1UWNX

The initial events in the photocycle of photoactive yellow protein: a common mechanism on light activation in photoreceptor proteins
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
124
Chain Sequence
EHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initial events in the photocycle of photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
molecule keywords PHOTOACTIVE YELLOW PROTEIN
total genus 34
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1uwnX00
1N9NA 1V9YA 1X0OA 3D72A 1GSWA 4HY8A 4LRXC 3T50A 1S4SA 5KIZA 1N9OA 1N9LA 4H6JB 4WF0A 4L9FA 3NHQA 3OLOA 4F3LB 4JGQA 4R70A 2I9VA 2V9AA 3C8CA 3MR0A 4I38A 2H28A 4HIAA 5HZHA 2OOLA 2L1MA 1MZUA 2PR6A 2VLGA 4MN5A 1D7EA 3A0VA 3LIDA 4GS9B 3LIAA 5HDSA 3EWKA 4XT2B 4HJ4A 4H6JA 2QJ5A 3E4QA 3HJIA 3UB7A 2WKRA 3F1PB 5G4ZA 3VOLA 2WKPA 1P97A 1OTBA 2EA9A 2J80A 3LIEA 2PD8A 2HV1A 2P7JA 4R38A 5HDDA 5HSQA 4JGOA 4RQ9A 5HWVA 3MQQA 1OT6A 4E04A 1S67L 1T1BA 4KQDA 3UB8A 1OJ5A 1XJ2A 2D02A 1DP6A 3LICA 4K08A 1OTIA 1G28A 1LSXA 4BBUA 4WN5A 1TS6A 4HJ6A 1S1YA 5F68A 5IS1A 4M4XA 3MXQA 1XFNA 4WL9A 1DP8A 2CMNA 3F1OA 4F3LA 2V1AA 1LT0A 3NOPC 3ULFA 1T18A 2VEAA 4I3JA 3NJAA 3VE4A 2PYPA 1UGUA 2QKPA 5TBMA 3H7WA 3IS2A 2K7SA 2VV6A 1UWNX 2Z6DA 3GECA 3E4OA 2V0UA 4GHIA 2L0WA 4L9GA 2B02A 1OTAA 5F5YA 1T19A 3K3CA 4I3AA 4NXFA 3LUQA 4R3AA 2PD7A 1V9ZA 3F1PA 2ZBBA 4HHDA 4EQ1A 5HD3A 4EESA 3UB6A 1T1AA 2A24A 4WLAA 1KOUA 1TS7A 3F1OB 1XFQA 3EEHA 3H82A 3CAXA 2VV7A 4LRZE 1OJGA 5A8BA 3UMEA 4DJ2A 3LIFA 3MQOA 3RTYA 2M1CA 3E4PA 4DJ3A 1BYWA 1OTDA 1F9IA 4HP4A 5TBMB 3UB9A 3A0SA 1S66L 4KUOA 5AVFA 5DKKA 5J7EA 4EEPA 1XJ6A 4EERA 1GSVA 4HOIA 3F1NA 4KUKA 1S1ZA 4BBVA 1F98A 2KX6A 3P7NA 3LIBA 4HP9A 1TS8A 4PKYG 2OWJA 4NXBA 3VE3A 2PDRA 5HWWA 3NOTC 4HH2A 1EW0A 3NOUC 1GSXA 3G6OA 3MFXA 3MJQA 4PKYA 4R6LA 4EXOA 2KDKA 4GW9A 4XT2A 5F69A 3FG8A 1VB6A 4GS9A 3B33A 3ZQ5A 3UMDA 2YKHA 3C2WA 3FC7A 3GDIA 3RH8B 4I3IA 1OT9A 2QHKA 1JNUA 3KX0X 5G4YA 3H9WA 4EETB 1LSWA 2Z6CA 4MN6A 1OTEA 3CWFA 3PYPA 1LL8A 3BY9A 2PYRA 4LLOB 1LSVA 2JHEA 3ICYA 3K3DA 3LI8A 5DKLA 1Y28A 4YWZA 4EEUA 2QWSA 2OWHA 3PHYA 4JGPA 2A24B 4I5SA 4HNBA 4BBTA 2PR5A 4JGRA 2ZOHA 1DP9A 4LPZA 2W0NA 2L4RA 2JN7A 1P0ZA 3SW1A 4EW7A 1D06A 4B9OA 3A0RA 1TS0A 4GHIB 5AVEA 1DRMA 4GCZA 1T1CA 3HJKA 4LRYC 3H7WB 3IS2B 4HQAA 3F1NB 5IU1A 5DJUA 2WKQA 3LYXA 4NXEA 4I39A 4HJ3A 2W27A 3BWLA 1WA9A 4HH3A 5EFWA 2V1BA 5HWTA 5J3WA 3UE6A 1S4RA 2INWA 5I5LA 2VV8A 2ZOIA 2YKFA 4WUJA 5HD5A 2V0WA 5J4EA 5HDCA 3H82B 1UWPX 5DJTA 3BY8A 1NWZA 2D01A 4NXGA 2PHYA 3IBRA 5F6AA 1ODVA 2BASA 2GJ3A 2R78A 4HI4A 4L9EA 3CLOA 1XJ3A 1XJ4A 2QJ7A 3LI9A
chains in the Genus database with same CATH superfamily
2HP6A 1V9YA 2XROA 1SDEA 1GSWA 4DE1A 4R70A 2I9VA 1WE4A 3UO9A 1BLCA 2L1MA 2DRWA 3A3IA 5EVIC 3HJIA 2JBFA 3BYDA 1NLYA 3C7VA 1K57C 3MQQA 5EVEA 3ITBA 3S7QA 4C6YA 3HLCA 1PI5A 3SZTA 5D3OA 4HBUA 5FDSA 5CEDA 4LGWA 2O9CA 5TBMA 5F5YA 3KYQA 3BQAA 3F1PA 4JKTA 3VP3A 1EI5A 3G2YA 1PWGA 3A0SA 5AVFA 1TEMA 1SDNA 3VSLA 3F1NA 1WYBA 3MZFA 1K25A 3FKVA 1F98A 2KX6A 2Y4AA 4AFIA 4GB7A 1U60A 4N1XA 2C6WB 1FSYA 4Y7PA 1VEUA 5HAPA 5TFQA 4MNRA 5HARA 3KX0X 4G3VA 2Y55A 4YWZA 4B93A 5GLBA 3HLGA 1ES5A 2JN7A 3LGOA 4B9OA 3C38A 4ESPA 4S2PA 4H8RA 4CLCB 5FEFA 2WKQA 1ONHA 2XD5A 3ZFZA 3KSFA 3DWKA 3VP1A 2PHYA 3U2AA 3L7HA 4IVIA 1KVLA 2JC7A 3EEAA 3KO6A 3LY4A 5FAQA 4IEDA 5FI2A 4MN5A 3EWKA 3UPPA 1DJCA 2HV1A 5JYOA 1G5UA 4OOYA 4P85A 1DP6A 3AGFA 4Q8IA 5F68A 2WGVA 5HPFA 5IS1A 3MXQA 4E3KA 1CJFA 5EVIA 1XGJA 1W8YA 3NJAA 4WMCA 4O8GA 1K54C 5M19A 3G30A 3K3CA 1YLPA 3QHYA 5E2GA 2V1ZA 4RX2A 5GLCA 4Z1WA 2QPNA 4S2LA 4KUOA 4OPRA 1S0WA 4QB8A 1S1ZA 4LCLA 4FSFA 3MFXA 2HZ5A 3C4OA 5F69A 4KZ9A 5E2HA 4S2JA 5CGWA 1PFLA 1OT9A 5CHJA 5G4YA 4M3KA 4MCWA 4JXSA 1H8MA 4GD6A 3PHYA 2G2WA 4UEYA 1DP9A 1EROA 2WGIA 1D06A 4OPZA 3IS2B 1YQSA 4OONA 2INWA 3VP2A 2YKFA 5HD5A 1Z6FA 3QP2A 1Q2QA 3Q7VB 3DWZA 1PWCA 3ZDJA 3WRZA 2ZQ7A 3CLOA 3HLWA 3ZVWA 4X69A 3HLFA 3JVUA 4P6ZS 3MR0A 2ZL1B 4QU3A 4WZ4A 2PR6A 3VSKA 4FH4A 4XT2B 4FTXA 4ZJ1A 3BEBA 3F1PB 4KZ8A 2VGKA 2ZM0A 1FIKA 4JGOA 2ACGA 4GNUA 1L0DA 2E8IA 4Y5FA 5A93A 2PAVP 5BOHA 1MWUA 1G28A 1LSXA 4WN5A 5AQ9A 3NIAA 4KQOA 3NOPC 5CTNA 2VGLM 1UGUA 2W1TA 1IYOA 3HBRA 1BLSA 2XFSA 2I72A 3BFEA 2Y2JA 3MQOA 3RTYA 1LHYA 1W63M 5TBMB 2XEPA 1K57A 4PKYG 4BJPA 1G6AA 1K0KA 1JWVA 1ES2A 1GSXA 4GJ4A 2Z2MB 3OC2A 5GHYA 2WGWA 3DTEA 5CECA 2RL3A 3IX4A 2Q9MA 2V20A 4R4SA 1LSVA 5KSHA 2E8JA 2M7UA 1HTZA 4QD4A 4I5SA 1XGIA 4EUVA 3JYIA 4II7A 5F1GA 3ZG9B 1DJBA 3LR4A 3MF0A 5FQ9A 5DVAA 3CI6A 3OCNA 5J3WA 1PW1A 3IX3A 5J4EA 5JYPA 3UPOA 1UWPX 3LFVA 3LI9A 3VP4A 5CGXA 4XXRA 3Q7VA 3BRMA 3SS3A 3IH9A 4K91A 1ERQA 5FI6A 2HP5A 5EE8A 4BLMA 1ACFA 2MJ6A 4XUXA 4JXGA 4E04A 3MXRA 3ZHHA 4JXVA 1KDWA 2ZLYA 1IYSA 3MS6A 5IT5A 2X01A 2Y2LA 3TG9A 1LT0A 3UB5P 2VEAA 1E4DA 2EWVA 3NDEA 3O87A 4L9GA 3W2ZA 4ZJ3A 4HHDA 1T1AA 3EOIA 2VZWA 1AWIA 1BYWA 4LV1A 4EV4A 4X53A 1XJ6A 4B4XA 4KG5A 3PAGA 3IXDA 4PM9A 1MWRA 3UY6A 3NOTC 1JTGA 1L2SA 4LV0A 3MJQA 4PKYA 4R6LA 1ONGA 2Y2QA 2JCHA 3ZQ5A 1ERMA 3C2WA 1GA9A 2Q0OA 2KLIA 1YKDA 4KQRA 1BTLA 5M1AA 2J3TC 3FYZA 4WZ5C 4HNBA 2Y59A 3RJUA 1MY8A 2W0NA 4LRYC 1T1CA 3H7WB 4Y0OA 5DJUA 2XQZA 4S2MA 2ZOIA 4EU0A 2Y91A 1NWZA 3MXSA 1MC0A 2OV5A 3SH8A 4UHUA 5TR7A 4PHTA 1XPBA 1VHMA 1N9OA 3SOIA 2ZC3B 2VGLS 4N9LA 4OPQA 1O7EA 2ZL1A 1MZUA 4GS9B 2WADA 1OTBA 4F94A 3PBRA 1M40A 1VETB 5HWVA 2P9VA 4KQDA 5IHVA 1FR1A 4DN0A 2RCXA 2H5SA 3IWIA 4M4XA 2CMNA 4LV2A 4NEED 3O86A 5E43A 2VV6A 3IHAA 3BM6A 5HAQA 4BMWA 3UB6A 1CI8A 5L2FA 4CLCE 4ME4A 4DJ3A 1IFQA 5FATA 4IUKA 1DY6A 1XA7A 2PDRA 2K2NA 4KZ7A 2GX5A 4OH0A 2WYXA 3UMDA 3TSGA 3DBAA 5EOOA 3N6IA 3IF6C 1BLHA 3HUMA 3IWQA 1VM1A 4GZBA 1JNUA 1YLWA 5KMWA 3G34A 5DTSA 3FKWA 4P87A 4QWOA 2H0YA 1LL8A 4IHQA 5CERA 3BFCA 1KE0A 2WKIA 2KOIA 1VETA 2JE5A 4BL3A 2JKGA 4R0QA 2EFUA 4NXEA 5CHUA 1W5DA 3UNWA 4MBHA 5KZHA 3H82B 4NG2A 4NXGA 3ISGA 1K54A 2Y2PA 3NY4A 4L9EA 1N4OA 1XJ3A 1NLZA 2OSUA 3C8CA 5FQJA 4KZ5A 4YNRA 3IH8A 5G18A 2ZC6B 3CITA 3LY3A 4LCMA 4LV3A 3QNBA 3DAVA 3LIEA 2A2LA 2UWXA 3N4IA 5DTTA 3HCYA 3BJNA 4PM7A 1T1BA 3VP0A 1XA1A 2J3WA 4C3QA 3MKFA 2HDSA 4N92A 4WL9A 2EXBA 3KYZA 1A0KA 3OCLA 4CLCA 2QKPA 5FI7A 3M2JA 1GA0A 1T19A 4NXFA 3LUQA 2PD7A 3HREA 1LLBA 1MKIA 4A5RA 4DJ2A 3W8KA 1IEMA 4DXBA 3GQZA 2M7VA 2XRNA 2KDKA 5GHZA 5GL9A 2EX2A 4FH2A 4PAUA 2VJWA 1L0EA 4R23A 1KGGA 3T4QA 2ZM2A 3ICYA 3GMWA 1ZHHB 4X56A 5AJGA 3ZCZA 4GD8A 1CQAA 5HPIA 2PR5A 3DW0A 4E3IA 1P0ZA 3PXPA 1SHVA 3P98A 3EGXC 4GCZA 4OLGA 2BLSA 4HQAA 2V1BA 4DF6A 2WUQA 3RXXA 1CI9A 2P9VB 1FOFA 5EM1A 2GJ3A 4MBFA 2DNSA 3HLDA 4N1HA 4S2KA 3VMAA 1BLPA 5TGFA 1G68A 3O88A 1NZOA 4QJGA 3T1XA 1P9WA 4HJ4A 2OLUA 3E4QA 4B4ZA 3S7PA 3VOLA 5HFOA 3D3OA 5HL1A 3WS5A 5L07A 1KE4A 1OTIA 5CGSA 4X1LA 4OVDA 2ZC5B 2HPBA 4E6WA 3G32A 3T4JA 2HJEA 2WGWB 4ETZA 1V9ZA 1TS7A 3C30A 1FCMA 5A8BA 2EWWA 3TRCA 1SKOA 1WYCA 4S2OA 2IA2A 4EEPA 1GSVA 4E3OA 1IYPA 2EX6A 3GSGA 4YFMA 1RGYA 2ZM8A 4XT2A 3FG8A 5E2FA 3V67A 5TJJA 4BQMA 2IWBA 2AVXA 2HJ9C 3LI8A 3V50A 1TDLA 2B95A 4EW7A 3Q82A 4Y17A 4GHIB 3HJKA 1KGEA 4JF6A 4MMNA 5AQ7A 1MPLA 4WZ5A 3M6HA 1OPXA 4Y13A 1BSGA 4Z9QA 2ZQDA 4ZBEA 5MC7A 3M6BA 4PM8A 3Q7ZA 5K5BA 3BQ8A 3T1QB 1N9NA 1S4SA 3O3VA 3GRJA 4ARZB 4ZRRA 3P01A 2XA7M 1TD5A 5A91A 2ZQAA 3NDGA 4IBXA 3LIDA 5HDSA 4K0WA 4FUWA 3T4OA 1H0MA 1ESUA 4GOGA 3JPUA 2P7JA 4RQ9A 4EBNA 1GHIA 1FCNA 5CRFA 5EPHA 1XJ2A 4U0XA 2ZQCA 3UDIA 3UDFA 4BBUA 5CX7A 2X71A 1DP8A 4QHCA 3QP5A 1P9RA 4I3JA 3VE4A 4IVKA 2PYPA 2Z6DA 1YSQA 3L9KA 1FSWA 2ZBBA 4LENA 4GDNA 5HX9A 4GKUA 3H82A 3UMEA 2PT7A 3DTKA 2HDRA 3Q1FA 1NYYA 3IXGA 4WM9A 3W4OA 2J9PA 3U4LP 2XF3A 1ZTUA 3A3FA 1PWDA 2LB5A 4ZDXA 2YKHA 4EBLA 3OOVA 2ZMVA 3NECA 3RXWA 4LLOB 3PYPA 1RGZA 3E2KA 4K0XA 3UE0A 3R7WB 4JGPA 5FDHA 1NXYA 4G3WA 4NETA 1MKMA 4HBTA 1SKFA 1TDGA 2BTFP 2W1TB 2WK0A 4DMZA 2G2UA 5FL3A 3N8LA 3C4PA 5L8MA 3HUOA 4Q0JA 4L0LA 2FFFB 1XJ4A 3OPLA 2NUTC 3C7UA 2JKRI 3UPNA 4KG6A 1BULA 3TOIA 2P74A 3LCEA 1HVBA 4OP5A 2EA9A 4ETXA 3T4LA 3NC8A 3UB8A 5A92A 2Y2KA 1YLYA 3QNCA 3T4TA 1ES4A 2V0UA 3OBFA 2B02A 3HLEA 1ZKJA 2Y2OA 4RVAA 1NRFA 3PAEA 4KZAA 1JVJA 4O0PA 4OQHA 3UB9A 3SH9A 4HEFA 1QMEA 2VGJA 3R4KA 3HLBA 5FQKA 2IWDA 1YMXA 4GDBA 2FH5A 3WS2A 4GS9A 1KE3A 2O9BA 4D60A 4U0TA 5LBRA 4JLFA 4DE0A 1TVFA 4EETB 2Z6CA 1RP5A 2J7VA 4MN6A 3WWXA 3A3DA 5DKLA 1Y28A 3MSHA 3QP6A 3PBQA 1F2KA 3OPRA 2L4RA 2Y2MA 3SW1A 3FWLA 4OQGA 3LYXA 2W27A 2WZZA 2VV8A 1NJ4A 3BLSA 5HDCA 3BY8A 4E3NA 3IBRA 1BT5A 2VKSA 1ODVA 4DDYA 4LFUA 2WAFA 1RCJA 1MBLA 4HY8A 4QPRA 1YPRA 3IHBA 2Y8HA 2W3GA 4H6JB 3E0YA 3S4XA 2Y2HA 4CLCD 5DF7A 1XKZA 1XP4A 3TE8A 2J80A 5HSQA 2PD8A 4B88A 1OJ5A 4DDSA 2V8CA 2W3DA 5F82A 1M6KA 4CQHA 3VOYA 1HLUP 3IS2A 4BBVA 3GECA 3TJZC 4WYYA 1OTAA 1H3QA 3E98A 4WLAA 2VV7A 2W3EA 2M1CA 2G7UA 1K56D 4KQQA 2H10A 2O9AA 4P6BA 4S2NA 2NUPC 3G6OA 2O99A 3ZYTA 3BLMA 2XR0A 3RH8B 3FPWA 4UQIM 2EX8A 1YLTA 3BFDA 1AXBA 1Y54A 1L3LA 2JKRM 4MLLA 4BBTA 4E6XA 4UAAA 3PBSA 3LR5A 3UE6A 1S4RA 5I5LA 2J9OA 1G6OA 3IBJA 2D01A 3BECA 3MKEA 2QMIA 5FA7A 3D72A 1X0OA 3DTMA 4OOMA 1N9LA 5EV0A 2XH9A 4RX3A 2H28A 2W1RA 3IXHA 4E3MA 3O5YA 1LL5A 2EXAA 3VOZA 1FCOA 3Q81A 3QP8A 3GV9A 3UDXA 3VFFA 4MDZA 5DFXA 3CUEC 4JBFA 1XFNA 2ZC4B 3VFHA 2V1AA 2Y2IA 4R4RA 3V3SA 3AGDA 4FOFA 3HL9A 4EQIA 1L0GA 2V8FA 2XFTA 3S7NA 4FD8A 4GN2A 4HP4A 1H5XA 2Y2NA 3WRTA 4HOIA 2OAP1 3P7NA 4NXBA 4HH2A 1PW8A 1E3UA 4OLDA 3IT9A 3IWOA 5FAOA 2HF6A 3UE1A 2JKFA 4EEUA 2PRFA 2A24B 4KZ6A 5GLAA 1XX2A 3GTCA 2Y79A 1I2WA 4EERA 4I39A 3BWLA 4HH3A 3KSIA 2WKEA 4BWIA 2V0WA 3WS4A 2R9WA 5DJTA 4Y3IA 4KG2A 2BASA 1PIOA 2QJ7A 2ZQ8A 4PMAA 2B5RA 4ZAMA 5EVIB 2JKTI 4NKPA 3QP4A 3UE3A 3HVFA 2R9XA 5EECA 1K4EA 4R1GA 4KZ3A 4UA6A 3UB7A 2WKRA 3NULA 5G4ZA 1Q2PA 3G31A 2PBDP 3LR3A 3BFFA 3CPTA 1JTDA 1T18A 3ZNTA 3Q07A 3CZDA 3H7WA 1YAXA 4PPRA 3E4OA 4KENB 5CTMA 4Q0IA 3MZDA 4R3AA 4BL2A 1LI9A 4EESA 5E2EA 1XFQA 3EEHA 3CAXA 1NYMA 1QMFA 3OZHA 2Q9NA 1F9IA 4EUZA 5J7EA 5CEBA 4KUKA 4ARZA 2J8YA 1NRJA 5L10A 1W7FA 5F1FA 1PZPA 4I3IA 2HP9A 5J8XA 3I7JA 4X25A 4CJNA 1IOUA 2JHEA 1K56A 1E25A 3CHWP 2W3HA 1BZAA 1OMEA 1CEGA 4BENA 4LPZA 2ZMFA 5IU1A 1DJAA 3F1NB 4OQ0A 2VA0A 4RA7A 5CHMA 2P04A 4XUZA 4N9KA 3M2KA 4OP8A 2PBYA 4U3TA 4MEZA 1W8QA 1VQQA 1SCWA 5DF8A 4WF0A 4JF4A 2FZ0A 4WBGA 3NHQA 3OLOA 2V9AA 3N8SA 2A3UA 4HIAA 3BW6A 5HZHA 3E2LA 2W3FA 4DE2A 5CXWA 3A0VA 4IJGA 2OLVA 4C75A 3EGDC 1P97A 4RYEA 4P0MA 3A3JA 5HDDA 2OAQ1 1C3BA 1K6RA 1OT6A 1PNEA 1S67L 4S2NC 4HJ6A 2WAEA 4S2IA 2LB9A 3F1OA 4IUHA 1Y4OA 1ZG4A 1NY0A 4P6ZM 4O01A 3ZNYA 4PM5A 4OQIA 4OKPA 1YT4A 3FZCA 3G35A 3F1OB 1JWPA 3LIFA 2XDMA 4WMCD 2XSSA 3FPVA 2CC1A 4EWFA 4Q0HA 3V3RA 1BUEA 3LO7A 4ZTKA 3LIBA 3VE3A 2OWJA 4UA9A 5M18A 3JVVA 1VB6A 1J3WA 5C5KA 2EX9A 2QHKA 2DCFA 4UQIS 1YSPA 1CK3A 3IF6A 1IELA 4JGRA 2ZOHA 1CF0A 4Y0TA 5FAPA 3T4SA 5AVEA 3CJMA 4E3JA 5HWTA 4Y0UA 2J3TD 5EFWA 4E3LA 1EWZA 2HDQA 3PBNA 4KZBA 1MXOA 1GHMA 2X02A 2WZXA 2VX8A 5GHXA 2ZJ9A 4HI4A 3AGEA 4LRXC 5KIZA 3T50A 4L9FA 2C5WB 3LEQA 2VLGA 1J9MA 3K2NA 3S7OA 2UV0E 3LIAA 3MFDA 4H6JA 2QJ5A 2ZQ9A 5HL6A 5EM0A 3PTEA 5AQBA 3V5MA 3R7WA 5FQIA 4BD0A 1S1YA 5FQQA 3N8RA 3ZG0A 5FSRA 3OPHA 4CLCC 2V2FF 3KYEA 5A90A 5F83A 1H8YA 3TW8A 3IF6B 1KOUA 1ZG6A 2DMWA 3HUNA 5DFYA 3LR0A 4PM6A 3NBLA 5DKKA 2JKTM 1PZOA 3KSGA 1TS8A 4ZJ2A 5HWWA 3NOUC 1D1JA 1KVMA 5DTKA 1FR6A 3G2ZA 3FC7A 3GDIA 3IQAA 1KGFA 3T1RA 1LSWA 3T1SA 3BY9A 2PYRA 3W4PA 3B47A 3ZG8B 2QWSA 3CPTB 5FASA 2A49A 1GHPA 3QP1A 1YLZA 3S1YA 4WEJA 5EOEA 1TS0A 4WELA 3A3EA 4HJ3A 1WA9A 4FCFA 1GCEA 4WUJA 3EQUA 3SH7A 2H0TA 3D9YA 2XD1A 3PBOA 4G3KA 1S6RA 5F6AA 1LL9A 1ES3A 4GLQA 3ZG7B 4WEKA 4F3LB 4BD1A 3ITAA 4X55A 4OPYA 2IWCA 4JF5A 2WKPA 4R38A 3C5AA 3B3XA 3B42A 1H8ZA 2D02A 5DF9A 3LICA 2XK1A 4K08A 3D4FA 1IKIA 5AQAA 2BG1A 4F3LA 1JWZA 3FV7A 3ZG5A 1W79A 1STZA 1UWNX 1N9BA 2L0WA 4D2OA 3DTIA 3MZEA 3MBZA 2XGNA 4YOFA 5HD3A 2QZ6A 2WKHA 4LRZE 4QY5A 3E4PA 1OTDA 1MWSA 3EQVA 4HP9A 3IF5A 2HGVA 2PU2A 4DXCA 4YINA 3W4QA 3WS0A 1K38A 3S22A 5EVLA 4O7DA 1K55C 5FEGA 1OTEA 3CWFA 3K3DA 1ESIA 2OWHA 1K6SA 4X1MA 2B18A 1TF1A 1PYYA 4DRTA 2XLNA 3ZGAB 1MWTA 3A0RA 2QYBA 5KSCA 1DRMA 4Y2FA 1W63Q 1YM1A 2Y2GA 4NK3A 5EVID 1PRQA 1O07A 2HDUA 3OPPA 4EBPA 1KDSA 4ID4A 2R78A 1YLJA 3CG5A 2FFYA 3SS5A 5GLDA 4JGQA 3V39A 4I38A 2OOLA 1HZOA 3GVBA 1D7EA 1ZC2A 2K31A 5L09A 1CEFA 2ZC7A 3NI9A 3CUEA 1FILA 2VK3A 4Y15A 1IYQA 5U47A 4DKIA 3PBTA 4IBRA 3SS4A 2Z2LB 1LI0A 5FQMA 4R3BA 2ZMAA 2EFXA 1TS6A 3WS1A 1I2SA 3GR2A 3ULFA 4DE3A 1F5MA 3KSHA 2K7SA 4X6TA 3IX8A 4GHIA 2GNXA 1K4FA 4I3AA 2O0YA 4EQ1A 3IXBA 1IKGA 2A24A 2GDNA 4MN7A 1Z09A 5I94A 1OJGA 4CPKA 1I5QA 3LEZA 1S66L 4X68A 4MBKA 3VV4A 3RFBA 3T12B 1XXMA 3NCKA 1SZVA 3MQ0A 3ZVTA 1EW0A 4QY6A 2P08A 4EXOA 4HESA 4GW9A 5HAIA 1PI4A 3B33A 3T4KA 3N7WA 1FQGA 1K55A 1HD8A 2GZAA 3H9WA 4KZ4A 4OOLA 3P09A 1SKOB 1E3UD 2PU4A 3G4PA 3MMHA 4JXWA 4UA7A 1VEUB 1YMSA 3PR6A 1L0FA 4R3JA 1NZUA 1ALQA 5HW3A 3UN7A 2XA7S 3CMZA 4JPMA 3BFGA 5EUAA 2ZD8A
chains in the Genus database with same CATH topology
1V9YA 2XROA 1GSWA 2NUTC 1VHMA 1N9OA 2JKRI 4WF0A 2FZ0A 3NHQA 3OLOA 2VGLS 4R70A 2I9VA 2V9AA 4HIAA 3BW6A 5HZHA 2L1MA 2W3FA 1MZUA 3A0VA 4GS9B 4IJGA 3HJIA 3EGDC 1NLYA 1P97A 1OTBA 2EA9A 4ETXA 5HDDA 3PBRA 3T4LA 2OAQ1 5HWVA 3MQQA 1OT6A 1S67L 4KQDA 3S7QA 3UB8A 4DN0A 4HJ6A 4M4XA 2LB9A 2CMNA 3F1OA 4IUHA 4NEED 2O9CA 3T4TA 4P6ZM 5TBMA 4O01A 2VV6A 2V0UA 3OBFA 2B02A 5F5YA 3KYQA 3BQAA 4BMWA 3F1PA 3UB6A 3F1OB 3LIFA 4CLCE 4ME4A 4DJ3A 4O0PA 3UB9A 2XSSA 3A0SA 5AVFA 3FPVA 1IFQA 3F1NA 4Q0HA 3R4KA 4IUKA 1F98A 2KX6A 3LIBA 3VE3A 2OWJA 4AFIA 2PDRA 2K2NA 2FH5A 2GX5A 3JVVA 1VB6A 4GS9A 2O9BA 3UMDA 3DBAA 5LBRA 5C5KA 2QHKA 1JNUA 3KX0X 4EETB 2Z6CA 4MN6A 1LL8A 4G3VA 5DKLA 1Y28A 4UQIS 4YWZA 4B93A 1YSPA 4IHQA 3PBQA 4JGRA 2ZOHA 2L4RA 2KOIA 2JN7A 3SW1A 3T4SA 4B9OA 3C38A 5AVEA 4CLCB 2WKQA 3LYXA 4NXEA 2W27A 5HWTA 2J3TD 5EFWA 3KSFA 2VV8A 5HDCA 3H82B 3PBNA 3BY8A 4NXGA 2PHYA 3IBRA 3U2AA 2VX8A 2VKSA 1ODVA 4HI4A 4L9EA 1XJ3A 1NLZA 4LRXC 4HY8A 5KIZA 4QPRA 3T50A 2Y8HA 2W3GA 4H6JB 3EEAA 4L9FA 3KO6A 3E0YA 3C8CA 4YNRA 4CLCD 2VLGA 3K2NA 4MN5A 3S7OA 3CITA 3LIAA 3EWKA 4H6JA 2QJ5A 3TE8A 3LIEA 2J80A 2A2LA 5HSQA 2PD8A 2HV1A 5HL6A 3HCYA 3BJNA 1T1BA 1OJ5A 2W3DA 1DP6A 2J3WA 3R7WA 1S1YA 5F68A 5HPFA 5IS1A 3MXQA 4WL9A 3OCLA 3KYZA 4CQHA 4CLCA 3NJAA 4CLCC 2QKPA 4O8GA 3IS2A 4BBVA 3GECA 3TJZC 1OTAA 1T19A 1H3QA 3K3CA 4NXFA 3LUQA 2PD7A 3TW8A 3E98A 4WLAA 1KOUA 2DMWA 2VV7A 2W3EA 4DJ2A 5DFYA 2M1CA 2G7UA 3LR0A 4Z1WA 4KUOA 5DKKA 2JKTM 1S1ZA 2O9AA 3KSGA 4FSFA 1TS8A 5HWWA 3NOUC 2NUPC 2M7VA 3G6OA 3MFXA 2XRNA 2KDKA 2O99A 3ZYTA 5F69A 3FC7A 3GDIA 3RH8B 4PAUA 1OT9A 3FPWA 4UQIM 5G4YA 2VJWA 1LSWA 4MCWA 3T4QA 3BY9A 2PYRA 1H8MA 3ICYA 1ZHHB 3B47A 2QWSA 5AJGA 2JKRM 3PHYA 5HPIA 4UEYA 4BBTA 2PR5A 1DP9A 1P0ZA 3PXPA 4WEJA 1D06A 1TS0A 3EGXC 4GCZA 3PBSA 3IS2B 4HQAA 3LR5A 4WELA 4HJ3A 1WA9A 3UE6A 2V1BA 1S4RA 2INWA 5I5LA 1G6OA 2YKFA 3EQUA 4WUJA 5HD5A 3IBJA 3PBOA 2D01A 4G3KA 5F6AA 2GJ3A 4GLQA 3CLOA 3D72A 1X0OA 4WEKA 3JVUA 1N9LA 4OOMA 4F3LB 4P6ZS 3MR0A 2H28A 2W1RA 2PR6A 1P9WA 4XT2B 4HJ4A 3E4QA 3O5YA 3F1PB 3S7PA 3VOLA 2WKPA 3D3OA 4R38A 4JGOA 3B42A 4Y5FA 2D02A 5DF9A 3LICA 4MDZA 4K08A 1OTIA 1LSXA 1G28A 5DFXA 4WN5A 3CUEC 1XFNA 4KQOA 4F3LA 2V1AA 3NOPC 2VGLM 1UGUA 2W1TA 1STZA 1UWNX 3T4JA 2HJEA 2L0WA 4FOFA 4ETZA 1V9ZA 4YOFA 5HD3A 1TS7A 3C30A 5A8BA 4LRZE 2EWWA 3TRCA 3MQOA 3RTYA 3S7NA 3E4PA 1W63M 1OTDA 4HP4A 5TBMB 2IA2A 4EEPA 1GSVA 4HOIA 3EQVA 2OAP1 4PKYG 3P7NA 4HP9A 4BJPA 4NXBA 2HGVA 4HH2A 1GSXA 4GJ4A 4XT2A 3FG8A 3OC2A 3V67A 5TJJA 2HJ9C 2HF6A 1OTEA 3CWFA 1LSVA 3K3DA 3LI8A 5KSHA 2M7UA 4EEUA 2OWHA 2A24B 2B18A 4I5SA 1TF1A 4EUVA 4II7A 4EW7A 3A0RA 4GHIB 2Y79A 2QYBA 1DRMA 4Y2FA 3HJKA 3LR4A 4EERA 3MF0A 1W63Q 4MMNA 4I39A 3BWLA 4HH3A 3CI6A 3OCNA 3KSIA 5J3WA 4BWIA 2V0WA 5J4EA 1UWPX 1OPXA 5DJTA 3LFVA 4Y3IA 5MC7A 2BASA 2R78A 5K5BA 3BQ8A 2QJ7A 3LI9A 1N9NA 1S4SA 4ARZB 4ZRRA 3P01A 2JKTI 4JGQA 4NKPA 2XA7M 1TD5A 4I38A 3UE3A 2OOLA 1D7EA 2K31A 3LIDA 5HDSA 3T4OA 3UB7A 2WKRA 5G4ZA 3CUEA 2P7JA 2MJ6A 4RQ9A 4E04A 3PBTA 1XJ2A 4BBUA 3LR3A 1TS6A 5IT5A 5CX7A 1DP8A 1LT0A 3ULFA 1T18A 1P9RA 2VEAA 4I3JA 3VE4A 1F5MA 2PYPA 2EWVA 3H7WA 3KSHA 2K7SA 4GHIA 1YAXA 2Z6DA 3E4OA 1YSQA 4L9GA 2GNXA 4Q0IA 4I3AA 2O0YA 4R3AA 3W2ZA 4EQ1A 2ZBBA 4HHDA 4EESA 1T1AA 2A24A 3EOIA 4MN7A 1XFQA 3EEHA 3H82A 3CAXA 1OJGA 3UMEA 2VZWA 2PT7A 1BYWA 1F9IA 1S66L 5J7EA 1XJ6A 3VV4A 4KUKA 3RFBA 4ARZA 3MQ0A 1NRJA 3NOTC 1EW0A 2P08A 3MJQA 4PKYA 4R6LA 4EXOA 1ZTUA 4GW9A 3ZQ5A 2LB5A 3B33A 2YKHA 3C2WA 3T4KA 4I3IA 3OOVA 2GZAA 2ZMVA 3H9WA 2KLIA 4LLOB 3PYPA 1YKDA 1IOUA 4OOLA 2JHEA 3MMHA 2J3TC 3R7WB 2W3HA 4JGPA 4HNBA 3PR6A 4G3WA 1MKMA 4LPZA 2W0NA 2ZMFA 2W1TB 4LRYC 1T1CA 5IU1A 3H7WB 3F1NB 2VA0A 5DJUA 4DMZA 2ZOIA 2XA7S 4EU0A 5FL3A 2P04A 5L8MA 1NWZA 1MC0A 4Q0JA 4L0LA 4PHTA 1XJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9N A;  1V9Y A;  1X0O A;  3D72 A;  1GSW A;  4HY8 A;  4LRX C;  3T50 A;  1S4S A;  5KIZ A;  1N9O A;  1N9L A;  4H6J B;  4WF0 A;  4L9F A;  3NHQ A;  3OLO A;  4F3L B;  4JGQ A;  4R70 A;  2I9V A;  2V9A A;  3C8C A;  3MR0 A;  4I38 A;  2H28 A;  4HIA A;  5HZH A;  2OOL A;  2L1M A;  1MZU A;  2PR6 A;  2VLG A;  4MN5 A;  1D7E A;  3A0V A;  3LID A;  4GS9 B;  3LIA A;  5HDS A;  3EWK A;  4XT2 B;  4HJ4 A;  4H6J A;  2QJ5 A;  3E4Q A;  3HJI A;  3UB7 A;  2WKR A;  3F1P B;  5G4Z A;  3VOL A;  2WKP A;  1P97 A;  1OTB A;  2EA9 A;  2J80 A;  3LIE A;  2PD8 A;  2HV1 A;  2P7J A;  4R38 A;  5HDD A;  5HSQ A;  4JGO A;  4RQ9 A;  5HWV A;  3MQQ A;  1OT6 A;  4E04 A;  1S67 L;  1T1B A;  4KQD A;  3UB8 A;  1OJ5 A;  1XJ2 A;  2D02 A;  1DP6 A;  3LIC A;  4K08 A;  1OTI A;  1G28 A;  1LSX A;  4BBU A;  4WN5 A;  1TS6 A;  4HJ6 A;  1S1Y A;  5F68 A;  5IS1 A;  4M4X A;  3MXQ A;  1XFN A;  4WL9 A;  1DP8 A;  2CMN A;  3F1O A;  4F3L A;  2V1A A;  1LT0 A;  3NOP C;  3ULF A;  1T18 A;  2VEA A;  4I3J A;  3NJA A;  3VE4 A;  2PYP A;  1UGU A;  2QKP A;  5TBM A;  3H7W A;  3IS2 A;  2K7S A;  2VV6 A;  1UWN X;  2Z6D A;  3GEC A;  3E4O A;  2V0U A;  4GHI A;  2L0W A;  4L9G A;  2B02 A;  1OTA A;  5F5Y A;  1T19 A;  3K3C A;  4I3A A;  4NXF A;  3LUQ A;  4R3A A;  2PD7 A;  1V9Z A;  3F1P A;  2ZBB A;  4HHD A;  4EQ1 A;  5HD3 A;  4EES A;  3UB6 A;  1T1A A;  2A24 A;  4WLA A;  1KOU A;  1TS7 A;  3F1O B;  1XFQ A;  3EEH A;  3H82 A;  3CAX A;  2VV7 A;  4LRZ E;  1OJG A;  5A8B A;  3UME A;  4DJ2 A;  3LIF A;  3MQO A;  3RTY A;  2M1C A;  3E4P A;  4DJ3 A;  1BYW A;  1OTD A;  1F9I A;  4HP4 A;  5TBM B;  3UB9 A;  3A0S A;  1S66 L;  4KUO A;  5AVF A;  5DKK A;  5J7E A;  4EEP A;  1XJ6 A;  4EER A;  1GSV A;  4HOI A;  3F1N A;  4KUK A;  1S1Z A;  4BBV A;  1F98 A;  2KX6 A;  3P7N A;  3LIB A;  4HP9 A;  1TS8 A;  4PKY G;  2OWJ A;  4NXB A;  3VE3 A;  2PDR A;  5HWW A;  3NOT C;  4HH2 A;  1EW0 A;  3NOU C;  1GSX A;  3G6O A;  3MFX A;  3MJQ A;  4PKY A;  4R6L A;  4EXO A;  2KDK A;  4GW9 A;  4XT2 A;  5F69 A;  3FG8 A;  1VB6 A;  4GS9 A;  3B33 A;  3ZQ5 A;  3UMD A;  2YKH A;  3C2W A;  3FC7 A;  3GDI A;  3RH8 B;  4I3I A;  1OT9 A;  2QHK A;  1JNU A;  3KX0 X;  5G4Y A;  3H9W A;  4EET B;  1LSW A;  2Z6C A;  4MN6 A;  1OTE A;  3CWF A;  3PYP A;  1LL8 A;  3BY9 A;  2PYR A;  4LLO B;  1LSV A;  2JHE A;  3ICY A;  3K3D A;  3LI8 A;  5DKL A;  1Y28 A;  4YWZ A;  4EEU A;  2QWS A;  2OWH A;  3PHY A;  4JGP A;  2A24 B;  4I5S A;  4HNB A;  4BBT A;  2PR5 A;  4JGR A;  2ZOH A;  1DP9 A;  4LPZ A;  2W0N A;  2L4R A;  2JN7 A;  1P0Z A;  3SW1 A;  4EW7 A;  1D06 A;  4B9O A;  3A0R A;  1TS0 A;  4GHI B;  5AVE A;  1DRM A;  4GCZ A;  1T1C A;  3HJK A;  4LRY C;  3H7W B;  3IS2 B;  4HQA A;  3F1N B;  5IU1 A;  5DJU A;  2WKQ A;  3LYX A;  4NXE A;  4I39 A;  4HJ3 A;  2W27 A;  3BWL A;  1WA9 A;  4HH3 A;  5EFW A;  2V1B A;  5HWT A;  5J3W A;  3UE6 A;  1S4R A;  2INW A;  5I5L A;  2VV8 A;  2ZOI A;  2YKF A;  4WUJ A;  5HD5 A;  2V0W A;  5J4E A;  5HDC A;  3H82 B;  1UWP X;  5DJT A;  3BY8 A;  1NWZ A;  2D01 A;  4NXG A;  2PHY A;  3IBR A;  5F6A A;  1ODV A;  2BAS A;  2GJ3 A;  2R78 A;  4HI4 A;  4L9E A;  3CLO A;  1XJ3 A;  1XJ4 A;  2QJ7 A;  3LI9 A; 
#chains in the Genus database with same CATH topology
 2HP6 A;  1V9Y A;  2XRO A;  1SDE A;  1GSW A;  4DE1 A;  4R70 A;  2I9V A;  1WE4 A;  3UO9 A;  1BLC A;  2L1M A;  2DRW A;  3A3I A;  5EVI C;  3HJI A;  2JBF A;  3BYD A;  1NLY A;  3C7V A;  1K57 C;  3MQQ A;  5EVE A;  3ITB A;  3S7Q A;  4C6Y A;  3HLC A;  1PI5 A;  3SZT A;  5D3O A;  4HBU A;  5FDS A;  5CED A;  4LGW A;  2O9C A;  5TBM A;  5F5Y A;  3KYQ A;  3BQA A;  3F1P A;  4JKT A;  3VP3 A;  1EI5 A;  3G2Y A;  1PWG A;  3A0S A;  5AVF A;  1TEM A;  1SDN A;  3VSL A;  3F1N A;  1WYB A;  3MZF A;  1K25 A;  3FKV A;  1F98 A;  2KX6 A;  2Y4A A;  4AFI A;  4GB7 A;  1U60 A;  4N1X A;  2C6W B;  1FSY A;  4Y7P A;  1VEU A;  5HAP A;  5TFQ A;  4MNR A;  5HAR A;  3KX0 X;  4G3V A;  2Y55 A;  4YWZ A;  4B93 A;  5GLB A;  3HLG A;  1ES5 A;  2JN7 A;  3LGO A;  4B9O A;  3C38 A;  4ESP A;  4S2P A;  4H8R A;  4CLC B;  5FEF A;  2WKQ A;  1ONH A;  2XD5 A;  3ZFZ A;  3KSF A;  3DWK A;  3VP1 A;  2PHY A;  3U2A A;  3L7H A;  4IVI A;  1KVL A;  2JC7 A;  3EEA A;  3KO6 A;  3LY4 A;  5FAQ A;  4IED A;  5FI2 A;  4MN5 A;  3EWK A;  3UPP A;  1DJC A;  2HV1 A;  5JYO A;  1G5U A;  4OOY A;  4P85 A;  1DP6 A;  3AGF A;  4Q8I A;  5F68 A;  2WGV A;  5HPF A;  5IS1 A;  3MXQ A;  4E3K A;  1CJF A;  5EVI A;  1XGJ A;  1W8Y A;  3NJA A;  4WMC A;  4O8G A;  1K54 C;  5M19 A;  3G30 A;  3K3C A;  1YLP A;  3QHY A;  5E2G A;  2V1Z A;  4RX2 A;  5GLC A;  4Z1W A;  2QPN A;  4S2L A;  4KUO A;  4OPR A;  1S0W A;  4QB8 A;  1S1Z A;  4LCL A;  4FSF A;  3MFX A;  2HZ5 A;  3C4O A;  5F69 A;  4KZ9 A;  5E2H A;  4S2J A;  5CGW A;  1PFL A;  1OT9 A;  5CHJ A;  5G4Y A;  4M3K A;  4MCW A;  4JXS A;  1H8M A;  4GD6 A;  3PHY A;  2G2W A;  4UEY A;  1DP9 A;  1ERO A;  2WGI A;  1D06 A;  4OPZ A;  3IS2 B;  1YQS A;  4OON A;  2INW A;  3VP2 A;  2YKF A;  5HD5 A;  1Z6F A;  3QP2 A;  1Q2Q A;  3Q7V B;  3DWZ A;  1PWC A;  3ZDJ A;  3WRZ A;  2ZQ7 A;  3CLO A;  3HLW A;  3ZVW A;  4X69 A;  3HLF A;  3JVU A;  4P6Z S;  3MR0 A;  2ZL1 B;  4QU3 A;  4WZ4 A;  2PR6 A;  3VSK A;  4FH4 A;  4XT2 B;  4FTX A;  4ZJ1 A;  3BEB A;  3F1P B;  4KZ8 A;  2VGK A;  2ZM0 A;  1FIK A;  4JGO A;  2ACG A;  4GNU A;  1L0D A;  2E8I A;  4Y5F A;  5A93 A;  2PAV P;  5BOH A;  1MWU A;  1G28 A;  1LSX A;  4WN5 A;  5AQ9 A;  3NIA A;  4KQO A;  3NOP C;  5CTN A;  2VGL M;  1UGU A;  2W1T A;  1IYO A;  3HBR A;  1BLS A;  2XFS A;  2I72 A;  3BFE A;  2Y2J A;  3MQO A;  3RTY A;  1LHY A;  1W63 M;  5TBM B;  2XEP A;  1K57 A;  4PKY G;  4BJP A;  1G6A A;  1K0K A;  1JWV A;  1ES2 A;  1GSX A;  4GJ4 A;  2Z2M B;  3OC2 A;  5GHY A;  2WGW A;  3DTE A;  5CEC A;  2RL3 A;  3IX4 A;  2Q9M A;  2V20 A;  4R4S A;  1LSV A;  5KSH A;  2E8J A;  2M7U A;  1HTZ A;  4QD4 A;  4I5S A;  1XGI A;  4EUV A;  3JYI A;  4II7 A;  5F1G A;  3ZG9 B;  1DJB A;  3LR4 A;  3MF0 A;  5FQ9 A;  5DVA A;  3CI6 A;  3OCN A;  5J3W A;  1PW1 A;  3IX3 A;  5J4E A;  5JYP A;  3UPO A;  1UWP X;  3LFV A;  3LI9 A;  3VP4 A;  5CGX A;  4XXR A;  3Q7V A;  3BRM A;  3SS3 A;  3IH9 A;  4K91 A;  1ERQ A;  5FI6 A;  2HP5 A;  5EE8 A;  4BLM A;  1ACF A;  2MJ6 A;  4XUX A;  4JXG A;  4E04 A;  3MXR A;  3ZHH A;  4JXV A;  1KDW A;  2ZLY A;  1IYS A;  3MS6 A;  5IT5 A;  2X01 A;  2Y2L A;  3TG9 A;  1LT0 A;  3UB5 P;  2VEA A;  1E4D A;  2EWV A;  3NDE A;  3O87 A;  4L9G A;  3W2Z A;  4ZJ3 A;  4HHD A;  1T1A A;  3EOI A;  2VZW A;  1AWI A;  1BYW A;  4LV1 A;  4EV4 A;  4X53 A;  1XJ6 A;  4B4X A;  4KG5 A;  3PAG A;  3IXD A;  4PM9 A;  1MWR A;  3UY6 A;  3NOT C;  1JTG A;  1L2S A;  4LV0 A;  3MJQ A;  4PKY A;  4R6L A;  1ONG A;  2Y2Q A;  2JCH A;  3ZQ5 A;  1ERM A;  3C2W A;  1GA9 A;  2Q0O A;  2KLI A;  1YKD A;  4KQR A;  1BTL A;  5M1A A;  2J3T C;  3FYZ A;  4WZ5 C;  4HNB A;  2Y59 A;  3RJU A;  1MY8 A;  2W0N A;  4LRY C;  1T1C A;  3H7W B;  4Y0O A;  5DJU A;  2XQZ A;  4S2M A;  2ZOI A;  4EU0 A;  2Y91 A;  1NWZ A;  3MXS A;  1MC0 A;  2OV5 A;  3SH8 A;  4UHU A;  5TR7 A;  4PHT A;  1XPB A;  1VHM A;  1N9O A;  3SOI A;  2ZC3 B;  2VGL S;  4N9L A;  4OPQ A;  1O7E A;  2ZL1 A;  1MZU A;  4GS9 B;  2WAD A;  1OTB A;  4F94 A;  3PBR A;  1M40 A;  1VET B;  5HWV A;  2P9V A;  4KQD A;  5IHV A;  1FR1 A;  4DN0 A;  2RCX A;  2H5S A;  3IWI A;  4M4X A;  2CMN A;  4LV2 A;  4NEE D;  3O86 A;  5E43 A;  2VV6 A;  3IHA A;  3BM6 A;  5HAQ A;  4BMW A;  3UB6 A;  1CI8 A;  5L2F A;  4CLC E;  4ME4 A;  4DJ3 A;  1IFQ A;  5FAT A;  4IUK A;  1DY6 A;  1XA7 A;  2PDR A;  2K2N A;  4KZ7 A;  2GX5 A;  4OH0 A;  2WYX A;  3UMD A;  3TSG A;  3DBA A;  5EOO A;  3N6I A;  3IF6 C;  1BLH A;  3HUM A;  3IWQ A;  1VM1 A;  4GZB A;  1JNU A;  1YLW A;  5KMW A;  3G34 A;  5DTS A;  3FKW A;  4P87 A;  4QWO A;  2H0Y A;  1LL8 A;  4IHQ A;  5CER A;  3BFC A;  1KE0 A;  2WKI A;  2KOI A;  1VET A;  2JE5 A;  4BL3 A;  2JKG A;  4R0Q A;  2EFU A;  4NXE A;  5CHU A;  1W5D A;  3UNW A;  4MBH A;  5KZH A;  3H82 B;  4NG2 A;  4NXG A;  3ISG A;  1K54 A;  2Y2P A;  3NY4 A;  4L9E A;  1N4O A;  1XJ3 A;  1NLZ A;  2OSU A;  3C8C A;  5FQJ A;  4KZ5 A;  4YNR A;  3IH8 A;  5G18 A;  2ZC6 B;  3CIT A;  3LY3 A;  4LCM A;  4LV3 A;  3QNB A;  3DAV A;  3LIE A;  2A2L A;  2UWX A;  3N4I A;  5DTT A;  3HCY A;  3BJN A;  4PM7 A;  1T1B A;  3VP0 A;  1XA1 A;  2J3W A;  4C3Q A;  3MKF A;  2HDS A;  4N92 A;  4WL9 A;  2EXB A;  3KYZ A;  1A0K A;  3OCL A;  4CLC A;  2QKP A;  5FI7 A;  3M2J A;  1GA0 A;  1T19 A;  4NXF A;  3LUQ A;  2PD7 A;  3HRE A;  1LLB A;  1MKI A;  4A5R A;  4DJ2 A;  3W8K A;  1IEM A;  4DXB A;  3GQZ A;  2M7V A;  2XRN A;  2KDK A;  5GHZ A;  5GL9 A;  2EX2 A;  4FH2 A;  4PAU A;  2VJW A;  1L0E A;  4R23 A;  1KGG A;  3T4Q A;  2ZM2 A;  3ICY A;  3GMW A;  1ZHH B;  4X56 A;  5AJG A;  3ZCZ A;  4GD8 A;  1CQA A;  5HPI A;  2PR5 A;  3DW0 A;  4E3I A;  1P0Z A;  3PXP A;  1SHV A;  3P98 A;  3EGX C;  4GCZ A;  4OLG A;  2BLS A;  4HQA A;  2V1B A;  4DF6 A;  2WUQ A;  3RXX A;  1CI9 A;  2P9V B;  1FOF A;  5EM1 A;  2GJ3 A;  4MBF A;  2DNS A;  3HLD A;  4N1H A;  4S2K A;  3VMA A;  1BLP A;  5TGF A;  1G68 A;  3O88 A;  1NZO A;  4QJG A;  3T1X A;  1P9W A;  4HJ4 A;  2OLU A;  3E4Q A;  4B4Z A;  3S7P A;  3VOL A;  5HFO A;  3D3O A;  5HL1 A;  3WS5 A;  5L07 A;  1KE4 A;  1OTI A;  5CGS A;  4X1L A;  4OVD A;  2ZC5 B;  2HPB A;  4E6W A;  3G32 A;  3T4J A;  2HJE A;  2WGW B;  4ETZ A;  1V9Z A;  1TS7 A;  3C30 A;  1FCM A;  5A8B A;  2EWW A;  3TRC A;  1SKO A;  1WYC A;  4S2O A;  2IA2 A;  4EEP A;  1GSV A;  4E3O A;  1IYP A;  2EX6 A;  3GSG A;  4YFM A;  1RGY A;  2ZM8 A;  4XT2 A;  3FG8 A;  5E2F A;  3V67 A;  5TJJ A;  4BQM A;  2IWB A;  2AVX A;  2HJ9 C;  3LI8 A;  3V50 A;  1TDL A;  2B95 A;  4EW7 A;  3Q82 A;  4Y17 A;  4GHI B;  3HJK A;  1KGE A;  4JF6 A;  4MMN A;  5AQ7 A;  1MPL A;  4WZ5 A;  3M6H A;  1OPX A;  4Y13 A;  1BSG A;  4Z9Q A;  2ZQD A;  4ZBE A;  5MC7 A;  3M6B A;  4PM8 A;  3Q7Z A;  5K5B A;  3BQ8 A;  3T1Q B;  1N9N A;  1S4S A;  3O3V A;  3GRJ A;  4ARZ B;  4ZRR A;  3P01 A;  2XA7 M;  1TD5 A;  5A91 A;  2ZQA A;  3NDG A;  4IBX A;  3LID A;  5HDS A;  4K0W A;  4FUW A;  3T4O A;  1H0M A;  1ESU A;  4GOG A;  3JPU A;  2P7J A;  4RQ9 A;  4EBN A;  1GHI A;  1FCN A;  5CRF A;  5EPH A;  1XJ2 A;  4U0X A;  2ZQC A;  3UDI A;  3UDF A;  4BBU A;  5CX7 A;  2X71 A;  1DP8 A;  4QHC A;  3QP5 A;  1P9R A;  4I3J A;  3VE4 A;  4IVK A;  2PYP A;  2Z6D A;  1YSQ A;  3L9K A;  1FSW A;  2ZBB A;  4LEN A;  4GDN A;  5HX9 A;  4GKU A;  3H82 A;  3UME A;  2PT7 A;  3DTK A;  2HDR A;  3Q1F A;  1NYY A;  3IXG A;  4WM9 A;  3W4O A;  2J9P A;  3U4L P;  2XF3 A;  1ZTU A;  3A3F A;  1PWD A;  2LB5 A;  4ZDX A;  2YKH A;  4EBL A;  3OOV A;  2ZMV A;  3NEC A;  3RXW A;  4LLO B;  3PYP A;  1RGZ A;  3E2K A;  4K0X A;  3UE0 A;  3R7W B;  4JGP A;  5FDH A;  1NXY A;  4G3W A;  4NET A;  1MKM A;  4HBT A;  1SKF A;  1TDG A;  2BTF P;  2W1T B;  2WK0 A;  4DMZ A;  2G2U A;  5FL3 A;  3N8L A;  3C4P A;  5L8M A;  3HUO A;  4Q0J A;  4L0L A;  2FFF B;  1XJ4 A;  3OPL A;  2NUT C;  3C7U A;  2JKR I;  3UPN A;  4KG6 A;  1BUL A;  3TOI A;  2P74 A;  3LCE A;  1HVB A;  4OP5 A;  2EA9 A;  4ETX A;  3T4L A;  3NC8 A;  3UB8 A;  5A92 A;  2Y2K A;  1YLY A;  3QNC A;  3T4T A;  1ES4 A;  2V0U A;  3OBF A;  2B02 A;  3HLE A;  1ZKJ A;  2Y2O A;  4RVA A;  1NRF A;  3PAE A;  4KZA A;  1JVJ A;  4O0P A;  4OQH A;  3UB9 A;  3SH9 A;  4HEF A;  1QME A;  2VGJ A;  3R4K A;  3HLB A;  5FQK A;  2IWD A;  1YMX A;  4GDB A;  2FH5 A;  3WS2 A;  4GS9 A;  1KE3 A;  2O9B A;  4D60 A;  4U0T A;  5LBR A;  4JLF A;  4DE0 A;  1TVF A;  4EET B;  2Z6C A;  1RP5 A;  2J7V A;  4MN6 A;  3WWX A;  3A3D A;  5DKL A;  1Y28 A;  3MSH A;  3QP6 A;  3PBQ A;  1F2K A;  3OPR A;  2L4R A;  2Y2M A;  3SW1 A;  3FWL A;  4OQG A;  3LYX A;  2W27 A;  2WZZ A;  2VV8 A;  1NJ4 A;  3BLS A;  5HDC A;  3BY8 A;  4E3N A;  3IBR A;  1BT5 A;  2VKS A;  1ODV A;  4DDY A;  4LFU A;  2WAF A;  1RCJ A;  1MBL A;  4HY8 A;  4QPR A;  1YPR A;  3IHB A;  2Y8H A;  2W3G A;  4H6J B;  3E0Y A;  3S4X A;  2Y2H A;  4CLC D;  5DF7 A;  1XKZ A;  1XP4 A;  3TE8 A;  2J80 A;  5HSQ A;  2PD8 A;  4B88 A;  1OJ5 A;  4DDS A;  2V8C A;  2W3D A;  5F82 A;  1M6K A;  4CQH A;  3VOY A;  1HLU P;  3IS2 A;  4BBV A;  3GEC A;  3TJZ C;  4WYY A;  1OTA A;  1H3Q A;  3E98 A;  4WLA A;  2VV7 A;  2W3E A;  2M1C A;  2G7U A;  1K56 D;  4KQQ A;  2H10 A;  2O9A A;  4P6B A;  4S2N A;  2NUP C;  3G6O A;  2O99 A;  3ZYT A;  3BLM A;  2XR0 A;  3RH8 B;  3FPW A;  4UQI M;  2EX8 A;  1YLT A;  3BFD A;  1AXB A;  1Y54 A;  1L3L A;  2JKR M;  4MLL A;  4BBT A;  4E6X A;  4UAA A;  3PBS A;  3LR5 A;  3UE6 A;  1S4R A;  5I5L A;  2J9O A;  1G6O A;  3IBJ A;  2D01 A;  3BEC A;  3MKE A;  2QMI A;  5FA7 A;  3D72 A;  1X0O A;  3DTM A;  4OOM A;  1N9L A;  5EV0 A;  2XH9 A;  4RX3 A;  2H28 A;  2W1R A;  3IXH A;  4E3M A;  3O5Y A;  1LL5 A;  2EXA A;  3VOZ A;  1FCO A;  3Q81 A;  3QP8 A;  3GV9 A;  3UDX A;  3VFF A;  4MDZ A;  5DFX A;  3CUE C;  4JBF A;  1XFN A;  2ZC4 B;  3VFH A;  2V1A A;  2Y2I A;  4R4R A;  3V3S A;  3AGD A;  4FOF A;  3HL9 A;  4EQI A;  1L0G A;  2V8F A;  2XFT A;  3S7N A;  4FD8 A;  4GN2 A;  4HP4 A;  1H5X A;  2Y2N A;  3WRT A;  4HOI A;  2OAP 1;  3P7N A;  4NXB A;  4HH2 A;  1PW8 A;  1E3U A;  4OLD A;  3IT9 A;  3IWO A;  5FAO A;  2HF6 A;  3UE1 A;  2JKF A;  4EEU A;  2PRF A;  2A24 B;  4KZ6 A;  5GLA A;  1XX2 A;  3GTC A;  2Y79 A;  1I2W A;  4EER A;  4I39 A;  3BWL A;  4HH3 A;  3KSI A;  2WKE A;  4BWI A;  2V0W A;  3WS4 A;  2R9W A;  5DJT A;  4Y3I A;  4KG2 A;  2BAS A;  1PIO A;  2QJ7 A;  2ZQ8 A;  4PMA A;  2B5R A;  4ZAM A;  5EVI B;  2JKT I;  4NKP A;  3QP4 A;  3UE3 A;  3HVF A;  2R9X A;  5EEC A;  1K4E A;  4R1G A;  4KZ3 A;  4UA6 A;  3UB7 A;  2WKR A;  3NUL A;  5G4Z A;  1Q2P A;  3G31 A;  2PBD P;  3LR3 A;  3BFF A;  3CPT A;  1JTD A;  1T18 A;  3ZNT A;  3Q07 A;  3CZD A;  3H7W A;  1YAX A;  4PPR A;  3E4O A;  4KEN B;  5CTM A;  4Q0I A;  3MZD A;  4R3A A;  4BL2 A;  1LI9 A;  4EES A;  5E2E A;  1XFQ A;  3EEH A;  3CAX A;  1NYM A;  1QMF A;  3OZH A;  2Q9N A;  1F9I A;  4EUZ A;  5J7E A;  5CEB A;  4KUK A;  4ARZ A;  2J8Y A;  1NRJ A;  5L10 A;  1W7F A;  5F1F A;  1PZP A;  4I3I A;  2HP9 A;  5J8X A;  3I7J A;  4X25 A;  4CJN A;  1IOU A;  2JHE A;  1K56 A;  1E25 A;  3CHW P;  2W3H A;  1BZA A;  1OME A;  1CEG A;  4BEN A;  4LPZ A;  2ZMF A;  5IU1 A;  1DJA A;  3F1N B;  4OQ0 A;  2VA0 A;  4RA7 A;  5CHM A;  2P04 A;  4XUZ A;  4N9K A;  3M2K A;  4OP8 A;  2PBY A;  4U3T A;  4MEZ A;  1W8Q A;  1VQQ A;  1SCW A;  5DF8 A;  4WF0 A;  4JF4 A;  2FZ0 A;  4WBG A;  3NHQ A;  3OLO A;  2V9A A;  3N8S A;  2A3U A;  4HIA A;  3BW6 A;  5HZH A;  3E2L A;  2W3F A;  4DE2 A;  5CXW A;  3A0V A;  4IJG A;  2OLV A;  4C75 A;  3EGD C;  1P97 A;  4RYE A;  4P0M A;  3A3J A;  5HDD A;  2OAQ 1;  1C3B A;  1K6R A;  1OT6 A;  1PNE A;  1S67 L;  4S2N C;  4HJ6 A;  2WAE A;  4S2I A;  2LB9 A;  3F1O A;  4IUH A;  1Y4O A;  1ZG4 A;  1NY0 A;  4P6Z M;  4O01 A;  3ZNY A;  4PM5 A;  4OQI A;  4OKP A;  1YT4 A;  3FZC A;  3G35 A;  3F1O B;  1JWP A;  3LIF A;  2XDM A;  4WMC D;  2XSS A;  3FPV A;  2CC1 A;  4EWF A;  4Q0H A;  3V3R A;  1BUE A;  3LO7 A;  4ZTK A;  3LIB A;  3VE3 A;  2OWJ A;  4UA9 A;  5M18 A;  3JVV A;  1VB6 A;  1J3W A;  5C5K A;  2EX9 A;  2QHK A;  2DCF A;  4UQI S;  1YSP A;  1CK3 A;  3IF6 A;  1IEL A;  4JGR A;  2ZOH A;  1CF0 A;  4Y0T A;  5FAP A;  3T4S A;  5AVE A;  3CJM A;  4E3J A;  5HWT A;  4Y0U A;  2J3T D;  5EFW A;  4E3L A;  1EWZ A;  2HDQ A;  3PBN A;  4KZB A;  1MXO A;  1GHM A;  2X02 A;  2WZX A;  2VX8 A;  5GHX A;  2ZJ9 A;  4HI4 A;  3AGE A;  4LRX C;  5KIZ A;  3T50 A;  4L9F A;  2C5W B;  3LEQ A;  2VLG A;  1J9M A;  3K2N A;  3S7O A;  2UV0 E;  3LIA A;  3MFD A;  4H6J A;  2QJ5 A;  2ZQ9 A;  5HL6 A;  5EM0 A;  3PTE A;  5AQB A;  3V5M A;  3R7W A;  5FQI A;  4BD0 A;  1S1Y A;  5FQQ A;  3N8R A;  3ZG0 A;  5FSR A;  3OPH A;  4CLC C;  2V2F F;  3KYE A;  5A90 A;  5F83 A;  1H8Y A;  3TW8 A;  3IF6 B;  1KOU A;  1ZG6 A;  2DMW A;  3HUN A;  5DFY A;  3LR0 A;  4PM6 A;  3NBL A;  5DKK A;  2JKT M;  1PZO A;  3KSG A;  1TS8 A;  4ZJ2 A;  5HWW A;  3NOU C;  1D1J A;  1KVM A;  5DTK A;  1FR6 A;  3G2Z A;  3FC7 A;  3GDI A;  3IQA A;  1KGF A;  3T1R A;  1LSW A;  3T1S A;  3BY9 A;  2PYR A;  3W4P A;  3B47 A;  3ZG8 B;  2QWS A;  3CPT B;  5FAS A;  2A49 A;  1GHP A;  3QP1 A;  1YLZ A;  3S1Y A;  4WEJ A;  5EOE A;  1TS0 A;  4WEL A;  3A3E A;  4HJ3 A;  1WA9 A;  4FCF A;  1GCE A;  4WUJ A;  3EQU A;  3SH7 A;  2H0T A;  3D9Y A;  2XD1 A;  3PBO A;  4G3K A;  1S6R A;  5F6A A;  1LL9 A;  1ES3 A;  4GLQ A;  3ZG7 B;  4WEK A;  4F3L B;  4BD1 A;  3ITA A;  4X55 A;  4OPY A;  2IWC A;  4JF5 A;  2WKP A;  4R38 A;  3C5A A;  3B3X A;  3B42 A;  1H8Z A;  2D02 A;  5DF9 A;  3LIC A;  2XK1 A;  4K08 A;  3D4F A;  1IKI A;  5AQA A;  2BG1 A;  4F3L A;  1JWZ A;  3FV7 A;  3ZG5 A;  1W79 A;  1STZ A;  1UWN X;  1N9B A;  2L0W A;  4D2O A;  3DTI A;  3MZE A;  3MBZ A;  2XGN A;  4YOF A;  5HD3 A;  2QZ6 A;  2WKH A;  4LRZ E;  4QY5 A;  3E4P A;  1OTD A;  1MWS A;  3EQV A;  4HP9 A;  3IF5 A;  2HGV A;  2PU2 A;  4DXC A;  4YIN A;  3W4Q A;  3WS0 A;  1K38 A;  3S22 A;  5EVL A;  4O7D A;  1K55 C;  5FEG A;  1OTE A;  3CWF A;  3K3D A;  1ESI A;  2OWH A;  1K6S A;  4X1M A;  2B18 A;  1TF1 A;  1PYY A;  4DRT A;  2XLN A;  3ZGA B;  1MWT A;  3A0R A;  2QYB A;  5KSC A;  1DRM A;  4Y2F A;  1W63 Q;  1YM1 A;  2Y2G A;  4NK3 A;  5EVI D;  1PRQ A;  1O07 A;  2HDU A;  3OPP A;  4EBP A;  1KDS A;  4ID4 A;  2R78 A;  1YLJ A;  3CG5 A;  2FFY A;  3SS5 A;  5GLD A;  4JGQ A;  3V39 A;  4I38 A;  2OOL A;  1HZO A;  3GVB A;  1D7E A;  1ZC2 A;  2K31 A;  5L09 A;  1CEF A;  2ZC7 A;  3NI9 A;  3CUE A;  1FIL A;  2VK3 A;  4Y15 A;  1IYQ A;  5U47 A;  4DKI A;  3PBT A;  4IBR A;  3SS4 A;  2Z2L B;  1LI0 A;  5FQM A;  4R3B A;  2ZMA A;  2EFX A;  1TS6 A;  3WS1 A;  1I2S A;  3GR2 A;  3ULF A;  4DE3 A;  1F5M A;  3KSH A;  2K7S A;  4X6T A;  3IX8 A;  4GHI A;  2GNX A;  1K4F A;  4I3A A;  2O0Y A;  4EQ1 A;  3IXB A;  1IKG A;  2A24 A;  2GDN A;  4MN7 A;  1Z09 A;  5I94 A;  1OJG A;  4CPK A;  1I5Q A;  3LEZ A;  1S66 L;  4X68 A;  4MBK A;  3VV4 A;  3RFB A;  3T12 B;  1XXM A;  3NCK A;  1SZV A;  3MQ0 A;  3ZVT A;  1EW0 A;  4QY6 A;  2P08 A;  4EXO A;  4HES A;  4GW9 A;  5HAI A;  1PI4 A;  3B33 A;  3T4K A;  3N7W A;  1FQG A;  1K55 A;  1HD8 A;  2GZA A;  3H9W A;  4KZ4 A;  4OOL A;  3P09 A;  1SKO B;  1E3U D;  2PU4 A;  3G4P A;  3MMH A;  4JXW A;  4UA7 A;  1VEU B;  1YMS A;  3PR6 A;  1L0F A;  4R3J A;  1NZU A;  1ALQ A;  5HW3 A;  3UN7 A;  2XA7 S;  3CMZ A;  4JPM A;  3BFG A;  5EUA A;  2ZD8 A; 
#chains in the Genus database with same CATH homology
 1V9Y A;  2XRO A;  1GSW A;  2NUT C;  1VHM A;  1N9O A;  2JKR I;  4WF0 A;  2FZ0 A;  3NHQ A;  3OLO A;  2VGL S;  4R70 A;  2I9V A;  2V9A A;  4HIA A;  3BW6 A;  5HZH A;  2L1M A;  2W3F A;  1MZU A;  3A0V A;  4GS9 B;  4IJG A;  3HJI A;  3EGD C;  1NLY A;  1P97 A;  1OTB A;  2EA9 A;  4ETX A;  5HDD A;  3PBR A;  3T4L A;  2OAQ 1;  5HWV A;  3MQQ A;  1OT6 A;  1S67 L;  4KQD A;  3S7Q A;  3UB8 A;  4DN0 A;  4HJ6 A;  4M4X A;  2LB9 A;  2CMN A;  3F1O A;  4IUH A;  4NEE D;  2O9C A;  3T4T A;  4P6Z M;  5TBM A;  4O01 A;  2VV6 A;  2V0U A;  3OBF A;  2B02 A;  5F5Y A;  3KYQ A;  3BQA A;  4BMW A;  3F1P A;  3UB6 A;  3F1O B;  3LIF A;  4CLC E;  4ME4 A;  4DJ3 A;  4O0P A;  3UB9 A;  2XSS A;  3A0S A;  5AVF A;  3FPV A;  1IFQ A;  3F1N A;  4Q0H A;  3R4K A;  4IUK A;  1F98 A;  2KX6 A;  3LIB A;  3VE3 A;  2OWJ A;  4AFI A;  2PDR A;  2K2N A;  2FH5 A;  2GX5 A;  3JVV A;  1VB6 A;  4GS9 A;  2O9B A;  3UMD A;  3DBA A;  5LBR A;  5C5K A;  2QHK A;  1JNU A;  3KX0 X;  4EET B;  2Z6C A;  4MN6 A;  1LL8 A;  4G3V A;  5DKL A;  1Y28 A;  4UQI S;  4YWZ A;  4B93 A;  1YSP A;  4IHQ A;  3PBQ A;  4JGR A;  2ZOH A;  2L4R A;  2KOI A;  2JN7 A;  3SW1 A;  3T4S A;  4B9O A;  3C38 A;  5AVE A;  4CLC B;  2WKQ A;  3LYX A;  4NXE A;  2W27 A;  5HWT A;  2J3T D;  5EFW A;  3KSF A;  2VV8 A;  5HDC A;  3H82 B;  3PBN A;  3BY8 A;  4NXG A;  2PHY A;  3IBR A;  3U2A A;  2VX8 A;  2VKS A;  1ODV A;  4HI4 A;  4L9E A;  1XJ3 A;  1NLZ A;  4LRX C;  4HY8 A;  5KIZ A;  4QPR A;  3T50 A;  2Y8H A;  2W3G A;  4H6J B;  3EEA A;  4L9F A;  3KO6 A;  3E0Y A;  3C8C A;  4YNR A;  4CLC D;  2VLG A;  3K2N A;  4MN5 A;  3S7O A;  3CIT A;  3LIA A;  3EWK A;  4H6J A;  2QJ5 A;  3TE8 A;  3LIE A;  2J80 A;  2A2L A;  5HSQ A;  2PD8 A;  2HV1 A;  5HL6 A;  3HCY A;  3BJN A;  1T1B A;  1OJ5 A;  2W3D A;  1DP6 A;  2J3W A;  3R7W A;  1S1Y A;  5F68 A;  5HPF A;  5IS1 A;  3MXQ A;  4WL9 A;  3OCL A;  3KYZ A;  4CQH A;  4CLC A;  3NJA A;  4CLC C;  2QKP A;  4O8G A;  3IS2 A;  4BBV A;  3GEC A;  3TJZ C;  1OTA A;  1T19 A;  1H3Q A;  3K3C A;  4NXF A;  3LUQ A;  2PD7 A;  3TW8 A;  3E98 A;  4WLA A;  1KOU A;  2DMW A;  2VV7 A;  2W3E A;  4DJ2 A;  5DFY A;  2M1C A;  2G7U A;  3LR0 A;  4Z1W A;  4KUO A;  5DKK A;  2JKT M;  1S1Z A;  2O9A A;  3KSG A;  4FSF A;  1TS8 A;  5HWW A;  3NOU C;  2NUP C;  2M7V A;  3G6O A;  3MFX A;  2XRN A;  2KDK A;  2O99 A;  3ZYT A;  5F69 A;  3FC7 A;  3GDI A;  3RH8 B;  4PAU A;  1OT9 A;  3FPW A;  4UQI M;  5G4Y A;  2VJW A;  1LSW A;  4MCW A;  3T4Q A;  3BY9 A;  2PYR A;  1H8M A;  3ICY A;  1ZHH B;  3B47 A;  2QWS A;  5AJG A;  2JKR M;  3PHY A;  5HPI A;  4UEY A;  4BBT A;  2PR5 A;  1DP9 A;  1P0Z A;  3PXP A;  4WEJ A;  1D06 A;  1TS0 A;  3EGX C;  4GCZ A;  3PBS A;  3IS2 B;  4HQA A;  3LR5 A;  4WEL A;  4HJ3 A;  1WA9 A;  3UE6 A;  2V1B A;  1S4R A;  2INW A;  5I5L A;  1G6O A;  2YKF A;  3EQU A;  4WUJ A;  5HD5 A;  3IBJ A;  3PBO A;  2D01 A;  4G3K A;  5F6A A;  2GJ3 A;  4GLQ A;  3CLO A;  3D72 A;  1X0O A;  4WEK A;  3JVU A;  1N9L A;  4OOM A;  4F3L B;  4P6Z S;  3MR0 A;  2H28 A;  2W1R A;  2PR6 A;  1P9W A;  4XT2 B;  4HJ4 A;  3E4Q A;  3O5Y A;  3F1P B;  3S7P A;  3VOL A;  2WKP A;  3D3O A;  4R38 A;  4JGO A;  3B42 A;  4Y5F A;  2D02 A;  5DF9 A;  3LIC A;  4MDZ A;  4K08 A;  1OTI A;  1LSX A;  1G28 A;  5DFX A;  4WN5 A;  3CUE C;  1XFN A;  4KQO A;  4F3L A;  2V1A A;  3NOP C;  2VGL M;  1UGU A;  2W1T A;  1STZ A;  1UWN X;  3T4J A;  2HJE A;  2L0W A;  4FOF A;  4ETZ A;  1V9Z A;  4YOF A;  5HD3 A;  1TS7 A;  3C30 A;  5A8B A;  4LRZ E;  2EWW A;  3TRC A;  3MQO A;  3RTY A;  3S7N A;  3E4P A;  1W63 M;  1OTD A;  4HP4 A;  5TBM B;  2IA2 A;  4EEP A;  1GSV A;  4HOI A;  3EQV A;  2OAP 1;  4PKY G;  3P7N A;  4HP9 A;  4BJP A;  4NXB A;  2HGV A;  4HH2 A;  1GSX A;  4GJ4 A;  4XT2 A;  3FG8 A;  3OC2 A;  3V67 A;  5TJJ A;  2HJ9 C;  2HF6 A;  1OTE A;  3CWF A;  1LSV A;  3K3D A;  3LI8 A;  5KSH A;  2M7U A;  4EEU A;  2OWH A;  2A24 B;  2B18 A;  4I5S A;  1TF1 A;  4EUV A;  4II7 A;  4EW7 A;  3A0R A;  4GHI B;  2Y79 A;  2QYB A;  1DRM A;  4Y2F A;  3HJK A;  3LR4 A;  4EER A;  3MF0 A;  1W63 Q;  4MMN A;  4I39 A;  3BWL A;  4HH3 A;  3CI6 A;  3OCN A;  3KSI A;  5J3W A;  4BWI A;  2V0W A;  5J4E A;  1UWP X;  1OPX A;  5DJT A;  3LFV A;  4Y3I A;  5MC7 A;  2BAS A;  2R78 A;  5K5B A;  3BQ8 A;  2QJ7 A;  3LI9 A;  1N9N A;  1S4S A;  4ARZ B;  4ZRR A;  3P01 A;  2JKT I;  4JGQ A;  4NKP A;  2XA7 M;  1TD5 A;  4I38 A;  3UE3 A;  2OOL A;  1D7E A;  2K31 A;  3LID A;  5HDS A;  3T4O A;  3UB7 A;  2WKR A;  5G4Z A;  3CUE A;  2P7J A;  2MJ6 A;  4RQ9 A;  4E04 A;  3PBT A;  1XJ2 A;  4BBU A;  3LR3 A;  1TS6 A;  5IT5 A;  5CX7 A;  1DP8 A;  1LT0 A;  3ULF A;  1T18 A;  1P9R A;  2VEA A;  4I3J A;  3VE4 A;  1F5M A;  2PYP A;  2EWV A;  3H7W A;  3KSH A;  2K7S A;  4GHI A;  1YAX A;  2Z6D A;  3E4O A;  1YSQ A;  4L9G A;  2GNX A;  4Q0I A;  4I3A A;  2O0Y A;  4R3A A;  3W2Z A;  4EQ1 A;  2ZBB A;  4HHD A;  4EES A;  1T1A A;  2A24 A;  3EOI A;  4MN7 A;  1XFQ A;  3EEH A;  3H82 A;  3CAX A;  1OJG A;  3UME A;  2VZW A;  2PT7 A;  1BYW A;  1F9I A;  1S66 L;  5J7E A;  1XJ6 A;  3VV4 A;  4KUK A;  3RFB A;  4ARZ A;  3MQ0 A;  1NRJ A;  3NOT C;  1EW0 A;  2P08 A;  3MJQ A;  4PKY A;  4R6L A;  4EXO A;  1ZTU A;  4GW9 A;  3ZQ5 A;  2LB5 A;  3B33 A;  2YKH A;  3C2W A;  3T4K A;  4I3I A;  3OOV A;  2GZA A;  2ZMV A;  3H9W A;  2KLI A;  4LLO B;  3PYP A;  1YKD A;  1IOU A;  4OOL A;  2JHE A;  3MMH A;  2J3T C;  3R7W B;  2W3H A;  4JGP A;  4HNB A;  3PR6 A;  4G3W A;  1MKM A;  4LPZ A;  2W0N A;  2ZMF A;  2W1T B;  4LRY C;  1T1C A;  5IU1 A;  3H7W B;  3F1N B;  2VA0 A;  5DJU A;  4DMZ A;  2ZOI A;  2XA7 S;  4EU0 A;  5FL3 A;  2P04 A;  5L8M A;  1NWZ A;  1MC0 A;  4Q0J A;  4L0L A;  4PHT A;  1XJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...