2HGVA

N-terminal gaf domain of transcriptional pleiotropic repressor cody
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
155
structure length
155
Chain Sequence
b'MALLQKTRIINSMLQAAAGKPVNFKEMAETLRDVIDSNIFVVSRRGKLLGYSINQQIENDRMKKMLEDRQFPEEYTKNLFNVPETSSNLDINSEYTAFPVENRDLFQAGLTTIVPIIGGGERLGTLILSRLQDQFNDDDLILAEYGATVVGMEIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-sensing transcriptional pleiotropic repressor codY
molecule tags Dna binding protein
source organism Bacillus subtilis
publication title The Structure of CodY, a GTP- and Isoleucine-responsive Regulator of Stationary Phase and Virulence in Gram-positive Bacteria
pubmed doi rcsb
total genus 41
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2006-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2hgvA00
4YOFA 4Y2FA 1YKDA 4Q0JA 5TJJA 4Q0HA 5I5LA 4BWIA 4YNRA 3R4KA 3BJNA 5LBRA 1YSQA 3LFVA 4FOFA 5DFXA 3K2NA 3CITA 4GW9A 5K5BA 4GLQA 2W3DA 5L8MA 2O9AA 4O01A 3S7PA 4IJGA 3RFBA 4LRXC 3IBJA 4G3WA 2O9BA 2G7UA 3NOPC 3E98A 2W1RA 4MMNA 3NOTC 2W3HA 4ME4A 5HL6A 4G3VA 4QPRA 4RQ9A 1STZA 3MMHA 4DN0A 3OBFA 5HSQA 3S7OA 4Z1WA 3G6OA 1F5MA 2B18A 3CI6A 3DBAA 1TF1A 1MKMA 2W3FA 3KO6A 2VJWA 3NHQA 4CQHA 2O0YA 2Y79A 3S7NA 2ZMFA 3TRCA 2KLIA 3C2WA 1TD5A 2LB9A 4R70A 4DMZA 3EEAA 1MC0A 3MQ0A 3ZQ5A 3VV4A 5C5KA 2K2NA 3HCYA 3S7QA 3MF0A 4ETXA 4Y3IA 4MDZA 2M7UA 2OOLA 4R6LA 3KSGA 4Q0IA 4LRZE 5HPIA 2VZWA 4IUKA 3E0YA 5AJGA 2IA2A 4E04A 2XSSA 2Y8HA 2HGVA 1VHMA 3IBRA 4ETZA 2GX5A 4MN7A 4PAUA 2VEAA 4EU0A 4ZRRA 2O9CA 2XRNA 4G3KA 2W3EA 1YSPA 2XROA 3NOUC 2W1TA 3OOVA 4LRYC 4MCWA 3O5YA 4O0PA 2W3GA 1ZTUA 5HPFA 2LB5A 4EUVA 2M7VA 4O8GA 2K31A 3KSIA 2W1TB 4Y5FA 2QYBA 5DFYA 3W2ZA 3D3OA 2O99A 3KSFA 3KSHA 4IUHA 2VKSA 2KOIA
chains in the Genus database with same CATH superfamily
3CLOA 3OPRA 1BT5A 2Y2PA 2VGLM 2WKPA 4JXVA 2ACGA 5M1AA 4FH2A 1ES4A 4FTXA 1F2KA 2J3WA 5DFXA 1VQQA 3HVFA 4OLDA 1MKIA 2W3DA 1PW1A 1PNEA 3VE3A 4O01A 1F9IA 2XA7S 2XD1A 3V39A 2O9BA 3HLWA 3BYDA 2JKRM 4ME4A 2B02A 1NYMA 2WK0A 1MBLA 4CPKA 5CX7A 1OTDA 3D72A 2PD7A 4R3BA 1T1CA 4IBRA 2Y2JA 3S7NA 4OVDA 1GCEA 5CECA 2ZJ9A 3GQZA 4PM7A 1BSGA 4CJNA 1HVBA 4KZ3A 4HJ6A 3H7WA 4CLCB 2E8IA 3FV7A 4BBUA 4X69A 3TJZC 1N9OA 1H0MA 1K55C 4JF6A 3VOLA 4CLCC 1OT6A 3T4SA 3SS4A 3NOUC 4GKUA 4X1LA 3OOVA 4PM8A 2JC7A 3U2AA 1O07A 3E4QA 3B42A 3C8CA 1TS0A 1IKGA 3F1PB 3GMWA 1LI0A 5F6AA 1CEGA 3A0VA 4GOGA 3P7NA 1WYBA 1P97A 5TBMB 5I5LA 4YWZA 3WRZA 3BLMA 4Y15A 1FSYA 4FOFA 2K7SA 1JTGA 4OONA 3RJUA 1J9MA 4C3QA 4LV2A 5FEFA 1SCWA 4MEZA 2BG1A 2EXBA 2Y55A 4MMNA 3VMAA 5CERA 3QHYA 2PHYA 3T12B 5U47A 5FDSA 2V8FA 3MKEA 5J8XA 3AGEA 1NYYA 3W4OA 1BLHA 1T1AA 2B5RA 4WUJA 1BYWA 2ZL1A 4UHUA 3VV4A 2K2NA 4C6YA 1I5QA 2Y4AA 2YKFA 2V0WA 1IELA 3N8RA 4Q0IA 3EWKA 4P6ZM 3GTCA 4JF5A 4Y17A 3E0YA 3SH8A 2ZOIA 4GD6A 4KQQA 3QNCA 2WGWA 3Q82A 2WKRA 2I72A 2JKGA 4XXRA 4MBKA 4QD4A 4G3KA 5F1GA 2JCHA 2XEPA 2VGLS 4LRYC 4MCWA 4E3OA 3BEBA 3EEHA 3O5YA 1ZTUA 3SOIA 4S2KA 4E3JA 1FCOA 2V9AA 3G30A 2EX2A 5F69A 5HAPA 1DJAA 5EE8A 4IVKA 3SH7A 4ID4A 1KE3A 3W4QA 4DF6A 1GSVA 3V67A 4L0LA 1W7FA 5KIZA 4LCLA 1NLYA 4E6WA 3ZVWA 2J3TC 2E8JA 3HUNA 4PMAA 2J80A 1IKIA 2ZOHA 4GW9A 4S2PA 1ESIA 4R1GA 1FR6A 5CGWA 3S7PA 1WA9A 1BTLA 3EGDC 1Q2PA 5JYOA 1FCMA 4I5SA 5HFOA 4GD8A 2V1ZA 4UEYA 4XT2B 5IS1A 1KE0A 4OP8A 2V1AA 3DBAA 1VETB 1DP9A 3A3JA 1FR1A 4GS9A 3FKWA 1UWNX 2EXAA 5C5KA 1XJ3A 4S2JA 4ETXA 3T4OA 2ZLYA 3BFDA 5HARA 4HESA 5CEBA 5EVIA 5D3OA 5GLAA 3Q7VB 3GR2A 3N8LA 1HD8A 2HZ5A 5FAOA 4FCFA 3ZVTA 4CLCE 1JNUA 5J3WA 4XT2A 3S1YA 2HP6A 1E25A 4F3LA 3C4PA 4RA7A 4I3JA 4D60A 4EETB 1M6KA 1OTAA 2HDUA 1XGJA 5CGSA 5GHXA 3CWFA 3BWLA 1P0ZA 1PWCA 4EW7A 4XUXA 4N9KA 5M19A 1NLZA 5HD5A 4N92A 5EVID 2UWXA 1KDWA 3DTEA 2HDQA 3UDFA 1LI9A 5FQIA 1N9LA 1YSQA 1G28A 2ZC6B 4H6JB 3EOIA 3G35A 1BLPA 4LRXC 1RP5A 3OPPA 2WYXA 3G2YA 3LIFA 3E98A 3NI9A 4NETA 3HLEA 4QHCA 5DF8A 5HX9A 4S2NA 4WZ4A 4HH2A 1STZA 3OBFA 5CTMA 2OSUA 4KG5A 1YLYA 3NY4A 3ZG9B 4B9OA 3ZGAB 2Y79A 1KVMA 2KLIA 2QPNA 1G6AA 5HWTA 4JXWA 4S2NC 3QP8A 2PU4A 3KYZA 4E3NA 4P6BA 1K56D 1ACFA 1MPLA 3LY3A 1VHMA 4KG6A 1MWTA 4N9LA 4PAUA 4ZBEA 4P87A 3AGDA 3PBRA 1U60A 3MJQA 5CHUA 1CI8A 3C7UA 4KQRA 2IWBA 4O0PA 1KOUA 1Y28A 4JGRA 2VGJA 1CF0A 3KSIA 4ZDXA 2QYBA 5HD3A 5FAPA 2H0YA 3D3OA 2CMNA 2OV5A 4EEUA 3MKFA 4X6TA 4EERA 3WS5A 2WADA 3NC8A 5DF9A 5CXWA 3CITA 3O86A 2VX8A 5L8MA 3QNBA 2X01A 5J7EA 4HOIA 5HZHA 4G3WA 3K3DA 1XJ6A 1T1BA 3S4XA 1L0EA 3ZYTA 4BBTA 4KUKA 3ZNTA 3F1NB 2VV6A 3MSHA 4NXEA 1I2WA 1W5DA 1NWZA 4PKYA 1XJ4A 1S4SA 2WZXA 4E3LA 3H82B 3OCLA 2B95A 5E43A 2H10A 4OQ0A 2A24A 5GLBA 3P01A 2LB9A 2BASA 2VA0A 3BRMA 4GN2A 4MLLA 1K6SA 4X25A 1W63Q 3IX8A 2AVXA 1D1JA 3KYQA 5FEGA 2HGVA 4ETZA 3IH8A 2Z2LB 5G4YA 3T4QA 1ESUA 3DTMA 4EU0A 3PBTA 2EX8A 1YSPA 4RYEA 2MJ6A 3LR5A 2Z6DA 2RL3A 3TOIA 5AQ9A 4F94A 2PU2A 4GDBA 2Y91A 3SS3A 3PBOA 1ZG6A 4NXGA 4OQHA 4OOYA 1UWPX 4DJ2A 3IWQA 4S2OA 1MZUA 3LI8A 3MQOA 5FL3A 2IWDA 4L9EA 1PI5A 4GZBA 1XX2A 1ES5A 1PZOA 4NXBA 3VSKA 1Z6FA 4H6JA 4LPZA 3PR6A 1CJFA 2VK3A 5DKKA 5HDSA 3CPTA 2H0TA 1H8ZA 3NOPC 4OQGA 3CHWP 1BZAA 1A0KA 2FFYA 3F1OB 5L2FA 3T4KA 2RCXA 1GHMA 1W8YA 4DE3A 2A49A 2HDSA 2L4RA 2XFSA 3G6OA 4UA7A 5FI2A 2O0YA 3G4PA 4KZ4A 3W4PA 3TRCA 1D06A 3WRTA 3ZQ5A 2V2FF 2X71A 4JBFA 2V20A 3UPOA 4LFUA 4Y13A 2QWSA 3LIDA 3MFXA 3Q7VA 3DWKA 4PM9A 4CLCA 5HPIA 3W8KA 5CHMA 1K38A 2J3TD 3UE1A 3IS2B 3UDIA 2Y2LA 3IBRA 3UB9A 2PDRA 2XDMA 1ZC2A 1FSWA 3B3XA 1PW8A 3BY9A 2W3EA 5J4EA 4LV1A 3CZDA 4QJGA 2WGIA 1VEUA 1H3QA 4Y5FA 4KZBA 1EWZA 1LL9A 3BY8A 5HDCA 1WYCA 3MS6A 3F1PA 3OZHA 4WN5A 5I94A 1IFQA 2WAFA 3UO9A 4Q8IA 4B93A 1Q2QA 1T18A 2WKHA 4QB8A 1OTEA 3FKVA 4LLOB 1K54C 2VLGA 3BFEA 3BM6A 5A8BA 3PHYA 1HZOA 5EOEA 2HJEA 4BD1A 4GLQA 5DJUA 2QJ7A 1YPRA 5FQ9A 2XA7M 4I3AA 3LYXA 4R0QA 1Y54A 4EQ1A 4RQ9A 5KMWA 1LHYA 5FI6A 3BFGA 2W27A 4E3KA 4EBPA 1RCJA 2B18A 3CI6A 5EUAA 3H82A 2W0NA 3KO6A 1W8QA 4KZ9A 3ZG8B 4LV3A 5EM0A 5A90A 3IHAA 4KZ6A 5EVEA 3FPWA 1MWRA 2J8YA 3BQ8A 5DTSA 3UE6A 3DTKA 3HL9A 5E2HA 1H5XA 1GHIA 3PBQA 1KE4A 3R7WA 2P9VB 4ZJ2A 4MDZA 2OOLA 3IF5A 2JKTM 3HLCA 2Z6CA 1YM1A 5E2EA 2XSSA 3NULA 1TS8A 1EW0A 4BENA 4MN7A 2Q9MA 2WGWB 3LIBA 2WGVA 2ZC3B 1CI9A 2W3GA 2R78A 1YLPA 1K55A 5EOOA 3FYZA 2EFUA 4DDYA 2PR5A 3NDGA 2KOIA 5AVFA 1XA1A 4DRTA 3A3IA 5AVEA 3PAEA 4GDNA 4DKIA 1PWGA 5TBMA 2UV0E 3B47A 4IHQA 4EBLA 5M18A 2G2WA 1KGEA 1VB6A 4DE2A 1GA0A 4JKTA 4KQDA 1YT4A 4P85A 3HJKA 4HY8A 1JWVA 2HF6A 3LICA 4KG2A 1W79A 3JYIA 3IXBA 2NUTC 3UN7A 4HJ3A 3IXGA 5AQBA 5EFWA 3N6IA 5EECA 2JBFA 2OAP1 4MN5A 3E2KA 5HL1A 3S7OA 1O7EA 4DXCA 2FFFB 1RGYA 2OWJA 4KENB 4OPQA 3VP3A 3MQ0A 5EV0A 3VFFA 5HWWA 1JVJA 3IF6C 4GS9B 3MXQA 3IH9A 3M2JA 1ES3A 4B88A 2Y2MA 4ZAMA 3V5MA 1SHVA 3M6HA 1QMEA 2ZM0A 2Y8HA 1TDLA 3MXSA 5CGXA 4BLMA 2QKPA 3FZCA 1E4DA 1NZOA 3D4FA 1YLWA 3MFDA 2J9PA 3LGOA 5GHZA 3VFHA 4EUVA 2QMIA 3UPNA 4X55A 1ZHHB 3WS2A 4NEED 3T1SA 3IWIA 2Y2OA 4HI4A 4Y2FA 5E2FA 3NDEA 2HJ9C 1XXMA 1DY6A 2WUQA 5GLCA 5A93A 4YNRA 4I3IA 3BJNA 3OCNA 3EQVA 4WMCA 2JHEA 2ZQ9A 5F83A 5DJTA 3G34A 3IF6B 1DJBA 5IU1A 3F1OA 1GA9A 3GRJA 4N1XA 1LL5A 4GCZA 4EWFA 2W1RA 4EQIA 4YINA 3NOTC 4PHTA 1NJ4A 5MC7A 1WE4A 1XA7A 2ZC7A 3IXHA 1L0FA 2W3FA 2I9VA 3HUMA 1LSVA 4RX3A 3HLFA 3TE8A 5L07A 4DMZA 1K25A 1ALQA 4WMCD 1GHPA 5KZHA 1OJGA 2WKEA 5DTTA 2R9WA 4R6LA 3KSGA 1S67L 4U0XA 3V50A 4U3TA 1YMSA 1FIKA 2V0UA 1L3LA 2IA2A 2R9XA 1L0GA 1AXBA 2OLUA 4S2LA 2C6WB 2OWHA 5AQ7A 1YLTA 1KVLA 1G68A 3JVVA 5HW3A 4R3AA 4HEFA 4O7DA 3UMEA 5EM1A 2GDNA 3A0SA 3TSGA 3SZTA 3KSFA 2G7UA 3UE0A 3QP2A 1XP4A 4JF4A 1CEFA 3H7WB 4MN6A 1KGFA 1YKDA 2G2UA 1NZUA 4K08A 3R4KA 1IYPA 2Y2IA 3CJMA 4BQMA 4Y0OA 4OPZA 2XLNA 1PFLA 2HV1A 4OP5A 3BFCA 2P9VA 5F82A 1TS6A 1XFQA 1BLCA 3CUEC 4UA6A 3CMZA 1IYOA 4HHDA 3BLSA 1DP8A 2ZM8A 5CRFA 4WEKA 5FASA 3O88A 2C5WB 1JTDA 3QP5A 4UQIM 4EXOA 1SDNA 4A5RA 1V9YA 1M40A 4WELA 4OH0A 1ES2A 3R7WB 4DDSA 4X1MA 2Y2NA 3VOZA 3HLBA 3E2LA 4BJPA 3JVUA 3GSGA 3TW8A 3UE3A 5DTKA 3T50A 4JLFA 4I38A 4QY6A 4HBUA 3GDIA 3VP2A 3MR0A 5F68A 4YFMA 3LR0A 4WZ5A 2VEAA 3IQAA 1LSWA 2VV8A 3A3DA 4DE1A 5GL9A 3UMDA 1HLUP 5DFYA 3UB7A 2P74A 4FD8A 2A3UA 4MBHA 3NJAA 4YOFA 1L0DA 4X53A 2OAQ1 2ZC4B 4BWIA 5LBRA 1SKOB 4QWOA 4ZJ3A 3RXXA 2XD5A 3QP4A 4JGPA 4GB7A 2H28A 1FILA 4WZ5C 3C38A 5EVIB 4M4XA 2P04A 1I2SA 4KQOA 4BD0A 1BULA 2JKFA 4WL9A 3N7WA 1KGGA 1TEMA 4WYYA 4IBXA 3G31A 1D7EA 4C75A 5HSQA 4HP9A 2PT7A 4Z1WA 2J9OA 2DNSA 5KSHA 5HWVA 1MKMA 3AGFA 3ZDJA 4EEPA 3G2ZA 1XFNA 1PRQA 3L9KA 2Y2GA 1IYSA 2VV7A 2PD8A 4OOMA 4NKPA 4GHIB 3MF0A 3PBNA 5L10A 1SKOA 1CQAA 2QJ5A 2GJ3A 4LRZE 4MBFA 4X56A 3O3VA 4Y0UA 3DWZA 5AJGA 4HNBA 2EA9A 1ERMA 5HAQA 5F5YA 2M1CA 4LGWA 4JGOA 4P6ZS 3WS4A 4M3KA 1YQSA 4S2IA 2DMWA 2XROA 1LLBA 3CAXA 3ZNYA 3CG5A 5E2GA 3OC2A 1SZVA 2EX9A 3Q81A 5HPFA 2BTFP 3DAVA 4Y0TA 2PRFA 2W1TB 4OKPA 2EFXA 3P09A 3BFFA 3ZFZA 2PYRA 2PR6A 4IUHA 4KUOA 1OTIA 2DCFA 3HJIA 1ZKJA 2WKIA 4UAAA 2Y2QA 4QU3A 1BLSA 1F98A 1PWDA 1OPXA 2XF3A 3PTEA 4FH4A 1K57A 3LFVA 1AWIA 2L1MA 4ARZA 4EUZA 4RX2A 1P9WA 1H8MA 2CC1A 4JXSA 2O9AA 3UY6A 1EI5A 3RFBA 4HBTA 3IX4A 1MY8A 3VSLA 1X0OA 3T1XA 5G18A 3NCKA 5FQQA 3MMHA 4WM9A 1GSXA 5BOHA 3MXRA 3S22A 1F5MA 3MZDA 2WKQA 1S1ZA 2INWA 3NECA 3M6BA 5FAQA 1Y4OA 5GHYA 1LT0A 3IT9A 1PIOA 5DKLA 5FATA 4Y3IA 4EV4A 1FOFA 4HP4A 4K91A 4R3JA 2WZZA 2XR0A 5F1FA 4ZJ1A 2XH9A 4GJ4A 4DJ3A 3LCEA 3MZEA 4IEDA 1N9NA 4EBNA 3C30A 1ERQA 2H5SA 4GNUA 1OJ5A 1K4EA 3FWLA 1HTZA 4I39A 2Y59A 3E4OA 3UB5P 5KSCA 3HLDA 3W2ZA 2YKHA 3VOYA 1K4FA 3KSHA 4PM6A 3ZCZA 1IOUA 2V8CA 4R23A 5EVLA 3T4JA 4MNRA 5EPHA 4Q0JA 5TJJA 2EWWA 2ZQAA 3ZG0A 2PYPA 1ODVA 4D2OA 4L9GA 4PKYG 3C4OA 3ISGA 1ZG4A 2X02A 3RTYA 2KX6A 3ITAA 1CK3A 3LUQA 4IJGA 3GV9A 3Q7ZA 5DVAA 3SH9A 5IT5A 1UGUA 4Y7PA 1PI4A 1H8YA 4QPRA 3A3FA 5TR7A 4OQIA 4H8RA 4PPRA 2D02A 2ZMAA 4BL2A 1MWSA 2ZL1B 1G6OA 4CQHA 2Z2MB 1K57C 3LEZA 2JE5A 1TD5A 4UQIS 2HP5A 3EEAA 3QP6A 3HLGA 3BQAA 3S7QA 4ZTKA 1OMEA 2ZQCA 4OPRA 1S4RA 1ONGA 4HQAA 4II7A 2FZ0A 4E04A 3C5AA 1PYYA 3IWOA 3N8SA 3F1NA 4DE0A 1KDSA 5AQAA 4NK3A 2XRNA 2ZBBA 3B33A 4F3LB 4LENA 1MWUA 3V3SA 4L9FA 4O8GA 2K31A 4WF0A 3PXPA 3ULFA 1J3WA 3HUOA 4IVIA 5FA7A 1DRMA 3LEQA 2XFTA 1YMXA 3UDXA 1SKFA 3CUEA 4QY5A 4ARZB 1XKZA 3K2NA 3ZHHA 1Z09A 4JPMA 2JN7A 5JYPA 1EROA 2JKTI 3IBJA 4E3MA 3FG8A 1E3UD 4BMWA 3MQQA 2D01A 1K56A 1PZPA 5HL6A 2EX6A 4G3VA 2XK1A 3PYPA 3FC7A 2HPBA 3BW6A 3BECA 3O87A 3OPLA 2PBYA 4B4ZA 5A91A 2ZC5B 3RXWA 4P0MA 2ZM2A 5GLDA 3T1RA 3EQUA 3C2WA 4R70A 3K3CA 3LR3A 3G32A 2DRWA 2GNXA 4UA9A 4FUWA 3T1QB 3MZFA 4DXBA 1G5UA 1JWZA 3MBZA 1K0KA 3OPHA 1GSWA 4FSFA 2XQZA 3KYEA 1E3UA 4HIAA 4E3IA 4PM5A 2VZWA 4R4RA 2WAEA 5L09A 1BUEA 3KX0X 5G4ZA 3T4LA 2QZ6A 4NG2A 1JWPA 3PAGA 4BBVA 4HJ4A 3A3EA 1VM1A 2W1TA 4K0WA 3UNWA 1IEMA 3DTIA 2P08A 3WS1A 3VP1A 3WWXA 2LB5A 2ZQ7A 1NRFA 2GZAA 5CHJA 1S66L 4JXGA 1S1YA 1W63M 2KDKA 1P9RA 4AFIA 2P7JA 4BL3A 1XGIA 5A92A 3ITBA 3OLOA 2Q0OA 4B4XA 3VP4A 2ZMVA 2PBDP 3QP1A 5HDDA 1K6RA 3SS5A 2V1BA 1N9BA 1S6RA 4R4SA 5FI7A 4LCMA 5FQJA 1T19A 1TVFA 3IS2A 4KZ5A 3IF6A 4KZ8A 3RH8B 3IXDA 1S0WA 1QMFA 2W3HA 2HP9A 1NY0A 4HH3A 3WS0A 4EESA 3L7HA 1VEUB 4WLAA 1TF1A 3Q07A 3UB8A 2VJWA 3NHQA 3UPPA 1C3BA 1N4OA 2NUPC 4KZAA 3D9YA 2ZMFA 3ZG5A 1MC0A 2ZQDA 1TS7A 3HCYA 4RVAA 2PAVP 3NIAA 1NXYA 5FQKA 4R38A 2M7UA 2Q9NA 4N1HA 3VP0A 2IWCA 2QHKA 5FQMA 5DF7A 3LI9A 1V9ZA 4IUKA 2XGNA 3UB6A 2EWVA 2GX5A 5EVIC 2L0WA 4LV0A 4XUZA 5FSRA 4ZRRA 2O9CA 1NRJA 1MXOA 1LSXA 5TFQA 3IX3A 3P98A 1DP6A 3NBLA 3I7JA 3H9WA 3ICYA 3A0RA 3SW1A 2VKSA 3LR4A 3V3RA 1L2SA 4S2MA 3HREA 1K54A 1DJCA 4Q0HA 1IYQA 3JPUA 3U4LP 3C7VA 1TDGA 2JKRI 2J7VA 1YLJA 3EGXC 5K5BA 2A2LA 3ZG7B 3M2KA 3LO7A 3HBRA 3PBSA 4CLCD 3LIAA 2ZD8A 2BLSA 4KZ7A 2HDRA 1YAXA 1ONHA 1YLZA 1FQGA 4OLGA 4DN0A 5CEDA 2VGKA 4ESPA 1RGZA 2A24B 2Y2HA 3FPVA 1OTBA 4U0TA 1OT9A 1VETA 4OPYA 2ZQ8A 1FCNA 2Y2KA 3LIEA 1LL8A 4E6XA 3VE4A 4WBGA 1SDEA 4NXFA 5FDHA 3DW0A 1XJ2A 3GECA 3TG9A 5IHVA 2FH5A 4K0XA 3E4PA 5TGFA 2OLVA 3Q1FA 5HAIA 4OOLA 3T4TA 4JGQA 3CPTB 4X68A 3N4IA 3LY4A 3IHBA 2M7VA 4GHIA 3GVBA 1XPBA 5CTNA 4Z9QA 2O99A 4WEJA
chains in the Genus database with same CATH topology
3CLOA 2CMNA 1IOUA 4HI4A 3T4JA 4Y2FA 4EEUA 4Q0JA 5TJJA 2HJ9C 2EWWA 2VGLM 2WKPA 2PYPA 1ODVA 4L9GA 4YNRA 4PKYG 4I3IA 3BJNA 4EERA 3OCNA 5DF9A 3EQVA 2J3WA 5DFXA 2JHEA 3CITA 3RTYA 5DJTA 2KX6A 2VX8A 2W3DA 5L8MA 3VE3A 3LUQA 4O01A 5IU1A 3F1OA 4IJGA 1F9IA 2XA7S 5J7EA 4HOIA 5HZHA 4G3WA 3K3DA 1XJ6A 4GCZA 5IT5A 2O9BA 1T1BA 1UGUA 2W1RA 3ZYTA 2JKRM 4BBTA 3NOTC 4KUKA 4PHTA 4ME4A 3F1NB 4QPRA 2B02A 2VV6A 4NXEA 5CX7A 5MC7A 1NWZA 1OTDA 2D02A 4PKYA 3D72A 1XJ4A 1S4SA 2PD7A 2W3FA 3H82B 1G6OA 2I9VA 3OCLA 1T1CA 4CQHA 3S7NA 1LSVA 2A24A 3P01A 1TD5A 4UQIS 2LB9A 2BASA 3TE8A 4DMZA 3EEAA 2VA0A 3BQAA 3S7QA 4HJ6A 3H7WA 4CLCB 1OJGA 1W63Q 4BBUA 4R6LA 3KSGA 1S67L 1S4RA 4HQAA 4II7A 3TJZC 1N9OA 2V0UA 3KYQA 2IA2A 2FZ0A 4E04A 2HGVA 3VOLA 4ETZA 4CLCC 1OT6A 5G4YA 3T4QA 3F1NA 4EU0A 2OWHA 3T4SA 2XRNA 3PBTA 1YSPA 2MJ6A 3NOUC 3LR5A 3OOVA 2ZBBA 3B33A 2Z6DA 4F3LB 3U2AA 3JVVA 3E4QA 3B42A 3C8CA 4L9FA 4O8GA 1TS0A 2K31A 4R3AA 3F1PB 4WF0A 3UMEA 3PXPA 3ULFA 3A0SA 5F6AA 3A0VA 3KSFA 3PBOA 4NXGA 1DRMA 2G7UA 1UWPX 4DJ2A 3P7NA 3H7WB 4MN6A 1P97A 1YKDA 5TBMB 5I5LA 1MZUA 3LI8A 3MQOA 5FL3A 4L9EA 3CUEA 4K08A 3R4KA 4YWZA 4FOFA 4ARZB 4NXBA 3K2NA 2K7SA 2HV1A 4H6JA 4LPZA 3PR6A 2JN7A 5DKKA 5HDSA 1TS6A 2JKTI 3IBJA 1XFQA 3FG8A 3NOPC 4BMWA 3MQQA 3CUEC 4MMNA 2D01A 3F1OB 4HHDA 4G3VA 5HL6A 2PHYA 3T4KA 3PYPA 1DP8A 3FC7A 4WEKA 3BW6A 2L4RA 3G6OA 1T1AA 4UQIM 4EXOA 1V9YA 4WELA 2O0YA 4WUJA 1BYWA 3TRCA 3EQUA 3C2WA 4R70A 1D06A 3R7WB 3K3CA 3LR3A 3ZQ5A 2GNXA 3VV4A 2K2NA 4BJPA 3JVUA 3TW8A 2QWSA 3UE3A 2YKFA 2V0WA 1GSWA 3LIDA 3MFXA 4FSFA 4Q0IA 3T50A 3EWKA 4P6ZM 4CLCA 4I38A 4HIAA 5HPIA 2VZWA 3E0YA 2ZOIA 3KX0X 3GDIA 2J3TD 5G4ZA 3IS2B 3T4LA 3MR0A 5F68A 3IBRA 3LR0A 3UB9A 2PDRA 2WKRA 2VEAA 4BBVA 1LSWA 4HJ4A 2VV8A 3BY9A 4G3KA 2W3EA 2W1TA 2VGLS 4LRYC 4MCWA 2P08A 5J4EA 3EEHA 3O5YA 3UMDA 1ZTUA 2LB5A 2GZAA 1H3QA 1S66L 4Y5FA 2V9AA 1S1YA 1W63M 5F69A 5DFYA 3UB7A 3BY8A 2KDKA 5HDCA 1P9RA 4AFIA 2P7JA 3F1PA 4WN5A 3OLOA 1IFQA 4B93A 2ZMVA 3NJAA 4YOFA 1T18A 5HDDA 1GSVA 2V1BA 4L0LA 1OTEA 3V67A 5KIZA 2OAQ1 1NLYA 4LLOB 4BWIA 2VLGA 2J3TC 5LBRA 5A8BA 3PHYA 2J80A 1T19A 4JGPA 3IS2A 2H28A 2HJEA 2ZOHA 4GLQA 4GW9A 5DJUA 2QJ7A 2XA7M 3C38A 4I3AA 4M4XA 1WA9A 2P04A 3S7PA 3LYXA 4KQOA 3RH8B 3EGDC 4WL9A 2W3HA 4I5SA 4HH3A 4RQ9A 4EQ1A 4EESA 1D7EA 4UEYA 5HSQA 4XT2B 4HP9A 2W27A 2PT7A 4Z1WA 5IS1A 5KSHA 5HWVA 2B18A 2V1AA 3CI6A 3DBAA 1TF1A 3H82A 1MKMA 2W0NA 3KO6A 4WLAA 1DP9A 3UB8A 2VJWA 3NHQA 2NUPC 4EEPA 1XFNA 4GS9A 2ZMFA 1UWNX 2VV7A 3FPWA 1MC0A 2PD8A 3BQ8A 4OOMA 4NKPA 4GHIB 5C5KA 3UE6A 1TS7A 3HCYA 1XJ3A 3PBQA 3MF0A 4ETXA 3PBNA 3R7WA 3T4OA 4MDZA 4R38A 2M7UA 2OOLA 2QJ5A 2GJ3A 2QHKA 2JKTM 4LRZE 3LI9A 1V9ZA 4IUKA 2Z6CA 5AJGA 4HNBA 3UB6A 2EA9A 2XSSA 1TS8A 1EW0A 2EWVA 2GX5A 5F5YA 2M1CA 4MN7A 2L0WA 4JGOA 4P6ZS 4CLCE 1JNUA 4ZRRA 2O9CA 1NRJA 5J3WA 2DMWA 1LSXA 3LIBA 4XT2A 3CAXA 2XROA 3OC2A 4F3LA 2W3GA 2R78A 5HPFA 4I3JA 2W1TB 4EETB 1DP6A 1OTAA 3H9WA 3ICYA 2PYRA 3CWFA 2PR6A 4IUHA 2PR5A 3BWLA 3A0RA 4KUOA 3SW1A 1P0ZA 2VKSA 2KOIA 1OTIA 4EW7A 3LR4A 5AVFA 3HJIA 1NLZA 5HD5A 5AVEA 1F98A 4Q0HA 5TBMA 1OPXA 3B47A 4IHQA 1N9LA 1YSQA 3LFVA 2JKRI 1VB6A 2L1MA 4ARZA 3EGXC 1G28A 5K5BA 2A2LA 4KQDA 1P9WA 1H8MA 4H6JB 2O9AA 3HJKA 3EOIA 4HY8A 3RFBA 2HF6A 3LICA 4LRXC 1X0OA 2NUTC 3PBSA 4CLCD 4HJ3A 3LIFA 3LIAA 3E98A 1YAXA 5EFWA 4HH2A 1STZA 3MMHA 2OAP1 4MN5A 4DN0A 3OBFA 1GSXA 3S7OA 1F5MA 2A24B 2WKQA 4B9OA 1S1ZA 3FPVA 2INWA 2Y79A 1OTBA 2OWJA 1OT9A 2KLIA 3MQ0A 5HWWA 5HWTA 1LT0A 3LIEA 4GS9B 1LL8A 3MXQA 5DKLA 3VE4A 4Y3IA 4HP4A 4NXFA 1XJ2A 3GECA 3KYZA 4GJ4A 2Y8HA 4DJ3A 1VHMA 2FH5A 3E4PA 4PAUA 2QKPA 1N9NA 3PBRA 3C30A 4OOLA 3MJQA 3T4TA 1OJ5A 4JGQA 4O0PA 1KOUA 1Y28A 4EUVA 4I39A 2M7VA 4JGRA 4GHIA 3KSIA 1ZHHB 3E4OA 2QYBA 5HD3A 4NEED 3W2ZA 3D3OA 2YKHA 2O99A 3KSHA 4WEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YOF A;  4Y2F A;  1YKD A;  4Q0J A;  5TJJ A;  4Q0H A;  5I5L A;  4BWI A;  4YNR A;  3R4K A;  3BJN A;  5LBR A;  1YSQ A;  3LFV A;  4FOF A;  5DFX A;  3K2N A;  3CIT A;  4GW9 A;  5K5B A;  4GLQ A;  2W3D A;  5L8M A;  2O9A A;  4O01 A;  3S7P A;  4IJG A;  3RFB A;  4LRX C;  3IBJ A;  4G3W A;  2O9B A;  2G7U A;  3NOP C;  3E98 A;  2W1R A;  4MMN A;  3NOT C;  2W3H A;  4ME4 A;  5HL6 A;  4G3V A;  4QPR A;  4RQ9 A;  1STZ A;  3MMH A;  4DN0 A;  3OBF A;  5HSQ A;  3S7O A;  4Z1W A;  3G6O A;  1F5M A;  2B18 A;  3CI6 A;  3DBA A;  1TF1 A;  1MKM A;  2W3F A;  3KO6 A;  2VJW A;  3NHQ A;  4CQH A;  2O0Y A;  2Y79 A;  3S7N A;  2ZMF A;  3TRC A;  2KLI A;  3C2W A;  1TD5 A;  2LB9 A;  4R70 A;  4DMZ A;  3EEA A;  1MC0 A;  3MQ0 A;  3ZQ5 A;  3VV4 A;  5C5K A;  2K2N A;  3HCY A;  3S7Q A;  3MF0 A;  4ETX A;  4Y3I A;  4MDZ A;  2M7U A;  2OOL A;  4R6L A;  3KSG A;  4Q0I A;  4LRZ E;  5HPI A;  2VZW A;  4IUK A;  3E0Y A;  5AJG A;  2IA2 A;  4E04 A;  2XSS A;  2Y8H A;  2HGV A;  1VHM A;  3IBR A;  4ETZ A;  2GX5 A;  4MN7 A;  4PAU A;  2VEA A;  4EU0 A;  4ZRR A;  2O9C A;  2XRN A;  4G3K A;  2W3E A;  1YSP A;  2XRO A;  3NOU C;  2W1T A;  3OOV A;  4LRY C;  4MCW A;  3O5Y A;  4O0P A;  2W3G A;  1ZTU A;  5HPF A;  2LB5 A;  4EUV A;  2M7V A;  4O8G A;  2K31 A;  3KSI A;  2W1T B;  4Y5F A;  2QYB A;  5DFY A;  3W2Z A;  3D3O A;  2O99 A;  3KSF A;  3KSH A;  4IUH A;  2VKS A;  2KOI A; 
#chains in the Genus database with same CATH topology
 3CLO A;  3OPR A;  1BT5 A;  2Y2P A;  2VGL M;  2WKP A;  4JXV A;  2ACG A;  5M1A A;  4FH2 A;  1ES4 A;  4FTX A;  1F2K A;  2J3W A;  5DFX A;  1VQQ A;  3HVF A;  4OLD A;  1MKI A;  2W3D A;  1PW1 A;  1PNE A;  3VE3 A;  4O01 A;  1F9I A;  2XA7 S;  2XD1 A;  3V39 A;  2O9B A;  3HLW A;  3BYD A;  2JKR M;  4ME4 A;  2B02 A;  1NYM A;  2WK0 A;  1MBL A;  4CPK A;  5CX7 A;  1OTD A;  3D72 A;  2PD7 A;  4R3B A;  1T1C A;  4IBR A;  2Y2J A;  3S7N A;  4OVD A;  1GCE A;  5CEC A;  2ZJ9 A;  3GQZ A;  4PM7 A;  1BSG A;  4CJN A;  1HVB A;  4KZ3 A;  4HJ6 A;  3H7W A;  4CLC B;  2E8I A;  3FV7 A;  4BBU A;  4X69 A;  3TJZ C;  1N9O A;  1H0M A;  1K55 C;  4JF6 A;  3VOL A;  4CLC C;  1OT6 A;  3T4S A;  3SS4 A;  3NOU C;  4GKU A;  4X1L A;  3OOV A;  4PM8 A;  2JC7 A;  3U2A A;  1O07 A;  3E4Q A;  3B42 A;  3C8C A;  1TS0 A;  1IKG A;  3F1P B;  3GMW A;  1LI0 A;  5F6A A;  1CEG A;  3A0V A;  4GOG A;  3P7N A;  1WYB A;  1P97 A;  5TBM B;  5I5L A;  4YWZ A;  3WRZ A;  3BLM A;  4Y15 A;  1FSY A;  4FOF A;  2K7S A;  1JTG A;  4OON A;  3RJU A;  1J9M A;  4C3Q A;  4LV2 A;  5FEF A;  1SCW A;  4MEZ A;  2BG1 A;  2EXB A;  2Y55 A;  4MMN A;  3VMA A;  5CER A;  3QHY A;  2PHY A;  3T12 B;  5U47 A;  5FDS A;  2V8F A;  3MKE A;  5J8X A;  3AGE A;  1NYY A;  3W4O A;  1BLH A;  1T1A A;  2B5R A;  4WUJ A;  1BYW A;  2ZL1 A;  4UHU A;  3VV4 A;  2K2N A;  4C6Y A;  1I5Q A;  2Y4A A;  2YKF A;  2V0W A;  1IEL A;  3N8R A;  4Q0I A;  3EWK A;  4P6Z M;  3GTC A;  4JF5 A;  4Y17 A;  3E0Y A;  3SH8 A;  2ZOI A;  4GD6 A;  4KQQ A;  3QNC A;  2WGW A;  3Q82 A;  2WKR A;  2I72 A;  2JKG A;  4XXR A;  4MBK A;  4QD4 A;  4G3K A;  5F1G A;  2JCH A;  2XEP A;  2VGL S;  4LRY C;  4MCW A;  4E3O A;  3BEB A;  3EEH A;  3O5Y A;  1ZTU A;  3SOI A;  4S2K A;  4E3J A;  1FCO A;  2V9A A;  3G30 A;  2EX2 A;  5F69 A;  5HAP A;  1DJA A;  5EE8 A;  4IVK A;  3SH7 A;  4ID4 A;  1KE3 A;  3W4Q A;  4DF6 A;  1GSV A;  3V67 A;  4L0L A;  1W7F A;  5KIZ A;  4LCL A;  1NLY A;  4E6W A;  3ZVW A;  2J3T C;  2E8J A;  3HUN A;  4PMA A;  2J80 A;  1IKI A;  2ZOH A;  4GW9 A;  4S2P A;  1ESI A;  4R1G A;  1FR6 A;  5CGW A;  3S7P A;  1WA9 A;  1BTL A;  3EGD C;  1Q2P A;  5JYO A;  1FCM A;  4I5S A;  5HFO A;  4GD8 A;  2V1Z A;  4UEY A;  4XT2 B;  5IS1 A;  1KE0 A;  4OP8 A;  2V1A A;  3DBA A;  1VET B;  1DP9 A;  3A3J A;  1FR1 A;  4GS9 A;  3FKW A;  1UWN X;  2EXA A;  5C5K A;  1XJ3 A;  4S2J A;  4ETX A;  3T4O A;  2ZLY A;  3BFD A;  5HAR A;  4HES A;  5CEB A;  5EVI A;  5D3O A;  5GLA A;  3Q7V B;  3GR2 A;  3N8L A;  1HD8 A;  2HZ5 A;  5FAO A;  4FCF A;  3ZVT A;  4CLC E;  1JNU A;  5J3W A;  4XT2 A;  3S1Y A;  2HP6 A;  1E25 A;  4F3L A;  3C4P A;  4RA7 A;  4I3J A;  4D60 A;  4EET B;  1M6K A;  1OTA A;  2HDU A;  1XGJ A;  5CGS A;  5GHX A;  3CWF A;  3BWL A;  1P0Z A;  1PWC A;  4EW7 A;  4XUX A;  4N9K A;  5M19 A;  1NLZ A;  5HD5 A;  4N92 A;  5EVI D;  2UWX A;  1KDW A;  3DTE A;  2HDQ A;  3UDF A;  1LI9 A;  5FQI A;  1N9L A;  1YSQ A;  1G28 A;  2ZC6 B;  4H6J B;  3EOI A;  3G35 A;  1BLP A;  4LRX C;  1RP5 A;  3OPP A;  2WYX A;  3G2Y A;  3LIF A;  3E98 A;  3NI9 A;  4NET A;  3HLE A;  4QHC A;  5DF8 A;  5HX9 A;  4S2N A;  4WZ4 A;  4HH2 A;  1STZ A;  3OBF A;  5CTM A;  2OSU A;  4KG5 A;  1YLY A;  3NY4 A;  3ZG9 B;  4B9O A;  3ZGA B;  2Y79 A;  1KVM A;  2KLI A;  2QPN A;  1G6A A;  5HWT A;  4JXW A;  4S2N C;  3QP8 A;  2PU4 A;  3KYZ A;  4E3N A;  4P6B A;  1K56 D;  1ACF A;  1MPL A;  3LY3 A;  1VHM A;  4KG6 A;  1MWT A;  4N9L A;  4PAU A;  4ZBE A;  4P87 A;  3AGD A;  3PBR A;  1U60 A;  3MJQ A;  5CHU A;  1CI8 A;  3C7U A;  4KQR A;  2IWB A;  4O0P A;  1KOU A;  1Y28 A;  4JGR A;  2VGJ A;  1CF0 A;  3KSI A;  4ZDX A;  2QYB A;  5HD3 A;  5FAP A;  2H0Y A;  3D3O A;  2CMN A;  2OV5 A;  4EEU A;  3MKF A;  4X6T A;  4EER A;  3WS5 A;  2WAD A;  3NC8 A;  5DF9 A;  5CXW A;  3CIT A;  3O86 A;  2VX8 A;  5L8M A;  3QNB A;  2X01 A;  5J7E A;  4HOI A;  5HZH A;  4G3W A;  3K3D A;  1XJ6 A;  1T1B A;  3S4X A;  1L0E A;  3ZYT A;  4BBT A;  4KUK A;  3ZNT A;  3F1N B;  2VV6 A;  3MSH A;  4NXE A;  1I2W A;  1W5D A;  1NWZ A;  4PKY A;  1XJ4 A;  1S4S A;  2WZX A;  4E3L A;  3H82 B;  3OCL A;  2B95 A;  5E43 A;  2H10 A;  4OQ0 A;  2A24 A;  5GLB A;  3P01 A;  2LB9 A;  2BAS A;  2VA0 A;  3BRM A;  4GN2 A;  4MLL A;  1K6S A;  4X25 A;  1W63 Q;  3IX8 A;  2AVX A;  1D1J A;  3KYQ A;  5FEG A;  2HGV A;  4ETZ A;  3IH8 A;  2Z2L B;  5G4Y A;  3T4Q A;  1ESU A;  3DTM A;  4EU0 A;  3PBT A;  2EX8 A;  1YSP A;  4RYE A;  2MJ6 A;  3LR5 A;  2Z6D A;  2RL3 A;  3TOI A;  5AQ9 A;  4F94 A;  2PU2 A;  4GDB A;  2Y91 A;  3SS3 A;  3PBO A;  1ZG6 A;  4NXG A;  4OQH A;  4OOY A;  1UWP X;  4DJ2 A;  3IWQ A;  4S2O A;  1MZU A;  3LI8 A;  3MQO A;  5FL3 A;  2IWD A;  4L9E A;  1PI5 A;  4GZB A;  1XX2 A;  1ES5 A;  1PZO A;  4NXB A;  3VSK A;  1Z6F A;  4H6J A;  4LPZ A;  3PR6 A;  1CJF A;  2VK3 A;  5DKK A;  5HDS A;  3CPT A;  2H0T A;  1H8Z A;  3NOP C;  4OQG A;  3CHW P;  1BZA A;  1A0K A;  2FFY A;  3F1O B;  5L2F A;  3T4K A;  2RCX A;  1GHM A;  1W8Y A;  4DE3 A;  2A49 A;  2HDS A;  2L4R A;  2XFS A;  3G6O A;  4UA7 A;  5FI2 A;  2O0Y A;  3G4P A;  4KZ4 A;  3W4P A;  3TRC A;  1D06 A;  3WRT A;  3ZQ5 A;  2V2F F;  2X71 A;  4JBF A;  2V20 A;  3UPO A;  4LFU A;  4Y13 A;  2QWS A;  3LID A;  3MFX A;  3Q7V A;  3DWK A;  4PM9 A;  4CLC A;  5HPI A;  3W8K A;  5CHM A;  1K38 A;  2J3T D;  3UE1 A;  3IS2 B;  3UDI A;  2Y2L A;  3IBR A;  3UB9 A;  2PDR A;  2XDM A;  1ZC2 A;  1FSW A;  3B3X A;  1PW8 A;  3BY9 A;  2W3E A;  5J4E A;  4LV1 A;  3CZD A;  4QJG A;  2WGI A;  1VEU A;  1H3Q A;  4Y5F A;  4KZB A;  1EWZ A;  1LL9 A;  3BY8 A;  5HDC A;  1WYC A;  3MS6 A;  3F1P A;  3OZH A;  4WN5 A;  5I94 A;  1IFQ A;  2WAF A;  3UO9 A;  4Q8I A;  4B93 A;  1Q2Q A;  1T18 A;  2WKH A;  4QB8 A;  1OTE A;  3FKV A;  4LLO B;  1K54 C;  2VLG A;  3BFE A;  3BM6 A;  5A8B A;  3PHY A;  1HZO A;  5EOE A;  2HJE A;  4BD1 A;  4GLQ A;  5DJU A;  2QJ7 A;  1YPR A;  5FQ9 A;  2XA7 M;  4I3A A;  3LYX A;  4R0Q A;  1Y54 A;  4EQ1 A;  4RQ9 A;  5KMW A;  1LHY A;  5FI6 A;  3BFG A;  2W27 A;  4E3K A;  4EBP A;  1RCJ A;  2B18 A;  3CI6 A;  5EUA A;  3H82 A;  2W0N A;  3KO6 A;  1W8Q A;  4KZ9 A;  3ZG8 B;  4LV3 A;  5EM0 A;  5A90 A;  3IHA A;  4KZ6 A;  5EVE A;  3FPW A;  1MWR A;  2J8Y A;  3BQ8 A;  5DTS A;  3UE6 A;  3DTK A;  3HL9 A;  5E2H A;  1H5X A;  1GHI A;  3PBQ A;  1KE4 A;  3R7W A;  2P9V B;  4ZJ2 A;  4MDZ A;  2OOL A;  3IF5 A;  2JKT M;  3HLC A;  2Z6C A;  1YM1 A;  5E2E A;  2XSS A;  3NUL A;  1TS8 A;  1EW0 A;  4BEN A;  4MN7 A;  2Q9M A;  2WGW B;  3LIB A;  2WGV A;  2ZC3 B;  1CI9 A;  2W3G A;  2R78 A;  1YLP A;  1K55 A;  5EOO A;  3FYZ A;  2EFU A;  4DDY A;  2PR5 A;  3NDG A;  2KOI A;  5AVF A;  1XA1 A;  4DRT A;  3A3I A;  5AVE A;  3PAE A;  4GDN A;  4DKI A;  1PWG A;  5TBM A;  2UV0 E;  3B47 A;  4IHQ A;  4EBL A;  5M18 A;  2G2W A;  1KGE A;  1VB6 A;  4DE2 A;  1GA0 A;  4JKT A;  4KQD A;  1YT4 A;  4P85 A;  3HJK A;  4HY8 A;  1JWV A;  2HF6 A;  3LIC A;  4KG2 A;  1W79 A;  3JYI A;  3IXB A;  2NUT C;  3UN7 A;  4HJ3 A;  3IXG A;  5AQB A;  5EFW A;  3N6I A;  5EEC A;  2JBF A;  2OAP 1;  4MN5 A;  3E2K A;  5HL1 A;  3S7O A;  1O7E A;  4DXC A;  2FFF B;  1RGY A;  2OWJ A;  4KEN B;  4OPQ A;  3VP3 A;  3MQ0 A;  5EV0 A;  3VFF A;  5HWW A;  1JVJ A;  3IF6 C;  4GS9 B;  3MXQ A;  3IH9 A;  3M2J A;  1ES3 A;  4B88 A;  2Y2M A;  4ZAM A;  3V5M A;  1SHV A;  3M6H A;  1QME A;  2ZM0 A;  2Y8H A;  1TDL A;  3MXS A;  5CGX A;  4BLM A;  2QKP A;  3FZC A;  1E4D A;  1NZO A;  3D4F A;  1YLW A;  3MFD A;  2J9P A;  3LGO A;  5GHZ A;  3VFH A;  4EUV A;  2QMI A;  3UPN A;  4X55 A;  1ZHH B;  3WS2 A;  4NEE D;  3T1S A;  3IWI A;  2Y2O A;  4HI4 A;  4Y2F A;  5E2F A;  3NDE A;  2HJ9 C;  1XXM A;  1DY6 A;  2WUQ A;  5GLC A;  5A93 A;  4YNR A;  4I3I A;  3BJN A;  3OCN A;  3EQV A;  4WMC A;  2JHE A;  2ZQ9 A;  5F83 A;  5DJT A;  3G34 A;  3IF6 B;  1DJB A;  5IU1 A;  3F1O A;  1GA9 A;  3GRJ A;  4N1X A;  1LL5 A;  4GCZ A;  4EWF A;  2W1R A;  4EQI A;  4YIN A;  3NOT C;  4PHT A;  1NJ4 A;  5MC7 A;  1WE4 A;  1XA7 A;  2ZC7 A;  3IXH A;  1L0F A;  2W3F A;  2I9V A;  3HUM A;  1LSV A;  4RX3 A;  3HLF A;  3TE8 A;  5L07 A;  4DMZ A;  1K25 A;  1ALQ A;  4WMC D;  1GHP A;  5KZH A;  1OJG A;  2WKE A;  5DTT A;  2R9W A;  4R6L A;  3KSG A;  1S67 L;  4U0X A;  3V50 A;  4U3T A;  1YMS A;  1FIK A;  2V0U A;  1L3L A;  2IA2 A;  2R9X A;  1L0G A;  1AXB A;  2OLU A;  4S2L A;  2C6W B;  2OWH A;  5AQ7 A;  1YLT A;  1KVL A;  1G68 A;  3JVV A;  5HW3 A;  4R3A A;  4HEF A;  4O7D A;  3UME A;  5EM1 A;  2GDN A;  3A0S A;  3TSG A;  3SZT A;  3KSF A;  2G7U A;  3UE0 A;  3QP2 A;  1XP4 A;  4JF4 A;  1CEF A;  3H7W B;  4MN6 A;  1KGF A;  1YKD A;  2G2U A;  1NZU A;  4K08 A;  3R4K A;  1IYP A;  2Y2I A;  3CJM A;  4BQM A;  4Y0O A;  4OPZ A;  2XLN A;  1PFL A;  2HV1 A;  4OP5 A;  3BFC A;  2P9V A;  5F82 A;  1TS6 A;  1XFQ A;  1BLC A;  3CUE C;  4UA6 A;  3CMZ A;  1IYO A;  4HHD A;  3BLS A;  1DP8 A;  2ZM8 A;  5CRF A;  4WEK A;  5FAS A;  3O88 A;  2C5W B;  1JTD A;  3QP5 A;  4UQI M;  4EXO A;  1SDN A;  4A5R A;  1V9Y A;  1M40 A;  4WEL A;  4OH0 A;  1ES2 A;  3R7W B;  4DDS A;  4X1M A;  2Y2N A;  3VOZ A;  3HLB A;  3E2L A;  4BJP A;  3JVU A;  3GSG A;  3TW8 A;  3UE3 A;  5DTK A;  3T50 A;  4JLF A;  4I38 A;  4QY6 A;  4HBU A;  3GDI A;  3VP2 A;  3MR0 A;  5F68 A;  4YFM A;  3LR0 A;  4WZ5 A;  2VEA A;  3IQA A;  1LSW A;  2VV8 A;  3A3D A;  4DE1 A;  5GL9 A;  3UMD A;  1HLU P;  5DFY A;  3UB7 A;  2P74 A;  4FD8 A;  2A3U A;  4MBH A;  3NJA A;  4YOF A;  1L0D A;  4X53 A;  2OAQ 1;  2ZC4 B;  4BWI A;  5LBR A;  1SKO B;  4QWO A;  4ZJ3 A;  3RXX A;  2XD5 A;  3QP4 A;  4JGP A;  4GB7 A;  2H28 A;  1FIL A;  4WZ5 C;  3C38 A;  5EVI B;  4M4X A;  2P04 A;  1I2S A;  4KQO A;  4BD0 A;  1BUL A;  2JKF A;  4WL9 A;  3N7W A;  1KGG A;  1TEM A;  4WYY A;  4IBX A;  3G31 A;  1D7E A;  4C75 A;  5HSQ A;  4HP9 A;  2PT7 A;  4Z1W A;  2J9O A;  2DNS A;  5KSH A;  5HWV A;  1MKM A;  3AGF A;  3ZDJ A;  4EEP A;  3G2Z A;  1XFN A;  1PRQ A;  3L9K A;  2Y2G A;  1IYS A;  2VV7 A;  2PD8 A;  4OOM A;  4NKP A;  4GHI B;  3MF0 A;  3PBN A;  5L10 A;  1SKO A;  1CQA A;  2QJ5 A;  2GJ3 A;  4LRZ E;  4MBF A;  4X56 A;  3O3V A;  4Y0U A;  3DWZ A;  5AJG A;  4HNB A;  2EA9 A;  1ERM A;  5HAQ A;  5F5Y A;  2M1C A;  4LGW A;  4JGO A;  4P6Z S;  3WS4 A;  4M3K A;  1YQS A;  4S2I A;  2DMW A;  2XRO A;  1LLB A;  3CAX A;  3ZNY A;  3CG5 A;  5E2G A;  3OC2 A;  1SZV A;  2EX9 A;  3Q81 A;  5HPF A;  2BTF P;  3DAV A;  4Y0T A;  2PRF A;  2W1T B;  4OKP A;  2EFX A;  3P09 A;  3BFF A;  3ZFZ A;  2PYR A;  2PR6 A;  4IUH A;  4KUO A;  1OTI A;  2DCF A;  3HJI A;  1ZKJ A;  2WKI A;  4UAA A;  2Y2Q A;  4QU3 A;  1BLS A;  1F98 A;  1PWD A;  1OPX A;  2XF3 A;  3PTE A;  4FH4 A;  1K57 A;  3LFV A;  1AWI A;  2L1M A;  4ARZ A;  4EUZ A;  4RX2 A;  1P9W A;  1H8M A;  2CC1 A;  4JXS A;  2O9A A;  3UY6 A;  1EI5 A;  3RFB A;  4HBT A;  3IX4 A;  1MY8 A;  3VSL A;  1X0O A;  3T1X A;  5G18 A;  3NCK A;  5FQQ A;  3MMH A;  4WM9 A;  1GSX A;  5BOH A;  3MXR A;  3S22 A;  1F5M A;  3MZD A;  2WKQ A;  1S1Z A;  2INW A;  3NEC A;  3M6B A;  5FAQ A;  1Y4O A;  5GHY A;  1LT0 A;  3IT9 A;  1PIO A;  5DKL A;  5FAT A;  4Y3I A;  4EV4 A;  1FOF A;  4HP4 A;  4K91 A;  4R3J A;  2WZZ A;  2XR0 A;  5F1F A;  4ZJ1 A;  2XH9 A;  4GJ4 A;  4DJ3 A;  3LCE A;  3MZE A;  4IED A;  1N9N A;  4EBN A;  3C30 A;  1ERQ A;  2H5S A;  4GNU A;  1OJ5 A;  1K4E A;  3FWL A;  1HTZ A;  4I39 A;  2Y59 A;  3E4O A;  3UB5 P;  5KSC A;  3HLD A;  3W2Z A;  2YKH A;  3VOY A;  1K4F A;  3KSH A;  4PM6 A;  3ZCZ A;  1IOU A;  2V8C A;  4R23 A;  5EVL A;  3T4J A;  4MNR A;  5EPH A;  4Q0J A;  5TJJ A;  2EWW A;  2ZQA A;  3ZG0 A;  2PYP A;  1ODV A;  4D2O A;  4L9G A;  4PKY G;  3C4O A;  3ISG A;  1ZG4 A;  2X02 A;  3RTY A;  2KX6 A;  3ITA A;  1CK3 A;  3LUQ A;  4IJG A;  3GV9 A;  3Q7Z A;  5DVA A;  3SH9 A;  5IT5 A;  1UGU A;  4Y7P A;  1PI4 A;  1H8Y A;  4QPR A;  3A3F A;  5TR7 A;  4OQI A;  4H8R A;  4PPR A;  2D02 A;  2ZMA A;  4BL2 A;  1MWS A;  2ZL1 B;  1G6O A;  4CQH A;  2Z2M B;  1K57 C;  3LEZ A;  2JE5 A;  1TD5 A;  4UQI S;  2HP5 A;  3EEA A;  3QP6 A;  3HLG A;  3BQA A;  3S7Q A;  4ZTK A;  1OME A;  2ZQC A;  4OPR A;  1S4R A;  1ONG A;  4HQA A;  4II7 A;  2FZ0 A;  4E04 A;  3C5A A;  1PYY A;  3IWO A;  3N8S A;  3F1N A;  4DE0 A;  1KDS A;  5AQA A;  4NK3 A;  2XRN A;  2ZBB A;  3B33 A;  4F3L B;  4LEN A;  1MWU A;  3V3S A;  4L9F A;  4O8G A;  2K31 A;  4WF0 A;  3PXP A;  3ULF A;  1J3W A;  3HUO A;  4IVI A;  5FA7 A;  1DRM A;  3LEQ A;  2XFT A;  1YMX A;  3UDX A;  1SKF A;  3CUE A;  4QY5 A;  4ARZ B;  1XKZ A;  3K2N A;  3ZHH A;  1Z09 A;  4JPM A;  2JN7 A;  5JYP A;  1ERO A;  2JKT I;  3IBJ A;  4E3M A;  3FG8 A;  1E3U D;  4BMW A;  3MQQ A;  2D01 A;  1K56 A;  1PZP A;  5HL6 A;  2EX6 A;  4G3V A;  2XK1 A;  3PYP A;  3FC7 A;  2HPB A;  3BW6 A;  3BEC A;  3O87 A;  3OPL A;  2PBY A;  4B4Z A;  5A91 A;  2ZC5 B;  3RXW A;  4P0M A;  2ZM2 A;  5GLD A;  3T1R A;  3EQU A;  3C2W A;  4R70 A;  3K3C A;  3LR3 A;  3G32 A;  2DRW A;  2GNX A;  4UA9 A;  4FUW A;  3T1Q B;  3MZF A;  4DXB A;  1G5U A;  1JWZ A;  3MBZ A;  1K0K A;  3OPH A;  1GSW A;  4FSF A;  2XQZ A;  3KYE A;  1E3U A;  4HIA A;  4E3I A;  4PM5 A;  2VZW A;  4R4R A;  2WAE A;  5L09 A;  1BUE A;  3KX0 X;  5G4Z A;  3T4L A;  2QZ6 A;  4NG2 A;  1JWP A;  3PAG A;  4BBV A;  4HJ4 A;  3A3E A;  1VM1 A;  2W1T A;  4K0W A;  3UNW A;  1IEM A;  3DTI A;  2P08 A;  3WS1 A;  3VP1 A;  3WWX A;  2LB5 A;  2ZQ7 A;  1NRF A;  2GZA A;  5CHJ A;  1S66 L;  4JXG A;  1S1Y A;  1W63 M;  2KDK A;  1P9R A;  4AFI A;  2P7J A;  4BL3 A;  1XGI A;  5A92 A;  3ITB A;  3OLO A;  2Q0O A;  4B4X A;  3VP4 A;  2ZMV A;  2PBD P;  3QP1 A;  5HDD A;  1K6R A;  3SS5 A;  2V1B A;  1N9B A;  1S6R A;  4R4S A;  5FI7 A;  4LCM A;  5FQJ A;  1T19 A;  1TVF A;  3IS2 A;  4KZ5 A;  3IF6 A;  4KZ8 A;  3RH8 B;  3IXD A;  1S0W A;  1QMF A;  2W3H A;  2HP9 A;  1NY0 A;  4HH3 A;  3WS0 A;  4EES A;  3L7H A;  1VEU B;  4WLA A;  1TF1 A;  3Q07 A;  3UB8 A;  2VJW A;  3NHQ A;  3UPP A;  1C3B A;  1N4O A;  2NUP C;  4KZA A;  3D9Y A;  2ZMF A;  3ZG5 A;  1MC0 A;  2ZQD A;  1TS7 A;  3HCY A;  4RVA A;  2PAV P;  3NIA A;  1NXY A;  5FQK A;  4R38 A;  2M7U A;  2Q9N A;  4N1H A;  3VP0 A;  2IWC A;  2QHK A;  5FQM A;  5DF7 A;  3LI9 A;  1V9Z A;  4IUK A;  2XGN A;  3UB6 A;  2EWV A;  2GX5 A;  5EVI C;  2L0W A;  4LV0 A;  4XUZ A;  5FSR A;  4ZRR A;  2O9C A;  1NRJ A;  1MXO A;  1LSX A;  5TFQ A;  3IX3 A;  3P98 A;  1DP6 A;  3NBL A;  3I7J A;  3H9W A;  3ICY A;  3A0R A;  3SW1 A;  2VKS A;  3LR4 A;  3V3R A;  1L2S A;  4S2M A;  3HRE A;  1K54 A;  1DJC A;  4Q0H A;  1IYQ A;  3JPU A;  3U4L P;  3C7V A;  1TDG A;  2JKR I;  2J7V A;  1YLJ A;  3EGX C;  5K5B A;  2A2L A;  3ZG7 B;  3M2K A;  3LO7 A;  3HBR A;  3PBS A;  4CLC D;  3LIA A;  2ZD8 A;  2BLS A;  4KZ7 A;  2HDR A;  1YAX A;  1ONH A;  1YLZ A;  1FQG A;  4OLG A;  4DN0 A;  5CED A;  2VGK A;  4ESP A;  1RGZ A;  2A24 B;  2Y2H A;  3FPV A;  1OTB A;  4U0T A;  1OT9 A;  1VET A;  4OPY A;  2ZQ8 A;  1FCN A;  2Y2K A;  3LIE A;  1LL8 A;  4E6X A;  3VE4 A;  4WBG A;  1SDE A;  4NXF A;  5FDH A;  3DW0 A;  1XJ2 A;  3GEC A;  3TG9 A;  5IHV A;  2FH5 A;  4K0X A;  3E4P A;  5TGF A;  2OLV A;  3Q1F A;  5HAI A;  4OOL A;  3T4T A;  4JGQ A;  3CPT B;  4X68 A;  3N4I A;  3LY4 A;  3IHB A;  2M7V A;  4GHI A;  3GVB A;  1XPB A;  5CTN A;  4Z9Q A;  2O99 A;  4WEJ A; 
#chains in the Genus database with same CATH homology
 3CLO A;  2CMN A;  1IOU A;  4HI4 A;  3T4J A;  4Y2F A;  4EEU A;  4Q0J A;  5TJJ A;  2HJ9 C;  2EWW A;  2VGL M;  2WKP A;  2PYP A;  1ODV A;  4L9G A;  4YNR A;  4PKY G;  4I3I A;  3BJN A;  4EER A;  3OCN A;  5DF9 A;  3EQV A;  2J3W A;  5DFX A;  2JHE A;  3CIT A;  3RTY A;  5DJT A;  2KX6 A;  2VX8 A;  2W3D A;  5L8M A;  3VE3 A;  3LUQ A;  4O01 A;  5IU1 A;  3F1O A;  4IJG A;  1F9I A;  2XA7 S;  5J7E A;  4HOI A;  5HZH A;  4G3W A;  3K3D A;  1XJ6 A;  4GCZ A;  5IT5 A;  2O9B A;  1T1B A;  1UGU A;  2W1R A;  3ZYT A;  2JKR M;  4BBT A;  3NOT C;  4KUK A;  4PHT A;  4ME4 A;  3F1N B;  4QPR A;  2B02 A;  2VV6 A;  4NXE A;  5CX7 A;  5MC7 A;  1NWZ A;  1OTD A;  2D02 A;  4PKY A;  3D72 A;  1XJ4 A;  1S4S A;  2PD7 A;  2W3F A;  3H82 B;  1G6O A;  2I9V A;  3OCL A;  1T1C A;  4CQH A;  3S7N A;  1LSV A;  2A24 A;  3P01 A;  1TD5 A;  4UQI S;  2LB9 A;  2BAS A;  3TE8 A;  4DMZ A;  3EEA A;  2VA0 A;  3BQA A;  3S7Q A;  4HJ6 A;  3H7W A;  4CLC B;  1OJG A;  1W63 Q;  4BBU A;  4R6L A;  3KSG A;  1S67 L;  1S4R A;  4HQA A;  4II7 A;  3TJZ C;  1N9O A;  2V0U A;  3KYQ A;  2IA2 A;  2FZ0 A;  4E04 A;  2HGV A;  3VOL A;  4ETZ A;  4CLC C;  1OT6 A;  5G4Y A;  3T4Q A;  3F1N A;  4EU0 A;  2OWH A;  3T4S A;  2XRN A;  3PBT A;  1YSP A;  2MJ6 A;  3NOU C;  3LR5 A;  3OOV A;  2ZBB A;  3B33 A;  2Z6D A;  4F3L B;  3U2A A;  3JVV A;  3E4Q A;  3B42 A;  3C8C A;  4L9F A;  4O8G A;  1TS0 A;  2K31 A;  4R3A A;  3F1P B;  4WF0 A;  3UME A;  3PXP A;  3ULF A;  3A0S A;  5F6A A;  3A0V A;  3KSF A;  3PBO A;  4NXG A;  1DRM A;  2G7U A;  1UWP X;  4DJ2 A;  3P7N A;  3H7W B;  4MN6 A;  1P97 A;  1YKD A;  5TBM B;  5I5L A;  1MZU A;  3LI8 A;  3MQO A;  5FL3 A;  4L9E A;  3CUE A;  4K08 A;  3R4K A;  4YWZ A;  4FOF A;  4ARZ B;  4NXB A;  3K2N A;  2K7S A;  2HV1 A;  4H6J A;  4LPZ A;  3PR6 A;  2JN7 A;  5DKK A;  5HDS A;  1TS6 A;  2JKT I;  3IBJ A;  1XFQ A;  3FG8 A;  3NOP C;  4BMW A;  3MQQ A;  3CUE C;  4MMN A;  2D01 A;  3F1O B;  4HHD A;  4G3V A;  5HL6 A;  2PHY A;  3T4K A;  3PYP A;  1DP8 A;  3FC7 A;  4WEK A;  3BW6 A;  2L4R A;  3G6O A;  1T1A A;  4UQI M;  4EXO A;  1V9Y A;  4WEL A;  2O0Y A;  4WUJ A;  1BYW A;  3TRC A;  3EQU A;  3C2W A;  4R70 A;  1D06 A;  3R7W B;  3K3C A;  3LR3 A;  3ZQ5 A;  2GNX A;  3VV4 A;  2K2N A;  4BJP A;  3JVU A;  3TW8 A;  2QWS A;  3UE3 A;  2YKF A;  2V0W A;  1GSW A;  3LID A;  3MFX A;  4FSF A;  4Q0I A;  3T50 A;  3EWK A;  4P6Z M;  4CLC A;  4I38 A;  4HIA A;  5HPI A;  2VZW A;  3E0Y A;  2ZOI A;  3KX0 X;  3GDI A;  2J3T D;  5G4Z A;  3IS2 B;  3T4L A;  3MR0 A;  5F68 A;  3IBR A;  3LR0 A;  3UB9 A;  2PDR A;  2WKR A;  2VEA A;  4BBV A;  1LSW A;  4HJ4 A;  2VV8 A;  3BY9 A;  4G3K A;  2W3E A;  2W1T A;  2VGL S;  4LRY C;  4MCW A;  2P08 A;  5J4E A;  3EEH A;  3O5Y A;  3UMD A;  1ZTU A;  2LB5 A;  2GZA A;  1H3Q A;  1S66 L;  4Y5F A;  2V9A A;  1S1Y A;  1W63 M;  5F69 A;  5DFY A;  3UB7 A;  3BY8 A;  2KDK A;  5HDC A;  1P9R A;  4AFI A;  2P7J A;  3F1P A;  4WN5 A;  3OLO A;  1IFQ A;  4B93 A;  2ZMV A;  3NJA A;  4YOF A;  1T18 A;  5HDD A;  1GSV A;  2V1B A;  4L0L A;  1OTE A;  3V67 A;  5KIZ A;  2OAQ 1;  1NLY A;  4LLO B;  4BWI A;  2VLG A;  2J3T C;  5LBR A;  5A8B A;  3PHY A;  2J80 A;  1T19 A;  4JGP A;  3IS2 A;  2H28 A;  2HJE A;  2ZOH A;  4GLQ A;  4GW9 A;  5DJU A;  2QJ7 A;  2XA7 M;  3C38 A;  4I3A A;  4M4X A;  1WA9 A;  2P04 A;  3S7P A;  3LYX A;  4KQO A;  3RH8 B;  3EGD C;  4WL9 A;  2W3H A;  4I5S A;  4HH3 A;  4RQ9 A;  4EQ1 A;  4EES A;  1D7E A;  4UEY A;  5HSQ A;  4XT2 B;  4HP9 A;  2W27 A;  2PT7 A;  4Z1W A;  5IS1 A;  5KSH A;  5HWV A;  2B18 A;  2V1A A;  3CI6 A;  3DBA A;  1TF1 A;  3H82 A;  1MKM A;  2W0N A;  3KO6 A;  4WLA A;  1DP9 A;  3UB8 A;  2VJW A;  3NHQ A;  2NUP C;  4EEP A;  1XFN A;  4GS9 A;  2ZMF A;  1UWN X;  2VV7 A;  3FPW A;  1MC0 A;  2PD8 A;  3BQ8 A;  4OOM A;  4NKP A;  4GHI B;  5C5K A;  3UE6 A;  1TS7 A;  3HCY A;  1XJ3 A;  3PBQ A;  3MF0 A;  4ETX A;  3PBN A;  3R7W A;  3T4O A;  4MDZ A;  4R38 A;  2M7U A;  2OOL A;  2QJ5 A;  2GJ3 A;  2QHK A;  2JKT M;  4LRZ E;  3LI9 A;  1V9Z A;  4IUK A;  2Z6C A;  5AJG A;  4HNB A;  3UB6 A;  2EA9 A;  2XSS A;  1TS8 A;  1EW0 A;  2EWV A;  2GX5 A;  5F5Y A;  2M1C A;  4MN7 A;  2L0W A;  4JGO A;  4P6Z S;  4CLC E;  1JNU A;  4ZRR A;  2O9C A;  1NRJ A;  5J3W A;  2DMW A;  1LSX A;  3LIB A;  4XT2 A;  3CAX A;  2XRO A;  3OC2 A;  4F3L A;  2W3G A;  2R78 A;  5HPF A;  4I3J A;  2W1T B;  4EET B;  1DP6 A;  1OTA A;  3H9W A;  3ICY A;  2PYR A;  3CWF A;  2PR6 A;  4IUH A;  2PR5 A;  3BWL A;  3A0R A;  4KUO A;  3SW1 A;  1P0Z A;  2VKS A;  2KOI A;  1OTI A;  4EW7 A;  3LR4 A;  5AVF A;  3HJI A;  1NLZ A;  5HD5 A;  5AVE A;  1F98 A;  4Q0H A;  5TBM A;  1OPX A;  3B47 A;  4IHQ A;  1N9L A;  1YSQ A;  3LFV A;  2JKR I;  1VB6 A;  2L1M A;  4ARZ A;  3EGX C;  1G28 A;  5K5B A;  2A2L A;  4KQD A;  1P9W A;  1H8M A;  4H6J B;  2O9A A;  3HJK A;  3EOI A;  4HY8 A;  3RFB A;  2HF6 A;  3LIC A;  4LRX C;  1X0O A;  2NUT C;  3PBS A;  4CLC D;  4HJ3 A;  3LIF A;  3LIA A;  3E98 A;  1YAX A;  5EFW A;  4HH2 A;  1STZ A;  3MMH A;  2OAP 1;  4MN5 A;  4DN0 A;  3OBF A;  1GSX A;  3S7O A;  1F5M A;  2A24 B;  2WKQ A;  4B9O A;  1S1Z A;  3FPV A;  2INW A;  2Y79 A;  1OTB A;  2OWJ A;  1OT9 A;  2KLI A;  3MQ0 A;  5HWW A;  5HWT A;  1LT0 A;  3LIE A;  4GS9 B;  1LL8 A;  3MXQ A;  5DKL A;  3VE4 A;  4Y3I A;  4HP4 A;  4NXF A;  1XJ2 A;  3GEC A;  3KYZ A;  4GJ4 A;  2Y8H A;  4DJ3 A;  1VHM A;  2FH5 A;  3E4P A;  4PAU A;  2QKP A;  1N9N A;  3PBR A;  3C30 A;  4OOL A;  3MJQ A;  3T4T A;  1OJ5 A;  4JGQ A;  4O0P A;  1KOU A;  1Y28 A;  4EUV A;  4I39 A;  2M7V A;  4JGR A;  4GHI A;  3KSI A;  1ZHH B;  3E4O A;  2QYB A;  5HD3 A;  4NEE D;  3W2Z A;  3D3O A;  2YKH A;  2O99 A;  3KSH A;  4WEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...