4ZJ2A

Crystal structure of p-acrylamido-phenylalanine modified tem1 beta-lactamase from escherichia coli :e166n mutant
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
265
structure length
264
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWNPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring the potential impact of an expanded genetic code on protein function.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
total genus 92
structure length 264
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4zj2A00
1KDSA 2EX8A 5TR7A 2OV5A 1PI5A 4FCFA 3HL9A 4K0WA 4RYEA 2Y2GA 4R0QA 1K25A 3N4IA 4EUZA 3IF6C 1FCNA 1O07A 4WZ5A 5CHMA 1L2SA 4ZJ1A 4QHCA 4JBFA 3UPNA 1WE4A 4DF6A 3IF5A 4S2MA 3G2ZA 4EQIA 4ZJ3A 1XX2A 2WADA 4BQMA 5KSCA 1ERQA 3HBRA 1PYYA 5HFOA 5TFQA 1S0WA 3UPPA 5CECA 3A3FA 3ITBA 2XR0A 4DE2A 2ZQ8A 3HLGA 1H8ZA 3IF6B 2WYXA 3W8KA 3WS4A 4F94A 2Y2LA 4FH2A 5CHJA 3VFHA 5FASA 2H10A 3OC2A 1N9BA 4QD4A 3O87A 1MBLA 1XP4A 1M40A 3EQVA 1XKZA 4JXSA 3WRZA 2J9PA 2VGKA 5GHYA 3BYDA 5M1AA 2PBYA 3WS2A 2CC1A 3PBTA 5CEBA 1TVFA 5EECA 1LLBA 1LL9A 3TSGA 1SCWA 2Y4AA 3ZDJA 4YFMA 1FOFA 2EFXA 3W4OA 1XPBA 1ZG4A 4Q8IA 3BFEA 3WS0A 5AQ7A 1ES5A 1BSGA 2V1ZA 3IWIA 5F1GA 1KVMA 3HLBA 3PBNA 3QNCA 4H8RA 2Y2OA 5M18A 3C7VA 4EWFA 4ZAMA 5F1FA 1GA0A 5E43A 2ZC7A 3NY4A 4GB7A 3BFDA 4LV2A 4IVIA 5DTKA 5CHUA 1U60A 4M3KA 3VSLA 1W79A 1W8YA 3FWLA 1OMEA 4WM9A 2Y2JA 3VP3A 1HZOA 3ZG5A 1FR6A 3WS1A 1ESIA 1JVJA 4WYYA 3ISGA 1JWVA 3HREA 2XK1A 4GD8A 3VSKA 5E2FA 4BJPA 4N9LA 3OCLA 4KG6A 4QJGA 4OONA 5EVLA 4C6YA 5FAQA 3MZDA 4KG2A 2J8YA 3SS5A 5EVIC 3IWQA 3ZCZA 2ZQ7A 3OPLA 1CEFA 4MNRA 3UN7A 1CEGA 4UA7A 2WGIA 5GLAA 2PU2A 4E3IA 4BLMA 1DJAA 2R9XA 5AQAA 2ZD8A 5EVIA 2WK0A 3Q81A 2X01A 1BT5A 3V3RA 3NCKA 4KZ6A 2IWCA 4OQ0A 4MBHA 2ZQ9A 1YT4A 4LV3A 1IYSA 2H0TA 3LO7A 3M6HA 4S2IA 1K57C 1LI9A 1Q2QA 4UHUA 4OPRA 4WELA 1EWZA 5E2EA 3GVBA 3I7JA 1IELA 3GV9A 3PBRA 4N9KA 3G31A 1NYMA 4X55A 5E2HA 3DW0A 2EXBA 1TEMA 1QMFA 1ESUA 3IHBA 5DVAA 3V5MA 4B88A 4C3QA 1IYOA 2ZC5B 1PW8A 1VQQA 1MWTA 4N1XA 5FAPA 1K4FA 2Y2MA 1I2SA 4OLDA 3MFDA 1MPLA 5FQJA 1ES4A 4PM9A 1VM1A 3G2YA 3ZNTA 4E3NA 2GDNA 2VGJA 2Z2LB 4X68A 4KQOA 3FV7A 4X6TA 4BL2A 4DRTA 3G30A 3IH9A 4FSFA 3LY4A 4X69A 4JLFA 3VP1A 4MEZA 1Q2PA 4IBRA 4BD0A 1FCOA 3MZFA 2ZMAA 1YMSA 5A91A 3HLFA 4DDSA 4DDYA 4BD1A 4MBFA 1L0DA 5FDHA 3HLEA 2Q9MA 2E8IA 2I72A 5E2GA 2V20A 3BFFA 5HARA 4N1HA 5GLBA 3PBQA 1HVBA 1KGEA 3MBZA 3Q1FA 3EQUA 3WRTA 5GL9A 1NJ4A 2FFYA 4LENA 4OOYA 1G6AA 5HAQA 2ZM2A 4ZJ2A 1NZOA 5I94A 3NIAA 4JXGA 3G35A 2HDQA 4KZ3A 3N8SA 3AGDA 3VP0A 4C75A 1JWZA 5CRFA 3UDFA 3C4OA 3WS5A 4EBNA 1K56D 3C4PA 5CEDA 5FI6A 5DTTA 3OPHA 2EX2A 3UPOA 4LV0A 1H8YA 4ZDXA 1KVLA 1W7FA 4R4SA 4R4RA 1BLSA 2XLNA 3FKVA 3ZGAB 4PM5A 1PWDA 3IXDA 4IVKA 1MKIA 3VOZA 1FSWA 1XGJA 4E3KA 1IKGA 1E4DA 4S2NC 4KZAA 4Y7PA 3GQZA 3LCEA 4HBTA 4DXBA 3CG5A 2ZJ9A 4K91A 5FI7A 1ALQA 4OPYA 1RP5A 4U0XA 2JBFA 3IT9A 4EBLA 1NRFA 4KZ7A 2ZC6B 3OPPA 4LV1A 5M19A 3RXWA 4PPRA 1CK3A 4PMAA 4WZ5C 4S2LA 1MXOA 5L2FA 1L0EA 3HLDA 4R23A 2XD5A 3JYIA 3W4PA 2HDUA 3CZDA 1YLTA 3M2JA 4OVDA 3NI9A 4IBXA 4UA6A 5KZHA 4X56A 1XGIA 2WAEA 2HPBA 1PI4A 4KZ9A 3UNWA 3PTEA 1SDEA 2ZQAA 2Y59A 3G4PA 1TDLA 3IQAA 5CXWA 1MWRA 5F82A 5FQIA 3WWXA 2XD1A 4RVAA 4OQGA 5CTNA 5JYOA 4OPQA 1PZPA 1WYCA 4ID4A 2JE5A 4WZ4A 4DKIA 3NDEA 3N8LA 4ZTKA 3DTMA 2Y2HA 4MBKA 2Y2QA 3BECA 2ZQDA 2OLVA 4R1GA 1HD8A 2UWXA 3HVFA 3DWZA 3UDXA 4PM8A 3GMWA 3LY3A 2WGWB 3IXBA 3VP2A 4DE0A 1YMXA 4JF4A 2QPNA 2P9VB 3HLWA 1K6SA 5FQQA 5A92A 3W4QA 2HDRA 1SHVA 5F83A 5HX9A 1J9MA 3AGEA 3Q7ZA 3Q82A 1AXBA 2ZC3B 3C7UA 1KE4A 4S2OA 3SH8A 2WGVA 3O86A 5EVIB 2XFTA 3PAEA 1IYQA 1YLPA 3E2KA 4OKPA 1JTDA 1RGYA 1K55C 4NK3A 3M6BA 4JF6A 4DE1A 1YLYA 1JTGA 5HL1A 5HAIA 3IWOA 3VP4A 5KSHA 1CI8A 1RCJA 3ZVWA 2Y91A 4KQQA 4CPKA 4E3JA 4S2KA 2XFSA 3O3VA 3GTCA 1DY6A 1BUEA 1KE0A 1K57A 3ZFZA 4OQIA 3IH8A 2V2FF 4EV4A 3PAGA 1IKIA 2Z2MB 2JC7A 4WEJA 3FYZA 3LEZA 1BULA 1PW1A 2ZQCA 3NC8A 5DTSA 5HAPA 5DF7A 4OPZA 4L0LA 5EOEA 3IF6A 4KQRA 1ZG6A 5J8XA 1RGZA 2DCFA 4OH0A 2H0YA 2J7VA 4JPMA 1PZOA 1WYBA 3HUOA 5FQ9A 2XGNA 5FI2A 2DNSA 4FD8A 2HP6A 4R3BA 3V39A 1MWUA 4ZBEA 4E3MA 4OOLA 4IEDA 1K6RA 4LCMA 4FH4A 4QB8A 2WKIA 3BRMA 2A49A 5FA7A 5FQMA 2IWBA 2Y2KA 1BTLA 1Z6FA 4UAAA 3S22A 4JXWA 1MWSA 4OP5A 1BZAA 4E3LA 4XXRA 1KE3A 3M2KA 1GCEA 5FATA 4P6BA 3OZHA 4KENB 1L0FA 5DF8A 5EVID 3TG9A 3ITAA 1ZKJA 2BLSA 1L0GA 1S6RA 2B5RA 2ZC4B 4RA7A 3BLMA 4O7DA 1FR1A 3D4FA 3N6IA 1KGGA 3A3EA 1KGFA 2HDSA 1KDWA 3A3JA 3MXRA 5AQBA 5U47A 1IYPA 4GD6A 3ZG8B 3IXHA 3FKWA 5EE8A 2WKHA 5FQKA 1PIOA 2QMIA 5JYPA 4S2JA 1I5QA 4BENA 2ZM0A 3E2LA 1NZUA 1C3BA 4U0TA 3GRJA 4HBUA 4Z9QA 4E3OA 3VMAA 3CJMA 2EXAA 2WKEA 4R3JA 1QMEA 1PWCA 5HW3A 2QZ6A 1GHMA 3C5AA 1K56A 4N92A 4RX2A 4RX3A 4NETA 4WMCA 2XH9A 3O88A 4KZBA 3OCNA 3S1YA 1XXMA 4KZ4A 2BG1A 5GHXA 3GSGA 3RJUA 2HP9A 2XEPA 4QU3A 5GLCA 1SKFA 1LI0A 2H5SA 2RCXA 3BFCA 2WGWA 1CI9A 3HLCA 4D2OA 2EX6A 1K54C 1GHPA 3ZHHA 4OQHA 2PU4A 4KZ5A 3OPRA 3UE3A 1XA7A 5GHZA 3MXSA 3N8RA 1NY0A 2XDMA 3HUNA 3A3DA 3QHYA 4JKTA 2P9VA 3GR2A 4GNUA 2Y2IA 3QNBA 3IHAA 3Q07A 3ZVTA 4HEFA 4XUXA 3BEBA 4GZBA 3SH7A 2EFUA 3RXXA 3AGFA 3FZCA 2P74A 5CGWA 2WAFA 2Q9NA 5FAOA 4GDNA 5BOHA 2Y2PA 4A5RA 1G68A 1PWGA 2IWDA 4QY5A 5IHVA 5CGXA 3UO9A 3VFFA 5CTMA 4MLLA 4S2NA 5EPHA 4QY6A 4S2PA 5A93A 1M6KA 1FQGA 4Y0TA 1GHIA 4P0MA 3P98A 3Q7VB 4Y0OA 1I2WA 1ES2A 4CJNA 1XA1A 2JCHA 4PM6A 1SDNA 2DRWA 1E3UD 3ZG0A 2WUQA 2HP5A 4GKUA 3MKFA 4WEKA 2WZZA 1N4OA 3DWKA 2XF3A 3PBSA 3SS4A 4WBGA 4GDBA 5CGSA 1BLPA 1Y54A 4X53A 1ONGA 3BFGA 2FFFB 1O7EA 2XQZA 3ZNYA 3UDIA 1E25A 1NYYA 2ZM8A 3Q7VA 5FSRA 2ZLYA 4KZ8A 1ERMA 1E3UA 5CERA 3ZG7B 2C6WB 1TDGA 5A90A 1YM1A 4DXCA 1EROA 2RL3A 2Y2NA 4GOGA 4E6WA 4B4XA 3ZG9B 3UE0A 3HUMA 4HESA 4U3TA 4YINA 4DE3A 3BLSA 4OOMA 4OLGA 5EOOA 5G18A 3SS3A 1W8QA 3NBLA 1ONHA 4KG5A 3V3SA 3NDGA 4JF5A 4OP8A 3TOIA 3SOIA 3V50A 3CMZA 3G32A 3MKEA 1K54A 5GLDA 2WZXA 3N7WA 1FSYA 1ZC2A 3IXGA 2R9WA 3B3XA 3UE1A 2EX9A 3VOYA 5AQ9A 1YQSA 2OLUA 1MY8A 3P09A 1BLHA 5KMWA 2OSUA 2G2WA 5EUAA 4JXVA 1K55A 1LL5A 2C5WB 4P87A 4PM7A 1DJBA 4E6XA 1GA9A 1W5DA 4XUZA 1BLCA 4GN2A 1YLJA 4LCLA 4WMCD 1IEMA 2Y55A 5DF9A 1K38A 3SH9A 1K4EA 3S4XA 4BL3A 5D3OA 2X71A 4Y0UA 1JWPA 1NXYA 2X02A 4P85A 1ES3A 3BM6A 4EBPA 3G34A 1YLWA 2J9OA 3MZEA 1H5XA 1DJCA 1LHYA 2G2UA 3UY6A 4B4ZA 3A3IA 2A3UA 1FCMA 4UA9A 5TGFA 1HTZA 1YLZA 3PBOA 4K0XA 1EI5A
chains in the Genus database with same CATH superfamily
2EX8A 2OV5A 1N9LA 4R0QA 2WKPA 3T1XA 4HI4A 1FCNA 1FILA 5CHMA 3RFBA 3CI6A 1IOUA 4S2MA 3DTEA 4ZJ3A 3HBRA 1PYYA 5HFOA 5CECA 3UPPA 2XR0A 3D72A 3IF6B 4F94A 2Y2LA 3OC2A 1N9BA 5IT5A 3NOTC 1XP4A 1OT6A 1OPXA 2J9PA 3LR0A 5G4ZA 2PBYA 3WS2A 3TW8A 5F6AA 2PDRA 1LLBA 1SCWA 2VEAA 3W4OA 1XPBA 1BSGA 3MJQA 3S7OA 3L7HA 3QNCA 4EWFA 5F1FA 1GA0A 3MMHA 5E43A 3NY4A 4GB7A 3BFDA 4LV2A 2VZWA 3VSLA 1W8YA 2Y2JA 3VP3A 2HJ9C 2VLGA 3WS1A 3B33A 3U4LP 1YKDA 1JWVA 4BJPA 4KG6A 5EVLA 4X25A 5EVIC 1CEFA 4MNRA 2V1AA 4UA7A 2GNXA 3UN7A 5GLAA 4D60A 4BLMA 1Y4OA 2ZD8A 5EVIA 4ZRRA 2X01A 1BT5A 4KZ6A 1JNUA 4OQ0A 1YT4A 3BJNA 2H0TA 3M6HA 1K57C 4UHUA 4WELA 5E2EA 3I7JA 4PKYA 1IELA 4N9KA 1NYMA 2VGLM 3IHBA 5HZHA 4C3QA 1IYOA 1DP9A 1VQQA 2W27A 3SW1A 4G3KA 1XJ4A 5FQJA 4PM9A 4QPRA 4KQOA 3VP1A 5HD3A 4MEZA 1Q2PA 4IBRA 4BD0A 1W63M 4L9EA 2B18A 4DDYA 4BD1A 4L9GA 1H0MA 5FDHA 3HLEA 2I72A 5E2GA 2L4RA 5HARA 4N1HA 3MBZA 3Q1FA 5GL9A 1NJ4A 1G6AA 2HDQA 1P9RA 3IBJA 5G4YA 4C75A 3UDFA 3C4OA 4EBNA 2BASA 1K56D 4PKYG 3OPHA 2EX2A 3FKVA 2PT7A 2HZ5A 1V9ZA 1FSWA 1H8MA 4GHIB 4HBTA 4EESA 2INWA 2JBFA 3LGOA 3T4LA 1BYWA 2ZC6B 4LV1A 5M19A 2J3TC 5DFYA 2WKRA 1CK3A 1VEUA 5L2FA 4UQIM 2XD5A 1NLZA 3W4PA 1S1YA 3TE8A 3NI9A 4UA6A 3UB6A 4EERA 4ESPA 2PR5A 1PI4A 1F2KA 4HH3A 2ZQAA 1LT0A 3IQAA 2XD1A 5JYOA 4OPQA 3SZTA 1NRJA 3NDEA 2K7SA 5EVEA 5IU1A 2Y2HA 2A24B 1HD8A 3BWLA 2UWXA 2B02A 4DE0A 4IJGA 1YMXA 4JF4A 5LBRA 2K2NA 3UB7A 3TJZC 5EM1A 3AGEA 3Q7ZA 1G28A 3C7UA 1KE4A 4OKPA 1RGYA 5HL1A 3ZVWA 4EU0A 4E3JA 2XFSA 1K57A 3FPWA 2V2FF 4WEJA 3BY9A 3NC8A 3LEZA 5DF7A 4OPZA 3IF6A 5DKLA 2DCFA 2H0YA 3DAVA 5FI2A 3K3DA 4R70A 4IEDA 2WKIA 3BRMA 2A49A 2VV7A 4GLQA 3F1PA 2GX5A 4E3LA 3MQQA 1GCEA 1OTAA 2OWHA 3T4KA 5DF8A 2XSSA 3BLMA 4GS9B 1FR1A 5HD5A 1F5MA 1KGGA 1KGFA 5AQBA 2J3WA 4KUOA 3ZG8B 3FKWA 3K2NA 4IHQA 2PBDP 2WKHA 2QMIA 5HPIA 5JYPA 3MFXA 4S2JA 4U0TA 5J4EA 4Z9QA 3VMAA 4Y3IA 4Y2FA 1GHMA 3LR4A 4RX2A 2Z6DA 3ULFA 4EW7A 3LICA 3RJUA 3F1OA 4LRZE 3BFCA 2WGWA 4KQDA 2EX6A 1S4SA 3NOPC 3R4KA 1OTIA 2CMNA 4CLCB 5GHZA 1NY0A 2P9VA 2AVXA 4XUXA 3HCYA 4UQIS 1KOUA 2WAFA 5FAOA 2IWDA 5CGXA 4MLLA 4S2NA 1M6KA 4P0MA 3P98A 4GS9A 3Q7VB 4Y0OA 1H3QA 1XA1A 2JCHA 2Y8HA 4GKUA 2HP5A 1N4OA 4WBGA 3L9KA 1ONGA 1DP6A 4G3WA 3BW6A 5TBMA 3KSFA 1NYYA 2ZM8A 2V8FA 2ZLYA 4KZ8A 5CERA 4B4XA 3ZG9B 4U3TA 1D06A 5AVEA 1W8QA 3NBLA 3EOIA 3UE6A 3V3SA 5FEFA 4OP8A 1A0KA 3TOIA 2MJ6A 1VETB 3MKEA 1P9WA 1PNEA 5GLDA 3OBFA 3B3XA 4Y17A 5EUAA 4JXVA 2J80A 1K55A 3C38A 1LL5A 3UMDA 2C5WB 4PM7A 1DJBA 1GA9A 4XUZA 4GN2A 3SH9A 1VETA 2X71A 1ES3A 2JN7A 3G34A 2J9OA 3A0RA 2V9AA 4BWIA 2JKRM 3R7WA 5HDDA 5TR7A 1PI5A 4B93A 4WF0A 2QJ7A 2KX6A 1K25A 4EUZA 2VA0A 3FPVA 1S4RA 4ZJ1A 4M4XA 1WE4A 2QYBA 3IF5A 4EQIA 5KSCA 5I5LA 4GHIA 1ERQA 2ZL1A 1S0WA 1MZUA 2Y79A 2ZQ8A 4R3AA 1H8ZA 3W8KA 3WS4A 4F3LB 5CHJA 3VE4A 5FASA 1TS0A 1LSXA 2B95A 1MBLA 3WRZA 2VGKA 5GHYA 1MKMA 2W3GA 2CC1A 5CEBA 3GECA 1FOFA 4Q8IA 3BFEA 3KO6A 3WS0A 5AQ7A 4HP4A 1KVMA 3HLBA 3ICYA 1Y28A 5M18A 3EWKA 2M7UA 1F98A 4IVIA 4R6LA 3NJAA 1OMEA 4WM9A 3ZG5A 2QHKA 3HREA 3VSKA 4OONA 1HLUP 3MZDA 3SS5A 2ZQ7A 3OPLA 3PHYA 2UV0E 5AQAA 3Q81A 1TS8A 2IWCA 4MBHA 2ZQ9A 5F5YA 1IYSA 3LO7A 2W1RA 4X1LA 3S7QA 1Q2QA 4OPRA 1EWZA 3GVBA 2JKGA 1LSWA 3G31A 4HY8A 4X55A 2HJEA 3DW0A 1QMFA 5DVAA 1AWIA 1PW8A 3JPUA 1CF0A 1K4FA 4OLDA 1ES4A 4MN5A 1XFNA 3KSGA 4X68A 4X6TA 5L8MA 3G30A 3IH9A 3LY4A 4EEUA 4JLFA 1VB6A 1FCOA 3MZFA 5CX7A 1YMSA 5A91A 4MBFA 1L0DA 2E8IA 1LSVA 3PBQA 3EEHA 3EQUA 2O99A 2FFYA 5HAQA 3CUEC 1K0KA 4ZJ2A 3NIAA 5DJTA 4R38A 1UWPX 1JWZA 1CQAA 3LIFA 5DFXA 5CEDA 1DRMA 5FI6A 4ZDXA 4R4RA 3IS2A 1PWDA 3IXDA 4IVKA 2OAP1 3H7WB 4IUKA 2OAQ1 4S2NC 4QWOA 3CPTB 3GQZA 3LCEA 4K91A 4OPYA 3PR6A 4EBLA 3OPPA 3RXWA 4PMAA 4PHTA 4S2LA 4WZ5C 1L0EA 4R23A 3JYIA 2R78A 2GJ3A 2K31A 5AVFA 1XGIA 1TDLA 1MWRA 5CTNA 3E98A 1WYCA 2HGVA 4MBKA 4CLCD 2D02A 3BECA 2QKPA 2ZQDA 2OLVA 4CLCA 4R1GA 3LY3A 2WGWB 2QPNA 4ARZB 5FQQA 1K6SA 1FIKA 1S66L 3W2ZA 1SHVA 5HX9A 1J9MA 3Q82A 1AXBA 5FEGA 1IYQA 3E2KA 3IX4A 4DE1A 1JTGA 3IWOA 1CI8A 1XJ3A 5F68A 4MMNA 3O3VA 3GTCA 1DY6A 1IFQA 4LGWA 4EV4A 3PAGA 2Z2MB 4BBVA 3FYZA 5HAPA 1PW1A 5FL3A 1T1AA 2JKFA 4L0LA 4KQRA 5EOEA 2OOLA 1TS6A 4OH0A 2J7VA 3HUOA 3V39A 4ZBEA 4OOLA 1K6RA 1GSXA 4FH4A 1D7EA 4JGQA 5FA7A 3FG8A 2Y2KA 1Z6FA 2ZMFA 3CPTA 1MWSA 1BZAA 3UB9A 3MF0A 5FATA 1L0FA 2BLSA 4E04A 3D4FA 4ETXA 1KDWA 5U47A 3MXRA 5HPFA 4LPZA 4Y5FA 5EE8A 5FQKA 3T4JA 3O5YA 2ZM0A 3E2LA 2PAVP 4WN5A 3CJMA 1PWCA 1S1ZA 2QZ6A 5HW3A 3BY8A 1STZA 2HF6A 4N92A 4WMCA 3S1YA 2O0YA 3OCNA 4Y13A 2VKSA 4KZ4A 5FDSA 2HP9A 1LI0A 2H5SA 5F69A 3HLCA 3MSHA 1K54C 2V0UA 3ZHHA 4KZ5A 3OPRA 4G3VA 1YAXA 3MXSA 3C30A 3QHYA 4MDZA 2P04A 4FTXA 3BEBA 4GZBA 3SH7A 1T18A 2P74A 4EXOA 2Q9NA 1YPRA 5BOHA 2Y2PA 1G68A 4I38A 2M1CA 5EPHA 4Y0TA 5HSQA 3OOVA 1ES2A 3H82A 3KYQA 3E4QA 3MKFA 4WL9A 2XF3A 3SS4A 2WKQA 1Y54A 4X53A 2D01A 4HH2A 1VEUB 3ZNYA 4X1MA 3Q7VA 5FSRA 4LLOB 1E3UA 2H28A 2W3EA 3ZG7B 2C6WB 2I9VA 1TDGA 3V67A 1ZTUA 2W3DA 4NKPA 3UE0A 3NHQA 3BLSA 5G18A 1ONHA 4JF5A 2P7JA 3G32A 1FSYA 1ZC2A 4I3JA 5K5BA 3T4OA 2EX9A 2OLUA 4PAUA 4II7A 3KYEA 2KOIA 3F1NB 3P09A 4HNBA 2VX8A 3VE3A 2EA9A 4P87A 1W5DA 4LCLA 5DF9A 3LIAA 1IEMA 3K3CA 3QP2A 2X02A 4P85A 2G7UA 1YLWA 1H5XA 2FZ0A 1LHYA 3UY6A 4B4ZA 1HTZA 3PBOA 1EI5A 2PD8A 1KDSA 3IX3A 3HL9A 3QP6A 3D3OA 3N4IA 3MR0A 3ZQ5A 3IF6C 5HL6A 1O07A 3IX8A 4WZ5A 1ACFA 1DP8A 1L2SA 4QHCA 4JBFA 3UPNA 3VOLA 4DF6A 3G2ZA 1T1CA 2VJWA 2XA7M 3A3FA 3ITBA 3H7WA 2DMWA 3LR5A 2JKRI 1NLYA 3GDIA 3VFHA 2H10A 4QD4A 3O87A 2XRNA 3EQVA 1XKZA 4JXSA 1TVFA 4I3IA 4MN6A 3TSGA 2Y4AA 3ZDJA 4YFMA 5HDSA 3LEQA 3IS2B 2V1ZA 2PYPA 5F1GA 3PBNA 2Y2OA 4ZAMA 2E8JA 1ZHHB 5CHUA 1U60A 2O9CA 4BBTA 1TS7A 1ESIA 1JVJA 4BBUA 4WYYA 3ISGA 1OT9A 5E2FA 4N9LA 3OCLA 2A24A 4HQAA 4C6YA 4GCZA 2KDKA 4KG2A 4WUJA 3ZCZA 5EV0A 1CEGA 2WGIA 2PU2A 5C5KA 1DJAA 2O9AA 2WK0A 3V3RA 2YKFA 3NCKA 3OLOA 4S2IA 3PBRA 4H6JA 3T4QA 2EXBA 1TEMA 4B88A 2L1MA 4Q0IA 1EW0A 3DTKA 3EEAA 3G2YA 1J3WA 3ZNTA 2GDNA 4E3NA 4BL2A 1OTEA 4FSFA 4X69A 3HLFA 4DDSA 1CJFA 2Q9MA 2XROA 1YSQA 3CLOA 2V20A 3BFFA 1KGEA 3WRTA 4OOYA 2ZM2A 1NZOA 3G35A 4KZ3A 3AGDA 3VP0A 5CRFA 1TD5A 3WS5A 4ME4A 5DTTA 4CQHA 4LV0A 1KVLA 1BLSA 3ZGAB 4PM5A 3T12B 5L09A 1IKGA 4KZAA 2ZL1B 4Y7PA 3CG5A 3E4OA 1RP5A 4U0XA 2VV6A 4KZ7A 4HJ6A 3R7WB 2KLIA 2PHYA 4ETZA 1LL8A 5AJGA 1MC0A 1T19A 2GZAA 3CZDA 1YLTA 3M2JA 3LIBA 4OVDA 4KZ9A 3H82B 1N9NA 1PZPA 4MCWA 4ID4A 2W3HA 4WZ4A 4LRXC 4NEED 2ZOHA 3DTMA 3HVFA 3DWZA 4PM8A 2EWVA 3IXBA 2V8CA 4YOFA 2PD7A 2V1BA 5F83A 3MS6A 2ZC3B 3SH8A 3NECA 3O86A 5EVIB 2XFTA 2HV1A 3E4PA 1K55C 4JF6A 5HAIA 3VP4A 5KSHA 3NULA 4S2KA 3LIEA 1BUEA 1KE0A 1T1BA 3ZFZA 2JC7A 5DKKA 5HDCA 2VGLS 2ZQCA 5J8XA 1ZG6A 4JPMA 1WYBA 2XGNA 4FD8A 2W0NA 1S67L 2HP6A 4R3BA 4E3MA 4FOFA 4LCMA 4QB8A 2Q0OA 4UAAA 3S22A 2PR6A 4L9FA 4OP5A 4LFUA 4P6BA 3OZHA 4KENB 5EVID 3TG9A 3ITAA 1L0GA 1S6RA 2B5RA 2ZC4B 4RA7A 4O7DA 4KUKA 2HDSA 3A3JA 3EGXC 1IYPA 1OTBA 1PIOA 1I5QA 3LR3A 1L3LA 1C3BA 3GRJA 4HBUA 4HJ4A 4E3OA 1OJ5A 2Z6CA 4R3JA 1QMEA 1G5UA 5J7EA 2NUTC 3O88A 1NWZA 3C2WA 5GHXA 3GSGA 3LUQA 2XEPA 4QU3A 5GLCA 1SKFA 3HJKA 2RCXA 4D2OA 5HWVA 2PU4A 2W1TA 1XA7A 3UE3A 4P6ZS 1UGUA 3HUNA 3LI9A 3GR2A 4ARZA 4GNUA 3QNBA 2EFUA 4A5RA 5IHVA 3UO9A 2XA7S 5KIZA 4QY6A 4S2PA 3E0YA 1FQGA 1GHIA 3UB5P 4CJNA 1I2WA 4F3LA 4PM6A 1E3UD 4WEKA 3PBSA 5CGSA 1VHMA 1BLPA 2FFFB 2XQZA 2LB5A 1E25A 3F1PB 1YM1A 1EROA 2RL3A 4GOGA 4E6WA 3HUMA 4HESA 4YINA 4DE3A 3T50A 5EOOA 3SS3A 5EFWA 1UWNX 3SOIA 3N7WA 1GSVA 1TF1A 3CUEA 4EETB 3LFVA 5KMWA 2P08A 3KYZA 4AFIA 4E6XA 4WMCD 1YLJA 2Y55A 3HJIA 1K4EA 4BL3A 2ZOIA 3NOUC 4Y0UA 4Q0JA 3BM6A 4EBPA 1DJCA 2G2UA 1FCMA 1YLZA 4FCFA 4K0WA 4RYEA 2Y2GA 4HP9A 5IS1A 2EWWA 5EM0A 1XX2A 2WADA 4BQMA 5TFQA 2PYRA 4O01A 4DE2A 3HLGA 4YWZA 2WYXA 5L10A 4DMZA 4FH2A 2JKTM 1M40A 4NXFA 5M1AA 3BYDA 4LRYC 2L0WA 1OTDA 3DTIA 4XT2A 3PBTA 5EECA 4EEPA 3A0SA 1LL9A 4NXGA 2EFXA 1P97A 1ZG4A 3VV4A 3U2AA 1ES5A 3IWIA 3MXQA 4H8RA 2FH5A 3C7VA 2ZC7A 3P7NA 5DTKA 3G6OA 4M3KA 2BTFP 1W79A 3FWLA 1V9YA 3D9YA 1HZOA 3S7NA 4CLCC 1FR6A 4DJ2A 4GD8A 2XK1A 3CAXA 4QJGA 3EGDC 5FAQA 2J8YA 3IWQA 1G6OA 3QP5A 4DJ3A 4E3IA 2R9XA 1SKOB 3CWFA 4Y15A 4LV3A 2J3TD 1LI9A 3GV9A 3A0VA 5E2HA 1ESUA 4UEYA 1GSWA 3V5MA 4JGOA 3JVUA 2ZC5B 4P6ZM 1MWTA 3BQ8A 4N1XA 5FAPA 2Y2MA 1I2SA 5HWWA 1N9OA 3MFDA 1MPLA 1F9IA 2QWSA 1VM1A 2A2LA 2VGJA 2Z2LB 3FV7A 4DRTA 2ZMAA 3T1SA 2M7VA 2O9BA 3ZYTA 5GLBA 1HVBA 4LENA 5I94A 4JXGA 2PRFA 3N8SA 1PFLA 3LI8A 3C4PA 2W3FA 3UPOA 1H8YA 1W7FA 4R4SA 2XLNA 4NXBA 1MKIA 4Z1WA 3VOZA 1XGJA 4E3KA 1E4DA 4HOIA 4I5SA 4HIAA 4DXBA 2ZJ9A 5FI7A 1ALQA 1XJ2A 3IT9A 5MC7A 1NRFA 4PPRA 5TBMB 1MXOA 3HLDA 3T1RA 2HDUA 2OWJA 4IBXA 5KZHA 3QP1A 4X56A 2WAEA 2HPBA 3UNWA 3PTEA 1SDEA 4K08A 5CXWA 2Y59A 3G4PA 4DN0A 5F82A 5FQIA 3WWXA 4JGPA 4RVAA 4OQGA 4HHDA 2JE5A 4DKIA 3N8LA 4ZTKA 3F1NA 1X0OA 2NUPC 2Y2QA 3CITA 2W1TB 3LIDA 3UDXA 3GMWA 3VP2A 4HJ3A 2P9VB 3HLWA 5A92A 4MN7A 4YNRA 3W4QA 2HDRA 3JVVA 3KSHA 4S2OA 2IA2A 2WGVA 3C8CA 3PAEA 1YSPA 1YLPA 1JTDA 4NK3A 3M6BA 4RQ9A 1YLYA 1RCJA 2YKHA 2Y91A 4KQQA 4CPKA 3MQOA 4I3AA 5A8BA 2VV8A 4OQIA 3IH8A 1IKIA 3T1QB 2VK3A 5DTSA 1BULA 5J3WA 4NXEA 1RGZA 3QP8A 5FQ9A 1PZOA 3BQAA 4I39A 2DNSA 1MWUA 3QP4A 3UMEA 2ZBBA 2V0WA 3LYXA 5FQMA 2IWBA 4IUHA 1BTLA 4JXWA 4XXRA 1KE3A 4B9OA 3M2KA 1WA9A 3PXPA 3TRCA 3MQ0A 1ZKJA 4H6JB 1PRQA 3N6IA 3A3EA 4GD6A 3IXHA 3B47A 2JHEA 4BENA 1NZUA 1Z09A 3RTYA 1D1JA 3FC7A 2EXAA 2WKEA 3C5AA 1K56A 4RX3A 4NETA 2XH9A 3B42A 4FUWA 4KZBA 1XXMA 3T4SA 2BG1A 4JGRA 4CLCE 1CI9A 5HWTA 3S7PA 1GHPA 4OQHA 3N8RA 2XDMA 3A3DA 4JKTA 2Y2IA 3IHAA 4Q0HA 3Q07A 3ZVTA 4HEFA 3KSIA 1P0ZA 3RXXA 4O0PA 3AGFA 3FZCA 5CGWA 4GDNA 1PWGA 3IBRA 4QY5A 3VFFA 5DJUA 5CTMA 5A93A 1XJ6A 3KX0X 3T4TA 1SDNA 2DRWA 3ZG0A 3CHWP 2WUQA 2ACGA 2WZZA 1XFQA 3DWKA 4GDBA 4GJ4A 1ODVA 3BFGA 4GW9A 1O7EA 1SKOA 1W63Q 3UDIA 2QJ5A 1ERMA 3P01A 5A90A 4DXCA 3RH8B 1OJGA 2Y2NA 2LB9A 4OOMA 4OLGA 4EUVA 4WLAA 4KG5A 3F1OB 3NDGA 3V50A 3CMZA 1K54A 2WZXA 1SZVA 4NG2A 3IXGA 2R9WA 3UE1A 3VOYA 5AQ9A 1YQSA 4BMWA 1MY8A 3DBAA 1BLHA 4EQ1A 2OSUA 2G2WA 4XT2B 5TJJA 1BLCA 1K38A 2ZMVA 3S4XA 5D3OA 4O8GA 1JWPA 1NXYA 2JKTI 3H9WA 3MZEA 5L07A 3A3IA 2A3UA 4UA9A 5TGFA 4K0XA 3UB8A 3PYPA
chains in the Genus database with same CATH topology
1KDSA 2EX8A 5TR7A 2OV5A 1PI5A 4FCFA 3HL9A 4K0WA 4RYEA 2Y2GA 4R0QA 1K25A 3N4IA 4EUZA 3IF6C 1FCNA 1O07A 4WZ5A 5CHMA 1L2SA 4ZJ1A 4QHCA 4JBFA 3UPNA 1WE4A 4DF6A 3IF5A 4S2MA 3G2ZA 4EQIA 4ZJ3A 1XX2A 2WADA 4BQMA 5KSCA 1ERQA 3HBRA 1PYYA 5HFOA 5TFQA 1S0WA 3UPPA 5CECA 3A3FA 3ITBA 2XR0A 4DE2A 2ZQ8A 3HLGA 1H8ZA 3IF6B 2WYXA 3W8KA 3WS4A 4F94A 2Y2LA 4FH2A 5CHJA 3VFHA 5FASA 2H10A 3OC2A 1N9BA 4QD4A 3O87A 1MBLA 1XP4A 1M40A 3EQVA 1XKZA 4JXSA 3WRZA 2J9PA 2VGKA 5GHYA 3BYDA 5M1AA 2PBYA 3WS2A 2CC1A 3PBTA 5CEBA 1TVFA 5EECA 1LLBA 1LL9A 3TSGA 1SCWA 2Y4AA 3ZDJA 4YFMA 1FOFA 2EFXA 3W4OA 1XPBA 1ZG4A 4Q8IA 3BFEA 3WS0A 5AQ7A 1ES5A 1BSGA 2V1ZA 3IWIA 5F1GA 1KVMA 3HLBA 3PBNA 3QNCA 4H8RA 2Y2OA 5M18A 3C7VA 4EWFA 4ZAMA 5F1FA 1GA0A 5E43A 2ZC7A 3NY4A 4GB7A 3BFDA 4LV2A 4IVIA 5DTKA 5CHUA 1U60A 4M3KA 3VSLA 1W79A 1W8YA 3FWLA 1OMEA 4WM9A 2Y2JA 3VP3A 1HZOA 3ZG5A 1FR6A 3WS1A 1ESIA 1JVJA 4WYYA 3ISGA 1JWVA 3HREA 2XK1A 4GD8A 3VSKA 5E2FA 4BJPA 4N9LA 3OCLA 4KG6A 4QJGA 4OONA 5EVLA 4C6YA 5FAQA 3MZDA 4KG2A 2J8YA 3SS5A 5EVIC 3IWQA 3ZCZA 2ZQ7A 3OPLA 1CEFA 4MNRA 3UN7A 1CEGA 4UA7A 2WGIA 5GLAA 2PU2A 4E3IA 4BLMA 1DJAA 2R9XA 5AQAA 2ZD8A 5EVIA 2WK0A 3Q81A 2X01A 1BT5A 3V3RA 3NCKA 4KZ6A 2IWCA 4OQ0A 4MBHA 2ZQ9A 1YT4A 4LV3A 1IYSA 2H0TA 3LO7A 3M6HA 4S2IA 1K57C 1LI9A 1Q2QA 4UHUA 4OPRA 4WELA 1EWZA 5E2EA 3GVBA 3I7JA 1IELA 3GV9A 3PBRA 4N9KA 3G31A 1NYMA 4X55A 5E2HA 3DW0A 2EXBA 1TEMA 1QMFA 1ESUA 3IHBA 5DVAA 3V5MA 4B88A 4C3QA 1IYOA 2ZC5B 1PW8A 1VQQA 1MWTA 4N1XA 5FAPA 1K4FA 2Y2MA 1I2SA 4OLDA 3MFDA 1MPLA 5FQJA 1ES4A 4PM9A 1VM1A 3G2YA 3ZNTA 4E3NA 2GDNA 2VGJA 2Z2LB 4X68A 4KQOA 3FV7A 4X6TA 4BL2A 4DRTA 3G30A 3IH9A 4FSFA 3LY4A 4X69A 4JLFA 3VP1A 4MEZA 1Q2PA 4IBRA 4BD0A 1FCOA 3MZFA 2ZMAA 1YMSA 5A91A 3HLFA 4DDSA 4DDYA 4BD1A 4MBFA 1L0DA 5FDHA 3HLEA 2Q9MA 2E8IA 2I72A 5E2GA 2V20A 3BFFA 5HARA 4N1HA 5GLBA 3PBQA 1HVBA 1KGEA 3MBZA 3Q1FA 3EQUA 3WRTA 5GL9A 1NJ4A 2FFYA 4LENA 4OOYA 1G6AA 5HAQA 2ZM2A 4ZJ2A 1NZOA 5I94A 3NIAA 4JXGA 3G35A 2HDQA 4KZ3A 3N8SA 3AGDA 3VP0A 4C75A 1JWZA 5CRFA 3UDFA 3C4OA 3WS5A 4EBNA 1K56D 3C4PA 5CEDA 5FI6A 5DTTA 3OPHA 2EX2A 3UPOA 4LV0A 1H8YA 4ZDXA 1KVLA 1W7FA 4R4SA 4R4RA 1BLSA 2XLNA 3FKVA 3ZGAB 4PM5A 1PWDA 3IXDA 4IVKA 1MKIA 3VOZA 1FSWA 1XGJA 4E3KA 1IKGA 1E4DA 4S2NC 4KZAA 4Y7PA 3GQZA 3LCEA 4HBTA 4DXBA 3CG5A 2ZJ9A 4K91A 5FI7A 1ALQA 4OPYA 1RP5A 4U0XA 2JBFA 3IT9A 4EBLA 1NRFA 4KZ7A 2ZC6B 3OPPA 4LV1A 5M19A 3RXWA 4PPRA 1CK3A 4PMAA 4WZ5C 4S2LA 1MXOA 5L2FA 1L0EA 3HLDA 4R23A 2XD5A 3JYIA 3W4PA 2HDUA 3CZDA 1YLTA 3M2JA 4OVDA 3NI9A 4IBXA 4UA6A 5KZHA 4X56A 1XGIA 2WAEA 2HPBA 1PI4A 4KZ9A 3UNWA 3PTEA 1SDEA 2ZQAA 2Y59A 3G4PA 1TDLA 3IQAA 5CXWA 1MWRA 5F82A 5FQIA 3WWXA 2XD1A 4RVAA 4OQGA 5CTNA 5JYOA 4OPQA 1PZPA 1WYCA 4ID4A 2JE5A 4WZ4A 4DKIA 3NDEA 3N8LA 4ZTKA 3DTMA 2Y2HA 4MBKA 2Y2QA 3BECA 2ZQDA 2OLVA 4R1GA 1HD8A 2UWXA 3HVFA 3DWZA 3UDXA 4PM8A 3GMWA 3LY3A 2WGWB 3IXBA 3VP2A 4DE0A 1YMXA 4JF4A 2QPNA 2P9VB 3HLWA 1K6SA 5FQQA 5A92A 3W4QA 2HDRA 1SHVA 5F83A 5HX9A 1J9MA 3AGEA 3Q7ZA 3Q82A 1AXBA 2ZC3B 3C7UA 1KE4A 4S2OA 3SH8A 2WGVA 3O86A 5EVIB 2XFTA 3PAEA 1IYQA 1YLPA 3E2KA 4OKPA 1JTDA 1RGYA 1K55C 4NK3A 3M6BA 4JF6A 4DE1A 1YLYA 1JTGA 5HL1A 5HAIA 3IWOA 3VP4A 5KSHA 1CI8A 1RCJA 3ZVWA 2Y91A 4KQQA 4CPKA 4E3JA 4S2KA 2XFSA 3O3VA 3GTCA 1DY6A 1BUEA 1KE0A 1K57A 3ZFZA 4OQIA 3IH8A 2V2FF 4EV4A 3PAGA 1IKIA 2Z2MB 2JC7A 4WEJA 3FYZA 3LEZA 1BULA 1PW1A 2ZQCA 3NC8A 5DTSA 5HAPA 5DF7A 4OPZA 4L0LA 5EOEA 3IF6A 4KQRA 1ZG6A 5J8XA 1RGZA 2DCFA 4OH0A 2H0YA 2J7VA 4JPMA 1PZOA 1WYBA 3HUOA 5FQ9A 2XGNA 5FI2A 2DNSA 4FD8A 2HP6A 4R3BA 3V39A 1MWUA 4ZBEA 4E3MA 4OOLA 4IEDA 1K6RA 4LCMA 4FH4A 4QB8A 2WKIA 3BRMA 2A49A 5FA7A 5FQMA 2IWBA 2Y2KA 1BTLA 1Z6FA 4UAAA 3S22A 4JXWA 1MWSA 4OP5A 1BZAA 4E3LA 4XXRA 1KE3A 3M2KA 1GCEA 5FATA 4P6BA 3OZHA 4KENB 1L0FA 5DF8A 5EVID 3TG9A 3ITAA 1ZKJA 2BLSA 1L0GA 1S6RA 2B5RA 2ZC4B 4RA7A 3BLMA 4O7DA 1FR1A 3D4FA 3N6IA 1KGGA 3A3EA 1KGFA 2HDSA 1KDWA 3A3JA 3MXRA 5AQBA 5U47A 1IYPA 4GD6A 3ZG8B 3IXHA 3FKWA 5EE8A 2WKHA 5FQKA 1PIOA 2QMIA 5JYPA 4S2JA 1I5QA 4BENA 2ZM0A 3E2LA 1NZUA 1C3BA 4U0TA 3GRJA 4HBUA 4Z9QA 4E3OA 3VMAA 3CJMA 2EXAA 2WKEA 4R3JA 1QMEA 1PWCA 5HW3A 2QZ6A 1GHMA 3C5AA 1K56A 4N92A 4RX2A 4RX3A 4NETA 4WMCA 2XH9A 3O88A 4KZBA 3OCNA 3S1YA 1XXMA 4KZ4A 2BG1A 5GHXA 3GSGA 3RJUA 2HP9A 2XEPA 4QU3A 5GLCA 1SKFA 1LI0A 2H5SA 2RCXA 3BFCA 2WGWA 1CI9A 3HLCA 4D2OA 2EX6A 1K54C 1GHPA 3ZHHA 4OQHA 2PU4A 4KZ5A 3OPRA 3UE3A 1XA7A 5GHZA 3MXSA 3N8RA 1NY0A 2XDMA 3HUNA 3A3DA 3QHYA 4JKTA 2P9VA 3GR2A 4GNUA 2Y2IA 3QNBA 3IHAA 3Q07A 3ZVTA 4HEFA 4XUXA 3BEBA 4GZBA 3SH7A 2EFUA 3RXXA 3AGFA 3FZCA 2P74A 5CGWA 2WAFA 2Q9NA 5FAOA 4GDNA 5BOHA 2Y2PA 4A5RA 1G68A 1PWGA 2IWDA 4QY5A 5IHVA 5CGXA 3UO9A 3VFFA 5CTMA 4MLLA 4S2NA 5EPHA 4QY6A 4S2PA 5A93A 1M6KA 1FQGA 4Y0TA 1GHIA 4P0MA 3P98A 3Q7VB 4Y0OA 1I2WA 1ES2A 4CJNA 1XA1A 2JCHA 4PM6A 1SDNA 2DRWA 1E3UD 3ZG0A 2WUQA 2HP5A 4GKUA 3MKFA 4WEKA 2WZZA 1N4OA 3DWKA 2XF3A 3PBSA 3SS4A 4WBGA 4GDBA 5CGSA 1BLPA 1Y54A 4X53A 1ONGA 3BFGA 2FFFB 1O7EA 2XQZA 3ZNYA 3UDIA 1E25A 1NYYA 2ZM8A 3Q7VA 5FSRA 2ZLYA 4KZ8A 1ERMA 1E3UA 5CERA 3ZG7B 2C6WB 1TDGA 5A90A 1YM1A 4DXCA 1EROA 2RL3A 2Y2NA 4GOGA 4E6WA 4B4XA 3ZG9B 3UE0A 3HUMA 4HESA 4U3TA 4YINA 4DE3A 3BLSA 4OOMA 4OLGA 5EOOA 5G18A 3SS3A 1W8QA 3NBLA 1ONHA 4KG5A 3V3SA 3NDGA 4JF5A 4OP8A 3TOIA 3SOIA 3V50A 3CMZA 3G32A 3MKEA 1K54A 5GLDA 2WZXA 3N7WA 1FSYA 1ZC2A 3IXGA 2R9WA 3B3XA 3UE1A 2EX9A 3VOYA 5AQ9A 1YQSA 2OLUA 1MY8A 3P09A 1BLHA 5KMWA 2OSUA 2G2WA 5EUAA 4JXVA 1K55A 1LL5A 2C5WB 4P87A 4PM7A 1DJBA 4E6XA 1GA9A 1W5DA 4XUZA 1BLCA 4GN2A 1YLJA 4LCLA 4WMCD 1IEMA 2Y55A 5DF9A 1K38A 3SH9A 1K4EA 3S4XA 4BL3A 5D3OA 2X71A 4Y0UA 1JWPA 1NXYA 2X02A 4P85A 1ES3A 3BM6A 4EBPA 3G34A 1YLWA 2J9OA 3MZEA 1H5XA 1DJCA 1LHYA 2G2UA 3UY6A 4B4ZA 3A3IA 2A3UA 1FCMA 4UA9A 5TGFA 1HTZA 1YLZA 3PBOA 4K0XA 1EI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KDS A;  2EX8 A;  5TR7 A;  2OV5 A;  1PI5 A;  4FCF A;  3HL9 A;  4K0W A;  4RYE A;  2Y2G A;  4R0Q A;  1K25 A;  3N4I A;  4EUZ A;  3IF6 C;  1FCN A;  1O07 A;  4WZ5 A;  5CHM A;  1L2S A;  4ZJ1 A;  4QHC A;  4JBF A;  3UPN A;  1WE4 A;  4DF6 A;  3IF5 A;  4S2M A;  3G2Z A;  4EQI A;  4ZJ3 A;  1XX2 A;  2WAD A;  4BQM A;  5KSC A;  1ERQ A;  3HBR A;  1PYY A;  5HFO A;  5TFQ A;  1S0W A;  3UPP A;  5CEC A;  3A3F A;  3ITB A;  2XR0 A;  4DE2 A;  2ZQ8 A;  3HLG A;  1H8Z A;  3IF6 B;  2WYX A;  3W8K A;  3WS4 A;  4F94 A;  2Y2L A;  4FH2 A;  5CHJ A;  3VFH A;  5FAS A;  2H10 A;  3OC2 A;  1N9B A;  4QD4 A;  3O87 A;  1MBL A;  1XP4 A;  1M40 A;  3EQV A;  1XKZ A;  4JXS A;  3WRZ A;  2J9P A;  2VGK A;  5GHY A;  3BYD A;  5M1A A;  2PBY A;  3WS2 A;  2CC1 A;  3PBT A;  5CEB A;  1TVF A;  5EEC A;  1LLB A;  1LL9 A;  3TSG A;  1SCW A;  2Y4A A;  3ZDJ A;  4YFM A;  1FOF A;  2EFX A;  3W4O A;  1XPB A;  1ZG4 A;  4Q8I A;  3BFE A;  3WS0 A;  5AQ7 A;  1ES5 A;  1BSG A;  2V1Z A;  3IWI A;  5F1G A;  1KVM A;  3HLB A;  3PBN A;  3QNC A;  4H8R A;  2Y2O A;  5M18 A;  3C7V A;  4EWF A;  4ZAM A;  5F1F A;  1GA0 A;  5E43 A;  2ZC7 A;  3NY4 A;  4GB7 A;  3BFD A;  4LV2 A;  4IVI A;  5DTK A;  5CHU A;  1U60 A;  4M3K A;  3VSL A;  1W79 A;  1W8Y A;  3FWL A;  1OME A;  4WM9 A;  2Y2J A;  3VP3 A;  1HZO A;  3ZG5 A;  1FR6 A;  3WS1 A;  1ESI A;  1JVJ A;  4WYY A;  3ISG A;  1JWV A;  3HRE A;  2XK1 A;  4GD8 A;  3VSK A;  5E2F A;  4BJP A;  4N9L A;  3OCL A;  4KG6 A;  4QJG A;  4OON A;  5EVL A;  4C6Y A;  5FAQ A;  3MZD A;  4KG2 A;  2J8Y A;  3SS5 A;  5EVI C;  3IWQ A;  3ZCZ A;  2ZQ7 A;  3OPL A;  1CEF A;  4MNR A;  3UN7 A;  1CEG A;  4UA7 A;  2WGI A;  5GLA A;  2PU2 A;  4E3I A;  4BLM A;  1DJA A;  2R9X A;  5AQA A;  2ZD8 A;  5EVI A;  2WK0 A;  3Q81 A;  2X01 A;  1BT5 A;  3V3R A;  3NCK A;  4KZ6 A;  2IWC A;  4OQ0 A;  4MBH A;  2ZQ9 A;  1YT4 A;  4LV3 A;  1IYS A;  2H0T A;  3LO7 A;  3M6H A;  4S2I A;  1K57 C;  1LI9 A;  1Q2Q A;  4UHU A;  4OPR A;  4WEL A;  1EWZ A;  5E2E A;  3GVB A;  3I7J A;  1IEL A;  3GV9 A;  3PBR A;  4N9K A;  3G31 A;  1NYM A;  4X55 A;  5E2H A;  3DW0 A;  2EXB A;  1TEM A;  1QMF A;  1ESU A;  3IHB A;  5DVA A;  3V5M A;  4B88 A;  4C3Q A;  1IYO A;  2ZC5 B;  1PW8 A;  1VQQ A;  1MWT A;  4N1X A;  5FAP A;  1K4F A;  2Y2M A;  1I2S A;  4OLD A;  3MFD A;  1MPL A;  5FQJ A;  1ES4 A;  4PM9 A;  1VM1 A;  3G2Y A;  3ZNT A;  4E3N A;  2GDN A;  2VGJ A;  2Z2L B;  4X68 A;  4KQO A;  3FV7 A;  4X6T A;  4BL2 A;  4DRT A;  3G30 A;  3IH9 A;  4FSF A;  3LY4 A;  4X69 A;  4JLF A;  3VP1 A;  4MEZ A;  1Q2P A;  4IBR A;  4BD0 A;  1FCO A;  3MZF A;  2ZMA A;  1YMS A;  5A91 A;  3HLF A;  4DDS A;  4DDY A;  4BD1 A;  4MBF A;  1L0D A;  5FDH A;  3HLE A;  2Q9M A;  2E8I A;  2I72 A;  5E2G A;  2V20 A;  3BFF A;  5HAR A;  4N1H A;  5GLB A;  3PBQ A;  1HVB A;  1KGE A;  3MBZ A;  3Q1F A;  3EQU A;  3WRT A;  5GL9 A;  1NJ4 A;  2FFY A;  4LEN A;  4OOY A;  1G6A A;  5HAQ A;  2ZM2 A;  4ZJ2 A;  1NZO A;  5I94 A;  3NIA A;  4JXG A;  3G35 A;  2HDQ A;  4KZ3 A;  3N8S A;  3AGD A;  3VP0 A;  4C75 A;  1JWZ A;  5CRF A;  3UDF A;  3C4O A;  3WS5 A;  4EBN A;  1K56 D;  3C4P A;  5CED A;  5FI6 A;  5DTT A;  3OPH A;  2EX2 A;  3UPO A;  4LV0 A;  1H8Y A;  4ZDX A;  1KVL A;  1W7F A;  4R4S A;  4R4R A;  1BLS A;  2XLN A;  3FKV A;  3ZGA B;  4PM5 A;  1PWD A;  3IXD A;  4IVK A;  1MKI A;  3VOZ A;  1FSW A;  1XGJ A;  4E3K A;  1IKG A;  1E4D A;  4S2N C;  4KZA A;  4Y7P A;  3GQZ A;  3LCE A;  4HBT A;  4DXB A;  3CG5 A;  2ZJ9 A;  4K91 A;  5FI7 A;  1ALQ A;  4OPY A;  1RP5 A;  4U0X A;  2JBF A;  3IT9 A;  4EBL A;  1NRF A;  4KZ7 A;  2ZC6 B;  3OPP A;  4LV1 A;  5M19 A;  3RXW A;  4PPR A;  1CK3 A;  4PMA A;  4WZ5 C;  4S2L A;  1MXO A;  5L2F A;  1L0E A;  3HLD A;  4R23 A;  2XD5 A;  3JYI A;  3W4P A;  2HDU A;  3CZD A;  1YLT A;  3M2J A;  4OVD A;  3NI9 A;  4IBX A;  4UA6 A;  5KZH A;  4X56 A;  1XGI A;  2WAE A;  2HPB A;  1PI4 A;  4KZ9 A;  3UNW A;  3PTE A;  1SDE A;  2ZQA A;  2Y59 A;  3G4P A;  1TDL A;  3IQA A;  5CXW A;  1MWR A;  5F82 A;  5FQI A;  3WWX A;  2XD1 A;  4RVA A;  4OQG A;  5CTN A;  5JYO A;  4OPQ A;  1PZP A;  1WYC A;  4ID4 A;  2JE5 A;  4WZ4 A;  4DKI A;  3NDE A;  3N8L A;  4ZTK A;  3DTM A;  2Y2H A;  4MBK A;  2Y2Q A;  3BEC A;  2ZQD A;  2OLV A;  4R1G A;  1HD8 A;  2UWX A;  3HVF A;  3DWZ A;  3UDX A;  4PM8 A;  3GMW A;  3LY3 A;  2WGW B;  3IXB A;  3VP2 A;  4DE0 A;  1YMX A;  4JF4 A;  2QPN A;  2P9V B;  3HLW A;  1K6S A;  5FQQ A;  5A92 A;  3W4Q A;  2HDR A;  1SHV A;  5F83 A;  5HX9 A;  1J9M A;  3AGE A;  3Q7Z A;  3Q82 A;  1AXB A;  2ZC3 B;  3C7U A;  1KE4 A;  4S2O A;  3SH8 A;  2WGV A;  3O86 A;  5EVI B;  2XFT A;  3PAE A;  1IYQ A;  1YLP A;  3E2K A;  4OKP A;  1JTD A;  1RGY A;  1K55 C;  4NK3 A;  3M6B A;  4JF6 A;  4DE1 A;  1YLY A;  1JTG A;  5HL1 A;  5HAI A;  3IWO A;  3VP4 A;  5KSH A;  1CI8 A;  1RCJ A;  3ZVW A;  2Y91 A;  4KQQ A;  4CPK A;  4E3J A;  4S2K A;  2XFS A;  3O3V A;  3GTC A;  1DY6 A;  1BUE A;  1KE0 A;  1K57 A;  3ZFZ A;  4OQI A;  3IH8 A;  2V2F F;  4EV4 A;  3PAG A;  1IKI A;  2Z2M B;  2JC7 A;  4WEJ A;  3FYZ A;  3LEZ A;  1BUL A;  1PW1 A;  2ZQC A;  3NC8 A;  5DTS A;  5HAP A;  5DF7 A;  4OPZ A;  4L0L A;  5EOE A;  3IF6 A;  4KQR A;  1ZG6 A;  5J8X A;  1RGZ A;  2DCF A;  4OH0 A;  2H0Y A;  2J7V A;  4JPM A;  1PZO A;  1WYB A;  3HUO A;  5FQ9 A;  2XGN A;  5FI2 A;  2DNS A;  4FD8 A;  2HP6 A;  4R3B A;  3V39 A;  1MWU A;  4ZBE A;  4E3M A;  4OOL A;  4IED A;  1K6R A;  4LCM A;  4FH4 A;  4QB8 A;  2WKI A;  3BRM A;  2A49 A;  5FA7 A;  5FQM A;  2IWB A;  2Y2K A;  1BTL A;  1Z6F A;  4UAA A;  3S22 A;  4JXW A;  1MWS A;  4OP5 A;  1BZA A;  4E3L A;  4XXR A;  1KE3 A;  3M2K A;  1GCE A;  5FAT A;  4P6B A;  3OZH A;  4KEN B;  1L0F A;  5DF8 A;  5EVI D;  3TG9 A;  3ITA A;  1ZKJ A;  2BLS A;  1L0G A;  1S6R A;  2B5R A;  2ZC4 B;  4RA7 A;  3BLM A;  4O7D A;  1FR1 A;  3D4F A;  3N6I A;  1KGG A;  3A3E A;  1KGF A;  2HDS A;  1KDW A;  3A3J A;  3MXR A;  5AQB A;  5U47 A;  1IYP A;  4GD6 A;  3ZG8 B;  3IXH A;  3FKW A;  5EE8 A;  2WKH A;  5FQK A;  1PIO A;  2QMI A;  5JYP A;  4S2J A;  1I5Q A;  4BEN A;  2ZM0 A;  3E2L A;  1NZU A;  1C3B A;  4U0T A;  3GRJ A;  4HBU A;  4Z9Q A;  4E3O A;  3VMA A;  3CJM A;  2EXA A;  2WKE A;  4R3J A;  1QME A;  1PWC A;  5HW3 A;  2QZ6 A;  1GHM A;  3C5A A;  1K56 A;  4N92 A;  4RX2 A;  4RX3 A;  4NET A;  4WMC A;  2XH9 A;  3O88 A;  4KZB A;  3OCN A;  3S1Y A;  1XXM A;  4KZ4 A;  2BG1 A;  5GHX A;  3GSG A;  3RJU A;  2HP9 A;  2XEP A;  4QU3 A;  5GLC A;  1SKF A;  1LI0 A;  2H5S A;  2RCX A;  3BFC A;  2WGW A;  1CI9 A;  3HLC A;  4D2O A;  2EX6 A;  1K54 C;  1GHP A;  3ZHH A;  4OQH A;  2PU4 A;  4KZ5 A;  3OPR A;  3UE3 A;  1XA7 A;  5GHZ A;  3MXS A;  3N8R A;  1NY0 A;  2XDM A;  3HUN A;  3A3D A;  3QHY A;  4JKT A;  2P9V A;  3GR2 A;  4GNU A;  2Y2I A;  3QNB A;  3IHA A;  3Q07 A;  3ZVT A;  4HEF A;  4XUX A;  3BEB A;  4GZB A;  3SH7 A;  2EFU A;  3RXX A;  3AGF A;  3FZC A;  2P74 A;  5CGW A;  2WAF A;  2Q9N A;  5FAO A;  4GDN A;  5BOH A;  2Y2P A;  4A5R A;  1G68 A;  1PWG A;  2IWD A;  4QY5 A;  5IHV A;  5CGX A;  3UO9 A;  3VFF A;  5CTM A;  4MLL A;  4S2N A;  5EPH A;  4QY6 A;  4S2P A;  5A93 A;  1M6K A;  1FQG A;  4Y0T A;  1GHI A;  4P0M A;  3P98 A;  3Q7V B;  4Y0O A;  1I2W A;  1ES2 A;  4CJN A;  1XA1 A;  2JCH A;  4PM6 A;  1SDN A;  2DRW A;  1E3U D;  3ZG0 A;  2WUQ A;  2HP5 A;  4GKU A;  3MKF A;  4WEK A;  2WZZ A;  1N4O A;  3DWK A;  2XF3 A;  3PBS A;  3SS4 A;  4WBG A;  4GDB A;  5CGS A;  1BLP A;  1Y54 A;  4X53 A;  1ONG A;  3BFG A;  2FFF B;  1O7E A;  2XQZ A;  3ZNY A;  3UDI A;  1E25 A;  1NYY A;  2ZM8 A;  3Q7V A;  5FSR A;  2ZLY A;  4KZ8 A;  1ERM A;  1E3U A;  5CER A;  3ZG7 B;  2C6W B;  1TDG A;  5A90 A;  1YM1 A;  4DXC A;  1ERO A;  2RL3 A;  2Y2N A;  4GOG A;  4E6W A;  4B4X A;  3ZG9 B;  3UE0 A;  3HUM A;  4HES A;  4U3T A;  4YIN A;  4DE3 A;  3BLS A;  4OOM A;  4OLG A;  5EOO A;  5G18 A;  3SS3 A;  1W8Q A;  3NBL A;  1ONH A;  4KG5 A;  3V3S A;  3NDG A;  4JF5 A;  4OP8 A;  3TOI A;  3SOI A;  3V50 A;  3CMZ A;  3G32 A;  3MKE A;  1K54 A;  5GLD A;  2WZX A;  3N7W A;  1FSY A;  1ZC2 A;  3IXG A;  2R9W A;  3B3X A;  3UE1 A;  2EX9 A;  3VOY A;  5AQ9 A;  1YQS A;  2OLU A;  1MY8 A;  3P09 A;  1BLH A;  5KMW A;  2OSU A;  2G2W A;  5EUA A;  4JXV A;  1K55 A;  1LL5 A;  2C5W B;  4P87 A;  4PM7 A;  1DJB A;  4E6X A;  1GA9 A;  1W5D A;  4XUZ A;  1BLC A;  4GN2 A;  1YLJ A;  4LCL A;  4WMC D;  1IEM A;  2Y55 A;  5DF9 A;  1K38 A;  3SH9 A;  1K4E A;  3S4X A;  4BL3 A;  5D3O A;  2X71 A;  4Y0U A;  1JWP A;  1NXY A;  2X02 A;  4P85 A;  1ES3 A;  3BM6 A;  4EBP A;  3G34 A;  1YLW A;  2J9O A;  3MZE A;  1H5X A;  1DJC A;  1LHY A;  2G2U A;  3UY6 A;  4B4Z A;  3A3I A;  2A3U A;  1FCM A;  4UA9 A;  5TGF A;  1HTZ A;  1YLZ A;  3PBO A;  4K0X A;  1EI5 A; 
#chains in the Genus database with same CATH topology
 2EX8 A;  2OV5 A;  1N9L A;  4R0Q A;  2WKP A;  3T1X A;  4HI4 A;  1FCN A;  1FIL A;  5CHM A;  3RFB A;  3CI6 A;  1IOU A;  4S2M A;  3DTE A;  4ZJ3 A;  3HBR A;  1PYY A;  5HFO A;  5CEC A;  3UPP A;  2XR0 A;  3D72 A;  3IF6 B;  4F94 A;  2Y2L A;  3OC2 A;  1N9B A;  5IT5 A;  3NOT C;  1XP4 A;  1OT6 A;  1OPX A;  2J9P A;  3LR0 A;  5G4Z A;  2PBY A;  3WS2 A;  3TW8 A;  5F6A A;  2PDR A;  1LLB A;  1SCW A;  2VEA A;  3W4O A;  1XPB A;  1BSG A;  3MJQ A;  3S7O A;  3L7H A;  3QNC A;  4EWF A;  5F1F A;  1GA0 A;  3MMH A;  5E43 A;  3NY4 A;  4GB7 A;  3BFD A;  4LV2 A;  2VZW A;  3VSL A;  1W8Y A;  2Y2J A;  3VP3 A;  2HJ9 C;  2VLG A;  3WS1 A;  3B33 A;  3U4L P;  1YKD A;  1JWV A;  4BJP A;  4KG6 A;  5EVL A;  4X25 A;  5EVI C;  1CEF A;  4MNR A;  2V1A A;  4UA7 A;  2GNX A;  3UN7 A;  5GLA A;  4D60 A;  4BLM A;  1Y4O A;  2ZD8 A;  5EVI A;  4ZRR A;  2X01 A;  1BT5 A;  4KZ6 A;  1JNU A;  4OQ0 A;  1YT4 A;  3BJN A;  2H0T A;  3M6H A;  1K57 C;  4UHU A;  4WEL A;  5E2E A;  3I7J A;  4PKY A;  1IEL A;  4N9K A;  1NYM A;  2VGL M;  3IHB A;  5HZH A;  4C3Q A;  1IYO A;  1DP9 A;  1VQQ A;  2W27 A;  3SW1 A;  4G3K A;  1XJ4 A;  5FQJ A;  4PM9 A;  4QPR A;  4KQO A;  3VP1 A;  5HD3 A;  4MEZ A;  1Q2P A;  4IBR A;  4BD0 A;  1W63 M;  4L9E A;  2B18 A;  4DDY A;  4BD1 A;  4L9G A;  1H0M A;  5FDH A;  3HLE A;  2I72 A;  5E2G A;  2L4R A;  5HAR A;  4N1H A;  3MBZ A;  3Q1F A;  5GL9 A;  1NJ4 A;  1G6A A;  2HDQ A;  1P9R A;  3IBJ A;  5G4Y A;  4C75 A;  3UDF A;  3C4O A;  4EBN A;  2BAS A;  1K56 D;  4PKY G;  3OPH A;  2EX2 A;  3FKV A;  2PT7 A;  2HZ5 A;  1V9Z A;  1FSW A;  1H8M A;  4GHI B;  4HBT A;  4EES A;  2INW A;  2JBF A;  3LGO A;  3T4L A;  1BYW A;  2ZC6 B;  4LV1 A;  5M19 A;  2J3T C;  5DFY A;  2WKR A;  1CK3 A;  1VEU A;  5L2F A;  4UQI M;  2XD5 A;  1NLZ A;  3W4P A;  1S1Y A;  3TE8 A;  3NI9 A;  4UA6 A;  3UB6 A;  4EER A;  4ESP A;  2PR5 A;  1PI4 A;  1F2K A;  4HH3 A;  2ZQA A;  1LT0 A;  3IQA A;  2XD1 A;  5JYO A;  4OPQ A;  3SZT A;  1NRJ A;  3NDE A;  2K7S A;  5EVE A;  5IU1 A;  2Y2H A;  2A24 B;  1HD8 A;  3BWL A;  2UWX A;  2B02 A;  4DE0 A;  4IJG A;  1YMX A;  4JF4 A;  5LBR A;  2K2N A;  3UB7 A;  3TJZ C;  5EM1 A;  3AGE A;  3Q7Z A;  1G28 A;  3C7U A;  1KE4 A;  4OKP A;  1RGY A;  5HL1 A;  3ZVW A;  4EU0 A;  4E3J A;  2XFS A;  1K57 A;  3FPW A;  2V2F F;  4WEJ A;  3BY9 A;  3NC8 A;  3LEZ A;  5DF7 A;  4OPZ A;  3IF6 A;  5DKL A;  2DCF A;  2H0Y A;  3DAV A;  5FI2 A;  3K3D A;  4R70 A;  4IED A;  2WKI A;  3BRM A;  2A49 A;  2VV7 A;  4GLQ A;  3F1P A;  2GX5 A;  4E3L A;  3MQQ A;  1GCE A;  1OTA A;  2OWH A;  3T4K A;  5DF8 A;  2XSS A;  3BLM A;  4GS9 B;  1FR1 A;  5HD5 A;  1F5M A;  1KGG A;  1KGF A;  5AQB A;  2J3W A;  4KUO A;  3ZG8 B;  3FKW A;  3K2N A;  4IHQ A;  2PBD P;  2WKH A;  2QMI A;  5HPI A;  5JYP A;  3MFX A;  4S2J A;  4U0T A;  5J4E A;  4Z9Q A;  3VMA A;  4Y3I A;  4Y2F A;  1GHM A;  3LR4 A;  4RX2 A;  2Z6D A;  3ULF A;  4EW7 A;  3LIC A;  3RJU A;  3F1O A;  4LRZ E;  3BFC A;  2WGW A;  4KQD A;  2EX6 A;  1S4S A;  3NOP C;  3R4K A;  1OTI A;  2CMN A;  4CLC B;  5GHZ A;  1NY0 A;  2P9V A;  2AVX A;  4XUX A;  3HCY A;  4UQI S;  1KOU A;  2WAF A;  5FAO A;  2IWD A;  5CGX A;  4MLL A;  4S2N A;  1M6K A;  4P0M A;  3P98 A;  4GS9 A;  3Q7V B;  4Y0O A;  1H3Q A;  1XA1 A;  2JCH A;  2Y8H A;  4GKU A;  2HP5 A;  1N4O A;  4WBG A;  3L9K A;  1ONG A;  1DP6 A;  4G3W A;  3BW6 A;  5TBM A;  3KSF A;  1NYY A;  2ZM8 A;  2V8F A;  2ZLY A;  4KZ8 A;  5CER A;  4B4X A;  3ZG9 B;  4U3T A;  1D06 A;  5AVE A;  1W8Q A;  3NBL A;  3EOI A;  3UE6 A;  3V3S A;  5FEF A;  4OP8 A;  1A0K A;  3TOI A;  2MJ6 A;  1VET B;  3MKE A;  1P9W A;  1PNE A;  5GLD A;  3OBF A;  3B3X A;  4Y17 A;  5EUA A;  4JXV A;  2J80 A;  1K55 A;  3C38 A;  1LL5 A;  3UMD A;  2C5W B;  4PM7 A;  1DJB A;  1GA9 A;  4XUZ A;  4GN2 A;  3SH9 A;  1VET A;  2X71 A;  1ES3 A;  2JN7 A;  3G34 A;  2J9O A;  3A0R A;  2V9A A;  4BWI A;  2JKR M;  3R7W A;  5HDD A;  5TR7 A;  1PI5 A;  4B93 A;  4WF0 A;  2QJ7 A;  2KX6 A;  1K25 A;  4EUZ A;  2VA0 A;  3FPV A;  1S4R A;  4ZJ1 A;  4M4X A;  1WE4 A;  2QYB A;  3IF5 A;  4EQI A;  5KSC A;  5I5L A;  4GHI A;  1ERQ A;  2ZL1 A;  1S0W A;  1MZU A;  2Y79 A;  2ZQ8 A;  4R3A A;  1H8Z A;  3W8K A;  3WS4 A;  4F3L B;  5CHJ A;  3VE4 A;  5FAS A;  1TS0 A;  1LSX A;  2B95 A;  1MBL A;  3WRZ A;  2VGK A;  5GHY A;  1MKM A;  2W3G A;  2CC1 A;  5CEB A;  3GEC A;  1FOF A;  4Q8I A;  3BFE A;  3KO6 A;  3WS0 A;  5AQ7 A;  4HP4 A;  1KVM A;  3HLB A;  3ICY A;  1Y28 A;  5M18 A;  3EWK A;  2M7U A;  1F98 A;  4IVI A;  4R6L A;  3NJA A;  1OME A;  4WM9 A;  3ZG5 A;  2QHK A;  3HRE A;  3VSK A;  4OON A;  1HLU P;  3MZD A;  3SS5 A;  2ZQ7 A;  3OPL A;  3PHY A;  2UV0 E;  5AQA A;  3Q81 A;  1TS8 A;  2IWC A;  4MBH A;  2ZQ9 A;  5F5Y A;  1IYS A;  3LO7 A;  2W1R A;  4X1L A;  3S7Q A;  1Q2Q A;  4OPR A;  1EWZ A;  3GVB A;  2JKG A;  1LSW A;  3G31 A;  4HY8 A;  4X55 A;  2HJE A;  3DW0 A;  1QMF A;  5DVA A;  1AWI A;  1PW8 A;  3JPU A;  1CF0 A;  1K4F A;  4OLD A;  1ES4 A;  4MN5 A;  1XFN A;  3KSG A;  4X68 A;  4X6T A;  5L8M A;  3G30 A;  3IH9 A;  3LY4 A;  4EEU A;  4JLF A;  1VB6 A;  1FCO A;  3MZF A;  5CX7 A;  1YMS A;  5A91 A;  4MBF A;  1L0D A;  2E8I A;  1LSV A;  3PBQ A;  3EEH A;  3EQU A;  2O99 A;  2FFY A;  5HAQ A;  3CUE C;  1K0K A;  4ZJ2 A;  3NIA A;  5DJT A;  4R38 A;  1UWP X;  1JWZ A;  1CQA A;  3LIF A;  5DFX A;  5CED A;  1DRM A;  5FI6 A;  4ZDX A;  4R4R A;  3IS2 A;  1PWD A;  3IXD A;  4IVK A;  2OAP 1;  3H7W B;  4IUK A;  2OAQ 1;  4S2N C;  4QWO A;  3CPT B;  3GQZ A;  3LCE A;  4K91 A;  4OPY A;  3PR6 A;  4EBL A;  3OPP A;  3RXW A;  4PMA A;  4PHT A;  4S2L A;  4WZ5 C;  1L0E A;  4R23 A;  3JYI A;  2R78 A;  2GJ3 A;  2K31 A;  5AVF A;  1XGI A;  1TDL A;  1MWR A;  5CTN A;  3E98 A;  1WYC A;  2HGV A;  4MBK A;  4CLC D;  2D02 A;  3BEC A;  2QKP A;  2ZQD A;  2OLV A;  4CLC A;  4R1G A;  3LY3 A;  2WGW B;  2QPN A;  4ARZ B;  5FQQ A;  1K6S A;  1FIK A;  1S66 L;  3W2Z A;  1SHV A;  5HX9 A;  1J9M A;  3Q82 A;  1AXB A;  5FEG A;  1IYQ A;  3E2K A;  3IX4 A;  4DE1 A;  1JTG A;  3IWO A;  1CI8 A;  1XJ3 A;  5F68 A;  4MMN A;  3O3V A;  3GTC A;  1DY6 A;  1IFQ A;  4LGW A;  4EV4 A;  3PAG A;  2Z2M B;  4BBV A;  3FYZ A;  5HAP A;  1PW1 A;  5FL3 A;  1T1A A;  2JKF A;  4L0L A;  4KQR A;  5EOE A;  2OOL A;  1TS6 A;  4OH0 A;  2J7V A;  3HUO A;  3V39 A;  4ZBE A;  4OOL A;  1K6R A;  1GSX A;  4FH4 A;  1D7E A;  4JGQ A;  5FA7 A;  3FG8 A;  2Y2K A;  1Z6F A;  2ZMF A;  3CPT A;  1MWS A;  1BZA A;  3UB9 A;  3MF0 A;  5FAT A;  1L0F A;  2BLS A;  4E04 A;  3D4F A;  4ETX A;  1KDW A;  5U47 A;  3MXR A;  5HPF A;  4LPZ A;  4Y5F A;  5EE8 A;  5FQK A;  3T4J A;  3O5Y A;  2ZM0 A;  3E2L A;  2PAV P;  4WN5 A;  3CJM A;  1PWC A;  1S1Z A;  2QZ6 A;  5HW3 A;  3BY8 A;  1STZ A;  2HF6 A;  4N92 A;  4WMC A;  3S1Y A;  2O0Y A;  3OCN A;  4Y13 A;  2VKS A;  4KZ4 A;  5FDS A;  2HP9 A;  1LI0 A;  2H5S A;  5F69 A;  3HLC A;  3MSH A;  1K54 C;  2V0U A;  3ZHH A;  4KZ5 A;  3OPR A;  4G3V A;  1YAX A;  3MXS A;  3C30 A;  3QHY A;  4MDZ A;  2P04 A;  4FTX A;  3BEB A;  4GZB A;  3SH7 A;  1T18 A;  2P74 A;  4EXO A;  2Q9N A;  1YPR A;  5BOH A;  2Y2P A;  1G68 A;  4I38 A;  2M1C A;  5EPH A;  4Y0T A;  5HSQ A;  3OOV A;  1ES2 A;  3H82 A;  3KYQ A;  3E4Q A;  3MKF A;  4WL9 A;  2XF3 A;  3SS4 A;  2WKQ A;  1Y54 A;  4X53 A;  2D01 A;  4HH2 A;  1VEU B;  3ZNY A;  4X1M A;  3Q7V A;  5FSR A;  4LLO B;  1E3U A;  2H28 A;  2W3E A;  3ZG7 B;  2C6W B;  2I9V A;  1TDG A;  3V67 A;  1ZTU A;  2W3D A;  4NKP A;  3UE0 A;  3NHQ A;  3BLS A;  5G18 A;  1ONH A;  4JF5 A;  2P7J A;  3G32 A;  1FSY A;  1ZC2 A;  4I3J A;  5K5B A;  3T4O A;  2EX9 A;  2OLU A;  4PAU A;  4II7 A;  3KYE A;  2KOI A;  3F1N B;  3P09 A;  4HNB A;  2VX8 A;  3VE3 A;  2EA9 A;  4P87 A;  1W5D A;  4LCL A;  5DF9 A;  3LIA A;  1IEM A;  3K3C A;  3QP2 A;  2X02 A;  4P85 A;  2G7U A;  1YLW A;  1H5X A;  2FZ0 A;  1LHY A;  3UY6 A;  4B4Z A;  1HTZ A;  3PBO A;  1EI5 A;  2PD8 A;  1KDS A;  3IX3 A;  3HL9 A;  3QP6 A;  3D3O A;  3N4I A;  3MR0 A;  3ZQ5 A;  3IF6 C;  5HL6 A;  1O07 A;  3IX8 A;  4WZ5 A;  1ACF A;  1DP8 A;  1L2S A;  4QHC A;  4JBF A;  3UPN A;  3VOL A;  4DF6 A;  3G2Z A;  1T1C A;  2VJW A;  2XA7 M;  3A3F A;  3ITB A;  3H7W A;  2DMW A;  3LR5 A;  2JKR I;  1NLY A;  3GDI A;  3VFH A;  2H10 A;  4QD4 A;  3O87 A;  2XRN A;  3EQV A;  1XKZ A;  4JXS A;  1TVF A;  4I3I A;  4MN6 A;  3TSG A;  2Y4A A;  3ZDJ A;  4YFM A;  5HDS A;  3LEQ A;  3IS2 B;  2V1Z A;  2PYP A;  5F1G A;  3PBN A;  2Y2O A;  4ZAM A;  2E8J A;  1ZHH B;  5CHU A;  1U60 A;  2O9C A;  4BBT A;  1TS7 A;  1ESI A;  1JVJ A;  4BBU A;  4WYY A;  3ISG A;  1OT9 A;  5E2F A;  4N9L A;  3OCL A;  2A24 A;  4HQA A;  4C6Y A;  4GCZ A;  2KDK A;  4KG2 A;  4WUJ A;  3ZCZ A;  5EV0 A;  1CEG A;  2WGI A;  2PU2 A;  5C5K A;  1DJA A;  2O9A A;  2WK0 A;  3V3R A;  2YKF A;  3NCK A;  3OLO A;  4S2I A;  3PBR A;  4H6J A;  3T4Q A;  2EXB A;  1TEM A;  4B88 A;  2L1M A;  4Q0I A;  1EW0 A;  3DTK A;  3EEA A;  3G2Y A;  1J3W A;  3ZNT A;  2GDN A;  4E3N A;  4BL2 A;  1OTE A;  4FSF A;  4X69 A;  3HLF A;  4DDS A;  1CJF A;  2Q9M A;  2XRO A;  1YSQ A;  3CLO A;  2V20 A;  3BFF A;  1KGE A;  3WRT A;  4OOY A;  2ZM2 A;  1NZO A;  3G35 A;  4KZ3 A;  3AGD A;  3VP0 A;  5CRF A;  1TD5 A;  3WS5 A;  4ME4 A;  5DTT A;  4CQH A;  4LV0 A;  1KVL A;  1BLS A;  3ZGA B;  4PM5 A;  3T12 B;  5L09 A;  1IKG A;  4KZA A;  2ZL1 B;  4Y7P A;  3CG5 A;  3E4O A;  1RP5 A;  4U0X A;  2VV6 A;  4KZ7 A;  4HJ6 A;  3R7W B;  2KLI A;  2PHY A;  4ETZ A;  1LL8 A;  5AJG A;  1MC0 A;  1T19 A;  2GZA A;  3CZD A;  1YLT A;  3M2J A;  3LIB A;  4OVD A;  4KZ9 A;  3H82 B;  1N9N A;  1PZP A;  4MCW A;  4ID4 A;  2W3H A;  4WZ4 A;  4LRX C;  4NEE D;  2ZOH A;  3DTM A;  3HVF A;  3DWZ A;  4PM8 A;  2EWV A;  3IXB A;  2V8C A;  4YOF A;  2PD7 A;  2V1B A;  5F83 A;  3MS6 A;  2ZC3 B;  3SH8 A;  3NEC A;  3O86 A;  5EVI B;  2XFT A;  2HV1 A;  3E4P A;  1K55 C;  4JF6 A;  5HAI A;  3VP4 A;  5KSH A;  3NUL A;  4S2K A;  3LIE A;  1BUE A;  1KE0 A;  1T1B A;  3ZFZ A;  2JC7 A;  5DKK A;  5HDC A;  2VGL S;  2ZQC A;  5J8X A;  1ZG6 A;  4JPM A;  1WYB A;  2XGN A;  4FD8 A;  2W0N A;  1S67 L;  2HP6 A;  4R3B A;  4E3M A;  4FOF A;  4LCM A;  4QB8 A;  2Q0O A;  4UAA A;  3S22 A;  2PR6 A;  4L9F A;  4OP5 A;  4LFU A;  4P6B A;  3OZH A;  4KEN B;  5EVI D;  3TG9 A;  3ITA A;  1L0G A;  1S6R A;  2B5R A;  2ZC4 B;  4RA7 A;  4O7D A;  4KUK A;  2HDS A;  3A3J A;  3EGX C;  1IYP A;  1OTB A;  1PIO A;  1I5Q A;  3LR3 A;  1L3L A;  1C3B A;  3GRJ A;  4HBU A;  4HJ4 A;  4E3O A;  1OJ5 A;  2Z6C A;  4R3J A;  1QME A;  1G5U A;  5J7E A;  2NUT C;  3O88 A;  1NWZ A;  3C2W A;  5GHX A;  3GSG A;  3LUQ A;  2XEP A;  4QU3 A;  5GLC A;  1SKF A;  3HJK A;  2RCX A;  4D2O A;  5HWV A;  2PU4 A;  2W1T A;  1XA7 A;  3UE3 A;  4P6Z S;  1UGU A;  3HUN A;  3LI9 A;  3GR2 A;  4ARZ A;  4GNU A;  3QNB A;  2EFU A;  4A5R A;  5IHV A;  3UO9 A;  2XA7 S;  5KIZ A;  4QY6 A;  4S2P A;  3E0Y A;  1FQG A;  1GHI A;  3UB5 P;  4CJN A;  1I2W A;  4F3L A;  4PM6 A;  1E3U D;  4WEK A;  3PBS A;  5CGS A;  1VHM A;  1BLP A;  2FFF B;  2XQZ A;  2LB5 A;  1E25 A;  3F1P B;  1YM1 A;  1ERO A;  2RL3 A;  4GOG A;  4E6W A;  3HUM A;  4HES A;  4YIN A;  4DE3 A;  3T50 A;  5EOO A;  3SS3 A;  5EFW A;  1UWN X;  3SOI A;  3N7W A;  1GSV A;  1TF1 A;  3CUE A;  4EET B;  3LFV A;  5KMW A;  2P08 A;  3KYZ A;  4AFI A;  4E6X A;  4WMC D;  1YLJ A;  2Y55 A;  3HJI A;  1K4E A;  4BL3 A;  2ZOI A;  3NOU C;  4Y0U A;  4Q0J A;  3BM6 A;  4EBP A;  1DJC A;  2G2U A;  1FCM A;  1YLZ A;  4FCF A;  4K0W A;  4RYE A;  2Y2G A;  4HP9 A;  5IS1 A;  2EWW A;  5EM0 A;  1XX2 A;  2WAD A;  4BQM A;  5TFQ A;  2PYR A;  4O01 A;  4DE2 A;  3HLG A;  4YWZ A;  2WYX A;  5L10 A;  4DMZ A;  4FH2 A;  2JKT M;  1M40 A;  4NXF A;  5M1A A;  3BYD A;  4LRY C;  2L0W A;  1OTD A;  3DTI A;  4XT2 A;  3PBT A;  5EEC A;  4EEP A;  3A0S A;  1LL9 A;  4NXG A;  2EFX A;  1P97 A;  1ZG4 A;  3VV4 A;  3U2A A;  1ES5 A;  3IWI A;  3MXQ A;  4H8R A;  2FH5 A;  3C7V A;  2ZC7 A;  3P7N A;  5DTK A;  3G6O A;  4M3K A;  2BTF P;  1W79 A;  3FWL A;  1V9Y A;  3D9Y A;  1HZO A;  3S7N A;  4CLC C;  1FR6 A;  4DJ2 A;  4GD8 A;  2XK1 A;  3CAX A;  4QJG A;  3EGD C;  5FAQ A;  2J8Y A;  3IWQ A;  1G6O A;  3QP5 A;  4DJ3 A;  4E3I A;  2R9X A;  1SKO B;  3CWF A;  4Y15 A;  4LV3 A;  2J3T D;  1LI9 A;  3GV9 A;  3A0V A;  5E2H A;  1ESU A;  4UEY A;  1GSW A;  3V5M A;  4JGO A;  3JVU A;  2ZC5 B;  4P6Z M;  1MWT A;  3BQ8 A;  4N1X A;  5FAP A;  2Y2M A;  1I2S A;  5HWW A;  1N9O A;  3MFD A;  1MPL A;  1F9I A;  2QWS A;  1VM1 A;  2A2L A;  2VGJ A;  2Z2L B;  3FV7 A;  4DRT A;  2ZMA A;  3T1S A;  2M7V A;  2O9B A;  3ZYT A;  5GLB A;  1HVB A;  4LEN A;  5I94 A;  4JXG A;  2PRF A;  3N8S A;  1PFL A;  3LI8 A;  3C4P A;  2W3F A;  3UPO A;  1H8Y A;  1W7F A;  4R4S A;  2XLN A;  4NXB A;  1MKI A;  4Z1W A;  3VOZ A;  1XGJ A;  4E3K A;  1E4D A;  4HOI A;  4I5S A;  4HIA A;  4DXB A;  2ZJ9 A;  5FI7 A;  1ALQ A;  1XJ2 A;  3IT9 A;  5MC7 A;  1NRF A;  4PPR A;  5TBM B;  1MXO A;  3HLD A;  3T1R A;  2HDU A;  2OWJ A;  4IBX A;  5KZH A;  3QP1 A;  4X56 A;  2WAE A;  2HPB A;  3UNW A;  3PTE A;  1SDE A;  4K08 A;  5CXW A;  2Y59 A;  3G4P A;  4DN0 A;  5F82 A;  5FQI A;  3WWX A;  4JGP A;  4RVA A;  4OQG A;  4HHD A;  2JE5 A;  4DKI A;  3N8L A;  4ZTK A;  3F1N A;  1X0O A;  2NUP C;  2Y2Q A;  3CIT A;  2W1T B;  3LID A;  3UDX A;  3GMW A;  3VP2 A;  4HJ3 A;  2P9V B;  3HLW A;  5A92 A;  4MN7 A;  4YNR A;  3W4Q A;  2HDR A;  3JVV A;  3KSH A;  4S2O A;  2IA2 A;  2WGV A;  3C8C A;  3PAE A;  1YSP A;  1YLP A;  1JTD A;  4NK3 A;  3M6B A;  4RQ9 A;  1YLY A;  1RCJ A;  2YKH A;  2Y91 A;  4KQQ A;  4CPK A;  3MQO A;  4I3A A;  5A8B A;  2VV8 A;  4OQI A;  3IH8 A;  1IKI A;  3T1Q B;  2VK3 A;  5DTS A;  1BUL A;  5J3W A;  4NXE A;  1RGZ A;  3QP8 A;  5FQ9 A;  1PZO A;  3BQA A;  4I39 A;  2DNS A;  1MWU A;  3QP4 A;  3UME A;  2ZBB A;  2V0W A;  3LYX A;  5FQM A;  2IWB A;  4IUH A;  1BTL A;  4JXW A;  4XXR A;  1KE3 A;  4B9O A;  3M2K A;  1WA9 A;  3PXP A;  3TRC A;  3MQ0 A;  1ZKJ A;  4H6J B;  1PRQ A;  3N6I A;  3A3E A;  4GD6 A;  3IXH A;  3B47 A;  2JHE A;  4BEN A;  1NZU A;  1Z09 A;  3RTY A;  1D1J A;  3FC7 A;  2EXA A;  2WKE A;  3C5A A;  1K56 A;  4RX3 A;  4NET A;  2XH9 A;  3B42 A;  4FUW A;  4KZB A;  1XXM A;  3T4S A;  2BG1 A;  4JGR A;  4CLC E;  1CI9 A;  5HWT A;  3S7P A;  1GHP A;  4OQH A;  3N8R A;  2XDM A;  3A3D A;  4JKT A;  2Y2I A;  3IHA A;  4Q0H A;  3Q07 A;  3ZVT A;  4HEF A;  3KSI A;  1P0Z A;  3RXX A;  4O0P A;  3AGF A;  3FZC A;  5CGW A;  4GDN A;  1PWG A;  3IBR A;  4QY5 A;  3VFF A;  5DJU A;  5CTM A;  5A93 A;  1XJ6 A;  3KX0 X;  3T4T A;  1SDN A;  2DRW A;  3ZG0 A;  3CHW P;  2WUQ A;  2ACG A;  2WZZ A;  1XFQ A;  3DWK A;  4GDB A;  4GJ4 A;  1ODV A;  3BFG A;  4GW9 A;  1O7E A;  1SKO A;  1W63 Q;  3UDI A;  2QJ5 A;  1ERM A;  3P01 A;  5A90 A;  4DXC A;  3RH8 B;  1OJG A;  2Y2N A;  2LB9 A;  4OOM A;  4OLG A;  4EUV A;  4WLA A;  4KG5 A;  3F1O B;  3NDG A;  3V50 A;  3CMZ A;  1K54 A;  2WZX A;  1SZV A;  4NG2 A;  3IXG A;  2R9W A;  3UE1 A;  3VOY A;  5AQ9 A;  1YQS A;  4BMW A;  1MY8 A;  3DBA A;  1BLH A;  4EQ1 A;  2OSU A;  2G2W A;  4XT2 B;  5TJJ A;  1BLC A;  1K38 A;  2ZMV A;  3S4X A;  5D3O A;  4O8G A;  1JWP A;  1NXY A;  2JKT I;  3H9W A;  3MZE A;  5L07 A;  3A3I A;  2A3U A;  4UA9 A;  5TGF A;  4K0X A;  3UB8 A;  3PYP A; 
#chains in the Genus database with same CATH homology
 1KDS A;  2EX8 A;  5TR7 A;  2OV5 A;  1PI5 A;  4FCF A;  3HL9 A;  4K0W A;  4RYE A;  2Y2G A;  4R0Q A;  1K25 A;  3N4I A;  4EUZ A;  3IF6 C;  1FCN A;  1O07 A;  4WZ5 A;  5CHM A;  1L2S A;  4ZJ1 A;  4QHC A;  4JBF A;  3UPN A;  1WE4 A;  4DF6 A;  3IF5 A;  4S2M A;  3G2Z A;  4EQI A;  4ZJ3 A;  1XX2 A;  2WAD A;  4BQM A;  5KSC A;  1ERQ A;  3HBR A;  1PYY A;  5HFO A;  5TFQ A;  1S0W A;  3UPP A;  5CEC A;  3A3F A;  3ITB A;  2XR0 A;  4DE2 A;  2ZQ8 A;  3HLG A;  1H8Z A;  3IF6 B;  2WYX A;  3W8K A;  3WS4 A;  4F94 A;  2Y2L A;  4FH2 A;  5CHJ A;  3VFH A;  5FAS A;  2H10 A;  3OC2 A;  1N9B A;  4QD4 A;  3O87 A;  1MBL A;  1XP4 A;  1M40 A;  3EQV A;  1XKZ A;  4JXS A;  3WRZ A;  2J9P A;  2VGK A;  5GHY A;  3BYD A;  5M1A A;  2PBY A;  3WS2 A;  2CC1 A;  3PBT A;  5CEB A;  1TVF A;  5EEC A;  1LLB A;  1LL9 A;  3TSG A;  1SCW A;  2Y4A A;  3ZDJ A;  4YFM A;  1FOF A;  2EFX A;  3W4O A;  1XPB A;  1ZG4 A;  4Q8I A;  3BFE A;  3WS0 A;  5AQ7 A;  1ES5 A;  1BSG A;  2V1Z A;  3IWI A;  5F1G A;  1KVM A;  3HLB A;  3PBN A;  3QNC A;  4H8R A;  2Y2O A;  5M18 A;  3C7V A;  4EWF A;  4ZAM A;  5F1F A;  1GA0 A;  5E43 A;  2ZC7 A;  3NY4 A;  4GB7 A;  3BFD A;  4LV2 A;  4IVI A;  5DTK A;  5CHU A;  1U60 A;  4M3K A;  3VSL A;  1W79 A;  1W8Y A;  3FWL A;  1OME A;  4WM9 A;  2Y2J A;  3VP3 A;  1HZO A;  3ZG5 A;  1FR6 A;  3WS1 A;  1ESI A;  1JVJ A;  4WYY A;  3ISG A;  1JWV A;  3HRE A;  2XK1 A;  4GD8 A;  3VSK A;  5E2F A;  4BJP A;  4N9L A;  3OCL A;  4KG6 A;  4QJG A;  4OON A;  5EVL A;  4C6Y A;  5FAQ A;  3MZD A;  4KG2 A;  2J8Y A;  3SS5 A;  5EVI C;  3IWQ A;  3ZCZ A;  2ZQ7 A;  3OPL A;  1CEF A;  4MNR A;  3UN7 A;  1CEG A;  4UA7 A;  2WGI A;  5GLA A;  2PU2 A;  4E3I A;  4BLM A;  1DJA A;  2R9X A;  5AQA A;  2ZD8 A;  5EVI A;  2WK0 A;  3Q81 A;  2X01 A;  1BT5 A;  3V3R A;  3NCK A;  4KZ6 A;  2IWC A;  4OQ0 A;  4MBH A;  2ZQ9 A;  1YT4 A;  4LV3 A;  1IYS A;  2H0T A;  3LO7 A;  3M6H A;  4S2I A;  1K57 C;  1LI9 A;  1Q2Q A;  4UHU A;  4OPR A;  4WEL A;  1EWZ A;  5E2E A;  3GVB A;  3I7J A;  1IEL A;  3GV9 A;  3PBR A;  4N9K A;  3G31 A;  1NYM A;  4X55 A;  5E2H A;  3DW0 A;  2EXB A;  1TEM A;  1QMF A;  1ESU A;  3IHB A;  5DVA A;  3V5M A;  4B88 A;  4C3Q A;  1IYO A;  2ZC5 B;  1PW8 A;  1VQQ A;  1MWT A;  4N1X A;  5FAP A;  1K4F A;  2Y2M A;  1I2S A;  4OLD A;  3MFD A;  1MPL A;  5FQJ A;  1ES4 A;  4PM9 A;  1VM1 A;  3G2Y A;  3ZNT A;  4E3N A;  2GDN A;  2VGJ A;  2Z2L B;  4X68 A;  4KQO A;  3FV7 A;  4X6T A;  4BL2 A;  4DRT A;  3G30 A;  3IH9 A;  4FSF A;  3LY4 A;  4X69 A;  4JLF A;  3VP1 A;  4MEZ A;  1Q2P A;  4IBR A;  4BD0 A;  1FCO A;  3MZF A;  2ZMA A;  1YMS A;  5A91 A;  3HLF A;  4DDS A;  4DDY A;  4BD1 A;  4MBF A;  1L0D A;  5FDH A;  3HLE A;  2Q9M A;  2E8I A;  2I72 A;  5E2G A;  2V20 A;  3BFF A;  5HAR A;  4N1H A;  5GLB A;  3PBQ A;  1HVB A;  1KGE A;  3MBZ A;  3Q1F A;  3EQU A;  3WRT A;  5GL9 A;  1NJ4 A;  2FFY A;  4LEN A;  4OOY A;  1G6A A;  5HAQ A;  2ZM2 A;  4ZJ2 A;  1NZO A;  5I94 A;  3NIA A;  4JXG A;  3G35 A;  2HDQ A;  4KZ3 A;  3N8S A;  3AGD A;  3VP0 A;  4C75 A;  1JWZ A;  5CRF A;  3UDF A;  3C4O A;  3WS5 A;  4EBN A;  1K56 D;  3C4P A;  5CED A;  5FI6 A;  5DTT A;  3OPH A;  2EX2 A;  3UPO A;  4LV0 A;  1H8Y A;  4ZDX A;  1KVL A;  1W7F A;  4R4S A;  4R4R A;  1BLS A;  2XLN A;  3FKV A;  3ZGA B;  4PM5 A;  1PWD A;  3IXD A;  4IVK A;  1MKI A;  3VOZ A;  1FSW A;  1XGJ A;  4E3K A;  1IKG A;  1E4D A;  4S2N C;  4KZA A;  4Y7P A;  3GQZ A;  3LCE A;  4HBT A;  4DXB A;  3CG5 A;  2ZJ9 A;  4K91 A;  5FI7 A;  1ALQ A;  4OPY A;  1RP5 A;  4U0X A;  2JBF A;  3IT9 A;  4EBL A;  1NRF A;  4KZ7 A;  2ZC6 B;  3OPP A;  4LV1 A;  5M19 A;  3RXW A;  4PPR A;  1CK3 A;  4PMA A;  4WZ5 C;  4S2L A;  1MXO A;  5L2F A;  1L0E A;  3HLD A;  4R23 A;  2XD5 A;  3JYI A;  3W4P A;  2HDU A;  3CZD A;  1YLT A;  3M2J A;  4OVD A;  3NI9 A;  4IBX A;  4UA6 A;  5KZH A;  4X56 A;  1XGI A;  2WAE A;  2HPB A;  1PI4 A;  4KZ9 A;  3UNW A;  3PTE A;  1SDE A;  2ZQA A;  2Y59 A;  3G4P A;  1TDL A;  3IQA A;  5CXW A;  1MWR A;  5F82 A;  5FQI A;  3WWX A;  2XD1 A;  4RVA A;  4OQG A;  5CTN A;  5JYO A;  4OPQ A;  1PZP A;  1WYC A;  4ID4 A;  2JE5 A;  4WZ4 A;  4DKI A;  3NDE A;  3N8L A;  4ZTK A;  3DTM A;  2Y2H A;  4MBK A;  2Y2Q A;  3BEC A;  2ZQD A;  2OLV A;  4R1G A;  1HD8 A;  2UWX A;  3HVF A;  3DWZ A;  3UDX A;  4PM8 A;  3GMW A;  3LY3 A;  2WGW B;  3IXB A;  3VP2 A;  4DE0 A;  1YMX A;  4JF4 A;  2QPN A;  2P9V B;  3HLW A;  1K6S A;  5FQQ A;  5A92 A;  3W4Q A;  2HDR A;  1SHV A;  5F83 A;  5HX9 A;  1J9M A;  3AGE A;  3Q7Z A;  3Q82 A;  1AXB A;  2ZC3 B;  3C7U A;  1KE4 A;  4S2O A;  3SH8 A;  2WGV A;  3O86 A;  5EVI B;  2XFT A;  3PAE A;  1IYQ A;  1YLP A;  3E2K A;  4OKP A;  1JTD A;  1RGY A;  1K55 C;  4NK3 A;  3M6B A;  4JF6 A;  4DE1 A;  1YLY A;  1JTG A;  5HL1 A;  5HAI A;  3IWO A;  3VP4 A;  5KSH A;  1CI8 A;  1RCJ A;  3ZVW A;  2Y91 A;  4KQQ A;  4CPK A;  4E3J A;  4S2K A;  2XFS A;  3O3V A;  3GTC A;  1DY6 A;  1BUE A;  1KE0 A;  1K57 A;  3ZFZ A;  4OQI A;  3IH8 A;  2V2F F;  4EV4 A;  3PAG A;  1IKI A;  2Z2M B;  2JC7 A;  4WEJ A;  3FYZ A;  3LEZ A;  1BUL A;  1PW1 A;  2ZQC A;  3NC8 A;  5DTS A;  5HAP A;  5DF7 A;  4OPZ A;  4L0L A;  5EOE A;  3IF6 A;  4KQR A;  1ZG6 A;  5J8X A;  1RGZ A;  2DCF A;  4OH0 A;  2H0Y A;  2J7V A;  4JPM A;  1PZO A;  1WYB A;  3HUO A;  5FQ9 A;  2XGN A;  5FI2 A;  2DNS A;  4FD8 A;  2HP6 A;  4R3B A;  3V39 A;  1MWU A;  4ZBE A;  4E3M A;  4OOL A;  4IED A;  1K6R A;  4LCM A;  4FH4 A;  4QB8 A;  2WKI A;  3BRM A;  2A49 A;  5FA7 A;  5FQM A;  2IWB A;  2Y2K A;  1BTL A;  1Z6F A;  4UAA A;  3S22 A;  4JXW A;  1MWS A;  4OP5 A;  1BZA A;  4E3L A;  4XXR A;  1KE3 A;  3M2K A;  1GCE A;  5FAT A;  4P6B A;  3OZH A;  4KEN B;  1L0F A;  5DF8 A;  5EVI D;  3TG9 A;  3ITA A;  1ZKJ A;  2BLS A;  1L0G A;  1S6R A;  2B5R A;  2ZC4 B;  4RA7 A;  3BLM A;  4O7D A;  1FR1 A;  3D4F A;  3N6I A;  1KGG A;  3A3E A;  1KGF A;  2HDS A;  1KDW A;  3A3J A;  3MXR A;  5AQB A;  5U47 A;  1IYP A;  4GD6 A;  3ZG8 B;  3IXH A;  3FKW A;  5EE8 A;  2WKH A;  5FQK A;  1PIO A;  2QMI A;  5JYP A;  4S2J A;  1I5Q A;  4BEN A;  2ZM0 A;  3E2L A;  1NZU A;  1C3B A;  4U0T A;  3GRJ A;  4HBU A;  4Z9Q A;  4E3O A;  3VMA A;  3CJM A;  2EXA A;  2WKE A;  4R3J A;  1QME A;  1PWC A;  5HW3 A;  2QZ6 A;  1GHM A;  3C5A A;  1K56 A;  4N92 A;  4RX2 A;  4RX3 A;  4NET A;  4WMC A;  2XH9 A;  3O88 A;  4KZB A;  3OCN A;  3S1Y A;  1XXM A;  4KZ4 A;  2BG1 A;  5GHX A;  3GSG A;  3RJU A;  2HP9 A;  2XEP A;  4QU3 A;  5GLC A;  1SKF A;  1LI0 A;  2H5S A;  2RCX A;  3BFC A;  2WGW A;  1CI9 A;  3HLC A;  4D2O A;  2EX6 A;  1K54 C;  1GHP A;  3ZHH A;  4OQH A;  2PU4 A;  4KZ5 A;  3OPR A;  3UE3 A;  1XA7 A;  5GHZ A;  3MXS A;  3N8R A;  1NY0 A;  2XDM A;  3HUN A;  3A3D A;  3QHY A;  4JKT A;  2P9V A;  3GR2 A;  4GNU A;  2Y2I A;  3QNB A;  3IHA A;  3Q07 A;  3ZVT A;  4HEF A;  4XUX A;  3BEB A;  4GZB A;  3SH7 A;  2EFU A;  3RXX A;  3AGF A;  3FZC A;  2P74 A;  5CGW A;  2WAF A;  2Q9N A;  5FAO A;  4GDN A;  5BOH A;  2Y2P A;  4A5R A;  1G68 A;  1PWG A;  2IWD A;  4QY5 A;  5IHV A;  5CGX A;  3UO9 A;  3VFF A;  5CTM A;  4MLL A;  4S2N A;  5EPH A;  4QY6 A;  4S2P A;  5A93 A;  1M6K A;  1FQG A;  4Y0T A;  1GHI A;  4P0M A;  3P98 A;  3Q7V B;  4Y0O A;  1I2W A;  1ES2 A;  4CJN A;  1XA1 A;  2JCH A;  4PM6 A;  1SDN A;  2DRW A;  1E3U D;  3ZG0 A;  2WUQ A;  2HP5 A;  4GKU A;  3MKF A;  4WEK A;  2WZZ A;  1N4O A;  3DWK A;  2XF3 A;  3PBS A;  3SS4 A;  4WBG A;  4GDB A;  5CGS A;  1BLP A;  1Y54 A;  4X53 A;  1ONG A;  3BFG A;  2FFF B;  1O7E A;  2XQZ A;  3ZNY A;  3UDI A;  1E25 A;  1NYY A;  2ZM8 A;  3Q7V A;  5FSR A;  2ZLY A;  4KZ8 A;  1ERM A;  1E3U A;  5CER A;  3ZG7 B;  2C6W B;  1TDG A;  5A90 A;  1YM1 A;  4DXC A;  1ERO A;  2RL3 A;  2Y2N A;  4GOG A;  4E6W A;  4B4X A;  3ZG9 B;  3UE0 A;  3HUM A;  4HES A;  4U3T A;  4YIN A;  4DE3 A;  3BLS A;  4OOM A;  4OLG A;  5EOO A;  5G18 A;  3SS3 A;  1W8Q A;  3NBL A;  1ONH A;  4KG5 A;  3V3S A;  3NDG A;  4JF5 A;  4OP8 A;  3TOI A;  3SOI A;  3V50 A;  3CMZ A;  3G32 A;  3MKE A;  1K54 A;  5GLD A;  2WZX A;  3N7W A;  1FSY A;  1ZC2 A;  3IXG A;  2R9W A;  3B3X A;  3UE1 A;  2EX9 A;  3VOY A;  5AQ9 A;  1YQS A;  2OLU A;  1MY8 A;  3P09 A;  1BLH A;  5KMW A;  2OSU A;  2G2W A;  5EUA A;  4JXV A;  1K55 A;  1LL5 A;  2C5W B;  4P87 A;  4PM7 A;  1DJB A;  4E6X A;  1GA9 A;  1W5D A;  4XUZ A;  1BLC A;  4GN2 A;  1YLJ A;  4LCL A;  4WMC D;  1IEM A;  2Y55 A;  5DF9 A;  1K38 A;  3SH9 A;  1K4E A;  3S4X A;  4BL3 A;  5D3O A;  2X71 A;  4Y0U A;  1JWP A;  1NXY A;  2X02 A;  4P85 A;  1ES3 A;  3BM6 A;  4EBP A;  3G34 A;  1YLW A;  2J9O A;  3MZE A;  1H5X A;  1DJC A;  1LHY A;  2G2U A;  3UY6 A;  4B4Z A;  3A3I A;  2A3U A;  1FCM A;  4UA9 A;  5TGF A;  1HTZ A;  1YLZ A;  3PBO A;  4K0X A;  1EI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...