1UWNX

The initial events in the photocycle of photoactive yellow protein: a common mechanism on light activation in photoreceptor proteins
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
124
Chain Sequence
EHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Initial events in the photocycle of photoactive yellow protein.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 34
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1uwnX00
4GS9A 2ZOHA 3MFXA 3FC7A 1OTDA 2JN7A 2I9VA 4HHDA 5A8BA 4GCZA 2KDKA 2H28A 1OT9A 1GSVA 2QHKA 4E04A 5HDSA 1KOUA 5J3WA 5HD5A 5IS1A 3ULFA 3SW1A 1LSVA 5TBMA 4KQDA 2Z6CA 4XT2A 5DKLA 3VE3A 1GSXA 3NOPC 1S67L 3H82A 4HNBA 3T50A 3IS2B 3UB6A 1S1ZA 3G6OA 3HJKA 1N9LA 2HV1A 4HP9A 4K08A 4EQ1A 3GECA 1DP8A 2ZBBA 1OTEA 1OJGA 4EETB 5J7EA 4WUJA 4GHIA 2L1MA 2V0WA 1VB6A 3BY8A 3HJIA 4WLAA 4KUOA 3UB9A 1S4SA 1LL8A 4F3LB 1T1CA 3UE6A 4LPZA 2PYRA 2V1AA 3MJQA 4EXOA 4I5SA 4EERA 1UWNX 3A0VA 4I38A 4HQAA 4HJ6A 2Z6DA 3H7WB 3CWFA 3KX0X 5HWTA 5F69A 3A0SA 3F1OA 1V9YA 4I3IA 3PYPA 2OOLA 1S4RA 3F1PB 2GJ3A 4L9EA 3LYXA 4R70A 2A24B 1D06A 1F98A 4EESA 4I3JA 2CMNA 2JHEA 1F9IA 4NXFA 1XJ2A 3F1NA 4H6JA 2WKPA 2PD7A 4LRXC 4WL9A 2QJ5A 2PYPA 3NOTC 1Y28A 2M1CA 3VOLA 3ZQ5A 2PD8A 1XJ4A 2VV7A 4JGOA 1XJ6A 1LT0A 1OTAA 3MQOA 4DJ3A 1S1YA 5HZHA 1P97A 3E4PA 4LLOB 5HDCA 2V9AA 5J4EA 2OWJA 4PKYG 4GS9B 5F5YA 4HH3A 3IBRA 3K3CA 4HI4A 1OT6A 1TS7A 3BY9A 2B02A 3UB8A 4BBUA 3MR0A 2KX6A 2VLGA 3EWKA 4PKYA 4RQ9A 4LRZE 3LI8A 5TBMB 5DKKA 2W27A 1D7EA 3LIBA 1V9ZA 2INWA 4XT2B 2QJ7A 2YKHA 4R38A 3BWLA 4R3AA 1XFNA 3H82B 4WF0A 1JNUA 1P0ZA 4NXEA 3LIAA 1OTBA 1OJ5A 3B33A 1N9OA 4GHIB 2D01A 1WA9A 4JGPA 4EEPA 3C8CA 4EW7A 2D02A 3LIEA 1DRMA 2EA9A 5HDDA 1X0OA 4MN6A 4M4XA 2VEAA 1LSXA 3A0RA 3CLOA 1T1BA 1UWPX 4HJ4A 3LIDA 1NWZA 3UMDA 3LUQA 5G4ZA 4HJ3A 3UB7A 1UGUA 2YKFA 4WN5A 3D72A 4KUKA 2L4RA 4I39A 4HH2A 3F1OB 4HY8A 1ODVA 4YWZA 2VV6A 5F6AA 5DJUA 2J80A 3UMEA 1LSWA 4L9GA 4NXBA 1N9NA 5IU1A 2PHYA 3OLOA 4L9FA 2QWSA 5EFWA 4HP4A 3RTYA 2PR5A 3IS2A 4HIAA 4MN5A 2PDRA 2PR6A 5DJTA 3F1NB 4H6JB 3FG8A 4R6LA 5HWWA 1S66L 1G28A 2BASA 2K7SA 4BBVA 1TS0A 2V0UA 3MXQA 1OTIA 5HWVA 3E4QA 1MZUA 3VE4A 3GDIA 4F3LA 2P7JA 1T18A 2L0WA 4LRYC 4JGQA 3P7NA 1TS6A 4B9OA 1T1AA 3LI9A 2ZOIA 3NJAA 3H7WA 1DP6A 3ICYA 3K3DA 3H9WA 3C2WA 3LIFA 1BYWA 3LICA 2W0NA 3EEHA 5AVEA 4GW9A 3F1PA 3CAXA 2WKRA 2WKQA 5HSQA 2A24A 2VV8A 4DJ2A 5F68A 3MQQA 4EEUA 5KIZA 3NHQA 2R78A 3PHYA 5I5LA 5HD3A 1T19A 4NXGA 5G4YA 4BBTA 1XFQA 3E4OA 2OWHA 1GSWA 2QKPA 3RH8B 3NOUC 1EW0A 2V1BA 4HOIA 1XJ3A 4I3AA 1TS8A 4JGRA 1DP9A 5AVFA
chains in the Genus database with same CATH superfamily
5U47A 1NYMA 2FH5A 4D2OA 5L2FA 4C75A 5G18A 2I9VA 4QY6A 4CLCB 5A8BA 4GCZA 2KDKA 2XLNA 1DJCA 2HDQA 1MY8A 2Y2LA 4D60A 4QB8A 3NDEA 3C4OA 4MEZA 2Z6CA 2JKTM 3RXXA 4XT2A 3CG5A 4BJPA 3G32A 4Y0OA 1GSXA 2RL3A 2DRWA 3G2ZA 2HGVA 2MJ6A 1KGFA 3IS2B 1FCOA 1EI5A 4HP9A 4K08A 4EQ1A 1Y54A 3GECA 1N9BA 1DP8A 1OTEA 2XEPA 1OJGA 4GHIA 1VHMA 3NBLA 4ETXA 1CI9A 2V0WA 2HDUA 1WYBA 1O7EA 2AVXA 3A3JA 4ZTKA 3UB9A 1LL8A 3K2NA 1T1CA 2JKGA 4JF5A 4LPZA 2HP9A 3LR4A 3FZCA 2HJ9C 4EXOA 1UWNX 1PNEA 1E25A 2WKEA 3QNCA 2VKSA 1YLPA 4HQAA 3H7WB 3KX0X 4KZAA 1SHVA 4GDBA 5HWTA 5F69A 3FPWA 1PI4A 1TVFA 5GLDA 3PYPA 1VETA 2OOLA 3M6BA 1PZOA 2DNSA 3LEQA 5HAIA 4ARZB 3F1PB 4S2IA 1SKOA 3PBTA 3V3SA 3LYXA 4LV2A 1A0KA 1PIOA 3BM6A 4B4XA 4DN0A 1K6SA 1YLTA 4Y7PA 4EESA 1YMXA 4I3JA 3PXPA 5EV0A 1SCWA 3QP6A 3FV7A 4JPMA 1HTZA 4LRXC 4UA6A 3NOTC 4Q0HA 1Y28A 2IWCA 3EOIA 3BECA 2PD8A 1XJ4A 2VV7A 2JE5A 3KSIA 3HLWA 3R7WA 3BFGA 2RCXA 1G5UA 3G2YA 1OTAA 3Q81A 5AQAA 2Z2MB 1S1YA 2NUTC 5HZHA 3MZDA 1P97A 5TGFA 4EBNA 3GMWA 4FCFA 4N1XA 2OWJA 4QU3A 3IBRA 5CHUA 4HI4A 4PPRA 3VP4A 3ZGAB 3S7QA 1TS7A 3WRTA 5HL6A 2A49A 2ZQ8A 4Y5FA 4BBUA 3UDXA 3MR0A 4Y2FA 2PAVP 2KX6A 3V50A 1ESUA 4GB7A 4P87A 4GDNA 3PAGA 2OLUA 3IX8A 2O99A 1XX2A 2I72A 4KQRA 2INWA 4NG2A 2V1ZA 4XT2B 1GCEA 2XSSA 4N9KA 1YT4A 4N1HA 4OLGA 3T4KA 3TOIA 1BSGA 4IUKA 2ZL1A 5M18A 2Y2JA 4DDSA 5EOOA 3RXWA 2WZZA 4S2NC 3NCKA 4MBKA 5C5KA 4KQOA 1N9OA 3IXDA 1DY6A 4GHIB 3DWKA 4JLFA 1L0GA 2JKFA 3LIEA 5AQBA 3HLGA 2EA9A 5HDDA 2H10A 4UHUA 3IBJA 1SKFA 4OOMA 5GHZA 4DE1A 1IYPA 3UMDA 1K56D 4EBPA 4KZ8A 4GLQA 3UB7A 1UGUA 2ZMVA 1ESIA 3D72A 3BEBA 4X1MA 3QP4A 4BWIA 1VETB 2VV6A 2HF6A 3OPRA 4M3KA 1CJFA 2EWVA 1SKOB 3LR3A 3GRJA 2HDSA 4MN7A 4LV0A 1IKIA 3TW8A 3ZVTA 4NXBA 2EWWA 3E98A 4CPKA 1LHYA 4OPRA 3S7PA 3WS4A 2PHYA 3OLOA 4IVIA 2JKTI 4HP4A 1NJ4A 3EQVA 3WS1A 3MQ0A 4RX2A 3BFCA 4BL2A 1PW8A 4KZ3A 5DJTA 4AFIA 4R6LA 1NXYA 1Y4OA 2O9AA 4BBVA 4PM5A 5EVEA 1TS0A 5DTTA 1OTIA 5HWVA 3R7WB 4S2KA 2PBDP 4ME4A 2W3FA 3SS3A 1K54C 1FR6A 4GKUA 1XXMA 1YLYA 2P7JA 3C7UA 4K0WA 2PU2A 1TS6A 3CUEA 4P6ZS 2VGKA 2K2NA 4X55A 3MSHA 2V2FF 3QP5A 3NJAA 4Z1WA 2OLVA 5GLBA 1CEGA 3LY3A 4DXCA 3C2WA 3LIFA 4CQHA 3VP3A 1NY0A 1YLJA 3QP8A 4ETZA 2B95A 5HSQA 2Y8HA 3IH8A 2A24A 4WMCA 2M7UA 5A90A 5L10A 3OPLA 2EXBA 3EEAA 2V8FA 4KZ6A 1NYYA 4WZ5C 1JWVA 3T1RA 4FTXA 4FSFA 1CF0A 5E2HA 1FCMA 4BBTA 3G31A 1U60A 1W8QA 2ZL1B 4JXGA 4R4RA 2VGLS 1HVBA 3IX3A 3QP1A 3KYZA 4GZBA 3NOUC 5F1GA 3S1YA 3D9YA 5CGXA 1OMEA 4FOFA 3MXRA 4EWFA 3DW0A 4I3AA 3HBRA 1JWPA 4OP8A 1TS8A 5FDSA 2KOIA 1DP9A 3U4LP 5TR7A 3W4QA 4KZBA 4GS9A 4RX3A 3QNBA 1W63M 3FKWA 2JN7A 4YFMA 1H8ZA 5DVAA 5FATA 5HAQA 2XQZA 3NY4A 4CLCC 5HL1A 2H28A 4PM6A 2QHKA 4NEED 1KOUA 5HD5A 2BLSA 3ULFA 3SW1A 5EVIC 4MBHA 3UNWA 5TBMA 4KQDA 3T1SA 2X01A 2G7UA 2ZJ9A 1PW1A 1E3UD 3NOPC 3N8SA 1S67L 3WRZA 3H82A 3T50A 3B42A 1RGZA 1N9LA 2W3HA 2HV1A 1BULA 2ZBBA 4WUJA 4QWOA 1H8MA 4KUOA 4OPQA 5FQ9A 4OOLA 3UE6A 4HBUA 3KSGA 5F83A 2PYRA 1H0MA 4XXRA 1MWSA 3MJQA 2WAFA 4I5SA 4EERA 1ES5A 3A0VA 2WKHA 3CWFA 1ZC2A 4LV1A 5A93A 2ZLYA 2M7VA 3T4OA 1ES2A 2UV0E 4N9LA 2H0YA 1V9YA 1IYSA 1KDWA 4E3KA 2OV5A 3M6HA 1S4RA 3SS5A 1LLBA 2WKIA 3BW6A 2P08A 4BENA 2HJEA 4L9EA 4CLCD 2Y55A 2OSUA 2A24B 5HPIA 1F98A 2Z2LB 4QY5A 3T4TA 5JYPA 4OQHA 5EVID 2JHEA 3MKEA 1I5QA 2C6WB 1M40A 1XJ2A 3BQAA 4H6JA 5HFOA 2QJ5A 3DTKA 2PYPA 5HPFA 4ZBEA 3VOLA 3ZQ5A 3DTMA 3HREA 3A3EA 4BMWA 4JGOA 3OCNA 3SOIA 2VX8A 1LT0A 2XFTA 1J9MA 3MQOA 2PT7A 2XH9A 4DJ3A 5FL3A 1LI0A 1H5XA 2CC1A 4EQIA 1DJBA 4GS9B 5F5YA 4HH3A 2PBYA 3T4JA 4R4SA 5CRFA 1OT6A 3IWQA 3VV4A 4Y13A 3SH9A 1BLCA 5DTKA 5KSCA 3UB8A 4ZDXA 3LR5A 4QHCA 4B93A 4OH0A 1IKGA 2VLGA 3EWKA 3Q1FA 1ZG4A 2UWXA 3TSGA 1STZA 4EBLA 2HDRA 4G3WA 5CECA 5TBMB 4FD8A 1PWGA 1ZKJA 4PHTA 2QJ7A 4OQGA 4R38A 4KG6A 4S2PA 3BWLA 4HEFA 4IHQA 3IF6A 1XFNA 3C4PA 3H82B 3MF0A 3LFVA 1JNUA 4E6WA 3E0YA 1XP4A 4JXWA 4Q0IA 1OJ5A 3B33A 1KE3A 2WUQA 3P09A 4UAAA 2D01A 1C3BA 1O07A 1WA9A 5KMWA 4P85A 4EW7A 4GD8A 1FSWA 1XGIA 3ZDJA 2IA2A 1LSXA 1UWPX 3LIDA 3Q7VA 3A3FA 4OPYA 1MWRA 1LL9A 3PBSA 1IYOA 3LUQA 2B18A 1Z6FA 2ZC5B 1I2WA 3LY4A 4X53A 3PBNA 4KUKA 2L4RA 4HH2A 3MMHA 4HY8A 1GHPA 1KE4A 2A2LA 4ZRRA 2QPNA 3VP2A 3VSLA 3T12B 3UMEA 2P9VA 4ZJ2A 1MWTA 1GHMA 1LSWA 1JWZA 4L9GA 3P01A 4MBFA 1FIKA 3VOZA 4L9FA 1MKMA 4S2JA 2LB9A 5EFWA 4C3QA 1FCNA 4WELA 1VM1A 2NUPC 4MN5A 3OBFA 2XA7M 4G3VA 4H6JB 3FG8A 2FFYA 1K57C 3MKFA 1IEMA 3BFFA 1KVMA 2K7SA 2WGVA 5FASA 3CI6A 3DBAA 1MBLA 2HZ5A 4WYYA 4YOFA 1K0KA 3E4QA 2OAQ1 3D4FA 4DKIA 4H8RA 4KENB 4F3LA 2DMWA 5HARA 2W3DA 1T18A 3PBQA 4JGQA 2Q0OA 1PRQA 3JPUA 4JXVA 1KE0A 2V20A 1CK3A 1K4EA 2ZOIA 3W4PA 1DP6A 4UA7A 2EXAA 3ICYA 3NIAA 4S2NA 3OCLA 1BYWA 3ZHHA 5FAPA 4GW9A 4Q8IA 3B3XA 2Y2GA 5CEDA 2WKRA 5EM1A 4IVKA 2WKQA 2ZC6B 3GQZA 3S22A 5J8XA 3UPPA 3GTCA 2EFXA 5FSRA 2ZD8A 5EE8A 2JC7A 3NHQA 3W4OA 3PHYA 3TJZC 1T19A 3IF6B 4NXGA 3UDFA 3UPOA 5AQ9A 1XFQA 3V67A 2J9OA 2XRNA 4X56A 4R1GA 2QKPA 3M2JA 4JKTA 4U3TA 3HUMA 3PBOA 4IJGA 4II7A 4C6YA 3VSKA 5EECA 4EV4A 3T1QB 5FQIA 2EX9A 4DE2A 3Q7VB 3MFXA 3EGDC 4O7DA 3FC7A 1OTDA 5LBRA 3BLMA 4WEJA 4BD1A 4OP5A 4E3IA 4JF4A 3IF5A 3C30A 1GSVA 2W1RA 4OLDA 5J3WA 4GNUA 5IS1A 2QMIA 1G68A 1LSVA 2P9VB 4WZ4A 4UQIM 3AGFA 3VP0A 3GR2A 1FQGA 4RVAA 1L0EA 4EUZA 4KG5A 3VE3A 4MLLA 1VEUA 5TJJA 5CTNA 3E2KA 2Y2NA 1YKDA 3P98A 3UB6A 3C5AA 1S1ZA 3G6OA 3HJKA 3OPHA 4Y0TA 4Q0JA 3KO6A 4EETB 5J7EA 1GHIA 3V5MA 3NECA 2L1MA 2VZWA 1VB6A 3BY8A 1ES4A 4WLAA 4JF6A 1S4SA 3ZCZA 3LEZA 2VGLM 4F3LB 4RA7A 1LL5A 2V1AA 3UY6A 4IEDA 1K55A 1HD8A 4I38A 4FH2A 2R9XA 1QMFA 3MZEA 1RCJA 4N92A 4OOYA 3ZVWA 3MZFA 4JXSA 5F1FA 3F1OA 4I3IA 4QPRA 2XD5A 4DDYA 4Y17A 1Q2QA 2ZQDA 2GJ3A 3HVFA 4Y3IA 3N8RA 3MBZA 3O5YA 4E3NA 2P04A 2WYXA 1P9RA 5GHXA 5TFQA 4BQMA 4F94A 3JYIA 3ZYTA 2JKRM 5KSHA 4LCMA 2CMNA 3AGDA 3QP2A 2HPBA 5HAPA 1ERMA 3PAEA 2E8IA 3UN7A 1TEMA 3S7NA 2H5SA 2EX6A 5EVIA 4Z9QA 2XROA 1K25A 3T4QA 3O88A 4UEYA 1XJ6A 3C38A 3ZG0A 4OONA 4X6TA 3TG9A 5AJGA 1ZG6A 5AQ7A 3O86A 3R4KA 1KGEA 3E4PA 2ACGA 1NZOA 5HDCA 2V9AA 5EVLA 5HW3A 1BUEA 4IUHA 4PKYG 2B5RA 3K3CA 3O3VA 5DF8A 1YAXA 5K5BA 1NRFA 4OVDA 5FAOA 4LGWA 2WADA 3GVBA 4X68A 1WE4A 1YPRA 1ZHHB 4PKYA 3ITAA 2GZAA 1E4DA 4RQ9A 4LRZE 1GA9A 3DAVA 3LI8A 2ZM8A 1G6OA 5DKKA 2W27A 3BLSA 1TD5A 4RYEA 1HLUP 1D7EA 3OPPA 5CXWA 1SDNA 3LIBA 1V9ZA 4OQIA 2ZQCA 2YKHA 2XGNA 1VEUB 2H0TA 2QZ6A 1KVLA 3FKVA 4WMCD 1TDLA 3LO7A 3MXSA 1MWUA 2ZQAA 3N6IA 3EGXC 3N7WA 3ZG7B 1SZVA 2K31A 2G2UA 4NXEA 1OTBA 3SS4A 4UA9A 3KSHA 1YLZA 3HLBA 3VP1A 2JCHA 4JGPA 4PAUA 5DFYA 4KZ5A 5I94A 5KZHA 2O0YA 4WEKA 1LI9A 2Q9NA 3RFBA 4X1LA 1XGJA 3IT9A 3LCEA 3WS2A 4MNRA 3CZDA 1T1BA 4X25A 2VK3A 2ZC3B 3IXGA 3AGEA 1NWZA 1GA0A 2Y2MA 2V8CA 3NI9A 4PM7A 3IX4A 4DE3A 3UE3A 3TRCA 2WK0A 1IELA 4E6XA 2WGIA 4U0XA 4X69A 3PBRA 4GOGA 1W7FA 4S2MA 4I39A 4ESPA 3F1OB 4DF6A 1ODVA 5F6AA 2BG1A 4L0LA 5DJUA 3CJMA 5GLAA 1Z09A 2J80A 4LENA 1TF1A 3OOVA 4O8GA 3SH8A 5E2EA 5IU1A 5FAQA 4BD0A 2Y2IA 3UDIA 2QWSA 5CGSA 4YNRA 1XA1A 5FEGA 3RTYA 2KLIA 3MS6A 1L3LA 4K91A 4S2LA 4P6BA 2J9PA 4R3BA 2ZC4B 3UB5P 5HX9A 3V39A 1TDGA 2XF3A 5EVIB 3CITA 1XKZA 2V0UA 3MXQA 5CEBA 3Q7ZA 4HBTA 2OAP1 2FZ0A 2PU4A 1MZUA 2X71A 2J8YA 3SZTA 2L0WA 4KG2A 4EU0A 3IXBA 1G6AA 1XA7A 3FWLA 3ZFZA 3LI9A 3HCYA 5MC7A 2WGWA 1W5DA 2ZM0A 4MCWA 4FUWA 4PMAA 3EEHA 5AVEA 3A3IA 3C7VA 5E2FA 4IBRA 3NDGA 5E43A 3UO9A 3WS0A 1YSQA 3FYZA 3I7JA 2WZXA 3LGOA 5GHYA 1Q2PA 2ZM2A 3HL9A 2VGJA 4WM9A 3MQQA 4R0QA 5KIZA 2JKRI 2C5WB 2ZC7A 1ONHA 3IF6C 3BQ8A 3W2ZA 3RH8B 3CMZA 1EW0A 2V1BA 3IXHA 1H8YA 4HOIA 1K56A 4QJGA 3IHBA 1K6RA 4JGRA 4MMNA 2Y79A 3T1XA 1ACFA 5AVFA 3NULA 1L0DA 2WAEA 2ZOHA 1K57A 5A91A 4R3JA 2J3WA 1RGYA 5FI6A 4HHDA 2J7VA 4OKPA 3T4LA 1OT9A 2Y2OA 3HLFA 4E04A 3NC8A 5HDSA 1SDEA 1PYYA 2HP6A 4U0TA 3CHWP 4IBXA 4LFUA 4ZAMA 3ZG9B 3S4XA 3W8KA 2FFFB 5DTSA 4KQQA 2GX5A 2G2WA 3HLEA 5DKLA 5FQKA 4HNBA 2Y2HA 4S2OA 5IT5A 1MKIA 3GSGA 1K4FA 3HLCA 5IHVA 1BLSA 1ONGA 5CX7A 4GD6A 5E2GA 1RP5A 3HJIA 1W63Q 3UE0A 3Q82A 5CHMA 1ES3A 5L07A 2XA7S 3Q07A 1F2KA 3CPTA 1DJAA 1BT5A 3BRMA 5BOHA 1IYQA 2W3GA 1EWZA 1H3QA 4HJ6A 1EROA 3QHYA 5CTMA 2Z6DA 2WGWB 5M1AA 3S7OA 1F5MA 3VMAA 1PI5A 3PTEA 2IWDA 3A0SA 2A3UA 3L9KA 2Y91A 3BFDA 3G4PA 2R9WA 3HUOA 4P0MA 4OPZA 3BYDA 4R70A 1W79A 5EUAA 2Y4AA 3JVUA 1D06A 4E3OA 2Y59A 5GL9A 3ISGA 4OQ0A 3ITBA 3T4SA 2E8JA 4LV3A 1F9IA 4B4ZA 3N4IA 2IWBA 2EX8A 4NXFA 3F1NA 3DWZA 3A3DA 2WKPA 2PD7A 4WL9A 2QYBA 4P6ZM 2M1CA 3IHAA 1FR1A 5CGWA 2EFUA 5FI2A 3RJUA 5EPHA 3M2KA 1K54A 2JBFA 1J3WA 1VQQA 4KZ4A 4E3JA 3PR6A 4LLOB 1WYCA 1S6RA 5J4EA 2VJWA 1BZAA 4NK3A 5DF9A 1PWCA 2O9BA 2W3EA 3BY9A 3LR0A 2B02A 1CQAA 2W1TA 2ZMAA 2EX2A 3OC2A 1E3UA 2ZMFA 3G35A 1MC0A 3HLDA 4GN2A 5FQQA 4A5RA 1FSYA 3UPNA 5CERA 4LCLA 3DTIA 4WZ5A 5DF7A 4DXBA 4ZJ1A 4ZJ3A 3IWOA 1OPXA 4R3AA 1MXOA 2LB5A 3CUEC 4NKPA 1ERQA 1YQSA 3D3OA 4CJNA 5GLCA 1S0WA 5DFXA 4WF0A 4XUXA 4UQIS 1MPLA 1P0ZA 3LIAA 3TE8A 1JTDA 3KYQA 4BLMA 3UE1A 1ZTUA 3GV9A 4K0XA 1AWIA 4EEPA 3C8CA 1ALQA 2D02A 3SH7A 2DCFA 1DRMA 1X0OA 3MFDA 1M6KA 4MN6A 4O01A 4M4XA 2VEAA 4CLCE 4BL3A 3CPTB 2J3TC 3A0RA 3CLOA 4HJ4A 1K55C 1D1JA 5L8MA 2XFSA 1PWDA 3VFHA 5G4ZA 3U2AA 4HJ3A 4CLCA 2VA0A 2YKFA 4WN5A 4JBFA 4YINA 1AXBA 1NLYA 1L2SA 1JVJA 4YWZA 3V3RA 5FA7A 3WS5A 2O9CA 2P74A 1NLZA 4PM8A 3FPVA 5FEFA 1N9NA 2XD1A 3IH9A 4HESA 2Y2QA 2GNXA 4QD4A 3DTEA 4WBGA 3EQUA 5FQMA 3KYEA 2PR5A 3IS2A 4HIAA 2PDRA 1KDSA 2PR6A 3G30A 3F1NB 3VOYA 1YLWA 3JVVA 5HWWA 1CEFA 4KZ7A 4FH4A 1S66L 3N8LA 1G28A 2BASA 5CHJA 3BFEA 2X02A 4Y0UA 5EM0A 1P9WA 2PRFA 3VE4A 3GDIA 4XUZA 1W8YA 4E3LA 2HP5A 4G3KA 3BJNA 4LRYC 3P7NA 4DMZA 1XPBA 1I2SA 5EOEA 4KZ9A 5L09A 4B9OA 1T1AA 2XR0A 1IFQA 3VFFA 5D3OA 3H7WA 1PFLA 3ZG8B 1L0FA 3K3DA 1YSPA 3H9WA 3WWXA 1QMEA 4DRTA 3O87A 2J3TD 3L7HA 3IQAA 3LICA 2W0NA 1NRJA 5JYOA 4ARZA 2W1TB 3HUNA 3F1PA 4O0PA 4R23A 3CAXA 4ID4A 2Q9MA 4EUVA 1KGGA 4DE0A 4B88A 2VV8A 4DJ2A 5FI7A 5F68A 4EEUA 1CI8A 4MDZA 1BTLA 1FILA 2R78A 2ZQ7A 5I5LA 1BLPA 2Y2PA 3ZNTA 5HD3A 4NETA 1JTGA 1HZOA 5G4YA 4GJ4A 3KSFA 3E4OA 3G34A 5M19A 5A92A 2OWHA 3ZNYA 5F82A 2Y2KA 1GSWA 1PZPA 3IWIA 2XDMA 5FDHA 2GDNA 2BTFP 3B47A 1XJ3A 3E2LA 1FOFA 4PM9A 5FQJA 1YMSA 3OZHA 1IOUA 1N4OA 4E3MA 4Y15A 3ZG5A 1NZUA 1YM1A 1BLHA 2ZQ9A 1K38A 2XK1A
chains in the Genus database with same CATH topology
4GS9A 2ZOHA 3EGDC 3MFXA 1W63M 2FH5A 3FC7A 1OTDA 2JN7A 2J3WA 5LBRA 2I9VA 4CLCB 4WEJA 4HHDA 5A8BA 4CLCC 4GCZA 2KDKA 2H28A 3T4LA 1OT9A 3C30A 1GSVA 2W1RA 2QHKA 4NEED 4E04A 5HDSA 1KOUA 5J3WA 5HD5A 5IS1A 3ULFA 3SW1A 1LSVA 5TBMA 4UQIM 4KQDA 2Z6CA 2JKTM 2G7UA 2GX5A 4XT2A 4BJPA 5DKLA 3VE3A 1GSXA 3NOPC 5TJJA 1S67L 3H82A 4HNBA 2HGVA 3T50A 2MJ6A 3B42A 1YKDA 5IT5A 3IS2B 3UB6A 1S1ZA 3G6OA 3HJKA 1N9LA 2W3HA 2HV1A 4HP9A 4Q0JA 4K08A 3KO6A 4EQ1A 3GECA 1DP8A 2ZBBA 1OTEA 1OJGA 4EETB 5J7EA 4WUJA 4GHIA 5CX7A 2L1MA 1VHMA 2VZWA 1H8MA 4ETXA 2V0WA 1VB6A 3BY8A 3HJIA 1W63Q 4WLAA 4KUOA 3UB9A 1S4SA 1LL8A 2VGLM 3K2NA 4OOLA 4F3LB 2XA7S 1T1CA 3UE6A 4LPZA 3KSGA 2PYRA 2V1AA 3LR4A 2HJ9C 3MJQA 4EXOA 4I5SA 4EERA 1UWNX 3A0VA 4I38A 2W3GA 2VKSA 1H3QA 4HQAA 4HJ6A 2Z6DA 3H7WB 3CWFA 3S7OA 3KX0X 1F5MA 5HWTA 2M7VA 3T4OA 5F69A 3FPWA 3A0SA 3F1OA 1V9YA 4I3IA 3PYPA 2OOLA 4QPRA 4ARZB 1S4RA 3F1PB 3BW6A 2P08A 2GJ3A 3PBTA 4Y3IA 2HJEA 4L9EA 3LYXA 4CLCD 3O5YA 4R70A 2P04A 4DN0A 1P9RA 2A24B 3JVUA 1D06A 5HPIA 3ZYTA 1F98A 2JKRM 4EESA 3T4TA 5KSHA 3T4SA 4I3JA 2CMNA 3PXPA 2JHEA 1F9IA 1XJ2A 4NXFA 3BQAA 3F1NA 4H6JA 2WKPA 2PD7A 3S7NA 4LRXC 4WL9A 2QJ5A 2PYPA 3NOTC 4Q0HA 5HPFA 2QYBA 1Y28A 2M1CA 4P6ZM 3VOLA 3ZQ5A 3EOIA 2PD8A 1XJ4A 2VV7A 2XROA 3T4QA 4BMWA 3KSIA 4JGOA 4UEYA 3OCNA 3R7WA 1XJ6A 2VX8A 3C38A 1LT0A 1OTAA 3MQOA 2PT7A 5AJGA 4DJ3A 1S1YA 2NUTC 5HZHA 5FL3A 3R4KA 3PR6A 1P97A 3E4PA 4LLOB 5HDCA 2V9AA 5J4EA 4IUHA 2VJWA 2OWJA 4PKYG 4GS9B 5F5YA 4HH3A 3T4JA 3IBRA 3K3CA 4HI4A 5DF9A 1OT6A 2O9BA 3VV4A 3S7QA 1TS7A 1YAXA 5K5BA 2W3EA 3BY9A 3LR0A 2B02A 5HL6A 3UB8A 4Y5FA 4BBUA 3LR5A 4B93A 2W1TA 3MR0A 4Y2FA 3OC2A 1ZHHB 2KX6A 2VLGA 3EWKA 4PKYA 2GZAA 1STZA 2ZMFA 4RQ9A 4LRZE 4G3WA 1MC0A 3LI8A 5TBMB 1G6OA 5DKKA 2O99A 2W27A 1TD5A 1D7EA 3LIBA 1V9ZA 2INWA 4XT2B 4PHTA 2QJ7A 2YKHA 2XSSA 4R38A 3BWLA 4IHQA 1OPXA 4R3AA 3T4KA 2LB5A 3CUEC 4NKPA 1XFNA 3H82B 3MF0A 3D3OA 3LFVA 5DFXA 4IUKA 1JNUA 4WF0A 3E0YA 4UQIS 3EGXC 2K31A 1P0ZA 4NXEA 3LIAA 3TE8A 4Q0IA 1OTBA 1OJ5A 3B33A 3KYQA 5C5KA 3KSHA 4KQOA 1N9OA 4GHIB 1ZTUA 2D01A 1WA9A 4JGPA 4PAUA 5DFYA 4EEPA 3C8CA 4EW7A 2D02A 2O0YA 3LIEA 4WEKA 1DRMA 2EA9A 5HDDA 1X0OA 3RFBA 4MN6A 4O01A 4M4XA 2VEAA 4CLCE 3IBJA 2IA2A 4OOMA 1LSXA 2J3TC 3A0RA 3CLOA 1T1BA 1UWPX 4HJ4A 3LIDA 1NWZA 5L8MA 3UMDA 3PBSA 3UE3A 3LUQA 2B18A 5G4ZA 3TRCA 3U2AA 4GLQA 4HJ3A 3UB7A 3PBRA 4CLCA 1UGUA 2VA0A 2ZMVA 2YKFA 4WN5A 3D72A 3PBNA 4KUKA 1NLYA 2L4RA 4I39A 4HH2A 3F1OB 3MMHA 4HY8A 1ODVA 4BWIA 4YWZA 2VV6A 5F6AA 2A2LA 2HF6A 2O9CA 4L0LA 5DJUA 4ZRRA 2J80A 3UMEA 1NLZA 2EWVA 1TF1A 3OOVA 3FPVA 3LR3A 1LSWA 4MN7A 4L9GA 4O8GA 3TW8A 4NXBA 2EWWA 3E98A 1N9NA 5IU1A 3S7PA 3P01A 2PHYA 3OLOA 4L9FA 1MKMA 2LB9A 2QWSA 5EFWA 4YNRA 2JKTI 4HP4A 2GNXA 4WELA 3EQVA 3EQUA 3MQ0A 3RTYA 2KLIA 2PR5A 3IS2A 4HIAA 2NUPC 4MN5A 3OBFA 2PDRA 2XA7M 2PR6A 5DJTA 3F1NB 4G3VA 4AFIA 4H6JB 3FG8A 3JVVA 4R6LA 5HWWA 1S66L 1G28A 2O9AA 2BASA 3CITA 2K7SA 3CI6A 4BBVA 3DBAA 1TS0A 2V0UA 3MXQA 1OTIA 4YOFA 5HWVA 1P9WA 3R7WB 4ME4A 2W3FA 2OAP1 3E4QA 2FZ0A 2OAQ1 1MZUA 3VE4A 3GDIA 4F3LA 2DMWA 2P7JA 2W3DA 1T18A 2L0WA 3PBQA 4G3KA 3BJNA 4LRYC 4EU0A 4JGQA 3P7NA 1TS6A 3CUEA 4DMZA 4P6ZS 4B9OA 1T1AA 2K2NA 1IFQA 3LI9A 3HCYA 2ZOIA 3NJAA 3H7WA 1DP6A 5MC7A 4Z1WA 3ICYA 3K3DA 1YSPA 3H9WA 2J3TD 3C2WA 3LIFA 3OCLA 4MCWA 4CQHA 1BYWA 3LICA 2W0NA 1NRJA 3EEHA 4ARZA 5AVEA 2W1TB 4GW9A 3F1PA 4O0PA 4ETZA 3CAXA 2WKRA 2WKQA 5HSQA 2Y8HA 2A24A 2M7UA 4EUVA 1YSQA 2VV8A 4DJ2A 3EEAA 5F68A 3MQQA 4EEUA 4MDZA 5KIZA 3NHQA 2R78A 3PHYA 2JKRI 5I5LA 4FSFA 3TJZC 5HD3A 1T19A 4NXGA 5G4YA 4GJ4A 3KSFA 4BBTA 1XFQA 3E4OA 3V67A 3BQ8A 2OWHA 2XRNA 3W2ZA 2VGLS 1GSWA 3KYZA 2QKPA 3RH8B 3NOUC 1EW0A 2V1BA 3B47A 4HOIA 3PBOA 4IJGA 4II7A 1XJ3A 4FOFA 4I3AA 1TS8A 4JGRA 1IOUA 2KOIA 4MMNA 2Y79A 1DP9A 5AVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GS9 A;  2ZOH A;  3MFX A;  3FC7 A;  1OTD A;  2JN7 A;  2I9V A;  4HHD A;  5A8B A;  4GCZ A;  2KDK A;  2H28 A;  1OT9 A;  1GSV A;  2QHK A;  4E04 A;  5HDS A;  1KOU A;  5J3W A;  5HD5 A;  5IS1 A;  3ULF A;  3SW1 A;  1LSV A;  5TBM A;  4KQD A;  2Z6C A;  4XT2 A;  5DKL A;  3VE3 A;  1GSX A;  3NOP C;  1S67 L;  3H82 A;  4HNB A;  3T50 A;  3IS2 B;  3UB6 A;  1S1Z A;  3G6O A;  3HJK A;  1N9L A;  2HV1 A;  4HP9 A;  4K08 A;  4EQ1 A;  3GEC A;  1DP8 A;  2ZBB A;  1OTE A;  1OJG A;  4EET B;  5J7E A;  4WUJ A;  4GHI A;  2L1M A;  2V0W A;  1VB6 A;  3BY8 A;  3HJI A;  4WLA A;  4KUO A;  3UB9 A;  1S4S A;  1LL8 A;  4F3L B;  1T1C A;  3UE6 A;  4LPZ A;  2PYR A;  2V1A A;  3MJQ A;  4EXO A;  4I5S A;  4EER A;  1UWN X;  3A0V A;  4I38 A;  4HQA A;  4HJ6 A;  2Z6D A;  3H7W B;  3CWF A;  3KX0 X;  5HWT A;  5F69 A;  3A0S A;  3F1O A;  1V9Y A;  4I3I A;  3PYP A;  2OOL A;  1S4R A;  3F1P B;  2GJ3 A;  4L9E A;  3LYX A;  4R70 A;  2A24 B;  1D06 A;  1F98 A;  4EES A;  4I3J A;  2CMN A;  2JHE A;  1F9I A;  4NXF A;  1XJ2 A;  3F1N A;  4H6J A;  2WKP A;  2PD7 A;  4LRX C;  4WL9 A;  2QJ5 A;  2PYP A;  3NOT C;  1Y28 A;  2M1C A;  3VOL A;  3ZQ5 A;  2PD8 A;  1XJ4 A;  2VV7 A;  4JGO A;  1XJ6 A;  1LT0 A;  1OTA A;  3MQO A;  4DJ3 A;  1S1Y A;  5HZH A;  1P97 A;  3E4P A;  4LLO B;  5HDC A;  2V9A A;  5J4E A;  2OWJ A;  4PKY G;  4GS9 B;  5F5Y A;  4HH3 A;  3IBR A;  3K3C A;  4HI4 A;  1OT6 A;  1TS7 A;  3BY9 A;  2B02 A;  3UB8 A;  4BBU A;  3MR0 A;  2KX6 A;  2VLG A;  3EWK A;  4PKY A;  4RQ9 A;  4LRZ E;  3LI8 A;  5TBM B;  5DKK A;  2W27 A;  1D7E A;  3LIB A;  1V9Z A;  2INW A;  4XT2 B;  2QJ7 A;  2YKH A;  4R38 A;  3BWL A;  4R3A A;  1XFN A;  3H82 B;  4WF0 A;  1JNU A;  1P0Z A;  4NXE A;  3LIA A;  1OTB A;  1OJ5 A;  3B33 A;  1N9O A;  4GHI B;  2D01 A;  1WA9 A;  4JGP A;  4EEP A;  3C8C A;  4EW7 A;  2D02 A;  3LIE A;  1DRM A;  2EA9 A;  5HDD A;  1X0O A;  4MN6 A;  4M4X A;  2VEA A;  1LSX A;  3A0R A;  3CLO A;  1T1B A;  1UWP X;  4HJ4 A;  3LID A;  1NWZ A;  3UMD A;  3LUQ A;  5G4Z A;  4HJ3 A;  3UB7 A;  1UGU A;  2YKF A;  4WN5 A;  3D72 A;  4KUK A;  2L4R A;  4I39 A;  4HH2 A;  3F1O B;  4HY8 A;  1ODV A;  4YWZ A;  2VV6 A;  5F6A A;  5DJU A;  2J80 A;  3UME A;  1LSW A;  4L9G A;  4NXB A;  1N9N A;  5IU1 A;  2PHY A;  3OLO A;  4L9F A;  2QWS A;  5EFW A;  4HP4 A;  3RTY A;  2PR5 A;  3IS2 A;  4HIA A;  4MN5 A;  2PDR A;  2PR6 A;  5DJT A;  3F1N B;  4H6J B;  3FG8 A;  4R6L A;  5HWW A;  1S66 L;  1G28 A;  2BAS A;  2K7S A;  4BBV A;  1TS0 A;  2V0U A;  3MXQ A;  1OTI A;  5HWV A;  3E4Q A;  1MZU A;  3VE4 A;  3GDI A;  4F3L A;  2P7J A;  1T18 A;  2L0W A;  4LRY C;  4JGQ A;  3P7N A;  1TS6 A;  4B9O A;  1T1A A;  3LI9 A;  2ZOI A;  3NJA A;  3H7W A;  1DP6 A;  3ICY A;  3K3D A;  3H9W A;  3C2W A;  3LIF A;  1BYW A;  3LIC A;  2W0N A;  3EEH A;  5AVE A;  4GW9 A;  3F1P A;  3CAX A;  2WKR A;  2WKQ A;  5HSQ A;  2A24 A;  2VV8 A;  4DJ2 A;  5F68 A;  3MQQ A;  4EEU A;  5KIZ A;  3NHQ A;  2R78 A;  3PHY A;  5I5L A;  5HD3 A;  1T19 A;  4NXG A;  5G4Y A;  4BBT A;  1XFQ A;  3E4O A;  2OWH A;  1GSW A;  2QKP A;  3RH8 B;  3NOU C;  1EW0 A;  2V1B A;  4HOI A;  1XJ3 A;  4I3A A;  1TS8 A;  4JGR A;  1DP9 A;  5AVF A; 
#chains in the Genus database with same CATH topology
 5U47 A;  1NYM A;  2FH5 A;  4D2O A;  5L2F A;  4C75 A;  5G18 A;  2I9V A;  4QY6 A;  4CLC B;  5A8B A;  4GCZ A;  2KDK A;  2XLN A;  1DJC A;  2HDQ A;  1MY8 A;  2Y2L A;  4D60 A;  4QB8 A;  3NDE A;  3C4O A;  4MEZ A;  2Z6C A;  2JKT M;  3RXX A;  4XT2 A;  3CG5 A;  4BJP A;  3G32 A;  4Y0O A;  1GSX A;  2RL3 A;  2DRW A;  3G2Z A;  2HGV A;  2MJ6 A;  1KGF A;  3IS2 B;  1FCO A;  1EI5 A;  4HP9 A;  4K08 A;  4EQ1 A;  1Y54 A;  3GEC A;  1N9B A;  1DP8 A;  1OTE A;  2XEP A;  1OJG A;  4GHI A;  1VHM A;  3NBL A;  4ETX A;  1CI9 A;  2V0W A;  2HDU A;  1WYB A;  1O7E A;  2AVX A;  3A3J A;  4ZTK A;  3UB9 A;  1LL8 A;  3K2N A;  1T1C A;  2JKG A;  4JF5 A;  4LPZ A;  2HP9 A;  3LR4 A;  3FZC A;  2HJ9 C;  4EXO A;  1UWN X;  1PNE A;  1E25 A;  2WKE A;  3QNC A;  2VKS A;  1YLP A;  4HQA A;  3H7W B;  3KX0 X;  4KZA A;  1SHV A;  4GDB A;  5HWT A;  5F69 A;  3FPW A;  1PI4 A;  1TVF A;  5GLD A;  3PYP A;  1VET A;  2OOL A;  3M6B A;  1PZO A;  2DNS A;  3LEQ A;  5HAI A;  4ARZ B;  3F1P B;  4S2I A;  1SKO A;  3PBT A;  3V3S A;  3LYX A;  4LV2 A;  1A0K A;  1PIO A;  3BM6 A;  4B4X A;  4DN0 A;  1K6S A;  1YLT A;  4Y7P A;  4EES A;  1YMX A;  4I3J A;  3PXP A;  5EV0 A;  1SCW A;  3QP6 A;  3FV7 A;  4JPM A;  1HTZ A;  4LRX C;  4UA6 A;  3NOT C;  4Q0H A;  1Y28 A;  2IWC A;  3EOI A;  3BEC A;  2PD8 A;  1XJ4 A;  2VV7 A;  2JE5 A;  3KSI A;  3HLW A;  3R7W A;  3BFG A;  2RCX A;  1G5U A;  3G2Y A;  1OTA A;  3Q81 A;  5AQA A;  2Z2M B;  1S1Y A;  2NUT C;  5HZH A;  3MZD A;  1P97 A;  5TGF A;  4EBN A;  3GMW A;  4FCF A;  4N1X A;  2OWJ A;  4QU3 A;  3IBR A;  5CHU A;  4HI4 A;  4PPR A;  3VP4 A;  3ZGA B;  3S7Q A;  1TS7 A;  3WRT A;  5HL6 A;  2A49 A;  2ZQ8 A;  4Y5F A;  4BBU A;  3UDX A;  3MR0 A;  4Y2F A;  2PAV P;  2KX6 A;  3V50 A;  1ESU A;  4GB7 A;  4P87 A;  4GDN A;  3PAG A;  2OLU A;  3IX8 A;  2O99 A;  1XX2 A;  2I72 A;  4KQR A;  2INW A;  4NG2 A;  2V1Z A;  4XT2 B;  1GCE A;  2XSS A;  4N9K A;  1YT4 A;  4N1H A;  4OLG A;  3T4K A;  3TOI A;  1BSG A;  4IUK A;  2ZL1 A;  5M18 A;  2Y2J A;  4DDS A;  5EOO A;  3RXW A;  2WZZ A;  4S2N C;  3NCK A;  4MBK A;  5C5K A;  4KQO A;  1N9O A;  3IXD A;  1DY6 A;  4GHI B;  3DWK A;  4JLF A;  1L0G A;  2JKF A;  3LIE A;  5AQB A;  3HLG A;  2EA9 A;  5HDD A;  2H10 A;  4UHU A;  3IBJ A;  1SKF A;  4OOM A;  5GHZ A;  4DE1 A;  1IYP A;  3UMD A;  1K56 D;  4EBP A;  4KZ8 A;  4GLQ A;  3UB7 A;  1UGU A;  2ZMV A;  1ESI A;  3D72 A;  3BEB A;  4X1M A;  3QP4 A;  4BWI A;  1VET B;  2VV6 A;  2HF6 A;  3OPR A;  4M3K A;  1CJF A;  2EWV A;  1SKO B;  3LR3 A;  3GRJ A;  2HDS A;  4MN7 A;  4LV0 A;  1IKI A;  3TW8 A;  3ZVT A;  4NXB A;  2EWW A;  3E98 A;  4CPK A;  1LHY A;  4OPR A;  3S7P A;  3WS4 A;  2PHY A;  3OLO A;  4IVI A;  2JKT I;  4HP4 A;  1NJ4 A;  3EQV A;  3WS1 A;  3MQ0 A;  4RX2 A;  3BFC A;  4BL2 A;  1PW8 A;  4KZ3 A;  5DJT A;  4AFI A;  4R6L A;  1NXY A;  1Y4O A;  2O9A A;  4BBV A;  4PM5 A;  5EVE A;  1TS0 A;  5DTT A;  1OTI A;  5HWV A;  3R7W B;  4S2K A;  2PBD P;  4ME4 A;  2W3F A;  3SS3 A;  1K54 C;  1FR6 A;  4GKU A;  1XXM A;  1YLY A;  2P7J A;  3C7U A;  4K0W A;  2PU2 A;  1TS6 A;  3CUE A;  4P6Z S;  2VGK A;  2K2N A;  4X55 A;  3MSH A;  2V2F F;  3QP5 A;  3NJA A;  4Z1W A;  2OLV A;  5GLB A;  1CEG A;  3LY3 A;  4DXC A;  3C2W A;  3LIF A;  4CQH A;  3VP3 A;  1NY0 A;  1YLJ A;  3QP8 A;  4ETZ A;  2B95 A;  5HSQ A;  2Y8H A;  3IH8 A;  2A24 A;  4WMC A;  2M7U A;  5A90 A;  5L10 A;  3OPL A;  2EXB A;  3EEA A;  2V8F A;  4KZ6 A;  1NYY A;  4WZ5 C;  1JWV A;  3T1R A;  4FTX A;  4FSF A;  1CF0 A;  5E2H A;  1FCM A;  4BBT A;  3G31 A;  1U60 A;  1W8Q A;  2ZL1 B;  4JXG A;  4R4R A;  2VGL S;  1HVB A;  3IX3 A;  3QP1 A;  3KYZ A;  4GZB A;  3NOU C;  5F1G A;  3S1Y A;  3D9Y A;  5CGX A;  1OME A;  4FOF A;  3MXR A;  4EWF A;  3DW0 A;  4I3A A;  3HBR A;  1JWP A;  4OP8 A;  1TS8 A;  5FDS A;  2KOI A;  1DP9 A;  3U4L P;  5TR7 A;  3W4Q A;  4KZB A;  4GS9 A;  4RX3 A;  3QNB A;  1W63 M;  3FKW A;  2JN7 A;  4YFM A;  1H8Z A;  5DVA A;  5FAT A;  5HAQ A;  2XQZ A;  3NY4 A;  4CLC C;  5HL1 A;  2H28 A;  4PM6 A;  2QHK A;  4NEE D;  1KOU A;  5HD5 A;  2BLS A;  3ULF A;  3SW1 A;  5EVI C;  4MBH A;  3UNW A;  5TBM A;  4KQD A;  3T1S A;  2X01 A;  2G7U A;  2ZJ9 A;  1PW1 A;  1E3U D;  3NOP C;  3N8S A;  1S67 L;  3WRZ A;  3H82 A;  3T50 A;  3B42 A;  1RGZ A;  1N9L A;  2W3H A;  2HV1 A;  1BUL A;  2ZBB A;  4WUJ A;  4QWO A;  1H8M A;  4KUO A;  4OPQ A;  5FQ9 A;  4OOL A;  3UE6 A;  4HBU A;  3KSG A;  5F83 A;  2PYR A;  1H0M A;  4XXR A;  1MWS A;  3MJQ A;  2WAF A;  4I5S A;  4EER A;  1ES5 A;  3A0V A;  2WKH A;  3CWF A;  1ZC2 A;  4LV1 A;  5A93 A;  2ZLY A;  2M7V A;  3T4O A;  1ES2 A;  2UV0 E;  4N9L A;  2H0Y A;  1V9Y A;  1IYS A;  1KDW A;  4E3K A;  2OV5 A;  3M6H A;  1S4R A;  3SS5 A;  1LLB A;  2WKI A;  3BW6 A;  2P08 A;  4BEN A;  2HJE A;  4L9E A;  4CLC D;  2Y55 A;  2OSU A;  2A24 B;  5HPI A;  1F98 A;  2Z2L B;  4QY5 A;  3T4T A;  5JYP A;  4OQH A;  5EVI D;  2JHE A;  3MKE A;  1I5Q A;  2C6W B;  1M40 A;  1XJ2 A;  3BQA A;  4H6J A;  5HFO A;  2QJ5 A;  3DTK A;  2PYP A;  5HPF A;  4ZBE A;  3VOL A;  3ZQ5 A;  3DTM A;  3HRE A;  3A3E A;  4BMW A;  4JGO A;  3OCN A;  3SOI A;  2VX8 A;  1LT0 A;  2XFT A;  1J9M A;  3MQO A;  2PT7 A;  2XH9 A;  4DJ3 A;  5FL3 A;  1LI0 A;  1H5X A;  2CC1 A;  4EQI A;  1DJB A;  4GS9 B;  5F5Y A;  4HH3 A;  2PBY A;  3T4J A;  4R4S A;  5CRF A;  1OT6 A;  3IWQ A;  3VV4 A;  4Y13 A;  3SH9 A;  1BLC A;  5DTK A;  5KSC A;  3UB8 A;  4ZDX A;  3LR5 A;  4QHC A;  4B93 A;  4OH0 A;  1IKG A;  2VLG A;  3EWK A;  3Q1F A;  1ZG4 A;  2UWX A;  3TSG A;  1STZ A;  4EBL A;  2HDR A;  4G3W A;  5CEC A;  5TBM B;  4FD8 A;  1PWG A;  1ZKJ A;  4PHT A;  2QJ7 A;  4OQG A;  4R38 A;  4KG6 A;  4S2P A;  3BWL A;  4HEF A;  4IHQ A;  3IF6 A;  1XFN A;  3C4P A;  3H82 B;  3MF0 A;  3LFV A;  1JNU A;  4E6W A;  3E0Y A;  1XP4 A;  4JXW A;  4Q0I A;  1OJ5 A;  3B33 A;  1KE3 A;  2WUQ A;  3P09 A;  4UAA A;  2D01 A;  1C3B A;  1O07 A;  1WA9 A;  5KMW A;  4P85 A;  4EW7 A;  4GD8 A;  1FSW A;  1XGI A;  3ZDJ A;  2IA2 A;  1LSX A;  1UWP X;  3LID A;  3Q7V A;  3A3F A;  4OPY A;  1MWR A;  1LL9 A;  3PBS A;  1IYO A;  3LUQ A;  2B18 A;  1Z6F A;  2ZC5 B;  1I2W A;  3LY4 A;  4X53 A;  3PBN A;  4KUK A;  2L4R A;  4HH2 A;  3MMH A;  4HY8 A;  1GHP A;  1KE4 A;  2A2L A;  4ZRR A;  2QPN A;  3VP2 A;  3VSL A;  3T12 B;  3UME A;  2P9V A;  4ZJ2 A;  1MWT A;  1GHM A;  1LSW A;  1JWZ A;  4L9G A;  3P01 A;  4MBF A;  1FIK A;  3VOZ A;  4L9F A;  1MKM A;  4S2J A;  2LB9 A;  5EFW A;  4C3Q A;  1FCN A;  4WEL A;  1VM1 A;  2NUP C;  4MN5 A;  3OBF A;  2XA7 M;  4G3V A;  4H6J B;  3FG8 A;  2FFY A;  1K57 C;  3MKF A;  1IEM A;  3BFF A;  1KVM A;  2K7S A;  2WGV A;  5FAS A;  3CI6 A;  3DBA A;  1MBL A;  2HZ5 A;  4WYY A;  4YOF A;  1K0K A;  3E4Q A;  2OAQ 1;  3D4F A;  4DKI A;  4H8R A;  4KEN B;  4F3L A;  2DMW A;  5HAR A;  2W3D A;  1T18 A;  3PBQ A;  4JGQ A;  2Q0O A;  1PRQ A;  3JPU A;  4JXV A;  1KE0 A;  2V20 A;  1CK3 A;  1K4E A;  2ZOI A;  3W4P A;  1DP6 A;  4UA7 A;  2EXA A;  3ICY A;  3NIA A;  4S2N A;  3OCL A;  1BYW A;  3ZHH A;  5FAP A;  4GW9 A;  4Q8I A;  3B3X A;  2Y2G A;  5CED A;  2WKR A;  5EM1 A;  4IVK A;  2WKQ A;  2ZC6 B;  3GQZ A;  3S22 A;  5J8X A;  3UPP A;  3GTC A;  2EFX A;  5FSR A;  2ZD8 A;  5EE8 A;  2JC7 A;  3NHQ A;  3W4O A;  3PHY A;  3TJZ C;  1T19 A;  3IF6 B;  4NXG A;  3UDF A;  3UPO A;  5AQ9 A;  1XFQ A;  3V67 A;  2J9O A;  2XRN A;  4X56 A;  4R1G A;  2QKP A;  3M2J A;  4JKT A;  4U3T A;  3HUM A;  3PBO A;  4IJG A;  4II7 A;  4C6Y A;  3VSK A;  5EEC A;  4EV4 A;  3T1Q B;  5FQI A;  2EX9 A;  4DE2 A;  3Q7V B;  3MFX A;  3EGD C;  4O7D A;  3FC7 A;  1OTD A;  5LBR A;  3BLM A;  4WEJ A;  4BD1 A;  4OP5 A;  4E3I A;  4JF4 A;  3IF5 A;  3C30 A;  1GSV A;  2W1R A;  4OLD A;  5J3W A;  4GNU A;  5IS1 A;  2QMI A;  1G68 A;  1LSV A;  2P9V B;  4WZ4 A;  4UQI M;  3AGF A;  3VP0 A;  3GR2 A;  1FQG A;  4RVA A;  1L0E A;  4EUZ A;  4KG5 A;  3VE3 A;  4MLL A;  1VEU A;  5TJJ A;  5CTN A;  3E2K A;  2Y2N A;  1YKD A;  3P98 A;  3UB6 A;  3C5A A;  1S1Z A;  3G6O A;  3HJK A;  3OPH A;  4Y0T A;  4Q0J A;  3KO6 A;  4EET B;  5J7E A;  1GHI A;  3V5M A;  3NEC A;  2L1M A;  2VZW A;  1VB6 A;  3BY8 A;  1ES4 A;  4WLA A;  4JF6 A;  1S4S A;  3ZCZ A;  3LEZ A;  2VGL M;  4F3L B;  4RA7 A;  1LL5 A;  2V1A A;  3UY6 A;  4IED A;  1K55 A;  1HD8 A;  4I38 A;  4FH2 A;  2R9X A;  1QMF A;  3MZE A;  1RCJ A;  4N92 A;  4OOY A;  3ZVW A;  3MZF A;  4JXS A;  5F1F A;  3F1O A;  4I3I A;  4QPR A;  2XD5 A;  4DDY A;  4Y17 A;  1Q2Q A;  2ZQD A;  2GJ3 A;  3HVF A;  4Y3I A;  3N8R A;  3MBZ A;  3O5Y A;  4E3N A;  2P04 A;  2WYX A;  1P9R A;  5GHX A;  5TFQ A;  4BQM A;  4F94 A;  3JYI A;  3ZYT A;  2JKR M;  5KSH A;  4LCM A;  2CMN A;  3AGD A;  3QP2 A;  2HPB A;  5HAP A;  1ERM A;  3PAE A;  2E8I A;  3UN7 A;  1TEM A;  3S7N A;  2H5S A;  2EX6 A;  5EVI A;  4Z9Q A;  2XRO A;  1K25 A;  3T4Q A;  3O88 A;  4UEY A;  1XJ6 A;  3C38 A;  3ZG0 A;  4OON A;  4X6T A;  3TG9 A;  5AJG A;  1ZG6 A;  5AQ7 A;  3O86 A;  3R4K A;  1KGE A;  3E4P A;  2ACG A;  1NZO A;  5HDC A;  2V9A A;  5EVL A;  5HW3 A;  1BUE A;  4IUH A;  4PKY G;  2B5R A;  3K3C A;  3O3V A;  5DF8 A;  1YAX A;  5K5B A;  1NRF A;  4OVD A;  5FAO A;  4LGW A;  2WAD A;  3GVB A;  4X68 A;  1WE4 A;  1YPR A;  1ZHH B;  4PKY A;  3ITA A;  2GZA A;  1E4D A;  4RQ9 A;  4LRZ E;  1GA9 A;  3DAV A;  3LI8 A;  2ZM8 A;  1G6O A;  5DKK A;  2W27 A;  3BLS A;  1TD5 A;  4RYE A;  1HLU P;  1D7E A;  3OPP A;  5CXW A;  1SDN A;  3LIB A;  1V9Z A;  4OQI A;  2ZQC A;  2YKH A;  2XGN A;  1VEU B;  2H0T A;  2QZ6 A;  1KVL A;  3FKV A;  4WMC D;  1TDL A;  3LO7 A;  3MXS A;  1MWU A;  2ZQA A;  3N6I A;  3EGX C;  3N7W A;  3ZG7 B;  1SZV A;  2K31 A;  2G2U A;  4NXE A;  1OTB A;  3SS4 A;  4UA9 A;  3KSH A;  1YLZ A;  3HLB A;  3VP1 A;  2JCH A;  4JGP A;  4PAU A;  5DFY A;  4KZ5 A;  5I94 A;  5KZH A;  2O0Y A;  4WEK A;  1LI9 A;  2Q9N A;  3RFB A;  4X1L A;  1XGJ A;  3IT9 A;  3LCE A;  3WS2 A;  4MNR A;  3CZD A;  1T1B A;  4X25 A;  2VK3 A;  2ZC3 B;  3IXG A;  3AGE A;  1NWZ A;  1GA0 A;  2Y2M A;  2V8C A;  3NI9 A;  4PM7 A;  3IX4 A;  4DE3 A;  3UE3 A;  3TRC A;  2WK0 A;  1IEL A;  4E6X A;  2WGI A;  4U0X A;  4X69 A;  3PBR A;  4GOG A;  1W7F A;  4S2M A;  4I39 A;  4ESP A;  3F1O B;  4DF6 A;  1ODV A;  5F6A A;  2BG1 A;  4L0L A;  5DJU A;  3CJM A;  5GLA A;  1Z09 A;  2J80 A;  4LEN A;  1TF1 A;  3OOV A;  4O8G A;  3SH8 A;  5E2E A;  5IU1 A;  5FAQ A;  4BD0 A;  2Y2I A;  3UDI A;  2QWS A;  5CGS A;  4YNR A;  1XA1 A;  5FEG A;  3RTY A;  2KLI A;  3MS6 A;  1L3L A;  4K91 A;  4S2L A;  4P6B A;  2J9P A;  4R3B A;  2ZC4 B;  3UB5 P;  5HX9 A;  3V39 A;  1TDG A;  2XF3 A;  5EVI B;  3CIT A;  1XKZ A;  2V0U A;  3MXQ A;  5CEB A;  3Q7Z A;  4HBT A;  2OAP 1;  2FZ0 A;  2PU4 A;  1MZU A;  2X71 A;  2J8Y A;  3SZT A;  2L0W A;  4KG2 A;  4EU0 A;  3IXB A;  1G6A A;  1XA7 A;  3FWL A;  3ZFZ A;  3LI9 A;  3HCY A;  5MC7 A;  2WGW A;  1W5D A;  2ZM0 A;  4MCW A;  4FUW A;  4PMA A;  3EEH A;  5AVE A;  3A3I A;  3C7V A;  5E2F A;  4IBR A;  3NDG A;  5E43 A;  3UO9 A;  3WS0 A;  1YSQ A;  3FYZ A;  3I7J A;  2WZX A;  3LGO A;  5GHY A;  1Q2P A;  2ZM2 A;  3HL9 A;  2VGJ A;  4WM9 A;  3MQQ A;  4R0Q A;  5KIZ A;  2JKR I;  2C5W B;  2ZC7 A;  1ONH A;  3IF6 C;  3BQ8 A;  3W2Z A;  3RH8 B;  3CMZ A;  1EW0 A;  2V1B A;  3IXH A;  1H8Y A;  4HOI A;  1K56 A;  4QJG A;  3IHB A;  1K6R A;  4JGR A;  4MMN A;  2Y79 A;  3T1X A;  1ACF A;  5AVF A;  3NUL A;  1L0D A;  2WAE A;  2ZOH A;  1K57 A;  5A91 A;  4R3J A;  2J3W A;  1RGY A;  5FI6 A;  4HHD A;  2J7V A;  4OKP A;  3T4L A;  1OT9 A;  2Y2O A;  3HLF A;  4E04 A;  3NC8 A;  5HDS A;  1SDE A;  1PYY A;  2HP6 A;  4U0T A;  3CHW P;  4IBX A;  4LFU A;  4ZAM A;  3ZG9 B;  3S4X A;  3W8K A;  2FFF B;  5DTS A;  4KQQ A;  2GX5 A;  2G2W A;  3HLE A;  5DKL A;  5FQK A;  4HNB A;  2Y2H A;  4S2O A;  5IT5 A;  1MKI A;  3GSG A;  1K4F A;  3HLC A;  5IHV A;  1BLS A;  1ONG A;  5CX7 A;  4GD6 A;  5E2G A;  1RP5 A;  3HJI A;  1W63 Q;  3UE0 A;  3Q82 A;  5CHM A;  1ES3 A;  5L07 A;  2XA7 S;  3Q07 A;  1F2K A;  3CPT A;  1DJA A;  1BT5 A;  3BRM A;  5BOH A;  1IYQ A;  2W3G A;  1EWZ A;  1H3Q A;  4HJ6 A;  1ERO A;  3QHY A;  5CTM A;  2Z6D A;  2WGW B;  5M1A A;  3S7O A;  1F5M A;  3VMA A;  1PI5 A;  3PTE A;  2IWD A;  3A0S A;  2A3U A;  3L9K A;  2Y91 A;  3BFD A;  3G4P A;  2R9W A;  3HUO A;  4P0M A;  4OPZ A;  3BYD A;  4R70 A;  1W79 A;  5EUA A;  2Y4A A;  3JVU A;  1D06 A;  4E3O A;  2Y59 A;  5GL9 A;  3ISG A;  4OQ0 A;  3ITB A;  3T4S A;  2E8J A;  4LV3 A;  1F9I A;  4B4Z A;  3N4I A;  2IWB A;  2EX8 A;  4NXF A;  3F1N A;  3DWZ A;  3A3D A;  2WKP A;  2PD7 A;  4WL9 A;  2QYB A;  4P6Z M;  2M1C A;  3IHA A;  1FR1 A;  5CGW A;  2EFU A;  5FI2 A;  3RJU A;  5EPH A;  3M2K A;  1K54 A;  2JBF A;  1J3W A;  1VQQ A;  4KZ4 A;  4E3J A;  3PR6 A;  4LLO B;  1WYC A;  1S6R A;  5J4E A;  2VJW A;  1BZA A;  4NK3 A;  5DF9 A;  1PWC A;  2O9B A;  2W3E A;  3BY9 A;  3LR0 A;  2B02 A;  1CQA A;  2W1T A;  2ZMA A;  2EX2 A;  3OC2 A;  1E3U A;  2ZMF A;  3G35 A;  1MC0 A;  3HLD A;  4GN2 A;  5FQQ A;  4A5R A;  1FSY A;  3UPN A;  5CER A;  4LCL A;  3DTI A;  4WZ5 A;  5DF7 A;  4DXB A;  4ZJ1 A;  4ZJ3 A;  3IWO A;  1OPX A;  4R3A A;  1MXO A;  2LB5 A;  3CUE C;  4NKP A;  1ERQ A;  1YQS A;  3D3O A;  4CJN A;  5GLC A;  1S0W A;  5DFX A;  4WF0 A;  4XUX A;  4UQI S;  1MPL A;  1P0Z A;  3LIA A;  3TE8 A;  1JTD A;  3KYQ A;  4BLM A;  3UE1 A;  1ZTU A;  3GV9 A;  4K0X A;  1AWI A;  4EEP A;  3C8C A;  1ALQ A;  2D02 A;  3SH7 A;  2DCF A;  1DRM A;  1X0O A;  3MFD A;  1M6K A;  4MN6 A;  4O01 A;  4M4X A;  2VEA A;  4CLC E;  4BL3 A;  3CPT B;  2J3T C;  3A0R A;  3CLO A;  4HJ4 A;  1K55 C;  1D1J A;  5L8M A;  2XFS A;  1PWD A;  3VFH A;  5G4Z A;  3U2A A;  4HJ3 A;  4CLC A;  2VA0 A;  2YKF A;  4WN5 A;  4JBF A;  4YIN A;  1AXB A;  1NLY A;  1L2S A;  1JVJ A;  4YWZ A;  3V3R A;  5FA7 A;  3WS5 A;  2O9C A;  2P74 A;  1NLZ A;  4PM8 A;  3FPV A;  5FEF A;  1N9N A;  2XD1 A;  3IH9 A;  4HES A;  2Y2Q A;  2GNX A;  4QD4 A;  3DTE A;  4WBG A;  3EQU A;  5FQM A;  3KYE A;  2PR5 A;  3IS2 A;  4HIA A;  2PDR A;  1KDS A;  2PR6 A;  3G30 A;  3F1N B;  3VOY A;  1YLW A;  3JVV A;  5HWW A;  1CEF A;  4KZ7 A;  4FH4 A;  1S66 L;  3N8L A;  1G28 A;  2BAS A;  5CHJ A;  3BFE A;  2X02 A;  4Y0U A;  5EM0 A;  1P9W A;  2PRF A;  3VE4 A;  3GDI A;  4XUZ A;  1W8Y A;  4E3L A;  2HP5 A;  4G3K A;  3BJN A;  4LRY C;  3P7N A;  4DMZ A;  1XPB A;  1I2S A;  5EOE A;  4KZ9 A;  5L09 A;  4B9O A;  1T1A A;  2XR0 A;  1IFQ A;  3VFF A;  5D3O A;  3H7W A;  1PFL A;  3ZG8 B;  1L0F A;  3K3D A;  1YSP A;  3H9W A;  3WWX A;  1QME A;  4DRT A;  3O87 A;  2J3T D;  3L7H A;  3IQA A;  3LIC A;  2W0N A;  1NRJ A;  5JYO A;  4ARZ A;  2W1T B;  3HUN A;  3F1P A;  4O0P A;  4R23 A;  3CAX A;  4ID4 A;  2Q9M A;  4EUV A;  1KGG A;  4DE0 A;  4B88 A;  2VV8 A;  4DJ2 A;  5FI7 A;  5F68 A;  4EEU A;  1CI8 A;  4MDZ A;  1BTL A;  1FIL A;  2R78 A;  2ZQ7 A;  5I5L A;  1BLP A;  2Y2P A;  3ZNT A;  5HD3 A;  4NET A;  1JTG A;  1HZO A;  5G4Y A;  4GJ4 A;  3KSF A;  3E4O A;  3G34 A;  5M19 A;  5A92 A;  2OWH A;  3ZNY A;  5F82 A;  2Y2K A;  1GSW A;  1PZP A;  3IWI A;  2XDM A;  5FDH A;  2GDN A;  2BTF P;  3B47 A;  1XJ3 A;  3E2L A;  1FOF A;  4PM9 A;  5FQJ A;  1YMS A;  3OZH A;  1IOU A;  1N4O A;  4E3M A;  4Y15 A;  3ZG5 A;  1NZU A;  1YM1 A;  1BLH A;  2ZQ9 A;  1K38 A;  2XK1 A; 
#chains in the Genus database with same CATH homology
 4GS9 A;  2ZOH A;  3EGD C;  3MFX A;  1W63 M;  2FH5 A;  3FC7 A;  1OTD A;  2JN7 A;  2J3W A;  5LBR A;  2I9V A;  4CLC B;  4WEJ A;  4HHD A;  5A8B A;  4CLC C;  4GCZ A;  2KDK A;  2H28 A;  3T4L A;  1OT9 A;  3C30 A;  1GSV A;  2W1R A;  2QHK A;  4NEE D;  4E04 A;  5HDS A;  1KOU A;  5J3W A;  5HD5 A;  5IS1 A;  3ULF A;  3SW1 A;  1LSV A;  5TBM A;  4UQI M;  4KQD A;  2Z6C A;  2JKT M;  2G7U A;  2GX5 A;  4XT2 A;  4BJP A;  5DKL A;  3VE3 A;  1GSX A;  3NOP C;  5TJJ A;  1S67 L;  3H82 A;  4HNB A;  2HGV A;  3T50 A;  2MJ6 A;  3B42 A;  1YKD A;  5IT5 A;  3IS2 B;  3UB6 A;  1S1Z A;  3G6O A;  3HJK A;  1N9L A;  2W3H A;  2HV1 A;  4HP9 A;  4Q0J A;  4K08 A;  3KO6 A;  4EQ1 A;  3GEC A;  1DP8 A;  2ZBB A;  1OTE A;  1OJG A;  4EET B;  5J7E A;  4WUJ A;  4GHI A;  5CX7 A;  2L1M A;  1VHM A;  2VZW A;  1H8M A;  4ETX A;  2V0W A;  1VB6 A;  3BY8 A;  3HJI A;  1W63 Q;  4WLA A;  4KUO A;  3UB9 A;  1S4S A;  1LL8 A;  2VGL M;  3K2N A;  4OOL A;  4F3L B;  2XA7 S;  1T1C A;  3UE6 A;  4LPZ A;  3KSG A;  2PYR A;  2V1A A;  3LR4 A;  2HJ9 C;  3MJQ A;  4EXO A;  4I5S A;  4EER A;  1UWN X;  3A0V A;  4I38 A;  2W3G A;  2VKS A;  1H3Q A;  4HQA A;  4HJ6 A;  2Z6D A;  3H7W B;  3CWF A;  3S7O A;  3KX0 X;  1F5M A;  5HWT A;  2M7V A;  3T4O A;  5F69 A;  3FPW A;  3A0S A;  3F1O A;  1V9Y A;  4I3I A;  3PYP A;  2OOL A;  4QPR A;  4ARZ B;  1S4R A;  3F1P B;  3BW6 A;  2P08 A;  2GJ3 A;  3PBT A;  4Y3I A;  2HJE A;  4L9E A;  3LYX A;  4CLC D;  3O5Y A;  4R70 A;  2P04 A;  4DN0 A;  1P9R A;  2A24 B;  3JVU A;  1D06 A;  5HPI A;  3ZYT A;  1F98 A;  2JKR M;  4EES A;  3T4T A;  5KSH A;  3T4S A;  4I3J A;  2CMN A;  3PXP A;  2JHE A;  1F9I A;  1XJ2 A;  4NXF A;  3BQA A;  3F1N A;  4H6J A;  2WKP A;  2PD7 A;  3S7N A;  4LRX C;  4WL9 A;  2QJ5 A;  2PYP A;  3NOT C;  4Q0H A;  5HPF A;  2QYB A;  1Y28 A;  2M1C A;  4P6Z M;  3VOL A;  3ZQ5 A;  3EOI A;  2PD8 A;  1XJ4 A;  2VV7 A;  2XRO A;  3T4Q A;  4BMW A;  3KSI A;  4JGO A;  4UEY A;  3OCN A;  3R7W A;  1XJ6 A;  2VX8 A;  3C38 A;  1LT0 A;  1OTA A;  3MQO A;  2PT7 A;  5AJG A;  4DJ3 A;  1S1Y A;  2NUT C;  5HZH A;  5FL3 A;  3R4K A;  3PR6 A;  1P97 A;  3E4P A;  4LLO B;  5HDC A;  2V9A A;  5J4E A;  4IUH A;  2VJW A;  2OWJ A;  4PKY G;  4GS9 B;  5F5Y A;  4HH3 A;  3T4J A;  3IBR A;  3K3C A;  4HI4 A;  5DF9 A;  1OT6 A;  2O9B A;  3VV4 A;  3S7Q A;  1TS7 A;  1YAX A;  5K5B A;  2W3E A;  3BY9 A;  3LR0 A;  2B02 A;  5HL6 A;  3UB8 A;  4Y5F A;  4BBU A;  3LR5 A;  4B93 A;  2W1T A;  3MR0 A;  4Y2F A;  3OC2 A;  1ZHH B;  2KX6 A;  2VLG A;  3EWK A;  4PKY A;  2GZA A;  1STZ A;  2ZMF A;  4RQ9 A;  4LRZ E;  4G3W A;  1MC0 A;  3LI8 A;  5TBM B;  1G6O A;  5DKK A;  2O99 A;  2W27 A;  1TD5 A;  1D7E A;  3LIB A;  1V9Z A;  2INW A;  4XT2 B;  4PHT A;  2QJ7 A;  2YKH A;  2XSS A;  4R38 A;  3BWL A;  4IHQ A;  1OPX A;  4R3A A;  3T4K A;  2LB5 A;  3CUE C;  4NKP A;  1XFN A;  3H82 B;  3MF0 A;  3D3O A;  3LFV A;  5DFX A;  4IUK A;  1JNU A;  4WF0 A;  3E0Y A;  4UQI S;  3EGX C;  2K31 A;  1P0Z A;  4NXE A;  3LIA A;  3TE8 A;  4Q0I A;  1OTB A;  1OJ5 A;  3B33 A;  3KYQ A;  5C5K A;  3KSH A;  4KQO A;  1N9O A;  4GHI B;  1ZTU A;  2D01 A;  1WA9 A;  4JGP A;  4PAU A;  5DFY A;  4EEP A;  3C8C A;  4EW7 A;  2D02 A;  2O0Y A;  3LIE A;  4WEK A;  1DRM A;  2EA9 A;  5HDD A;  1X0O A;  3RFB A;  4MN6 A;  4O01 A;  4M4X A;  2VEA A;  4CLC E;  3IBJ A;  2IA2 A;  4OOM A;  1LSX A;  2J3T C;  3A0R A;  3CLO A;  1T1B A;  1UWP X;  4HJ4 A;  3LID A;  1NWZ A;  5L8M A;  3UMD A;  3PBS A;  3UE3 A;  3LUQ A;  2B18 A;  5G4Z A;  3TRC A;  3U2A A;  4GLQ A;  4HJ3 A;  3UB7 A;  3PBR A;  4CLC A;  1UGU A;  2VA0 A;  2ZMV A;  2YKF A;  4WN5 A;  3D72 A;  3PBN A;  4KUK A;  1NLY A;  2L4R A;  4I39 A;  4HH2 A;  3F1O B;  3MMH A;  4HY8 A;  1ODV A;  4BWI A;  4YWZ A;  2VV6 A;  5F6A A;  2A2L A;  2HF6 A;  2O9C A;  4L0L A;  5DJU A;  4ZRR A;  2J80 A;  3UME A;  1NLZ A;  2EWV A;  1TF1 A;  3OOV A;  3FPV A;  3LR3 A;  1LSW A;  4MN7 A;  4L9G A;  4O8G A;  3TW8 A;  4NXB A;  2EWW A;  3E98 A;  1N9N A;  5IU1 A;  3S7P A;  3P01 A;  2PHY A;  3OLO A;  4L9F A;  1MKM A;  2LB9 A;  2QWS A;  5EFW A;  4YNR A;  2JKT I;  4HP4 A;  2GNX A;  4WEL A;  3EQV A;  3EQU A;  3MQ0 A;  3RTY A;  2KLI A;  2PR5 A;  3IS2 A;  4HIA A;  2NUP C;  4MN5 A;  3OBF A;  2PDR A;  2XA7 M;  2PR6 A;  5DJT A;  3F1N B;  4G3V A;  4AFI A;  4H6J B;  3FG8 A;  3JVV A;  4R6L A;  5HWW A;  1S66 L;  1G28 A;  2O9A A;  2BAS A;  3CIT A;  2K7S A;  3CI6 A;  4BBV A;  3DBA A;  1TS0 A;  2V0U A;  3MXQ A;  1OTI A;  4YOF A;  5HWV A;  1P9W A;  3R7W B;  4ME4 A;  2W3F A;  2OAP 1;  3E4Q A;  2FZ0 A;  2OAQ 1;  1MZU A;  3VE4 A;  3GDI A;  4F3L A;  2DMW A;  2P7J A;  2W3D A;  1T18 A;  2L0W A;  3PBQ A;  4G3K A;  3BJN A;  4LRY C;  4EU0 A;  4JGQ A;  3P7N A;  1TS6 A;  3CUE A;  4DMZ A;  4P6Z S;  4B9O A;  1T1A A;  2K2N A;  1IFQ A;  3LI9 A;  3HCY A;  2ZOI A;  3NJA A;  3H7W A;  1DP6 A;  5MC7 A;  4Z1W A;  3ICY A;  3K3D A;  1YSP A;  3H9W A;  2J3T D;  3C2W A;  3LIF A;  3OCL A;  4MCW A;  4CQH A;  1BYW A;  3LIC A;  2W0N A;  1NRJ A;  3EEH A;  4ARZ A;  5AVE A;  2W1T B;  4GW9 A;  3F1P A;  4O0P A;  4ETZ A;  3CAX A;  2WKR A;  2WKQ A;  5HSQ A;  2Y8H A;  2A24 A;  2M7U A;  4EUV A;  1YSQ A;  2VV8 A;  4DJ2 A;  3EEA A;  5F68 A;  3MQQ A;  4EEU A;  4MDZ A;  5KIZ A;  3NHQ A;  2R78 A;  3PHY A;  2JKR I;  5I5L A;  4FSF A;  3TJZ C;  5HD3 A;  1T19 A;  4NXG A;  5G4Y A;  4GJ4 A;  3KSF A;  4BBT A;  1XFQ A;  3E4O A;  3V67 A;  3BQ8 A;  2OWH A;  2XRN A;  3W2Z A;  2VGL S;  1GSW A;  3KYZ A;  2QKP A;  3RH8 B;  3NOU C;  1EW0 A;  2V1B A;  3B47 A;  4HOI A;  3PBO A;  4IJG A;  4II7 A;  1XJ3 A;  4FOF A;  4I3A A;  1TS8 A;  4JGR A;  1IOU A;  2KOI A;  4MMN A;  2Y79 A;  1DP9 A;  5AVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...