A;  2V1Z A;  4M4X A;  4ZDX A;  2WUQ A;  3T50 A;  5J7E A;  3CMZ A;  4HY8 A;  5TGF A;  2E8J A;  1DJC A;  5FEG A;  4N9K A;  4PM6 A;  2K2N A;  4LPZ A;  2KOI A;  1JWV A;  1DP8 A;  4I38 A;  4HJ3 A;  4QU3 A;  4WZ5 C;  1H8M A;  1W63 Q;  3HRE A;  3G35 A;  1NY0 A;  2M1C A;  5HX9 A;  2EX8 A;  1L0D A;  1F98 A;  3IT9 A;  5CGS A;  1C3B A;  2PDR A;  4ZJ1 A;  3F1O B;  5FQM A;  4XT2 B;  4I39 A;  4P87 A;  1OME A;  2WZX A;  2OAP 1;  1OPX A;  1XJ2 A;  5EVI C;  1TS6 A;  3ZVT A;  2JKT M;  3E4O A;  1GSV A;  2EFU A;  1P9R A;  4GZB A;  5TR7 A;  5DTK A;  1ES4 A;  3D4F A;  2XA7 M;  3VP2 A;  3VV4 A;  2O9A A;  2G2U A;  1IYO A;  2ZC4 B;  4KZ7 A;  3S4X A;  1F2K A;  3ZG8 B;  4BMW A;  3I7J A;  3M2J A;  4NXE A;  3EWK A;  4BBT A; 
#chains in the Genus database with same CATH homology
 5A8B A;  5KIZ A;  2XA7 S;  5HPF A;  1OTD A;  2QWS A;  3LIC A;  4EUV A;  1S1Y A;  3VOL A;  4PAU A;  5L8M A;  3RH8 B;  3C8C A;  2A2L A;  2W3H A;  3UB9 A;  3TW8 A;  3H82 A;  3BY9 A;  2LB9 A;  3KSH A;  4EU0 A;  4HP9 A;  3OCN A;  5EFW A;  2PHY A;  1Y28 A;  4IUK A;  2J3T C;  4KUO A;  3UB7 A;  2O9B A;  1X0O A;  4PKY A;  5TJJ A;  2BAS A;  3G6O A;  4Q0H A;  1OT6 A;  4YOF A;  3B42 A;  3O5Y A;  4HP4 A;  3LUQ A;  3LIB A;  5AJG A;  5HDD A;  1YSP A;  4HH3 A;  2D01 A;  2Z6D A;  3DBA A;  1S67 L;  2ZMV A;  3EGX C;  2I9V A;  5HWW A;  2O0Y A;  2W0N A;  3B33 A;  2KX6 A;  2VKS A;  1YKD A;  4L9F A;  5HDC A;  3TE8 A;  3PBN A;  4Y3I A;  1LSX A;  3LFV A;  1EW0 A;  1ZHH B;  3UB6 A;  1ODV A;  2QKP A;  3PBO A;  4MN7 A;  1UGU A;  2VLG A;  4H6J B;  2V0U A;  3H9W A;  2MJ6 A;  3TRC A;  4YWZ A;  1IFQ A;  2L0W A;  3EEH A;  5LBR A;  3JVV A;  2XSS A;  2JHE A;  1STZ A;  4F3L B;  1N9O A;  2VX8 A;  2R78 A;  3A0R A;  4CLC D;  3BY8 A;  1S1Z A;  2V1A A;  2VZW A;  2G7U A;  1TD5 A;  4O0P A;  4HJ4 A;  2D02 A;  3OOV A;  3OC2 A;  4GW9 A;  2O9C A;  1OJ5 A;  3D72 A;  3OLO A;  1ZTU A;  1VHM A;  3F1O A;  3BW6 A;  2P04 A;  3CUE C;  3MQ0 A;  1UWN X;  1W63 M;  4XT2 A;  3BQA A;  5HZH A;  2OWH A;  1G28 A;  4GS9 B;  4IUH A;  2EWV A;  5DFX A;  2W3D A;  5F5Y A;  4EER A;  1TS7 A;  2FH5 A;  2NUT C;  4Z1W A;  3S7Q A;  3R7W B;  2GNX A;  3CUE A;  4HI4 A;  4FOF A;  1D7E A;  3PHY A;  1OT9 A;  4EW7 A;  5TBM A;  4GHI A;  5F69 A;  3HJK A;  4UEY A;  5DFY A;  5F6A A;  1XJ6 A;  3CWF A;  3JVU A;  3LR0 A;  4HJ6 A;  4OOM A;  5C5K A;  2WKP A;  3H7W A;  5IT5 A;  2INW A;  3R4K A;  5HD5 A;  3T4K A;  4UQI M;  1OJG A;  2WKQ A;  3W2Z A;  1S66 L;  4WLA A;  3PBT A;  3RFB A;  1D06 A;  4MDZ A;  4ARZ A;  5HPI A;  4PKY G;  3UE3 A;  5HWV A;  3NOU C;  3VE4 A;  3F1P B;  2Z6C A;  4EEP A;  5F68 A;  3ICY A;  4DJ3 A;  4ETZ A;  2QHK A;  1GSX A;  2VEA A;  5DF9 A;  5DJU A;  2B02 A;  5J4E A;  4UQI S;  2W1T A;  4HOI A;  4LRZ E;  3LI8 A;  4OOL A;  3EOI A;  3KYQ A;  4WEK A;  1F9I A;  3C2W A;  3NHQ A;  4PHT A;  3P7N A;  1GSW A;  4IJG A;  2JKT I;  2VGL S;  4YNR A;  4BJP A;  2JKR M;  4QPR A;  1OTI A;  2CMN A;  2ZMF A;  2ZOI A;  3LI9 A;  2VV7 A;  2XRO A;  5J3W A;  2NUP C;  2QJ5 A;  3FG8 A;  4MN5 A;  3UB8 A;  4HHD A;  3T4S A;  2QYB A;  4JGP A;  4WL9 A;  2A24 A;  3PXP A;  1V9Y A;  2P08 A;  3MR0 A;  1TS0 A;  3D3O A;  5DKK A;  3T4T A;  2HGV A;  4G3W A;  3FPV A;  5FL3 A;  4R3A A;  3GEC A;  4WUJ A;  3K3D A;  1NLY A;  3F1N B;  5DKL A;  2VA0 A;  3KSF A;  5IU1 A;  5G4Z A;  3HCY A;  5HDS A;  2XRN A;  5CX7 A;  4II7 A;  4CLC E;  4LRY C;  1T1C A;  2WKR A;  3IBR A;  4L9E A;  3PBS A;  5I5L A;  4MN6 A;  2ZBB A;  2P7J A;  2M7U A;  2QJ7 A;  5DJT A;  3NOT C;  2J3T D;  3EQV A;  4CLC B;  4HQA A;  5AVE A;  2HF6 A;  4H6J A;  3ZYT A;  5G4Y A;  4I3J A;  2K7S A;  3E4P A;  1MKM A;  3K2N A;  4JGR A;  4P6Z M;  4F3L A;  3FPW A;  1KOU A;  1XJ4 A;  3MF0 A;  4GJ4 A;  2Y79 A;  3B47 A;  3V67 A;  3MQQ A;  2FZ0 A;  2V0W A;  3IBJ A;  4NXF A;  4L9G A;  3T4Q A;  3T4J A;  2GX5 A;  3PBR A;  3BQ8 A;  3UMD A;  3UME A;  2KLI A;  2JN7 A;  3CIT A;  3P01 A;  4Q0I A;  4P6Z S;  4R6L A;  3KO6 A;  1DP6 A;  4O8G A;  3UE6 A;  4GS9 A;  4WEL A;  2LB5 A;  1XFQ A;  3R7W A;  2VV8 A;  2YKH A;  5IS1 A;  2V9A A;  1OTA A;  2W3E A;  2PYR A;  5K5B A;  4O01 A;  3MFX A;  2OWJ A;  4AFI A;  3LR3 A;  3HJI A;  4GHI B;  3S7O A;  2W3G A;  4NXB A;  4RQ9 A;  3VE3 A;  2HJ9 C;  1IOU A;  3EEA A;  4GCZ A;  1LL8 A;  1TS8 A;  4MMN A;  3LID A;  3FC7 A;  4G3K A;  3NOP C;  4ME4 A;  3F1P A;  2K31 A;  2OAQ 1;  1T1B A;  1OTB A;  5MC7 A;  1DP9 A;  3EQU A;  4FSF A;  4JGO A;  4L0L A;  2DMW A;  1N9N A;  2J3W A;  1OTE A;  2B18 A;  3IS2 B;  3A0S A;  3CI6 A;  3BWL A;  2PR6 A;  1N9L A;  4G3V A;  4Y5F A;  3MQO A;  4ETX A;  4GLQ A;  1H3Q A;  2HJE A;  4KQO A;  1T1A A;  4EQ1 A;  4WN5 A;  4R70 A;  2W27 A;  4CQH A;  1TF1 A;  1P9W A;  1T18 A;  1S4S A;  1YSQ A;  3H82 B;  2PR5 A;  3SW1 A;  1LSV A;  4Q0J A;  2VJW A;  1V9Z A;  1XFN A;  4NEE D;  3KX0 X;  2Y8H A;  4ZRR A;  5HD3 A;  4EEU A;  3C30 A;  3U2A A;  2H28 A;  3ZQ5 A;  1T19 A;  2J80 A;  1YAX A;  3S7N A;  3LIE A;  1F5M A;  4NXG A;  4BWI A;  2L4R A;  3LYX A;  2A24 B;  4EET B;  1VB6 A;  2W1R A;  3F1N A;  5HSQ A;  5KSH A;  2HV1 A;  3LIA A;  4R38 A;  2L1M A;  4CLC C;  4NKP A;  2EWW A;  5HL6 A;  1LT0 A;  1XJ3 A;  3MMH A;  1NRJ A;  1DRM A;  4WF0 A;  1S4R A;  3E98 A;  1NWZ A;  2JKR I;  4EXO A;  3K3C A;  4JGQ A;  2GZA A;  3RTY A;  3LIF A;  4EES A;  4B93 A;  3MJQ A;  1P0Z A;  4M4X A;  4CLC A;  2GJ3 A;  4MCW A;  3T50 A;  5J7E A;  3LR4 A;  4HY8 A;  4E04 A;  1LSW A;  4HH2 A;  4HNB A;  2K2N A;  4LRX C;  4LPZ A;  2KOI A;  2EA9 A;  1DP8 A;  3KYZ A;  3PYP A;  4DJ2 A;  4I38 A;  4HJ3 A;  2KDK A;  2W3F A;  1H8M A;  1W63 Q;  2O99 A;  4I3I A;  2M7V A;  4DMZ A;  3A0V A;  3E0Y A;  2M1C A;  3ULF A;  3KSI A;  1F98 A;  2YKF A;  4Y2F A;  3CAX A;  2PDR A;  3EGD C;  2PT7 A;  3F1O B;  3MXQ A;  2ZOH A;  4XT2 B;  3NJA A;  4B9O A;  4I39 A;  3S7P A;  3GDI A;  1MZU A;  3KSG A;  5AVF A;  4BBV A;  2OAP 1;  1OPX A;  1XJ2 A;  4I5S A;  1JNU A;  3TJZ C;  4BBU A;  3OCL A;  5TBM B;  4KQD A;  1BYW A;  4HIA A;  2VV6 A;  1TS6 A;  4KUK A;  1WA9 A;  2IA2 A;  3BJN A;  4WEJ A;  1MC0 A;  3H7W B;  2JKT M;  3OBF A;  3E4O A;  3T4L A;  1GSV A;  4K08 A;  2PYP A;  1G6O A;  1P9R A;  4LLO B;  3LR5 A;  3CLO A;  2XA7 M;  2OOL A;  4ARZ B;  5HWT A;  4IHQ A;  3C38 A;  2V1B A;  2PD7 A;  3VV4 A;  2O9A A;  3PBQ A;  3PR6 A;  4DN0 A;  1NLZ A;  3T4O A;  3E4Q A;  4BMW A;  1P97 A;  2PD8 A;  3IS2 A;  2VGL M;  2W1T B;  4NXE A;  1UWP X;  4I3A A;  3EWK A;  4BBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...