1UWNX

The initial events in the photocycle of photoactive yellow protein: a common mechanism on light activation in photoreceptor proteins
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
124
Chain Sequence
EHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Initial events in the photocycle of photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 34
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1uwnX00
2PD8A 3UE6A 5EFWA 2WKQA 5IS1A 5DJTA 2L1MA 3A0VA 4KQDA 3K3CA 1OTAA 4EEPA 3NOPC 4YWZA 2KDKA 4HNBA 4I3AA 5HD5A 1V9ZA 3SW1A 5J4EA 3F1OB 3UB6A 4L9FA 2PD7A 1OJGA 2V1BA 4GCZA 1OJ5A 1UWNX 2QJ7A 3OLOA 4MN5A 2JN7A 2Z6CA 1XJ2A 3MR0A 1S4SA 1T1AA 2PYRA 3K3DA 4JGQA 3EEHA 2VV6A 4GS9B 4HIAA 3C8CA 1MZUA 5TBMA 4I3JA 1UGUA 4PKYA 1S1ZA 4K08A 2CMNA 3H7WB 4L9EA 4WLAA 1GSVA 3F1PB 3VE3A 4HI4A 4H6JB 5HWWA 1G28A 2QKPA 1UWPX 3EWKA 1F98A 3LICA 4PKYG 3BWLA 4HJ3A 1OTDA 2A24B 5AVEA 3BY8A 1XFNA 1Y28A 2BASA 5HDDA 2YKHA 4EERA 5J3WA 4EW7A 1LSXA 3LI8A 3BY9A 4M4XA 2V9AA 3C2WA 3H9WA 5HD3A 2ZBBA 5G4ZA 4EETB 2V0UA 4HP4A 5DKKA 2I9VA 5AVFA 2VLGA 1LSVA 5I5LA 4NXGA 2KX6A 3H7WA 3ULFA 2P7JA 3F1PA 2V0WA 3H82A 2OWHA 4KUKA 4F3LB 4I3IA 3FC7A 5HWVA 2A24A 5J7EA 4NXBA 2VEAA 4LPZA 1KOUA 2PYPA 1V9YA 4HH2A 3LIFA 4HP9A 3MQQA 3F1NA 4R6LA 1X0OA 3LIAA 4DJ2A 2ZOHA 4LLOB 3UB9A 2QWSA 1DP6A 5HDSA 1GSXA 3MQOA 3B33A 2V1AA 4JGOA 4WUJA 3IS2B 1DP9A 5F68A 1N9OA 1GSWA 3PYPA 4F3LA 1LSWA 4WF0A 3P7NA 1DP8A 4R38A 4EESA 3MXQA 1T18A 4HJ6A 4I5SA 4XT2B 4I38A 5HZHA 1S4RA 1VB6A 3LI9A 2OWJA 3ICYA 3IBRA 2W27A 3ZQ5A 3F1OA 4HQAA 1S1YA 1N9LA 5HSQA 3LIDA 5F6AA 3UMDA 3A0RA 3GECA 4GW9A 4HJ4A 1N9NA 4R3AA 2VV7A 3LIBA 2PR5A 2H28A 3T50A 3MJQA 4E04A 4BBUA 3G6OA 4L9GA 1P97A 3RH8B 3UB7A 3LUQA 3IS2A 3FG8A 2R78A 3D72A 3LIEA 4GS9A 4I39A 2OOLA 2J80A 1T19A 2L4RA 1TS8A 1F9IA 1T1BA 1OTEA 4XT2A 3E4PA 1ODVA 4H6JA 3UB8A 3HJKA 3UMEA 4WL9A 2GJ3A 1D06A 1TS6A 2PR6A 1NWZA 1XJ6A 1OTIA 2PDRA 4DJ3A 5DKLA 5IU1A 1TS0A 4LRXC 1OTBA 3RTYA 3NOTC 2JHEA 5F5YA 4EXOA 3KX0X 1XJ4A 1P0ZA 4NXEA 2B02A 2W0NA 1LL8A 4RQ9A 4BBTA 1TS7A 4JGPA 2L0WA 1XJ3A 3NJAA 4LRZE 3VE4A 3VOLA 3CWFA 5HDCA 5KIZA 2WKRA 1JNUA 5G4YA 3PHYA 2D02A 4GHIB 4LRYC 1DRMA 1LT0A 1XFQA 5A8BA 1D7EA 2PHYA 5F69A 3A0SA 2EA9A 4BBVA 2WKPA 2YKFA 3H82B 3LYXA 2ZOIA 4B9OA 2QHKA 1OT6A 4JGRA 1BYWA 2INWA 4HHDA 3CLOA 3E4QA 4NXFA 4MN6A 1S67L 3HJIA 4EEUA 3F1NB 1WA9A 2VV8A 1EW0A 2M1CA 1T1CA 4GHIA 4HH3A 4KUOA 4EQ1A 3NHQA 3GDIA 3CAXA 4R70A 4HOIA 4HY8A 2HV1A 2QJ5A 5HWTA 2K7SA 3MFXA 2Z6DA 4WN5A 2D01A 1OT9A 5DJUA 3NOUC 1S66L 5TBMB 3E4OA
chains in the Genus database with same CATH superfamily
3S4XA 1QMFA 3ZG9B 1BLPA 2ZC6B 2PU2A 4NK3A 4F94A 4GZBA 5FL3A 4JF4A 4X6TA 2VZWA 4BQMA 2JBFA 4RX2A 5J4EA 3T4LA 3B3XA 5FAQA 1OJGA 2V1BA 1BSGA 3HCYA 4HBTA 5JYOA 4JPMA 3D9YA 3Q82A 3OLOA 5FAOA 3KO6A 1Z09A 4K91A 4MMNA 2WZZA 3FKWA 3IWOA 3MR0A 4E6XA 3K3DA 2O9AA 1OMEA 1H8ZA 1PYYA 5TBMA 4WBGA 2K31A 4HEFA 3F1PB 1XP4A 3VE3A 4H6JB 3UY6A 3IHBA 4DE1A 4DE0A 4E3MA 3G35A 3BFGA 2A24B 5AVEA 2Y2GA 4DF6A 2WGWA 5L09A 2BASA 2YKHA 5EE8A 2DMWA 3S1YA 1GA9A 1LSXA 4FH4A 4Y0TA 2FFYA 4DKIA 4WYYA 3TG9A 2EX8A 2B5RA 1IEMA 3VOYA 3OPRA 3UE1A 1DY6A 3DWKA 4MBKA 3OPHA 2ZQCA 1U60A 3EEAA 3H7WA 3Q7VA 1PWCA 3G34A 3D3OA 2VX8A 1RGZA 3CG5A 1EWZA 1AXBA 4OPYA 4F3LB 5DFXA 4I3IA 5MC7A 2HDRA 5L2FA 3MZDA 4YOFA 4JXGA 2H5SA 5G18A 4B4XA 4N1XA 3LIFA 3MQQA 2WAFA 1GHPA 2HP9A 2A2LA 4FUWA 2G2UA 4MCWA 3HLCA 4LLOB 1HTZA 2QWSA 3WS0A 3JVUA 1BLHA 1RP5A 1OPXA 4WUJA 3C4PA 1F2KA 1VETB 1H8YA 3PAEA 3SS4A 3N8SA 1YLPA 3E2LA 2R9WA 4MBHA 4X68A 2R9XA 3W4QA 3RXXA 1GSWA 1VEUA 2H10A 3P7NA 4BJPA 4X1LA 2HP6A 2XSSA 4UQIM 3QP1A 4EESA 1YLJA 4HJ6A 1S4RA 4Y7PA 3OCNA 4Y15A 2Y2LA 2V1ZA 3IBRA 5KMWA 1W63M 2BLSA 4N9LA 3T4QA 3VP2A 4HQAA 1S1YA 5HSQA 5GL9A 3QP8A 2JKTM 1W8YA 4RYEA 3S7PA 3MS6A 3HLDA 4GW9A 1N9NA 4R3AA 3LIBA 1FSYA 1PZOA 2EX9A 4MEZA 3ITBA 3G4PA 3GSGA 4ID4A 4L9GA 1P97A 3PBRA 3UB7A 2X71A 1IKGA 2OSUA 5TFQA 3UDIA 1LL9A 2HJ9C 4LV3A 4YINA 3LO7A 5FQ9A 1KGEA 4N1HA 1YSQA 4FTXA 1E4DA 3GVBA 3FV7A 2J80A 3HUNA 4K0XA 4Y17A 2WYXA 2L4RA 1TS8A 4U3TA 4ZJ1A 4S2JA 4QJGA 1OTEA 2ZM0A 3E4PA 2IWDA 4H6JA 3TSGA 5HAPA 2P9VB 3UB8A 3R7WB 3A3JA 3ZCZA 1IYPA 3JPUA 1XJ6A 1XA7A 2PDRA 2XEPA 3G31A 5EVEA 4EBPA 5FQJA 2H0YA 4OH0A 1OTBA 3MQ0A 4Z9QA 4ZBEA 2XD1A 5GLCA 1MWSA 5A91A 5F5YA 5FDSA 1ONGA 4EXOA 3HLWA 1XJ4A 4UEYA 2B18A 4DDYA 3NBLA 3RFBA 2W0NA 3BM6A 1KDWA 1LHYA 1TS7A 1VHMA 2L0WA 2Z2MB 1W8QA 2P74A 4LRZE 3VE4A 3LR3A 3CWFA 3EOIA 3BJNA 4EBNA 4MLLA 4JKTA 5G4YA 4CLCB 2WKHA 2BTFP 4JF5A 2D02A 3LY4A 2ZMVA 1XFQA 5A8BA 4X1MA 2PHYA 1WYBA 3A0SA 3HLEA 4YFMA 3W8KA 4S2PA 3UN7A 4WEJA 3MXRA 3SS5A 2QPNA 2YKFA 3HUOA 4EQIA 4B9OA 4QY6A 3KSHA 2P08A 5GHZA 2INWA 2WZXA 3WS1A 4NXFA 2X02A 5CHUA 4EEUA 5M1AA 4UA9A 3HLBA 1WA9A 2M1CA 1ZTUA 1CEGA 2EX6A 4DE3A 1PIOA 2JCHA 4GHIA 4HH3A 1K56A 3VP3A 3C7VA 4D60A 1TVFA 4M3KA 3GDIA 3CAXA 2GX5A 4CLCC 2QYBA 4JXSA 4ESPA 2HDSA 3ZNYA 1NYMA 2QJ5A 1ZG4A 5JYPA 2MJ6A 2DRWA 4GDBA 3UPPA 3ZYTA 2Z6DA 2D01A 1OT9A 1IYOA 4BLMA 4B88A 1G6AA 2Y2IA 5TBMB 2O0YA 5CGXA 2Y2JA 2PD8A 3UE6A 2UV0E 5EFWA 4C3QA 1ES3A 5CTNA 4RVAA 3K3CA 3HREA 4OQGA 5EVIA 3NOPC 1K57A 3B42A 4YWZA 2XRNA 1PZPA 4I3AA 1V9ZA 5EECA 3UDFA 5HAQA 4Y0OA 3F1OB 4L9FA 3MSHA 3VP4A 3BQAA 2WGWB 4OP8A 4P87A 2WADA 3CUEA 4IVIA 3A3FA 3BW6A 4MN5A 3E0YA 5GLAA 3IBJA 3SOIA 2LB9A 3WS4A 5E2HA 3IXDA 4JGQA 4UA6A 3CZDA 3V67A 3R4KA 3C8CA 1YPRA 3GR2A 3KYZA 3O5YA 4I3JA 3BECA 2XK1A 3MKEA 4PKYA 1GA0A 1CJFA 3H7WB 4WLAA 1GSVA 3MKFA 1NZUA 3LR5A 3WRTA 4GOGA 3RXWA 4HI4A 1TDLA 2VJWA 4C75A 1UWPX 3IX8A 3M6BA 3LICA 2V2FF 2ZC3B 1G6OA 1OTDA 4QPRA 4GN2A 1H0MA 1G5UA 4EERA 3C30A 3BFCA 3LEZA 3IT9A 2ZMFA 3BY9A 4M4XA 5FASA 3MF0A 3C2WA 5HAIA 5CTMA 5HD3A 4U0XA 5G4ZA 4EETB 4OOLA 3BYDA 3NIAA 1I2WA 2I9VA 5AVFA 1TDGA 5I5LA 4NXGA 2PU4A 3IF5A 5A92A 2ZQAA 3T4OA 4KZ6A 3VMAA 4FOFA 2WKIA 5FI2A 2XQZA 1VEUB 1IKIA 5HARA 4KG6A 2M7VA 4P0MA 4NXBA 2VEAA 1CI8A 4LPZA 4QB8A 4BL2A 4KZ4A 2A49A 5AQ7A 3ZG5A 1YLTA 3M2JA 4R6LA 4DJ2A 4R1GA 4NKPA 1XKZA 4EBLA 3KYQA 4S2NA 5L10A 3N8LA 5EVLA 3ZDJA 2J3TC 3HLGA 3IF6A 3MQOA 3B33A 4JGOA 5GHXA 5IHVA 4G3WA 3KSGA 4KQQA 4WZ5A 1K25A 4S2LA 4P85A 5F68A 3W4OA 4EWFA 4WF0A 4E3NA 2Y4AA 4ZRRA 5EOEA 2ZLYA 3MXQA 4OVDA 4Y3IA 2V8CA 4Q0JA 4ZAMA 5TJJA 1XPBA 4PHTA 4I38A 4S2MA 1FQGA 1VB6A 1NLYA 3LI9A 3N4IA 3F1OA 4IBRA 5EM1A 4DDSA 2O9BA 4XXRA 4LV1A 4FCFA 3A0RA 3MZEA 3GECA 3T4KA 4HJ4A 4X56A 1WE4A 5L8MA 2Z2LB 2PR5A 4E04A 3V3SA 3LUQA 2HF6A 3IS2A 3IWQA 4X69A 2EXBA 3S7QA 3UPNA 2CC1A 3HVFA 4PM7A 2M7UA 4GLQA 3S7OA 1YMSA 2E8JA 3FPWA 4PPRA 1T19A 4CLCE 1F9IA 1JTDA 3ZG8B 4DE2A 1T1BA 4ARZA 5C5KA 2AVXA 1ODVA 1BT5A 4CJNA 4R3BA 2ZC4B 2FFFB 4LENA 3EGXC 3UMEA 4Q0IA 1D06A 2ZQDA 4N92A 5DFYA 2JE5A 2Y2PA 2ZMAA 3CMZA 3A3DA 3E98A 4JBFA 2WGVA 4Y5FA 5F1GA 3UNWA 1TS0A 3DW0A 1CK3A 3RJUA 3B47A 2W3FA 3BQ8A 3N6IA 3OPLA 2PT7A 3FYZA 5HW3A 1BLCA 4KZBA 1BTLA 1P0ZA 4GB7A 4NXEA 1MKIA 1LL8A 1O07A 2ZJ9A 3CI6A 1WYCA 1XA1A 1SKOA 3IH9A 1FCMA 4IVKA 2NUTC 2HDQA 1XJ3A 2OV5A 3NJAA 1SHVA 5FATA 4CLCD 1A0KA 1Q2QA 3HL9A 4LV2A 5U47A 3NI9A 4Q0HA 5KIZA 1FR6A 4R4RA 2J3WA 1BZAA 5AQBA 1JNUA 4GHIB 2IWCA 1L3LA 4DMZA 2O99A 1ZKJA 1MBLA 3NCKA 1STZA 1BLSA 4BD1A 2OLVA 1AWIA 4BBVA 2ZD8A 4KQRA 2WKPA 1CQAA 1HD8A 5EM0A 1YT4A 3LR4A 3UPOA 1C3BA 4JLFA 4OPQA 3KSIA 3T4SA 2QHKA 2ZM8A 4E3JA 4UHUA 2Y2MA 1HZOA 1HVBA 4BMWA 5EVIB 1Z6FA 2C5WB 1EI5A 2VV8A 1I5QA 1IELA 2W3DA 1T1CA 2J7VA 3TW8A 1H3QA 3ZVWA 5CHMA 1KGFA 3IXGA 4II7A 5DTTA 2OAP1 4HY8A 1VM1A 2HDUA 4LCLA 4YNRA 5HWTA 3BLSA 3MFXA 2EWWA 3IX4A 2WKEA 2K2NA 1XX2A 4MNRA 2EWVA 3LGOA 3NOUC 1PRQA 1NXYA 1DP9A 1ESUA 2JKRM 3A0VA 1CI9A 4KQDA 3LR0A 1OTAA 4EEPA 1L0GA 1YSPA 3L9KA 3SW1A 2JKTI 3D4FA 1BULA 2Q9MA 2WAEA 3NULA 4Z1WA 1F5MA 4EUVA 4KZ7A 3MXSA 3UB6A 5EVIC 2KLIA 4O8GA 3M6HA 4E3IA 1S0WA 4UQIS 4XUZA 3VFFA 2VGLM 4GDNA 2Z6CA 4GJ4A 1XJ2A 1YLWA 1SCWA 1S4SA 3JVVA 2XDMA 3CUEC 3EEHA 4GD8A 4HIAA 5FI7A 2Y8HA 3VP0A 2JKFA 3FWLA 3GMWA 3PBNA 2EFXA 2VK3A 4K08A 2CMNA 4L9EA 2HZ5A 1ES4A 2J9PA 5HWWA 3GQZA 2DCFA 3T12B 3EWKA 1F98A 3NC8A 4BD0A 4HJ3A 4QY5A 3C4OA 1NRFA 1L0DA 1Y28A 5HDDA 2J3TD 2ZQ8A 1KDSA 4A5RA 4EW7A 4WELA 5KSHA 1FIKA 2Y2NA 3P09A 3QNCA 3OPPA 3U4LP 2V9AA 3EQVA 3EGDC 1K55A 4AFIA 4LV0A 5DF7A 3NDGA 2V0UA 3T4TA 5EUAA 5DKKA 1LSVA 3IF6B 2QZ6A 3BRMA 1ES5A 4E3OA 1MWRA 2HGVA 3PR6A 1J3WA 5D3OA 4L0LA 1KVMA 1NLZA 3G30A 2V0WA 2OWHA 4KUKA 5F1FA 4KQOA 5TGFA 3PAGA 4X25A 4OLDA 3FC7A 4JF6A 2J9OA 5J7EA 1KOUA 3ZHHA 1V9YA 2XLNA 3AGDA 4OOYA 4HH2A 4HP9A 5FSRA 5TR7A 5HL1A 3M2KA 4DXBA 2IA2A 3LIAA 3MBZA 3E2KA 5HX9A 1FCNA 2O9CA 3ZGAB 3ITAA 1DJCA 1PW8A 5HPFA 5DTKA 3BEBA 5CGSA 5FQMA 1DP6A 3DTKA 3PBSA 3C5AA 4GKUA 2VGKA 4QHCA 2WGIA 3V39A 2EX2A 5M18A 3WWXA 3UE3A 2G2WA 2V1AA 3IS2B 4Q8IA 4DN0A 4GNUA 4WM9A 4S2NC 1N9OA 4DXCA 5FA7A 3IF6C 1NYYA 1KE3A 1XXMA 1LSWA 2A3UA 1FCOA 4WZ5C 1JTGA 2OLUA 5DF8A 1T18A 5AQAA 1MC0A 2PBDP 3SH7A 1L0EA 4RX3A 1EROA 4ARZB 1ONHA 1PWGA 3O3VA 1ESIA 5HZHA 2JKGA 3TOIA 4NG2A 4KZ3A 3DWZA 2PAVP 1IYSA 2W27A 3IHAA 3ZQ5A 1N9LA 5BOHA 3LIDA 3UMDA 5M19A 2ZC7A 4E3LA 4X55A 1LI0A 2H28A 4ZTKA 3PBTA 4LFUA 4BBUA 3RH8B 2GDNA 5F83A 1K4FA 2R78A 3IXBA 3G32A 3D72A 3LIEA 4I39A 2OOLA 2GZAA 5FEFA 1YMXA 1TF1A 1K38A 2PRFA 2QMIA 5HFOA 3UB5P 4ETZA 4OQIA 3ZFZA 1SKOB 4XT2A 5GLDA 4U0TA 2WUQA 3P01A 2V20A 4NETA 4WL9A 2Y2KA 2GJ3A 2HP5A 4ZJ2A 1ACFA 1TS6A 3Q1FA 2PR6A 3UDXA 5LBRA 3LCEA 3UE0A 1W63Q 3T1SA 4PM9A 5EOOA 5IU1A 3O88A 5KSCA 3NOTC 4S2IA 1GHMA 1M40A 3KX0X 3QP2A 3DAVA 1BUEA 2W3GA 4ETXA 2B02A 2RCXA 4KZ9A 1MY8A 4OPZA 1K54A 4JGPA 3WRZA 1FOFA 3IH8A 1RCJA 5HL6A 2VKSA 3VOLA 4WMCD 1L0FA 3FZCA 3C7UA 1K56D 3QHYA 4IJGA 1ALQA 5CECA 2FH5A 2BG1A 3QP4A 4LRYC 4KZ5A 5K5BA 2B95A 3ZG7B 3IQAA 4FSFA 3EQUA 3VP1A 5F69A 1K0KA 5GHYA 2EA9A 3AGEA 4UA7A 4E6WA 5FQKA 2P04A 1PFLA 3H82B 1PW1A 2JC7A 3LYXA 4H8RA 2ZOIA 4N9KA 3T1RA 5EVID 1MXOA 1OT6A 4GD6A 5CEDA 1BYWA 3S7NA 2W3EA 2XD5A 4HHDA 4EV4A 3CLOA 3E4QA 4MN6A 4P6BA 1XGIA 3F1NB 1RGYA 2OAQ1 2PBYA 3DTIA 5FEGA 1EW0A 4JXWA 3OOVA 1YLZA 3V50A 1MWTA 3SH8A 4PM6A 1FSWA 3OCLA 4O01A 3CITA 3ISGA 3KYEA 4C6YA 1PWDA 4ZJ3A 3V3RA 1L2SA 2H0TA 4NEED 2K7SA 4R4SA 4QWOA 2XROA 3QP6A 1CEFA 1KGGA 1NJ4A 1K4EA 1GHIA 5DJUA 5E2EA 1S66L 4HESA 5E43A 1YLYA 2Y2QA 3A3EA 3GRJA 4QU3A 3TE8A 2WKQA 1K6SA 5IS1A 5DJTA 4EU0A 1FR1A 2L1MA 5FI6A 3JYIA 1QMEA 1NZOA 1LL5A 3PBQA 4ME4A 2KDKA 4HNBA 5CRFA 5HD5A 2WK0A 1IFQA 4S2OA 4Y2FA 3LEQA 1JVJA 2ZL1B 1S6RA 3HUMA 2GNXA 3VFHA 1YM1A 1YKDA 4G3VA 2PD7A 4JXVA 4BENA 5F82A 3PXPA 4GCZA 2W1TA 1OJ5A 1UWNX 2QJ7A 3Q7ZA 2JN7A 2IWBA 5KZHA 1T1AA 1DJBA 2PYRA 3FKVA 1ZHHB 2XR0A 2VV6A 4GS9B 3A3IA 1K6RA 1MZUA 1N9BA 4OQ0A 1MPLA 1NY0A 1UGUA 1S1ZA 1E3UD 1O7EA 5EV0A 2EFUA 1FILA 1I2SA 2UWXA 1ERQA 2ZM2A 1G28A 1ZG6A 2QKPA 3MMHA 2XA7M 4PKYG 3IXHA 4QD4A 3BWLA 1Q2PA 3O87A 2C6WB 3BY8A 4D2OA 4OONA 1XFNA 3DBAA 1CF0A 4FH2A 4MBFA 3BLMA 4MDZA 5J3WA 4EUZA 2DNSA 4G3KA 5L07A 2W1RA 3LI8A 2ZQ9A 3OC2A 5A93A 3CPTB 1H8MA 3H9WA 2ZBBA 3I7JA 3BFEA 1YAXA 5E2GA 4HP4A 2VLGA 3WS2A 4PM8A 2KX6A 3N8RA 3K2NA 1DJAA 5CGWA 1K55C 4S2KA 4PMAA 2XGNA 3ULFA 2P7JA 3F1PA 1SKFA 3V5MA 3MZFA 3H82A 2LB5A 5HWVA 4RA7A 2A24A 3CHWP 3QP5A 5CXWA 2PYPA 5AQ9A 3VSKA 5FQQA 2ZC5B 1ERMA 3DTEA 3F1NA 1X0OA 3S22A 3WS5A 1W5DA 2Y2HA 2ZOHA 2KOIA 4B4ZA 1K57C 1KE0A 3UB9A 5FAPA 5AJGA 1P9RA 1GCEA 5HDSA 1GSXA 5EPHA 2HJEA 1LLBA 3PTEA 5J8XA 1LI9A 3HLFA 1IYQA 4OQHA 3VV4A 3VOZA 3T4JA 1SDNA 4O0PA 3PYPA 3FPVA 4F3LA 3NY4A 1DP8A 4R38A 4CQHA 1NRJA 3BFDA 1TEMA 3OZHA 4I5SA 4R0QA 1KE4A 4XT2B 4CPKA 2XA7S 2Y59A 4OOMA 2OWJA 3ICYA 2E8IA 2ZL1A 1PI4A 1XGJA 5FQIA 4IEDA 4E3KA 5F6AA 3BFFA 3IX3A 5CERA 2VV7A 3T50A 1Y4OA 3GTCA 3MJQA 3W2ZA 3G6OA 4K0WA 1N4OA 1SDEA 1VETA 4Y13A 4P6ZM 2JKRI 3W4PA 3FG8A 4KG5A 1YQSA 4GS9A 3Q81A 4PAUA 3T1XA 3QNBA 3OBFA 1J9MA 4WMCA 2HPBA 2J8YA 1D1JA 2XFSA 4LCMA 1SZVA 3C38A 3HJKA 1H5XA 5IT5A 2VA0A 4R23A 1NWZA 4B93A 1OTIA 4DJ3A 4UAAA 3Q07A 5DKLA 3DTMA 3ZNTA 4LRXC 5HPIA 3P98A 3RTYA 4PM5A 3G2YA 3PBOA 2JHEA 4R3JA 3CPTA 1P9WA 2Q0OA 2VGLS 1G68A 3SS3A 3VSLA 3IWIA 3TRCA 2VGJA 1IOUA 1ES2A 5I94A 4IBXA 3NECA 4RQ9A 4WZ4A 3O86A 4BBTA 4MN7A 1HLUP 4Y0UA 3ZG0A 3N7WA 3U2AA 4ZDXA 4OPRA 4BWIA 4KENB 5CHJA 2P9VA 2X01A 5DF9A 1E25A 3R7WA 3UO9A 4HBUA 2Q9NA 4X53A 1TD5A 5HDCA 2RL3A 3LFVA 1K54C 1VQQA 2WKRA 4OLGA 3TJZC 1KVLA 4FD8A 2FZ0A 3PHYA 3SZTA 4WEKA 4OKPA 1DRMA 2W3HA 5DVAA 5CEBA 1LT0A 3L7HA 1PI5A 1D7EA 2NUPC 2XF3A 1W7FA 3ZVTA 3Q7VB 3NDEA 3SH9A 2V8FA 4BL3A 4IUKA 4P6ZS 2Y2OA 2Y55A 4OP5A 1JWZA 1MWUA 4IUHA 1ZC2A 4O7DA 4KG2A 2Y91A 4JGRA 5GLBA 2G7UA 1S67L 2EXAA 3AGFA 3HJIA 3LY3A 4KZAA 2Y79A 5A90A 3T1QB 1PNEA 2XH9A 4CLCA 1W79A 5DTSA 2ACGA 5E2FA 1JWPA 4KUOA 2XFTA 4EQ1A 3GV9A 3NHQA 2W1TB 1M6KA 1JWVA 4R70A 4HOIA 2HV1A 4XUXA 3MFDA 4DRTA 1MKMA 3KSFA 4KZ8A 3G2ZA 3HBRA 2I72A 1Y54A 4LGWA 5FDHA 4WN5A 1E3UA 3CJMA 2ZQ7A 5CX7A 3E4OA 4IHQA
chains in the Genus database with same CATH topology
2PD8A 3UE6A 5EFWA 2WKQA 3TE8A 5IS1A 5DJTA 4EU0A 2L1MA 2JKRM 3A0VA 4KQDA 3K3CA 3LR0A 1OTAA 5FL3A 4EEPA 3NOPC 3PBQA 3B42A 4YWZA 2XRNA 2VZWA 1YSPA 4ME4A 2KDKA 4HNBA 4I3AA 5HD5A 1IFQA 1V9ZA 4Y2FA 3SW1A 5J4EA 2JKTI 3T4LA 4Z1WA 1F5MA 2GNXA 4EUVA 3F1OB 1YKDA 3UB6A 4G3VA 4L9FA 2PD7A 2KLIA 1OJGA 2V1BA 3HCYA 3BQAA 4O8GA 3PXPA 4GCZA 2W1TA 4UQIS 3CUEA 1OJ5A 1UWNX 3BW6A 2QJ7A 3OLOA 4MN5A 2VGLM 2JN7A 3E0YA 3KO6A 2Z6CA 4GJ4A 3IBJA 4MMNA 1XJ2A 3MR0A 1S4SA 2LB9A 1T1AA 3JVVA 2PYRA 3K3DA 4JGQA 2O9AA 3CUEC 3EEHA 1ZHHB 3V67A 2VV6A 3R4KA 4GS9B 4HIAA 3C8CA 1MZUA 3KYZA 2Y8HA 3O5YA 5TBMA 4I3JA 1UGUA 4PKYA 1S1ZA 3PBNA 4K08A 2CMNA 3H7WB 4L9EA 4WLAA 1GSVA 2K31A 3F1PB 3LR5A 3VE3A 4HI4A 4H6JB 5HWWA 2VJWA 1G28A 2QKPA 1UWPX 3MMHA 3EWKA 1F98A 3LICA 2XA7M 4PKYG 3BWLA 1G6OA 4HJ3A 1OTDA 2A24B 5AVEA 4QPRA 3BY8A 1XFNA 1Y28A 3DBAA 2BASA 5HDDA 2J3TD 2YKHA 4EERA 2DMWA 3C30A 4MDZA 5J3WA 4G3KA 2W1RA 4WELA 4EW7A 1LSXA 3LI8A 5KSHA 2ZMFA 3BY9A 4M4XA 3OC2A 2V9AA 1H8MA 3C2WA 3EGDC 3H9WA 3EQVA 3MF0A 4AFIA 5HD3A 2ZBBA 5G4ZA 4EETB 4OOLA 1YAXA 2V0UA 3T4TA 4HP4A 5DKKA 2I9VA 5AVFA 2VLGA 1LSVA 5I5LA 4NXGA 2KX6A 3K2NA 3EEAA 2HGVA 3H7WA 3PR6A 3T4OA 4FOFA 3D3OA 2VX8A 3ULFA 4L0LA 2P7JA 3F1PA 1NLZA 2V0WA 3H82A 2OWHA 4KUKA 4F3LB 5DFXA 4I3IA 2LB5A 5MC7A 4KQOA 3FC7A 5HWVA 2M7VA 2A24A 5J7EA 4YOFA 4NXBA 2VEAA 4LPZA 1KOUA 2PYPA 1V9YA 4HH2A 3LIFA 4HP9A 3MQQA 3F1NA 4R6LA 1X0OA 2IA2A 2A2LA 3LIAA 4MCWA 2O9CA 4DJ2A 2ZOHA 2KOIA 4NKPA 5HPFA 4LLOB 3UB9A 3KYQA 2QWSA 1DP6A 3JVUA 3PBSA 5AJGA 1P9RA 5HDSA 1GSXA 3UE3A 2J3TC 3MQOA 1OPXA 2V1AA 3B33A 4JGOA 2HJEA 4WUJA 4G3WA 3KSGA 3IS2B 4DN0A 3VV4A 3T4JA 1DP9A 5F68A 1N9OA 4O0PA 1GSWA 3PYPA 3FPVA 4F3LA 1LSWA 4WF0A 3P7NA 1DP8A 4ZRRA 4R38A 4BJPA 4CQHA 1NRJA 2XSSA 4UQIM 4EESA 3MXQA 1T18A 1MC0A 4Y3IA 4HJ6A 4I5SA 4ARZB 4XT2B 4Q0JA 5TJJA 4PHTA 4I38A 5HZHA 1S4RA 2XA7S 1VB6A 1NLYA 3LI9A 3OCNA 4OOMA 2OWJA 3ICYA 3IBRA 1W63M 2W27A 3T4QA 3F1OA 4HQAA 1N9LA 1S1YA 3ZQ5A 5HSQA 3LIDA 2JKTM 5F6AA 3S7PA 3UMDA 2O9BA 3A0RA 3GECA 3T4KA 4GW9A 4HJ4A 1N9NA 4R3AA 5L8MA 2VV7A 3LIBA 2PR5A 2H28A 3PBTA 3T50A 3MJQA 4E04A 3W2ZA 4BBUA 3G6OA 4L9GA 1P97A 3RH8B 3PBRA 3UB7A 3LUQA 4P6ZM 2JKRI 2HF6A 3IS2A 3FG8A 2HJ9C 2R78A 3S7QA 3D72A 2M7UA 3LIEA 4GLQA 4GS9A 4I39A 3S7OA 4PAUA 1YSQA 2OOLA 2GZAA 1TF1A 3FPWA 2J80A 1T19A 4CLCE 2L4RA 1TS8A 3OBFA 1F9IA 4ETZA 1T1BA 4ARZA 1OTEA 4XT2A 5C5KA 3E4PA 3P01A 1ODVA 4H6JA 3C38A 3UB8A 3HJKA 3R7WB 3EGXC 3UMEA 4WL9A 5IT5A 4Q0IA 2GJ3A 1D06A 2VA0A 1TS6A 2PR6A 5DFYA 1NWZA 4B93A 5LBRA 1XJ6A 1OTIA 2PDRA 1W63Q 4DJ3A 3E98A 5DKLA 5IU1A 4Y5FA 1TS0A 4LRXC 5HPIA 1OTBA 3MQ0A 3RTYA 3NOTC 3PBOA 2JHEA 3B47A 2W3FA 1P9WA 3BQ8A 5F5YA 2PT7A 4EXOA 2VGLS 3KX0X 1XJ4A 3TRCA 4UEYA 2B18A 2W3GA 1P0ZA 4ETXA 1IOUA 4NXEA 2B02A 3RFBA 2W0NA 1LL8A 4RQ9A 4BBTA 3CI6A 4MN7A 1TS7A 4JGPA 1VHMA 3U2AA 2L0WA 2NUTC 1XJ3A 5HL6A 4BWIA 3NJAA 4LRZE 2VKSA 3VE4A 3VOLA 3LR3A 5DF9A 3R7WA 4CLCD 3CWFA 3EOIA 3BJNA 1TD5A 5HDCA 4Q0HA 3LFVA 5KIZA 2J3WA 2WKRA 4IJGA 3TJZC 1JNUA 5G4YA 4CLCB 2FH5A 2FZ0A 3PHYA 2D02A 4GHIB 4WEKA 4LRYC 1DRMA 5K5BA 2ZMVA 4DMZA 2W3HA 1LT0A 2O99A 1XFQA 5A8BA 4FSFA 1D7EA 1STZA 3EQUA 2NUPC 2PHYA 5F69A 3A0SA 2EA9A 2P04A 4BBVA 4IUKA 2WKPA 4P6ZS 4WEJA 3LR4A 2YKFA 3H82B 4IUHA 3LYXA 2ZOIA 3KSIA 3T4SA 4B9OA 2QHKA 1OT6A 3KSHA 4JGRA 1BYWA 3S7NA 2P08A 2W3EA 2INWA 4HHDA 4BMWA 2G7UA 3CLOA 3E4QA 4NXFA 4MN6A 1S67L 3HJIA 4EEUA 2Y79A 3F1NB 1WA9A 2OAQ1 2VV8A 1EW0A 2M1CA 4CLCA 1ZTUA 2W3DA 1T1CA 3OOVA 4GHIA 4HH3A 3TW8A 1H3QA 4KUOA 4EQ1A 3NHQA 3OCLA 2W1TB 3GDIA 4O01A 3CITA 3CAXA 2GX5A 4CLCC 4II7A 4R70A 2QYBA 2OAP1 4HOIA 4HY8A 2HV1A 2QJ5A 1MKMA 3KSFA 4YNRA 5HWTA 4NEED 2K7SA 2MJ6A 3MFXA 2EWWA 3ZYTA 2XROA 2Z6DA 2K2NA 4WN5A 2EWVA 2D01A 1OT9A 5DJUA 3NOUC 1S66L 5CX7A 5TBMB 2O0YA 3E4OA 4IHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PD8 A;  3UE6 A;  5EFW A;  2WKQ A;  5IS1 A;  5DJT A;  2L1M A;  3A0V A;  4KQD A;  3K3C A;  1OTA A;  4EEP A;  3NOP C;  4YWZ A;  2KDK A;  4HNB A;  4I3A A;  5HD5 A;  1V9Z A;  3SW1 A;  5J4E A;  3F1O B;  3UB6 A;  4L9F A;  2PD7 A;  1OJG A;  2V1B A;  4GCZ A;  1OJ5 A;  1UWN X;  2QJ7 A;  3OLO A;  4MN5 A;  2JN7 A;  2Z6C A;  1XJ2 A;  3MR0 A;  1S4S A;  1T1A A;  2PYR A;  3K3D A;  4JGQ A;  3EEH A;  2VV6 A;  4GS9 B;  4HIA A;  3C8C A;  1MZU A;  5TBM A;  4I3J A;  1UGU A;  4PKY A;  1S1Z A;  4K08 A;  2CMN A;  3H7W B;  4L9E A;  4WLA A;  1GSV A;  3F1P B;  3VE3 A;  4HI4 A;  4H6J B;  5HWW A;  1G28 A;  2QKP A;  1UWP X;  3EWK A;  1F98 A;  3LIC A;  4PKY G;  3BWL A;  4HJ3 A;  1OTD A;  2A24 B;  5AVE A;  3BY8 A;  1XFN A;  1Y28 A;  2BAS A;  5HDD A;  2YKH A;  4EER A;  5J3W A;  4EW7 A;  1LSX A;  3LI8 A;  3BY9 A;  4M4X A;  2V9A A;  3C2W A;  3H9W A;  5HD3 A;  2ZBB A;  5G4Z A;  4EET B;  2V0U A;  4HP4 A;  5DKK A;  2I9V A;  5AVF A;  2VLG A;  1LSV A;  5I5L A;  4NXG A;  2KX6 A;  3H7W A;  3ULF A;  2P7J A;  3F1P A;  2V0W A;  3H82 A;  2OWH A;  4KUK A;  4F3L B;  4I3I A;  3FC7 A;  5HWV A;  2A24 A;  5J7E A;  4NXB A;  2VEA A;  4LPZ A;  1KOU A;  2PYP A;  1V9Y A;  4HH2 A;  3LIF A;  4HP9 A;  3MQQ A;  3F1N A;  4R6L A;  1X0O A;  3LIA A;  4DJ2 A;  2ZOH A;  4LLO B;  3UB9 A;  2QWS A;  1DP6 A;  5HDS A;  1GSX A;  3MQO A;  3B33 A;  2V1A A;  4JGO A;  4WUJ A;  3IS2 B;  1DP9 A;  5F68 A;  1N9O A;  1GSW A;  3PYP A;  4F3L A;  1LSW A;  4WF0 A;  3P7N A;  1DP8 A;  4R38 A;  4EES A;  3MXQ A;  1T18 A;  4HJ6 A;  4I5S A;  4XT2 B;  4I38 A;  5HZH A;  1S4R A;  1VB6 A;  3LI9 A;  2OWJ A;  3ICY A;  3IBR A;  2W27 A;  3ZQ5 A;  3F1O A;  4HQA A;  1S1Y A;  1N9L A;  5HSQ A;  3LID A;  5F6A A;  3UMD A;  3A0R A;  3GEC A;  4GW9 A;  4HJ4 A;  1N9N A;  4R3A A;  2VV7 A;  3LIB A;  2PR5 A;  2H28 A;  3T50 A;  3MJQ A;  4E04 A;  4BBU A;  3G6O A;  4L9G A;  1P97 A;  3RH8 B;  3UB7 A;  3LUQ A;  3IS2 A;  3FG8 A;  2R78 A;  3D72 A;  3LIE A;  4GS9 A;  4I39 A;  2OOL A;  2J80 A;  1T19 A;  2L4R A;  1TS8 A;  1F9I A;  1T1B A;  1OTE A;  4XT2 A;  3E4P A;  1ODV A;  4H6J A;  3UB8 A;  3HJK A;  3UME A;  4WL9 A;  2GJ3 A;  1D06 A;  1TS6 A;  2PR6 A;  1NWZ A;  1XJ6 A;  1OTI A;  2PDR A;  4DJ3 A;  5DKL A;  5IU1 A;  1TS0 A;  4LRX C;  1OTB A;  3RTY A;  3NOT C;  2JHE A;  5F5Y A;  4EXO A;  3KX0 X;  1XJ4 A;  1P0Z A;  4NXE A;  2B02 A;  2W0N A;  1LL8 A;  4RQ9 A;  4BBT A;  1TS7 A;  4JGP A;  2L0W A;  1XJ3 A;  3NJA A;  4LRZ E;  3VE4 A;  3VOL A;  3CWF A;  5HDC A;  5KIZ A;  2WKR A;  1JNU A;  5G4Y A;  3PHY A;  2D02 A;  4GHI B;  4LRY C;  1DRM A;  1LT0 A;  1XFQ A;  5A8B A;  1D7E A;  2PHY A;  5F69 A;  3A0S A;  2EA9 A;  4BBV A;  2WKP A;  2YKF A;  3H82 B;  3LYX A;  2ZOI A;  4B9O A;  2QHK A;  1OT6 A;  4JGR A;  1BYW A;  2INW A;  4HHD A;  3CLO A;  3E4Q A;  4NXF A;  4MN6 A;  1S67 L;  3HJI A;  4EEU A;  3F1N B;  1WA9 A;  2VV8 A;  1EW0 A;  2M1C A;  1T1C A;  4GHI A;  4HH3 A;  4KUO A;  4EQ1 A;  3NHQ A;  3GDI A;  3CAX A;  4R70 A;  4HOI A;  4HY8 A;  2HV1 A;  2QJ5 A;  5HWT A;  2K7S A;  3MFX A;  2Z6D A;  4WN5 A;  2D01 A;  1OT9 A;  5DJU A;  3NOU C;  1S66 L;  5TBM B;  3E4O A; 
#chains in the Genus database with same CATH topology
 3S4X A;  1QMF A;  3ZG9 B;  1BLP A;  2ZC6 B;  2PU2 A;  4NK3 A;  4F94 A;  4GZB A;  5FL3 A;  4JF4 A;  4X6T A;  2VZW A;  4BQM A;  2JBF A;  4RX2 A;  5J4E A;  3T4L A;  3B3X A;  5FAQ A;  1OJG A;  2V1B A;  1BSG A;  3HCY A;  4HBT A;  5JYO A;  4JPM A;  3D9Y A;  3Q82 A;  3OLO A;  5FAO A;  3KO6 A;  1Z09 A;  4K91 A;  4MMN A;  2WZZ A;  3FKW A;  3IWO A;  3MR0 A;  4E6X A;  3K3D A;  2O9A A;  1OME A;  1H8Z A;  1PYY A;  5TBM A;  4WBG A;  2K31 A;  4HEF A;  3F1P B;  1XP4 A;  3VE3 A;  4H6J B;  3UY6 A;  3IHB A;  4DE1 A;  4DE0 A;  4E3M A;  3G35 A;  3BFG A;  2A24 B;  5AVE A;  2Y2G A;  4DF6 A;  2WGW A;  5L09 A;  2BAS A;  2YKH A;  5EE8 A;  2DMW A;  3S1Y A;  1GA9 A;  1LSX A;  4FH4 A;  4Y0T A;  2FFY A;  4DKI A;  4WYY A;  3TG9 A;  2EX8 A;  2B5R A;  1IEM A;  3VOY A;  3OPR A;  3UE1 A;  1DY6 A;  3DWK A;  4MBK A;  3OPH A;  2ZQC A;  1U60 A;  3EEA A;  3H7W A;  3Q7V A;  1PWC A;  3G34 A;  3D3O A;  2VX8 A;  1RGZ A;  3CG5 A;  1EWZ A;  1AXB A;  4OPY A;  4F3L B;  5DFX A;  4I3I A;  5MC7 A;  2HDR A;  5L2F A;  3MZD A;  4YOF A;  4JXG A;  2H5S A;  5G18 A;  4B4X A;  4N1X A;  3LIF A;  3MQQ A;  2WAF A;  1GHP A;  2HP9 A;  2A2L A;  4FUW A;  2G2U A;  4MCW A;  3HLC A;  4LLO B;  1HTZ A;  2QWS A;  3WS0 A;  3JVU A;  1BLH A;  1RP5 A;  1OPX A;  4WUJ A;  3C4P A;  1F2K A;  1VET B;  1H8Y A;  3PAE A;  3SS4 A;  3N8S A;  1YLP A;  3E2L A;  2R9W A;  4MBH A;  4X68 A;  2R9X A;  3W4Q A;  3RXX A;  1GSW A;  1VEU A;  2H10 A;  3P7N A;  4BJP A;  4X1L A;  2HP6 A;  2XSS A;  4UQI M;  3QP1 A;  4EES A;  1YLJ A;  4HJ6 A;  1S4R A;  4Y7P A;  3OCN A;  4Y15 A;  2Y2L A;  2V1Z A;  3IBR A;  5KMW A;  1W63 M;  2BLS A;  4N9L A;  3T4Q A;  3VP2 A;  4HQA A;  1S1Y A;  5HSQ A;  5GL9 A;  3QP8 A;  2JKT M;  1W8Y A;  4RYE A;  3S7P A;  3MS6 A;  3HLD A;  4GW9 A;  1N9N A;  4R3A A;  3LIB A;  1FSY A;  1PZO A;  2EX9 A;  4MEZ A;  3ITB A;  3G4P A;  3GSG A;  4ID4 A;  4L9G A;  1P97 A;  3PBR A;  3UB7 A;  2X71 A;  1IKG A;  2OSU A;  5TFQ A;  3UDI A;  1LL9 A;  2HJ9 C;  4LV3 A;  4YIN A;  3LO7 A;  5FQ9 A;  1KGE A;  4N1H A;  1YSQ A;  4FTX A;  1E4D A;  3GVB A;  3FV7 A;  2J80 A;  3HUN A;  4K0X A;  4Y17 A;  2WYX A;  2L4R A;  1TS8 A;  4U3T A;  4ZJ1 A;  4S2J A;  4QJG A;  1OTE A;  2ZM0 A;  3E4P A;  2IWD A;  4H6J A;  3TSG A;  5HAP A;  2P9V B;  3UB8 A;  3R7W B;  3A3J A;  3ZCZ A;  1IYP A;  3JPU A;  1XJ6 A;  1XA7 A;  2PDR A;  2XEP A;  3G31 A;  5EVE A;  4EBP A;  5FQJ A;  2H0Y A;  4OH0 A;  1OTB A;  3MQ0 A;  4Z9Q A;  4ZBE A;  2XD1 A;  5GLC A;  1MWS A;  5A91 A;  5F5Y A;  5FDS A;  1ONG A;  4EXO A;  3HLW A;  1XJ4 A;  4UEY A;  2B18 A;  4DDY A;  3NBL A;  3RFB A;  2W0N A;  3BM6 A;  1KDW A;  1LHY A;  1TS7 A;  1VHM A;  2L0W A;  2Z2M B;  1W8Q A;  2P74 A;  4LRZ E;  3VE4 A;  3LR3 A;  3CWF A;  3EOI A;  3BJN A;  4EBN A;  4MLL A;  4JKT A;  5G4Y A;  4CLC B;  2WKH A;  2BTF P;  4JF5 A;  2D02 A;  3LY4 A;  2ZMV A;  1XFQ A;  5A8B A;  4X1M A;  2PHY A;  1WYB A;  3A0S A;  3HLE A;  4YFM A;  3W8K A;  4S2P A;  3UN7 A;  4WEJ A;  3MXR A;  3SS5 A;  2QPN A;  2YKF A;  3HUO A;  4EQI A;  4B9O A;  4QY6 A;  3KSH A;  2P08 A;  5GHZ A;  2INW A;  2WZX A;  3WS1 A;  4NXF A;  2X02 A;  5CHU A;  4EEU A;  5M1A A;  4UA9 A;  3HLB A;  1WA9 A;  2M1C A;  1ZTU A;  1CEG A;  2EX6 A;  4DE3 A;  1PIO A;  2JCH A;  4GHI A;  4HH3 A;  1K56 A;  3VP3 A;  3C7V A;  4D60 A;  1TVF A;  4M3K A;  3GDI A;  3CAX A;  2GX5 A;  4CLC C;  2QYB A;  4JXS A;  4ESP A;  2HDS A;  3ZNY A;  1NYM A;  2QJ5 A;  1ZG4 A;  5JYP A;  2MJ6 A;  2DRW A;  4GDB A;  3UPP A;  3ZYT A;  2Z6D A;  2D01 A;  1OT9 A;  1IYO A;  4BLM A;  4B88 A;  1G6A A;  2Y2I A;  5TBM B;  2O0Y A;  5CGX A;  2Y2J A;  2PD8 A;  3UE6 A;  2UV0 E;  5EFW A;  4C3Q A;  1ES3 A;  5CTN A;  4RVA A;  3K3C A;  3HRE A;  4OQG A;  5EVI A;  3NOP C;  1K57 A;  3B42 A;  4YWZ A;  2XRN A;  1PZP A;  4I3A A;  1V9Z A;  5EEC A;  3UDF A;  5HAQ A;  4Y0O A;  3F1O B;  4L9F A;  3MSH A;  3VP4 A;  3BQA A;  2WGW B;  4OP8 A;  4P87 A;  2WAD A;  3CUE A;  4IVI A;  3A3F A;  3BW6 A;  4MN5 A;  3E0Y A;  5GLA A;  3IBJ A;  3SOI A;  2LB9 A;  3WS4 A;  5E2H A;  3IXD A;  4JGQ A;  4UA6 A;  3CZD A;  3V67 A;  3R4K A;  3C8C A;  1YPR A;  3GR2 A;  3KYZ A;  3O5Y A;  4I3J A;  3BEC A;  2XK1 A;  3MKE A;  4PKY A;  1GA0 A;  1CJF A;  3H7W B;  4WLA A;  1GSV A;  3MKF A;  1NZU A;  3LR5 A;  3WRT A;  4GOG A;  3RXW A;  4HI4 A;  1TDL A;  2VJW A;  4C75 A;  1UWP X;  3IX8 A;  3M6B A;  3LIC A;  2V2F F;  2ZC3 B;  1G6O A;  1OTD A;  4QPR A;  4GN2 A;  1H0M A;  1G5U A;  4EER A;  3C30 A;  3BFC A;  3LEZ A;  3IT9 A;  2ZMF A;  3BY9 A;  4M4X A;  5FAS A;  3MF0 A;  3C2W A;  5HAI A;  5CTM A;  5HD3 A;  4U0X A;  5G4Z A;  4EET B;  4OOL A;  3BYD A;  3NIA A;  1I2W A;  2I9V A;  5AVF A;  1TDG A;  5I5L A;  4NXG A;  2PU4 A;  3IF5 A;  5A92 A;  2ZQA A;  3T4O A;  4KZ6 A;  3VMA A;  4FOF A;  2WKI A;  5FI2 A;  2XQZ A;  1VEU B;  1IKI A;  5HAR A;  4KG6 A;  2M7V A;  4P0M A;  4NXB A;  2VEA A;  1CI8 A;  4LPZ A;  4QB8 A;  4BL2 A;  4KZ4 A;  2A49 A;  5AQ7 A;  3ZG5 A;  1YLT A;  3M2J A;  4R6L A;  4DJ2 A;  4R1G A;  4NKP A;  1XKZ A;  4EBL A;  3KYQ A;  4S2N A;  5L10 A;  3N8L A;  5EVL A;  3ZDJ A;  2J3T C;  3HLG A;  3IF6 A;  3MQO A;  3B33 A;  4JGO A;  5GHX A;  5IHV A;  4G3W A;  3KSG A;  4KQQ A;  4WZ5 A;  1K25 A;  4S2L A;  4P85 A;  5F68 A;  3W4O A;  4EWF A;  4WF0 A;  4E3N A;  2Y4A A;  4ZRR A;  5EOE A;  2ZLY A;  3MXQ A;  4OVD A;  4Y3I A;  2V8C A;  4Q0J A;  4ZAM A;  5TJJ A;  1XPB A;  4PHT A;  4I38 A;  4S2M A;  1FQG A;  1VB6 A;  1NLY A;  3LI9 A;  3N4I A;  3F1O A;  4IBR A;  5EM1 A;  4DDS A;  2O9B A;  4XXR A;  4LV1 A;  4FCF A;  3A0R A;  3MZE A;  3GEC A;  3T4K A;  4HJ4 A;  4X56 A;  1WE4 A;  5L8M A;  2Z2L B;  2PR5 A;  4E04 A;  3V3S A;  3LUQ A;  2HF6 A;  3IS2 A;  3IWQ A;  4X69 A;  2EXB A;  3S7Q A;  3UPN A;  2CC1 A;  3HVF A;  4PM7 A;  2M7U A;  4GLQ A;  3S7O A;  1YMS A;  2E8J A;  3FPW A;  4PPR A;  1T19 A;  4CLC E;  1F9I A;  1JTD A;  3ZG8 B;  4DE2 A;  1T1B A;  4ARZ A;  5C5K A;  2AVX A;  1ODV A;  1BT5 A;  4CJN A;  4R3B A;  2ZC4 B;  2FFF B;  4LEN A;  3EGX C;  3UME A;  4Q0I A;  1D06 A;  2ZQD A;  4N92 A;  5DFY A;  2JE5 A;  2Y2P A;  2ZMA A;  3CMZ A;  3A3D A;  3E98 A;  4JBF A;  2WGV A;  4Y5F A;  5F1G A;  3UNW A;  1TS0 A;  3DW0 A;  1CK3 A;  3RJU A;  3B47 A;  2W3F A;  3BQ8 A;  3N6I A;  3OPL A;  2PT7 A;  3FYZ A;  5HW3 A;  1BLC A;  4KZB A;  1BTL A;  1P0Z A;  4GB7 A;  4NXE A;  1MKI A;  1LL8 A;  1O07 A;  2ZJ9 A;  3CI6 A;  1WYC A;  1XA1 A;  1SKO A;  3IH9 A;  1FCM A;  4IVK A;  2NUT C;  2HDQ A;  1XJ3 A;  2OV5 A;  3NJA A;  1SHV A;  5FAT A;  4CLC D;  1A0K A;  1Q2Q A;  3HL9 A;  4LV2 A;  5U47 A;  3NI9 A;  4Q0H A;  5KIZ A;  1FR6 A;  4R4R A;  2J3W A;  1BZA A;  5AQB A;  1JNU A;  4GHI B;  2IWC A;  1L3L A;  4DMZ A;  2O99 A;  1ZKJ A;  1MBL A;  3NCK A;  1STZ A;  1BLS A;  4BD1 A;  2OLV A;  1AWI A;  4BBV A;  2ZD8 A;  4KQR A;  2WKP A;  1CQA A;  1HD8 A;  5EM0 A;  1YT4 A;  3LR4 A;  3UPO A;  1C3B A;  4JLF A;  4OPQ A;  3KSI A;  3T4S A;  2QHK A;  2ZM8 A;  4E3J A;  4UHU A;  2Y2M A;  1HZO A;  1HVB A;  4BMW A;  5EVI B;  1Z6F A;  2C5W B;  1EI5 A;  2VV8 A;  1I5Q A;  1IEL A;  2W3D A;  1T1C A;  2J7V A;  3TW8 A;  1H3Q A;  3ZVW A;  5CHM A;  1KGF A;  3IXG A;  4II7 A;  5DTT A;  2OAP 1;  4HY8 A;  1VM1 A;  2HDU A;  4LCL A;  4YNR A;  5HWT A;  3BLS A;  3MFX A;  2EWW A;  3IX4 A;  2WKE A;  2K2N A;  1XX2 A;  4MNR A;  2EWV A;  3LGO A;  3NOU C;  1PRQ A;  1NXY A;  1DP9 A;  1ESU A;  2JKR M;  3A0V A;  1CI9 A;  4KQD A;  3LR0 A;  1OTA A;  4EEP A;  1L0G A;  1YSP A;  3L9K A;  3SW1 A;  2JKT I;  3D4F A;  1BUL A;  2Q9M A;  2WAE A;  3NUL A;  4Z1W A;  1F5M A;  4EUV A;  4KZ7 A;  3MXS A;  3UB6 A;  5EVI C;  2KLI A;  4O8G A;  3M6H A;  4E3I A;  1S0W A;  4UQI S;  4XUZ A;  3VFF A;  2VGL M;  4GDN A;  2Z6C A;  4GJ4 A;  1XJ2 A;  1YLW A;  1SCW A;  1S4S A;  3JVV A;  2XDM A;  3CUE C;  3EEH A;  4GD8 A;  4HIA A;  5FI7 A;  2Y8H A;  3VP0 A;  2JKF A;  3FWL A;  3GMW A;  3PBN A;  2EFX A;  2VK3 A;  4K08 A;  2CMN A;  4L9E A;  2HZ5 A;  1ES4 A;  2J9P A;  5HWW A;  3GQZ A;  2DCF A;  3T12 B;  3EWK A;  1F98 A;  3NC8 A;  4BD0 A;  4HJ3 A;  4QY5 A;  3C4O A;  1NRF A;  1L0D A;  1Y28 A;  5HDD A;  2J3T D;  2ZQ8 A;  1KDS A;  4A5R A;  4EW7 A;  4WEL A;  5KSH A;  1FIK A;  2Y2N A;  3P09 A;  3QNC A;  3OPP A;  3U4L P;  2V9A A;  3EQV A;  3EGD C;  1K55 A;  4AFI A;  4LV0 A;  5DF7 A;  3NDG A;  2V0U A;  3T4T A;  5EUA A;  5DKK A;  1LSV A;  3IF6 B;  2QZ6 A;  3BRM A;  1ES5 A;  4E3O A;  1MWR A;  2HGV A;  3PR6 A;  1J3W A;  5D3O A;  4L0L A;  1KVM A;  1NLZ A;  3G30 A;  2V0W A;  2OWH A;  4KUK A;  5F1F A;  4KQO A;  5TGF A;  3PAG A;  4X25 A;  4OLD A;  3FC7 A;  4JF6 A;  2J9O A;  5J7E A;  1KOU A;  3ZHH A;  1V9Y A;  2XLN A;  3AGD A;  4OOY A;  4HH2 A;  4HP9 A;  5FSR A;  5TR7 A;  5HL1 A;  3M2K A;  4DXB A;  2IA2 A;  3LIA A;  3MBZ A;  3E2K A;  5HX9 A;  1FCN A;  2O9C A;  3ZGA B;  3ITA A;  1DJC A;  1PW8 A;  5HPF A;  5DTK A;  3BEB A;  5CGS A;  5FQM A;  1DP6 A;  3DTK A;  3PBS A;  3C5A A;  4GKU A;  2VGK A;  4QHC A;  2WGI A;  3V39 A;  2EX2 A;  5M18 A;  3WWX A;  3UE3 A;  2G2W A;  2V1A A;  3IS2 B;  4Q8I A;  4DN0 A;  4GNU A;  4WM9 A;  4S2N C;  1N9O A;  4DXC A;  5FA7 A;  3IF6 C;  1NYY A;  1KE3 A;  1XXM A;  1LSW A;  2A3U A;  1FCO A;  4WZ5 C;  1JTG A;  2OLU A;  5DF8 A;  1T18 A;  5AQA A;  1MC0 A;  2PBD P;  3SH7 A;  1L0E A;  4RX3 A;  1ERO A;  4ARZ B;  1ONH A;  1PWG A;  3O3V A;  1ESI A;  5HZH A;  2JKG A;  3TOI A;  4NG2 A;  4KZ3 A;  3DWZ A;  2PAV P;  1IYS A;  2W27 A;  3IHA A;  3ZQ5 A;  1N9L A;  5BOH A;  3LID A;  3UMD A;  5M19 A;  2ZC7 A;  4E3L A;  4X55 A;  1LI0 A;  2H28 A;  4ZTK A;  3PBT A;  4LFU A;  4BBU A;  3RH8 B;  2GDN A;  5F83 A;  1K4F A;  2R78 A;  3IXB A;  3G32 A;  3D72 A;  3LIE A;  4I39 A;  2OOL A;  2GZA A;  5FEF A;  1YMX A;  1TF1 A;  1K38 A;  2PRF A;  2QMI A;  5HFO A;  3UB5 P;  4ETZ A;  4OQI A;  3ZFZ A;  1SKO B;  4XT2 A;  5GLD A;  4U0T A;  2WUQ A;  3P01 A;  2V20 A;  4NET A;  4WL9 A;  2Y2K A;  2GJ3 A;  2HP5 A;  4ZJ2 A;  1ACF A;  1TS6 A;  3Q1F A;  2PR6 A;  3UDX A;  5LBR A;  3LCE A;  3UE0 A;  1W63 Q;  3T1S A;  4PM9 A;  5EOO A;  5IU1 A;  3O88 A;  5KSC A;  3NOT C;  4S2I A;  1GHM A;  1M40 A;  3KX0 X;  3QP2 A;  3DAV A;  1BUE A;  2W3G A;  4ETX A;  2B02 A;  2RCX A;  4KZ9 A;  1MY8 A;  4OPZ A;  1K54 A;  4JGP A;  3WRZ A;  1FOF A;  3IH8 A;  1RCJ A;  5HL6 A;  2VKS A;  3VOL A;  4WMC D;  1L0F A;  3FZC A;  3C7U A;  1K56 D;  3QHY A;  4IJG A;  1ALQ A;  5CEC A;  2FH5 A;  2BG1 A;  3QP4 A;  4LRY C;  4KZ5 A;  5K5B A;  2B95 A;  3ZG7 B;  3IQA A;  4FSF A;  3EQU A;  3VP1 A;  5F69 A;  1K0K A;  5GHY A;  2EA9 A;  3AGE A;  4UA7 A;  4E6W A;  5FQK A;  2P04 A;  1PFL A;  3H82 B;  1PW1 A;  2JC7 A;  3LYX A;  4H8R A;  2ZOI A;  4N9K A;  3T1R A;  5EVI D;  1MXO A;  1OT6 A;  4GD6 A;  5CED A;  1BYW A;  3S7N A;  2W3E A;  2XD5 A;  4HHD A;  4EV4 A;  3CLO A;  3E4Q A;  4MN6 A;  4P6B A;  1XGI A;  3F1N B;  1RGY A;  2OAQ 1;  2PBY A;  3DTI A;  5FEG A;  1EW0 A;  4JXW A;  3OOV A;  1YLZ A;  3V50 A;  1MWT A;  3SH8 A;  4PM6 A;  1FSW A;  3OCL A;  4O01 A;  3CIT A;  3ISG A;  3KYE A;  4C6Y A;  1PWD A;  4ZJ3 A;  3V3R A;  1L2S A;  2H0T A;  4NEE D;  2K7S A;  4R4S A;  4QWO A;  2XRO A;  3QP6 A;  1CEF A;  1KGG A;  1NJ4 A;  1K4E A;  1GHI A;  5DJU A;  5E2E A;  1S66 L;  4HES A;  5E43 A;  1YLY A;  2Y2Q A;  3A3E A;  3GRJ A;  4QU3 A;  3TE8 A;  2WKQ A;  1K6S A;  5IS1 A;  5DJT A;  4EU0 A;  1FR1 A;  2L1M A;  5FI6 A;  3JYI A;  1QME A;  1NZO A;  1LL5 A;  3PBQ A;  4ME4 A;  2KDK A;  4HNB A;  5CRF A;  5HD5 A;  2WK0 A;  1IFQ A;  4S2O A;  4Y2F A;  3LEQ A;  1JVJ A;  2ZL1 B;  1S6R A;  3HUM A;  2GNX A;  3VFH A;  1YM1 A;  1YKD A;  4G3V A;  2PD7 A;  4JXV A;  4BEN A;  5F82 A;  3PXP A;  4GCZ A;  2W1T A;  1OJ5 A;  1UWN X;  2QJ7 A;  3Q7Z A;  2JN7 A;  2IWB A;  5KZH A;  1T1A A;  1DJB A;  2PYR A;  3FKV A;  1ZHH B;  2XR0 A;  2VV6 A;  4GS9 B;  3A3I A;  1K6R A;  1MZU A;  1N9B A;  4OQ0 A;  1MPL A;  1NY0 A;  1UGU A;  1S1Z A;  1E3U D;  1O7E A;  5EV0 A;  2EFU A;  1FIL A;  1I2S A;  2UWX A;  1ERQ A;  2ZM2 A;  1G28 A;  1ZG6 A;  2QKP A;  3MMH A;  2XA7 M;  4PKY G;  3IXH A;  4QD4 A;  3BWL A;  1Q2P A;  3O87 A;  2C6W B;  3BY8 A;  4D2O A;  4OON A;  1XFN A;  3DBA A;  1CF0 A;  4FH2 A;  4MBF A;  3BLM A;  4MDZ A;  5J3W A;  4EUZ A;  2DNS A;  4G3K A;  5L07 A;  2W1R A;  3LI8 A;  2ZQ9 A;  3OC2 A;  5A93 A;  3CPT B;  1H8M A;  3H9W A;  2ZBB A;  3I7J A;  3BFE A;  1YAX A;  5E2G A;  4HP4 A;  2VLG A;  3WS2 A;  4PM8 A;  2KX6 A;  3N8R A;  3K2N A;  1DJA A;  5CGW A;  1K55 C;  4S2K A;  4PMA A;  2XGN A;  3ULF A;  2P7J A;  3F1P A;  1SKF A;  3V5M A;  3MZF A;  3H82 A;  2LB5 A;  5HWV A;  4RA7 A;  2A24 A;  3CHW P;  3QP5 A;  5CXW A;  2PYP A;  5AQ9 A;  3VSK A;  5FQQ A;  2ZC5 B;  1ERM A;  3DTE A;  3F1N A;  1X0O A;  3S22 A;  3WS5 A;  1W5D A;  2Y2H A;  2ZOH A;  2KOI A;  4B4Z A;  1K57 C;  1KE0 A;  3UB9 A;  5FAP A;  5AJG A;  1P9R A;  1GCE A;  5HDS A;  1GSX A;  5EPH A;  2HJE A;  1LLB A;  3PTE A;  5J8X A;  1LI9 A;  3HLF A;  1IYQ A;  4OQH A;  3VV4 A;  3VOZ A;  3T4J A;  1SDN A;  4O0P A;  3PYP A;  3FPV A;  4F3L A;  3NY4 A;  1DP8 A;  4R38 A;  4CQH A;  1NRJ A;  3BFD A;  1TEM A;  3OZH A;  4I5S A;  4R0Q A;  1KE4 A;  4XT2 B;  4CPK A;  2XA7 S;  2Y59 A;  4OOM A;  2OWJ A;  3ICY A;  2E8I A;  2ZL1 A;  1PI4 A;  1XGJ A;  5FQI A;  4IED A;  4E3K A;  5F6A A;  3BFF A;  3IX3 A;  5CER A;  2VV7 A;  3T50 A;  1Y4O A;  3GTC A;  3MJQ A;  3W2Z A;  3G6O A;  4K0W A;  1N4O A;  1SDE A;  1VET A;  4Y13 A;  4P6Z M;  2JKR I;  3W4P A;  3FG8 A;  4KG5 A;  1YQS A;  4GS9 A;  3Q81 A;  4PAU A;  3T1X A;  3QNB A;  3OBF A;  1J9M A;  4WMC A;  2HPB A;  2J8Y A;  1D1J A;  2XFS A;  4LCM A;  1SZV A;  3C38 A;  3HJK A;  1H5X A;  5IT5 A;  2VA0 A;  4R23 A;  1NWZ A;  4B93 A;  1OTI A;  4DJ3 A;  4UAA A;  3Q07 A;  5DKL A;  3DTM A;  3ZNT A;  4LRX C;  5HPI A;  3P98 A;  3RTY A;  4PM5 A;  3G2Y A;  3PBO A;  2JHE A;  4R3J A;  3CPT A;  1P9W A;  2Q0O A;  2VGL S;  1G68 A;  3SS3 A;  3VSL A;  3IWI A;  3TRC A;  2VGJ A;  1IOU A;  1ES2 A;  5I94 A;  4IBX A;  3NEC A;  4RQ9 A;  4WZ4 A;  3O86 A;  4BBT A;  4MN7 A;  1HLU P;  4Y0U A;  3ZG0 A;  3N7W A;  3U2A A;  4ZDX A;  4OPR A;  4BWI A;  4KEN B;  5CHJ A;  2P9V A;  2X01 A;  5DF9 A;  1E25 A;  3R7W A;  3UO9 A;  4HBU A;  2Q9N A;  4X53 A;  1TD5 A;  5HDC A;  2RL3 A;  3LFV A;  1K54 C;  1VQQ A;  2WKR A;  4OLG A;  3TJZ C;  1KVL A;  4FD8 A;  2FZ0 A;  3PHY A;  3SZT A;  4WEK A;  4OKP A;  1DRM A;  2W3H A;  5DVA A;  5CEB A;  1LT0 A;  3L7H A;  1PI5 A;  1D7E A;  2NUP C;  2XF3 A;  1W7F A;  3ZVT A;  3Q7V B;  3NDE A;  3SH9 A;  2V8F A;  4BL3 A;  4IUK A;  4P6Z S;  2Y2O A;  2Y55 A;  4OP5 A;  1JWZ A;  1MWU A;  4IUH A;  1ZC2 A;  4O7D A;  4KG2 A;  2Y91 A;  4JGR A;  5GLB A;  2G7U A;  1S67 L;  2EXA A;  3AGF A;  3HJI A;  3LY3 A;  4KZA A;  2Y79 A;  5A90 A;  3T1Q B;  1PNE A;  2XH9 A;  4CLC A;  1W79 A;  5DTS A;  2ACG A;  5E2F A;  1JWP A;  4KUO A;  2XFT A;  4EQ1 A;  3GV9 A;  3NHQ A;  2W1T B;  1M6K A;  1JWV A;  4R70 A;  4HOI A;  2HV1 A;  4XUX A;  3MFD A;  4DRT A;  1MKM A;  3KSF A;  4KZ8 A;  3G2Z A;  3HBR A;  2I72 A;  1Y54 A;  4LGW A;  5FDH A;  4WN5 A;  1E3U A;  3CJM A;  2ZQ7 A;  5CX7 A;  3E4O A;  4IHQ A; 
#chains in the Genus database with same CATH homology
 2PD8 A;  3UE6 A;  5EFW A;  2WKQ A;  3TE8 A;  5IS1 A;  5DJT A;  4EU0 A;  2L1M A;  2JKR M;  3A0V A;  4KQD A;  3K3C A;  3LR0 A;  1OTA A;  5FL3 A;  4EEP A;  3NOP C;  3PBQ A;  3B42 A;  4YWZ A;  2XRN A;  2VZW A;  1YSP A;  4ME4 A;  2KDK A;  4HNB A;  4I3A A;  5HD5 A;  1IFQ A;  1V9Z A;  4Y2F A;  3SW1 A;  5J4E A;  2JKT I;  3T4L A;  4Z1W A;  1F5M A;  2GNX A;  4EUV A;  3F1O B;  1YKD A;  3UB6 A;  4G3V A;  4L9F A;  2PD7 A;  2KLI A;  1OJG A;  2V1B A;  3HCY A;  3BQA A;  4O8G A;  3PXP A;  4GCZ A;  2W1T A;  4UQI S;  3CUE A;  1OJ5 A;  1UWN X;  3BW6 A;  2QJ7 A;  3OLO A;  4MN5 A;  2VGL M;  2JN7 A;  3E0Y A;  3KO6 A;  2Z6C A;  4GJ4 A;  3IBJ A;  4MMN A;  1XJ2 A;  3MR0 A;  1S4S A;  2LB9 A;  1T1A A;  3JVV A;  2PYR A;  3K3D A;  4JGQ A;  2O9A A;  3CUE C;  3EEH A;  1ZHH B;  3V67 A;  2VV6 A;  3R4K A;  4GS9 B;  4HIA A;  3C8C A;  1MZU A;  3KYZ A;  2Y8H A;  3O5Y A;  5TBM A;  4I3J A;  1UGU A;  4PKY A;  1S1Z A;  3PBN A;  4K08 A;  2CMN A;  3H7W B;  4L9E A;  4WLA A;  1GSV A;  2K31 A;  3F1P B;  3LR5 A;  3VE3 A;  4HI4 A;  4H6J B;  5HWW A;  2VJW A;  1G28 A;  2QKP A;  1UWP X;  3MMH A;  3EWK A;  1F98 A;  3LIC A;  2XA7 M;  4PKY G;  3BWL A;  1G6O A;  4HJ3 A;  1OTD A;  2A24 B;  5AVE A;  4QPR A;  3BY8 A;  1XFN A;  1Y28 A;  3DBA A;  2BAS A;  5HDD A;  2J3T D;  2YKH A;  4EER A;  2DMW A;  3C30 A;  4MDZ A;  5J3W A;  4G3K A;  2W1R A;  4WEL A;  4EW7 A;  1LSX A;  3LI8 A;  5KSH A;  2ZMF A;  3BY9 A;  4M4X A;  3OC2 A;  2V9A A;  1H8M A;  3C2W A;  3EGD C;  3H9W A;  3EQV A;  3MF0 A;  4AFI A;  5HD3 A;  2ZBB A;  5G4Z A;  4EET B;  4OOL A;  1YAX A;  2V0U A;  3T4T A;  4HP4 A;  5DKK A;  2I9V A;  5AVF A;  2VLG A;  1LSV A;  5I5L A;  4NXG A;  2KX6 A;  3K2N A;  3EEA A;  2HGV A;  3H7W A;  3PR6 A;  3T4O A;  4FOF A;  3D3O A;  2VX8 A;  3ULF A;  4L0L A;  2P7J A;  3F1P A;  1NLZ A;  2V0W A;  3H82 A;  2OWH A;  4KUK A;  4F3L B;  5DFX A;  4I3I A;  2LB5 A;  5MC7 A;  4KQO A;  3FC7 A;  5HWV A;  2M7V A;  2A24 A;  5J7E A;  4YOF A;  4NXB A;  2VEA A;  4LPZ A;  1KOU A;  2PYP A;  1V9Y A;  4HH2 A;  3LIF A;  4HP9 A;  3MQQ A;  3F1N A;  4R6L A;  1X0O A;  2IA2 A;  2A2L A;  3LIA A;  4MCW A;  2O9C A;  4DJ2 A;  2ZOH A;  2KOI A;  4NKP A;  5HPF A;  4LLO B;  3UB9 A;  3KYQ A;  2QWS A;  1DP6 A;  3JVU A;  3PBS A;  5AJG A;  1P9R A;  5HDS A;  1GSX A;  3UE3 A;  2J3T C;  3MQO A;  1OPX A;  2V1A A;  3B33 A;  4JGO A;  2HJE A;  4WUJ A;  4G3W A;  3KSG A;  3IS2 B;  4DN0 A;  3VV4 A;  3T4J A;  1DP9 A;  5F68 A;  1N9O A;  4O0P A;  1GSW A;  3PYP A;  3FPV A;  4F3L A;  1LSW A;  4WF0 A;  3P7N A;  1DP8 A;  4ZRR A;  4R38 A;  4BJP A;  4CQH A;  1NRJ A;  2XSS A;  4UQI M;  4EES A;  3MXQ A;  1T18 A;  1MC0 A;  4Y3I A;  4HJ6 A;  4I5S A;  4ARZ B;  4XT2 B;  4Q0J A;  5TJJ A;  4PHT A;  4I38 A;  5HZH A;  1S4R A;  2XA7 S;  1VB6 A;  1NLY A;  3LI9 A;  3OCN A;  4OOM A;  2OWJ A;  3ICY A;  3IBR A;  1W63 M;  2W27 A;  3T4Q A;  3F1O A;  4HQA A;  1N9L A;  1S1Y A;  3ZQ5 A;  5HSQ A;  3LID A;  2JKT M;  5F6A A;  3S7P A;  3UMD A;  2O9B A;  3A0R A;  3GEC A;  3T4K A;  4GW9 A;  4HJ4 A;  1N9N A;  4R3A A;  5L8M A;  2VV7 A;  3LIB A;  2PR5 A;  2H28 A;  3PBT A;  3T50 A;  3MJQ A;  4E04 A;  3W2Z A;  4BBU A;  3G6O A;  4L9G A;  1P97 A;  3RH8 B;  3PBR A;  3UB7 A;  3LUQ A;  4P6Z M;  2JKR I;  2HF6 A;  3IS2 A;  3FG8 A;  2HJ9 C;  2R78 A;  3S7Q A;  3D72 A;  2M7U A;  3LIE A;  4GLQ A;  4GS9 A;  4I39 A;  3S7O A;  4PAU A;  1YSQ A;  2OOL A;  2GZA A;  1TF1 A;  3FPW A;  2J80 A;  1T19 A;  4CLC E;  2L4R A;  1TS8 A;  3OBF A;  1F9I A;  4ETZ A;  1T1B A;  4ARZ A;  1OTE A;  4XT2 A;  5C5K A;  3E4P A;  3P01 A;  1ODV A;  4H6J A;  3C38 A;  3UB8 A;  3HJK A;  3R7W B;  3EGX C;  3UME A;  4WL9 A;  5IT5 A;  4Q0I A;  2GJ3 A;  1D06 A;  2VA0 A;  1TS6 A;  2PR6 A;  5DFY A;  1NWZ A;  4B93 A;  5LBR A;  1XJ6 A;  1OTI A;  2PDR A;  1W63 Q;  4DJ3 A;  3E98 A;  5DKL A;  5IU1 A;  4Y5F A;  1TS0 A;  4LRX C;  5HPI A;  1OTB A;  3MQ0 A;  3RTY A;  3NOT C;  3PBO A;  2JHE A;  3B47 A;  2W3F A;  1P9W A;  3BQ8 A;  5F5Y A;  2PT7 A;  4EXO A;  2VGL S;  3KX0 X;  1XJ4 A;  3TRC A;  4UEY A;  2B18 A;  2W3G A;  1P0Z A;  4ETX A;  1IOU A;  4NXE A;  2B02 A;  3RFB A;  2W0N A;  1LL8 A;  4RQ9 A;  4BBT A;  3CI6 A;  4MN7 A;  1TS7 A;  4JGP A;  1VHM A;  3U2A A;  2L0W A;  2NUT C;  1XJ3 A;  5HL6 A;  4BWI A;  3NJA A;  4LRZ E;  2VKS A;  3VE4 A;  3VOL A;  3LR3 A;  5DF9 A;  3R7W A;  4CLC D;  3CWF A;  3EOI A;  3BJN A;  1TD5 A;  5HDC A;  4Q0H A;  3LFV A;  5KIZ A;  2J3W A;  2WKR A;  4IJG A;  3TJZ C;  1JNU A;  5G4Y A;  4CLC B;  2FH5 A;  2FZ0 A;  3PHY A;  2D02 A;  4GHI B;  4WEK A;  4LRY C;  1DRM A;  5K5B A;  2ZMV A;  4DMZ A;  2W3H A;  1LT0 A;  2O99 A;  1XFQ A;  5A8B A;  4FSF A;  1D7E A;  1STZ A;  3EQU A;  2NUP C;  2PHY A;  5F69 A;  3A0S A;  2EA9 A;  2P04 A;  4BBV A;  4IUK A;  2WKP A;  4P6Z S;  4WEJ A;  3LR4 A;  2YKF A;  3H82 B;  4IUH A;  3LYX A;  2ZOI A;  3KSI A;  3T4S A;  4B9O A;  2QHK A;  1OT6 A;  3KSH A;  4JGR A;  1BYW A;  3S7N A;  2P08 A;  2W3E A;  2INW A;  4HHD A;  4BMW A;  2G7U A;  3CLO A;  3E4Q A;  4NXF A;  4MN6 A;  1S67 L;  3HJI A;  4EEU A;  2Y79 A;  3F1N B;  1WA9 A;  2OAQ 1;  2VV8 A;  1EW0 A;  2M1C A;  4CLC A;  1ZTU A;  2W3D A;  1T1C A;  3OOV A;  4GHI A;  4HH3 A;  3TW8 A;  1H3Q A;  4KUO A;  4EQ1 A;  3NHQ A;  3OCL A;  2W1T B;  3GDI A;  4O01 A;  3CIT A;  3CAX A;  2GX5 A;  4CLC C;  4II7 A;  4R70 A;  2QYB A;  2OAP 1;  4HOI A;  4HY8 A;  2HV1 A;  2QJ5 A;  1MKM A;  3KSF A;  4YNR A;  5HWT A;  4NEE D;  2K7S A;  2MJ6 A;  3MFX A;  2EWW A;  3ZYT A;  2XRO A;  2Z6D A;  2K2N A;  4WN5 A;  2EWV A;  2D01 A;  1OT9 A;  5DJU A;  3NOU C;  1S66 L;  5CX7 A;  5TBM B;  2O0Y A;  3E4O A;  4IHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...