1UWNX

The initial events in the photocycle of photoactive yellow protein: a common mechanism on light activation in photoreceptor proteins
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
124
Chain Sequence
EHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Initial events in the photocycle of photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 34
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1uwnX00
2A24A 4HY8A 5G4ZA 3LYXA 4WLAA 4LRYC 4R6LA 4BBVA 4GHIA 4F3LA 2L1MA 2V1AA 3E4PA 3K3DA 1N9NA 3A0SA 5J3WA 1LL8A 5DJTA 3MFXA 1OJ5A 4H6JB 3A0VA 4HJ6A 4HHDA 1OTAA 1XJ6A 4HOIA 5HD5A 2VV6A 5HZHA 4I3JA 3LIFA 1G28A 2ZOIA 2PHYA 3EEHA 3LI8A 2I9VA 4B9OA 2V1BA 4MN6A 2VLGA 4GS9B 1LSWA 3GECA 2P7JA 1NWZA 4WF0A 3UMDA 3NOPC 2Z6CA 2QKPA 4H6JA 2OWJA 1T1AA 3LIEA 1LSVA 1P97A 1Y28A 1MZUA 1DRMA 4EQ1A 1GSXA 2OOLA 3PHYA 2L0WA 5HSQA 2QWSA 4L9FA 4EW7A 1S1YA 4HH3A 3H82B 2W27A 1T1CA 1XJ2A 4GS9A 5IU1A 5HDSA 2JN7A 4DJ3A 3FG8A 4HNBA 4GW9A 1N9OA 4HJ3A 1LT0A 5F6AA 1VB6A 2VV8A 3HJIA 5HDDA 1OJGA 1GSVA 1F9IA 2GJ3A 2PYRA 3E4OA 3EWKA 1UGUA 4HIAA 3UE6A 3IS2B 4MN5A 4BBTA 4LPZA 4LRZE 1OTBA 3VOLA 4KQDA 3MR0A 4HH2A 3H7WB 3LICA 1T1BA 2WKQA 2D02A 3UB6A 2KDKA 3KX0X 1D06A 2H28A 1S4RA 5TBMA 5J4EA 3BY9A 3E4QA 1XFNA 4HP4A 2Z6DA 1F98A 1S67L 4EETB 4JGPA 1WA9A 3RTYA 5A8BA 3ZQ5A 5KIZA 2EA9A 4NXFA 2INWA 1EW0A 2CMNA 4LRXC 4EESA 3H7WA 4XT2B 3F1OB 4HP9A 3VE4A 3CWFA 3LIAA 3LUQA 4KUOA 1DP9A 4K08A 4I3AA 2QJ5A 3NJAA 4R70A 3NOTC 3MJQA 2PR5A 5F69A 1TS7A 3F1OA 3BY8A 5HWVA 3A0RA 2M1CA 1T19A 2HV1A 5HWTA 1DP6A 5F68A 3D72A 2QJ7A 4L9EA 3K3CA 3B33A 2PDRA 2PD8A 2VEAA 1P0ZA 2A24B 3H82A 4I5SA 2V9AA 3F1PB 1T18A 1OTDA 5G4YA 4LLOB 5J7EA 1GSWA 1TS0A 4M4XA 2KX6A 3CAXA 3LIDA 3HJKA 5EFWA 4YWZA 3ULFA 2PD7A 3IBRA 1TS6A 2JHEA 4NXBA 4R3AA 3H9WA 2R78A 3F1PA 2WKRA 1TS8A 4I38A 2L4RA 2PR6A 4PKYA 2YKFA 3CLOA 4HQAA 1N9LA 5DJUA 3GDIA 4HJ4A 1V9YA 3MXQA 4L9GA 3C8CA 3IS2A 4EXOA 4DJ2A 1XJ4A 3UB9A 4NXEA 4E04A 3PYPA 5F5YA 1ODVA 4BBUA 1BYWA 1OT9A 5HDCA 4JGRA 3UB8A 4WN5A 5I5LA 1JNUA 4KUKA 3P7NA 5HWWA 3ICYA 2OWHA 4R38A 1S66L 4NXGA 2K7SA 1OTIA 1X0OA 4WUJA 1XFQA 5AVEA 4XT2A 1DP8A 3FC7A 4EEPA 4HI4A 2J80A 2BASA 2D01A 1D7EA 4I39A 5AVFA 3NHQA 5DKKA 3BWLA 2PYPA 4I3IA 2VV7A 2W0NA 1OTEA 3C2WA 4JGQA 2QHKA 3LI9A 1S4SA 1KOUA 4JGOA 3F1NB 4EERA 4WL9A 3MQQA 3G6OA 3NOUC 3OLOA 3MQOA 3T50A 2ZBBA 2V0WA 3VE3A 2B02A 4GHIB 1OT6A 4F3LB 5DKLA 3SW1A 3UMEA 1LSXA 1XJ3A 1UWNX 5HD3A 2V0UA 2YKHA 1UWPX 2ZOHA 3RH8B 1V9ZA 2WKPA 3UB7A 4GCZA 1S1ZA 4PKYG 3LIBA 5TBMB 4RQ9A 5IS1A 3F1NA 4EEUA
chains in the Genus database with same CATH superfamily
2XSSA 5G4ZA 2W3FA 3IWOA 1YSQA 4LRYC 4BENA 3L7HA 4R6LA 3T4SA 1YLTA 5KMWA 2H5SA 1SCWA 4UAAA 4Y5FA 3K3DA 3A0SA 5J3WA 5EOEA 2KOIA 3CUEC 4FCFA 2HDQA 4H6JB 1OTAA 1CQAA 2OAQ1 4KZ3A 1FQGA 2VV6A 5HZHA 3VMAA 4Y3IA 4B93A 3DTKA 2ZC4B 1G28A 2ZOIA 4IUHA 3LI8A 4N92A 4OQHA 1DJBA 4B9OA 3IWIA 2PU2A 1YSPA 2VLGA 2ZQ8A 1I2WA 3IH8A 2ZL1A 4ID4A 3PXPA 3NOPC 2Z6CA 3UDXA 2PBYA 2Y59A 1M6KA 1H3QA 3OPRA 5HFOA 4KQRA 3PBTA 4ESPA 1MC0A 3FKWA 2W3EA 4C3QA 2XA7M 1DRMA 5TFQA 4Y0TA 4S2IA 4GLQA 2L0WA 4E6XA 3IXGA 5L09A 3W4QA 5CHUA 1XPBA 3H82B 2W27A 4QB8A 3AGEA 2JKTI 1XJ2A 3E2KA 5HDSA 3CHWP 2Y2GA 3Q7ZA 4P6ZM 4MBFA 4HNBA 4O0PA 3P98A 3LO7A 3ZHHA 1CEGA 3R7WB 5F6AA 4X56A 1H0MA 4M3KA 4WMCD 5TR7A 4OQGA 3RXXA 2JCHA 3BLSA 3VP3A 5HDDA 5HARA 5GLBA 2PYRA 1ZHHB 3E4OA 4S2LA 2H0YA 1VQQA 3T4KA 3RFBA 1UGUA 3A3IA 4EBLA 3BQ8A 3G30A 1WE4A 4BBTA 2I72A 3UB5P 2VGLS 5EM0A 3UN7A 1K54A 5FATA 3G34A 1JWPA 3H7WB 4MNRA 1VHMA 2D02A 3UB6A 1L2SA 1D06A 2ZJ9A 4EUZA 4A5RA 4X69A 3E4QA 3TSGA 4HP4A 2Z6DA 5GLDA 1BT5A 4G3WA 4KG2A 4NK3A 3SH7A 2Y2MA 2OV5A 5E2EA 1MY8A 3OPPA 1NXYA 3VV4A 1EW0A 4B88A 1RGZA 1L0EA 3IQAA 3F1OB 2FH5A 4DRTA 1TEMA 5FASA 2Y2KA 1IYOA 3LUQA 2JKRM 4WBGA 4K08A 2KLIA 3BLMA 4DE3A 2UWXA 3HLEA 2H10A 4OP5A 2G2WA 5L10A 1ZKJA 5KZHA 3QP6A 3QP4A 4X6TA 4OPYA 5GL9A 1NLZA 4ETZA 4KZ4A 4DE2A 3MKFA 3NDGA 2Y79A 3LGOA 3PBSA 1E25A 2B5RA 1TD5A 3OPLA 5F68A 2K2NA 2HF6A 3NI9A 3PTEA 3D72A 2WKIA 2QJ7A 4L9EA 3TW8A 3WS1A 1PZPA 1BLCA 3B33A 4BMWA 2PD8A 5HAQA 3FPVA 4E3MA 1P0ZA 2A24B 3IHBA 3H82A 4CLCC 3MQ0A 2V9AA 3F1PB 3T1SA 1OTDA 2XDMA 4DF6A 5EVIC 1G6AA 3PBQA 4GZBA 2VZWA 1TS0A 3VFFA 1YLPA 4FH4A 4IBXA 1P9RA 1F5MA 3CAXA 4O8GA 4PM8A 2H0TA 3R7WA 4LFUA 1Q2QA 3C38A 5FDHA 3IBRA 5DFYA 3N8RA 2JHEA 3FWLA 2WKRA 5FQMA 4QWOA 5DJUA 3GDIA 4HJ4A 2AVXA 3NY4A 3C8CA 5FI6A 2BG1A 3O5YA 4DE0A 1LLBA 4BLMA 4X55A 3OC2A 3HLCA 1ZG6A 4BWIA 5BOHA 3CPTB 2LB9A 3OOVA 3UB8A 1HZOA 4Q0HA 4ZRRA 4KUKA 4BD0A 4C75A 5HWWA 1VEUB 1IELA 3C7VA 4NETA 5CERA 3FZCA 4XXRA 2QYBA 3FV7A 5M18A 4NXGA 3UE3A 4N9KA 3NDEA 5CEDA 1DP8A 2J9PA 3I7JA 4HI4A 5U47A 1IYSA 1XKZA 1U60A 3OCLA 3TRCA 3M6HA 1L3LA 4I39A 3C4OA 5AVFA 3MZEA 3G2YA 3Q81A 2ZLYA 1CJFA 5FDSA 5F1FA 1OTEA 2B95A 2Y2HA 3Q7VA 1KGEA 1E4DA 2A3UA 3IF6B 1S4SA 4KZAA 4HBUA 4ZTKA 3F1NB 2HDSA 5FSRA 4EERA 3NIAA 4WL9A 1TVFA 1PNEA 1JVJA 1YKDA 2O99A 3BM6A 4GD8A 3K2NA 5FQQA 4OLDA 2HP6A 3VE3A 4JXWA 3GR2A 1OT6A 4Y0UA 4UHUA 4CLCE 4QY5A 4JXVA 1LSXA 2E8JA 1UWPX 3RH8B 2XA7S 2WKPA 2NUPC 4IVIA 1W79A 3UB7A 2R9XA 2XROA 4GCZA 1Y54A 4PKYG 3LIBA 5TBMB 2EX6A 4EEUA 1E3UA 3L9KA 2A24A 3VP4A 4S2NA 4DDSA 3UE0A 3UE1A 1L0DA 1BSGA 1KE4A 1KGFA 4P6BA 4P6ZS 3PBNA 2L1MA 4KZ6A 2BLSA 5CHJA 1FR6A 2WKHA 1ZC2A 3WRTA 4X53A 4FSFA 3PR6A 3GVBA 4MLLA 1AWIA 2J3TD 2ZL1B 5DJTA 5L8MA 1OJ5A 3OZHA 1OMEA 2QZ6A 2WGWA 1W7FA 4FH2A 5GHZA 3CMZA 3EEAA 5CEBA 5L2FA 1BLHA 2PHYA 2W1TA 3EEHA 4RVAA 3BRMA 4HEFA 4KZ5A 4MN6A 1K57A 3UMDA 3E2LA 3CPTA 5EVEA 3DAVA 1YMSA 2V2FF 4R1GA 4OPRA 1T1AA 3LIEA 3WS5A 1P97A 4QPRA 2XLNA 4MMNA 4EQ1A 1NLYA 1K0KA 4WZ5C 1VEUA 1PYYA 3OCNA 4GJ4A 5HPFA 3SOIA 3T1XA 3A3EA 1S1YA 1J9MA 1XGIA 2JN7A 3WWXA 2O0YA 3ZVWA 3CI6A 1YLZA 3AGDA 4Y0OA 3FG8A 2OAP1 1W63Q 2XRNA 3HUOA 4CQHA 1HTZA 4PM9A 3MZFA 4LV2A 4WYYA 2P04A 4X25A 1VB6A 1YAXA 2P08A 3IX8A 3IXBA 3LY3A 2Q9MA 2J8YA 4MEZA 3NBLA 4OVDA 5G18A 3UDIA 4HESA 2HP9A 1J3WA 1OJGA 1F9IA 3VP2A 3S4XA 4WEJA 3PAGA 3UPNA 3ZYTA 2XH9A 5HW3A 5K5BA 2JKRI 3S7NA 3DTMA 4HIAA 1YLWA 5FA7A 5GLAA 1STZA 2J9OA 1OTBA 4OPQA 1GHMA 1NRJA 3VOLA 3VFHA 4HH2A 3MF0A 2WKQA 4Z9QA 3QP5A 2KDKA 3KX0X 3T12B 1S4RA 3SH9A 1PWGA 5TBMA 2HDRA 1F98A 5EECA 2EFXA 1S67L 4EETB 2EFUA 5FEFA 3ISGA 4EU0A 5A8BA 1KDWA 2CMNA 3ZG5A 1PWDA 4EESA 1FCMA 4OOLA 3IBJA 2XEPA 3CWFA 1K55A 4OH0A 1DP9A 3HCYA 5TJJA 4UQIM 2VGKA 1YT4A 1CEFA 1ACFA 4RX3A 3RXWA 3C7UA 3MJQA 2PR5A 3KSIA 3C30A 4LV0A 3BY8A 3CITA 3LR4A 1ZTUA 1T19A 1XGJA 1DP6A 3B47A 4K0WA 4ZJ2A 2PAVP 4PM6A 1H8YA 5E2HA 4DXBA 1K6SA 4Y7PA 1NZOA 1FOFA 5EPHA 1DJAA 2PDRA 3KYQA 2VEAA 3VOZA 4X68A 4DKIA 1PIOA 3ZDJA 3HBRA 4DN0A 4I5SA 5E2GA 3CJMA 3PAEA 2A2LA 1T18A 3ZNTA 4R0QA 4YOFA 5J7EA 3WS0A 4O01A 4JXSA 2W1RA 2KX6A 1WYBA 1I5QA 4Y17A 5EFWA 3CZDA 1NYYA 1W5DA 1JWVA 1FILA 3LEQA 3CUEA 3H9WA 1NZUA 2PR6A 4PKYA 3T1RA 2J3WA 3MXQA 1EI5A 4QHCA 4JLFA 4MBKA 1XJ4A 4BD1A 1K4FA 5DF8A 5DTKA 2OLUA 3IWQA 5HAPA 1IYQA 4GNUA 3PYPA 5F5YA 1ODVA 4LV1A 4KENB 3S7PA 1ESIA 1F2KA 4ME4A 4Y15A 2XD1A 3HUMA 2Y2QA 3IHAA 1ERQA 3DWKA 5FAPA 2DRWA 3ICYA 3NULA 3IXHA 5AQBA 4B4ZA 1SKOB 2OWHA 3ZFZA 3Q7VB 1S66L 2ZQAA 5JYPA 4DMZA 2FFFB 2O9AA 3S1YA 3JVVA 1OTIA 1X0OA 3NCKA 3BFGA 1I2SA 1C3BA 2J80A 2BASA 3T1QB 5DVAA 2D01A 2HDUA 2PRFA 1D7EA 4QD4A 3NHQA 2V1ZA 2Y2OA 2EX9A 4D2OA 2PYPA 4I3IA 5A91A 5TGFA 2XF3A 4EBPA 3C2WA 1KVMA 1D1JA 1SKFA 2FZ0A 3V3SA 3LR5A 3UY6A 2WZXA 4E6WA 4IUKA 3G6OA 3NOUC 3OLOA 5IT5A 3G4PA 3MQOA 3W4PA 2V0WA 2HJ9C 2B02A 3MBZA 3T4OA 1XA1A 3BEBA 2ZC7A 3JPUA 3PBOA 1XJ3A 4KQQA 1G5UA 1UWNX 3N7WA 4BJPA 4NKPA 1W8QA 3UO9A 1S1ZA 2G2UA 3BFEA 2J7VA 4RQ9A 4KZBA 1H8MA 1SDNA 2WGWB 2P74A 5F82A 4E3JA 3LYXA 4WLAA 1E3UD 3IXDA 4BBVA 1LL5A 2A49A 3W2ZA 3UDFA 1FCOA 5L07A 4F3LA 2JKTM 2W1TB 4R3BA 2V1AA 4OQ0A 1N9NA 2ZMVA 3E0YA 4PPRA 1LL8A 2ZQDA 3MFXA 3UPOA 2IWCA 3CG5A 1JTDA 3A0VA 1EROA 4HHDA 1XP4A 3IX4A 3HLBA 3V3RA 3AGFA 4IBRA 5HL6A 1P9WA 1QMFA 2EX8A 5A92A 4I3JA 2Q0OA 3KO6A 4WEKA 2I9VA 4S2MA 5CTNA 1MWSA 2V1BA 1SHVA 1LSWA 3GECA 1RGYA 1NWZA 4WF0A 2GX5A 3VOYA 3FYZA 2OWJA 1ONHA 1JTGA 3MKEA 5DFXA 4MCWA 4EBNA 1Y28A 5FI7A 1H5XA 1TDGA 3T4TA 1O07A 1HD8A 2OOLA 4E3LA 1HVBA 3NECA 2WKEA 1SKOA 1A0KA 4L9FA 2EXAA 4OPZA 1T1CA 4GS9A 3TJZC 3MZDA 4CLCA 3WRZA 3KYEA 3D3OA 3Q07A 5EM1A 5GHXA 4RX2A 3P01A 1ES2A 1N9OA 5EVIA 4HJ3A 3BFCA 1LT0A 3P09A 3N6IA 2ZQ7A 1GSVA 2HJEA 5FAOA 5CGSA 1N4OA 4DE1A 4UA7A 1XX2A 3DWZA 3UE6A 1MXOA 3KSGA 1Z6FA 2R9WA 2CC1A 4KQDA 3IF6C 3LICA 1PWCA 3GQZA 4OLGA 4G3KA 1GHPA 3VP1A 2H28A 5J4EA 3BY9A 4X1LA 5A93A 3D9YA 3B3XA 4IEDA 1XXMA 3VP0A 4ARZB 1M40A 1WA9A 2J3TC 2W3DA 3FPWA 3ZQ5A 1PW8A 4QJGA 4MDZA 2WYXA 4BQMA 4LRXC 4N9LA 4JF6A 5FQKA 2V8CA 1GCEA 4S2PA 5FL3A 3GRJA 3ZG8B 3N8LA 1ESUA 4BL2A 2JKGA 4KUOA 4B4XA 2WZZA 3B42A 2QMIA 4U0TA 2Z2LB 5AQ9A 3O87A 1L0FA 5M1AA 2QJ5A 1BZAA 3G2ZA 1K38A 1LL9A 3SZTA 1FIKA 4OOMA 4R70A 1ALQA 3OBFA 5EV0A 1TS7A 2WAFA 3E98A 4S2OA 3SS3A 5J8XA 1Z09A 2DNSA 2M1CA 4II7A 2HV1A 2GZAA 3S7QA 3BQAA 5JYOA 4N1HA 4ZAMA 1S6RA 2VKSA 5HPIA 5CGXA 1MPLA 1K56A 3EQUA 3UPPA 3ZG7B 5DF9A 1PW1A 3K3CA 3G31A 2MJ6A 1TDLA 5D3OA 1Y4OA 4LGWA 4JXGA 2WK0A 2BTFP 1NY0A 4S2JA 3QP1A 3SS5A 4U0XA 2XFSA 4GDNA 1YLYA 5FQIA 4U3TA 4IHQA 4LLOB 2QPNA 3MSHA 1GSWA 1PFLA 2ZM0A 4KZ7A 2Y2LA 4YFMA 2ZMFA 1DY6A 4RYEA 4ETXA 4Q0JA 3LIDA 3M6BA 2C5WB 3HVFA 5GHYA 4YWZA 4OQIA 2JC7A 2ZM8A 2PD7A 1BUEA 5DTTA 1TS6A 4OONA 4NXBA 1TS8A 4RA7A 4I38A 1YQSA 2L4RA 2YKFA 3CLOA 4HQAA 1N9LA 1IYPA 4XUZA 1V9YA 1K54C 3ITBA 3MS6A 4L9GA 3W8KA 1OPXA 4EXOA 4DJ2A 5KSHA 4EV4A 1IOUA 3V50A 4E04A 4C6YA 1MWTA 3O88A 1BYWA 2Y8HA 3A3FA 4JGRA 3U2AA 2GNXA 3N4IA 2JBFA 2XFTA 3M2KA 4AFIA 2O9BA 1MKMA 1FSYA 3NC8A 3P7NA 1XA7A 3S22A 4JF4A 1SDEA 4ARZA 2Y55A 1CI8A 3UNWA 2Z2MB 4N1XA 4WZ5A 4LCLA 2JKFA 5EVLA 1ERMA 4NG2A 2OLVA 1CI9A 1ZG4A 3BFFA 4E3IA 4OP8A 3TG9A 2VK3A 5CGWA 5F83A 5DKKA 1VETB 1HLUP 1MBLA 1YM1A 1S0WA 3VSLA 3HLGA 4R23A 3QNCA 3LY4A 4JGQA 2FFYA 4XUXA 1NJ4A 3TOIA 3GTCA 2QHKA 2HP5A 2RCXA 2ZC6B 4JGOA 4LCMA 2O9CA 3HLFA 5DF7A 3MQQA 5CTMA 2Y2IA 1PI5A 4OOYA 3VSKA 4DXCA 3T50A 2ZBBA 5FQ9A 1KGGA 1BLPA 2X02A 4F3LB 3SW1A 2VJWA 3UMEA 4KZ8A 2YKHA 3G32A 1CF0A 5CECA 2EWVA 4YNRA 3MMHA 3Q1FA 5CXWA 4HY8A 2WGIA 2EX2A 4EQIA 1BTLA 3QP2A 1NYMA 4BL3A 1K6RA 4UEYA 4GHIA 4Q8IA 4GB7A 4PHTA 4MN7A 3E4PA 5DTSA 4DDYA 3V39A 4FOFA 4GKUA 3BJNA 3V67A 4EWFA 4FUWA 2WADA 4HJ6A 4ZBEA 3WS2A 5HAIA 1XJ6A 4HOIA 4R4SA 1WYCA 1IFQA 2ZQ9A 5HD5A 4OKPA 3LIFA 2K31A 5FEGA 4GDBA 3JYIA 3S7OA 4QU3A 3ZVTA 5M19A 4GS9B 4HBTA 2P7JA 2XGNA 4S2KA 2QKPA 4H6JA 4CLCB 4E3KA 1KDSA 1IEMA 1K4EA 4K91A 1LSVA 5A90A 5EVIB 1MZUA 1GSXA 3PHYA 2E8IA 1BLSA 2M7UA 4NEED 5HSQA 2QWSA 4EW7A 3LEZA 3EGXC 3LCEA 1NRFA 4Q0IA 3EOIA 2B18A 4HH3A 4YINA 5IU1A 5FAQA 3O3VA 4Z1WA 4DJ3A 1MKIA 3ZG0A 4GW9A 4P85A 2X71A 3V5MA 3M2JA 4CLCD 1EWZA 2VGJA 3EQVA 4WMCA 3T4LA 3BW6A 1RCJA 1VETA 5KSCA 5AQ7A 1PRQA 4K0XA 2VV8A 1FSWA 3HJIA 5EVID 3IH9A 3HREA 3ZCZA 3HLDA 3SS4A 2GJ3A 2Y2NA 4FD8A 4QY6A 4KG6A 3EWKA 4P0MA 3ZNYA 1VM1A 3IS2B 4MN5A 4LPZA 4R4RA 3W4OA 3BYDA 4LRZE 2X01A 2NUTC 4JBFA 2VX8A 2Y2PA 3MR0A 5HX9A 1KE3A 1T1BA 4S2NC 2XR0A 1W8YA 1XFNA 1LI9A 1G6OA 2PBDP 1LI0A 4JGPA 3RJUA 3RTYA 5KIZA 2EA9A 4NXFA 2INWA 3FKVA 1FR1A 1ES4A 3DTEA 3O86A 3H7WA 4XT2B 4HP9A 3VE4A 3C4PA 3LIAA 5I94A 3EGDC 3LFVA 4PM7A 3T4QA 5EOOA 2P9VB 3HLWA 4I3AA 5CX7A 3KSFA 2HZ5A 3NJAA 3SH8A 4R3JA 3NOTC 1KVLA 5F69A 1K57C 2XK1A 2IWBA 4WELA 3F1OA 1K25A 3A0RA 5HWVA 2Y91A 3WS4A 2EWWA 5HWTA 2ZC5B 4X1MA 4D60A 3KYZA 2VGLM 1QMEA 5FI2A 1ONGA 2WUQA 3JVUA 4E3OA 2ZMAA 2V8FA 1G68A 1CK3A 4UQIS 1TF1A 2EXBA 1K56D 2XQZA 1FCNA 2Y4AA 3IX3A 3DW0A 1L0GA 4FTXA 4G3VA 2G7UA 1BULA 1JWZA 3BECA 2WAEA 1O7EA 5GLCA 2WGVA 5AJGA 2LB5A 4GN2A 2RL3A 3N8SA 4KG5A 4JKTA 4KZ9A 5G4YA 2Y2JA 1N9BA 3A3JA 3HUNA 4O7DA 5C5KA 4M4XA 4ZDXA 4LV3A 1MWRA 1PZOA 2ACGA 4E3NA 5CRFA 5E43A 3MXSA 3HJKA 3ZGAB 2XD5A 3ULFA 3Q82A 2UV0E 4IVKA 4PMAA 3KSHA 4R3AA 2R78A 3F1PA 1PI4A 3QNBA 2VA0A 3R4KA 2W3HA 3ITAA 4JPMA 3GMWA 1MWUA 4H8RA 4UA9A 5EE8A 3ZG9B 4CPKA 3QHYA 1ES5A 3IS2A 1Q2PA 1H8ZA 3LR3A 3UB9A 4NXEA 4IJGA 1YMXA 3MFDA 4BBUA 3IT9A 1OT9A 5HDCA 4PAUA 5HL1A 2GDNA 4ZJ3A 4L0LA 4WN5A 5I5LA 1JNUA 2PT7A 3HL9A 5EUAA 4F94A 4KQOA 5E2FA 1DJCA 2V20A 3PBRA 5IHVA 4R38A 4CJNA 4ZJ1A 1KE0A 2IWDA 2HPBA 4UA6A 3T4JA 4JF5A 1K55C 3MXRA 2K7SA 3BFDA 3GV9A 4WUJA 1XFQA 1GA0A 4WZ4A 5AVEA 4XT2A 3D4FA 3FC7A 3DBAA 4EEPA 4P87A 1ES3A 2C6WB 4GOGA 2HGVA 5LBRA 4PM5A 4LENA 3A3DA 1AXBA 2DCFA 2JE5A 2IA2A 3BWLA 2P9VA 4Y13A 2VV7A 2W0NA 5CHMA 2OSUA 1W63M 1GA9A 2PU4A 3GSGA 3DTIA 1IKGA 3LI9A 1IKIA 1RP5A 2ZD8A 1KOUA 4GD6A 5MC7A 5FQJA 3QP8A 4MBHA 3TE8A 5F1GA 3OPHA 3U4LP 2M7VA 2ZC3B 4GHIB 1GHIA 5AQAA 1SZVA 3C5AA 3IF5A 5DKLA 1YPRA 3G35A 2ZOHA 2V0UA 5HD3A 1V9ZA 4Y2FA 1YLJA 2W3GA 1LHYA 2Q9NA 2DMWA 3IF6A 4EUVA 3LR0A 2ZM2A 5IS1A 3F1NA 2ZQCA 4WM9A
chains in the Genus database with same CATH topology
2XSSA 2A24A 4HY8A 5G4ZA 3LYXA 2W3FA 1YSQA 4WLAA 4LRYC 4R6LA 3T4SA 4BBVA 4UEYA 3W2ZA 4GHIA 4P6ZS 4PHTA 3PBNA 4F3LA 2JKTM 2L1MA 4Y5FA 2W1TB 4MN7A 2V1AA 3E4PA 3K3DA 1N9NA 2ZMVA 3E0YA 4FSFA 3A0SA 3PR6A 4FOFA 2J3TD 3BJNA 5J3WA 1LL8A 3V67A 5DJTA 3MFXA 2KOIA 3CUEC 5L8MA 1OJ5A 4H6JB 3A0VA 4HJ6A 4HHDA 1OTAA 1XJ6A 2OAQ1 5HL6A 4HOIA 1P9WA 1IFQA 5HD5A 2VV6A 5HZHA 4I3JA 4Y3IA 4B93A 3EEAA 3KO6A 3LIFA 1G28A 2ZOIA 4IUHA 2PHYA 2W1TA 3EEHA 4WEKA 2K31A 3LI8A 2I9VA 4B9OA 3S7OA 2V1BA 1YSPA 4MN6A 2VLGA 4GS9B 1LSWA 3GECA 2P7JA 1NWZA 4WF0A 3PXPA 3UMDA 2GX5A 3NOPC 2Z6CA 2QKPA 1H3QA 4H6JA 4CLCB 2OWJA 3PBTA 1MC0A 5DFXA 4MCWA 1T1AA 3LIEA 1LSVA 1P97A 1Y28A 2W3EA 4QPRA 2XA7M 1MZUA 1DRMA 4MMNA 3T4TA 1NLYA 4EQ1A 1GSXA 2OOLA 3PHYA 4GLQA 2L0WA 2M7UA 4NEED 3OCNA 5HSQA 2QWSA 4GJ4A 4L9FA 4EW7A 5HPFA 3EGXC 4Q0IA 3EOIA 1S1YA 2B18A 3H82B 4HH3A 2W27A 1T1CA 1XJ2A 2JKTI 4GS9A 3TJZC 5IU1A 5HDSA 4Z1WA 2JN7A 2O0YA 4DJ3A 3CI6A 4P6ZM 4CLCA 3FG8A 4HNBA 2OAP1 4GW9A 3D3OA 1W63Q 2XRNA 4CQHA 4O0PA 4CLCD 3P01A 3EQVA 1N9OA 4HJ3A 3T4LA 1LT0A 3BW6A 3R7WB 2P04A 5F6AA 1VB6A 1YAXA 2VV8A 3HJIA 2P08A 5HDDA 1OJGA 1GSVA 2HJEA 1F9IA 2GJ3A 2PYRA 1ZHHB 3E4OA 4WEJA 3ZYTA 3T4KA 3RFBA 3EWKA 1UGUA 5K5BA 2JKRI 3S7NA 4HIAA 3BQ8A 3UE6A 3IS2B 4MN5A 4BBTA 4LPZA 3KSGA 1STZA 4LRZE 2VGLS 1OTBA 2NUTC 1NRJA 3VOLA 4KQDA 2VX8A 3MR0A 4HH2A 3H7WB 3LICA 1VHMA 1T1BA 3MF0A 2WKQA 2D02A 3UB6A 4G3KA 2KDKA 3KX0X 1D06A 2H28A 1S4RA 5TBMA 5J4EA 3BY9A 3E4QA 1XFNA 4HP4A 2Z6DA 4G3WA 1F98A 1G6OA 1S67L 4ARZB 4EETB 4JGPA 1WA9A 2J3TC 2W3DA 3FPWA 3RTYA 4EU0A 3ZQ5A 5A8BA 2EA9A 5KIZA 4NXFA 4MDZA 2INWA 3VV4A 1EW0A 2CMNA 4LRXC 4EESA 5FL3A 4OOLA 3H7WA 4XT2B 3F1OB 4HP9A 2FH5A 3IBJA 3VE4A 3CWFA 3LIAA 3LUQA 4KUOA 2JKRM 3B42A 3EGDC 1DP9A 4K08A 3LFVA 3HCYA 2KLIA 3T4QA 5TJJA 4UQIM 4I3AA 5CX7A 2QJ5A 3KSFA 3NJAA 4OOMA 4R70A 3NOTC 3MJQA 3OBFA 2PR5A 5F69A 3KSIA 1NLZA 4ETZA 1TS7A 4WELA 3F1OA 3C30A 3E98A 3BY8A 3CITA 3LR4A 1ZTUA 5HWVA 3A0RA 2M1CA 2Y79A 1T19A 4II7A 2EWWA 2HV1A 3PBSA 5HWTA 2GZAA 3S7QA 1TD5A 3BQAA 1DP6A 3KYZA 2VGLM 3B47A 5F68A 2K2NA 2HF6A 2VKSA 3JVUA 5HPIA 3D72A 3EQUA 2QJ7A 4L9EA 3TW8A 5DF9A 3K3CA 4UQIS 1TF1A 2MJ6A 3B33A 4G3VA 4BMWA 2PDRA 2G7UA 2PD8A 3KYQA 2VEAA 3FPVA 1P0ZA 2A24B 3H82A 4CLCC 4DN0A 3MQ0A 4I5SA 2V9AA 2LB5A 5AJGA 3F1PB 2A2LA 1T18A 1OTDA 4IHQA 5G4YA 3PBQA 4LLOB 2VZWA 4YOFA 5J7EA 1GSWA 1TS0A 4O01A 2W1RA 5C5KA 4M4XA 1P9RA 2KX6A 1F5MA 3CAXA 4O8GA 3R7WA 2ZMFA 4ETXA 4Q0JA 3LIDA 3HJKA 3C38A 5EFWA 4YWZA 3ULFA 2PD7A 3IBRA 5DFYA 1TS6A 3CUEA 2JHEA 3KSHA 4NXBA 4R3AA 3H9WA 2R78A 3F1PA 2WKRA 1TS8A 4I38A 2L4RA 2VA0A 3R4KA 2W3HA 2PR6A 4PKYA 2YKFA 3CLOA 4HQAA 1N9LA 5DJUA 3GDIA 4HJ4A 1V9YA 2J3WA 3MXQA 4L9GA 3C8CA 1OPXA 3IS2A 4EXOA 3O5YA 4DJ2A 1XJ4A 5KSHA 3LR3A 3UB9A 4NXEA 1IOUA 4IJGA 3OC2A 4E04A 3PYPA 5F5YA 4BWIA 1ODVA 4BBUA 1BYWA 2Y8HA 1OT9A 5HDCA 2LB9A 4ME4A 4PAUA 3S7PA 4JGRA 3U2AA 3OOVA 2GNXA 3UB8A 4L0LA 4WN5A 5I5LA 4Q0HA 1JNUA 4AFIA 2PT7A 4ZRRA 2O9BA 4KUKA 1MKMA 3P7NA 4KQOA 5HWWA 3ICYA 3PBRA 2OWHA 4ARZA 4R38A 2QYBA 1S66L 3T4JA 4NXGA 3UE3A 4DMZA 2O9AA 2K7SA 3JVVA 1OTIA 1X0OA 4WUJA 1XFQA 5AVEA 4XT2A 1DP8A 3FC7A 3DBAA 4EEPA 4HI4A 2J80A 2BASA 3OCLA 2D01A 3TRCA 2HGVA 1D7EA 4I39A 5LBRA 5AVFA 3NHQA 5DKKA 2IA2A 3BWLA 2PYPA 4I3IA 2VV7A 2W0NA 1OTEA 3C2WA 1W63M 4JGQA 2FZ0A 2QHKA 3LI9A 3LR5A 1S4SA 1KOUA 4JGOA 4IUKA 2O9CA 3F1NB 5MC7A 4EERA 4WL9A 3MQQA 3G6OA 3NOUC 3OLOA 5IT5A 3TE8A 1YKDA 2O99A 3MQOA 3T50A 3K2NA 2ZBBA 2V0WA 2HJ9C 3VE3A 2M7VA 2B02A 4GHIB 3T4OA 1OT6A 4F3LB 5DKLA 3SW1A 4CLCE 2VJWA 3PBOA 3UMEA 1LSXA 1XJ3A 1UWNX 2YKHA 2V0UA 2ZOHA 1UWPX 5HD3A 3RH8B 1V9ZA 2XA7S 2WKPA 2EWVA 4Y2FA 2W3GA 2NUPC 4YNRA 4NKPA 3UB7A 4BJPA 3MMHA 2XROA 4GCZA 1S1ZA 2DMWA 4PKYG 3LIBA 5TBMB 4EUVA 3LR0A 4RQ9A 5IS1A 1H8MA 3F1NA 4EEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A24 A;  4HY8 A;  5G4Z A;  3LYX A;  4WLA A;  4LRY C;  4R6L A;  4BBV A;  4GHI A;  4F3L A;  2L1M A;  2V1A A;  3E4P A;  3K3D A;  1N9N A;  3A0S A;  5J3W A;  1LL8 A;  5DJT A;  3MFX A;  1OJ5 A;  4H6J B;  3A0V A;  4HJ6 A;  4HHD A;  1OTA A;  1XJ6 A;  4HOI A;  5HD5 A;  2VV6 A;  5HZH A;  4I3J A;  3LIF A;  1G28 A;  2ZOI A;  2PHY A;  3EEH A;  3LI8 A;  2I9V A;  4B9O A;  2V1B A;  4MN6 A;  2VLG A;  4GS9 B;  1LSW A;  3GEC A;  2P7J A;  1NWZ A;  4WF0 A;  3UMD A;  3NOP C;  2Z6C A;  2QKP A;  4H6J A;  2OWJ A;  1T1A A;  3LIE A;  1LSV A;  1P97 A;  1Y28 A;  1MZU A;  1DRM A;  4EQ1 A;  1GSX A;  2OOL A;  3PHY A;  2L0W A;  5HSQ A;  2QWS A;  4L9F A;  4EW7 A;  1S1Y A;  4HH3 A;  3H82 B;  2W27 A;  1T1C A;  1XJ2 A;  4GS9 A;  5IU1 A;  5HDS A;  2JN7 A;  4DJ3 A;  3FG8 A;  4HNB A;  4GW9 A;  1N9O A;  4HJ3 A;  1LT0 A;  5F6A A;  1VB6 A;  2VV8 A;  3HJI A;  5HDD A;  1OJG A;  1GSV A;  1F9I A;  2GJ3 A;  2PYR A;  3E4O A;  3EWK A;  1UGU A;  4HIA A;  3UE6 A;  3IS2 B;  4MN5 A;  4BBT A;  4LPZ A;  4LRZ E;  1OTB A;  3VOL A;  4KQD A;  3MR0 A;  4HH2 A;  3H7W B;  3LIC A;  1T1B A;  2WKQ A;  2D02 A;  3UB6 A;  2KDK A;  3KX0 X;  1D06 A;  2H28 A;  1S4R A;  5TBM A;  5J4E A;  3BY9 A;  3E4Q A;  1XFN A;  4HP4 A;  2Z6D A;  1F98 A;  1S67 L;  4EET B;  4JGP A;  1WA9 A;  3RTY A;  5A8B A;  3ZQ5 A;  5KIZ A;  2EA9 A;  4NXF A;  2INW A;  1EW0 A;  2CMN A;  4LRX C;  4EES A;  3H7W A;  4XT2 B;  3F1O B;  4HP9 A;  3VE4 A;  3CWF A;  3LIA A;  3LUQ A;  4KUO A;  1DP9 A;  4K08 A;  4I3A A;  2QJ5 A;  3NJA A;  4R70 A;  3NOT C;  3MJQ A;  2PR5 A;  5F69 A;  1TS7 A;  3F1O A;  3BY8 A;  5HWV A;  3A0R A;  2M1C A;  1T19 A;  2HV1 A;  5HWT A;  1DP6 A;  5F68 A;  3D72 A;  2QJ7 A;  4L9E A;  3K3C A;  3B33 A;  2PDR A;  2PD8 A;  2VEA A;  1P0Z A;  2A24 B;  3H82 A;  4I5S A;  2V9A A;  3F1P B;  1T18 A;  1OTD A;  5G4Y A;  4LLO B;  5J7E A;  1GSW A;  1TS0 A;  4M4X A;  2KX6 A;  3CAX A;  3LID A;  3HJK A;  5EFW A;  4YWZ A;  3ULF A;  2PD7 A;  3IBR A;  1TS6 A;  2JHE A;  4NXB A;  4R3A A;  3H9W A;  2R78 A;  3F1P A;  2WKR A;  1TS8 A;  4I38 A;  2L4R A;  2PR6 A;  4PKY A;  2YKF A;  3CLO A;  4HQA A;  1N9L A;  5DJU A;  3GDI A;  4HJ4 A;  1V9Y A;  3MXQ A;  4L9G A;  3C8C A;  3IS2 A;  4EXO A;  4DJ2 A;  1XJ4 A;  3UB9 A;  4NXE A;  4E04 A;  3PYP A;  5F5Y A;  1ODV A;  4BBU A;  1BYW A;  1OT9 A;  5HDC A;  4JGR A;  3UB8 A;  4WN5 A;  5I5L A;  1JNU A;  4KUK A;  3P7N A;  5HWW A;  3ICY A;  2OWH A;  4R38 A;  1S66 L;  4NXG A;  2K7S A;  1OTI A;  1X0O A;  4WUJ A;  1XFQ A;  5AVE A;  4XT2 A;  1DP8 A;  3FC7 A;  4EEP A;  4HI4 A;  2J80 A;  2BAS A;  2D01 A;  1D7E A;  4I39 A;  5AVF A;  3NHQ A;  5DKK A;  3BWL A;  2PYP A;  4I3I A;  2VV7 A;  2W0N A;  1OTE A;  3C2W A;  4JGQ A;  2QHK A;  3LI9 A;  1S4S A;  1KOU A;  4JGO A;  3F1N B;  4EER A;  4WL9 A;  3MQQ A;  3G6O A;  3NOU C;  3OLO A;  3MQO A;  3T50 A;  2ZBB A;  2V0W A;  3VE3 A;  2B02 A;  4GHI B;  1OT6 A;  4F3L B;  5DKL A;  3SW1 A;  3UME A;  1LSX A;  1XJ3 A;  1UWN X;  5HD3 A;  2V0U A;  2YKH A;  1UWP X;  2ZOH A;  3RH8 B;  1V9Z A;  2WKP A;  3UB7 A;  4GCZ A;  1S1Z A;  4PKY G;  3LIB A;  5TBM B;  4RQ9 A;  5IS1 A;  3F1N A;  4EEU A; 
#chains in the Genus database with same CATH topology
 2XSS A;  5G4Z A;  2W3F A;  3IWO A;  1YSQ A;  4LRY C;  4BEN A;  3L7H A;  4R6L A;  3T4S A;  1YLT A;  5KMW A;  2H5S A;  1SCW A;  4UAA A;  4Y5F A;  3K3D A;  3A0S A;  5J3W A;  5EOE A;  2KOI A;  3CUE C;  4FCF A;  2HDQ A;  4H6J B;  1OTA A;  1CQA A;  2OAQ 1;  4KZ3 A;  1FQG A;  2VV6 A;  5HZH A;  3VMA A;  4Y3I A;  4B93 A;  3DTK A;  2ZC4 B;  1G28 A;  2ZOI A;  4IUH A;  3LI8 A;  4N92 A;  4OQH A;  1DJB A;  4B9O A;  3IWI A;  2PU2 A;  1YSP A;  2VLG A;  2ZQ8 A;  1I2W A;  3IH8 A;  2ZL1 A;  4ID4 A;  3PXP A;  3NOP C;  2Z6C A;  3UDX A;  2PBY A;  2Y59 A;  1M6K A;  1H3Q A;  3OPR A;  5HFO A;  4KQR A;  3PBT A;  4ESP A;  1MC0 A;  3FKW A;  2W3E A;  4C3Q A;  2XA7 M;  1DRM A;  5TFQ A;  4Y0T A;  4S2I A;  4GLQ A;  2L0W A;  4E6X A;  3IXG A;  5L09 A;  3W4Q A;  5CHU A;  1XPB A;  3H82 B;  2W27 A;  4QB8 A;  3AGE A;  2JKT I;  1XJ2 A;  3E2K A;  5HDS A;  3CHW P;  2Y2G A;  3Q7Z A;  4P6Z M;  4MBF A;  4HNB A;  4O0P A;  3P98 A;  3LO7 A;  3ZHH A;  1CEG A;  3R7W B;  5F6A A;  4X56 A;  1H0M A;  4M3K A;  4WMC D;  5TR7 A;  4OQG A;  3RXX A;  2JCH A;  3BLS A;  3VP3 A;  5HDD A;  5HAR A;  5GLB A;  2PYR A;  1ZHH B;  3E4O A;  4S2L A;  2H0Y A;  1VQQ A;  3T4K A;  3RFB A;  1UGU A;  3A3I A;  4EBL A;  3BQ8 A;  3G30 A;  1WE4 A;  4BBT A;  2I72 A;  3UB5 P;  2VGL S;  5EM0 A;  3UN7 A;  1K54 A;  5FAT A;  3G34 A;  1JWP A;  3H7W B;  4MNR A;  1VHM A;  2D02 A;  3UB6 A;  1L2S A;  1D06 A;  2ZJ9 A;  4EUZ A;  4A5R A;  4X69 A;  3E4Q A;  3TSG A;  4HP4 A;  2Z6D A;  5GLD A;  1BT5 A;  4G3W A;  4KG2 A;  4NK3 A;  3SH7 A;  2Y2M A;  2OV5 A;  5E2E A;  1MY8 A;  3OPP A;  1NXY A;  3VV4 A;  1EW0 A;  4B88 A;  1RGZ A;  1L0E A;  3IQA A;  3F1O B;  2FH5 A;  4DRT A;  1TEM A;  5FAS A;  2Y2K A;  1IYO A;  3LUQ A;  2JKR M;  4WBG A;  4K08 A;  2KLI A;  3BLM A;  4DE3 A;  2UWX A;  3HLE A;  2H10 A;  4OP5 A;  2G2W A;  5L10 A;  1ZKJ A;  5KZH A;  3QP6 A;  3QP4 A;  4X6T A;  4OPY A;  5GL9 A;  1NLZ A;  4ETZ A;  4KZ4 A;  4DE2 A;  3MKF A;  3NDG A;  2Y79 A;  3LGO A;  3PBS A;  1E25 A;  2B5R A;  1TD5 A;  3OPL A;  5F68 A;  2K2N A;  2HF6 A;  3NI9 A;  3PTE A;  3D72 A;  2WKI A;  2QJ7 A;  4L9E A;  3TW8 A;  3WS1 A;  1PZP A;  1BLC A;  3B33 A;  4BMW A;  2PD8 A;  5HAQ A;  3FPV A;  4E3M A;  1P0Z A;  2A24 B;  3IHB A;  3H82 A;  4CLC C;  3MQ0 A;  2V9A A;  3F1P B;  3T1S A;  1OTD A;  2XDM A;  4DF6 A;  5EVI C;  1G6A A;  3PBQ A;  4GZB A;  2VZW A;  1TS0 A;  3VFF A;  1YLP A;  4FH4 A;  4IBX A;  1P9R A;  1F5M A;  3CAX A;  4O8G A;  4PM8 A;  2H0T A;  3R7W A;  4LFU A;  1Q2Q A;  3C38 A;  5FDH A;  3IBR A;  5DFY A;  3N8R A;  2JHE A;  3FWL A;  2WKR A;  5FQM A;  4QWO A;  5DJU A;  3GDI A;  4HJ4 A;  2AVX A;  3NY4 A;  3C8C A;  5FI6 A;  2BG1 A;  3O5Y A;  4DE0 A;  1LLB A;  4BLM A;  4X55 A;  3OC2 A;  3HLC A;  1ZG6 A;  4BWI A;  5BOH A;  3CPT B;  2LB9 A;  3OOV A;  3UB8 A;  1HZO A;  4Q0H A;  4ZRR A;  4KUK A;  4BD0 A;  4C75 A;  5HWW A;  1VEU B;  1IEL A;  3C7V A;  4NET A;  5CER A;  3FZC A;  4XXR A;  2QYB A;  3FV7 A;  5M18 A;  4NXG A;  3UE3 A;  4N9K A;  3NDE A;  5CED A;  1DP8 A;  2J9P A;  3I7J A;  4HI4 A;  5U47 A;  1IYS A;  1XKZ A;  1U60 A;  3OCL A;  3TRC A;  3M6H A;  1L3L A;  4I39 A;  3C4O A;  5AVF A;  3MZE A;  3G2Y A;  3Q81 A;  2ZLY A;  1CJF A;  5FDS A;  5F1F A;  1OTE A;  2B95 A;  2Y2H A;  3Q7V A;  1KGE A;  1E4D A;  2A3U A;  3IF6 B;  1S4S A;  4KZA A;  4HBU A;  4ZTK A;  3F1N B;  2HDS A;  5FSR A;  4EER A;  3NIA A;  4WL9 A;  1TVF A;  1PNE A;  1JVJ A;  1YKD A;  2O99 A;  3BM6 A;  4GD8 A;  3K2N A;  5FQQ A;  4OLD A;  2HP6 A;  3VE3 A;  4JXW A;  3GR2 A;  1OT6 A;  4Y0U A;  4UHU A;  4CLC E;  4QY5 A;  4JXV A;  1LSX A;  2E8J A;  1UWP X;  3RH8 B;  2XA7 S;  2WKP A;  2NUP C;  4IVI A;  1W79 A;  3UB7 A;  2R9X A;  2XRO A;  4GCZ A;  1Y54 A;  4PKY G;  3LIB A;  5TBM B;  2EX6 A;  4EEU A;  1E3U A;  3L9K A;  2A24 A;  3VP4 A;  4S2N A;  4DDS A;  3UE0 A;  3UE1 A;  1L0D A;  1BSG A;  1KE4 A;  1KGF A;  4P6B A;  4P6Z S;  3PBN A;  2L1M A;  4KZ6 A;  2BLS A;  5CHJ A;  1FR6 A;  2WKH A;  1ZC2 A;  3WRT A;  4X53 A;  4FSF A;  3PR6 A;  3GVB A;  4MLL A;  1AWI A;  2J3T D;  2ZL1 B;  5DJT A;  5L8M A;  1OJ5 A;  3OZH A;  1OME A;  2QZ6 A;  2WGW A;  1W7F A;  4FH2 A;  5GHZ A;  3CMZ A;  3EEA A;  5CEB A;  5L2F A;  1BLH A;  2PHY A;  2W1T A;  3EEH A;  4RVA A;  3BRM A;  4HEF A;  4KZ5 A;  4MN6 A;  1K57 A;  3UMD A;  3E2L A;  3CPT A;  5EVE A;  3DAV A;  1YMS A;  2V2F F;  4R1G A;  4OPR A;  1T1A A;  3LIE A;  3WS5 A;  1P97 A;  4QPR A;  2XLN A;  4MMN A;  4EQ1 A;  1NLY A;  1K0K A;  4WZ5 C;  1VEU A;  1PYY A;  3OCN A;  4GJ4 A;  5HPF A;  3SOI A;  3T1X A;  3A3E A;  1S1Y A;  1J9M A;  1XGI A;  2JN7 A;  3WWX A;  2O0Y A;  3ZVW A;  3CI6 A;  1YLZ A;  3AGD A;  4Y0O A;  3FG8 A;  2OAP 1;  1W63 Q;  2XRN A;  3HUO A;  4CQH A;  1HTZ A;  4PM9 A;  3MZF A;  4LV2 A;  4WYY A;  2P04 A;  4X25 A;  1VB6 A;  1YAX A;  2P08 A;  3IX8 A;  3IXB A;  3LY3 A;  2Q9M A;  2J8Y A;  4MEZ A;  3NBL A;  4OVD A;  5G18 A;  3UDI A;  4HES A;  2HP9 A;  1J3W A;  1OJG A;  1F9I A;  3VP2 A;  3S4X A;  4WEJ A;  3PAG A;  3UPN A;  3ZYT A;  2XH9 A;  5HW3 A;  5K5B A;  2JKR I;  3S7N A;  3DTM A;  4HIA A;  1YLW A;  5FA7 A;  5GLA A;  1STZ A;  2J9O A;  1OTB A;  4OPQ A;  1GHM A;  1NRJ A;  3VOL A;  3VFH A;  4HH2 A;  3MF0 A;  2WKQ A;  4Z9Q A;  3QP5 A;  2KDK A;  3KX0 X;  3T12 B;  1S4R A;  3SH9 A;  1PWG A;  5TBM A;  2HDR A;  1F98 A;  5EEC A;  2EFX A;  1S67 L;  4EET B;  2EFU A;  5FEF A;  3ISG A;  4EU0 A;  5A8B A;  1KDW A;  2CMN A;  3ZG5 A;  1PWD A;  4EES A;  1FCM A;  4OOL A;  3IBJ A;  2XEP A;  3CWF A;  1K55 A;  4OH0 A;  1DP9 A;  3HCY A;  5TJJ A;  4UQI M;  2VGK A;  1YT4 A;  1CEF A;  1ACF A;  4RX3 A;  3RXW A;  3C7U A;  3MJQ A;  2PR5 A;  3KSI A;  3C30 A;  4LV0 A;  3BY8 A;  3CIT A;  3LR4 A;  1ZTU A;  1T19 A;  1XGJ A;  1DP6 A;  3B47 A;  4K0W A;  4ZJ2 A;  2PAV P;  4PM6 A;  1H8Y A;  5E2H A;  4DXB A;  1K6S A;  4Y7P A;  1NZO A;  1FOF A;  5EPH A;  1DJA A;  2PDR A;  3KYQ A;  2VEA A;  3VOZ A;  4X68 A;  4DKI A;  1PIO A;  3ZDJ A;  3HBR A;  4DN0 A;  4I5S A;  5E2G A;  3CJM A;  3PAE A;  2A2L A;  1T18 A;  3ZNT A;  4R0Q A;  4YOF A;  5J7E A;  3WS0 A;  4O01 A;  4JXS A;  2W1R A;  2KX6 A;  1WYB A;  1I5Q A;  4Y17 A;  5EFW A;  3CZD A;  1NYY A;  1W5D A;  1JWV A;  1FIL A;  3LEQ A;  3CUE A;  3H9W A;  1NZU A;  2PR6 A;  4PKY A;  3T1R A;  2J3W A;  3MXQ A;  1EI5 A;  4QHC A;  4JLF A;  4MBK A;  1XJ4 A;  4BD1 A;  1K4F A;  5DF8 A;  5DTK A;  2OLU A;  3IWQ A;  5HAP A;  1IYQ A;  4GNU A;  3PYP A;  5F5Y A;  1ODV A;  4LV1 A;  4KEN B;  3S7P A;  1ESI A;  1F2K A;  4ME4 A;  4Y15 A;  2XD1 A;  3HUM A;  2Y2Q A;  3IHA A;  1ERQ A;  3DWK A;  5FAP A;  2DRW A;  3ICY A;  3NUL A;  3IXH A;  5AQB A;  4B4Z A;  1SKO B;  2OWH A;  3ZFZ A;  3Q7V B;  1S66 L;  2ZQA A;  5JYP A;  4DMZ A;  2FFF B;  2O9A A;  3S1Y A;  3JVV A;  1OTI A;  1X0O A;  3NCK A;  3BFG A;  1I2S A;  1C3B A;  2J80 A;  2BAS A;  3T1Q B;  5DVA A;  2D01 A;  2HDU A;  2PRF A;  1D7E A;  4QD4 A;  3NHQ A;  2V1Z A;  2Y2O A;  2EX9 A;  4D2O A;  2PYP A;  4I3I A;  5A91 A;  5TGF A;  2XF3 A;  4EBP A;  3C2W A;  1KVM A;  1D1J A;  1SKF A;  2FZ0 A;  3V3S A;  3LR5 A;  3UY6 A;  2WZX A;  4E6W A;  4IUK A;  3G6O A;  3NOU C;  3OLO A;  5IT5 A;  3G4P A;  3MQO A;  3W4P A;  2V0W A;  2HJ9 C;  2B02 A;  3MBZ A;  3T4O A;  1XA1 A;  3BEB A;  2ZC7 A;  3JPU A;  3PBO A;  1XJ3 A;  4KQQ A;  1G5U A;  1UWN X;  3N7W A;  4BJP A;  4NKP A;  1W8Q A;  3UO9 A;  1S1Z A;  2G2U A;  3BFE A;  2J7V A;  4RQ9 A;  4KZB A;  1H8M A;  1SDN A;  2WGW B;  2P74 A;  5F82 A;  4E3J A;  3LYX A;  4WLA A;  1E3U D;  3IXD A;  4BBV A;  1LL5 A;  2A49 A;  3W2Z A;  3UDF A;  1FCO A;  5L07 A;  4F3L A;  2JKT M;  2W1T B;  4R3B A;  2V1A A;  4OQ0 A;  1N9N A;  2ZMV A;  3E0Y A;  4PPR A;  1LL8 A;  2ZQD A;  3MFX A;  3UPO A;  2IWC A;  3CG5 A;  1JTD A;  3A0V A;  1ERO A;  4HHD A;  1XP4 A;  3IX4 A;  3HLB A;  3V3R A;  3AGF A;  4IBR A;  5HL6 A;  1P9W A;  1QMF A;  2EX8 A;  5A92 A;  4I3J A;  2Q0O A;  3KO6 A;  4WEK A;  2I9V A;  4S2M A;  5CTN A;  1MWS A;  2V1B A;  1SHV A;  1LSW A;  3GEC A;  1RGY A;  1NWZ A;  4WF0 A;  2GX5 A;  3VOY A;  3FYZ A;  2OWJ A;  1ONH A;  1JTG A;  3MKE A;  5DFX A;  4MCW A;  4EBN A;  1Y28 A;  5FI7 A;  1H5X A;  1TDG A;  3T4T A;  1O07 A;  1HD8 A;  2OOL A;  4E3L A;  1HVB A;  3NEC A;  2WKE A;  1SKO A;  1A0K A;  4L9F A;  2EXA A;  4OPZ A;  1T1C A;  4GS9 A;  3TJZ C;  3MZD A;  4CLC A;  3WRZ A;  3KYE A;  3D3O A;  3Q07 A;  5EM1 A;  5GHX A;  4RX2 A;  3P01 A;  1ES2 A;  1N9O A;  5EVI A;  4HJ3 A;  3BFC A;  1LT0 A;  3P09 A;  3N6I A;  2ZQ7 A;  1GSV A;  2HJE A;  5FAO A;  5CGS A;  1N4O A;  4DE1 A;  4UA7 A;  1XX2 A;  3DWZ A;  3UE6 A;  1MXO A;  3KSG A;  1Z6F A;  2R9W A;  2CC1 A;  4KQD A;  3IF6 C;  3LIC A;  1PWC A;  3GQZ A;  4OLG A;  4G3K A;  1GHP A;  3VP1 A;  2H28 A;  5J4E A;  3BY9 A;  4X1L A;  5A93 A;  3D9Y A;  3B3X A;  4IED A;  1XXM A;  3VP0 A;  4ARZ B;  1M40 A;  1WA9 A;  2J3T C;  2W3D A;  3FPW A;  3ZQ5 A;  1PW8 A;  4QJG A;  4MDZ A;  2WYX A;  4BQM A;  4LRX C;  4N9L A;  4JF6 A;  5FQK A;  2V8C A;  1GCE A;  4S2P A;  5FL3 A;  3GRJ A;  3ZG8 B;  3N8L A;  1ESU A;  4BL2 A;  2JKG A;  4KUO A;  4B4X A;  2WZZ A;  3B42 A;  2QMI A;  4U0T A;  2Z2L B;  5AQ9 A;  3O87 A;  1L0F A;  5M1A A;  2QJ5 A;  1BZA A;  3G2Z A;  1K38 A;  1LL9 A;  3SZT A;  1FIK A;  4OOM A;  4R70 A;  1ALQ A;  3OBF A;  5EV0 A;  1TS7 A;  2WAF A;  3E98 A;  4S2O A;  3SS3 A;  5J8X A;  1Z09 A;  2DNS A;  2M1C A;  4II7 A;  2HV1 A;  2GZA A;  3S7Q A;  3BQA A;  5JYO A;  4N1H A;  4ZAM A;  1S6R A;  2VKS A;  5HPI A;  5CGX A;  1MPL A;  1K56 A;  3EQU A;  3UPP A;  3ZG7 B;  5DF9 A;  1PW1 A;  3K3C A;  3G31 A;  2MJ6 A;  1TDL A;  5D3O A;  1Y4O A;  4LGW A;  4JXG A;  2WK0 A;  2BTF P;  1NY0 A;  4S2J A;  3QP1 A;  3SS5 A;  4U0X A;  2XFS A;  4GDN A;  1YLY A;  5FQI A;  4U3T A;  4IHQ A;  4LLO B;  2QPN A;  3MSH A;  1GSW A;  1PFL A;  2ZM0 A;  4KZ7 A;  2Y2L A;  4YFM A;  2ZMF A;  1DY6 A;  4RYE A;  4ETX A;  4Q0J A;  3LID A;  3M6B A;  2C5W B;  3HVF A;  5GHY A;  4YWZ A;  4OQI A;  2JC7 A;  2ZM8 A;  2PD7 A;  1BUE A;  5DTT A;  1TS6 A;  4OON A;  4NXB A;  1TS8 A;  4RA7 A;  4I38 A;  1YQS A;  2L4R A;  2YKF A;  3CLO A;  4HQA A;  1N9L A;  1IYP A;  4XUZ A;  1V9Y A;  1K54 C;  3ITB A;  3MS6 A;  4L9G A;  3W8K A;  1OPX A;  4EXO A;  4DJ2 A;  5KSH A;  4EV4 A;  1IOU A;  3V50 A;  4E04 A;  4C6Y A;  1MWT A;  3O88 A;  1BYW A;  2Y8H A;  3A3F A;  4JGR A;  3U2A A;  2GNX A;  3N4I A;  2JBF A;  2XFT A;  3M2K A;  4AFI A;  2O9B A;  1MKM A;  1FSY A;  3NC8 A;  3P7N A;  1XA7 A;  3S22 A;  4JF4 A;  1SDE A;  4ARZ A;  2Y55 A;  1CI8 A;  3UNW A;  2Z2M B;  4N1X A;  4WZ5 A;  4LCL A;  2JKF A;  5EVL A;  1ERM A;  4NG2 A;  2OLV A;  1CI9 A;  1ZG4 A;  3BFF A;  4E3I A;  4OP8 A;  3TG9 A;  2VK3 A;  5CGW A;  5F83 A;  5DKK A;  1VET B;  1HLU P;  1MBL A;  1YM1 A;  1S0W A;  3VSL A;  3HLG A;  4R23 A;  3QNC A;  3LY4 A;  4JGQ A;  2FFY A;  4XUX A;  1NJ4 A;  3TOI A;  3GTC A;  2QHK A;  2HP5 A;  2RCX A;  2ZC6 B;  4JGO A;  4LCM A;  2O9C A;  3HLF A;  5DF7 A;  3MQQ A;  5CTM A;  2Y2I A;  1PI5 A;  4OOY A;  3VSK A;  4DXC A;  3T50 A;  2ZBB A;  5FQ9 A;  1KGG A;  1BLP A;  2X02 A;  4F3L B;  3SW1 A;  2VJW A;  3UME A;  4KZ8 A;  2YKH A;  3G32 A;  1CF0 A;  5CEC A;  2EWV A;  4YNR A;  3MMH A;  3Q1F A;  5CXW A;  4HY8 A;  2WGI A;  2EX2 A;  4EQI A;  1BTL A;  3QP2 A;  1NYM A;  4BL3 A;  1K6R A;  4UEY A;  4GHI A;  4Q8I A;  4GB7 A;  4PHT A;  4MN7 A;  3E4P A;  5DTS A;  4DDY A;  3V39 A;  4FOF A;  4GKU A;  3BJN A;  3V67 A;  4EWF A;  4FUW A;  2WAD A;  4HJ6 A;  4ZBE A;  3WS2 A;  5HAI A;  1XJ6 A;  4HOI A;  4R4S A;  1WYC A;  1IFQ A;  2ZQ9 A;  5HD5 A;  4OKP A;  3LIF A;  2K31 A;  5FEG A;  4GDB A;  3JYI A;  3S7O A;  4QU3 A;  3ZVT A;  5M19 A;  4GS9 B;  4HBT A;  2P7J A;  2XGN A;  4S2K A;  2QKP A;  4H6J A;  4CLC B;  4E3K A;  1KDS A;  1IEM A;  1K4E A;  4K91 A;  1LSV A;  5A90 A;  5EVI B;  1MZU A;  1GSX A;  3PHY A;  2E8I A;  1BLS A;  2M7U A;  4NEE D;  5HSQ A;  2QWS A;  4EW7 A;  3LEZ A;  3EGX C;  3LCE A;  1NRF A;  4Q0I A;  3EOI A;  2B18 A;  4HH3 A;  4YIN A;  5IU1 A;  5FAQ A;  3O3V A;  4Z1W A;  4DJ3 A;  1MKI A;  3ZG0 A;  4GW9 A;  4P85 A;  2X71 A;  3V5M A;  3M2J A;  4CLC D;  1EWZ A;  2VGJ A;  3EQV A;  4WMC A;  3T4L A;  3BW6 A;  1RCJ A;  1VET A;  5KSC A;  5AQ7 A;  1PRQ A;  4K0X A;  2VV8 A;  1FSW A;  3HJI A;  5EVI D;  3IH9 A;  3HRE A;  3ZCZ A;  3HLD A;  3SS4 A;  2GJ3 A;  2Y2N A;  4FD8 A;  4QY6 A;  4KG6 A;  3EWK A;  4P0M A;  3ZNY A;  1VM1 A;  3IS2 B;  4MN5 A;  4LPZ A;  4R4R A;  3W4O A;  3BYD A;  4LRZ E;  2X01 A;  2NUT C;  4JBF A;  2VX8 A;  2Y2P A;  3MR0 A;  5HX9 A;  1KE3 A;  1T1B A;  4S2N C;  2XR0 A;  1W8Y A;  1XFN A;  1LI9 A;  1G6O A;  2PBD P;  1LI0 A;  4JGP A;  3RJU A;  3RTY A;  5KIZ A;  2EA9 A;  4NXF A;  2INW A;  3FKV A;  1FR1 A;  1ES4 A;  3DTE A;  3O86 A;  3H7W A;  4XT2 B;  4HP9 A;  3VE4 A;  3C4P A;  3LIA A;  5I94 A;  3EGD C;  3LFV A;  4PM7 A;  3T4Q A;  5EOO A;  2P9V B;  3HLW A;  4I3A A;  5CX7 A;  3KSF A;  2HZ5 A;  3NJA A;  3SH8 A;  4R3J A;  3NOT C;  1KVL A;  5F69 A;  1K57 C;  2XK1 A;  2IWB A;  4WEL A;  3F1O A;  1K25 A;  3A0R A;  5HWV A;  2Y91 A;  3WS4 A;  2EWW A;  5HWT A;  2ZC5 B;  4X1M A;  4D60 A;  3KYZ A;  2VGL M;  1QME A;  5FI2 A;  1ONG A;  2WUQ A;  3JVU A;  4E3O A;  2ZMA A;  2V8F A;  1G68 A;  1CK3 A;  4UQI S;  1TF1 A;  2EXB A;  1K56 D;  2XQZ A;  1FCN A;  2Y4A A;  3IX3 A;  3DW0 A;  1L0G A;  4FTX A;  4G3V A;  2G7U A;  1BUL A;  1JWZ A;  3BEC A;  2WAE A;  1O7E A;  5GLC A;  2WGV A;  5AJG A;  2LB5 A;  4GN2 A;  2RL3 A;  3N8S A;  4KG5 A;  4JKT A;  4KZ9 A;  5G4Y A;  2Y2J A;  1N9B A;  3A3J A;  3HUN A;  4O7D A;  5C5K A;  4M4X A;  4ZDX A;  4LV3 A;  1MWR A;  1PZO A;  2ACG A;  4E3N A;  5CRF A;  5E43 A;  3MXS A;  3HJK A;  3ZGA B;  2XD5 A;  3ULF A;  3Q82 A;  2UV0 E;  4IVK A;  4PMA A;  3KSH A;  4R3A A;  2R78 A;  3F1P A;  1PI4 A;  3QNB A;  2VA0 A;  3R4K A;  2W3H A;  3ITA A;  4JPM A;  3GMW A;  1MWU A;  4H8R A;  4UA9 A;  5EE8 A;  3ZG9 B;  4CPK A;  3QHY A;  1ES5 A;  3IS2 A;  1Q2P A;  1H8Z A;  3LR3 A;  3UB9 A;  4NXE A;  4IJG A;  1YMX A;  3MFD A;  4BBU A;  3IT9 A;  1OT9 A;  5HDC A;  4PAU A;  5HL1 A;  2GDN A;  4ZJ3 A;  4L0L A;  4WN5 A;  5I5L A;  1JNU A;  2PT7 A;  3HL9 A;  5EUA A;  4F94 A;  4KQO A;  5E2F A;  1DJC A;  2V20 A;  3PBR A;  5IHV A;  4R38 A;  4CJN A;  4ZJ1 A;  1KE0 A;  2IWD A;  2HPB A;  4UA6 A;  3T4J A;  4JF5 A;  1K55 C;  3MXR A;  2K7S A;  3BFD A;  3GV9 A;  4WUJ A;  1XFQ A;  1GA0 A;  4WZ4 A;  5AVE A;  4XT2 A;  3D4F A;  3FC7 A;  3DBA A;  4EEP A;  4P87 A;  1ES3 A;  2C6W B;  4GOG A;  2HGV A;  5LBR A;  4PM5 A;  4LEN A;  3A3D A;  1AXB A;  2DCF A;  2JE5 A;  2IA2 A;  3BWL A;  2P9V A;  4Y13 A;  2VV7 A;  2W0N A;  5CHM A;  2OSU A;  1W63 M;  1GA9 A;  2PU4 A;  3GSG A;  3DTI A;  1IKG A;  3LI9 A;  1IKI A;  1RP5 A;  2ZD8 A;  1KOU A;  4GD6 A;  5MC7 A;  5FQJ A;  3QP8 A;  4MBH A;  3TE8 A;  5F1G A;  3OPH A;  3U4L P;  2M7V A;  2ZC3 B;  4GHI B;  1GHI A;  5AQA A;  1SZV A;  3C5A A;  3IF5 A;  5DKL A;  1YPR A;  3G35 A;  2ZOH A;  2V0U A;  5HD3 A;  1V9Z A;  4Y2F A;  1YLJ A;  2W3G A;  1LHY A;  2Q9N A;  2DMW A;  3IF6 A;  4EUV A;  3LR0 A;  2ZM2 A;  5IS1 A;  3F1N A;  2ZQC A;  4WM9 A; 
#chains in the Genus database with same CATH homology
 2XSS A;  2A24 A;  4HY8 A;  5G4Z A;  3LYX A;  2W3F A;  1YSQ A;  4WLA A;  4LRY C;  4R6L A;  3T4S A;  4BBV A;  4UEY A;  3W2Z A;  4GHI A;  4P6Z S;  4PHT A;  3PBN A;  4F3L A;  2JKT M;  2L1M A;  4Y5F A;  2W1T B;  4MN7 A;  2V1A A;  3E4P A;  3K3D A;  1N9N A;  2ZMV A;  3E0Y A;  4FSF A;  3A0S A;  3PR6 A;  4FOF A;  2J3T D;  3BJN A;  5J3W A;  1LL8 A;  3V67 A;  5DJT A;  3MFX A;  2KOI A;  3CUE C;  5L8M A;  1OJ5 A;  4H6J B;  3A0V A;  4HJ6 A;  4HHD A;  1OTA A;  1XJ6 A;  2OAQ 1;  5HL6 A;  4HOI A;  1P9W A;  1IFQ A;  5HD5 A;  2VV6 A;  5HZH A;  4I3J A;  4Y3I A;  4B93 A;  3EEA A;  3KO6 A;  3LIF A;  1G28 A;  2ZOI A;  4IUH A;  2PHY A;  2W1T A;  3EEH A;  4WEK A;  2K31 A;  3LI8 A;  2I9V A;  4B9O A;  3S7O A;  2V1B A;  1YSP A;  4MN6 A;  2VLG A;  4GS9 B;  1LSW A;  3GEC A;  2P7J A;  1NWZ A;  4WF0 A;  3PXP A;  3UMD A;  2GX5 A;  3NOP C;  2Z6C A;  2QKP A;  1H3Q A;  4H6J A;  4CLC B;  2OWJ A;  3PBT A;  1MC0 A;  5DFX A;  4MCW A;  1T1A A;  3LIE A;  1LSV A;  1P97 A;  1Y28 A;  2W3E A;  4QPR A;  2XA7 M;  1MZU A;  1DRM A;  4MMN A;  3T4T A;  1NLY A;  4EQ1 A;  1GSX A;  2OOL A;  3PHY A;  4GLQ A;  2L0W A;  2M7U A;  4NEE D;  3OCN A;  5HSQ A;  2QWS A;  4GJ4 A;  4L9F A;  4EW7 A;  5HPF A;  3EGX C;  4Q0I A;  3EOI A;  1S1Y A;  2B18 A;  3H82 B;  4HH3 A;  2W27 A;  1T1C A;  1XJ2 A;  2JKT I;  4GS9 A;  3TJZ C;  5IU1 A;  5HDS A;  4Z1W A;  2JN7 A;  2O0Y A;  4DJ3 A;  3CI6 A;  4P6Z M;  4CLC A;  3FG8 A;  4HNB A;  2OAP 1;  4GW9 A;  3D3O A;  1W63 Q;  2XRN A;  4CQH A;  4O0P A;  4CLC D;  3P01 A;  3EQV A;  1N9O A;  4HJ3 A;  3T4L A;  1LT0 A;  3BW6 A;  3R7W B;  2P04 A;  5F6A A;  1VB6 A;  1YAX A;  2VV8 A;  3HJI A;  2P08 A;  5HDD A;  1OJG A;  1GSV A;  2HJE A;  1F9I A;  2GJ3 A;  2PYR A;  1ZHH B;  3E4O A;  4WEJ A;  3ZYT A;  3T4K A;  3RFB A;  3EWK A;  1UGU A;  5K5B A;  2JKR I;  3S7N A;  4HIA A;  3BQ8 A;  3UE6 A;  3IS2 B;  4MN5 A;  4BBT A;  4LPZ A;  3KSG A;  1STZ A;  4LRZ E;  2VGL S;  1OTB A;  2NUT C;  1NRJ A;  3VOL A;  4KQD A;  2VX8 A;  3MR0 A;  4HH2 A;  3H7W B;  3LIC A;  1VHM A;  1T1B A;  3MF0 A;  2WKQ A;  2D02 A;  3UB6 A;  4G3K A;  2KDK A;  3KX0 X;  1D06 A;  2H28 A;  1S4R A;  5TBM A;  5J4E A;  3BY9 A;  3E4Q A;  1XFN A;  4HP4 A;  2Z6D A;  4G3W A;  1F98 A;  1G6O A;  1S67 L;  4ARZ B;  4EET B;  4JGP A;  1WA9 A;  2J3T C;  2W3D A;  3FPW A;  3RTY A;  4EU0 A;  3ZQ5 A;  5A8B A;  2EA9 A;  5KIZ A;  4NXF A;  4MDZ A;  2INW A;  3VV4 A;  1EW0 A;  2CMN A;  4LRX C;  4EES A;  5FL3 A;  4OOL A;  3H7W A;  4XT2 B;  3F1O B;  4HP9 A;  2FH5 A;  3IBJ A;  3VE4 A;  3CWF A;  3LIA A;  3LUQ A;  4KUO A;  2JKR M;  3B42 A;  3EGD C;  1DP9 A;  4K08 A;  3LFV A;  3HCY A;  2KLI A;  3T4Q A;  5TJJ A;  4UQI M;  4I3A A;  5CX7 A;  2QJ5 A;  3KSF A;  3NJA A;  4OOM A;  4R70 A;  3NOT C;  3MJQ A;  3OBF A;  2PR5 A;  5F69 A;  3KSI A;  1NLZ A;  4ETZ A;  1TS7 A;  4WEL A;  3F1O A;  3C30 A;  3E98 A;  3BY8 A;  3CIT A;  3LR4 A;  1ZTU A;  5HWV A;  3A0R A;  2M1C A;  2Y79 A;  1T19 A;  4II7 A;  2EWW A;  2HV1 A;  3PBS A;  5HWT A;  2GZA A;  3S7Q A;  1TD5 A;  3BQA A;  1DP6 A;  3KYZ A;  2VGL M;  3B47 A;  5F68 A;  2K2N A;  2HF6 A;  2VKS A;  3JVU A;  5HPI A;  3D72 A;  3EQU A;  2QJ7 A;  4L9E A;  3TW8 A;  5DF9 A;  3K3C A;  4UQI S;  1TF1 A;  2MJ6 A;  3B33 A;  4G3V A;  4BMW A;  2PDR A;  2G7U A;  2PD8 A;  3KYQ A;  2VEA A;  3FPV A;  1P0Z A;  2A24 B;  3H82 A;  4CLC C;  4DN0 A;  3MQ0 A;  4I5S A;  2V9A A;  2LB5 A;  5AJG A;  3F1P B;  2A2L A;  1T18 A;  1OTD A;  4IHQ A;  5G4Y A;  3PBQ A;  4LLO B;  2VZW A;  4YOF A;  5J7E A;  1GSW A;  1TS0 A;  4O01 A;  2W1R A;  5C5K A;  4M4X A;  1P9R A;  2KX6 A;  1F5M A;  3CAX A;  4O8G A;  3R7W A;  2ZMF A;  4ETX A;  4Q0J A;  3LID A;  3HJK A;  3C38 A;  5EFW A;  4YWZ A;  3ULF A;  2PD7 A;  3IBR A;  5DFY A;  1TS6 A;  3CUE A;  2JHE A;  3KSH A;  4NXB A;  4R3A A;  3H9W A;  2R78 A;  3F1P A;  2WKR A;  1TS8 A;  4I38 A;  2L4R A;  2VA0 A;  3R4K A;  2W3H A;  2PR6 A;  4PKY A;  2YKF A;  3CLO A;  4HQA A;  1N9L A;  5DJU A;  3GDI A;  4HJ4 A;  1V9Y A;  2J3W A;  3MXQ A;  4L9G A;  3C8C A;  1OPX A;  3IS2 A;  4EXO A;  3O5Y A;  4DJ2 A;  1XJ4 A;  5KSH A;  3LR3 A;  3UB9 A;  4NXE A;  1IOU A;  4IJG A;  3OC2 A;  4E04 A;  3PYP A;  5F5Y A;  4BWI A;  1ODV A;  4BBU A;  1BYW A;  2Y8H A;  1OT9 A;  5HDC A;  2LB9 A;  4ME4 A;  4PAU A;  3S7P A;  4JGR A;  3U2A A;  3OOV A;  2GNX A;  3UB8 A;  4L0L A;  4WN5 A;  5I5L A;  4Q0H A;  1JNU A;  4AFI A;  2PT7 A;  4ZRR A;  2O9B A;  4KUK A;  1MKM A;  3P7N A;  4KQO A;  5HWW A;  3ICY A;  3PBR A;  2OWH A;  4ARZ A;  4R38 A;  2QYB A;  1S66 L;  3T4J A;  4NXG A;  3UE3 A;  4DMZ A;  2O9A A;  2K7S A;  3JVV A;  1OTI A;  1X0O A;  4WUJ A;  1XFQ A;  5AVE A;  4XT2 A;  1DP8 A;  3FC7 A;  3DBA A;  4EEP A;  4HI4 A;  2J80 A;  2BAS A;  3OCL A;  2D01 A;  3TRC A;  2HGV A;  1D7E A;  4I39 A;  5LBR A;  5AVF A;  3NHQ A;  5DKK A;  2IA2 A;  3BWL A;  2PYP A;  4I3I A;  2VV7 A;  2W0N A;  1OTE A;  3C2W A;  1W63 M;  4JGQ A;  2FZ0 A;  2QHK A;  3LI9 A;  3LR5 A;  1S4S A;  1KOU A;  4JGO A;  4IUK A;  2O9C A;  3F1N B;  5MC7 A;  4EER A;  4WL9 A;  3MQQ A;  3G6O A;  3NOU C;  3OLO A;  5IT5 A;  3TE8 A;  1YKD A;  2O99 A;  3MQO A;  3T50 A;  3K2N A;  2ZBB A;  2V0W A;  2HJ9 C;  3VE3 A;  2M7V A;  2B02 A;  4GHI B;  3T4O A;  1OT6 A;  4F3L B;  5DKL A;  3SW1 A;  4CLC E;  2VJW A;  3PBO A;  3UME A;  1LSX A;  1XJ3 A;  1UWN X;  2YKH A;  2V0U A;  2ZOH A;  1UWP X;  5HD3 A;  3RH8 B;  1V9Z A;  2XA7 S;  2WKP A;  2EWV A;  4Y2F A;  2W3G A;  2NUP C;  4YNR A;  4NKP A;  3UB7 A;  4BJP A;  3MMH A;  2XRO A;  4GCZ A;  1S1Z A;  2DMW A;  4PKY G;  3LIB A;  5TBM B;  4EUV A;  3LR0 A;  4RQ9 A;  5IS1 A;  1H8M A;  3F1N A;  4EEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...