2HGVA

N-terminal gaf domain of transcriptional pleiotropic repressor cody
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
155
structure length
155
Chain Sequence
MALLQKTRIINSMLQAAAGKPVNFKEMAETLRDVIDSNIFVVSRRGKLLGYSINQQIENDRMKKMLEDRQFPEEYTKNLFNVPETSSNLDINSEYTAFPVENRDLFQAGLTTIVPIIGGGERLGTLILSRLQDQFNDDDLILAEYGATVVGMEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of CodY, a GTP- and Isoleucine-responsive Regulator of Stationary Phase and Virulence in Gram-positive Bacteria
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
molecule keywords GTP-sensing transcriptional pleiotropic repressor codY
total genus 41
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2006-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2hgvA00
4R70A 3EEAA 1YKDA 4Q0JA 3ZQ5A 4G3VA 2K2NA 4ETXA 5TJJA 5LBRA 5DFYA 1TD5A 4Y3IA 5I5LA 5K5BA 3S7NA 3CI6A 4YNRA 2XROA 2VEAA 4MDZA 4MMNA 4GLQA 2HGVA 2W3GA 3KO6A 4YOFA 3HCYA 1YSPA 3IBRA 1VHMA 3OOVA 2G7UA 5HPIA 2KLIA 2GX5A 4ME4A 3NOPC 5HL6A 4Z1WA 3S7PA 2ZMFA 5HPFA 4R6LA 2XSSA 3KSHA 4E04A 5AJGA 5C5KA 3LFVA 2KOIA 3C2WA 4QPRA 4BWIA 4DMZA 4EU0A 2VJWA 4FOFA 5DFXA 3NOTC 3RFBA 4DN0A 3R4KA 4O0PA 3NOUC 4GW9A 3S7QA 4LRXC 1MKMA 2OOLA 4RQ9A 2Y8HA 4CQHA 2O9CA 2LB9A 2VZWA 4IUKA 3IBJA 3D3OA 2M7UA 2VKSA 2K31A 4O8GA 3CITA 3KSFA 4G3WA 3MQ0A 2IA2A 3NHQA 4O01A 2LB5A 3W2ZA 3TRCA 2B18A 5L8MA 4G3KA 4Q0HA 4Y5FA 4IUHA 3DBAA 3MMHA 3S7OA 2O9AA 1F5MA 4LRZE 3E98A 4IJGA 2XRNA 4ETZA 1STZA 4LRYC 2QYBA 3KSIA 2M7VA 2W1TA 3O5YA 5HSQA 3MF0A 3VV4A 2O99A 2W3EA 1ZTUA 3KSGA 2W3FA 3BJNA 3K2NA 2Y79A 2W1TB 3OBFA 1TF1A 4ZRRA 3G6OA 3E0YA 4MCWA 1YSQA 2W1RA 2W3HA 4MN7A 2O0YA 4Q0IA 1MC0A 4EUVA 4Y2FA 2O9BA 4PAUA 2W3DA
chains in the Genus database with same CATH superfamily
3R7WA 2XH9A 3QNBA 4H6JA 4ETXA 3IWQA 1YAXA 3BQAA 1XJ2A 4OPZA 1K6RA 1UWPX 2ZMVA 4KQDA 4N9KA 2R9XA 2G7UA 5DJUA 2BG1A 4XT2B 3T1RA 5HD5A 2WKEA 1ES4A 5AJGA 4BWIA 3SH7A 3A0VA 3ZVTA 4IHQA 3RFBA 3IF6B 3SS3A 5DF9A 3V67A 5HAQA 2OAQ1 4NXBA 5FEFA 1K57C 4HI4A 1K55C 2J3TD 1G68A 1NYYA 4QB8A 1I2SA 3NDGA 3HLDA 3IH8A 5G4YA 1XJ3A 3MQ0A 4NKPA 4E3MA 3TOIA 2LB5A 4OH0A 5IHVA 1GA0A 3T4QA 5L8MA 1MZUA 3Q07A 4R4RA 5HWTA 4WBGA 4WZ5C 1PNEA 4GHIB 4HIAA 3PHYA 5EVIA 1KVLA 2V20A 5E43A 2W3EA 1W8YA 3PBNA 1YMSA 3JPUA 2G2UA 4EV4A 2V8CA 3ULFA 1FCOA 5M1AA 4HH2A 4B88A 1L3LA 3Q7VA 4MN7A 3A3DA 4FUWA 4K0WA 3N8RA 1LL8A 3BWLA 4EUVA 1MWUA 4HP4A 4PAUA 2J3TC 3EEAA 4G3VA 5CERA 4DDSA 5CHMA 1OTDA 4BBUA 2OWHA 2XQZA 4UA7A 2B5RA 4WEKA 5EVIC 4YINA 4EERA 1S1YA 1ZKJA 4HNBA 1BLSA 4E6WA 3DWKA 3F1NA 2ZM0A 4LCMA 2ZM8A 1OTIA 4NEED 1QMEA 2E8IA 2XD5A 3F1NB 1WYBA 1TS0A 1DJAA 4L0LA 1OJ5A 3NI9A 3IHAA 1JTGA 1E4DA 2VV8A 2OOLA 3LGOA 3CMZA 5F5YA 1XPBA 4X1MA 4BL3A 4GDBA 4WELA 1U60A 3PBTA 1O07A 2ZC6B 2VGLS 4R3JA 1ERMA 4KZ6A 4IEDA 2BTFP 3ZGAB 4G3KA 1IFQA 3T1XA 4QD4A 3DBAA 4UQIS 1TEMA 2ZMAA 5G4ZA 1CEGA 2WGVA 4GD8A 2W1TA 1FR1A 3BECA 2V9AA 2I9VA 3HLGA 3S1YA 4PM9A 5FI6A 5HDDA 3Q1FA 2VGJA 1HLUP 3JYIA 4S2KA 5JYPA 1L2SA 2QZ6A 5TFQA 1DJBA 2PHYA 1DRMA 4QWOA 1CJFA 3TE8A 2O9BA 1CF0A 4OOLA 3LR4A 5FASA 2V8FA 4R70A 4HESA 3AGFA 4NXEA 5TJJA 3OPRA 2GDNA 3LY3A 1K4EA 1LSWA 4KUOA 4Y0OA 3N8SA 5HAIA 4CLCE 2VEAA 4IVIA 1H0MA 3AGDA 3HCYA 3ZFZA 2EWVA 1W7FA 4NG2A 1FSYA 3HUNA 2ZMFA 4RYEA 4E3IA 5HPFA 2XSSA 4EU0A 1XP4A 2J9PA 3MXRA 4QY6A 1LI9A 1IKGA 3N6IA 4P0MA 4OKPA 4EBNA 3MFXA 2B95A 4LRXC 1MKMA 2DRWA 1Y4OA 3CUEA 2XFSA 1BLCA 4ZBEA 2VZWA 4R1GA 1MY8A 3V50A 1XA1A 4KZBA 3RJUA 3K3CA 4JF4A 1M6KA 3HLEA 4CPKA 4P87A 3GSGA 2QPNA 1L0FA 3IS2B 3G32A 3UB6A 5U47A 3PTEA 4LV2A 3IS2A 1ZTUA 1LL9A 1K4FA 4HY8A 2JKTM 3TW8A 4Z9QA 2DMWA 1TDLA 4S2LA 3VSLA 1E3UA 1TF1A 4HBTA 1IKIA 1CI9A 4B4ZA 2XA7S 4YWZA 3TJZC 3VOYA 4UEYA 3LI8A 2QWSA 3QHYA 4Q0JA 3V5MA 3UO9A 1KDWA 2WADA 4BD0A 4JGPA 3MQOA 2EXAA 4OQ0A 2QHKA 2UV0E 1ERQA 3NDEA 4KZ4A 5E2GA 5GL9A 3NOPC 1AXBA 1FCNA 4R6LA 3E4QA 2HF6A 4EEUA 3BEBA 3VFHA 4DN0A 5J8XA 4E3JA 1PRQA 3NC8A 5DKKA 4MBFA 2ACGA 3LR0A 3PAEA 2HDRA 3RTYA 5F83A 3W4PA 4CQHA 3T1SA 3A3FA 3O88A 5EV0A 1SKOA 3DTEA 4RVAA 1PW1A 3D9YA 5GHYA 4PMAA 3KYQA 3EQVA 3OPPA 2Y2NA 2WK0A 1SKOB 3IWOA 3VP4A 1IYPA 2ZL1B 2XD1A 2MJ6A 3BFCA 4BBVA 3D4FA 2YKFA 3VP2A 2Z6CA 3IH9A 2H0YA 3UN7A 4MN6A 3E0YA 4Y0TA 3G34A 3MXSA 4ZJ3A 2YKHA 1OJGA 4PKYG 5F68A 2XFTA 1YLWA 1MC0A 2IWCA 4Y2FA 3ZHHA 5GLAA 2WAEA 1ZG4A 2WKQA 4OOYA 1JWPA 1NLYA 2K2NA 4Y17A 2Y59A 4EESA 1MWSA 4LLOB 4DF6A 4MBKA 4D2OA 4KQQA 1I2WA 3UB7A 2DNSA 4EEPA 3G2YA 4MBHA 5KMWA 3FG8A 4KG2A 2Y2LA 3LR5A 3FPVA 5AQBA 2ZC5B 2VA0A 4XUXA 3CPTB 4N1HA 3S7QA 4I3IA 3C7VA 4JGRA 4JBFA 2GJ3A 1K54C 1MWTA 2Y2QA 4HJ6A 3BLMA 4P85A 5EPHA 5HWWA 3IXDA 5FQIA 4ZJ1A 2E8JA 3L9KA 2ZLYA 5EFWA 3VMAA 3VOZA 2HPBA 4A5RA 2OSUA 4F3LA 1BYWA 3S22A 3CHWP 4RX2A 4IJGA 1GHMA 3UMDA 2XLNA 3M2JA 2JKFA 2OLUA 5HARA 3VV4A 2PD8A 2Y79A 3HBRA 4RX3A 3P09A 4I3AA 4ZRRA 3UPPA 3MZDA 2WAFA 3PR6A 4EWFA 3LICA 3SS4A 1GSWA 4HQAA 1OT9A 1NRFA 4GNUA 2ZOHA 5I5LA 4X1LA 5FAOA 3LIEA 1W8QA 4LFUA 1FILA 5TGFA 3P98A 5A8BA 3ITAA 3UDXA 1E25A 1NXYA 2XROA 1D7EA 3DAVA 3B47A 5F6AA 3PXPA 5J3WA 3MJQA 1SCWA 4JXVA 5DVAA 3NULA 3SZTA 3UDIA 4QPRA 3T4KA 2X71A 1T1AA 1JWZA 3FZCA 4PKYA 5FI2A 4JXSA 3FKWA 3W4OA 4DE3A 3OC2A 2P74A 1XX2A 3BFDA 4AFIA 3D3OA 1JNUA 1LL5A 3FC7A 2VKSA 1ONHA 4B4XA 1NZOA 1FR6A 3T4LA 4D60A 1DP6A 2V0WA 1UWNX 3A3JA 4Y0UA 1BUEA 3TRCA 3WS4A 1LSVA 5JYOA 3C7UA 1NLZA 4Y7PA 4KZ3A 1M40A 2JKTI 1OT6A 1BT5A 4OPQA 4LRYC 2QYBA 3O5YA 1S0WA 4IBXA 2VGKA 1PWDA 3MFDA 3BJNA 1YLPA 2WKHA 5HDSA 4JGOA 5CGSA 2W0NA 1W5DA 2Y2JA 4L9EA 1ESUA 3NY4A 4E3NA 4DE2A 1ODVA 1F5MA 1ZG6A 1GSXA 4OPYA 3ZQ5A 4R4SA 4L9GA 4WM9A 2EX8A 5CHUA 5CRFA 1OTAA 3BYDA 5GLCA 2PU2A 5K5BA 1D1JA 4HOIA 4K91A 2ZQDA 2WGWA 4MDZA 1RGZA 3HJIA 4R0QA 4RA7A 3FPWA 3IX3A 1VHMA 5HPIA 3ZYTA 5J7EA 3CUEC 3RH8B 2PU4A 5FAQA 4R3AA 3A0SA 4K0XA 3C2WA 2WGIA 3OCNA 4KQOA 2PRFA 2V2FF 4ID4A 3EGXC 4KZ5A 4GW9A 1K57A 4MEZA 3OPHA 2C6WB 1K38A 1S66L 5CX7A 4XUZA 4ZTKA 3IF6A 4IUKA 2JBFA 1KGGA 1XJ6A 3FV7A 1YLTA 4O8GA 3WS1A 4G3WA 3GQZA 2R9WA 4MLLA 4I39A 5HL1A 4ZAMA 3OCLA 4NXFA 3E4PA 1CEFA 3Q7ZA 1WA9A 5FL3A 1MPLA 4DJ2A 1GHIA 2L0WA 3QP1A 1S67L 4ETZA 3SH8A 4OLGA 3MF0A 4HP9A 4JXGA 4S2PA 5FDHA 3KSGA 2ZL1A 4F94A 2G2WA 2L4RA 1G28A 4HHDA 4EXOA 5EOOA 3BY8A 2HDSA 2JE5A 3WWXA 4EQIA 1H8MA 5EVEA 3R7WB 4JF6A 1IYQA 1YPRA 5KSCA 3ZCZA 4JF5A 2IWDA 4OONA 2Z2MB 5DF7A 2JKRM 4HBUA 4MN5A 4S2IA 2EA9A 3F1OA 4N1XA 4GCZA 4GD6A 3CWFA 3UPOA 3QP8A 4GDNA 5AQAA 5DTSA 2L1MA 2ZBBA 2P08A 4BJPA 3LY4A 2W3GA 1G5UA 3PBQA 4JPMA 2GX5A 2EX2A 3G2ZA 2J9OA 1DP8A 3EGDC 4LENA 4MNRA 2VJWA 1ES5A 3DTMA 3R4KA 4WL9A 2J3WA 1A0KA 4LV1A 1VETA 4OLDA 4IBRA 3G31A 3IBJA 2FFYA 1HTZA 4Q8IA 4GKUA 3HLBA 4S2NA 3BRMA 3OLOA 4LV3A 3LO7A 2C5WB 3B33A 3VP1A 3NHQA 4O01A 2XDMA 2P04A 2Z2LB 4LGWA 5EVIB 3UNWA 3PBRA 4BLMA 2V1AA 3W4QA 1VB6A 4CJNA 4L9FA 3EEHA 1K56A 3CAXA 2EFUA 4GB7A 5KIZA 3N7WA 4WYYA 3A3EA 4JGQA 3VE3A 5IU1A 2PBDP 3C30A 3MZFA 5I94A 4EETB 2NUTC 3UE0A 1N9NA 2KDKA 1KE0A 1SHVA 3A3IA 4PM7A 3PAGA 4ZJ2A 3V3RA 1IEMA 3S4XA 1X0OA 2JCHA 3BQ8A 3MBZA 4KQRA 1OTEA 4YOFA 1YSPA 2A3UA 3N4IA 3KYEA 3E4OA 3AGEA 4I3JA 3LIAA 1BSGA 3MR0A 2EX6A 3LFVA 2H0TA 3GRJA 1W63M 4BQMA 2ZQCA 3NOTC 3SS5A 5MC7A 3HJKA 1D06A 3IF6C 3B3XA 1SZVA 4C75A 2A2LA 4N92A 2K31A 1CI8A 3LI9A 3IXHA 3OZHA 2XA7M 5EVID 1XFQA 3DTIA 2ZOIA 3UPNA 1LT0A 1J3WA 3F1PB 1S1ZA 4M4XA 3UB5P 3MMHA 4I5SA 2Y4AA 5FQKA 4C3QA 3LIFA 1H3QA 5HDCA 1IYOA 2M7VA 3ZG0A 1PI4A 4OPRA 5AVEA 5GLDA 4WF0A 4QU3A 1T19A 3NBLA 3T4SA 2HJEA 3CG5A 3DWZA 3M6BA 4MCWA 5E2EA 1OPXA 3V39A 4EBPA 4WZ4A 5EECA 4OQHA 3SH9A 3JVVA 5LBRA 5DFYA 5GHXA 5HWVA 1K56D 3EQUA 5DF8A 5G18A 3WS2A 4YNRA 2XR0A 4WEJA 4GLQA 4FTXA 1PIOA 2Y2OA 4ME4A 3ZG7B 5HL6A 3W8KA 4HH3A 4CLCB 3WRZA 2D01A 4OVDA 5FAPA 1MBLA 4DRTA 1ESIA 1NWZA 3NOUC 3G30A 4XT2A 3PBSA 5AVFA 4QJGA 2VLGA 3M2KA 3MQQA 3CLOA 2LB9A 4X68A 1K55A 4CLCD 1DY6A 1L0DA 3VP0A 4HJ4A 2IA2A 5F69A 1OTBA 3ZG8B 2OV5A 3UMEA 4P6ZS 4OQGA 4UA9A 3QNCA 2GZAA 4Y5FA 4IUHA 4E6XA 2PR5A 5EVLA 1CK3A 4GS9B 5DTKA 4FH4A 4R23A 3MSHA 4IVKA 5HSQA 4S2JA 2J8YA 3K2NA 3D72A 5E2FA 1HD8A 1PW8A 2EFXA 2CMNA 3HUOA 3T1QB 5HD3A 4II7A 3SOIA 1BLHA 5CHJA 4XXRA 4Q0IA 1J9MA 4U0XA 3G35A 3H7WB 1PZOA 2W3DA 1BTLA 1PYYA 2W27A 3Q7VB 1ZC2A 4KZ8A 1IYSA 2OWJA 4PM6A 3QP2A 3IX8A 3O3VA 4X53A 4X56A 5L10A 1JTDA 2BASA 3ZVWA 3EOIA 5DTTA 2H5SA 1EROA 4GOGA 3E2LA 3V3SA 5EOEA 4FCFA 1BULA 2B02A 3UB8A 2PAVP 3SW1A 3KYZA 1T1BA 3BM6A 5FQ9A 4OOMA 4FH2A 4UAAA 1KGEA 2WZXA 4LPZA 2Y8HA 1K0KA 2JHEA 1HVBA 3LEQA 5GLBA 3LEZA 1VEUA 5TBMB 2VX8A 3CPTA 2PBYA 2HDUA 5F1GA 2H10A 3KSFA 4X6TA 5DJTA 2GNXA 3A0RA 3T4JA 1ONGA 2FH5A 2R78A 2P9VA 2Y2GA 2OLVA 3T4TA 4DXBA 4KZ7A 1PWCA 2QJ5A 1O7EA 4KG6A 3FYZA 3RXWA 4UA6A 2WKPA 2ZQ8A 4UHUA 2RCXA 1W63Q 3WRTA 1K6SA 3VFFA 5L07A 2H28A 2Q9MA 1N9OA 1QMFA 1YM1A 2W1TB 3MKEA 5L09A 1KVMA 2Y91A 5M18A 1LSXA 4WMCD 4BD1A 3BFEA 3HVFA 4JXWA 3VE4A 3TSGA 5HFOA 1JVJA 3NCKA 1YKDA 1AWIA 1DP9A 3TG9A 2VK3A 4WN5A 5EUAA 1F2KA 3T4OA 3IX4A 5A92A 4R38A 3ICYA 4LV0A 3KO6A 3OOVA 4HEFA 1BZAA 4Z1WA 2Y2IA 4H8RA 2WZZA 2A24B 4E04A 5A93A 2ZQ9A 5FI7A 4E3LA 2V1BA 2HJ9C 2ZC3B 4C6YA 1Z09A 2JKRI 2INWA 4BMWA 1V9ZA 3C5AA 1FSWA 2ZC7A 1PFLA 5IT5A 1HZOA 2HP6A 4NXGA 2B18A 1GSVA 1L0EA 4DE1A 3S7OA 4PHTA 1TVFA 4EQ1A 2A49A 2J80A 5CTNA 3T12B 1STZA 3F1PA 3P7NA 2RL3A 5F82A 4EW7A 2PYRA 4O7DA 1MXOA 4P6ZM 2ZQAA 2WUQA 2JC7A 2OAP1 4PM8A 1P97A 1RGYA 1V9YA 2W3HA 1LLBA 1H8YA 1P0ZA 4FD8A 2EXBA 5D3OA 3E2KA 4CLCC 2VV7A 2Q9NA 3I7JA 4ARZA 3WS0A 5CGWA 4EUZA 3VP3A 1MWRA 3ZG9B 1ZHHB 2ZD8A 1FCMA 5DKLA 4P6BA 3BLSA 3IWIA 3CI6A 4ARZB 1RCJA 5HW3A 1S4RA 5A90A 3BFGA 1XA7A 3T50A 1JWVA 4OP8A 5FSRA 2I72A 3MZEA 1YLYA 3QP6A 2V0UA 1XJ4A 1Z6FA 4O0PA 1XFNA 2JN7A 4CLCA 4NK3A 4GN2A 3IT9A 2NUPC 1Y28A 3N8LA 1ES2A 3BFFA 4KZAA 5L2FA 3CITA 1F9IA 1TS7A 5EE8A 3CJMA 4WUJA 2EX9A 3W2ZA 3H82A 1K54A 1VQQA 3KX0X 4Q0HA 1XKZA 1YLZA 2O9AA 3EWKA 4E3KA 1Q2QA 1ACFA 2XRNA 2ZQ7A 3KSIA 1KDSA 4U0TA 3RXXA 5TR7A 4GS9A 3LIBA 3UY6A 3OPLA 2ZC4B 4ESPA 3C8CA 4WZ5A 3OBFA 2Z6DA 5EM1A 3G6OA 1YQSA 5KSHA 2HDQA 5IS1A 4H6JB 2ZJ9A 3CZDA 4Y13A 2XEPA 1K25A 4R3BA 3GMWA 3L7HA 5FEGA 4DJ3A 1P9RA 1GCEA 1IOUA 3DW0A 3FWLA 1NRJA 3HLCA 4HJ3A 2WKIA 1XGIA 1YMXA 5CTMA 1SDNA 3H7WA 5J4EA 1TS6A 3Q82A 3C4PA 2KX6A 5GHZA 4DDYA 3UDFA 1WYCA 2HGVA 3Q81A 5AQ9A 4JKTA 4E3OA 5HZHA 3ZG5A 3IXGA 5BOHA 4DMZA 4DKIA 1EWZA 2M1CA 1NZUA 2EWWA 4ZDXA 4KG5A 4DXCA 5CEDA 2X02A 3HREA 5FQQA 1T18A 1W79A 4N9LA 3P01A 1VETB 3O86A 2J7VA 3LUQA 2ZM2A 5E2HA 1VEUB 5TBMA 4GHIA 4NETA 3NJAA 5F1FA 2XF3A 5HAPA 2BLSA 3E98A 1Y54A 1XGJA 1SKFA 4F3LB 2JKGA 2O99A 1PI5A 2P9VB 1G6AA 3JVUA 2IWBA 3GTCA 1L0GA 2FFFB 1I5QA 1PZPA 5A91A 3HL9A 1NY0A 2W1RA 4BENA 3VOLA 3G4PA 2O0YA 1YLJA 3O87A 3F1OB 4X25A 2CC1A 4B93A 4KUKA 3C4OA 3B42A 3HLWA 1EW0A 3H9WA 2Y55A 1XXMA 4Y3IA 3ITBA 3PBOA 4QHCA 2HZ5A 5FATA 4MMNA 5M19A 1G6OA 3UB9A 2VV6A 4YFMA 1CQAA 1N4OA 2P7JA 3WS5A 3LYXA 2KOIA 3C38A 1GHPA 3UE1A 1NJ4A 4PM5A 4Y15A 4S2MA 3LCEA 2A24A 2Q0OA 2Y2PA 1LHYA 4EBLA 2QJ7A 4WLAA 3UE3A 2M7UA 4M3KA 3GVBA 1RP5A 3LR3A 5HX9A 2PYPA 4GJ4A 3GECA 3ZNYA 1UGUA 1T1CA 3BW6A 5EM0A 3HUMA 3PYPA 1SDEA 1DJCA 4LRZE 3QP4A 2Y2HA 5FA7A 1N9LA 2AVXA 1VM1A 3GV9A 1KE4A 2Y2MA 1P9WA 2PDRA 3GDIA 2W3FA 1Q2PA 4QY5A 3ISGA 1N9BA 4GZBA 4BL2A 1KE3A 2WKRA 2Y2KA 2X01A 3M6HA 5CEBA 2D02A 4I38A 3MKFA 1IELA 5AQ7A 1GA9A 2HP9A 1KGFA 3HLFA 3MXQA 1F98A 1TS8A 3GR2A 4JLFA 4DE0A 2QMIA 4U3TA 2WYXA 5KZHA 1TD5A 3MS6A 3IHBA 3FKVA 3NIAA 5FDSA 3S7NA 4WMCA 1FQGA 2PR6A 3LIDA 3BY9A 3IBRA 1EI5A 2KLIA 3NECA 1NYMA 3DTKA 2WGWB 2HV1A 3IF5A 1BLPA 1OMEA 3S7PA 1ES3A 2QKPA 3KSHA 5C5KA 2VGLM 5CGXA 4PPRA 4FOFA 4KENB 1H8ZA 5DFXA 4OQIA 5FQMA 1S4SA 1FIKA 3IQAA 4S2NC 1C3BA 4OP5A 2PT7A 1TDGA 4RQ9A 4X69A 1KOUA 2O9CA 2XGNA 4FSFA 1WE4A 3K3DA 3U2AA 1H5XA 2V1ZA 1PWGA 1LI0A 2DCFA 1FOFA 3ZNTA 1YT4A 1S6RA 4K08A 3H82B 3IXBA 4KZ9A 2HP5A 1MKIA 3VSKA 5FQJA 1ALQA 2PD7A 3QP5A 4UQIM 5CXWA 2UWXA 2FZ0A 3U4LP 2K7SA 4X55A 4B9OA 1YSQA 4S2OA 3ZDJA 1E3UD 2XK1A 3UE6A 4BBTA 5CECA 4LCLA
chains in the Genus database with same CATH topology
1N9NA 2VV7A 2KDKA 3R7WA 2WKQA 1NLYA 4H6JA 2K2NA 4ARZA 4ETXA 1YAXA 4EESA 1ZHHB 3BQAA 4LLOB 5DKLA 1XJ2A 1X0OA 3BQ8A 3CI6A 1UWPX 2ZMVA 4ARZB 4KQDA 3UB7A 1S4RA 1OTEA 4YOFA 1YSPA 2G7UA 3T50A 5DJUA 4EEPA 3E4OA 4I3JA 3LIAA 4XT2B 3MR0A 3FG8A 5HD5A 3LR5A 3FPVA 5AJGA 3LFVA 4BWIA 1W63M 2V0UA 3A0VA 1XJ4A 2VA0A 4IHQA 3NOTC 3RFBA 4O0PA 5DF9A 5MC7A 3HJKA 3V67A 1XFNA 2OAQ1 2JN7A 4CLCA 4NXBA 3S7QA 4I3IA 1D06A 4HI4A 4JGRA 2NUPC 2J3TD 2GJ3A 1Y28A 4HJ6A 5G4YA 2A2LA 2K31A 3CITA 3LI9A 1F9IA 1TS7A 1XJ3A 5HWWA 3MQ0A 4NKPA 2XA7M 4WUJA 1XFQA 3W2ZA 2LB5A 3H82A 2ZOIA 5EFWA 1LT0A 3KX0X 3T4QA 4M4XA 3F1PB 1S1ZA 5L8MA 4Q0HA 1MZUA 4F3LA 3MMHA 5HWTA 1BYWA 2O9AA 3EWKA 4I5SA 4IJGA 4GHIB 4HIAA 2XRNA 3UMDA 3LIFA 3PHYA 1H3QA 5HDCA 3KSIA 2M7VA 5AVEA 3VV4A 2PD8A 2W3EA 3PBNA 4GS9A 3LIBA 2Y79A 4WF0A 4I3AA 3C8CA 3OBFA 1T19A 3T4SA 2HJEA 2Z6DA 3ULFA 4ZRRA 4HH2A 3G6OA 4MCWA 5KSHA 5IS1A 4H6JB 4MN7A 1OPXA 3PR6A 3LICA 1LL8A 1GSWA 3BWLA 4HQAA 4EUVA 1OT9A 2ZOHA 4HP4A 5I5LA 4PAUA 4DJ3A 1P9RA 1IOUA 2J3TC 3EEAA 3LIEA 4G3VA 3JVVA 1NRJA 1OTDA 5LBRA 4HJ3A 5DFYA 4BBUA 2OWHA 5HWVA 3EQUA 5A8BA 5J4EA 3H7WA 1TS6A 4WEKA 4EERA 1S1YA 4HNBA 4YNRA 2KX6A 2XROA 1D7EA 4WEJA 3B47A 3F1NA 4GLQA 2HGVA 5F6AA 3PXPA 5J3WA 3MJQA 1OTIA 4NEED 4ME4A 5HZHA 5HL6A 4HH3A 4CLCB 2D01A 3F1NB 4DMZA 4QPRA 3T4KA 1TS0A 1T1AA 4L0LA 1OJ5A 2M1CA 1NWZA 3NOUC 4PKYA 4XT2A 2EWWA 3PBSA 5AVFA 2VV8A 2VLGA 2OOLA 3MQQA 3CLOA 3OC2A 2LB9A 5F5YA 4CLCD 4AFIA 4WELA 3D3OA 1JNUA 1T18A 3FC7A 2VKSA 3P01A 4HJ4A 3T4LA 1DP6A 3PBTA 3LUQA 2V0WA 2IA2A 1UWNX 2VGLS 1OTBA 5F69A 3UMEA 3TRCA 1LSVA 5TBMA 4P6ZS 4GHIA 2GZAA 3NJAA 4G3KA 4Y5FA 1IFQA 4IUHA 3DBAA 2PR5A 1NLZA 4GS9B 4UQIS 2JKTI 3E98A 1OT6A 5G4ZA 4LRYC 2QYBA 2W1TA 3O5YA 4F3LB 5HSQA 2V9AA 2O99A 2I9VA 3JVUA 3BJNA 3K2NA 3D72A 5HDDA 5HDSA 2CMNA 4JGOA 2W0NA 5HD3A 2W1RA 4II7A 3VOLA 4L9EA 2PHYA 2O0YA 1DRMA 4Q0IA 3F1OB 1ODVA 3TE8A 2O9BA 4B93A 4KUKA 3H7WB 1F5MA 3LR4A 2W3DA 4OOLA 1GSXA 2W27A 4R70A 3ZQ5A 3B42A 4L9GA 4NXEA 5TJJA 1EW0A 3H9WA 2OWJA 1OTAA 4Y3IA 5K5BA 3PBOA 1LSWA 4HOIA 4KUOA 2BASA 4CLCE 2VEAA 4MDZA 4MMNA 3EOIA 3HJIA 3FPWA 3HCYA 1VHMA 1G6OA 2EWVA 5HPIA 3UB9A 2VV6A 3ZYTA 5J7EA 3CUEC 3RH8B 2B02A 3UB8A 2ZMFA 4R3AA 5HPFA 3A0SA 3SW1A 2XSSA 2P7JA 3LYXA 3KYZA 3OCNA 2KOIA 3C38A 3C2WA 4KQOA 4EU0A 1T1BA 3EGXC 4GW9A 3MFXA 4OOMA 4LRXC 1MKMA 2A24A 3CUEA 1S66L 4LPZA 5CX7A 2Y8HA 2JHEA 2VZWA 4IUKA 2QJ7A 4WLAA 5TBMB 3UE3A 1XJ6A 2VX8A 2M7UA 3LR3A 4O8GA 2PYPA 3KSFA 4G3WA 3K3CA 4GJ4A 3GECA 1UGUA 5DJTA 2GNXA 1T1CA 3A0RA 3BW6A 4I39A 3T4JA 3OCLA 4NXFA 3E4PA 2FH5A 2R78A 3PYPA 3IS2B 1WA9A 5FL3A 4DJ2A 4LRZE 2L0WA 3UB6A 1S67L 4ETZA 3T4TA 1N9LA 2QJ5A 3MF0A 3IS2A 4HP9A 2WKPA 1ZTUA 1P9WA 3KSGA 2PDRA 4HY8A 3GDIA 2JKTM 2W3FA 3TW8A 1W63Q 2DMWA 2H28A 1N9OA 2L4RA 1G28A 4HHDA 4EXOA 2W1TB 1TF1A 3BY8A 2WKRA 1H8MA 3R7WB 2D02A 4I38A 2XA7S 1LSXA 4YWZA 3TJZC 3VE4A 4UEYA 3LI8A 2QWSA 3MXQA 1F98A 1YKDA 4Q0JA 1TS8A 1DP9A 2JKRM 4MN5A 4WN5A 3T4OA 2EA9A 1TD5A 3F1OA 4JGPA 4GCZA 3MQOA 3S7NA 3CWFA 4R38A 2QHKA 2L1MA 2ZBBA 2P08A 3ICYA 4BJPA 2W3GA 3KO6A 3PBQA 2PR6A 3LIDA 3BY9A 3IBRA 3OOVA 2KLIA 2GX5A 4Z1WA 3NOPC 2HV1A 3S7PA 4R6LA 2A24B 1DP8A 3EGDC 2QKPA 3E4QA 2VGLM 3KSHA 2HF6A 5C5KA 4E04A 4EEUA 2VJWA 4FOFA 5DFXA 4DN0A 1S4SA 3R4KA 2V1BA 2HJ9C 4WL9A 5DKKA 2J3WA 3LR0A 2PT7A 3RTYA 4RQ9A 4CQHA 1KOUA 2O9CA 4FSFA 2JKRI 3IBJA 2INWA 4BMWA 1V9ZA 3K3DA 3U2AA 3OLOA 5IT5A 3B33A 3NHQA 4O01A 4NXGA 3KYQA 3EQVA 2P04A 2B18A 1GSVA 3PBRA 4K08A 2V1AA 3S7OA 4PHTA 3H82B 4EQ1A 2J80A 1VB6A 2MJ6A 1STZA 4L9FA 3EEHA 3F1PA 4BBVA 3P7NA 2PD7A 2YKFA 3CAXA 4EW7A 4UQIM 2PYRA 5KIZA 2Z6CA 4P6ZM 2FZ0A 4JGQA 3VE3A 4MN6A 2OAP1 2K7SA 3E0YA 5IU1A 4B9OA 1P97A 1YSQA 1V9YA 2W3HA 1P0ZA 3C30A 2YKHA 1OJGA 4PKYG 5F68A 3UE6A 1MC0A 4BBTA 4Y2FA 4EETB 2NUTC 4CLCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R70 A;  3EEA A;  1YKD A;  4Q0J A;  3ZQ5 A;  4G3V A;  2K2N A;  4ETX A;  5TJJ A;  5LBR A;  5DFY A;  1TD5 A;  4Y3I A;  5I5L A;  5K5B A;  3S7N A;  3CI6 A;  4YNR A;  2XRO A;  2VEA A;  4MDZ A;  4MMN A;  4GLQ A;  2HGV A;  2W3G A;  3KO6 A;  4YOF A;  3HCY A;  1YSP A;  3IBR A;  1VHM A;  3OOV A;  2G7U A;  5HPI A;  2KLI A;  2GX5 A;  4ME4 A;  3NOP C;  5HL6 A;  4Z1W A;  3S7P A;  2ZMF A;  5HPF A;  4R6L A;  2XSS A;  3KSH A;  4E04 A;  5AJG A;  5C5K A;  3LFV A;  2KOI A;  3C2W A;  4QPR A;  4BWI A;  4DMZ A;  4EU0 A;  2VJW A;  4FOF A;  5DFX A;  3NOT C;  3RFB A;  4DN0 A;  3R4K A;  4O0P A;  3NOU C;  4GW9 A;  3S7Q A;  4LRX C;  1MKM A;  2OOL A;  4RQ9 A;  2Y8H A;  4CQH A;  2O9C A;  2LB9 A;  2VZW A;  4IUK A;  3IBJ A;  3D3O A;  2M7U A;  2VKS A;  2K31 A;  4O8G A;  3CIT A;  3KSF A;  4G3W A;  3MQ0 A;  2IA2 A;  3NHQ A;  4O01 A;  2LB5 A;  3W2Z A;  3TRC A;  2B18 A;  5L8M A;  4G3K A;  4Q0H A;  4Y5F A;  4IUH A;  3DBA A;  3MMH A;  3S7O A;  2O9A A;  1F5M A;  4LRZ E;  3E98 A;  4IJG A;  2XRN A;  4ETZ A;  1STZ A;  4LRY C;  2QYB A;  3KSI A;  2M7V A;  2W1T A;  3O5Y A;  5HSQ A;  3MF0 A;  3VV4 A;  2O99 A;  2W3E A;  1ZTU A;  3KSG A;  2W3F A;  3BJN A;  3K2N A;  2Y79 A;  2W1T B;  3OBF A;  1TF1 A;  4ZRR A;  3G6O A;  3E0Y A;  4MCW A;  1YSQ A;  2W1R A;  2W3H A;  4MN7 A;  2O0Y A;  4Q0I A;  1MC0 A;  4EUV A;  4Y2F A;  2O9B A;  4PAU A;  2W3D A; 
#chains in the Genus database with same CATH topology
 3R7W A;  2XH9 A;  3QNB A;  4H6J A;  4ETX A;  3IWQ A;  1YAX A;  3BQA A;  1XJ2 A;  4OPZ A;  1K6R A;  1UWP X;  2ZMV A;  4KQD A;  4N9K A;  2R9X A;  2G7U A;  5DJU A;  2BG1 A;  4XT2 B;  3T1R A;  5HD5 A;  2WKE A;  1ES4 A;  5AJG A;  4BWI A;  3SH7 A;  3A0V A;  3ZVT A;  4IHQ A;  3RFB A;  3IF6 B;  3SS3 A;  5DF9 A;  3V67 A;  5HAQ A;  2OAQ 1;  4NXB A;  5FEF A;  1K57 C;  4HI4 A;  1K55 C;  2J3T D;  1G68 A;  1NYY A;  4QB8 A;  1I2S A;  3NDG A;  3HLD A;  3IH8 A;  5G4Y A;  1XJ3 A;  3MQ0 A;  4NKP A;  4E3M A;  3TOI A;  2LB5 A;  4OH0 A;  5IHV A;  1GA0 A;  3T4Q A;  5L8M A;  1MZU A;  3Q07 A;  4R4R A;  5HWT A;  4WBG A;  4WZ5 C;  1PNE A;  4GHI B;  4HIA A;  3PHY A;  5EVI A;  1KVL A;  2V20 A;  5E43 A;  2W3E A;  1W8Y A;  3PBN A;  1YMS A;  3JPU A;  2G2U A;  4EV4 A;  2V8C A;  3ULF A;  1FCO A;  5M1A A;  4HH2 A;  4B88 A;  1L3L A;  3Q7V A;  4MN7 A;  3A3D A;  4FUW A;  4K0W A;  3N8R A;  1LL8 A;  3BWL A;  4EUV A;  1MWU A;  4HP4 A;  4PAU A;  2J3T C;  3EEA A;  4G3V A;  5CER A;  4DDS A;  5CHM A;  1OTD A;  4BBU A;  2OWH A;  2XQZ A;  4UA7 A;  2B5R A;  4WEK A;  5EVI C;  4YIN A;  4EER A;  1S1Y A;  1ZKJ A;  4HNB A;  1BLS A;  4E6W A;  3DWK A;  3F1N A;  2ZM0 A;  4LCM A;  2ZM8 A;  1OTI A;  4NEE D;  1QME A;  2E8I A;  2XD5 A;  3F1N B;  1WYB A;  1TS0 A;  1DJA A;  4L0L A;  1OJ5 A;  3NI9 A;  3IHA A;  1JTG A;  1E4D A;  2VV8 A;  2OOL A;  3LGO A;  3CMZ A;  5F5Y A;  1XPB A;  4X1M A;  4BL3 A;  4GDB A;  4WEL A;  1U60 A;  3PBT A;  1O07 A;  2ZC6 B;  2VGL S;  4R3J A;  1ERM A;  4KZ6 A;  4IED A;  2BTF P;  3ZGA B;  4G3K A;  1IFQ A;  3T1X A;  4QD4 A;  3DBA A;  4UQI S;  1TEM A;  2ZMA A;  5G4Z A;  1CEG A;  2WGV A;  4GD8 A;  2W1T A;  1FR1 A;  3BEC A;  2V9A A;  2I9V A;  3HLG A;  3S1Y A;  4PM9 A;  5FI6 A;  5HDD A;  3Q1F A;  2VGJ A;  1HLU P;  3JYI A;  4S2K A;  5JYP A;  1L2S A;  2QZ6 A;  5TFQ A;  1DJB A;  2PHY A;  1DRM A;  4QWO A;  1CJF A;  3TE8 A;  2O9B A;  1CF0 A;  4OOL A;  3LR4 A;  5FAS A;  2V8F A;  4R70 A;  4HES A;  3AGF A;  4NXE A;  5TJJ A;  3OPR A;  2GDN A;  3LY3 A;  1K4E A;  1LSW A;  4KUO A;  4Y0O A;  3N8S A;  5HAI A;  4CLC E;  2VEA A;  4IVI A;  1H0M A;  3AGD A;  3HCY A;  3ZFZ A;  2EWV A;  1W7F A;  4NG2 A;  1FSY A;  3HUN A;  2ZMF A;  4RYE A;  4E3I A;  5HPF A;  2XSS A;  4EU0 A;  1XP4 A;  2J9P A;  3MXR A;  4QY6 A;  1LI9 A;  1IKG A;  3N6I A;  4P0M A;  4OKP A;  4EBN A;  3MFX A;  2B95 A;  4LRX C;  1MKM A;  2DRW A;  1Y4O A;  3CUE A;  2XFS A;  1BLC A;  4ZBE A;  2VZW A;  4R1G A;  1MY8 A;  3V50 A;  1XA1 A;  4KZB A;  3RJU A;  3K3C A;  4JF4 A;  1M6K A;  3HLE A;  4CPK A;  4P87 A;  3GSG A;  2QPN A;  1L0F A;  3IS2 B;  3G32 A;  3UB6 A;  5U47 A;  3PTE A;  4LV2 A;  3IS2 A;  1ZTU A;  1LL9 A;  1K4F A;  4HY8 A;  2JKT M;  3TW8 A;  4Z9Q A;  2DMW A;  1TDL A;  4S2L A;  3VSL A;  1E3U A;  1TF1 A;  4HBT A;  1IKI A;  1CI9 A;  4B4Z A;  2XA7 S;  4YWZ A;  3TJZ C;  3VOY A;  4UEY A;  3LI8 A;  2QWS A;  3QHY A;  4Q0J A;  3V5M A;  3UO9 A;  1KDW A;  2WAD A;  4BD0 A;  4JGP A;  3MQO A;  2EXA A;  4OQ0 A;  2QHK A;  2UV0 E;  1ERQ A;  3NDE A;  4KZ4 A;  5E2G A;  5GL9 A;  3NOP C;  1AXB A;  1FCN A;  4R6L A;  3E4Q A;  2HF6 A;  4EEU A;  3BEB A;  3VFH A;  4DN0 A;  5J8X A;  4E3J A;  1PRQ A;  3NC8 A;  5DKK A;  4MBF A;  2ACG A;  3LR0 A;  3PAE A;  2HDR A;  3RTY A;  5F83 A;  3W4P A;  4CQH A;  3T1S A;  3A3F A;  3O88 A;  5EV0 A;  1SKO A;  3DTE A;  4RVA A;  1PW1 A;  3D9Y A;  5GHY A;  4PMA A;  3KYQ A;  3EQV A;  3OPP A;  2Y2N A;  2WK0 A;  1SKO B;  3IWO A;  3VP4 A;  1IYP A;  2ZL1 B;  2XD1 A;  2MJ6 A;  3BFC A;  4BBV A;  3D4F A;  2YKF A;  3VP2 A;  2Z6C A;  3IH9 A;  2H0Y A;  3UN7 A;  4MN6 A;  3E0Y A;  4Y0T A;  3G34 A;  3MXS A;  4ZJ3 A;  2YKH A;  1OJG A;  4PKY G;  5F68 A;  2XFT A;  1YLW A;  1MC0 A;  2IWC A;  4Y2F A;  3ZHH A;  5GLA A;  2WAE A;  1ZG4 A;  2WKQ A;  4OOY A;  1JWP A;  1NLY A;  2K2N A;  4Y17 A;  2Y59 A;  4EES A;  1MWS A;  4LLO B;  4DF6 A;  4MBK A;  4D2O A;  4KQQ A;  1I2W A;  3UB7 A;  2DNS A;  4EEP A;  3G2Y A;  4MBH A;  5KMW A;  3FG8 A;  4KG2 A;  2Y2L A;  3LR5 A;  3FPV A;  5AQB A;  2ZC5 B;  2VA0 A;  4XUX A;  3CPT B;  4N1H A;  3S7Q A;  4I3I A;  3C7V A;  4JGR A;  4JBF A;  2GJ3 A;  1K54 C;  1MWT A;  2Y2Q A;  4HJ6 A;  3BLM A;  4P85 A;  5EPH A;  5HWW A;  3IXD A;  5FQI A;  4ZJ1 A;  2E8J A;  3L9K A;  2ZLY A;  5EFW A;  3VMA A;  3VOZ A;  2HPB A;  4A5R A;  2OSU A;  4F3L A;  1BYW A;  3S22 A;  3CHW P;  4RX2 A;  4IJG A;  1GHM A;  3UMD A;  2XLN A;  3M2J A;  2JKF A;  2OLU A;  5HAR A;  3VV4 A;  2PD8 A;  2Y79 A;  3HBR A;  4RX3 A;  3P09 A;  4I3A A;  4ZRR A;  3UPP A;  3MZD A;  2WAF A;  3PR6 A;  4EWF A;  3LIC A;  3SS4 A;  1GSW A;  4HQA A;  1OT9 A;  1NRF A;  4GNU A;  2ZOH A;  5I5L A;  4X1L A;  5FAO A;  3LIE A;  1W8Q A;  4LFU A;  1FIL A;  5TGF A;  3P98 A;  5A8B A;  3ITA A;  3UDX A;  1E25 A;  1NXY A;  2XRO A;  1D7E A;  3DAV A;  3B47 A;  5F6A A;  3PXP A;  5J3W A;  3MJQ A;  1SCW A;  4JXV A;  5DVA A;  3NUL A;  3SZT A;  3UDI A;  4QPR A;  3T4K A;  2X71 A;  1T1A A;  1JWZ A;  3FZC A;  4PKY A;  5FI2 A;  4JXS A;  3FKW A;  3W4O A;  4DE3 A;  3OC2 A;  2P74 A;  1XX2 A;  3BFD A;  4AFI A;  3D3O A;  1JNU A;  1LL5 A;  3FC7 A;  2VKS A;  1ONH A;  4B4X A;  1NZO A;  1FR6 A;  3T4L A;  4D60 A;  1DP6 A;  2V0W A;  1UWN X;  3A3J A;  4Y0U A;  1BUE A;  3TRC A;  3WS4 A;  1LSV A;  5JYO A;  3C7U A;  1NLZ A;  4Y7P A;  4KZ3 A;  1M40 A;  2JKT I;  1OT6 A;  1BT5 A;  4OPQ A;  4LRY C;  2QYB A;  3O5Y A;  1S0W A;  4IBX A;  2VGK A;  1PWD A;  3MFD A;  3BJN A;  1YLP A;  2WKH A;  5HDS A;  4JGO A;  5CGS A;  2W0N A;  1W5D A;  2Y2J A;  4L9E A;  1ESU A;  3NY4 A;  4E3N A;  4DE2 A;  1ODV A;  1F5M A;  1ZG6 A;  1GSX A;  4OPY A;  3ZQ5 A;  4R4S A;  4L9G A;  4WM9 A;  2EX8 A;  5CHU A;  5CRF A;  1OTA A;  3BYD A;  5GLC A;  2PU2 A;  5K5B A;  1D1J A;  4HOI A;  4K91 A;  2ZQD A;  2WGW A;  4MDZ A;  1RGZ A;  3HJI A;  4R0Q A;  4RA7 A;  3FPW A;  3IX3 A;  1VHM A;  5HPI A;  3ZYT A;  5J7E A;  3CUE C;  3RH8 B;  2PU4 A;  5FAQ A;  4R3A A;  3A0S A;  4K0X A;  3C2W A;  2WGI A;  3OCN A;  4KQO A;  2PRF A;  2V2F F;  4ID4 A;  3EGX C;  4KZ5 A;  4GW9 A;  1K57 A;  4MEZ A;  3OPH A;  2C6W B;  1K38 A;  1S66 L;  5CX7 A;  4XUZ A;  4ZTK A;  3IF6 A;  4IUK A;  2JBF A;  1KGG A;  1XJ6 A;  3FV7 A;  1YLT A;  4O8G A;  3WS1 A;  4G3W A;  3GQZ A;  2R9W A;  4MLL A;  4I39 A;  5HL1 A;  4ZAM A;  3OCL A;  4NXF A;  3E4P A;  1CEF A;  3Q7Z A;  1WA9 A;  5FL3 A;  1MPL A;  4DJ2 A;  1GHI A;  2L0W A;  3QP1 A;  1S67 L;  4ETZ A;  3SH8 A;  4OLG A;  3MF0 A;  4HP9 A;  4JXG A;  4S2P A;  5FDH A;  3KSG A;  2ZL1 A;  4F94 A;  2G2W A;  2L4R A;  1G28 A;  4HHD A;  4EXO A;  5EOO A;  3BY8 A;  2HDS A;  2JE5 A;  3WWX A;  4EQI A;  1H8M A;  5EVE A;  3R7W B;  4JF6 A;  1IYQ A;  1YPR A;  5KSC A;  3ZCZ A;  4JF5 A;  2IWD A;  4OON A;  2Z2M B;  5DF7 A;  2JKR M;  4HBU A;  4MN5 A;  4S2I A;  2EA9 A;  3F1O A;  4N1X A;  4GCZ A;  4GD6 A;  3CWF A;  3UPO A;  3QP8 A;  4GDN A;  5AQA A;  5DTS A;  2L1M A;  2ZBB A;  2P08 A;  4BJP A;  3LY4 A;  2W3G A;  1G5U A;  3PBQ A;  4JPM A;  2GX5 A;  2EX2 A;  3G2Z A;  2J9O A;  1DP8 A;  3EGD C;  4LEN A;  4MNR A;  2VJW A;  1ES5 A;  3DTM A;  3R4K A;  4WL9 A;  2J3W A;  1A0K A;  4LV1 A;  1VET A;  4OLD A;  4IBR A;  3G31 A;  3IBJ A;  2FFY A;  1HTZ A;  4Q8I A;  4GKU A;  3HLB A;  4S2N A;  3BRM A;  3OLO A;  4LV3 A;  3LO7 A;  2C5W B;  3B33 A;  3VP1 A;  3NHQ A;  4O01 A;  2XDM A;  2P04 A;  2Z2L B;  4LGW A;  5EVI B;  3UNW A;  3PBR A;  4BLM A;  2V1A A;  3W4Q A;  1VB6 A;  4CJN A;  4L9F A;  3EEH A;  1K56 A;  3CAX A;  2EFU A;  4GB7 A;  5KIZ A;  3N7W A;  4WYY A;  3A3E A;  4JGQ A;  3VE3 A;  5IU1 A;  2PBD P;  3C30 A;  3MZF A;  5I94 A;  4EET B;  2NUT C;  3UE0 A;  1N9N A;  2KDK A;  1KE0 A;  1SHV A;  3A3I A;  4PM7 A;  3PAG A;  4ZJ2 A;  3V3R A;  1IEM A;  3S4X A;  1X0O A;  2JCH A;  3BQ8 A;  3MBZ A;  4KQR A;  1OTE A;  4YOF A;  1YSP A;  2A3U A;  3N4I A;  3KYE A;  3E4O A;  3AGE A;  4I3J A;  3LIA A;  1BSG A;  3MR0 A;  2EX6 A;  3LFV A;  2H0T A;  3GRJ A;  1W63 M;  4BQM A;  2ZQC A;  3NOT C;  3SS5 A;  5MC7 A;  3HJK A;  1D06 A;  3IF6 C;  3B3X A;  1SZV A;  4C75 A;  2A2L A;  4N92 A;  2K31 A;  1CI8 A;  3LI9 A;  3IXH A;  3OZH A;  2XA7 M;  5EVI D;  1XFQ A;  3DTI A;  2ZOI A;  3UPN A;  1LT0 A;  1J3W A;  3F1P B;  1S1Z A;  4M4X A;  3UB5 P;  3MMH A;  4I5S A;  2Y4A A;  5FQK A;  4C3Q A;  3LIF A;  1H3Q A;  5HDC A;  1IYO A;  2M7V A;  3ZG0 A;  1PI4 A;  4OPR A;  5AVE A;  5GLD A;  4WF0 A;  4QU3 A;  1T19 A;  3NBL A;  3T4S A;  2HJE A;  3CG5 A;  3DWZ A;  3M6B A;  4MCW A;  5E2E A;  1OPX A;  3V39 A;  4EBP A;  4WZ4 A;  5EEC A;  4OQH A;  3SH9 A;  3JVV A;  5LBR A;  5DFY A;  5GHX A;  5HWV A;  1K56 D;  3EQU A;  5DF8 A;  5G18 A;  3WS2 A;  4YNR A;  2XR0 A;  4WEJ A;  4GLQ A;  4FTX A;  1PIO A;  2Y2O A;  4ME4 A;  3ZG7 B;  5HL6 A;  3W8K A;  4HH3 A;  4CLC B;  3WRZ A;  2D01 A;  4OVD A;  5FAP A;  1MBL A;  4DRT A;  1ESI A;  1NWZ A;  3NOU C;  3G30 A;  4XT2 A;  3PBS A;  5AVF A;  4QJG A;  2VLG A;  3M2K A;  3MQQ A;  3CLO A;  2LB9 A;  4X68 A;  1K55 A;  4CLC D;  1DY6 A;  1L0D A;  3VP0 A;  4HJ4 A;  2IA2 A;  5F69 A;  1OTB A;  3ZG8 B;  2OV5 A;  3UME A;  4P6Z S;  4OQG A;  4UA9 A;  3QNC A;  2GZA A;  4Y5F A;  4IUH A;  4E6X A;  2PR5 A;  5EVL A;  1CK3 A;  4GS9 B;  5DTK A;  4FH4 A;  4R23 A;  3MSH A;  4IVK A;  5HSQ A;  4S2J A;  2J8Y A;  3K2N A;  3D72 A;  5E2F A;  1HD8 A;  1PW8 A;  2EFX A;  2CMN A;  3HUO A;  3T1Q B;  5HD3 A;  4II7 A;  3SOI A;  1BLH A;  5CHJ A;  4XXR A;  4Q0I A;  1J9M A;  4U0X A;  3G35 A;  3H7W B;  1PZO A;  2W3D A;  1BTL A;  1PYY A;  2W27 A;  3Q7V B;  1ZC2 A;  4KZ8 A;  1IYS A;  2OWJ A;  4PM6 A;  3QP2 A;  3IX8 A;  3O3V A;  4X53 A;  4X56 A;  5L10 A;  1JTD A;  2BAS A;  3ZVW A;  3EOI A;  5DTT A;  2H5S A;  1ERO A;  4GOG A;  3E2L A;  3V3S A;  5EOE A;  4FCF A;  1BUL A;  2B02 A;  3UB8 A;  2PAV P;  3SW1 A;  3KYZ A;  1T1B A;  3BM6 A;  5FQ9 A;  4OOM A;  4FH2 A;  4UAA A;  1KGE A;  2WZX A;  4LPZ A;  2Y8H A;  1K0K A;  2JHE A;  1HVB A;  3LEQ A;  5GLB A;  3LEZ A;  1VEU A;  5TBM B;  2VX8 A;  3CPT A;  2PBY A;  2HDU A;  5F1G A;  2H10 A;  3KSF A;  4X6T A;  5DJT A;  2GNX A;  3A0R A;  3T4J A;  1ONG A;  2FH5 A;  2R78 A;  2P9V A;  2Y2G A;  2OLV A;  3T4T A;  4DXB A;  4KZ7 A;  1PWC A;  2QJ5 A;  1O7E A;  4KG6 A;  3FYZ A;  3RXW A;  4UA6 A;  2WKP A;  2ZQ8 A;  4UHU A;  2RCX A;  1W63 Q;  3WRT A;  1K6S A;  3VFF A;  5L07 A;  2H28 A;  2Q9M A;  1N9O A;  1QMF A;  1YM1 A;  2W1T B;  3MKE A;  5L09 A;  1KVM A;  2Y91 A;  5M18 A;  1LSX A;  4WMC D;  4BD1 A;  3BFE A;  3HVF A;  4JXW A;  3VE4 A;  3TSG A;  5HFO A;  1JVJ A;  3NCK A;  1YKD A;  1AWI A;  1DP9 A;  3TG9 A;  2VK3 A;  4WN5 A;  5EUA A;  1F2K A;  3T4O A;  3IX4 A;  5A92 A;  4R38 A;  3ICY A;  4LV0 A;  3KO6 A;  3OOV A;  4HEF A;  1BZA A;  4Z1W A;  2Y2I A;  4H8R A;  2WZZ A;  2A24 B;  4E04 A;  5A93 A;  2ZQ9 A;  5FI7 A;  4E3L A;  2V1B A;  2HJ9 C;  2ZC3 B;  4C6Y A;  1Z09 A;  2JKR I;  2INW A;  4BMW A;  1V9Z A;  3C5A A;  1FSW A;  2ZC7 A;  1PFL A;  5IT5 A;  1HZO A;  2HP6 A;  4NXG A;  2B18 A;  1GSV A;  1L0E A;  4DE1 A;  3S7O A;  4PHT A;  1TVF A;  4EQ1 A;  2A49 A;  2J80 A;  5CTN A;  3T12 B;  1STZ A;  3F1P A;  3P7N A;  2RL3 A;  5F82 A;  4EW7 A;  2PYR A;  4O7D A;  1MXO A;  4P6Z M;  2ZQA A;  2WUQ A;  2JC7 A;  2OAP 1;  4PM8 A;  1P97 A;  1RGY A;  1V9Y A;  2W3H A;  1LLB A;  1H8Y A;  1P0Z A;  4FD8 A;  2EXB A;  5D3O A;  3E2K A;  4CLC C;  2VV7 A;  2Q9N A;  3I7J A;  4ARZ A;  3WS0 A;  5CGW A;  4EUZ A;  3VP3 A;  1MWR A;  3ZG9 B;  1ZHH B;  2ZD8 A;  1FCM A;  5DKL A;  4P6B A;  3BLS A;  3IWI A;  3CI6 A;  4ARZ B;  1RCJ A;  5HW3 A;  1S4R A;  5A90 A;  3BFG A;  1XA7 A;  3T50 A;  1JWV A;  4OP8 A;  5FSR A;  2I72 A;  3MZE A;  1YLY A;  3QP6 A;  2V0U A;  1XJ4 A;  1Z6F A;  4O0P A;  1XFN A;  2JN7 A;  4CLC A;  4NK3 A;  4GN2 A;  3IT9 A;  2NUP C;  1Y28 A;  3N8L A;  1ES2 A;  3BFF A;  4KZA A;  5L2F A;  3CIT A;  1F9I A;  1TS7 A;  5EE8 A;  3CJM A;  4WUJ A;  2EX9 A;  3W2Z A;  3H82 A;  1K54 A;  1VQQ A;  3KX0 X;  4Q0H A;  1XKZ A;  1YLZ A;  2O9A A;  3EWK A;  4E3K A;  1Q2Q A;  1ACF A;  2XRN A;  2ZQ7 A;  3KSI A;  1KDS A;  4U0T A;  3RXX A;  5TR7 A;  4GS9 A;  3LIB A;  3UY6 A;  3OPL A;  2ZC4 B;  4ESP A;  3C8C A;  4WZ5 A;  3OBF A;  2Z6D A;  5EM1 A;  3G6O A;  1YQS A;  5KSH A;  2HDQ A;  5IS1 A;  4H6J B;  2ZJ9 A;  3CZD A;  4Y13 A;  2XEP A;  1K25 A;  4R3B A;  3GMW A;  3L7H A;  5FEG A;  4DJ3 A;  1P9R A;  1GCE A;  1IOU A;  3DW0 A;  3FWL A;  1NRJ A;  3HLC A;  4HJ3 A;  2WKI A;  1XGI A;  1YMX A;  5CTM A;  1SDN A;  3H7W A;  5J4E A;  1TS6 A;  3Q82 A;  3C4P A;  2KX6 A;  5GHZ A;  4DDY A;  3UDF A;  1WYC A;  2HGV A;  3Q81 A;  5AQ9 A;  4JKT A;  4E3O A;  5HZH A;  3ZG5 A;  3IXG A;  5BOH A;  4DMZ A;  4DKI A;  1EWZ A;  2M1C A;  1NZU A;  2EWW A;  4ZDX A;  4KG5 A;  4DXC A;  5CED A;  2X02 A;  3HRE A;  5FQQ A;  1T18 A;  1W79 A;  4N9L A;  3P01 A;  1VET B;  3O86 A;  2J7V A;  3LUQ A;  2ZM2 A;  5E2H A;  1VEU B;  5TBM A;  4GHI A;  4NET A;  3NJA A;  5F1F A;  2XF3 A;  5HAP A;  2BLS A;  3E98 A;  1Y54 A;  1XGJ A;  1SKF A;  4F3L B;  2JKG A;  2O99 A;  1PI5 A;  2P9V B;  1G6A A;  3JVU A;  2IWB A;  3GTC A;  1L0G A;  2FFF B;  1I5Q A;  1PZP A;  5A91 A;  3HL9 A;  1NY0 A;  2W1R A;  4BEN A;  3VOL A;  3G4P A;  2O0Y A;  1YLJ A;  3O87 A;  3F1O B;  4X25 A;  2CC1 A;  4B93 A;  4KUK A;  3C4O A;  3B42 A;  3HLW A;  1EW0 A;  3H9W A;  2Y55 A;  1XXM A;  4Y3I A;  3ITB A;  3PBO A;  4QHC A;  2HZ5 A;  5FAT A;  4MMN A;  5M19 A;  1G6O A;  3UB9 A;  2VV6 A;  4YFM A;  1CQA A;  1N4O A;  2P7J A;  3WS5 A;  3LYX A;  2KOI A;  3C38 A;  1GHP A;  3UE1 A;  1NJ4 A;  4PM5 A;  4Y15 A;  4S2M A;  3LCE A;  2A24 A;  2Q0O A;  2Y2P A;  1LHY A;  4EBL A;  2QJ7 A;  4WLA A;  3UE3 A;  2M7U A;  4M3K A;  3GVB A;  1RP5 A;  3LR3 A;  5HX9 A;  2PYP A;  4GJ4 A;  3GEC A;  3ZNY A;  1UGU A;  1T1C A;  3BW6 A;  5EM0 A;  3HUM A;  3PYP A;  1SDE A;  1DJC A;  4LRZ E;  3QP4 A;  2Y2H A;  5FA7 A;  1N9L A;  2AVX A;  1VM1 A;  3GV9 A;  1KE4 A;  2Y2M A;  1P9W A;  2PDR A;  3GDI A;  2W3F A;  1Q2P A;  4QY5 A;  3ISG A;  1N9B A;  4GZB A;  4BL2 A;  1KE3 A;  2WKR A;  2Y2K A;  2X01 A;  3M6H A;  5CEB A;  2D02 A;  4I38 A;  3MKF A;  1IEL A;  5AQ7 A;  1GA9 A;  2HP9 A;  1KGF A;  3HLF A;  3MXQ A;  1F98 A;  1TS8 A;  3GR2 A;  4JLF A;  4DE0 A;  2QMI A;  4U3T A;  2WYX A;  5KZH A;  1TD5 A;  3MS6 A;  3IHB A;  3FKV A;  3NIA A;  5FDS A;  3S7N A;  4WMC A;  1FQG A;  2PR6 A;  3LID A;  3BY9 A;  3IBR A;  1EI5 A;  2KLI A;  3NEC A;  1NYM A;  3DTK A;  2WGW B;  2HV1 A;  3IF5 A;  1BLP A;  1OME A;  3S7P A;  1ES3 A;  2QKP A;  3KSH A;  5C5K A;  2VGL M;  5CGX A;  4PPR A;  4FOF A;  4KEN B;  1H8Z A;  5DFX A;  4OQI A;  5FQM A;  1S4S A;  1FIK A;  3IQA A;  4S2N C;  1C3B A;  4OP5 A;  2PT7 A;  1TDG A;  4RQ9 A;  4X69 A;  1KOU A;  2O9C A;  2XGN A;  4FSF A;  1WE4 A;  3K3D A;  3U2A A;  1H5X A;  2V1Z A;  1PWG A;  1LI0 A;  2DCF A;  1FOF A;  3ZNT A;  1YT4 A;  1S6R A;  4K08 A;  3H82 B;  3IXB A;  4KZ9 A;  2HP5 A;  1MKI A;  3VSK A;  5FQJ A;  1ALQ A;  2PD7 A;  3QP5 A;  4UQI M;  5CXW A;  2UWX A;  2FZ0 A;  3U4L P;  2K7S A;  4X55 A;  4B9O A;  1YSQ A;  4S2O A;  3ZDJ A;  1E3U D;  2XK1 A;  3UE6 A;  4BBT A;  5CEC A;  4LCL A; 
#chains in the Genus database with same CATH homology
 1N9N A;  2VV7 A;  2KDK A;  3R7W A;  2WKQ A;  1NLY A;  4H6J A;  2K2N A;  4ARZ A;  4ETX A;  1YAX A;  4EES A;  1ZHH B;  3BQA A;  4LLO B;  5DKL A;  1XJ2 A;  1X0O A;  3BQ8 A;  3CI6 A;  1UWP X;  2ZMV A;  4ARZ B;  4KQD A;  3UB7 A;  1S4R A;  1OTE A;  4YOF A;  1YSP A;  2G7U A;  3T50 A;  5DJU A;  4EEP A;  3E4O A;  4I3J A;  3LIA A;  4XT2 B;  3MR0 A;  3FG8 A;  5HD5 A;  3LR5 A;  3FPV A;  5AJG A;  3LFV A;  4BWI A;  1W63 M;  2V0U A;  3A0V A;  1XJ4 A;  2VA0 A;  4IHQ A;  3NOT C;  3RFB A;  4O0P A;  5DF9 A;  5MC7 A;  3HJK A;  3V67 A;  1XFN A;  2OAQ 1;  2JN7 A;  4CLC A;  4NXB A;  3S7Q A;  4I3I A;  1D06 A;  4HI4 A;  4JGR A;  2NUP C;  2J3T D;  2GJ3 A;  1Y28 A;  4HJ6 A;  5G4Y A;  2A2L A;  2K31 A;  3CIT A;  3LI9 A;  1F9I A;  1TS7 A;  1XJ3 A;  5HWW A;  3MQ0 A;  4NKP A;  2XA7 M;  4WUJ A;  1XFQ A;  3W2Z A;  2LB5 A;  3H82 A;  2ZOI A;  5EFW A;  1LT0 A;  3KX0 X;  3T4Q A;  4M4X A;  3F1P B;  1S1Z A;  5L8M A;  4Q0H A;  1MZU A;  4F3L A;  3MMH A;  5HWT A;  1BYW A;  2O9A A;  3EWK A;  4I5S A;  4IJG A;  4GHI B;  4HIA A;  2XRN A;  3UMD A;  3LIF A;  3PHY A;  1H3Q A;  5HDC A;  3KSI A;  2M7V A;  5AVE A;  3VV4 A;  2PD8 A;  2W3E A;  3PBN A;  4GS9 A;  3LIB A;  2Y79 A;  4WF0 A;  4I3A A;  3C8C A;  3OBF A;  1T19 A;  3T4S A;  2HJE A;  2Z6D A;  3ULF A;  4ZRR A;  4HH2 A;  3G6O A;  4MCW A;  5KSH A;  5IS1 A;  4H6J B;  4MN7 A;  1OPX A;  3PR6 A;  3LIC A;  1LL8 A;  1GSW A;  3BWL A;  4HQA A;  4EUV A;  1OT9 A;  2ZOH A;  4HP4 A;  5I5L A;  4PAU A;  4DJ3 A;  1P9R A;  1IOU A;  2J3T C;  3EEA A;  3LIE A;  4G3V A;  3JVV A;  1NRJ A;  1OTD A;  5LBR A;  4HJ3 A;  5DFY A;  4BBU A;  2OWH A;  5HWV A;  3EQU A;  5A8B A;  5J4E A;  3H7W A;  1TS6 A;  4WEK A;  4EER A;  1S1Y A;  4HNB A;  4YNR A;  2KX6 A;  2XRO A;  1D7E A;  4WEJ A;  3B47 A;  3F1N A;  4GLQ A;  2HGV A;  5F6A A;  3PXP A;  5J3W A;  3MJQ A;  1OTI A;  4NEE D;  4ME4 A;  5HZH A;  5HL6 A;  4HH3 A;  4CLC B;  2D01 A;  3F1N B;  4DMZ A;  4QPR A;  3T4K A;  1TS0 A;  1T1A A;  4L0L A;  1OJ5 A;  2M1C A;  1NWZ A;  3NOU C;  4PKY A;  4XT2 A;  2EWW A;  3PBS A;  5AVF A;  2VV8 A;  2VLG A;  2OOL A;  3MQQ A;  3CLO A;  3OC2 A;  2LB9 A;  5F5Y A;  4CLC D;  4AFI A;  4WEL A;  3D3O A;  1JNU A;  1T18 A;  3FC7 A;  2VKS A;  3P01 A;  4HJ4 A;  3T4L A;  1DP6 A;  3PBT A;  3LUQ A;  2V0W A;  2IA2 A;  1UWN X;  2VGL S;  1OTB A;  5F69 A;  3UME A;  3TRC A;  1LSV A;  5TBM A;  4P6Z S;  4GHI A;  2GZA A;  3NJA A;  4G3K A;  4Y5F A;  1IFQ A;  4IUH A;  3DBA A;  2PR5 A;  1NLZ A;  4GS9 B;  4UQI S;  2JKT I;  3E98 A;  1OT6 A;  5G4Z A;  4LRY C;  2QYB A;  2W1T A;  3O5Y A;  4F3L B;  5HSQ A;  2V9A A;  2O99 A;  2I9V A;  3JVU A;  3BJN A;  3K2N A;  3D72 A;  5HDD A;  5HDS A;  2CMN A;  4JGO A;  2W0N A;  5HD3 A;  2W1R A;  4II7 A;  3VOL A;  4L9E A;  2PHY A;  2O0Y A;  1DRM A;  4Q0I A;  3F1O B;  1ODV A;  3TE8 A;  2O9B A;  4B93 A;  4KUK A;  3H7W B;  1F5M A;  3LR4 A;  2W3D A;  4OOL A;  1GSX A;  2W27 A;  4R70 A;  3ZQ5 A;  3B42 A;  4L9G A;  4NXE A;  5TJJ A;  1EW0 A;  3H9W A;  2OWJ A;  1OTA A;  4Y3I A;  5K5B A;  3PBO A;  1LSW A;  4HOI A;  4KUO A;  2BAS A;  4CLC E;  2VEA A;  4MDZ A;  4MMN A;  3EOI A;  3HJI A;  3FPW A;  3HCY A;  1VHM A;  1G6O A;  2EWV A;  5HPI A;  3UB9 A;  2VV6 A;  3ZYT A;  5J7E A;  3CUE C;  3RH8 B;  2B02 A;  3UB8 A;  2ZMF A;  4R3A A;  5HPF A;  3A0S A;  3SW1 A;  2XSS A;  2P7J A;  3LYX A;  3KYZ A;  3OCN A;  2KOI A;  3C38 A;  3C2W A;  4KQO A;  4EU0 A;  1T1B A;  3EGX C;  4GW9 A;  3MFX A;  4OOM A;  4LRX C;  1MKM A;  2A24 A;  3CUE A;  1S66 L;  4LPZ A;  5CX7 A;  2Y8H A;  2JHE A;  2VZW A;  4IUK A;  2QJ7 A;  4WLA A;  5TBM B;  3UE3 A;  1XJ6 A;  2VX8 A;  2M7U A;  3LR3 A;  4O8G A;  2PYP A;  3KSF A;  4G3W A;  3K3C A;  4GJ4 A;  3GEC A;  1UGU A;  5DJT A;  2GNX A;  1T1C A;  3A0R A;  3BW6 A;  4I39 A;  3T4J A;  3OCL A;  4NXF A;  3E4P A;  2FH5 A;  2R78 A;  3PYP A;  3IS2 B;  1WA9 A;  5FL3 A;  4DJ2 A;  4LRZ E;  2L0W A;  3UB6 A;  1S67 L;  4ETZ A;  3T4T A;  1N9L A;  2QJ5 A;  3MF0 A;  3IS2 A;  4HP9 A;  2WKP A;  1ZTU A;  1P9W A;  3KSG A;  2PDR A;  4HY8 A;  3GDI A;  2JKT M;  2W3F A;  3TW8 A;  1W63 Q;  2DMW A;  2H28 A;  1N9O A;  2L4R A;  1G28 A;  4HHD A;  4EXO A;  2W1T B;  1TF1 A;  3BY8 A;  2WKR A;  1H8M A;  3R7W B;  2D02 A;  4I38 A;  2XA7 S;  1LSX A;  4YWZ A;  3TJZ C;  3VE4 A;  4UEY A;  3LI8 A;  2QWS A;  3MXQ A;  1F98 A;  1YKD A;  4Q0J A;  1TS8 A;  1DP9 A;  2JKR M;  4MN5 A;  4WN5 A;  3T4O A;  2EA9 A;  1TD5 A;  3F1O A;  4JGP A;  4GCZ A;  3MQO A;  3S7N A;  3CWF A;  4R38 A;  2QHK A;  2L1M A;  2ZBB A;  2P08 A;  3ICY A;  4BJP A;  2W3G A;  3KO6 A;  3PBQ A;  2PR6 A;  3LID A;  3BY9 A;  3IBR A;  3OOV A;  2KLI A;  2GX5 A;  4Z1W A;  3NOP C;  2HV1 A;  3S7P A;  4R6L A;  2A24 B;  1DP8 A;  3EGD C;  2QKP A;  3E4Q A;  2VGL M;  3KSH A;  2HF6 A;  5C5K A;  4E04 A;  4EEU A;  2VJW A;  4FOF A;  5DFX A;  4DN0 A;  1S4S A;  3R4K A;  2V1B A;  2HJ9 C;  4WL9 A;  5DKK A;  2J3W A;  3LR0 A;  2PT7 A;  3RTY A;  4RQ9 A;  4CQH A;  1KOU A;  2O9C A;  4FSF A;  2JKR I;  3IBJ A;  2INW A;  4BMW A;  1V9Z A;  3K3D A;  3U2A A;  3OLO A;  5IT5 A;  3B33 A;  3NHQ A;  4O01 A;  4NXG A;  3KYQ A;  3EQV A;  2P04 A;  2B18 A;  1GSV A;  3PBR A;  4K08 A;  2V1A A;  3S7O A;  4PHT A;  3H82 B;  4EQ1 A;  2J80 A;  1VB6 A;  2MJ6 A;  1STZ A;  4L9F A;  3EEH A;  3F1P A;  4BBV A;  3P7N A;  2PD7 A;  2YKF A;  3CAX A;  4EW7 A;  4UQI M;  2PYR A;  5KIZ A;  2Z6C A;  4P6Z M;  2FZ0 A;  4JGQ A;  3VE3 A;  4MN6 A;  2OAP 1;  2K7S A;  3E0Y A;  5IU1 A;  4B9O A;  1P97 A;  1YSQ A;  1V9Y A;  2W3H A;  1P0Z A;  3C30 A;  2YKH A;  1OJG A;  4PKY G;  5F68 A;  3UE6 A;  1MC0 A;  4BBT A;  4Y2F A;  4EET B;  2NUT C;  4CLC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...