4ZJ2A

Crystal structure of p-acrylamido-phenylalanine modified tem1 beta-lactamase from escherichia coli :e166n mutant
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
265
structure length
264
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWNPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
publication title Exploring the potential impact of an expanded genetic code on protein function.
pubmed doi rcsb
source organism Escherichia coli
total genus 92
structure length 264
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4zj2A00
2WKEA 1XGJA 3FWLA 4KENB 2Q9NA 3MXSA 4GD8A 4KQQA 4QY5A 2Y55A 3UY6A 3O88A 4C75A 2Y2GA 3ITAA 1GHPA 3MKFA 2JCHA 1BLHA 1ZG6A 4IBRA 4JF5A 5DTTA 3Q82A 3TSGA 4DE1A 2WYXA 4LV3A 5EUAA 1K4FA 2ZQ8A 3NC8A 3PBTA 5CXWA 3M2KA 3IF6B 3AGFA 3IH8A 3ZGAB 3O87A 5HX9A 4BJPA 2UWXA 2OLVA 4Q8IA 1ES2A 3NDEA 3SS4A 1TDGA 3WS4A 2Z2LB 5J8XA 4BD1A 3BFFA 4X69A 1XX2A 2H0TA 5CRFA 1EI5A 2A49A 5IHVA 1BUEA 3HVFA 3IF6A 4KQOA 3V3SA 1CEFA 1LLBA 4E3OA 2VGJA 3BECA 3A3IA 5FAPA 1BZAA 1K55C 2DRWA 3OZHA 5M1AA 2P9VB 3EQUA 2ZQ7A 4C6YA 4EBLA 1LL5A 3HLEA 4YINA 1LHYA 2R9XA 4HBUA 5EVIA 2V2FF 3NY4A 2WAFA 3N6IA 2IWBA 5A90A 1JVJA 1NZUA 1FCOA 3S4XA 2P74A 2CC1A 1IELA 1XA7A 4JXWA 3QNCA 1SHVA 1ZKJA 3UN7A 2RL3A 2QPNA 1YLZA 2WZZA 4EWFA 4GB7A 4GD6A 2WGWB 3OPPA 4N92A 1RGYA 4KZ9A 1IYPA 2OSUA 3EQVA 4D2OA 5HW3A 2ZC4B 1ERMA 1CI8A 2EXBA 5FQ9A 1C3BA 4PM9A 4OLDA 5GLDA 4DF6A 1PZPA 5BOHA 3W8KA 2Y2KA 3WS0A 5CHMA 1PWGA 4JXSA 2C6WB 2J8YA 2XGNA 4QD4A 4S2IA 4Z9QA 3ZCZA 5KMWA 4OQ0A 2OV5A 2H0YA 5CGWA 4KZ7A 3VP0A 3G2ZA 4KZBA 3D4FA 3OCLA 1FR6A 2R9WA 4IVKA 2XH9A 4NETA 4JBFA 4WZ4A 4Y0OA 3BLMA 5HAQA 1PIOA 3WRTA 3ZNYA 1RCJA 3PBQA 4E3IA 1YLWA 4NK3A 4K0XA 5E2GA 4S2MA 4QJGA 2XFSA 5JYPA 1KVMA 4JLFA 2Q9MA 2XD1A 1W8YA 2Z2MB 1ZC2A 4Y7PA 3VMAA 3MZEA 3FZCA 1NXYA 1ZG4A 4KZAA 4X55A 4E3KA 1FCMA 4GOGA 3ZFZA 3BFGA 1GHMA 5CHJA 1NY0A 3Q7VA 4OOMA 3W4QA 1PYYA 3UDFA 4DXCA 1XKZA 4WM9A 4ZAMA 3NDGA 1W79A 1DY6A 4RX3A 3A3JA 3ZG0A 5JYOA 3IXHA 2J9OA 2ZM8A 1L0DA 3G4PA 3ZG9B 3VP2A 3P98A 5CEDA 1CEGA 1Q2QA 1BULA 1XA1A 2Y59A 3IXGA 5E43A 1NYMA 4KG6A 3SOIA 4OPQA 5EPHA 4E6XA 2QMIA 5EVID 4DDSA 3C4OA 2X01A 1KGFA 1FCNA 5F1GA 3TG9A 3VOZA 1NZOA 4S2KA 1L2SA 1GHIA 4L0LA 4QB8A 5FQQA 1PWCA 4WMCA 1K6SA 3ITBA 1EWZA 3HLFA 4DDYA 3C7UA 5AQBA 5CEBA 4R0QA 3PBOA 4DE2A 3N8SA 1YQSA 1PW1A 2PU4A 4WBGA 1OMEA 2X02A 5FASA 4WEKA 3NBLA 4P0MA 5FATA 3BFDA 1PZOA 3MZDA 5M19A 5L2FA 2ZLYA 1SCWA 1ESUA 2H5SA 1JWZA 4S2OA 4WYYA 4PM7A 5CTMA 3RXXA 4BD0A 3N8RA 3WS5A 3GMWA 2ZQ9A 1L0EA 3E2KA 3M6BA 3PBSA 3UE3A 2J7VA 2HDQA 3LY3A 4F94A 5I94A 3UDXA 1EROA 3ZVWA 1K55A 2WUQA 3AGDA 3IWOA 5GL9A 1AXBA 4KG2A 1S0WA 2Y2OA 5FAQA 3ZG8B 4LV2A 1XP4A 3IT9A 2Y2MA 4K0WA 5HL1A 4BL2A 4UA7A 2ZM2A 4JF4A 2HDSA 3BFCA 3BM6A 4JF6A 5TFQA 3WRZA 3ZVTA 2BLSA 4PM6A 1KE0A 2EX2A 3IWQA 4X53A 4YFMA 4QU3A 5FA7A 5KSHA 1IEMA 4WZ5A 5CERA 4BENA 5EVIB 1MWSA 3FKVA 1K57C 4WEJA 3PAEA 4ZJ3A 5U47A 3SH9A 1FOFA 4H8RA 4GKUA 1H8ZA 3MZFA 4P87A 4CJNA 4EV4A 5CGSA 5FQKA 1Y54A 1H5XA 3UE0A 4JXVA 5A92A 2WGIA 1YT4A 4S2LA 1TVFA 1W7FA 3DW0A 3HLWA 3MXRA 1H8YA 2XQZA 3N8LA 3W4PA 1K6RA 4WMCD 4OH0A 1W8QA 4Y0TA 1I2SA 1FSYA 4XXRA 4ZTKA 4RA7A 3A3FA 4OOLA 3BRMA 3ZNTA 3TOIA 2XR0A 1M6KA 4LV1A 4R3BA 3O3VA 3NIAA 3VSLA 4QY6A 3MFDA 4EBNA 2HPBA 3Q1FA 3P09A 1MWTA 3GR2A 1JTDA 1J9MA 1XPBA 4BL3A 5CECA 5GLAA 1LI9A 2WKIA 1QMEA 4OQGA 2HP9A 3UO9A 4B4ZA 2WGVA 2ZC3B 4UA6A 4U0XA 4E3MA 5CGXA 2XF3A 3LCEA 4HBTA 1MXOA 4KQRA 4MBHA 2PBYA 4GDNA 2Y2HA 4KZ5A 3Q7ZA 3IH9A 4R23A 3Q81A 3IF6C 1KE3A 1Z6FA 1KGGA 3Q7VB 1Q2PA 3ZDJA 2ZC5B 4S2NC 1HVBA 3CG5A 5F82A 3VFFA 5E2EA 5DVAA 4HEFA 4R4RA 2B5RA 5CHUA 1N4OA 3VP4A 1SDEA 1ES3A 3LEZA 3MBZA 4IBXA 1KDSA 5EOOA 3G34A 2ZC6B 1L0GA 3FV7A 2WK0A 2XLNA 3S1YA 3SH8A 4XUZA 1E3UA 3CMZA 3Q07A 2JBFA 4GZBA 4BLMA 3DTMA 1O07A 1LL9A 1ES4A 3HUOA 3ZG7B 1YM1A 5F83A 4FSFA 5D3OA 3C5AA 1K56A 1XGIA 3CJMA 2Y91A 4OQIA 5M18A 5KSCA 5AQ9A 3V50A 3N7WA 3VP3A 4E6WA 2DCFA 1I2WA 3HL9A 1MWRA 2XDMA 4XUXA 1BTLA 1K54C 1O7EA 2HP5A 3A3DA 2WZXA 1HZOA 4KG5A 5FDHA 3PBRA 4E3JA 1YMXA 4PM8A 3MKEA 4O7DA 2Y2QA 1KVLA 3M6HA 4ZJ2A 2ZJ9A 2ZM0A 4P6BA 4X68A 5TGFA 1YLPA 2E8IA 4KZ3A 4IVIA 4Y0UA 1CI9A 1KGEA 4OPRA 3CZDA 3A3EA 2FFFB 2EX9A 1QMFA 4K91A 3UE1A 3BYDA 4OLGA 3WS1A 3C4PA 4LV0A 2X71A 5GLBA 1TEMA 4S2PA 4GN2A 3I7JA 4OPZA 3HUMA 1MY8A 2DNSA 1PI4A 5GHXA 5FQIA 2XFTA 5AQAA 3RJUA 1VM1A 2OLUA 4RX2A 4E3LA 4FH4A 2V20A 5E2FA 2GDNA 2HP6A 1NYYA 3HBRA 1NJ4A 2XK1A 5DF7A 5FQMA 3OC2A 1IYOA 1ONHA 1K25A 2EX8A 4R1GA 3OPHA 2Y2PA 3G32A 1M40A 1E3UD 4ID4A 4OP8A 5HFOA 5CTNA 4UA9A 3BLSA 1MWUA 4N1XA 4CPKA 3IHAA 4MNRA 3UPPA 3NI9A 1E4DA 4OVDA 3DWKA 1K56D 1I5QA 4RYEA 4S2JA 3AGEA 2G2WA 1S6RA 2A3UA 4QHCA 3WWXA 4HESA 5GHYA 4KZ6A 4PPRA 4PM5A 5GLCA 3FYZA 4IEDA 3HLCA 1ERQA 2I72A 3GVBA 3UPNA 1RGZA 1VQQA 1N9BA 3RXWA 3SS5A 2IWCA 3BEBA 1HTZA 4ZBEA 5HAIA 1K38A 3SS3A 3GQZA 5G18A 3IQAA 1E25A 4M3KA 4S2NA 2J9PA 4R4SA 4MEZA 1BT5A 2RCXA 3B3XA 2Y2NA 4EBPA 4U0TA 5AQ7A 2BG1A 4OP5A 2JE5A 3ZG5A 4ZDXA 1FQGA 3FKWA 4UAAA 3VOYA 1ALQA 1ONGA 3G31A 3E2LA 4ZJ1A 3UPOA 3NCKA 4FCFA 1G6AA 3O86A 3OPRA 5EE8A 1YMSA 1BLSA 2Y2JA 5FI2A 4PMAA 5A91A 1U60A 3SH7A 4OPYA 4KZ8A 2P9VA 1MPLA 4JKTA 1TDLA 1YLJA 4UHUA 5F1FA 3V39A 4BQMA 1MBLA 2G2UA 4N9KA 5DTKA 5EECA 3GRJA 3IF5A 3IHBA 1DJBA 4WZ5C 4U3TA 4B88A 1PWDA 4LCLA 4FD8A 3QNBA 3HUNA 4P85A 1JWPA 2IWDA 2ZD8A 1WYCA 4FH2A 1RP5A 2VGKA 4A5RA 2EXAA 2XD5A 2Y4AA 3ISGA 3V3RA 1K54A 1L0FA 4DE0A 1W5DA 2WGWA 3N4IA 2ZC7A 4X56A 1HD8A 4LENA 5EVIC 2QZ6A 3IXBA 3VFHA 3UNWA 1JTGA 3JYIA 3VP1A 3GV9A 1IKIA 4OKPA 4EUZA 1KE4A 1K4EA 4DE3A 3OCNA 4X6TA 5FSRA 3GSGA 1FR1A 1WYBA 2PU2A 2C5WB 3PAGA 2ZQCA 1KDWA 2HDUA 5FI7A 4DKIA 5KZHA 2ZQAA 4JXGA 3G35A 3QHYA 1SDNA 3IWIA 5DTSA 4R3JA 3G2YA 4KZ4A 3S22A 3DWZA 4DXBA 4C3QA 1XXMA 3G30A 5A93A 1IKGA 4MBKA 4N9LA 3PTEA 3LO7A 3BFEA 4GDBA 4JPMA 1MKIA 3HLDA 2Y2LA 1ES5A 1DJCA 1BSGA 2XEPA 2ZQDA 1GCEA 4B4XA 1GA9A 1NRFA 3HREA 4MLLA 2WKHA 1YLTA 5FI6A 1ESIA 4E3NA 1LI0A 4LCMA 1BLCA 5DF8A 1G68A 5FQJA 3PBNA 3LY4A 3UDIA 5EOEA 4EQIA 1FSWA 1BLPA 2WADA 4OONA 2EX6A 3OPLA 1DJAA 5HARA 4N1HA 5GHZA 1CK3A 2FFYA 3M2JA 5E2HA 2Y2IA 1IYSA 3W4OA 4OOYA 1K57A 2V1ZA 3VSKA 3WS2A 5HAPA 1YLYA 4WELA 1IYQA 4OQHA 5FAOA 3GTCA 1WE4A 4GNUA 2EFUA 2EFXA 3HLGA 5DF9A 1PW8A 3HLBA 4DRTA 2H10A 4RVAA 3IXDA 5TR7A 2WAEA 1SKFA 3C7VA 3V5MA 2ZMAA 1PI5A 2JC7A 2HDRA 5EVLA 4MBFA 3ZHHA 1JWVA 1GA0A
chains in the Genus database with same CATH superfamily
4QY5A 4HH3A 3UY6A 3ITAA 4BWIA 3NECA 1ZG6A 2QHKA 3TSGA 3Q82A 4LV3A 1K4FA 4HH2A 1P97A 2JKFA 3IH8A 1OPXA 2PD7A 2OLVA 1ES2A 3WS4A 2Z2LB 4IUHA 4BD1A 4X69A 4X1MA 2A49A 1W63Q 2VZWA 2XA7M 3V3SA 2A24B 3BECA 1T18A 5FAPA 2P9VB 3D72A 4H6JB 4YINA 1NRJA 2V2FF 4FTXA 2P74A 1XA7A 2RL3A 2WZZA 2WGWB 3OPPA 4N92A 3ZYTA 1IYPA 5FQ9A 1C3BA 3QP5A 2Y8HA 4OLDA 5GLDA 4FUWA 2J8YA 2XGNA 5KMWA 4KZ7A 4LPZA 3VP0A 2R9WA 4IVKA 4LGWA 4MN7A 4JBFA 3BLMA 3CAXA 1PIOA 1YLWA 2XFSA 1Z09A 4JLFA 1ZC2A 4Y7PA 3MZEA 3FZCA 3NJAA 1NXYA 5FEGA 3BFGA 5CHJA 2PBDP 3W4QA 3UDFA 4DXCA 4G3KA 4WM9A 3NDGA 2Q0OA 1DY6A 4RX3A 3A3JA 1Y28A 1J3WA 2ZM8A 3VP2A 5E43A 2JKRI 4KG6A 3KYQA 1ACFA 2X01A 5AVFA 4G3WA 1L2SA 5FQQA 1PWCA 4WMCA 3FG8A 3ITBA 3LIDA 4HOIA 4R0QA 3PBOA 2JN7A 1OMEA 3MSHA 4WEKA 3NBLA 3BFDA 1P9WA 1F2KA 1PZOA 3IBJA 5L2FA 1ESUA 5DJUA 4BD0A 3E2KA 3PBSA 2HDQA 4F94A 3E4PA 3UDXA 3H7WA 2WUQA 4R3AA 4KG2A 1S0WA 1X0OA 1XP4A 3CWFA 1XFQA 5HL1A 3P01A 1EW0A 5J4EA 2L0WA 4JF4A 2YKFA 4YWZA 2HDSA 5TFQA 3WRZA 5K5BA 5KSHA 3F1OA 4WZ5A 4WEJA 5U47A 3T4JA 1H5XA 5A92A 4PKYG 3EEHA 4S2LA 1W7FA 3HLWA 3S7PA 1F5MA 3N8LA 1PNEA 4WMCD 4Y0TA 1I2SA 1FSYA 4XXRA 2NUPC 1VETA 1M6KA 4L9GA 4R3BA 4B93A 4QY6A 3L7HA 1DP6A 3P09A 3KSHA 3B33A 2OOLA 2KDKA 1QMEA 5HWVA 3VE3A 4MBHA 3TW8A 5HDSA 4KZ5A 3LI9A 1KE3A 1KGGA 2ZC5B 4S2NC 5L10A 4CLCE 2D02A 5CHUA 1N4OA 1TS8A 3LEZA 4IBXA 2WK0A 2XLNA 3U4LP 5HDCA 5HZHA 3CMZA 3Q07A 2JBFA 1LL9A 3C5AA 1K56A 2Y91A 5M18A 1MWRA 3NOUC 4XUXA 5HD5A 3T1QB 1K54C 4JGRA 2DMWA 3M6HA 3OOVA 1D06A 5TGFA 1YLPA 2E8IA 4KZ3A 3DBAA 3CLOA 3A3EA 3CZDA 5I5LA 1D7EA 3PHYA 3C4PA 5GLBA 1TEMA 1ODVA 3I7JA 3EGXC 1XFNA 3W2ZA 3RJUA 3A0RA 1VM1A 1TS0A 3HBRA 2XK1A 2ZMVA 4ID4A 4OP8A 2V8FA 4CPKA 3F1NB 3NI9A 1K56D 3MJQA 4HIAA 4S2JA 3MQ0A 3AGEA 2G2WA 2ZOHA 1S6RA 1NWZA 2PR5A 4PM5A 3HLCA 3IX8A 4NXFA 4Q0JA 3C38A 1HTZA 3S7NA 1K38A 3GQZA 5G18A 3IQAA 1E25A 4S2NA 2B02A 1PRQA 1LSWA 3B3XA 4EBPA 2VV6A 1FQGA 4UAAA 4R6LA 1ONGA 3E0YA 3E2LA 4ZJ1A 3NCKA 4FCFA 1BLSA 2A24A 1U60A 4KZ8A 2P9VA 1TDLA 5F1FA 3V39A 4BQMA 2G2UA 4H6JA 4N9KA 3IF5A 4MN5A 3HUNA 4FH2A 1WYCA 4NXBA 1K54A 1S4RA 1NLYA 2WGWA 1HD8A 2QZ6A 2KOIA 4ETXA 3OCNA 5FSRA 1KDWA 2HDUA 5FI7A 3G35A 1SDNA 3IWIA 1GSXA 3G2YA 1TF1A 3S22A 1YAXA 3G30A 5A93A 5L07A 2I9VA 3KSIA 3PTEA 4JPMA 3QP1A 3HLDA 1ES5A 1DJCA 3MF0A 3LIEA 1NRFA 1YLTA 5FI6A 4LCMA 3UDIA 1S67L 5GHZA 4RQ9A 1IYSA 4OOYA 3VSKA 3WS2A 1YLYA 4WELA 1IYQA 2PYPA 2EFUA 2EFXA 4EEUA 3PXPA 3IXDA 2WAEA 2WKPA 1Y4OA 2JC7A 2UV0E 3MS6A 2Y55A 2JKGA 2Y2GA 1GHPA 3MKFA 2JCHA 1OT6A 4JF5A 2WYXA 3PBTA 5CXWA 3M2KA 3ZGAB 3AGFA 4BJPA 3NDEA 4EW7A 3BFFA 4NEED 5CRFA 1EI5A 4GW9A 5IHVA 1BUEA 3HVFA 3IF6A 1LLBA 2DRWA 3VV4A 5A8BA 4C6YA 1FILA 3NY4A 2GX5A 2QJ5A 3VOLA 2CC1A 3F1PB 5L8MA 1ZKJA 3UN7A 1YLZA 2VKSA 5HWWA 4GB7A 4GCZA 2G7UA 3BY8A 1AWIA 3A0SA 4KZ9A 4II7A 1CI8A 2EXBA 4DF6A 2FZ0A 4HHDA 5CHMA 3ZCZA 2C6WB 4Z9QA 1L3LA 4S2IA 4HNBA 2PT7A 3D4FA 3OCLA 1FR6A 2XH9A 4NETA 1OTIA 4Y0OA 5HAQA 3ZNYA 3PBQA 4K0XA 1N9OA 1KVMA 3K3CA 4L9FA 3BY9A 4LLOB 3LIFA 2YKHA 4KZAA 4X55A 1NY0A 4GLQA 4IHQA 1XKZA 2EWVA 2PD8A 3IXHA 3ZG9B 4BMWA 4CQHA 1XA1A 2Y59A 3VE4A 1NYMA 3GECA 4DDSA 1KGFA 3VOZA 1LSXA 4EERA 1K6SA 4DDYA 3C7UA 3LYXA 5CEBA 4QPRA 4WLAA 4DE2A 3N8SA 2PU4A 2X02A 5HPFA 5FATA 3T4OA 1SCWA 2H5SA 4MMNA 2J80A 4WYYA 4ARZA 1CQAA 3GMWA 2ZQ9A 1L0EA 3UE3A 3LY3A 5TJJA 5I94A 1EROA 2Y2OA 4LV2A 1H0MA 4BL2A 4UA7A 1BYWA 3UB7A 3ZVTA 4X53A 4YFMA 1S1YA 5CERA 4LFUA 1K57C 3PAEA 4EV4A 1LT0A 1KOUA 1OTEA 1TVFA 3NULA 3F1NA 1NLZA 4I5SA 3TJZC 5C5KA 1W8QA 2EA9A 3DTKA 4OOLA 3TOIA 1ZHHB 2OWJA 2HPBA 3GR2A 4L9EA 5GLAA 1LI9A 2WKIA 4HI4A 4B4ZA 2ZC3B 3CPTB 4E3MA 5CGXA 3LCEA 5G4ZA 4GDNA 2K2NA 2Y2HA 4EQ1A 1Q2PA 3CG5A 1GSWA 4HEFA 2KX6A 1G5UA 3S1YA 3SZTA 4XUZA 1W63M 5DFYA 2OAQ1 1O07A 3ZG7B 1ES4A 3HUOA 5F83A 4FSFA 1XGIA 5KSCA 3VP3A 2DCFA 3HL9A 1BTLA 3QP2A 2W3EA 4KG5A 5F6AA 3PBRA 4O7DA 2ZM0A 4P6BA 4X68A 5F68A 1CI9A 4OPRA 1OTDA 4O8GA 2FFFB 2EX9A 1QMFA 3BYDA 2VGLS 4P6ZM 1VEUB 4OPZA 1LL8A 2M7VA 2DNSA 5GHXA 5FQIA 2XFTA 2Z6CA 5AQAA 2OLUA 4LRYC 1JNUA 4RX2A 4E3LA 4EU0A 5KIZA 1IOUA 1OTAA 1NJ4A 4I39A 5FQMA 1IYOA 1ONHA 3T1RA 2P7JA 2PHYA 3G32A 4UA9A 3BLSA 4N1XA 2W1TB 3KYZA 4OVDA 3DWKA 2JKTM 2A3UA 3T4KA 4KZ6A 4ZRRA 4BBUA 3FYZA 3RFBA 1N9BA 3RXWA 3SS5A 3BEBA 2FH5A 4ZBEA 5HAIA 4R4SA 2LB9A 2RCXA 2H28A 3MXQA 4U0TA 4NXEA 2BG1A 3ZG5A 3FKWA 1ALQA 3OPRA 5EM1A 5A91A 5FI2A 4PMAA 3IX4A 3SH7A 3V67A 1MBLA 1DJBA 5CX7A 4U3TA 4FD8A 3QNBA 1SKOB 2ZOIA 1RP5A 4NKPA 3F1PA 3NOPC 3ISGA 3V3RA 3N4IA 3IXBA 4G3VA 3UNWA 3BJNA 2O99A 1KE4A 5TBMB 4X6TA 3GSGA 1FR1A 4HJ6A 2PU2A 3PAGA 4DKIA 4R3JA 1IKGA 4MBKA 4JGQA 4N9LA 3LICA 1MC0A 3LO7A 3BFEA 1MKIA 2Y2LA 3ICYA 1GCEA 4HY8A 1A0KA 2WKHA 5DF8A 3PBNA 2XA7S 3TRCA 4Y15A 1FSWA 2WADA 2EX6A 1DJAA 3LR3A 5E2HA 2Y2IA 5HAPA 5FAOA 3GTCA 4GNUA 3RTYA 3HLGA 4WF0A 4DRTA 4R70A 2H10A 5TR7A 4CLCB 3C7VA 2V1AA 3T12B 3V5MA 1PI5A 2HDRA 4UQIM 1S4SA 1H8MA 1JWVA 1XGJA 3MXSA 1BLHA 2ZMFA 4ETZA 4IBRA 3S7OA 3MQOA 5DTTA 2QJ7A 2ZQ8A 3NC8A 2UWXA 4Q8IA 4Z1WA 5AJGA 5IU1A 3C30A 5DKLA 5J8XA 1TD5A 2H0TA 2GZAA 3CUEC 4KQOA 1CJFA 1CEFA 4E3OA 4D60A 2VGJA 2O9BA 3A3IA 3OZHA 5M1AA 3EQUA 2ZQ7A 1LL5A 3EGDC 3HLEA 4UEYA 2R78A 4HBUA 3KSGA 2WAFA 3N6IA 2IWBA 1JVJA 1NZUA 1FCOA 3JVVA 4JXWA 3QNCA 1SHVA 3A0VA 3R4KA 4EWFA 4MN6A 4JGPA 2OSUA 3EQVA 5HW3A 1TS7A 3UMDA 4HP4A 2Y2KA 5G4YA 3W8KA 3LIAA 1STZA 3UPOA 4QD4A 1DP8A 4OQ0A 2OV5A 5J3WA 2Y79A 1LSVA 4KZBA 5HPIA 1RCJA 4NK3A 5E2GA 4Y17A 5JYPA 2O0YA 3P7NA 4I38A 2Q9MA 2XD1A 3T1XA 3VMAA 3CPTA 3E4QA 4E3KA 4GOGA 3ZFZA 3EOIA 1GHMA 4DJ2A 4IJGA 1PYYA 2V9AA 4ZAMA 2ACGA 3ZG0A 5JYOA 2J9OA 3P98A 5CEDA 1Q2QA 3SOIA 4OPQA 4E6XA 2QMIA 4EETB 3ULFA 3CHWP 1XJ6A 3TG9A 1NZOA 1V9ZA 1DP9A 1GHIA 4L0LA 3T50A 3UB9A 1EWZA 1G6OA 5AQBA 1PW1A 5HL6A 5FASA 4P0MA 2VX8A 3GDIA 4Y5FA 1T1CA 3JPUA 1JWZA 1OTBA 3N8RA 3CUEA 2PYRA 2KLIA 3M6BA 5DFXA 1VB6A 4F3LB 2J7VA 3IWOA 3AGDA 1AXBA 3LR0A 2OWHA 3IT9A 2Y2MA 3G6OA 3K3DA 2ZM2A 1P9RA 4ME4A 2BLSA 3FC7A 1KE0A 2EX2A 3IWQA 5EV0A 4QU3A 5FA7A 4WUJA 1FIKA 4BBVA 5EVIB 3FKVA 4ZJ3A 3SH9A 1FOFA 4H8RA 4GKUA 5CGSA 5FQKA 4Q0HA 4JXVA 1XJ2A 4HJ3A 2P04A 4PHTA 3QP8A 1YT4A 2W1TA 2QKPA 1VETB 3W4PA 2J3WA 4FOFA 4CLCC 3A3FA 3BRMA 4WL9A 2XR0A 1MZUA 3O3VA 3NIAA 4EBNA 5FDSA 4X25A 1MWTA 1JTDA 3EWKA 1XPBA 4BL3A 2HP9A 2HF6A 2HJEA 5FL3A 4R23A 1MXOA 2LB5A 3Q81A 1Z6FA 3Q7VB 5F82A 3PYPA 1OJ5A 5E2EA 5DVAA 2HV1A 2B5RA 3VP4A 5IS1A 1SDEA 1ES3A 3MBZA 1KDSA 1L0GA 1UWPX 1SKOA 3SH8A 2EWWA 4PAUA 4GZBA 3KYEA 4BLMA 1YM1A 1H3QA 4UQIS 3IS2B 1T1AA 3CJMA 3MMHA 4GS9B 3V50A 3KSFA 3LR5A 3N7WA 1I2WA 2V0WA 2A2LA 3E4OA 2HP5A 3A3DA 2K31A 3BQ8A 1HLUP 4E3JA 1YMXA 4PM8A 3MKEA 2Y2QA 3E98A 2M7UA 4Y0UA 3OLOA 4K91A 3UE1A 3H9WA 4OLGA 2X71A 4S2PA 4GN2A 2GNXA 1MY8A 2HZ5A 2VEAA 1PI4A 2W27A 4Q0IA 2PDRA 4DN0A 4FH4A 2V20A 4MDZA 2HP6A 1NYYA 1N9NA 2MJ6A 5AVEA 1S66L 2EX8A 4R1GA 3K2NA 1V9YA 3OPHA 1M40A 5HFOA 5CTNA 1D1JA 4CLCA 4MNRA 4RYEA 4KUKA 4HESA 5GHYA 5L09A 4NXGA 2I72A 3UPNA 1RGZA 2D01A 2IWCA 3MQQA 4M3KA 2J9PA 1P0ZA 4OP5A 2JE5A 2W3HA 3T4TA 2B95A 5J7EA 3LEQA 5EE8A 1IFQA 4JKTA 1YKDA 1YLJA 1MKMA 5DTKA 5FDHA 5EECA 3GRJA 3IHBA 4WZ5C 4B88A 4MCWA 2CMNA 1JWPA 2IWDA 3UB6A 2EXAA 2GJ3A 2Y4AA 4KQDA 4DE0A 1W5DA 2ZC7A 4X56A 2VA0A 4LENA 5EVIC 3LUQA 1JTGA 2E8JA 4LRXC 3JYIA 5EVEA 4CLCD 4OKPA 4EUZA 1K4EA 4DE3A 1WYBA 2C5WB 2ZQAA 4JXGA 5DTSA 4DXBA 1XXMA 4GJ4A 4KUOA 5F69A 2XEPA 2ZQDA 3C8CA 1VHMA 1LI0A 5HSQA 2BASA 3LY4A 5EOEA 4EQIA 3IX3A 4ESPA 4O01A 4OONA 3OPLA 4N1HA 3M2JA 3W4OA 1K57A 2V1ZA 4Y13A 1ZTUA 1PW8A 3H82B 3HLBA 2W3DA 4DMZA 4YOFA 2IA2A 2V8CA 1SKFA 3PR6A 5EVLA 3ZHHA 2WKEA 1F9IA 2HGVA 5FEFA 3FWLA 4KENB 2Q9NA 4GD8A 3ZQ5A 4KQQA 3O88A 4C75A 2ZL1B 4DE1A 5EUAA 4F3LA 3U2AA 3IF6B 2JHEA 3O87A 5HX9A 2QYBA 3SS4A 1TDGA 3L9KA 3S7QA 3CI6A 2VLGA 5DJTA 1XX2A 1G28A 1BZAA 1K55C 3MR0A 2J3TD 4EBLA 2M1CA 1LHYA 2AVXA 2R9XA 5EVIA 5A90A 3S4XA 2B18A 1IELA 1WA9A 2QPNA 4PKYA 1GSVA 3DAVA 4GD6A 1RGYA 4D2OA 2ZC4B 1ERMA 4PM9A 5BOHA 1PZPA 5LBRA 3WS0A 3R7WB 2VV8A 1PWGA 4GHIB 4JXSA 2H0YA 1PFLA 5CGWA 3G2ZA 1TS6A 4WZ4A 3WRTA 4DJ3A 4E3IA 4S2MA 1DRMA 4QJGA 5EFWA 1W8YA 2Z2MB 2W3GA 5EM0A 4QWOA 1ZG4A 2O9AA 1FCMA 3Q7VA 4OOMA 4XT2B 3LIBA 2NUTC 1W79A 2L1MA 1L0DA 3G4PA 1CEGA 3IXGA 1BULA 2V1BA 5HDDA 1T1BA 5EPHA 3LGOA 5EVID 4HQAA 3C4OA 1FCNA 5F1GA 3IS2A 4S2KA 2O9CA 4GS9A 3HCYA 4QB8A 3DTIA 4O0PA 3HLFA 4HP9A 2INWA 3MFXA 5MC7A 1YQSA 3DTEA 4ARZB 4WBGA 2OAP1 5IT5A 4I3JA 1K0KA 3MZDA 5M19A 2ZLYA 1XJ3A 3UB5P 4S2OA 3RXXA 4PM7A 5CTMA 3WS5A 2P08A 1S1ZA 4NG2A 3ZVWA 1K55A 5GL9A 3ZG8B 2V0UA 2PR6A 5FAQA 4K0WA 4AFIA 3IBRA 3BFCA 3BM6A 4JF6A 3C2WA 2W1RA 4PM6A 2XROA 1YPRA 1IEMA 2JKTI 4BENA 1MWSA 3BWLA 1H8ZA 3MZFA 4P87A 4CJNA 4LRZE 3UE0A 1Y54A 2VJWA 4R38A 2WGIA 4K08A 2XRNA 3DW0A 3MXRA 1H8YA 2XQZA 4JGOA 3FPVA 1K6RA 3NHQA 4OH0A 4ZTKA 2HJ9C 4HJ4A 4RA7A 5F5YA 3ZNTA 2PAVP 4LV1A 4IUKA 3VSLA 3MFDA 3Q1FA 1J9MA 3QP6A 5CECA 4OQGA 1XJ4A 3UO9A 2WGVA 4UA6A 4U0XA 2XF3A 4HBTA 4KQRA 2PBYA 3Q7ZA 3IH9A 3IF6C 4EXOA 4P6ZS 3ZDJA 1HVBA 3VFFA 4R4RA 3LI8A 4BBTA 4EESA 2PRFA 5EOOA 3G34A 2ZC6B 3FV7A 3D3OA 3CITA 3FPWA 3T4QA 1E3UA 2K7SA 3DTMA 2W0NA 5D3OA 4OQIA 5AQ9A 4E6WA 2VV7A 2XDMA 1O7EA 2VK3A 2WZXA 3D9YA 1HZOA 1KVLA 4ZJ2A 3T4LA 2ZJ9A 3LFVA 4IVIA 1KGEA 3WS1A 3H7WB 4I3IA 4LV0A 2L4RA 3TE8A 3HUMA 2ZBBA 4X1LA 1N9LA 3B47A 1OJGA 3F1OB 5E2FA 2GDNA 5DKKA 2WKRA 1VEUA 5DF7A 3OC2A 1K25A 2WKQA 3LR4A 2Y2PA 3T1SA 3H82A 1E3UD 3BW6A 1MWUA 1YSPA 4YNRA 4Y2FA 3IHAA 3UPPA 4I3AA 1E4DA 1I5QA 3O5YA 4QHCA 3WWXA 3T4SA 4EUVA 4PPRA 3NOTC 2ZL1A 5GLCA 4IEDA 4M4XA 1ERQA 3GVBA 1VQQA 3SS3A 4B9OA 3OBFA 4E04A 3QP4A 4MEZA 1BT5A 2VGLM 2Y2NA 5AQ7A 4ZDXA 3VOYA 3UB8A 3G31A 1G6AA 3O86A 1YMSA 3SW1A 2Y2JA 1CF0A 2XSSA 4OPYA 1MPLA 1OT9A 4UHUA 3B42A 1PWDA 4LCLA 4P85A 2ZD8A 2VGKA 4A5RA 3RH8B 3UMEA 2XD5A 3EEAA 3KO6A 1L0FA 1UGUA 1T19A 3VFHA 2W3FA 3R7WA 3GV9A 3VP1A 4GHIA 1F98A 1IKIA 4WN5A 3KX0X 5KZHA 2ZQCA 3QHYA 1SZVA 1UWNX 4KZ4A 3HJIA 3DWZA 4C3QA 5TBMA 2JKRM 2BTFP 3JVUA 3UE6A 4GDBA 1YSQA 1BSGA 4B4XA 1GA9A 3HREA 5HWTA 4MLLA 1ESIA 4XT2A 4E3NA 1BLCA 1G68A 5FQJA 1BLPA 5HARA 1CK3A 2FFYA 2QWSA 2Z6DA 4EEPA 3HJKA 4OQHA 1WE4A 5HD3A 4Y3IA 3BQAA 5DF9A 4RVAA 2J3TC 2ZMAA 4MBFA 1GA0A
chains in the Genus database with same CATH topology
2WKEA 1XGJA 3FWLA 4KENB 2Q9NA 3MXSA 4GD8A 4KQQA 4QY5A 2Y55A 3UY6A 3O88A 4C75A 2Y2GA 3ITAA 1GHPA 3MKFA 2JCHA 1BLHA 1ZG6A 4IBRA 4JF5A 5DTTA 3Q82A 3TSGA 4DE1A 2WYXA 4LV3A 5EUAA 1K4FA 2ZQ8A 3NC8A 3PBTA 5CXWA 3M2KA 3IF6B 3AGFA 3IH8A 3ZGAB 3O87A 5HX9A 4BJPA 2UWXA 2OLVA 4Q8IA 1ES2A 3NDEA 3SS4A 1TDGA 3WS4A 2Z2LB 5J8XA 4BD1A 3BFFA 4X69A 1XX2A 2H0TA 5CRFA 1EI5A 2A49A 5IHVA 1BUEA 3HVFA 3IF6A 4KQOA 3V3SA 1CEFA 1LLBA 4E3OA 2VGJA 3BECA 3A3IA 5FAPA 1BZAA 1K55C 2DRWA 3OZHA 5M1AA 2P9VB 3EQUA 2ZQ7A 4C6YA 4EBLA 1LL5A 3HLEA 4YINA 1LHYA 2R9XA 4HBUA 5EVIA 2V2FF 3NY4A 2WAFA 3N6IA 2IWBA 5A90A 1JVJA 1NZUA 1FCOA 3S4XA 2P74A 2CC1A 1IELA 1XA7A 4JXWA 3QNCA 1SHVA 1ZKJA 3UN7A 2RL3A 2QPNA 1YLZA 2WZZA 4EWFA 4GB7A 4GD6A 2WGWB 3OPPA 4N92A 1RGYA 4KZ9A 1IYPA 2OSUA 3EQVA 4D2OA 5HW3A 2ZC4B 1ERMA 1CI8A 2EXBA 5FQ9A 1C3BA 4PM9A 4OLDA 5GLDA 4DF6A 1PZPA 5BOHA 3W8KA 2Y2KA 3WS0A 5CHMA 1PWGA 4JXSA 2C6WB 2J8YA 2XGNA 4QD4A 4S2IA 4Z9QA 3ZCZA 5KMWA 4OQ0A 2OV5A 2H0YA 5CGWA 4KZ7A 3VP0A 3G2ZA 4KZBA 3D4FA 3OCLA 1FR6A 2R9WA 4IVKA 2XH9A 4NETA 4JBFA 4WZ4A 4Y0OA 3BLMA 5HAQA 1PIOA 3WRTA 3ZNYA 1RCJA 3PBQA 4E3IA 1YLWA 4NK3A 4K0XA 5E2GA 4S2MA 4QJGA 2XFSA 5JYPA 1KVMA 4JLFA 2Q9MA 2XD1A 1W8YA 2Z2MB 1ZC2A 4Y7PA 3VMAA 3MZEA 3FZCA 1NXYA 1ZG4A 4KZAA 4X55A 4E3KA 1FCMA 4GOGA 3ZFZA 3BFGA 1GHMA 5CHJA 1NY0A 3Q7VA 4OOMA 3W4QA 1PYYA 3UDFA 4DXCA 1XKZA 4WM9A 4ZAMA 3NDGA 1W79A 1DY6A 4RX3A 3A3JA 3ZG0A 5JYOA 3IXHA 2J9OA 2ZM8A 1L0DA 3G4PA 3ZG9B 3VP2A 3P98A 5CEDA 1CEGA 1Q2QA 1BULA 1XA1A 2Y59A 3IXGA 5E43A 1NYMA 4KG6A 3SOIA 4OPQA 5EPHA 4E6XA 2QMIA 5EVID 4DDSA 3C4OA 2X01A 1KGFA 1FCNA 5F1GA 3TG9A 3VOZA 1NZOA 4S2KA 1L2SA 1GHIA 4L0LA 4QB8A 5FQQA 1PWCA 4WMCA 1K6SA 3ITBA 1EWZA 3HLFA 4DDYA 3C7UA 5AQBA 5CEBA 4R0QA 3PBOA 4DE2A 3N8SA 1YQSA 1PW1A 2PU4A 4WBGA 1OMEA 2X02A 5FASA 4WEKA 3NBLA 4P0MA 5FATA 3BFDA 1PZOA 3MZDA 5M19A 5L2FA 2ZLYA 1SCWA 1ESUA 2H5SA 1JWZA 4S2OA 4WYYA 4PM7A 5CTMA 3RXXA 4BD0A 3N8RA 3WS5A 3GMWA 2ZQ9A 1L0EA 3E2KA 3M6BA 3PBSA 3UE3A 2J7VA 2HDQA 3LY3A 4F94A 5I94A 3UDXA 1EROA 3ZVWA 1K55A 2WUQA 3AGDA 3IWOA 5GL9A 1AXBA 4KG2A 1S0WA 2Y2OA 5FAQA 3ZG8B 4LV2A 1XP4A 3IT9A 2Y2MA 4K0WA 5HL1A 4BL2A 4UA7A 2ZM2A 4JF4A 2HDSA 3BFCA 3BM6A 4JF6A 5TFQA 3WRZA 3ZVTA 2BLSA 4PM6A 1KE0A 2EX2A 3IWQA 4X53A 4YFMA 4QU3A 5FA7A 5KSHA 1IEMA 4WZ5A 5CERA 4BENA 5EVIB 1MWSA 3FKVA 1K57C 4WEJA 3PAEA 4ZJ3A 5U47A 3SH9A 1FOFA 4H8RA 4GKUA 1H8ZA 3MZFA 4P87A 4CJNA 4EV4A 5CGSA 5FQKA 1Y54A 1H5XA 3UE0A 4JXVA 5A92A 2WGIA 1YT4A 4S2LA 1TVFA 1W7FA 3DW0A 3HLWA 3MXRA 1H8YA 2XQZA 3N8LA 3W4PA 1K6RA 4WMCD 4OH0A 1W8QA 4Y0TA 1I2SA 1FSYA 4XXRA 4ZTKA 4RA7A 3A3FA 4OOLA 3BRMA 3ZNTA 3TOIA 2XR0A 1M6KA 4LV1A 4R3BA 3O3VA 3NIAA 3VSLA 4QY6A 3MFDA 4EBNA 2HPBA 3Q1FA 3P09A 1MWTA 3GR2A 1JTDA 1J9MA 1XPBA 4BL3A 5CECA 5GLAA 1LI9A 2WKIA 1QMEA 4OQGA 2HP9A 3UO9A 4B4ZA 2WGVA 2ZC3B 4UA6A 4U0XA 4E3MA 5CGXA 2XF3A 3LCEA 4HBTA 1MXOA 4KQRA 4MBHA 2PBYA 4GDNA 2Y2HA 4KZ5A 3Q7ZA 3IH9A 4R23A 3Q81A 3IF6C 1KE3A 1Z6FA 1KGGA 3Q7VB 1Q2PA 3ZDJA 2ZC5B 4S2NC 1HVBA 3CG5A 5F82A 3VFFA 5E2EA 5DVAA 4HEFA 4R4RA 2B5RA 5CHUA 1N4OA 3VP4A 1SDEA 1ES3A 3LEZA 3MBZA 4IBXA 1KDSA 5EOOA 3G34A 2ZC6B 1L0GA 3FV7A 2WK0A 2XLNA 3S1YA 3SH8A 4XUZA 1E3UA 3CMZA 3Q07A 2JBFA 4GZBA 4BLMA 3DTMA 1O07A 1LL9A 1ES4A 3HUOA 3ZG7B 1YM1A 5F83A 4FSFA 5D3OA 3C5AA 1K56A 1XGIA 3CJMA 2Y91A 4OQIA 5M18A 5KSCA 5AQ9A 3V50A 3N7WA 3VP3A 4E6WA 2DCFA 1I2WA 3HL9A 1MWRA 2XDMA 4XUXA 1BTLA 1K54C 1O7EA 2HP5A 3A3DA 2WZXA 1HZOA 4KG5A 5FDHA 3PBRA 4E3JA 1YMXA 4PM8A 3MKEA 4O7DA 2Y2QA 1KVLA 3M6HA 4ZJ2A 2ZJ9A 2ZM0A 4P6BA 4X68A 5TGFA 1YLPA 2E8IA 4KZ3A 4IVIA 4Y0UA 1CI9A 1KGEA 4OPRA 3CZDA 3A3EA 2FFFB 2EX9A 1QMFA 4K91A 3UE1A 3BYDA 4OLGA 3WS1A 3C4PA 4LV0A 2X71A 5GLBA 1TEMA 4S2PA 4GN2A 3I7JA 4OPZA 3HUMA 1MY8A 2DNSA 1PI4A 5GHXA 5FQIA 2XFTA 5AQAA 3RJUA 1VM1A 2OLUA 4RX2A 4E3LA 4FH4A 2V20A 5E2FA 2GDNA 2HP6A 1NYYA 3HBRA 1NJ4A 2XK1A 5DF7A 5FQMA 3OC2A 1IYOA 1ONHA 1K25A 2EX8A 4R1GA 3OPHA 2Y2PA 3G32A 1M40A 1E3UD 4ID4A 4OP8A 5HFOA 5CTNA 4UA9A 3BLSA 1MWUA 4N1XA 4CPKA 3IHAA 4MNRA 3UPPA 3NI9A 1E4DA 4OVDA 3DWKA 1K56D 1I5QA 4RYEA 4S2JA 3AGEA 2G2WA 1S6RA 2A3UA 4QHCA 3WWXA 4HESA 5GHYA 4KZ6A 4PPRA 4PM5A 5GLCA 3FYZA 4IEDA 3HLCA 1ERQA 2I72A 3GVBA 3UPNA 1RGZA 1VQQA 1N9BA 3RXWA 3SS5A 2IWCA 3BEBA 1HTZA 4ZBEA 5HAIA 1K38A 3SS3A 3GQZA 5G18A 3IQAA 1E25A 4M3KA 4S2NA 2J9PA 4R4SA 4MEZA 1BT5A 2RCXA 3B3XA 2Y2NA 4EBPA 4U0TA 5AQ7A 2BG1A 4OP5A 2JE5A 3ZG5A 4ZDXA 1FQGA 3FKWA 4UAAA 3VOYA 1ALQA 1ONGA 3G31A 3E2LA 4ZJ1A 3UPOA 3NCKA 4FCFA 1G6AA 3O86A 3OPRA 5EE8A 1YMSA 1BLSA 2Y2JA 5FI2A 4PMAA 5A91A 1U60A 3SH7A 4OPYA 4KZ8A 2P9VA 1MPLA 4JKTA 1TDLA 1YLJA 4UHUA 5F1FA 3V39A 4BQMA 1MBLA 2G2UA 4N9KA 5DTKA 5EECA 3GRJA 3IF5A 3IHBA 1DJBA 4WZ5C 4U3TA 4B88A 1PWDA 4LCLA 4FD8A 3QNBA 3HUNA 4P85A 1JWPA 2IWDA 2ZD8A 1WYCA 4FH2A 1RP5A 2VGKA 4A5RA 2EXAA 2XD5A 2Y4AA 3ISGA 3V3RA 1K54A 1L0FA 4DE0A 1W5DA 2WGWA 3N4IA 2ZC7A 4X56A 1HD8A 4LENA 5EVIC 2QZ6A 3IXBA 3VFHA 3UNWA 1JTGA 3JYIA 3VP1A 3GV9A 1IKIA 4OKPA 4EUZA 1KE4A 1K4EA 4DE3A 3OCNA 4X6TA 5FSRA 3GSGA 1FR1A 1WYBA 2PU2A 2C5WB 3PAGA 2ZQCA 1KDWA 2HDUA 5FI7A 4DKIA 5KZHA 2ZQAA 4JXGA 3G35A 3QHYA 1SDNA 3IWIA 5DTSA 4R3JA 3G2YA 4KZ4A 3S22A 3DWZA 4DXBA 4C3QA 1XXMA 3G30A 5A93A 1IKGA 4MBKA 4N9LA 3PTEA 3LO7A 3BFEA 4GDBA 4JPMA 1MKIA 3HLDA 2Y2LA 1ES5A 1DJCA 1BSGA 2XEPA 2ZQDA 1GCEA 4B4XA 1GA9A 1NRFA 3HREA 4MLLA 2WKHA 1YLTA 5FI6A 1ESIA 4E3NA 1LI0A 4LCMA 1BLCA 5DF8A 1G68A 5FQJA 3PBNA 3LY4A 3UDIA 5EOEA 4EQIA 1FSWA 1BLPA 2WADA 4OONA 2EX6A 3OPLA 1DJAA 5HARA 4N1HA 5GHZA 1CK3A 2FFYA 3M2JA 5E2HA 2Y2IA 1IYSA 3W4OA 4OOYA 1K57A 2V1ZA 3VSKA 3WS2A 5HAPA 1YLYA 4WELA 1IYQA 4OQHA 5FAOA 3GTCA 1WE4A 4GNUA 2EFUA 2EFXA 3HLGA 5DF9A 1PW8A 3HLBA 4DRTA 2H10A 4RVAA 3IXDA 5TR7A 2WAEA 1SKFA 3C7VA 3V5MA 2ZMAA 1PI5A 2JC7A 2HDRA 5EVLA 4MBFA 3ZHHA 1JWVA 1GA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WKE A;  1XGJ A;  3FWL A;  4KEN B;  2Q9N A;  3MXS A;  4GD8 A;  4KQQ A;  4QY5 A;  2Y55 A;  3UY6 A;  3O88 A;  4C75 A;  2Y2G A;  3ITA A;  1GHP A;  3MKF A;  2JCH A;  1BLH A;  1ZG6 A;  4IBR A;  4JF5 A;  5DTT A;  3Q82 A;  3TSG A;  4DE1 A;  2WYX A;  4LV3 A;  5EUA A;  1K4F A;  2ZQ8 A;  3NC8 A;  3PBT A;  5CXW A;  3M2K A;  3IF6 B;  3AGF A;  3IH8 A;  3ZGA B;  3O87 A;  5HX9 A;  4BJP A;  2UWX A;  2OLV A;  4Q8I A;  1ES2 A;  3NDE A;  3SS4 A;  1TDG A;  3WS4 A;  2Z2L B;  5J8X A;  4BD1 A;  3BFF A;  4X69 A;  1XX2 A;  2H0T A;  5CRF A;  1EI5 A;  2A49 A;  5IHV A;  1BUE A;  3HVF A;  3IF6 A;  4KQO A;  3V3S A;  1CEF A;  1LLB A;  4E3O A;  2VGJ A;  3BEC A;  3A3I A;  5FAP A;  1BZA A;  1K55 C;  2DRW A;  3OZH A;  5M1A A;  2P9V B;  3EQU A;  2ZQ7 A;  4C6Y A;  4EBL A;  1LL5 A;  3HLE A;  4YIN A;  1LHY A;  2R9X A;  4HBU A;  5EVI A;  2V2F F;  3NY4 A;  2WAF A;  3N6I A;  2IWB A;  5A90 A;  1JVJ A;  1NZU A;  1FCO A;  3S4X A;  2P74 A;  2CC1 A;  1IEL A;  1XA7 A;  4JXW A;  3QNC A;  1SHV A;  1ZKJ A;  3UN7 A;  2RL3 A;  2QPN A;  1YLZ A;  2WZZ A;  4EWF A;  4GB7 A;  4GD6 A;  2WGW B;  3OPP A;  4N92 A;  1RGY A;  4KZ9 A;  1IYP A;  2OSU A;  3EQV A;  4D2O A;  5HW3 A;  2ZC4 B;  1ERM A;  1CI8 A;  2EXB A;  5FQ9 A;  1C3B A;  4PM9 A;  4OLD A;  5GLD A;  4DF6 A;  1PZP A;  5BOH A;  3W8K A;  2Y2K A;  3WS0 A;  5CHM A;  1PWG A;  4JXS A;  2C6W B;  2J8Y A;  2XGN A;  4QD4 A;  4S2I A;  4Z9Q A;  3ZCZ A;  5KMW A;  4OQ0 A;  2OV5 A;  2H0Y A;  5CGW A;  4KZ7 A;  3VP0 A;  3G2Z A;  4KZB A;  3D4F A;  3OCL A;  1FR6 A;  2R9W A;  4IVK A;  2XH9 A;  4NET A;  4JBF A;  4WZ4 A;  4Y0O A;  3BLM A;  5HAQ A;  1PIO A;  3WRT A;  3ZNY A;  1RCJ A;  3PBQ A;  4E3I A;  1YLW A;  4NK3 A;  4K0X A;  5E2G A;  4S2M A;  4QJG A;  2XFS A;  5JYP A;  1KVM A;  4JLF A;  2Q9M A;  2XD1 A;  1W8Y A;  2Z2M B;  1ZC2 A;  4Y7P A;  3VMA A;  3MZE A;  3FZC A;  1NXY A;  1ZG4 A;  4KZA A;  4X55 A;  4E3K A;  1FCM A;  4GOG A;  3ZFZ A;  3BFG A;  1GHM A;  5CHJ A;  1NY0 A;  3Q7V A;  4OOM A;  3W4Q A;  1PYY A;  3UDF A;  4DXC A;  1XKZ A;  4WM9 A;  4ZAM A;  3NDG A;  1W79 A;  1DY6 A;  4RX3 A;  3A3J A;  3ZG0 A;  5JYO A;  3IXH A;  2J9O A;  2ZM8 A;  1L0D A;  3G4P A;  3ZG9 B;  3VP2 A;  3P98 A;  5CED A;  1CEG A;  1Q2Q A;  1BUL A;  1XA1 A;  2Y59 A;  3IXG A;  5E43 A;  1NYM A;  4KG6 A;  3SOI A;  4OPQ A;  5EPH A;  4E6X A;  2QMI A;  5EVI D;  4DDS A;  3C4O A;  2X01 A;  1KGF A;  1FCN A;  5F1G A;  3TG9 A;  3VOZ A;  1NZO A;  4S2K A;  1L2S A;  1GHI A;  4L0L A;  4QB8 A;  5FQQ A;  1PWC A;  4WMC A;  1K6S A;  3ITB A;  1EWZ A;  3HLF A;  4DDY A;  3C7U A;  5AQB A;  5CEB A;  4R0Q A;  3PBO A;  4DE2 A;  3N8S A;  1YQS A;  1PW1 A;  2PU4 A;  4WBG A;  1OME A;  2X02 A;  5FAS A;  4WEK A;  3NBL A;  4P0M A;  5FAT A;  3BFD A;  1PZO A;  3MZD A;  5M19 A;  5L2F A;  2ZLY A;  1SCW A;  1ESU A;  2H5S A;  1JWZ A;  4S2O A;  4WYY A;  4PM7 A;  5CTM A;  3RXX A;  4BD0 A;  3N8R A;  3WS5 A;  3GMW A;  2ZQ9 A;  1L0E A;  3E2K A;  3M6B A;  3PBS A;  3UE3 A;  2J7V A;  2HDQ A;  3LY3 A;  4F94 A;  5I94 A;  3UDX A;  1ERO A;  3ZVW A;  1K55 A;  2WUQ A;  3AGD A;  3IWO A;  5GL9 A;  1AXB A;  4KG2 A;  1S0W A;  2Y2O A;  5FAQ A;  3ZG8 B;  4LV2 A;  1XP4 A;  3IT9 A;  2Y2M A;  4K0W A;  5HL1 A;  4BL2 A;  4UA7 A;  2ZM2 A;  4JF4 A;  2HDS A;  3BFC A;  3BM6 A;  4JF6 A;  5TFQ A;  3WRZ A;  3ZVT A;  2BLS A;  4PM6 A;  1KE0 A;  2EX2 A;  3IWQ A;  4X53 A;  4YFM A;  4QU3 A;  5FA7 A;  5KSH A;  1IEM A;  4WZ5 A;  5CER A;  4BEN A;  5EVI B;  1MWS A;  3FKV A;  1K57 C;  4WEJ A;  3PAE A;  4ZJ3 A;  5U47 A;  3SH9 A;  1FOF A;  4H8R A;  4GKU A;  1H8Z A;  3MZF A;  4P87 A;  4CJN A;  4EV4 A;  5CGS A;  5FQK A;  1Y54 A;  1H5X A;  3UE0 A;  4JXV A;  5A92 A;  2WGI A;  1YT4 A;  4S2L A;  1TVF A;  1W7F A;  3DW0 A;  3HLW A;  3MXR A;  1H8Y A;  2XQZ A;  3N8L A;  3W4P A;  1K6R A;  4WMC D;  4OH0 A;  1W8Q A;  4Y0T A;  1I2S A;  1FSY A;  4XXR A;  4ZTK A;  4RA7 A;  3A3F A;  4OOL A;  3BRM A;  3ZNT A;  3TOI A;  2XR0 A;  1M6K A;  4LV1 A;  4R3B A;  3O3V A;  3NIA A;  3VSL A;  4QY6 A;  3MFD A;  4EBN A;  2HPB A;  3Q1F A;  3P09 A;  1MWT A;  3GR2 A;  1JTD A;  1J9M A;  1XPB A;  4BL3 A;  5CEC A;  5GLA A;  1LI9 A;  2WKI A;  1QME A;  4OQG A;  2HP9 A;  3UO9 A;  4B4Z A;  2WGV A;  2ZC3 B;  4UA6 A;  4U0X A;  4E3M A;  5CGX A;  2XF3 A;  3LCE A;  4HBT A;  1MXO A;  4KQR A;  4MBH A;  2PBY A;  4GDN A;  2Y2H A;  4KZ5 A;  3Q7Z A;  3IH9 A;  4R23 A;  3Q81 A;  3IF6 C;  1KE3 A;  1Z6F A;  1KGG A;  3Q7V B;  1Q2P A;  3ZDJ A;  2ZC5 B;  4S2N C;  1HVB A;  3CG5 A;  5F82 A;  3VFF A;  5E2E A;  5DVA A;  4HEF A;  4R4R A;  2B5R A;  5CHU A;  1N4O A;  3VP4 A;  1SDE A;  1ES3 A;  3LEZ A;  3MBZ A;  4IBX A;  1KDS A;  5EOO A;  3G34 A;  2ZC6 B;  1L0G A;  3FV7 A;  2WK0 A;  2XLN A;  3S1Y A;  3SH8 A;  4XUZ A;  1E3U A;  3CMZ A;  3Q07 A;  2JBF A;  4GZB A;  4BLM A;  3DTM A;  1O07 A;  1LL9 A;  1ES4 A;  3HUO A;  3ZG7 B;  1YM1 A;  5F83 A;  4FSF A;  5D3O A;  3C5A A;  1K56 A;  1XGI A;  3CJM A;  2Y91 A;  4OQI A;  5M18 A;  5KSC A;  5AQ9 A;  3V50 A;  3N7W A;  3VP3 A;  4E6W A;  2DCF A;  1I2W A;  3HL9 A;  1MWR A;  2XDM A;  4XUX A;  1BTL A;  1K54 C;  1O7E A;  2HP5 A;  3A3D A;  2WZX A;  1HZO A;  4KG5 A;  5FDH A;  3PBR A;  4E3J A;  1YMX A;  4PM8 A;  3MKE A;  4O7D A;  2Y2Q A;  1KVL A;  3M6H A;  4ZJ2 A;  2ZJ9 A;  2ZM0 A;  4P6B A;  4X68 A;  5TGF A;  1YLP A;  2E8I A;  4KZ3 A;  4IVI A;  4Y0U A;  1CI9 A;  1KGE A;  4OPR A;  3CZD A;  3A3E A;  2FFF B;  2EX9 A;  1QMF A;  4K91 A;  3UE1 A;  3BYD A;  4OLG A;  3WS1 A;  3C4P A;  4LV0 A;  2X71 A;  5GLB A;  1TEM A;  4S2P A;  4GN2 A;  3I7J A;  4OPZ A;  3HUM A;  1MY8 A;  2DNS A;  1PI4 A;  5GHX A;  5FQI A;  2XFT A;  5AQA A;  3RJU A;  1VM1 A;  2OLU A;  4RX2 A;  4E3L A;  4FH4 A;  2V20 A;  5E2F A;  2GDN A;  2HP6 A;  1NYY A;  3HBR A;  1NJ4 A;  2XK1 A;  5DF7 A;  5FQM A;  3OC2 A;  1IYO A;  1ONH A;  1K25 A;  2EX8 A;  4R1G A;  3OPH A;  2Y2P A;  3G32 A;  1M40 A;  1E3U D;  4ID4 A;  4OP8 A;  5HFO A;  5CTN A;  4UA9 A;  3BLS A;  1MWU A;  4N1X A;  4CPK A;  3IHA A;  4MNR A;  3UPP A;  3NI9 A;  1E4D A;  4OVD A;  3DWK A;  1K56 D;  1I5Q A;  4RYE A;  4S2J A;  3AGE A;  2G2W A;  1S6R A;  2A3U A;  4QHC A;  3WWX A;  4HES A;  5GHY A;  4KZ6 A;  4PPR A;  4PM5 A;  5GLC A;  3FYZ A;  4IED A;  3HLC A;  1ERQ A;  2I72 A;  3GVB A;  3UPN A;  1RGZ A;  1VQQ A;  1N9B A;  3RXW A;  3SS5 A;  2IWC A;  3BEB A;  1HTZ A;  4ZBE A;  5HAI A;  1K38 A;  3SS3 A;  3GQZ A;  5G18 A;  3IQA A;  1E25 A;  4M3K A;  4S2N A;  2J9P A;  4R4S A;  4MEZ A;  1BT5 A;  2RCX A;  3B3X A;  2Y2N A;  4EBP A;  4U0T A;  5AQ7 A;  2BG1 A;  4OP5 A;  2JE5 A;  3ZG5 A;  4ZDX A;  1FQG A;  3FKW A;  4UAA A;  3VOY A;  1ALQ A;  1ONG A;  3G31 A;  3E2L A;  4ZJ1 A;  3UPO A;  3NCK A;  4FCF A;  1G6A A;  3O86 A;  3OPR A;  5EE8 A;  1YMS A;  1BLS A;  2Y2J A;  5FI2 A;  4PMA A;  5A91 A;  1U60 A;  3SH7 A;  4OPY A;  4KZ8 A;  2P9V A;  1MPL A;  4JKT A;  1TDL A;  1YLJ A;  4UHU A;  5F1F A;  3V39 A;  4BQM A;  1MBL A;  2G2U A;  4N9K A;  5DTK A;  5EEC A;  3GRJ A;  3IF5 A;  3IHB A;  1DJB A;  4WZ5 C;  4U3T A;  4B88 A;  1PWD A;  4LCL A;  4FD8 A;  3QNB A;  3HUN A;  4P85 A;  1JWP A;  2IWD A;  2ZD8 A;  1WYC A;  4FH2 A;  1RP5 A;  2VGK A;  4A5R A;  2EXA A;  2XD5 A;  2Y4A A;  3ISG A;  3V3R A;  1K54 A;  1L0F A;  4DE0 A;  1W5D A;  2WGW A;  3N4I A;  2ZC7 A;  4X56 A;  1HD8 A;  4LEN A;  5EVI C;  2QZ6 A;  3IXB A;  3VFH A;  3UNW A;  1JTG A;  3JYI A;  3VP1 A;  3GV9 A;  1IKI A;  4OKP A;  4EUZ A;  1KE4 A;  1K4E A;  4DE3 A;  3OCN A;  4X6T A;  5FSR A;  3GSG A;  1FR1 A;  1WYB A;  2PU2 A;  2C5W B;  3PAG A;  2ZQC A;  1KDW A;  2HDU A;  5FI7 A;  4DKI A;  5KZH A;  2ZQA A;  4JXG A;  3G35 A;  3QHY A;  1SDN A;  3IWI A;  5DTS A;  4R3J A;  3G2Y A;  4KZ4 A;  3S22 A;  3DWZ A;  4DXB A;  4C3Q A;  1XXM A;  3G30 A;  5A93 A;  1IKG A;  4MBK A;  4N9L A;  3PTE A;  3LO7 A;  3BFE A;  4GDB A;  4JPM A;  1MKI A;  3HLD A;  2Y2L A;  1ES5 A;  1DJC A;  1BSG A;  2XEP A;  2ZQD A;  1GCE A;  4B4X A;  1GA9 A;  1NRF A;  3HRE A;  4MLL A;  2WKH A;  1YLT A;  5FI6 A;  1ESI A;  4E3N A;  1LI0 A;  4LCM A;  1BLC A;  5DF8 A;  1G68 A;  5FQJ A;  3PBN A;  3LY4 A;  3UDI A;  5EOE A;  4EQI A;  1FSW A;  1BLP A;  2WAD A;  4OON A;  2EX6 A;  3OPL A;  1DJA A;  5HAR A;  4N1H A;  5GHZ A;  1CK3 A;  2FFY A;  3M2J A;  5E2H A;  2Y2I A;  1IYS A;  3W4O A;  4OOY A;  1K57 A;  2V1Z A;  3VSK A;  3WS2 A;  5HAP A;  1YLY A;  4WEL A;  1IYQ A;  4OQH A;  5FAO A;  3GTC A;  1WE4 A;  4GNU A;  2EFU A;  2EFX A;  3HLG A;  5DF9 A;  1PW8 A;  3HLB A;  4DRT A;  2H10 A;  4RVA A;  3IXD A;  5TR7 A;  2WAE A;  1SKF A;  3C7V A;  3V5M A;  2ZMA A;  1PI5 A;  2JC7 A;  2HDR A;  5EVL A;  4MBF A;  3ZHH A;  1JWV A;  1GA0 A; 
#chains in the Genus database with same CATH topology
 4QY5 A;  4HH3 A;  3UY6 A;  3ITA A;  4BWI A;  3NEC A;  1ZG6 A;  2QHK A;  3TSG A;  3Q82 A;  4LV3 A;  1K4F A;  4HH2 A;  1P97 A;  2JKF A;  3IH8 A;  1OPX A;  2PD7 A;  2OLV A;  1ES2 A;  3WS4 A;  2Z2L B;  4IUH A;  4BD1 A;  4X69 A;  4X1M A;  2A49 A;  1W63 Q;  2VZW A;  2XA7 M;  3V3S A;  2A24 B;  3BEC A;  1T18 A;  5FAP A;  2P9V B;  3D72 A;  4H6J B;  4YIN A;  1NRJ A;  2V2F F;  4FTX A;  2P74 A;  1XA7 A;  2RL3 A;  2WZZ A;  2WGW B;  3OPP A;  4N92 A;  3ZYT A;  1IYP A;  5FQ9 A;  1C3B A;  3QP5 A;  2Y8H A;  4OLD A;  5GLD A;  4FUW A;  2J8Y A;  2XGN A;  5KMW A;  4KZ7 A;  4LPZ A;  3VP0 A;  2R9W A;  4IVK A;  4LGW A;  4MN7 A;  4JBF A;  3BLM A;  3CAX A;  1PIO A;  1YLW A;  2XFS A;  1Z09 A;  4JLF A;  1ZC2 A;  4Y7P A;  3MZE A;  3FZC A;  3NJA A;  1NXY A;  5FEG A;  3BFG A;  5CHJ A;  2PBD P;  3W4Q A;  3UDF A;  4DXC A;  4G3K A;  4WM9 A;  3NDG A;  2Q0O A;  1DY6 A;  4RX3 A;  3A3J A;  1Y28 A;  1J3W A;  2ZM8 A;  3VP2 A;  5E43 A;  2JKR I;  4KG6 A;  3KYQ A;  1ACF A;  2X01 A;  5AVF A;  4G3W A;  1L2S A;  5FQQ A;  1PWC A;  4WMC A;  3FG8 A;  3ITB A;  3LID A;  4HOI A;  4R0Q A;  3PBO A;  2JN7 A;  1OME A;  3MSH A;  4WEK A;  3NBL A;  3BFD A;  1P9W A;  1F2K A;  1PZO A;  3IBJ A;  5L2F A;  1ESU A;  5DJU A;  4BD0 A;  3E2K A;  3PBS A;  2HDQ A;  4F94 A;  3E4P A;  3UDX A;  3H7W A;  2WUQ A;  4R3A A;  4KG2 A;  1S0W A;  1X0O A;  1XP4 A;  3CWF A;  1XFQ A;  5HL1 A;  3P01 A;  1EW0 A;  5J4E A;  2L0W A;  4JF4 A;  2YKF A;  4YWZ A;  2HDS A;  5TFQ A;  3WRZ A;  5K5B A;  5KSH A;  3F1O A;  4WZ5 A;  4WEJ A;  5U47 A;  3T4J A;  1H5X A;  5A92 A;  4PKY G;  3EEH A;  4S2L A;  1W7F A;  3HLW A;  3S7P A;  1F5M A;  3N8L A;  1PNE A;  4WMC D;  4Y0T A;  1I2S A;  1FSY A;  4XXR A;  2NUP C;  1VET A;  1M6K A;  4L9G A;  4R3B A;  4B93 A;  4QY6 A;  3L7H A;  1DP6 A;  3P09 A;  3KSH A;  3B33 A;  2OOL A;  2KDK A;  1QME A;  5HWV A;  3VE3 A;  4MBH A;  3TW8 A;  5HDS A;  4KZ5 A;  3LI9 A;  1KE3 A;  1KGG A;  2ZC5 B;  4S2N C;  5L10 A;  4CLC E;  2D02 A;  5CHU A;  1N4O A;  1TS8 A;  3LEZ A;  4IBX A;  2WK0 A;  2XLN A;  3U4L P;  5HDC A;  5HZH A;  3CMZ A;  3Q07 A;  2JBF A;  1LL9 A;  3C5A A;  1K56 A;  2Y91 A;  5M18 A;  1MWR A;  3NOU C;  4XUX A;  5HD5 A;  3T1Q B;  1K54 C;  4JGR A;  2DMW A;  3M6H A;  3OOV A;  1D06 A;  5TGF A;  1YLP A;  2E8I A;  4KZ3 A;  3DBA A;  3CLO A;  3A3E A;  3CZD A;  5I5L A;  1D7E A;  3PHY A;  3C4P A;  5GLB A;  1TEM A;  1ODV A;  3I7J A;  3EGX C;  1XFN A;  3W2Z A;  3RJU A;  3A0R A;  1VM1 A;  1TS0 A;  3HBR A;  2XK1 A;  2ZMV A;  4ID4 A;  4OP8 A;  2V8F A;  4CPK A;  3F1N B;  3NI9 A;  1K56 D;  3MJQ A;  4HIA A;  4S2J A;  3MQ0 A;  3AGE A;  2G2W A;  2ZOH A;  1S6R A;  1NWZ A;  2PR5 A;  4PM5 A;  3HLC A;  3IX8 A;  4NXF A;  4Q0J A;  3C38 A;  1HTZ A;  3S7N A;  1K38 A;  3GQZ A;  5G18 A;  3IQA A;  1E25 A;  4S2N A;  2B02 A;  1PRQ A;  1LSW A;  3B3X A;  4EBP A;  2VV6 A;  1FQG A;  4UAA A;  4R6L A;  1ONG A;  3E0Y A;  3E2L A;  4ZJ1 A;  3NCK A;  4FCF A;  1BLS A;  2A24 A;  1U60 A;  4KZ8 A;  2P9V A;  1TDL A;  5F1F A;  3V39 A;  4BQM A;  2G2U A;  4H6J A;  4N9K A;  3IF5 A;  4MN5 A;  3HUN A;  4FH2 A;  1WYC A;  4NXB A;  1K54 A;  1S4R A;  1NLY A;  2WGW A;  1HD8 A;  2QZ6 A;  2KOI A;  4ETX A;  3OCN A;  5FSR A;  1KDW A;  2HDU A;  5FI7 A;  3G35 A;  1SDN A;  3IWI A;  1GSX A;  3G2Y A;  1TF1 A;  3S22 A;  1YAX A;  3G30 A;  5A93 A;  5L07 A;  2I9V A;  3KSI A;  3PTE A;  4JPM A;  3QP1 A;  3HLD A;  1ES5 A;  1DJC A;  3MF0 A;  3LIE A;  1NRF A;  1YLT A;  5FI6 A;  4LCM A;  3UDI A;  1S67 L;  5GHZ A;  4RQ9 A;  1IYS A;  4OOY A;  3VSK A;  3WS2 A;  1YLY A;  4WEL A;  1IYQ A;  2PYP A;  2EFU A;  2EFX A;  4EEU A;  3PXP A;  3IXD A;  2WAE A;  2WKP A;  1Y4O A;  2JC7 A;  2UV0 E;  3MS6 A;  2Y55 A;  2JKG A;  2Y2G A;  1GHP A;  3MKF A;  2JCH A;  1OT6 A;  4JF5 A;  2WYX A;  3PBT A;  5CXW A;  3M2K A;  3ZGA B;  3AGF A;  4BJP A;  3NDE A;  4EW7 A;  3BFF A;  4NEE D;  5CRF A;  1EI5 A;  4GW9 A;  5IHV A;  1BUE A;  3HVF A;  3IF6 A;  1LLB A;  2DRW A;  3VV4 A;  5A8B A;  4C6Y A;  1FIL A;  3NY4 A;  2GX5 A;  2QJ5 A;  3VOL A;  2CC1 A;  3F1P B;  5L8M A;  1ZKJ A;  3UN7 A;  1YLZ A;  2VKS A;  5HWW A;  4GB7 A;  4GCZ A;  2G7U A;  3BY8 A;  1AWI A;  3A0S A;  4KZ9 A;  4II7 A;  1CI8 A;  2EXB A;  4DF6 A;  2FZ0 A;  4HHD A;  5CHM A;  3ZCZ A;  2C6W B;  4Z9Q A;  1L3L A;  4S2I A;  4HNB A;  2PT7 A;  3D4F A;  3OCL A;  1FR6 A;  2XH9 A;  4NET A;  1OTI A;  4Y0O A;  5HAQ A;  3ZNY A;  3PBQ A;  4K0X A;  1N9O A;  1KVM A;  3K3C A;  4L9F A;  3BY9 A;  4LLO B;  3LIF A;  2YKH A;  4KZA A;  4X55 A;  1NY0 A;  4GLQ A;  4IHQ A;  1XKZ A;  2EWV A;  2PD8 A;  3IXH A;  3ZG9 B;  4BMW A;  4CQH A;  1XA1 A;  2Y59 A;  3VE4 A;  1NYM A;  3GEC A;  4DDS A;  1KGF A;  3VOZ A;  1LSX A;  4EER A;  1K6S A;  4DDY A;  3C7U A;  3LYX A;  5CEB A;  4QPR A;  4WLA A;  4DE2 A;  3N8S A;  2PU4 A;  2X02 A;  5HPF A;  5FAT A;  3T4O A;  1SCW A;  2H5S A;  4MMN A;  2J80 A;  4WYY A;  4ARZ A;  1CQA A;  3GMW A;  2ZQ9 A;  1L0E A;  3UE3 A;  3LY3 A;  5TJJ A;  5I94 A;  1ERO A;  2Y2O A;  4LV2 A;  1H0M A;  4BL2 A;  4UA7 A;  1BYW A;  3UB7 A;  3ZVT A;  4X53 A;  4YFM A;  1S1Y A;  5CER A;  4LFU A;  1K57 C;  3PAE A;  4EV4 A;  1LT0 A;  1KOU A;  1OTE A;  1TVF A;  3NUL A;  3F1N A;  1NLZ A;  4I5S A;  3TJZ C;  5C5K A;  1W8Q A;  2EA9 A;  3DTK A;  4OOL A;  3TOI A;  1ZHH B;  2OWJ A;  2HPB A;  3GR2 A;  4L9E A;  5GLA A;  1LI9 A;  2WKI A;  4HI4 A;  4B4Z A;  2ZC3 B;  3CPT B;  4E3M A;  5CGX A;  3LCE A;  5G4Z A;  4GDN A;  2K2N A;  2Y2H A;  4EQ1 A;  1Q2P A;  3CG5 A;  1GSW A;  4HEF A;  2KX6 A;  1G5U A;  3S1Y A;  3SZT A;  4XUZ A;  1W63 M;  5DFY A;  2OAQ 1;  1O07 A;  3ZG7 B;  1ES4 A;  3HUO A;  5F83 A;  4FSF A;  1XGI A;  5KSC A;  3VP3 A;  2DCF A;  3HL9 A;  1BTL A;  3QP2 A;  2W3E A;  4KG5 A;  5F6A A;  3PBR A;  4O7D A;  2ZM0 A;  4P6B A;  4X68 A;  5F68 A;  1CI9 A;  4OPR A;  1OTD A;  4O8G A;  2FFF B;  2EX9 A;  1QMF A;  3BYD A;  2VGL S;  4P6Z M;  1VEU B;  4OPZ A;  1LL8 A;  2M7V A;  2DNS A;  5GHX A;  5FQI A;  2XFT A;  2Z6C A;  5AQA A;  2OLU A;  4LRY C;  1JNU A;  4RX2 A;  4E3L A;  4EU0 A;  5KIZ A;  1IOU A;  1OTA A;  1NJ4 A;  4I39 A;  5FQM A;  1IYO A;  1ONH A;  3T1R A;  2P7J A;  2PHY A;  3G32 A;  4UA9 A;  3BLS A;  4N1X A;  2W1T B;  3KYZ A;  4OVD A;  3DWK A;  2JKT M;  2A3U A;  3T4K A;  4KZ6 A;  4ZRR A;  4BBU A;  3FYZ A;  3RFB A;  1N9B A;  3RXW A;  3SS5 A;  3BEB A;  2FH5 A;  4ZBE A;  5HAI A;  4R4S A;  2LB9 A;  2RCX A;  2H28 A;  3MXQ A;  4U0T A;  4NXE A;  2BG1 A;  3ZG5 A;  3FKW A;  1ALQ A;  3OPR A;  5EM1 A;  5A91 A;  5FI2 A;  4PMA A;  3IX4 A;  3SH7 A;  3V67 A;  1MBL A;  1DJB A;  5CX7 A;  4U3T A;  4FD8 A;  3QNB A;  1SKO B;  2ZOI A;  1RP5 A;  4NKP A;  3F1P A;  3NOP C;  3ISG A;  3V3R A;  3N4I A;  3IXB A;  4G3V A;  3UNW A;  3BJN A;  2O99 A;  1KE4 A;  5TBM B;  4X6T A;  3GSG A;  1FR1 A;  4HJ6 A;  2PU2 A;  3PAG A;  4DKI A;  4R3J A;  1IKG A;  4MBK A;  4JGQ A;  4N9L A;  3LIC A;  1MC0 A;  3LO7 A;  3BFE A;  1MKI A;  2Y2L A;  3ICY A;  1GCE A;  4HY8 A;  1A0K A;  2WKH A;  5DF8 A;  3PBN A;  2XA7 S;  3TRC A;  4Y15 A;  1FSW A;  2WAD A;  2EX6 A;  1DJA A;  3LR3 A;  5E2H A;  2Y2I A;  5HAP A;  5FAO A;  3GTC A;  4GNU A;  3RTY A;  3HLG A;  4WF0 A;  4DRT A;  4R70 A;  2H10 A;  5TR7 A;  4CLC B;  3C7V A;  2V1A A;  3T12 B;  3V5M A;  1PI5 A;  2HDR A;  4UQI M;  1S4S A;  1H8M A;  1JWV A;  1XGJ A;  3MXS A;  1BLH A;  2ZMF A;  4ETZ A;  4IBR A;  3S7O A;  3MQO A;  5DTT A;  2QJ7 A;  2ZQ8 A;  3NC8 A;  2UWX A;  4Q8I A;  4Z1W A;  5AJG A;  5IU1 A;  3C30 A;  5DKL A;  5J8X A;  1TD5 A;  2H0T A;  2GZA A;  3CUE C;  4KQO A;  1CJF A;  1CEF A;  4E3O A;  4D60 A;  2VGJ A;  2O9B A;  3A3I A;  3OZH A;  5M1A A;  3EQU A;  2ZQ7 A;  1LL5 A;  3EGD C;  3HLE A;  4UEY A;  2R78 A;  4HBU A;  3KSG A;  2WAF A;  3N6I A;  2IWB A;  1JVJ A;  1NZU A;  1FCO A;  3JVV A;  4JXW A;  3QNC A;  1SHV A;  3A0V A;  3R4K A;  4EWF A;  4MN6 A;  4JGP A;  2OSU A;  3EQV A;  5HW3 A;  1TS7 A;  3UMD A;  4HP4 A;  2Y2K A;  5G4Y A;  3W8K A;  3LIA A;  1STZ A;  3UPO A;  4QD4 A;  1DP8 A;  4OQ0 A;  2OV5 A;  5J3W A;  2Y79 A;  1LSV A;  4KZB A;  5HPI A;  1RCJ A;  4NK3 A;  5E2G A;  4Y17 A;  5JYP A;  2O0Y A;  3P7N A;  4I38 A;  2Q9M A;  2XD1 A;  3T1X A;  3VMA A;  3CPT A;  3E4Q A;  4E3K A;  4GOG A;  3ZFZ A;  3EOI A;  1GHM A;  4DJ2 A;  4IJG A;  1PYY A;  2V9A A;  4ZAM A;  2ACG A;  3ZG0 A;  5JYO A;  2J9O A;  3P98 A;  5CED A;  1Q2Q A;  3SOI A;  4OPQ A;  4E6X A;  2QMI A;  4EET B;  3ULF A;  3CHW P;  1XJ6 A;  3TG9 A;  1NZO A;  1V9Z A;  1DP9 A;  1GHI A;  4L0L A;  3T50 A;  3UB9 A;  1EWZ A;  1G6O A;  5AQB A;  1PW1 A;  5HL6 A;  5FAS A;  4P0M A;  2VX8 A;  3GDI A;  4Y5F A;  1T1C A;  3JPU A;  1JWZ A;  1OTB A;  3N8R A;  3CUE A;  2PYR A;  2KLI A;  3M6B A;  5DFX A;  1VB6 A;  4F3L B;  2J7V A;  3IWO A;  3AGD A;  1AXB A;  3LR0 A;  2OWH A;  3IT9 A;  2Y2M A;  3G6O A;  3K3D A;  2ZM2 A;  1P9R A;  4ME4 A;  2BLS A;  3FC7 A;  1KE0 A;  2EX2 A;  3IWQ A;  5EV0 A;  4QU3 A;  5FA7 A;  4WUJ A;  1FIK A;  4BBV A;  5EVI B;  3FKV A;  4ZJ3 A;  3SH9 A;  1FOF A;  4H8R A;  4GKU A;  5CGS A;  5FQK A;  4Q0H A;  4JXV A;  1XJ2 A;  4HJ3 A;  2P04 A;  4PHT A;  3QP8 A;  1YT4 A;  2W1T A;  2QKP A;  1VET B;  3W4P A;  2J3W A;  4FOF A;  4CLC C;  3A3F A;  3BRM A;  4WL9 A;  2XR0 A;  1MZU A;  3O3V A;  3NIA A;  4EBN A;  5FDS A;  4X25 A;  1MWT A;  1JTD A;  3EWK A;  1XPB A;  4BL3 A;  2HP9 A;  2HF6 A;  2HJE A;  5FL3 A;  4R23 A;  1MXO A;  2LB5 A;  3Q81 A;  1Z6F A;  3Q7V B;  5F82 A;  3PYP A;  1OJ5 A;  5E2E A;  5DVA A;  2HV1 A;  2B5R A;  3VP4 A;  5IS1 A;  1SDE A;  1ES3 A;  3MBZ A;  1KDS A;  1L0G A;  1UWP X;  1SKO A;  3SH8 A;  2EWW A;  4PAU A;  4GZB A;  3KYE A;  4BLM A;  1YM1 A;  1H3Q A;  4UQI S;  3IS2 B;  1T1A A;  3CJM A;  3MMH A;  4GS9 B;  3V50 A;  3KSF A;  3LR5 A;  3N7W A;  1I2W A;  2V0W A;  2A2L A;  3E4O A;  2HP5 A;  3A3D A;  2K31 A;  3BQ8 A;  1HLU P;  4E3J A;  1YMX A;  4PM8 A;  3MKE A;  2Y2Q A;  3E98 A;  2M7U A;  4Y0U A;  3OLO A;  4K91 A;  3UE1 A;  3H9W A;  4OLG A;  2X71 A;  4S2P A;  4GN2 A;  2GNX A;  1MY8 A;  2HZ5 A;  2VEA A;  1PI4 A;  2W27 A;  4Q0I A;  2PDR A;  4DN0 A;  4FH4 A;  2V20 A;  4MDZ A;  2HP6 A;  1NYY A;  1N9N A;  2MJ6 A;  5AVE A;  1S66 L;  2EX8 A;  4R1G A;  3K2N A;  1V9Y A;  3OPH A;  1M40 A;  5HFO A;  5CTN A;  1D1J A;  4CLC A;  4MNR A;  4RYE A;  4KUK A;  4HES A;  5GHY A;  5L09 A;  4NXG A;  2I72 A;  3UPN A;  1RGZ A;  2D01 A;  2IWC A;  3MQQ A;  4M3K A;  2J9P A;  1P0Z A;  4OP5 A;  2JE5 A;  2W3H A;  3T4T A;  2B95 A;  5J7E A;  3LEQ A;  5EE8 A;  1IFQ A;  4JKT A;  1YKD A;  1YLJ A;  1MKM A;  5DTK A;  5FDH A;  5EEC A;  3GRJ A;  3IHB A;  4WZ5 C;  4B88 A;  4MCW A;  2CMN A;  1JWP A;  2IWD A;  3UB6 A;  2EXA A;  2GJ3 A;  2Y4A A;  4KQD A;  4DE0 A;  1W5D A;  2ZC7 A;  4X56 A;  2VA0 A;  4LEN A;  5EVI C;  3LUQ A;  1JTG A;  2E8J A;  4LRX C;  3JYI A;  5EVE A;  4CLC D;  4OKP A;  4EUZ A;  1K4E A;  4DE3 A;  1WYB A;  2C5W B;  2ZQA A;  4JXG A;  5DTS A;  4DXB A;  1XXM A;  4GJ4 A;  4KUO A;  5F69 A;  2XEP A;  2ZQD A;  3C8C A;  1VHM A;  1LI0 A;  5HSQ A;  2BAS A;  3LY4 A;  5EOE A;  4EQI A;  3IX3 A;  4ESP A;  4O01 A;  4OON A;  3OPL A;  4N1H A;  3M2J A;  3W4O A;  1K57 A;  2V1Z A;  4Y13 A;  1ZTU A;  1PW8 A;  3H82 B;  3HLB A;  2W3D A;  4DMZ A;  4YOF A;  2IA2 A;  2V8C A;  1SKF A;  3PR6 A;  5EVL A;  3ZHH A;  2WKE A;  1F9I A;  2HGV A;  5FEF A;  3FWL A;  4KEN B;  2Q9N A;  4GD8 A;  3ZQ5 A;  4KQQ A;  3O88 A;  4C75 A;  2ZL1 B;  4DE1 A;  5EUA A;  4F3L A;  3U2A A;  3IF6 B;  2JHE A;  3O87 A;  5HX9 A;  2QYB A;  3SS4 A;  1TDG A;  3L9K A;  3S7Q A;  3CI6 A;  2VLG A;  5DJT A;  1XX2 A;  1G28 A;  1BZA A;  1K55 C;  3MR0 A;  2J3T D;  4EBL A;  2M1C A;  1LHY A;  2AVX A;  2R9X A;  5EVI A;  5A90 A;  3S4X A;  2B18 A;  1IEL A;  1WA9 A;  2QPN A;  4PKY A;  1GSV A;  3DAV A;  4GD6 A;  1RGY A;  4D2O A;  2ZC4 B;  1ERM A;  4PM9 A;  5BOH A;  1PZP A;  5LBR A;  3WS0 A;  3R7W B;  2VV8 A;  1PWG A;  4GHI B;  4JXS A;  2H0Y A;  1PFL A;  5CGW A;  3G2Z A;  1TS6 A;  4WZ4 A;  3WRT A;  4DJ3 A;  4E3I A;  4S2M A;  1DRM A;  4QJG A;  5EFW A;  1W8Y A;  2Z2M B;  2W3G A;  5EM0 A;  4QWO A;  1ZG4 A;  2O9A A;  1FCM A;  3Q7V A;  4OOM A;  4XT2 B;  3LIB A;  2NUT C;  1W79 A;  2L1M A;  1L0D A;  3G4P A;  1CEG A;  3IXG A;  1BUL A;  2V1B A;  5HDD A;  1T1B A;  5EPH A;  3LGO A;  5EVI D;  4HQA A;  3C4O A;  1FCN A;  5F1G A;  3IS2 A;  4S2K A;  2O9C A;  4GS9 A;  3HCY A;  4QB8 A;  3DTI A;  4O0P A;  3HLF A;  4HP9 A;  2INW A;  3MFX A;  5MC7 A;  1YQS A;  3DTE A;  4ARZ B;  4WBG A;  2OAP 1;  5IT5 A;  4I3J A;  1K0K A;  3MZD A;  5M19 A;  2ZLY A;  1XJ3 A;  3UB5 P;  4S2O A;  3RXX A;  4PM7 A;  5CTM A;  3WS5 A;  2P08 A;  1S1Z A;  4NG2 A;  3ZVW A;  1K55 A;  5GL9 A;  3ZG8 B;  2V0U A;  2PR6 A;  5FAQ A;  4K0W A;  4AFI A;  3IBR A;  3BFC A;  3BM6 A;  4JF6 A;  3C2W A;  2W1R A;  4PM6 A;  2XRO A;  1YPR A;  1IEM A;  2JKT I;  4BEN A;  1MWS A;  3BWL A;  1H8Z A;  3MZF A;  4P87 A;  4CJN A;  4LRZ E;  3UE0 A;  1Y54 A;  2VJW A;  4R38 A;  2WGI A;  4K08 A;  2XRN A;  3DW0 A;  3MXR A;  1H8Y A;  2XQZ A;  4JGO A;  3FPV A;  1K6R A;  3NHQ A;  4OH0 A;  4ZTK A;  2HJ9 C;  4HJ4 A;  4RA7 A;  5F5Y A;  3ZNT A;  2PAV P;  4LV1 A;  4IUK A;  3VSL A;  3MFD A;  3Q1F A;  1J9M A;  3QP6 A;  5CEC A;  4OQG A;  1XJ4 A;  3UO9 A;  2WGV A;  4UA6 A;  4U0X A;  2XF3 A;  4HBT A;  4KQR A;  2PBY A;  3Q7Z A;  3IH9 A;  3IF6 C;  4EXO A;  4P6Z S;  3ZDJ A;  1HVB A;  3VFF A;  4R4R A;  3LI8 A;  4BBT A;  4EES A;  2PRF A;  5EOO A;  3G34 A;  2ZC6 B;  3FV7 A;  3D3O A;  3CIT A;  3FPW A;  3T4Q A;  1E3U A;  2K7S A;  3DTM A;  2W0N A;  5D3O A;  4OQI A;  5AQ9 A;  4E6W A;  2VV7 A;  2XDM A;  1O7E A;  2VK3 A;  2WZX A;  3D9Y A;  1HZO A;  1KVL A;  4ZJ2 A;  3T4L A;  2ZJ9 A;  3LFV A;  4IVI A;  1KGE A;  3WS1 A;  3H7W B;  4I3I A;  4LV0 A;  2L4R A;  3TE8 A;  3HUM A;  2ZBB A;  4X1L A;  1N9L A;  3B47 A;  1OJG A;  3F1O B;  5E2F A;  2GDN A;  5DKK A;  2WKR A;  1VEU A;  5DF7 A;  3OC2 A;  1K25 A;  2WKQ A;  3LR4 A;  2Y2P A;  3T1S A;  3H82 A;  1E3U D;  3BW6 A;  1MWU A;  1YSP A;  4YNR A;  4Y2F A;  3IHA A;  3UPP A;  4I3A A;  1E4D A;  1I5Q A;  3O5Y A;  4QHC A;  3WWX A;  3T4S A;  4EUV A;  4PPR A;  3NOT C;  2ZL1 A;  5GLC A;  4IED A;  4M4X A;  1ERQ A;  3GVB A;  1VQQ A;  3SS3 A;  4B9O A;  3OBF A;  4E04 A;  3QP4 A;  4MEZ A;  1BT5 A;  2VGL M;  2Y2N A;  5AQ7 A;  4ZDX A;  3VOY A;  3UB8 A;  3G31 A;  1G6A A;  3O86 A;  1YMS A;  3SW1 A;  2Y2J A;  1CF0 A;  2XSS A;  4OPY A;  1MPL A;  1OT9 A;  4UHU A;  3B42 A;  1PWD A;  4LCL A;  4P85 A;  2ZD8 A;  2VGK A;  4A5R A;  3RH8 B;  3UME A;  2XD5 A;  3EEA A;  3KO6 A;  1L0F A;  1UGU A;  1T19 A;  3VFH A;  2W3F A;  3R7W A;  3GV9 A;  3VP1 A;  4GHI A;  1F98 A;  1IKI A;  4WN5 A;  3KX0 X;  5KZH A;  2ZQC A;  3QHY A;  1SZV A;  1UWN X;  4KZ4 A;  3HJI A;  3DWZ A;  4C3Q A;  5TBM A;  2JKR M;  2BTF P;  3JVU A;  3UE6 A;  4GDB A;  1YSQ A;  1BSG A;  4B4X A;  1GA9 A;  3HRE A;  5HWT A;  4MLL A;  1ESI A;  4XT2 A;  4E3N A;  1BLC A;  1G68 A;  5FQJ A;  1BLP A;  5HAR A;  1CK3 A;  2FFY A;  2QWS A;  2Z6D A;  4EEP A;  3HJK A;  4OQH A;  1WE4 A;  5HD3 A;  4Y3I A;  3BQA A;  5DF9 A;  4RVA A;  2J3T C;  2ZMA A;  4MBF A;  1GA0 A; 
#chains in the Genus database with same CATH homology
 2WKE A;  1XGJ A;  3FWL A;  4KEN B;  2Q9N A;  3MXS A;  4GD8 A;  4KQQ A;  4QY5 A;  2Y55 A;  3UY6 A;  3O88 A;  4C75 A;  2Y2G A;  3ITA A;  1GHP A;  3MKF A;  2JCH A;  1BLH A;  1ZG6 A;  4IBR A;  4JF5 A;  5DTT A;  3Q82 A;  3TSG A;  4DE1 A;  2WYX A;  4LV3 A;  5EUA A;  1K4F A;  2ZQ8 A;  3NC8 A;  3PBT A;  5CXW A;  3M2K A;  3IF6 B;  3AGF A;  3IH8 A;  3ZGA B;  3O87 A;  5HX9 A;  4BJP A;  2UWX A;  2OLV A;  4Q8I A;  1ES2 A;  3NDE A;  3SS4 A;  1TDG A;  3WS4 A;  2Z2L B;  5J8X A;  4BD1 A;  3BFF A;  4X69 A;  1XX2 A;  2H0T A;  5CRF A;  1EI5 A;  2A49 A;  5IHV A;  1BUE A;  3HVF A;  3IF6 A;  4KQO A;  3V3S A;  1CEF A;  1LLB A;  4E3O A;  2VGJ A;  3BEC A;  3A3I A;  5FAP A;  1BZA A;  1K55 C;  2DRW A;  3OZH A;  5M1A A;  2P9V B;  3EQU A;  2ZQ7 A;  4C6Y A;  4EBL A;  1LL5 A;  3HLE A;  4YIN A;  1LHY A;  2R9X A;  4HBU A;  5EVI A;  2V2F F;  3NY4 A;  2WAF A;  3N6I A;  2IWB A;  5A90 A;  1JVJ A;  1NZU A;  1FCO A;  3S4X A;  2P74 A;  2CC1 A;  1IEL A;  1XA7 A;  4JXW A;  3QNC A;  1SHV A;  1ZKJ A;  3UN7 A;  2RL3 A;  2QPN A;  1YLZ A;  2WZZ A;  4EWF A;  4GB7 A;  4GD6 A;  2WGW B;  3OPP A;  4N92 A;  1RGY A;  4KZ9 A;  1IYP A;  2OSU A;  3EQV A;  4D2O A;  5HW3 A;  2ZC4 B;  1ERM A;  1CI8 A;  2EXB A;  5FQ9 A;  1C3B A;  4PM9 A;  4OLD A;  5GLD A;  4DF6 A;  1PZP A;  5BOH A;  3W8K A;  2Y2K A;  3WS0 A;  5CHM A;  1PWG A;  4JXS A;  2C6W B;  2J8Y A;  2XGN A;  4QD4 A;  4S2I A;  4Z9Q A;  3ZCZ A;  5KMW A;  4OQ0 A;  2OV5 A;  2H0Y A;  5CGW A;  4KZ7 A;  3VP0 A;  3G2Z A;  4KZB A;  3D4F A;  3OCL A;  1FR6 A;  2R9W A;  4IVK A;  2XH9 A;  4NET A;  4JBF A;  4WZ4 A;  4Y0O A;  3BLM A;  5HAQ A;  1PIO A;  3WRT A;  3ZNY A;  1RCJ A;  3PBQ A;  4E3I A;  1YLW A;  4NK3 A;  4K0X A;  5E2G A;  4S2M A;  4QJG A;  2XFS A;  5JYP A;  1KVM A;  4JLF A;  2Q9M A;  2XD1 A;  1W8Y A;  2Z2M B;  1ZC2 A;  4Y7P A;  3VMA A;  3MZE A;  3FZC A;  1NXY A;  1ZG4 A;  4KZA A;  4X55 A;  4E3K A;  1FCM A;  4GOG A;  3ZFZ A;  3BFG A;  1GHM A;  5CHJ A;  1NY0 A;  3Q7V A;  4OOM A;  3W4Q A;  1PYY A;  3UDF A;  4DXC A;  1XKZ A;  4WM9 A;  4ZAM A;  3NDG A;  1W79 A;  1DY6 A;  4RX3 A;  3A3J A;  3ZG0 A;  5JYO A;  3IXH A;  2J9O A;  2ZM8 A;  1L0D A;  3G4P A;  3ZG9 B;  3VP2 A;  3P98 A;  5CED A;  1CEG A;  1Q2Q A;  1BUL A;  1XA1 A;  2Y59 A;  3IXG A;  5E43 A;  1NYM A;  4KG6 A;  3SOI A;  4OPQ A;  5EPH A;  4E6X A;  2QMI A;  5EVI D;  4DDS A;  3C4O A;  2X01 A;  1KGF A;  1FCN A;  5F1G A;  3TG9 A;  3VOZ A;  1NZO A;  4S2K A;  1L2S A;  1GHI A;  4L0L A;  4QB8 A;  5FQQ A;  1PWC A;  4WMC A;  1K6S A;  3ITB A;  1EWZ A;  3HLF A;  4DDY A;  3C7U A;  5AQB A;  5CEB A;  4R0Q A;  3PBO A;  4DE2 A;  3N8S A;  1YQS A;  1PW1 A;  2PU4 A;  4WBG A;  1OME A;  2X02 A;  5FAS A;  4WEK A;  3NBL A;  4P0M A;  5FAT A;  3BFD A;  1PZO A;  3MZD A;  5M19 A;  5L2F A;  2ZLY A;  1SCW A;  1ESU A;  2H5S A;  1JWZ A;  4S2O A;  4WYY A;  4PM7 A;  5CTM A;  3RXX A;  4BD0 A;  3N8R A;  3WS5 A;  3GMW A;  2ZQ9 A;  1L0E A;  3E2K A;  3M6B A;  3PBS A;  3UE3 A;  2J7V A;  2HDQ A;  3LY3 A;  4F94 A;  5I94 A;  3UDX A;  1ERO A;  3ZVW A;  1K55 A;  2WUQ A;  3AGD A;  3IWO A;  5GL9 A;  1AXB A;  4KG2 A;  1S0W A;  2Y2O A;  5FAQ A;  3ZG8 B;  4LV2 A;  1XP4 A;  3IT9 A;  2Y2M A;  4K0W A;  5HL1 A;  4BL2 A;  4UA7 A;  2ZM2 A;  4JF4 A;  2HDS A;  3BFC A;  3BM6 A;  4JF6 A;  5TFQ A;  3WRZ A;  3ZVT A;  2BLS A;  4PM6 A;  1KE0 A;  2EX2 A;  3IWQ A;  4X53 A;  4YFM A;  4QU3 A;  5FA7 A;  5KSH A;  1IEM A;  4WZ5 A;  5CER A;  4BEN A;  5EVI B;  1MWS A;  3FKV A;  1K57 C;  4WEJ A;  3PAE A;  4ZJ3 A;  5U47 A;  3SH9 A;  1FOF A;  4H8R A;  4GKU A;  1H8Z A;  3MZF A;  4P87 A;  4CJN A;  4EV4 A;  5CGS A;  5FQK A;  1Y54 A;  1H5X A;  3UE0 A;  4JXV A;  5A92 A;  2WGI A;  1YT4 A;  4S2L A;  1TVF A;  1W7F A;  3DW0 A;  3HLW A;  3MXR A;  1H8Y A;  2XQZ A;  3N8L A;  3W4P A;  1K6R A;  4WMC D;  4OH0 A;  1W8Q A;  4Y0T A;  1I2S A;  1FSY A;  4XXR A;  4ZTK A;  4RA7 A;  3A3F A;  4OOL A;  3BRM A;  3ZNT A;  3TOI A;  2XR0 A;  1M6K A;  4LV1 A;  4R3B A;  3O3V A;  3NIA A;  3VSL A;  4QY6 A;  3MFD A;  4EBN A;  2HPB A;  3Q1F A;  3P09 A;  1MWT A;  3GR2 A;  1JTD A;  1J9M A;  1XPB A;  4BL3 A;  5CEC A;  5GLA A;  1LI9 A;  2WKI A;  1QME A;  4OQG A;  2HP9 A;  3UO9 A;  4B4Z A;  2WGV A;  2ZC3 B;  4UA6 A;  4U0X A;  4E3M A;  5CGX A;  2XF3 A;  3LCE A;  4HBT A;  1MXO A;  4KQR A;  4MBH A;  2PBY A;  4GDN A;  2Y2H A;  4KZ5 A;  3Q7Z A;  3IH9 A;  4R23 A;  3Q81 A;  3IF6 C;  1KE3 A;  1Z6F A;  1KGG A;  3Q7V B;  1Q2P A;  3ZDJ A;  2ZC5 B;  4S2N C;  1HVB A;  3CG5 A;  5F82 A;  3VFF A;  5E2E A;  5DVA A;  4HEF A;  4R4R A;  2B5R A;  5CHU A;  1N4O A;  3VP4 A;  1SDE A;  1ES3 A;  3LEZ A;  3MBZ A;  4IBX A;  1KDS A;  5EOO A;  3G34 A;  2ZC6 B;  1L0G A;  3FV7 A;  2WK0 A;  2XLN A;  3S1Y A;  3SH8 A;  4XUZ A;  1E3U A;  3CMZ A;  3Q07 A;  2JBF A;  4GZB A;  4BLM A;  3DTM A;  1O07 A;  1LL9 A;  1ES4 A;  3HUO A;  3ZG7 B;  1YM1 A;  5F83 A;  4FSF A;  5D3O A;  3C5A A;  1K56 A;  1XGI A;  3CJM A;  2Y91 A;  4OQI A;  5M18 A;  5KSC A;  5AQ9 A;  3V50 A;  3N7W A;  3VP3 A;  4E6W A;  2DCF A;  1I2W A;  3HL9 A;  1MWR A;  2XDM A;  4XUX A;  1BTL A;  1K54 C;  1O7E A;  2HP5 A;  3A3D A;  2WZX A;  1HZO A;  4KG5 A;  5FDH A;  3PBR A;  4E3J A;  1YMX A;  4PM8 A;  3MKE A;  4O7D A;  2Y2Q A;  1KVL A;  3M6H A;  4ZJ2 A;  2ZJ9 A;  2ZM0 A;  4P6B A;  4X68 A;  5TGF A;  1YLP A;  2E8I A;  4KZ3 A;  4IVI A;  4Y0U A;  1CI9 A;  1KGE A;  4OPR A;  3CZD A;  3A3E A;  2FFF B;  2EX9 A;  1QMF A;  4K91 A;  3UE1 A;  3BYD A;  4OLG A;  3WS1 A;  3C4P A;  4LV0 A;  2X71 A;  5GLB A;  1TEM A;  4S2P A;  4GN2 A;  3I7J A;  4OPZ A;  3HUM A;  1MY8 A;  2DNS A;  1PI4 A;  5GHX A;  5FQI A;  2XFT A;  5AQA A;  3RJU A;  1VM1 A;  2OLU A;  4RX2 A;  4E3L A;  4FH4 A;  2V20 A;  5E2F A;  2GDN A;  2HP6 A;  1NYY A;  3HBR A;  1NJ4 A;  2XK1 A;  5DF7 A;  5FQM A;  3OC2 A;  1IYO A;  1ONH A;  1K25 A;  2EX8 A;  4R1G A;  3OPH A;  2Y2P A;  3G32 A;  1M40 A;  1E3U D;  4ID4 A;  4OP8 A;  5HFO A;  5CTN A;  4UA9 A;  3BLS A;  1MWU A;  4N1X A;  4CPK A;  3IHA A;  4MNR A;  3UPP A;  3NI9 A;  1E4D A;  4OVD A;  3DWK A;  1K56 D;  1I5Q A;  4RYE A;  4S2J A;  3AGE A;  2G2W A;  1S6R A;  2A3U A;  4QHC A;  3WWX A;  4HES A;  5GHY A;  4KZ6 A;  4PPR A;  4PM5 A;  5GLC A;  3FYZ A;  4IED A;  3HLC A;  1ERQ A;  2I72 A;  3GVB A;  3UPN A;  1RGZ A;  1VQQ A;  1N9B A;  3RXW A;  3SS5 A;  2IWC A;  3BEB A;  1HTZ A;  4ZBE A;  5HAI A;  1K38 A;  3SS3 A;  3GQZ A;  5G18 A;  3IQA A;  1E25 A;  4M3K A;  4S2N A;  2J9P A;  4R4S A;  4MEZ A;  1BT5 A;  2RCX A;  3B3X A;  2Y2N A;  4EBP A;  4U0T A;  5AQ7 A;  2BG1 A;  4OP5 A;  2JE5 A;  3ZG5 A;  4ZDX A;  1FQG A;  3FKW A;  4UAA A;  3VOY A;  1ALQ A;  1ONG A;  3G31 A;  3E2L A;  4ZJ1 A;  3UPO A;  3NCK A;  4FCF A;  1G6A A;  3O86 A;  3OPR A;  5EE8 A;  1YMS A;  1BLS A;  2Y2J A;  5FI2 A;  4PMA A;  5A91 A;  1U60 A;  3SH7 A;  4OPY A;  4KZ8 A;  2P9V A;  1MPL A;  4JKT A;  1TDL A;  1YLJ A;  4UHU A;  5F1F A;  3V39 A;  4BQM A;  1MBL A;  2G2U A;  4N9K A;  5DTK A;  5EEC A;  3GRJ A;  3IF5 A;  3IHB A;  1DJB A;  4WZ5 C;  4U3T A;  4B88 A;  1PWD A;  4LCL A;  4FD8 A;  3QNB A;  3HUN A;  4P85 A;  1JWP A;  2IWD A;  2ZD8 A;  1WYC A;  4FH2 A;  1RP5 A;  2VGK A;  4A5R A;  2EXA A;  2XD5 A;  2Y4A A;  3ISG A;  3V3R A;  1K54 A;  1L0F A;  4DE0 A;  1W5D A;  2WGW A;  3N4I A;  2ZC7 A;  4X56 A;  1HD8 A;  4LEN A;  5EVI C;  2QZ6 A;  3IXB A;  3VFH A;  3UNW A;  1JTG A;  3JYI A;  3VP1 A;  3GV9 A;  1IKI A;  4OKP A;  4EUZ A;  1KE4 A;  1K4E A;  4DE3 A;  3OCN A;  4X6T A;  5FSR A;  3GSG A;  1FR1 A;  1WYB A;  2PU2 A;  2C5W B;  3PAG A;  2ZQC A;  1KDW A;  2HDU A;  5FI7 A;  4DKI A;  5KZH A;  2ZQA A;  4JXG A;  3G35 A;  3QHY A;  1SDN A;  3IWI A;  5DTS A;  4R3J A;  3G2Y A;  4KZ4 A;  3S22 A;  3DWZ A;  4DXB A;  4C3Q A;  1XXM A;  3G30 A;  5A93 A;  1IKG A;  4MBK A;  4N9L A;  3PTE A;  3LO7 A;  3BFE A;  4GDB A;  4JPM A;  1MKI A;  3HLD A;  2Y2L A;  1ES5 A;  1DJC A;  1BSG A;  2XEP A;  2ZQD A;  1GCE A;  4B4X A;  1GA9 A;  1NRF A;  3HRE A;  4MLL A;  2WKH A;  1YLT A;  5FI6 A;  1ESI A;  4E3N A;  1LI0 A;  4LCM A;  1BLC A;  5DF8 A;  1G68 A;  5FQJ A;  3PBN A;  3LY4 A;  3UDI A;  5EOE A;  4EQI A;  1FSW A;  1BLP A;  2WAD A;  4OON A;  2EX6 A;  3OPL A;  1DJA A;  5HAR A;  4N1H A;  5GHZ A;  1CK3 A;  2FFY A;  3M2J A;  5E2H A;  2Y2I A;  1IYS A;  3W4O A;  4OOY A;  1K57 A;  2V1Z A;  3VSK A;  3WS2 A;  5HAP A;  1YLY A;  4WEL A;  1IYQ A;  4OQH A;  5FAO A;  3GTC A;  1WE4 A;  4GNU A;  2EFU A;  2EFX A;  3HLG A;  5DF9 A;  1PW8 A;  3HLB A;  4DRT A;  2H10 A;  4RVA A;  3IXD A;  5TR7 A;  2WAE A;  1SKF A;  3C7V A;  3V5M A;  2ZMA A;  1PI5 A;  2JC7 A;  2HDR A;  5EVL A;  4MBF A;  3ZHH A;  1JWV A;  1GA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...