1BLCA

Inhibition of beta-lactamase by clavulanate: trapped intermediates in cryocrystallographic studies
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(acting in cyclic amides)
molecule keywords BETA-LACTAMASE
publication title Inhibition of beta-lactamase by clavulanate. Trapped intermediates in cryocrystallographic studies.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 95
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1993-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1blcA00
4ZBEA 1ONHA 4N1HA 1ZG4A 3IH9A 3FKVA 5E2GA 1FOFA 5FDHA 4B4ZA 4OQGA 5M19A 2HP5A 4U0TA 3ZG8B 3A3EA 5CXWA 5CGWA 4HESA 4L0LA 3VFFA 5EVID 5EE8A 4WEKA 3VOYA 1K6SA 5EVLA 3LEZA 3ZG0A 4DDSA 2XR0A 3BFEA 1RGYA 1YMSA 3GMWA 1S0WA 1IYSA 3FKWA 3P98A 2Y2NA 1WE4A 4LV2A 4X55A 2IWDA 5CTNA 2Y2KA 3EQUA 1JTDA 5FQ9A 4OQIA 4C75A 4DKIA 4ZAMA 5GLCA 3GQZA 3FWLA 4GN2A 3IHBA 4U3TA 5GHZA 2EXBA 4OONA 4S2LA 4OQHA 3BECA 3UY6A 1SCWA 1O07A 1W5DA 1YLYA 5FAQA 5FA7A 2V1ZA 2QZ6A 3G2ZA 1YLWA 2PU2A 5GHYA 3VOZA 2Y91A 4IVIA 3VP3A 4P6BA 1QMEA 2A3UA 1ZC2A 2Q9MA 4ZJ3A 4Y0OA 3P09A 1SDEA 3HUMA 3WS4A 4GKUA 3BM6A 4E3NA 4DF6A 3WS1A 1GCEA 5FAOA 5CGSA 5AQ7A 3IXHA 4JF6A 3UDXA 4X56A 2Y59A 2XQZA 2EXAA 1IYQA 2ZQ7A 3UDFA 3W4PA 4FD8A 1XA7A 4IVKA 4B4XA 5JYPA 3TG9A 1EROA 1FCNA 1M6KA 4FSFA 5D3OA 1I5QA 3GVBA 1K25A 2X71A 3MBZA 4DDYA 1RCJA 2ZM2A 3AGDA 2Y2GA 5M18A 4GDNA 3D4FA 2ZM0A 3LY3A 3ZG5A 4XUXA 3BFDA 2OSUA 3UO9A 3ZVWA 1BLPA 4X6TA 1MPLA 3IWQA 5HAPA 2HP6A 5CHMA 1BULA 1PW1A 1EI5A 1ES3A 3WS5A 1C3BA 1Q2PA 1TDGA 2Y55A 3DWKA 3O87A 2DCFA 3HLWA 1FR6A 3DTMA 2EFXA 4MBFA 3GR2A 1HTZA 3NDEA 1FCMA 3N8SA 3PBRA 5GLAA 4DXBA 4MBKA 4UHUA 3TSGA 3VP4A 1SKFA 2QMIA 4RX3A 2WGWA 1GA0A 2XDMA 3BLMA 5FI2A 3WS0A 4GD6A 2ZC7A 4JXSA 3IHAA 2H0YA 4KZ8A 3O88A 3SS3A 1XX2A 4PM9A 5KZHA 5DTKA 1NY0A 1N4OA 4OOLA 3RXXA 1PWCA 2JC7A 1BTLA 4WEJA 5CHJA 3ZFZA 2V2FF 4LENA 3NBLA 1H8ZA 2Z2MB 1GHPA 4EBPA 4OKPA 4BL2A 5A93A 3SS4A 5EPHA 3OC2A 4UA7A 5BOHA 4S2PA 2FFFB 2EX8A 5EVIB 4R3BA 1BZAA 1CI8A 2P74A 3M2KA 3Q7VB 4OPQA 4Y0UA 5CHUA 1LI9A 3V39A 5KSHA 2G2WA 3Q7VA 4WYYA 3ZCZA 4QD4A 3M2JA 2B5RA 3AGEA 1AXBA 4JXVA 2WKHA 3NY4A 2ZMAA 4N92A 4S2OA 3UE3A 5KMWA 4UA6A 1RP5A 2J8YA 1K54C 3VSKA 2JCHA 2H5SA 3IWIA 2WGIA 4BQMA 3IXBA 5CRFA 3DWZA 1I2WA 3NCKA 1CEFA 2FFYA 4U0XA 4YINA 4KZ3A 4KG2A 4S2KA 3BYDA 4PMAA 5EVIC 3ZHHA 4E3LA 4WBGA 5GL9A 3HL9A 4Y7PA 4OPZA 4R4RA 1CK3A 4EWFA 4IBXA 4DE1A 3A3IA 1N9BA 4A5RA 1IYPA 1MBLA 2XH9A 4S2JA 5GLDA 3OCLA 4DRTA 4GZBA 5I94A 5EOOA 5AQBA 4CPKA 1KE3A 4BL3A 4F94A 4XUZA 1MWTA 4DE3A 1LLBA 5E43A 1XKZA 2Y2IA 4FH2A 3FZCA 2ZD8A 4HBTA 4EBNA 5JYOA 1JWZA 2WKIA 2PU4A 1MWUA 1I2SA 1W7FA 2ZC3B 1L0EA 5GHXA 1JTGA 4KZ5A 4PPRA 4LV1A 2HDUA 2ZLYA 5EUAA 3CJMA 4WELA 2XFTA 2ZM8A 4E6WA 3OPRA 1BLSA 2WZXA 5TGFA 3UDIA 4K0XA 3I7JA 5CGXA 4JXWA 4IEDA 1E3UA 3G35A 4OP8A 3IWOA 4E3OA 3MZEA 3HBRA 5CEDA 4UA9A 1BT5A 3E2LA 4DXCA 3G2YA 2E8IA 5U47A 5E2HA 2DRWA 5F83A 2XF3A 1YLPA 3OZHA 4S2NA 3MZDA 4E6XA 4XXRA 5FATA 1SHVA 1KGFA 3C5AA 2Y4AA 3SH8A 1DY6A 1BUEA 1PYYA 5DF9A 1K4EA 2H10A 1YM1A 3HREA 3PBNA 4OP5A 3NI9A 1BSGA 4P85A 1WYCA 3Q7ZA 4C6YA 2VGJA 4Q8IA 3B3XA 4R0QA 4M3KA 3UPNA 4JXGA 5E2FA 1PIOA 3N4IA 4P0MA 1W8QA 1FQGA 4KZBA 3SH7A 3G4PA 5EECA 4JF4A 4JF5A 4P87A 4S2NC 3WWXA 4N9KA 2X01A 5FQKA 2UWXA 4KZAA 3N6IA 1E3UD 2WAEA 1CEGA 3PBOA 3UE0A 4QU3A 1IELA 4RVAA 5HAQA 1HVBA 2JBFA 2EFUA 2GDNA 1ZKJA 3IH8A 2J7VA 1H8YA 1ES4A 5DF8A 4KZ9A 4R23A 4N9LA 1NYMA 2EX6A 1E25A 4MEZA 3ZNTA 4K0WA 5HX9A 2WGWB 4O7DA 3WRTA 4GD8A 2WAFA 2ZQDA 4E3IA 5A92A 1HZOA 3VMAA 4C3QA 3GV9A 3ISGA 1NZOA 4BD0A 4DE2A 3IF6B 3PBQA 1MY8A 2OLUA 3AGFA 3IF6A 4CJNA 3S22A 3ZGAB 4RYEA 2H0TA 1ES2A 3G32A 1EWZA 2Z2LB 1FSWA 5FSRA 5J8XA 1KVLA 1Y54A 2ZQ9A 3HUNA 4KENB 3WRZA 4EBLA 4WZ5A 5FQQA 3Q81A 3C4OA 2Y2JA 1MWSA 3PAEA 1ERQA 4JBFA 3RJUA 3UE1A 1NYYA 4JKTA 3CG5A 4PM8A 3QNCA 5FQIA 4Z9QA 1GA9A 1BLHA 1CI9A 1DJAA 2IWBA 3IXGA 2JE5A 1ZG6A 3NIAA 4BJPA 3HLFA 1KVMA 3V5MA 1GHIA 3BFCA 3MKEA 1DJCA 2I72A 2Y2HA 5CTMA 4D2OA 3M6BA 4PM6A 4N1XA 1XGIA 3IF6C 2EX2A 1FCOA 4R1GA 3ITBA 4BD1A 3W4OA 3G30A 4OPYA 4S2MA 2EX9A 5FASA 1ES5A 4GOGA 1Z6FA 2WZZA 4NK3A 4PM7A 2HPBA 1YMXA 4QY5A 4WZ5C 3PTEA 3PAGA 5GLBA 5TR7A 3HLBA 1HD8A 3G31A 2OLVA 4FCFA 2VGKA 4LCLA 2HDRA 4BLMA 1U60A 5DF7A 1PW8A 3LCEA 4KQRA 3S1YA 1WYBA 3ZG9B 4KZ6A 3N8RA 3MFDA 2PBYA 5DTTA 3JYIA 2RL3A 3OPLA 5CEBA 4LCMA 3BLSA 5HW3A 3OCNA 3M6HA 1L2SA 1DJBA 4GNUA 4WMCA 5AQAA 3HUOA 1MXOA 3MKFA 1XXMA 1MKIA 1NJ4A 3QNBA 4KQOA 2XFSA 2WGVA 3WS2A 2BLSA 3FYZA 2Y2MA 3VSLA 3G34A 1IKIA 1PI4A 3HVFA 4R4SA 1G6AA 5TFQA 1LL5A 3DW0A 3BFFA 4BENA 2R9XA 3W4QA 2XLNA 4EUZA 1K56A 1E4DA 1YLTA 4QY6A 3UNWA 3OPPA 1K55A 4ZJ2A 3SH9A 3LO7A 5FI7A 5FQMA 3VFHA 4ZDXA 1NXYA 2HDQA 3HLCA 1NRFA 5HARA 3ZVTA 2C5WB 3MXSA 3NC8A 1O7EA 3V3RA 3IXDA 3C7VA 1PZPA 1XA1A 2QPNA 2Y2OA 2ZC4B 3N7WA 3SS5A 4KG5A 1GHMA 1KE4A 1TEMA 2V20A 3C7UA 5EOEA 5F82A 3VP2A 4OPRA 1JWVA 2Y2PA 3UN7A 3ZDJA 4KG6A 3RXWA 3VP1A 2ZQCA 4X68A 3PBTA 4WMCD 3LY4A 4K91A 1KDSA 1ONGA 3OPHA 1K55C 3UPPA 1KGEA 3MXRA 2BG1A 2XEPA 1L0FA 1XPBA 2RCXA 1LI0A 4UAAA 1Q2QA 4OH0A 4KQQA 3O3VA 1PI5A 1YLZA 4OQ0A 1H5XA 5F1GA 4E3MA 3PBSA 2Y2QA 4YFMA 3VP0A 1S6RA 1ALQA 4JPMA 1SDNA 3UPOA 1K56D 4E3KA 2HDSA 1BLCA 3C4PA 1K38A 3FV7A 2Q9NA 4EQIA 3HLEA 4MNRA 2OV5A 4E3JA 1M40A 1PWDA 2IWCA 4S2IA 5A90A 5HL1A 3E2KA 2HP9A 1TVFA 2XK1A 1IEMA 4JLFA 4RX2A 1PZOA 5FAPA 2WYXA 1K4FA 3ZNYA 5CERA 2R9WA 1W8YA 1KE0A 4KZ7A 2C6WB 3CMZA 1YQSA 2ZC6B 4X69A 3SOIA 5A91A 4NETA 2WKEA 2ZQAA 2G2UA 3A3JA 3EQVA 1OMEA 4H8RA 3HLGA 3Q82A 2XD5A 4ZTKA 4EV4A 3S4XA 2WK0A 1L0DA 3A3FA 5DVAA 4OLGA 4MLLA 3CZDA 4ZJ1A 4OOYA 3N8LA 4QHCA 2A49A 1RGZA 4LV0A 1K6RA 3GRJA 1XP4A 4MBHA 1FR1A 3NDGA 3V3SA 3O86A 4GB7A 5CECA 3GSGA 3IQAA 4X53A 4IBRA 3V50A 3W8KA 4DE0A 1PWGA 1G68A 5F1FA 1FSYA 1ESUA 2ZJ9A 2ZQ8A 1JWPA 1L0GA 1K54A 3GTCA 4B88A 3MZFA 3ITAA 3BEBA 1IYOA 1K57A 2P9VB 4OVDA 4PM5A 5AQ9A 1KDWA 4WM9A 1IKGA 2P9VA 1VM1A 3IT9A 2WUQA 4HBUA 1VQQA 2DNSA 1NZUA 1QMFA 4FH4A 5E2EA 3Q1FA 5FQJA 5G18A 1XGJA 5EVIA 5HAIA 2Y2LA 1LL9A 4WZ4A 4RA7A 3BFGA 5HFOA 5IHVA 4ID4A 3Q07A 1ESIA 2WADA 2X02A 1ERMA 4OOMA 5M1AA 1YLJA 3IF5A 1MWRA 2J9OA 5FI6A 1TDLA 3QHYA 2XD1A 1LHYA 2CC1A 4GDBA 4KZ4A 4OLDA 2ZC5B 3HLDA 3ZG7B 4QJGA 1K57C 4HEFA 4QB8A 1JVJA 3BRMA 2J9PA 4LV3A 5L2FA 1J9MA 3A3DA 4R3JA 5DTSA 1W79A 5KSCA 3TOIA 4Y0TA 2XGNA 1YT4A 1KGGA
chains in the Genus database with same CATH superfamily
4ZBEA 1ONHA 4N1HA 1FOFA 4B9OA 4U0TA 5L8MA 3KSIA 2WKPA 4Y5FA 3F1NB 5CGWA 1W63Q 3F1NA 2XROA 5EVID 4WEKA 3LEZA 3ZG0A 1RGYA 4JGRA 1YMSA 1IYSA 3FKWA 4CLCB 4LV2A 4CLCA 2XA7S 5FQ9A 4II7A 3GQZA 3FWLA 2PRFA 3IHBA 2W3EA 3UY6A 1W5DA 1O07A 5FA7A 2V1ZA 2PU2A 2PR6A 1VHMA 1D06A 3LI8A 2VEAA 4Y0OA 1T1AA 3BM6A 5HDCA 5FAOA 2E8JA 3IXHA 2Y59A 2EWWA 3W4PA 1OTAA 4B4XA 3IBRA 1M6KA 4FSFA 4I3AA 5D3OA 4CLCD 3GVBA 4DDYA 1RCJA 3LY3A 4R38A 2OSUA 3UO9A 3ZVWA 1MPLA 1CQAA 2HV1A 3KSHA 5CHMA 2B18A 1PW1A 1EI5A 3A0VA 1TDGA 3DWKA 3O87A 3HLWA 1FR6A 3LIAA 2O9AA 4MBFA 3T1XA 1HTZA 1FCMA 2JKRM 3LICA 4UHUA 1S66L 3VP4A 1GA0A 5FI2A 1N9NA 4GD6A 3UMDA 5G4ZA 3IHAA 2H0YA 1XX2A 2V8FA 3P01A 2HJEA 3LUQA 1PWCA 2JC7A 5F6AA 3ZFZA 4LENA 4EBPA 4NKPA 1SKOB 4OKPA 3OC2A 4UA7A 2FFFB 3VV4A 1SKOA 2P74A 3EWKA 3M2KA 1GSVA 2G2WA 4QD4A 4UQIS 2ZMAA 3UE3A 2PHYA 2XRNA 2JCHA 4F3LB 3IXBA 4F3LA 1Y4OA 3HJIA 4DJ3A 1CEFA 4GW9A 2K31A 4S2KA 3ZHHA 4ESPA 4E3LA 1MKMA 4OPZA 4R4RA 3ZQ5A 3A3IA 1N9BA 4P6ZM 1IYPA 1MBLA 4S2JA 5GLDA 2VV8A 4BL3A 2OAP1 1XKZA 2GNXA 4FH2A 4EBNA 3BW6A 3L9KA 1MWUA 2ZC3B 2XFTA 2ZM8A 4E6WA 1S1ZA 4FOFA 3UDIA 5DJUA 4IEDA 4ARZB 4E3OA 3MZEA 4UA9A 4DXCA 2GJ3A 5E2HA 2DRWA 5F83A 1YLPA 4E6XA 4L9FA 2Y4AA 4EETB 4OP5A 2VGJA 4Q8IA 1G5UA 4JXGA 3DAVA 4O0PA 1FQGA 4P87A 3WWXA 1XJ4A 4N9KA 2X01A 4KZAA 1UWNX 1P0ZA 3UE0A 2K2NA 2P7JA 4RVAA 2JBFA 1ZKJA 2EFUA 4HJ4A 5KIZA 2J7VA 1ES4A 2V0UA 1P9WA 2WGWB 2IA2A 2BTFP 1OTDA 3PXPA 1NLZA 3CAXA 4DE2A 4LRYC 4CJNA 4Q0HA 3MQQA 3G32A 5J8XA 1Y54A 3HUNA 2PBDP 3RJUA 1D1JA 1MWSA 2Y2JA 1NYYA 4Z9QA 1GA9A 4X1LA 2NUPC 1ZG6A 3HLFA 1VETB 2I72A 5HDSA 1HLUP 4BD1A 1UWPX 4I38A 3RFBA 2WZZA 4PM7A 1YMXA 3RH8B 4WZ5C 5HZHA 3PTEA 4HIAA 2PDRA 2HZ5A 1HD8A 3G31A 4GCZA 1H0MA 2R78A 1F2KA 2M1CA 1U60A 5DF7A 3LCEA 4KZ6A 3N8RA 5DTTA 2FZ0A 1L2SA 4WMCA 1MXOA 3MXQA 1XXMA 3QNBA 3T1SA 5F68A 3WS2A 2BLSA 3FYZA 3OOVA 3G34A 4HH2A 2P04A 3H7WB 4Y2FA 3BFFA 2R9XA 1K56A 3SZTA 4ZJ2A 3VFHA 2J3TC 2DMWA 3ZYTA 4WF0A 1NXYA 2JN7A 1NRFA 2XA7M 3S7OA 3V3RA 1A0KA 4IHQA 3C7VA 1PZPA 1XA1A 2Y2OA 3N7WA 3SS5A 1NLYA 5EOEA 1S4RA 1JWVA 2ZQCA 4WMCD 3T4JA 4O8GA 1KGEA 3MXRA 3PR6A 2RCXA 1N9LA 1XPBA 4UAAA 1Q2QA 1PI5A 3IS2A 5LBRA 2L1MA 2VZWA 1ALQA 1K56D 2O9BA 4MNRA 4S2IA 3LIFA 3EOIA 1TVFA 2PD8A 2WYXA 1K4FA 5FL3A 3ZNYA 5L09A 1KE0A 2C6WB 3CMZA 1YQSA 3BY8A 3T4QA 2ZQAA 4QWOA 3CPTB 3HLGA 1L0DA 4EQ1A 3TJZC 3UB9A 3KO6A 4OOYA 1PRQA 1S67L 2QWSA 1YSPA 3S7NA 4GB7A 2KX6A 4IBRA 3V50A 3KYQA 2G7UA 3B42A 1LL8A 5J7EA 3EEAA 1J3WA 1ESUA 1L0GA 4XT2B 5FEGA 2FH5A 1IYOA 2P9VB 3DTIA 5AQ9A 4KUKA 2P9VA 1VQQA 2DNSA 3Q1FA 3KX0X 5HAIA 3CHWP 2Y2LA 4LGWA 5HFOA 1DP6A 2X02A 1ZTUA 3IF5A 4WL9A 1MWRA 3P7NA 1XJ3A 1LT0A 4OLDA 4GDBA 4QJGA 1K57C 4P6ZS 3JPUA 2J9PA 1J9MA 5KSCA 2VK3A 2PR5A 4Y0TA 3NJAA 3UB6A 1KGGA 4GHIB 2KOIA 4L9EA 4GHIA 3FKVA 5E2GA 3ZG8B 4DN0A 5CXWA 4L0LA 4ME4A 2WKQA 5EE8A 2XR0A 3H82B 3C38A 3GMWA 1WE4A 3KSGA 4C75A 4ZAMA 1VEUB 3FPVA 4U3TA 5AJGA 4OONA 4S2LA 4OQHA 4HHDA 4EERA 3E4PA 2QZ6A 2Y91A 3NECA 2ACGA 4P6BA 1IFQA 2A3UA 5IT5A 1OT9A 2Q9MA 4ZJ3A 3P09A 3HUMA 4GKUA 3T1QB 4E3NA 5I5LA 3LFVA 1GCEA 4IUKA 1DP8A 1XJ2A 3MQ0A 1IYQA 2PYPA 3IX8A 4FD8A 5G4YA 4IVKA 5JYPA 3TG9A 1EROA 1FCNA 4NXFA 2X71A 3MBZA 3NULA 2ZM2A 2ZMFA 2ZM0A 5F5YA 2QHKA 1GSWA 1BLPA 1YSQA 3BY9A 3WS5A 1Q2PA 2DCFA 1LSWA 1BYWA 2GX5A 3GR2A 3NDEA 3PBRA 4MBKA 3TSGA 1SKFA 2XDMA 3WS0A 4KZ8A 3SS3A 5DTKA 1OTBA 4OOLA 3RXXA 5CHJA 1H8ZA 5EPHA 5EVIB 1TD5A 4Y0UA 3V39A 1LI9A 5IS1A 1TS8A 1V9YA 2B5RA 3AGEA 1AXBA 4S2OA 5KMWA 4GS9B 4UA6A 1RP5A 4NXEA 4HQAA 1F5MA 1T18A 3IWIA 5CRFA 3E98A 4KG2A 5GL9A 4BBUA 3TE8A 5HDDA 1CK3A 4IBXA 4Y13A 5FDSA 3K3CA 1DRMA 3BWLA 2V1AA 5EOOA 5AQBA 4CPKA 1MZUA 4XUZA 1MWTA 3FZCA 2OWHA 5JYOA 3ICYA 1FIKA 3CUEC 2PU4A 1W7FA 1L0EA 5GHXA 4KZ5A 1OT6A 4LRXC 4HP9A 2ZLYA 1GSXA 2WZXA 5HD5A 4K0XA 3MFXA 4OP8A 3HBRA 3E2LA 3G2YA 2EWVA 4S2NA 4PAUA 1SHVA 2J3TD 2LB9A 1OTEA 2OAQ1 3SH8A 1XFNA 1BUEA 1PYYA 4RQ9A 2KDKA 2P08A 1WYCA 3Q7ZA 2PYRA 1TS0A 4R0QA 3MS6A 2OWJA 5E2FA 4KZBA 5EECA 4G3KA 4MN5A 5FQKA 2JKFA 2UWXA 1VB6A 4QU3A 3T4KA 2D01A 3QP6A 3UB7A 1KOUA 5J3WA 4KZ9A 4R23A 3ZNTA 5HX9A 4O7DA 4GD8A 5A92A 1HZOA 4C3QA 2O9CA 2VV7A 4BD0A 3T12B 1MY8A 3AGFA 3S22A 3ZGAB 4RYEA 1ES2A 1EWZA 5FSRA 1F9IA 5AVEA 4KENB 3WRZA 3PAEA 1ERQA 3T50A 4JKTA 5FQIA 5F69A 3IXGA 2JE5A 4BJPA 3V5MA 4D2OA 3MKEA 2Y2HA 4HH3A 3IF6C 3C30A 2VJWA 5EVEA 4MN6A 5FASA 1ES5A 4GOGA 1Z6FA 5GLBA 3PAGA 3V67A 5TBMA 4BLMA 3LIBA 4KQRA 5HWTA 3S1YA 2W3DA 1Y28A 3MFDA 2PBYA 3JYIA 3OPLA 3M6HA 1DJBA 4GNUA 5AQAA 3K2NA 2XFSA 2V8CA 1G6AA 5TFQA 2XLNA 4QY6A 1K55A 5FI7A 2HDQA 3HLCA 3MXSA 3NC8A 2QPNA 2ZC4B 1GHMA 3C7UA 5F82A 4G3WA 4OPRA 3UN7A 3BQAA 3VP1A 4X68A 4K91A 1KDSA 2XEPA 1L0FA 1LI0A 4NXGA 4KQQA 3MSHA 2O0YA 4M4XA 4OQ0A 1H5XA 5F1GA 3PBSA 5HPFA 2HDSA 3FV7A 2Q9NA 4ETZA 3E2KA 2XK1A 1IEMA 4RX2A 5FAPA 4JGOA 5CX7A 2W1TA 1W8YA 4X69A 1Z09A 4H8RA 2G2UA 2XD5A 3S4XA 3A3FA 2OOLA 4FUWA 3CZDA 4ZJ1A 4ZRRA 3N8LA 2Y8HA 4QHCA 4LV0A 1K6RA 1XP4A 1FR1A 3O86A 5CECA 4X53A 4Y3IA 4DE0A 1PWGA 4Y15A 2V0WA 1G68A 5MC7A 2ZJ9A 4YWZA 3CITA 3MZFA 3ITAA 4PM5A 4WM9A 3IT9A 2WUQA 1F98A 5FQJA 1LL9A 1G28A 4FTXA 4ID4A 1G6OA 1CJFA 4EW7A 1ERMA 5M1AA 4NEED 3MJQA 3KSFA 4WN5A 2WKRA 1LHYA 4KZ4A 5HD3A 4HEFA 1ZHHB 1JVJA 3BRMA 4H6JA 5DTSA 3A3DA 3C8CA 4R3JA 3DBAA 3TOIA 2XGNA 1YT4A 4PKYA 1ZG4A 3IH9A 4PHTA 4B4ZA 5M19A 4HESA 1K6SA 4NXBA 5EVLA 3BFEA 1S0WA 2Y2NA 2IWDA 2Y2KA 3EQUA 4OQIA 4DKIA 5GLCA 1TS6A 4HJ6A 4GN2A 3B33A 3GECA 4HOIA 2EXBA 2JKTM 4QPRA 1SCWA 1YLYA 2INWA 5FAQA 2CMNA 3G2ZA 5GHYA 3VOZA 4IVIA 3IS2B 3FG8A 1QMEA 2NUTC 4MMNA 1ZC2A 1SDEA 4I39A 4UEYA 4CLCC 3WS1A 4R6LA 4NG2A 5AQ7A 4JF6A 3UDXA 4EEUA 2EXAA 3UDFA 5C5KA 3U2AA 3R4KA 1I5QA 3AGDA 5M18A 4GDNA 3D4FA 3MF0A 2GZAA 3ZG5A 3BFDA 3A0RA 5DKKA 4X6TA 2HP6A 1BULA 2W3FA 3JVUA 2Z6DA 3A0SA 5GLAA 4BBTA 2YKFA 2QMIA 4RX3A 1H8MA 4IJGA 2ZC7A 5KZHA 3O88A 4PM9A 1NY0A 3UB8A 1N4OA 5HWVA 5EM1A 1BTLA 3KYZA 3DTKA 2V2FF 3NBLA 1GHPA 3SS4A 5BOHA 4S2PA 2EX8A 1BZAA 1CI8A 3Q7VB 2PAVP 3Q7VA 4WYYA 5EFWA 2WKHA 2J8YA 2W1RA 2H5SA 2WGIA 2MJ6A 4BQMA 3T4LA 1T1BA 3DWZA 3GDIA 2FFYA 4KZ3A 3BYDA 4PMAA 4WBGA 5A8BA 3LR4A 4EWFA 5HWWA 2HJ9C 2A24A 1OPXA 3OCLA 5I94A 1KE3A 4F94A 3TW8A 2J3WA 5E43A 4R3AA 2ZD8A 3NOUC 4JGQA 1JWZA 2WKIA 1DP9A 1I2SA 2Q0OA 4PPRA 4LV1A 5EUAA 4WELA 2L4RA 1BLSA 1YKDA 3QP5A 3IX3A 5TGFA 5CGXA 3G35A 4HP4A 5CEDA 2B02A 2E8IA 5U47A 1PFLA 4I3IA 4XXRA 5FATA 3C5AA 3EGXC 1K4EA 3HREA 3PBNA 2VKSA 3E4QA 3K3DA 4C6YA 4PKYG 2ZMVA 4M3KA 4X25A 3VOLA 4E04A 4I5SA 1PIOA 3N4IA 4P0MA 1XJ6A 4JF5A 2W0NA 2W27A 4DJ2A 3N6IA 4LLOB 1CEGA 1AWIA 3PBOA 1IELA 5HAQA 4X1MA 3IH8A 3T1RA 3U4LP 1XFQA 1NYMA 2EX6A 3LR3A 1E25A 4K0WA 3IBJA 2B95A 2ZQDA 2LB5A 4WLAA 4O01A 2JHEA 4Q0IA 2OLUA 2QKPA 1FSWA 4WZ5A 5FQQA 2ZL1A 3F1PA 1PNEA 3QNCA 1BLHA 3HCYA 1CI9A 2HF6A 3BFCA 1DJCA 2ZOHA 4N1XA 3W4OA 2EX9A 4NK3A 2HPBA 4QY5A 3NOPC 2OLVA 4FCFA 2VGKA 4LCLA 4LFUA 1PW8A 1WYBA 2A2LA 2JKRI 2RL3A 2W3GA 5FEFA 3BQ8A 5CEBA 2UV0E 3OCNA 1ACFA 1T19A 4B93A 3QP2A 4HI4A 1MKIA 4KQOA 3F1OA 1LSXA 1D7EA 3VSLA 3HVFA 4R4SA 1LL5A 3LYXA 4BENA 4IUHA 3W4QA 4EUZA 2PT7A 1YLTA 3OPPA 3LO7A 5FQMA 4YOFA 3ZVTA 5DKLA 5AVFA 3IXDA 1KE4A 1TEMA 1LSVA 4GLQA 3ZDJA 2H28A 3RXWA 3PBTA 4K08A 5L07A 3LY4A 1MC0A 2M7UA 3CWFA 1TS7A 4JPMA 1SDNA 4E3KA 1BLCA 3C4PA 4EQIA 1W63M 4E3JA 4WUJA 1X0OA 2IWCA 3JVVA 2HP9A 4JLFA 2EA9A 1STZA 4MN7A 5CERA 4KZ7A 2R9WA 3SOIA 2VGLM 5A91A 4BBVA 1OMEA 2WK0A 4OLGA 4MLLA 3UB5P 4ETXA 2JKGA 2A49A 1RGZA 3V3SA 3NDGA 4CLCE 2ZQ8A 2BASA 2Y79A 1K57A 4OVDA 1KDWA 3D3OA 4HBUA 1QMFA 5E2EA 1NRJA 3E0YA 4WZ4A 3H9WA 5TBMB 1ESIA 2WADA 5HL6A 2J9OA 5FI6A 1P9RA 2XD1A 5DFYA 2CC1A 3OLOA 2ZC5B 3ZG7B 4BMWA 5L2FA 1P97A 3T4SA 1EW0A 3CI6A 5DFXA 5FDHA 4OQGA 2HP5A 3A3EA 3VFFA 3C2WA 2QYBA 3VOYA 3S7QA 4DDSA 1WA9A 1IOUA 2J80A 3P98A 4X55A 5CTNA 1JTDA 3SW1A 5GHZA 3BECA 4MCWA 3VP3A 1YLWA 4ARZA 3EGDC 1YAXA 3WS4A 4LPZA 2ZBBA 4R70A 4Y17A 3QP4A 1T1CA 4DF6A 4BWIA 3UE6A 4X56A 2XQZA 2ZQ7A 1XA7A 3LGOA 2W1TB 1V9ZA 1K25A 3PYPA 2Y2GA 3E4OA 4XUXA 3IWQA 5HAPA 1ES3A 1C3BA 4DMZA 2Y55A 2AVXA 3NOTC 3DTMA 2EFXA 3D72A 3N8SA 4DXBA 2I9VA 2JKTI 2W3HA 2WGWA 3BLMA 4JXSA 4WEJA 2XSSA 2Z2MB 4BL2A 5A93A 4I3JA 4R3BA 5KSHA 4OPQA 5CHUA 3LIDA 3T4TA 3ZCZA 4G3VA 3M2JA 4JXVA 3NY4A 4N92A 3MR0A 1VETA 3LI9A 1UGUA 2QJ7A 1K54C 3VSKA 4H6JB 1I2WA 3NCKA 3CUEA 4YINA 4U0XA 5EVIC 3HL9A 4Y7PA 3T4OA 4DE1A 4A5RA 5K5BA 2XH9A 4DRTA 4GZBA 4HY8A 4EXOA 5J4EA 4DE3A 4L9GA 1LLBA 4HNBA 2Y2IA 4HBTA 1JTGA 2HDUA 4MDZA 3CJMA 3H7WA 3OPRA 3PHYA 3I7JA 4JXWA 1E3UA 3IWOA 5EV0A 1BT5A 5TJJA 5HPIA 2VV6A 2XF3A 4GJ4A 3OZHA 3MZDA 3HJKA 1L3LA 3ULFA 1FILA 1KGFA 2HGVA 1SZVA 1DY6A 5DF9A 2H10A 1YM1A 3NI9A 1BSGA 4P85A 3B3XA 2VX8A 2Z6CA 3UPNA 1W8QA 3SH7A 3G4PA 4JF4A 4S2NC 4EESA 2VGLS 2YKHA 3S7PA 1E3UD 2WAEA 3RTYA 5L10A 1HVBA 2GDNA 3LR5A 1H8YA 5DF8A 4N9LA 4LRZE 4MEZA 3O5YA 2D02A 3WRTA 3VE4A 3B47A 2WAFA 4E3IA 3CPTA 3OBFA 3VMAA 3GV9A 2VA0A 3ISGA 1NZOA 2VLGA 1OJGA 3IF6B 3PBQA 3IF6A 2H0TA 1TF1A 2Z2LB 1KVLA 2ZQ9A 4EBLA 1S1YA 3Q81A 3C4OA 4JBFA 3UE1A 3CG5A 4PM8A 2V1BA 4CQHA 3MQOA 1DJAA 3D9YA 2IWBA 3NIAA 1KVMA 1GHIA 5CTMA 3EEHA 3NHQA 3M6BA 4PM6A 4XT2A 1XGIA 2EX2A 1FCOA 4R1GA 3ITBA 3G30A 4OPYA 1ODVA 4S2MA 1NWZA 4UQIM 4KUOA 4EU0A 5TR7A 2K7SA 3HLBA 2KLIA 1S4SA 4JGPA 2HDRA 2A24B 3ZG9B 2O99A 4LCMA 3BLSA 5HW3A 2QJ5A 3HUOA 3MKFA 1NJ4A 1OJ5A 1K0KA 2WGVA 3G6OA 2Y2MA 1IKIA 1PI4A 3DW0A 1E4DA 3UNWA 3SH9A 4ZDXA 5DJTA 5HARA 1N9OA 2C5WB 1O7EA 5IU1A 3H82A 4KG5A 2V20A 3VP2A 2Y2PA 1VEUA 4KG6A 1ONGA 3OPHA 1K55C 3UPPA 2BG1A 2PD7A 4OH0A 3O3VA 1YLZA 2L0WA 4E3MA 2Y2QA 3QP1A 4YFMA 3VP0A 1S6RA 3LR0A 3UPOA 1YPRA 3LEQA 5HSQA 1K38A 3HLEA 1M40A 1PWDA 1OTIA 5A90A 5HL1A 2V9AA 1PZOA 1CF0A 2ZC6B 4NETA 3QP8A 2WKEA 3A3JA 3EQVA 2OV5A 4ZTKA 3Q82A 4EV4A 3MMHA 3L7HA 5DVAA 3TRCA 4EEPA 3FPWA 3VE3A 3GRJA 4KQDA 4MBHA 1H3QA 3IX4A 2ZL1B 3DTEA 3F1PB 3GSGA 3IQAA 2M7VA 3W8KA 3BJNA 3KYEA 5F1FA 1FSYA 1JNUA 4D60A 1JWPA 1K54A 3GTCA 4B88A 3FC7A 3BEBA 1IKGA 4Z1WA 1VM1A 4YNRA 3W2ZA 4EUVA 1NZUA 2ZOIA 4FH4A 5G18A 1XGJA 5EVIA 4RA7A 4Q0JA 3BFGA 5IHVA 3Q07A 3R7WB 4OOMA 3R7WA 1YLJA 3CLOA 4GS9A 1TDLA 3QHYA 3UMEA 4AFIA 5EM0A 3LIEA 3HLDA 4QB8A 4LV3A 1W79A 4HJ3A 3F1OB 5CGSA
chains in the Genus database with same CATH topology
4ZBEA 1ONHA 4N1HA 1ZG4A 3IH9A 3FKVA 5E2GA 1FOFA 5FDHA 4B4ZA 4OQGA 5M19A 2HP5A 4U0TA 3ZG8B 3A3EA 5CXWA 5CGWA 4HESA 4L0LA 3VFFA 5EVID 5EE8A 4WEKA 3VOYA 1K6SA 5EVLA 3LEZA 3ZG0A 4DDSA 2XR0A 3BFEA 1RGYA 1YMSA 3GMWA 1S0WA 1IYSA 3FKWA 3P98A 2Y2NA 1WE4A 4LV2A 4X55A 2IWDA 5CTNA 2Y2KA 3EQUA 1JTDA 5FQ9A 4OQIA 4C75A 4DKIA 4ZAMA 5GLCA 3GQZA 3FWLA 4GN2A 3IHBA 4U3TA 5GHZA 2EXBA 4OONA 4S2LA 4OQHA 3BECA 3UY6A 1SCWA 1O07A 1W5DA 1YLYA 5FAQA 5FA7A 2V1ZA 2QZ6A 3G2ZA 1YLWA 2PU2A 5GHYA 3VOZA 2Y91A 4IVIA 3VP3A 4P6BA 1QMEA 2A3UA 1ZC2A 2Q9MA 4ZJ3A 4Y0OA 3P09A 1SDEA 3HUMA 3WS4A 4GKUA 3BM6A 4E3NA 4DF6A 3WS1A 1GCEA 5FAOA 5CGSA 5AQ7A 3IXHA 4JF6A 3UDXA 4X56A 2Y59A 2XQZA 2EXAA 1IYQA 2ZQ7A 3UDFA 3W4PA 4FD8A 1XA7A 4IVKA 4B4XA 5JYPA 3TG9A 1EROA 1FCNA 1M6KA 4FSFA 5D3OA 1I5QA 3GVBA 1K25A 2X71A 3MBZA 4DDYA 1RCJA 2ZM2A 3AGDA 2Y2GA 5M18A 4GDNA 3D4FA 2ZM0A 3LY3A 3ZG5A 4XUXA 3BFDA 2OSUA 3UO9A 3ZVWA 1BLPA 4X6TA 1MPLA 3IWQA 5HAPA 2HP6A 5CHMA 1BULA 1PW1A 1EI5A 1ES3A 3WS5A 1C3BA 1Q2PA 1TDGA 2Y55A 3DWKA 3O87A 2DCFA 3HLWA 1FR6A 3DTMA 2EFXA 4MBFA 3GR2A 1HTZA 3NDEA 1FCMA 3N8SA 3PBRA 5GLAA 4DXBA 4MBKA 4UHUA 3TSGA 3VP4A 1SKFA 2QMIA 4RX3A 2WGWA 1GA0A 2XDMA 3BLMA 5FI2A 3WS0A 4GD6A 2ZC7A 4JXSA 3IHAA 2H0YA 4KZ8A 3O88A 3SS3A 1XX2A 4PM9A 5KZHA 5DTKA 1NY0A 1N4OA 4OOLA 3RXXA 1PWCA 2JC7A 1BTLA 4WEJA 5CHJA 3ZFZA 2V2FF 4LENA 3NBLA 1H8ZA 2Z2MB 1GHPA 4EBPA 4OKPA 4BL2A 5A93A 3SS4A 5EPHA 3OC2A 4UA7A 5BOHA 4S2PA 2FFFB 2EX8A 5EVIB 4R3BA 1BZAA 1CI8A 2P74A 3M2KA 3Q7VB 4OPQA 4Y0UA 5CHUA 1LI9A 3V39A 5KSHA 2G2WA 3Q7VA 4WYYA 3ZCZA 4QD4A 3M2JA 2B5RA 3AGEA 1AXBA 4JXVA 2WKHA 3NY4A 2ZMAA 4N92A 4S2OA 3UE3A 5KMWA 4UA6A 1RP5A 2J8YA 1K54C 3VSKA 2JCHA 2H5SA 3IWIA 2WGIA 4BQMA 3IXBA 5CRFA 3DWZA 1I2WA 3NCKA 1CEFA 2FFYA 4U0XA 4YINA 4KZ3A 4KG2A 4S2KA 3BYDA 4PMAA 5EVIC 3ZHHA 4E3LA 4WBGA 5GL9A 3HL9A 4Y7PA 4OPZA 4R4RA 1CK3A 4EWFA 4IBXA 4DE1A 3A3IA 1N9BA 4A5RA 1IYPA 1MBLA 2XH9A 4S2JA 5GLDA 3OCLA 4DRTA 4GZBA 5I94A 5EOOA 5AQBA 4CPKA 1KE3A 4BL3A 4F94A 4XUZA 1MWTA 4DE3A 1LLBA 5E43A 1XKZA 2Y2IA 4FH2A 3FZCA 2ZD8A 4HBTA 4EBNA 5JYOA 1JWZA 2WKIA 2PU4A 1MWUA 1I2SA 1W7FA 2ZC3B 1L0EA 5GHXA 1JTGA 4KZ5A 4PPRA 4LV1A 2HDUA 2ZLYA 5EUAA 3CJMA 4WELA 2XFTA 2ZM8A 4E6WA 3OPRA 1BLSA 2WZXA 5TGFA 3UDIA 4K0XA 3I7JA 5CGXA 4JXWA 4IEDA 1E3UA 3G35A 4OP8A 3IWOA 4E3OA 3MZEA 3HBRA 5CEDA 4UA9A 1BT5A 3E2LA 4DXCA 3G2YA 2E8IA 5U47A 5E2HA 2DRWA 5F83A 2XF3A 1YLPA 3OZHA 4S2NA 3MZDA 4E6XA 4XXRA 5FATA 1SHVA 1KGFA 3C5AA 2Y4AA 3SH8A 1DY6A 1BUEA 1PYYA 5DF9A 1K4EA 2H10A 1YM1A 3HREA 3PBNA 4OP5A 3NI9A 1BSGA 4P85A 1WYCA 3Q7ZA 4C6YA 2VGJA 4Q8IA 3B3XA 4R0QA 4M3KA 3UPNA 4JXGA 5E2FA 1PIOA 3N4IA 4P0MA 1W8QA 1FQGA 4KZBA 3SH7A 3G4PA 5EECA 4JF4A 4JF5A 4P87A 4S2NC 3WWXA 4N9KA 2X01A 5FQKA 2UWXA 4KZAA 3N6IA 1E3UD 2WAEA 1CEGA 3PBOA 3UE0A 4QU3A 1IELA 4RVAA 5HAQA 1HVBA 2JBFA 2EFUA 2GDNA 1ZKJA 3IH8A 2J7VA 1H8YA 1ES4A 5DF8A 4KZ9A 4R23A 4N9LA 1NYMA 2EX6A 1E25A 4MEZA 3ZNTA 4K0WA 5HX9A 2WGWB 4O7DA 3WRTA 4GD8A 2WAFA 2ZQDA 4E3IA 5A92A 1HZOA 3VMAA 4C3QA 3GV9A 3ISGA 1NZOA 4BD0A 4DE2A 3IF6B 3PBQA 1MY8A 2OLUA 3AGFA 3IF6A 4CJNA 3S22A 3ZGAB 4RYEA 2H0TA 1ES2A 3G32A 1EWZA 2Z2LB 1FSWA 5FSRA 5J8XA 1KVLA 1Y54A 2ZQ9A 3HUNA 4KENB 3WRZA 4EBLA 4WZ5A 5FQQA 3Q81A 3C4OA 2Y2JA 1MWSA 3PAEA 1ERQA 4JBFA 3RJUA 3UE1A 1NYYA 4JKTA 3CG5A 4PM8A 3QNCA 5FQIA 4Z9QA 1GA9A 1BLHA 1CI9A 1DJAA 2IWBA 3IXGA 2JE5A 1ZG6A 3NIAA 4BJPA 3HLFA 1KVMA 3V5MA 1GHIA 3BFCA 3MKEA 1DJCA 2I72A 2Y2HA 5CTMA 4D2OA 3M6BA 4PM6A 4N1XA 1XGIA 3IF6C 2EX2A 1FCOA 4R1GA 3ITBA 4BD1A 3W4OA 3G30A 4OPYA 4S2MA 2EX9A 5FASA 1ES5A 4GOGA 1Z6FA 2WZZA 4NK3A 4PM7A 2HPBA 1YMXA 4QY5A 4WZ5C 3PTEA 3PAGA 5GLBA 5TR7A 3HLBA 1HD8A 3G31A 2OLVA 4FCFA 2VGKA 4LCLA 2HDRA 4BLMA 1U60A 5DF7A 1PW8A 3LCEA 4KQRA 3S1YA 1WYBA 3ZG9B 4KZ6A 3N8RA 3MFDA 2PBYA 5DTTA 3JYIA 2RL3A 3OPLA 5CEBA 4LCMA 3BLSA 5HW3A 3OCNA 3M6HA 1L2SA 1DJBA 4GNUA 4WMCA 5AQAA 3HUOA 1MXOA 3MKFA 1XXMA 1MKIA 1NJ4A 3QNBA 4KQOA 2XFSA 2WGVA 3WS2A 2BLSA 3FYZA 2Y2MA 3VSLA 3G34A 1IKIA 1PI4A 3HVFA 4R4SA 1G6AA 5TFQA 1LL5A 3DW0A 3BFFA 4BENA 2R9XA 3W4QA 2XLNA 4EUZA 1K56A 1E4DA 1YLTA 4QY6A 3UNWA 3OPPA 1K55A 4ZJ2A 3SH9A 3LO7A 5FI7A 5FQMA 3VFHA 4ZDXA 1NXYA 2HDQA 3HLCA 1NRFA 5HARA 3ZVTA 2C5WB 3MXSA 3NC8A 1O7EA 3V3RA 3IXDA 3C7VA 1PZPA 1XA1A 2QPNA 2Y2OA 2ZC4B 3N7WA 3SS5A 4KG5A 1GHMA 1KE4A 1TEMA 2V20A 3C7UA 5EOEA 5F82A 3VP2A 4OPRA 1JWVA 2Y2PA 3UN7A 3ZDJA 4KG6A 3RXWA 3VP1A 2ZQCA 4X68A 3PBTA 4WMCD 3LY4A 4K91A 1KDSA 1ONGA 3OPHA 1K55C 3UPPA 1KGEA 3MXRA 2BG1A 2XEPA 1L0FA 1XPBA 2RCXA 1LI0A 4UAAA 1Q2QA 4OH0A 4KQQA 3O3VA 1PI5A 1YLZA 4OQ0A 1H5XA 5F1GA 4E3MA 3PBSA 2Y2QA 4YFMA 3VP0A 1S6RA 1ALQA 4JPMA 1SDNA 3UPOA 1K56D 4E3KA 2HDSA 1BLCA 3C4PA 1K38A 3FV7A 2Q9NA 4EQIA 3HLEA 4MNRA 2OV5A 4E3JA 1M40A 1PWDA 2IWCA 4S2IA 5A90A 5HL1A 3E2KA 2HP9A 1TVFA 2XK1A 1IEMA 4JLFA 4RX2A 1PZOA 5FAPA 2WYXA 1K4FA 3ZNYA 5CERA 2R9WA 1W8YA 1KE0A 4KZ7A 2C6WB 3CMZA 1YQSA 2ZC6B 4X69A 3SOIA 5A91A 4NETA 2WKEA 2ZQAA 2G2UA 3A3JA 3EQVA 1OMEA 4H8RA 3HLGA 3Q82A 2XD5A 4ZTKA 4EV4A 3S4XA 2WK0A 1L0DA 3A3FA 5DVAA 4OLGA 4MLLA 3CZDA 4ZJ1A 4OOYA 3N8LA 4QHCA 2A49A 1RGZA 4LV0A 1K6RA 3GRJA 1XP4A 4MBHA 1FR1A 3NDGA 3V3SA 3O86A 4GB7A 5CECA 3GSGA 3IQAA 4X53A 4IBRA 3V50A 3W8KA 4DE0A 1PWGA 1G68A 5F1FA 1FSYA 1ESUA 2ZJ9A 2ZQ8A 1JWPA 1L0GA 1K54A 3GTCA 4B88A 3MZFA 3ITAA 3BEBA 1IYOA 1K57A 2P9VB 4OVDA 4PM5A 5AQ9A 1KDWA 4WM9A 1IKGA 2P9VA 1VM1A 3IT9A 2WUQA 4HBUA 1VQQA 2DNSA 1NZUA 1QMFA 4FH4A 5E2EA 3Q1FA 5FQJA 5G18A 1XGJA 5EVIA 5HAIA 2Y2LA 1LL9A 4WZ4A 4RA7A 3BFGA 5HFOA 5IHVA 4ID4A 3Q07A 1ESIA 2WADA 2X02A 1ERMA 4OOMA 5M1AA 1YLJA 3IF5A 1MWRA 2J9OA 5FI6A 1TDLA 3QHYA 2XD1A 1LHYA 2CC1A 4GDBA 4KZ4A 4OLDA 2ZC5B 3HLDA 3ZG7B 4QJGA 1K57C 4HEFA 4QB8A 1JVJA 3BRMA 2J9PA 4LV3A 5L2FA 1J9MA 3A3DA 4R3JA 5DTSA 1W79A 5KSCA 3TOIA 4Y0TA 2XGNA 1YT4A 1KGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZBE A;  1ONH A;  4N1H A;  1ZG4 A;  3IH9 A;  3FKV A;  5E2G A;  1FOF A;  5FDH A;  4B4Z A;  4OQG A;  5M19 A;  2HP5 A;  4U0T A;  3ZG8 B;  3A3E A;  5CXW A;  5CGW A;  4HES A;  4L0L A;  3VFF A;  5EVI D;  5EE8 A;  4WEK A;  3VOY A;  1K6S A;  5EVL A;  3LEZ A;  3ZG0 A;  4DDS A;  2XR0 A;  3BFE A;  1RGY A;  1YMS A;  3GMW A;  1S0W A;  1IYS A;  3FKW A;  3P98 A;  2Y2N A;  1WE4 A;  4LV2 A;  4X55 A;  2IWD A;  5CTN A;  2Y2K A;  3EQU A;  1JTD A;  5FQ9 A;  4OQI A;  4C75 A;  4DKI A;  4ZAM A;  5GLC A;  3GQZ A;  3FWL A;  4GN2 A;  3IHB A;  4U3T A;  5GHZ A;  2EXB A;  4OON A;  4S2L A;  4OQH A;  3BEC A;  3UY6 A;  1SCW A;  1O07 A;  1W5D A;  1YLY A;  5FAQ A;  5FA7 A;  2V1Z A;  2QZ6 A;  3G2Z A;  1YLW A;  2PU2 A;  5GHY A;  3VOZ A;  2Y91 A;  4IVI A;  3VP3 A;  4P6B A;  1QME A;  2A3U A;  1ZC2 A;  2Q9M A;  4ZJ3 A;  4Y0O A;  3P09 A;  1SDE A;  3HUM A;  3WS4 A;  4GKU A;  3BM6 A;  4E3N A;  4DF6 A;  3WS1 A;  1GCE A;  5FAO A;  5CGS A;  5AQ7 A;  3IXH A;  4JF6 A;  3UDX A;  4X56 A;  2Y59 A;  2XQZ A;  2EXA A;  1IYQ A;  2ZQ7 A;  3UDF A;  3W4P A;  4FD8 A;  1XA7 A;  4IVK A;  4B4X A;  5JYP A;  3TG9 A;  1ERO A;  1FCN A;  1M6K A;  4FSF A;  5D3O A;  1I5Q A;  3GVB A;  1K25 A;  2X71 A;  3MBZ A;  4DDY A;  1RCJ A;  2ZM2 A;  3AGD A;  2Y2G A;  5M18 A;  4GDN A;  3D4F A;  2ZM0 A;  3LY3 A;  3ZG5 A;  4XUX A;  3BFD A;  2OSU A;  3UO9 A;  3ZVW A;  1BLP A;  4X6T A;  1MPL A;  3IWQ A;  5HAP A;  2HP6 A;  5CHM A;  1BUL A;  1PW1 A;  1EI5 A;  1ES3 A;  3WS5 A;  1C3B A;  1Q2P A;  1TDG A;  2Y55 A;  3DWK A;  3O87 A;  2DCF A;  3HLW A;  1FR6 A;  3DTM A;  2EFX A;  4MBF A;  3GR2 A;  1HTZ A;  3NDE A;  1FCM A;  3N8S A;  3PBR A;  5GLA A;  4DXB A;  4MBK A;  4UHU A;  3TSG A;  3VP4 A;  1SKF A;  2QMI A;  4RX3 A;  2WGW A;  1GA0 A;  2XDM A;  3BLM A;  5FI2 A;  3WS0 A;  4GD6 A;  2ZC7 A;  4JXS A;  3IHA A;  2H0Y A;  4KZ8 A;  3O88 A;  3SS3 A;  1XX2 A;  4PM9 A;  5KZH A;  5DTK A;  1NY0 A;  1N4O A;  4OOL A;  3RXX A;  1PWC A;  2JC7 A;  1BTL A;  4WEJ A;  5CHJ A;  3ZFZ A;  2V2F F;  4LEN A;  3NBL A;  1H8Z A;  2Z2M B;  1GHP A;  4EBP A;  4OKP A;  4BL2 A;  5A93 A;  3SS4 A;  5EPH A;  3OC2 A;  4UA7 A;  5BOH A;  4S2P A;  2FFF B;  2EX8 A;  5EVI B;  4R3B A;  1BZA A;  1CI8 A;  2P74 A;  3M2K A;  3Q7V B;  4OPQ A;  4Y0U A;  5CHU A;  1LI9 A;  3V39 A;  5KSH A;  2G2W A;  3Q7V A;  4WYY A;  3ZCZ A;  4QD4 A;  3M2J A;  2B5R A;  3AGE A;  1AXB A;  4JXV A;  2WKH A;  3NY4 A;  2ZMA A;  4N92 A;  4S2O A;  3UE3 A;  5KMW A;  4UA6 A;  1RP5 A;  2J8Y A;  1K54 C;  3VSK A;  2JCH A;  2H5S A;  3IWI A;  2WGI A;  4BQM A;  3IXB A;  5CRF A;  3DWZ A;  1I2W A;  3NCK A;  1CEF A;  2FFY A;  4U0X A;  4YIN A;  4KZ3 A;  4KG2 A;  4S2K A;  3BYD A;  4PMA A;  5EVI C;  3ZHH A;  4E3L A;  4WBG A;  5GL9 A;  3HL9 A;  4Y7P A;  4OPZ A;  4R4R A;  1CK3 A;  4EWF A;  4IBX A;  4DE1 A;  3A3I A;  1N9B A;  4A5R A;  1IYP A;  1MBL A;  2XH9 A;  4S2J A;  5GLD A;  3OCL A;  4DRT A;  4GZB A;  5I94 A;  5EOO A;  5AQB A;  4CPK A;  1KE3 A;  4BL3 A;  4F94 A;  4XUZ A;  1MWT A;  4DE3 A;  1LLB A;  5E43 A;  1XKZ A;  2Y2I A;  4FH2 A;  3FZC A;  2ZD8 A;  4HBT A;  4EBN A;  5JYO A;  1JWZ A;  2WKI A;  2PU4 A;  1MWU A;  1I2S A;  1W7F A;  2ZC3 B;  1L0E A;  5GHX A;  1JTG A;  4KZ5 A;  4PPR A;  4LV1 A;  2HDU A;  2ZLY A;  5EUA A;  3CJM A;  4WEL A;  2XFT A;  2ZM8 A;  4E6W A;  3OPR A;  1BLS A;  2WZX A;  5TGF A;  3UDI A;  4K0X A;  3I7J A;  5CGX A;  4JXW A;  4IED A;  1E3U A;  3G35 A;  4OP8 A;  3IWO A;  4E3O A;  3MZE A;  3HBR A;  5CED A;  4UA9 A;  1BT5 A;  3E2L A;  4DXC A;  3G2Y A;  2E8I A;  5U47 A;  5E2H A;  2DRW A;  5F83 A;  2XF3 A;  1YLP A;  3OZH A;  4S2N A;  3MZD A;  4E6X A;  4XXR A;  5FAT A;  1SHV A;  1KGF A;  3C5A A;  2Y4A A;  3SH8 A;  1DY6 A;  1BUE A;  1PYY A;  5DF9 A;  1K4E A;  2H10 A;  1YM1 A;  3HRE A;  3PBN A;  4OP5 A;  3NI9 A;  1BSG A;  4P85 A;  1WYC A;  3Q7Z A;  4C6Y A;  2VGJ A;  4Q8I A;  3B3X A;  4R0Q A;  4M3K A;  3UPN A;  4JXG A;  5E2F A;  1PIO A;  3N4I A;  4P0M A;  1W8Q A;  1FQG A;  4KZB A;  3SH7 A;  3G4P A;  5EEC A;  4JF4 A;  4JF5 A;  4P87 A;  4S2N C;  3WWX A;  4N9K A;  2X01 A;  5FQK A;  2UWX A;  4KZA A;  3N6I A;  1E3U D;  2WAE A;  1CEG A;  3PBO A;  3UE0 A;  4QU3 A;  1IEL A;  4RVA A;  5HAQ A;  1HVB A;  2JBF A;  2EFU A;  2GDN A;  1ZKJ A;  3IH8 A;  2J7V A;  1H8Y A;  1ES4 A;  5DF8 A;  4KZ9 A;  4R23 A;  4N9L A;  1NYM A;  2EX6 A;  1E25 A;  4MEZ A;  3ZNT A;  4K0W A;  5HX9 A;  2WGW B;  4O7D A;  3WRT A;  4GD8 A;  2WAF A;  2ZQD A;  4E3I A;  5A92 A;  1HZO A;  3VMA A;  4C3Q A;  3GV9 A;  3ISG A;  1NZO A;  4BD0 A;  4DE2 A;  3IF6 B;  3PBQ A;  1MY8 A;  2OLU A;  3AGF A;  3IF6 A;  4CJN A;  3S22 A;  3ZGA B;  4RYE A;  2H0T A;  1ES2 A;  3G32 A;  1EWZ A;  2Z2L B;  1FSW A;  5FSR A;  5J8X A;  1KVL A;  1Y54 A;  2ZQ9 A;  3HUN A;  4KEN B;  3WRZ A;  4EBL A;  4WZ5 A;  5FQQ A;  3Q81 A;  3C4O A;  2Y2J A;  1MWS A;  3PAE A;  1ERQ A;  4JBF A;  3RJU A;  3UE1 A;  1NYY A;  4JKT A;  3CG5 A;  4PM8 A;  3QNC A;  5FQI A;  4Z9Q A;  1GA9 A;  1BLH A;  1CI9 A;  1DJA A;  2IWB A;  3IXG A;  2JE5 A;  1ZG6 A;  3NIA A;  4BJP A;  3HLF A;  1KVM A;  3V5M A;  1GHI A;  3BFC A;  3MKE A;  1DJC A;  2I72 A;  2Y2H A;  5CTM A;  4D2O A;  3M6B A;  4PM6 A;  4N1X A;  1XGI A;  3IF6 C;  2EX2 A;  1FCO A;  4R1G A;  3ITB A;  4BD1 A;  3W4O A;  3G30 A;  4OPY A;  4S2M A;  2EX9 A;  5FAS A;  1ES5 A;  4GOG A;  1Z6F A;  2WZZ A;  4NK3 A;  4PM7 A;  2HPB A;  1YMX A;  4QY5 A;  4WZ5 C;  3PTE A;  3PAG A;  5GLB A;  5TR7 A;  3HLB A;  1HD8 A;  3G31 A;  2OLV A;  4FCF A;  2VGK A;  4LCL A;  2HDR A;  4BLM A;  1U60 A;  5DF7 A;  1PW8 A;  3LCE A;  4KQR A;  3S1Y A;  1WYB A;  3ZG9 B;  4KZ6 A;  3N8R A;  3MFD A;  2PBY A;  5DTT A;  3JYI A;  2RL3 A;  3OPL A;  5CEB A;  4LCM A;  3BLS A;  5HW3 A;  3OCN A;  3M6H A;  1L2S A;  1DJB A;  4GNU A;  4WMC A;  5AQA A;  3HUO A;  1MXO A;  3MKF A;  1XXM A;  1MKI A;  1NJ4 A;  3QNB A;  4KQO A;  2XFS A;  2WGV A;  3WS2 A;  2BLS A;  3FYZ A;  2Y2M A;  3VSL A;  3G34 A;  1IKI A;  1PI4 A;  3HVF A;  4R4S A;  1G6A A;  5TFQ A;  1LL5 A;  3DW0 A;  3BFF A;  4BEN A;  2R9X A;  3W4Q A;  2XLN A;  4EUZ A;  1K56 A;  1E4D A;  1YLT A;  4QY6 A;  3UNW A;  3OPP A;  1K55 A;  4ZJ2 A;  3SH9 A;  3LO7 A;  5FI7 A;  5FQM A;  3VFH A;  4ZDX A;  1NXY A;  2HDQ A;  3HLC A;  1NRF A;  5HAR A;  3ZVT A;  2C5W B;  3MXS A;  3NC8 A;  1O7E A;  3V3R A;  3IXD A;  3C7V A;  1PZP A;  1XA1 A;  2QPN A;  2Y2O A;  2ZC4 B;  3N7W A;  3SS5 A;  4KG5 A;  1GHM A;  1KE4 A;  1TEM A;  2V20 A;  3C7U A;  5EOE A;  5F82 A;  3VP2 A;  4OPR A;  1JWV A;  2Y2P A;  3UN7 A;  3ZDJ A;  4KG6 A;  3RXW A;  3VP1 A;  2ZQC A;  4X68 A;  3PBT A;  4WMC D;  3LY4 A;  4K91 A;  1KDS A;  1ONG A;  3OPH A;  1K55 C;  3UPP A;  1KGE A;  3MXR A;  2BG1 A;  2XEP A;  1L0F A;  1XPB A;  2RCX A;  1LI0 A;  4UAA A;  1Q2Q A;  4OH0 A;  4KQQ A;  3O3V A;  1PI5 A;  1YLZ A;  4OQ0 A;  1H5X A;  5F1G A;  4E3M A;  3PBS A;  2Y2Q A;  4YFM A;  3VP0 A;  1S6R A;  1ALQ A;  4JPM A;  1SDN A;  3UPO A;  1K56 D;  4E3K A;  2HDS A;  1BLC A;  3C4P A;  1K38 A;  3FV7 A;  2Q9N A;  4EQI A;  3HLE A;  4MNR A;  2OV5 A;  4E3J A;  1M40 A;  1PWD A;  2IWC A;  4S2I A;  5A90 A;  5HL1 A;  3E2K A;  2HP9 A;  1TVF A;  2XK1 A;  1IEM A;  4JLF A;  4RX2 A;  1PZO A;  5FAP A;  2WYX A;  1K4F A;  3ZNY A;  5CER A;  2R9W A;  1W8Y A;  1KE0 A;  4KZ7 A;  2C6W B;  3CMZ A;  1YQS A;  2ZC6 B;  4X69 A;  3SOI A;  5A91 A;  4NET A;  2WKE A;  2ZQA A;  2G2U A;  3A3J A;  3EQV A;  1OME A;  4H8R A;  3HLG A;  3Q82 A;  2XD5 A;  4ZTK A;  4EV4 A;  3S4X A;  2WK0 A;  1L0D A;  3A3F A;  5DVA A;  4OLG A;  4MLL A;  3CZD A;  4ZJ1 A;  4OOY A;  3N8L A;  4QHC A;  2A49 A;  1RGZ A;  4LV0 A;  1K6R A;  3GRJ A;  1XP4 A;  4MBH A;  1FR1 A;  3NDG A;  3V3S A;  3O86 A;  4GB7 A;  5CEC A;  3GSG A;  3IQA A;  4X53 A;  4IBR A;  3V50 A;  3W8K A;  4DE0 A;  1PWG A;  1G68 A;  5F1F A;  1FSY A;  1ESU A;  2ZJ9 A;  2ZQ8 A;  1JWP A;  1L0G A;  1K54 A;  3GTC A;  4B88 A;  3MZF A;  3ITA A;  3BEB A;  1IYO A;  1K57 A;  2P9V B;  4OVD A;  4PM5 A;  5AQ9 A;  1KDW A;  4WM9 A;  1IKG A;  2P9V A;  1VM1 A;  3IT9 A;  2WUQ A;  4HBU A;  1VQQ A;  2DNS A;  1NZU A;  1QMF A;  4FH4 A;  5E2E A;  3Q1F A;  5FQJ A;  5G18 A;  1XGJ A;  5EVI A;  5HAI A;  2Y2L A;  1LL9 A;  4WZ4 A;  4RA7 A;  3BFG A;  5HFO A;  5IHV A;  4ID4 A;  3Q07 A;  1ESI A;  2WAD A;  2X02 A;  1ERM A;  4OOM A;  5M1A A;  1YLJ A;  3IF5 A;  1MWR A;  2J9O A;  5FI6 A;  1TDL A;  3QHY A;  2XD1 A;  1LHY A;  2CC1 A;  4GDB A;  4KZ4 A;  4OLD A;  2ZC5 B;  3HLD A;  3ZG7 B;  4QJG A;  1K57 C;  4HEF A;  4QB8 A;  1JVJ A;  3BRM A;  2J9P A;  4LV3 A;  5L2F A;  1J9M A;  3A3D A;  4R3J A;  5DTS A;  1W79 A;  5KSC A;  3TOI A;  4Y0T A;  2XGN A;  1YT4 A;  1KGG A; 
#chains in the Genus database with same CATH topology
 4ZBE A;  1ONH A;  4N1H A;  1FOF A;  4B9O A;  4U0T A;  5L8M A;  3KSI A;  2WKP A;  4Y5F A;  3F1N B;  5CGW A;  1W63 Q;  3F1N A;  2XRO A;  5EVI D;  4WEK A;  3LEZ A;  3ZG0 A;  1RGY A;  4JGR A;  1YMS A;  1IYS A;  3FKW A;  4CLC B;  4LV2 A;  4CLC A;  2XA7 S;  5FQ9 A;  4II7 A;  3GQZ A;  3FWL A;  2PRF A;  3IHB A;  2W3E A;  3UY6 A;  1W5D A;  1O07 A;  5FA7 A;  2V1Z A;  2PU2 A;  2PR6 A;  1VHM A;  1D06 A;  3LI8 A;  2VEA A;  4Y0O A;  1T1A A;  3BM6 A;  5HDC A;  5FAO A;  2E8J A;  3IXH A;  2Y59 A;  2EWW A;  3W4P A;  1OTA A;  4B4X A;  3IBR A;  1M6K A;  4FSF A;  4I3A A;  5D3O A;  4CLC D;  3GVB A;  4DDY A;  1RCJ A;  3LY3 A;  4R38 A;  2OSU A;  3UO9 A;  3ZVW A;  1MPL A;  1CQA A;  2HV1 A;  3KSH A;  5CHM A;  2B18 A;  1PW1 A;  1EI5 A;  3A0V A;  1TDG A;  3DWK A;  3O87 A;  3HLW A;  1FR6 A;  3LIA A;  2O9A A;  4MBF A;  3T1X A;  1HTZ A;  1FCM A;  2JKR M;  3LIC A;  4UHU A;  1S66 L;  3VP4 A;  1GA0 A;  5FI2 A;  1N9N A;  4GD6 A;  3UMD A;  5G4Z A;  3IHA A;  2H0Y A;  1XX2 A;  2V8F A;  3P01 A;  2HJE A;  3LUQ A;  1PWC A;  2JC7 A;  5F6A A;  3ZFZ A;  4LEN A;  4EBP A;  4NKP A;  1SKO B;  4OKP A;  3OC2 A;  4UA7 A;  2FFF B;  3VV4 A;  1SKO A;  2P74 A;  3EWK A;  3M2K A;  1GSV A;  2G2W A;  4QD4 A;  4UQI S;  2ZMA A;  3UE3 A;  2PHY A;  2XRN A;  2JCH A;  4F3L B;  3IXB A;  4F3L A;  1Y4O A;  3HJI A;  4DJ3 A;  1CEF A;  4GW9 A;  2K31 A;  4S2K A;  3ZHH A;  4ESP A;  4E3L A;  1MKM A;  4OPZ A;  4R4R A;  3ZQ5 A;  3A3I A;  1N9B A;  4P6Z M;  1IYP A;  1MBL A;  4S2J A;  5GLD A;  2VV8 A;  4BL3 A;  2OAP 1;  1XKZ A;  2GNX A;  4FH2 A;  4EBN A;  3BW6 A;  3L9K A;  1MWU A;  2ZC3 B;  2XFT A;  2ZM8 A;  4E6W A;  1S1Z A;  4FOF A;  3UDI A;  5DJU A;  4IED A;  4ARZ B;  4E3O A;  3MZE A;  4UA9 A;  4DXC A;  2GJ3 A;  5E2H A;  2DRW A;  5F83 A;  1YLP A;  4E6X A;  4L9F A;  2Y4A A;  4EET B;  4OP5 A;  2VGJ A;  4Q8I A;  1G5U A;  4JXG A;  3DAV A;  4O0P A;  1FQG A;  4P87 A;  3WWX A;  1XJ4 A;  4N9K A;  2X01 A;  4KZA A;  1UWN X;  1P0Z A;  3UE0 A;  2K2N A;  2P7J A;  4RVA A;  2JBF A;  1ZKJ A;  2EFU A;  4HJ4 A;  5KIZ A;  2J7V A;  1ES4 A;  2V0U A;  1P9W A;  2WGW B;  2IA2 A;  2BTF P;  1OTD A;  3PXP A;  1NLZ A;  3CAX A;  4DE2 A;  4LRY C;  4CJN A;  4Q0H A;  3MQQ A;  3G32 A;  5J8X A;  1Y54 A;  3HUN A;  2PBD P;  3RJU A;  1D1J A;  1MWS A;  2Y2J A;  1NYY A;  4Z9Q A;  1GA9 A;  4X1L A;  2NUP C;  1ZG6 A;  3HLF A;  1VET B;  2I72 A;  5HDS A;  1HLU P;  4BD1 A;  1UWP X;  4I38 A;  3RFB A;  2WZZ A;  4PM7 A;  1YMX A;  3RH8 B;  4WZ5 C;  5HZH A;  3PTE A;  4HIA A;  2PDR A;  2HZ5 A;  1HD8 A;  3G31 A;  4GCZ A;  1H0M A;  2R78 A;  1F2K A;  2M1C A;  1U60 A;  5DF7 A;  3LCE A;  4KZ6 A;  3N8R A;  5DTT A;  2FZ0 A;  1L2S A;  4WMC A;  1MXO A;  3MXQ A;  1XXM A;  3QNB A;  3T1S A;  5F68 A;  3WS2 A;  2BLS A;  3FYZ A;  3OOV A;  3G34 A;  4HH2 A;  2P04 A;  3H7W B;  4Y2F A;  3BFF A;  2R9X A;  1K56 A;  3SZT A;  4ZJ2 A;  3VFH A;  2J3T C;  2DMW A;  3ZYT A;  4WF0 A;  1NXY A;  2JN7 A;  1NRF A;  2XA7 M;  3S7O A;  3V3R A;  1A0K A;  4IHQ A;  3C7V A;  1PZP A;  1XA1 A;  2Y2O A;  3N7W A;  3SS5 A;  1NLY A;  5EOE A;  1S4R A;  1JWV A;  2ZQC A;  4WMC D;  3T4J A;  4O8G A;  1KGE A;  3MXR A;  3PR6 A;  2RCX A;  1N9L A;  1XPB A;  4UAA A;  1Q2Q A;  1PI5 A;  3IS2 A;  5LBR A;  2L1M A;  2VZW A;  1ALQ A;  1K56 D;  2O9B A;  4MNR A;  4S2I A;  3LIF A;  3EOI A;  1TVF A;  2PD8 A;  2WYX A;  1K4F A;  5FL3 A;  3ZNY A;  5L09 A;  1KE0 A;  2C6W B;  3CMZ A;  1YQS A;  3BY8 A;  3T4Q A;  2ZQA A;  4QWO A;  3CPT B;  3HLG A;  1L0D A;  4EQ1 A;  3TJZ C;  3UB9 A;  3KO6 A;  4OOY A;  1PRQ A;  1S67 L;  2QWS A;  1YSP A;  3S7N A;  4GB7 A;  2KX6 A;  4IBR A;  3V50 A;  3KYQ A;  2G7U A;  3B42 A;  1LL8 A;  5J7E A;  3EEA A;  1J3W A;  1ESU A;  1L0G A;  4XT2 B;  5FEG A;  2FH5 A;  1IYO A;  2P9V B;  3DTI A;  5AQ9 A;  4KUK A;  2P9V A;  1VQQ A;  2DNS A;  3Q1F A;  3KX0 X;  5HAI A;  3CHW P;  2Y2L A;  4LGW A;  5HFO A;  1DP6 A;  2X02 A;  1ZTU A;  3IF5 A;  4WL9 A;  1MWR A;  3P7N A;  1XJ3 A;  1LT0 A;  4OLD A;  4GDB A;  4QJG A;  1K57 C;  4P6Z S;  3JPU A;  2J9P A;  1J9M A;  5KSC A;  2VK3 A;  2PR5 A;  4Y0T A;  3NJA A;  3UB6 A;  1KGG A;  4GHI B;  2KOI A;  4L9E A;  4GHI A;  3FKV A;  5E2G A;  3ZG8 B;  4DN0 A;  5CXW A;  4L0L A;  4ME4 A;  2WKQ A;  5EE8 A;  2XR0 A;  3H82 B;  3C38 A;  3GMW A;  1WE4 A;  3KSG A;  4C75 A;  4ZAM A;  1VEU B;  3FPV A;  4U3T A;  5AJG A;  4OON A;  4S2L A;  4OQH A;  4HHD A;  4EER A;  3E4P A;  2QZ6 A;  2Y91 A;  3NEC A;  2ACG A;  4P6B A;  1IFQ A;  2A3U A;  5IT5 A;  1OT9 A;  2Q9M A;  4ZJ3 A;  3P09 A;  3HUM A;  4GKU A;  3T1Q B;  4E3N A;  5I5L A;  3LFV A;  1GCE A;  4IUK A;  1DP8 A;  1XJ2 A;  3MQ0 A;  1IYQ A;  2PYP A;  3IX8 A;  4FD8 A;  5G4Y A;  4IVK A;  5JYP A;  3TG9 A;  1ERO A;  1FCN A;  4NXF A;  2X71 A;  3MBZ A;  3NUL A;  2ZM2 A;  2ZMF A;  2ZM0 A;  5F5Y A;  2QHK A;  1GSW A;  1BLP A;  1YSQ A;  3BY9 A;  3WS5 A;  1Q2P A;  2DCF A;  1LSW A;  1BYW A;  2GX5 A;  3GR2 A;  3NDE A;  3PBR A;  4MBK A;  3TSG A;  1SKF A;  2XDM A;  3WS0 A;  4KZ8 A;  3SS3 A;  5DTK A;  1OTB A;  4OOL A;  3RXX A;  5CHJ A;  1H8Z A;  5EPH A;  5EVI B;  1TD5 A;  4Y0U A;  3V39 A;  1LI9 A;  5IS1 A;  1TS8 A;  1V9Y A;  2B5R A;  3AGE A;  1AXB A;  4S2O A;  5KMW A;  4GS9 B;  4UA6 A;  1RP5 A;  4NXE A;  4HQA A;  1F5M A;  1T18 A;  3IWI A;  5CRF A;  3E98 A;  4KG2 A;  5GL9 A;  4BBU A;  3TE8 A;  5HDD A;  1CK3 A;  4IBX A;  4Y13 A;  5FDS A;  3K3C A;  1DRM A;  3BWL A;  2V1A A;  5EOO A;  5AQB A;  4CPK A;  1MZU A;  4XUZ A;  1MWT A;  3FZC A;  2OWH A;  5JYO A;  3ICY A;  1FIK A;  3CUE C;  2PU4 A;  1W7F A;  1L0E A;  5GHX A;  4KZ5 A;  1OT6 A;  4LRX C;  4HP9 A;  2ZLY A;  1GSX A;  2WZX A;  5HD5 A;  4K0X A;  3MFX A;  4OP8 A;  3HBR A;  3E2L A;  3G2Y A;  2EWV A;  4S2N A;  4PAU A;  1SHV A;  2J3T D;  2LB9 A;  1OTE A;  2OAQ 1;  3SH8 A;  1XFN A;  1BUE A;  1PYY A;  4RQ9 A;  2KDK A;  2P08 A;  1WYC A;  3Q7Z A;  2PYR A;  1TS0 A;  4R0Q A;  3MS6 A;  2OWJ A;  5E2F A;  4KZB A;  5EEC A;  4G3K A;  4MN5 A;  5FQK A;  2JKF A;  2UWX A;  1VB6 A;  4QU3 A;  3T4K A;  2D01 A;  3QP6 A;  3UB7 A;  1KOU A;  5J3W A;  4KZ9 A;  4R23 A;  3ZNT A;  5HX9 A;  4O7D A;  4GD8 A;  5A92 A;  1HZO A;  4C3Q A;  2O9C A;  2VV7 A;  4BD0 A;  3T12 B;  1MY8 A;  3AGF A;  3S22 A;  3ZGA B;  4RYE A;  1ES2 A;  1EWZ A;  5FSR A;  1F9I A;  5AVE A;  4KEN B;  3WRZ A;  3PAE A;  1ERQ A;  3T50 A;  4JKT A;  5FQI A;  5F69 A;  3IXG A;  2JE5 A;  4BJP A;  3V5M A;  4D2O A;  3MKE A;  2Y2H A;  4HH3 A;  3IF6 C;  3C30 A;  2VJW A;  5EVE A;  4MN6 A;  5FAS A;  1ES5 A;  4GOG A;  1Z6F A;  5GLB A;  3PAG A;  3V67 A;  5TBM A;  4BLM A;  3LIB A;  4KQR A;  5HWT A;  3S1Y A;  2W3D A;  1Y28 A;  3MFD A;  2PBY A;  3JYI A;  3OPL A;  3M6H A;  1DJB A;  4GNU A;  5AQA A;  3K2N A;  2XFS A;  2V8C A;  1G6A A;  5TFQ A;  2XLN A;  4QY6 A;  1K55 A;  5FI7 A;  2HDQ A;  3HLC A;  3MXS A;  3NC8 A;  2QPN A;  2ZC4 B;  1GHM A;  3C7U A;  5F82 A;  4G3W A;  4OPR A;  3UN7 A;  3BQA A;  3VP1 A;  4X68 A;  4K91 A;  1KDS A;  2XEP A;  1L0F A;  1LI0 A;  4NXG A;  4KQQ A;  3MSH A;  2O0Y A;  4M4X A;  4OQ0 A;  1H5X A;  5F1G A;  3PBS A;  5HPF A;  2HDS A;  3FV7 A;  2Q9N A;  4ETZ A;  3E2K A;  2XK1 A;  1IEM A;  4RX2 A;  5FAP A;  4JGO A;  5CX7 A;  2W1T A;  1W8Y A;  4X69 A;  1Z09 A;  4H8R A;  2G2U A;  2XD5 A;  3S4X A;  3A3F A;  2OOL A;  4FUW A;  3CZD A;  4ZJ1 A;  4ZRR A;  3N8L A;  2Y8H A;  4QHC A;  4LV0 A;  1K6R A;  1XP4 A;  1FR1 A;  3O86 A;  5CEC A;  4X53 A;  4Y3I A;  4DE0 A;  1PWG A;  4Y15 A;  2V0W A;  1G68 A;  5MC7 A;  2ZJ9 A;  4YWZ A;  3CIT A;  3MZF A;  3ITA A;  4PM5 A;  4WM9 A;  3IT9 A;  2WUQ A;  1F98 A;  5FQJ A;  1LL9 A;  1G28 A;  4FTX A;  4ID4 A;  1G6O A;  1CJF A;  4EW7 A;  1ERM A;  5M1A A;  4NEE D;  3MJQ A;  3KSF A;  4WN5 A;  2WKR A;  1LHY A;  4KZ4 A;  5HD3 A;  4HEF A;  1ZHH B;  1JVJ A;  3BRM A;  4H6J A;  5DTS A;  3A3D A;  3C8C A;  4R3J A;  3DBA A;  3TOI A;  2XGN A;  1YT4 A;  4PKY A;  1ZG4 A;  3IH9 A;  4PHT A;  4B4Z A;  5M19 A;  4HES A;  1K6S A;  4NXB A;  5EVL A;  3BFE A;  1S0W A;  2Y2N A;  2IWD A;  2Y2K A;  3EQU A;  4OQI A;  4DKI A;  5GLC A;  1TS6 A;  4HJ6 A;  4GN2 A;  3B33 A;  3GEC A;  4HOI A;  2EXB A;  2JKT M;  4QPR A;  1SCW A;  1YLY A;  2INW A;  5FAQ A;  2CMN A;  3G2Z A;  5GHY A;  3VOZ A;  4IVI A;  3IS2 B;  3FG8 A;  1QME A;  2NUT C;  4MMN A;  1ZC2 A;  1SDE A;  4I39 A;  4UEY A;  4CLC C;  3WS1 A;  4R6L A;  4NG2 A;  5AQ7 A;  4JF6 A;  3UDX A;  4EEU A;  2EXA A;  3UDF A;  5C5K A;  3U2A A;  3R4K A;  1I5Q A;  3AGD A;  5M18 A;  4GDN A;  3D4F A;  3MF0 A;  2GZA A;  3ZG5 A;  3BFD A;  3A0R A;  5DKK A;  4X6T A;  2HP6 A;  1BUL A;  2W3F A;  3JVU A;  2Z6D A;  3A0S A;  5GLA A;  4BBT A;  2YKF A;  2QMI A;  4RX3 A;  1H8M A;  4IJG A;  2ZC7 A;  5KZH A;  3O88 A;  4PM9 A;  1NY0 A;  3UB8 A;  1N4O A;  5HWV A;  5EM1 A;  1BTL A;  3KYZ A;  3DTK A;  2V2F F;  3NBL A;  1GHP A;  3SS4 A;  5BOH A;  4S2P A;  2EX8 A;  1BZA A;  1CI8 A;  3Q7V B;  2PAV P;  3Q7V A;  4WYY A;  5EFW A;  2WKH A;  2J8Y A;  2W1R A;  2H5S A;  2WGI A;  2MJ6 A;  4BQM A;  3T4L A;  1T1B A;  3DWZ A;  3GDI A;  2FFY A;  4KZ3 A;  3BYD A;  4PMA A;  4WBG A;  5A8B A;  3LR4 A;  4EWF A;  5HWW A;  2HJ9 C;  2A24 A;  1OPX A;  3OCL A;  5I94 A;  1KE3 A;  4F94 A;  3TW8 A;  2J3W A;  5E43 A;  4R3A A;  2ZD8 A;  3NOU C;  4JGQ A;  1JWZ A;  2WKI A;  1DP9 A;  1I2S A;  2Q0O A;  4PPR A;  4LV1 A;  5EUA A;  4WEL A;  2L4R A;  1BLS A;  1YKD A;  3QP5 A;  3IX3 A;  5TGF A;  5CGX A;  3G35 A;  4HP4 A;  5CED A;  2B02 A;  2E8I A;  5U47 A;  1PFL A;  4I3I A;  4XXR A;  5FAT A;  3C5A A;  3EGX C;  1K4E A;  3HRE A;  3PBN A;  2VKS A;  3E4Q A;  3K3D A;  4C6Y A;  4PKY G;  2ZMV A;  4M3K A;  4X25 A;  3VOL A;  4E04 A;  4I5S A;  1PIO A;  3N4I A;  4P0M A;  1XJ6 A;  4JF5 A;  2W0N A;  2W27 A;  4DJ2 A;  3N6I A;  4LLO B;  1CEG A;  1AWI A;  3PBO A;  1IEL A;  5HAQ A;  4X1M A;  3IH8 A;  3T1R A;  3U4L P;  1XFQ A;  1NYM A;  2EX6 A;  3LR3 A;  1E25 A;  4K0W A;  3IBJ A;  2B95 A;  2ZQD A;  2LB5 A;  4WLA A;  4O01 A;  2JHE A;  4Q0I A;  2OLU A;  2QKP A;  1FSW A;  4WZ5 A;  5FQQ A;  2ZL1 A;  3F1P A;  1PNE A;  3QNC A;  1BLH A;  3HCY A;  1CI9 A;  2HF6 A;  3BFC A;  1DJC A;  2ZOH A;  4N1X A;  3W4O A;  2EX9 A;  4NK3 A;  2HPB A;  4QY5 A;  3NOP C;  2OLV A;  4FCF A;  2VGK A;  4LCL A;  4LFU A;  1PW8 A;  1WYB A;  2A2L A;  2JKR I;  2RL3 A;  2W3G A;  5FEF A;  3BQ8 A;  5CEB A;  2UV0 E;  3OCN A;  1ACF A;  1T19 A;  4B93 A;  3QP2 A;  4HI4 A;  1MKI A;  4KQO A;  3F1O A;  1LSX A;  1D7E A;  3VSL A;  3HVF A;  4R4S A;  1LL5 A;  3LYX A;  4BEN A;  4IUH A;  3W4Q A;  4EUZ A;  2PT7 A;  1YLT A;  3OPP A;  3LO7 A;  5FQM A;  4YOF A;  3ZVT A;  5DKL A;  5AVF A;  3IXD A;  1KE4 A;  1TEM A;  1LSV A;  4GLQ A;  3ZDJ A;  2H28 A;  3RXW A;  3PBT A;  4K08 A;  5L07 A;  3LY4 A;  1MC0 A;  2M7U A;  3CWF A;  1TS7 A;  4JPM A;  1SDN A;  4E3K A;  1BLC A;  3C4P A;  4EQI A;  1W63 M;  4E3J A;  4WUJ A;  1X0O A;  2IWC A;  3JVV A;  2HP9 A;  4JLF A;  2EA9 A;  1STZ A;  4MN7 A;  5CER A;  4KZ7 A;  2R9W A;  3SOI A;  2VGL M;  5A91 A;  4BBV A;  1OME A;  2WK0 A;  4OLG A;  4MLL A;  3UB5 P;  4ETX A;  2JKG A;  2A49 A;  1RGZ A;  3V3S A;  3NDG A;  4CLC E;  2ZQ8 A;  2BAS A;  2Y79 A;  1K57 A;  4OVD A;  1KDW A;  3D3O A;  4HBU A;  1QMF A;  5E2E A;  1NRJ A;  3E0Y A;  4WZ4 A;  3H9W A;  5TBM B;  1ESI A;  2WAD A;  5HL6 A;  2J9O A;  5FI6 A;  1P9R A;  2XD1 A;  5DFY A;  2CC1 A;  3OLO A;  2ZC5 B;  3ZG7 B;  4BMW A;  5L2F A;  1P97 A;  3T4S A;  1EW0 A;  3CI6 A;  5DFX A;  5FDH A;  4OQG A;  2HP5 A;  3A3E A;  3VFF A;  3C2W A;  2QYB A;  3VOY A;  3S7Q A;  4DDS A;  1WA9 A;  1IOU A;  2J80 A;  3P98 A;  4X55 A;  5CTN A;  1JTD A;  3SW1 A;  5GHZ A;  3BEC A;  4MCW A;  3VP3 A;  1YLW A;  4ARZ A;  3EGD C;  1YAX A;  3WS4 A;  4LPZ A;  2ZBB A;  4R70 A;  4Y17 A;  3QP4 A;  1T1C A;  4DF6 A;  4BWI A;  3UE6 A;  4X56 A;  2XQZ A;  2ZQ7 A;  1XA7 A;  3LGO A;  2W1T B;  1V9Z A;  1K25 A;  3PYP A;  2Y2G A;  3E4O A;  4XUX A;  3IWQ A;  5HAP A;  1ES3 A;  1C3B A;  4DMZ A;  2Y55 A;  2AVX A;  3NOT C;  3DTM A;  2EFX A;  3D72 A;  3N8S A;  4DXB A;  2I9V A;  2JKT I;  2W3H A;  2WGW A;  3BLM A;  4JXS A;  4WEJ A;  2XSS A;  2Z2M B;  4BL2 A;  5A93 A;  4I3J A;  4R3B A;  5KSH A;  4OPQ A;  5CHU A;  3LID A;  3T4T A;  3ZCZ A;  4G3V A;  3M2J A;  4JXV A;  3NY4 A;  4N92 A;  3MR0 A;  1VET A;  3LI9 A;  1UGU A;  2QJ7 A;  1K54 C;  3VSK A;  4H6J B;  1I2W A;  3NCK A;  3CUE A;  4YIN A;  4U0X A;  5EVI C;  3HL9 A;  4Y7P A;  3T4O A;  4DE1 A;  4A5R A;  5K5B A;  2XH9 A;  4DRT A;  4GZB A;  4HY8 A;  4EXO A;  5J4E A;  4DE3 A;  4L9G A;  1LLB A;  4HNB A;  2Y2I A;  4HBT A;  1JTG A;  2HDU A;  4MDZ A;  3CJM A;  3H7W A;  3OPR A;  3PHY A;  3I7J A;  4JXW A;  1E3U A;  3IWO A;  5EV0 A;  1BT5 A;  5TJJ A;  5HPI A;  2VV6 A;  2XF3 A;  4GJ4 A;  3OZH A;  3MZD A;  3HJK A;  1L3L A;  3ULF A;  1FIL A;  1KGF A;  2HGV A;  1SZV A;  1DY6 A;  5DF9 A;  2H10 A;  1YM1 A;  3NI9 A;  1BSG A;  4P85 A;  3B3X A;  2VX8 A;  2Z6C A;  3UPN A;  1W8Q A;  3SH7 A;  3G4P A;  4JF4 A;  4S2N C;  4EES A;  2VGL S;  2YKH A;  3S7P A;  1E3U D;  2WAE A;  3RTY A;  5L10 A;  1HVB A;  2GDN A;  3LR5 A;  1H8Y A;  5DF8 A;  4N9L A;  4LRZ E;  4MEZ A;  3O5Y A;  2D02 A;  3WRT A;  3VE4 A;  3B47 A;  2WAF A;  4E3I A;  3CPT A;  3OBF A;  3VMA A;  3GV9 A;  2VA0 A;  3ISG A;  1NZO A;  2VLG A;  1OJG A;  3IF6 B;  3PBQ A;  3IF6 A;  2H0T A;  1TF1 A;  2Z2L B;  1KVL A;  2ZQ9 A;  4EBL A;  1S1Y A;  3Q81 A;  3C4O A;  4JBF A;  3UE1 A;  3CG5 A;  4PM8 A;  2V1B A;  4CQH A;  3MQO A;  1DJA A;  3D9Y A;  2IWB A;  3NIA A;  1KVM A;  1GHI A;  5CTM A;  3EEH A;  3NHQ A;  3M6B A;  4PM6 A;  4XT2 A;  1XGI A;  2EX2 A;  1FCO A;  4R1G A;  3ITB A;  3G30 A;  4OPY A;  1ODV A;  4S2M A;  1NWZ A;  4UQI M;  4KUO A;  4EU0 A;  5TR7 A;  2K7S A;  3HLB A;  2KLI A;  1S4S A;  4JGP A;  2HDR A;  2A24 B;  3ZG9 B;  2O99 A;  4LCM A;  3BLS A;  5HW3 A;  2QJ5 A;  3HUO A;  3MKF A;  1NJ4 A;  1OJ5 A;  1K0K A;  2WGV A;  3G6O A;  2Y2M A;  1IKI A;  1PI4 A;  3DW0 A;  1E4D A;  3UNW A;  3SH9 A;  4ZDX A;  5DJT A;  5HAR A;  1N9O A;  2C5W B;  1O7E A;  5IU1 A;  3H82 A;  4KG5 A;  2V20 A;  3VP2 A;  2Y2P A;  1VEU A;  4KG6 A;  1ONG A;  3OPH A;  1K55 C;  3UPP A;  2BG1 A;  2PD7 A;  4OH0 A;  3O3V A;  1YLZ A;  2L0W A;  4E3M A;  2Y2Q A;  3QP1 A;  4YFM A;  3VP0 A;  1S6R A;  3LR0 A;  3UPO A;  1YPR A;  3LEQ A;  5HSQ A;  1K38 A;  3HLE A;  1M40 A;  1PWD A;  1OTI A;  5A90 A;  5HL1 A;  2V9A A;  1PZO A;  1CF0 A;  2ZC6 B;  4NET A;  3QP8 A;  2WKE A;  3A3J A;  3EQV A;  2OV5 A;  4ZTK A;  3Q82 A;  4EV4 A;  3MMH A;  3L7H A;  5DVA A;  3TRC A;  4EEP A;  3FPW A;  3VE3 A;  3GRJ A;  4KQD A;  4MBH A;  1H3Q A;  3IX4 A;  2ZL1 B;  3DTE A;  3F1P B;  3GSG A;  3IQA A;  2M7V A;  3W8K A;  3BJN A;  3KYE A;  5F1F A;  1FSY A;  1JNU A;  4D60 A;  1JWP A;  1K54 A;  3GTC A;  4B88 A;  3FC7 A;  3BEB A;  1IKG A;  4Z1W A;  1VM1 A;  4YNR A;  3W2Z A;  4EUV A;  1NZU A;  2ZOI A;  4FH4 A;  5G18 A;  1XGJ A;  5EVI A;  4RA7 A;  4Q0J A;  3BFG A;  5IHV A;  3Q07 A;  3R7W B;  4OOM A;  3R7W A;  1YLJ A;  3CLO A;  4GS9 A;  1TDL A;  3QHY A;  3UME A;  4AFI A;  5EM0 A;  3LIE A;  3HLD A;  4QB8 A;  4LV3 A;  1W79 A;  4HJ3 A;  3F1O B;  5CGS A; 
#chains in the Genus database with same CATH homology
 4ZBE A;  1ONH A;  4N1H A;  1ZG4 A;  3IH9 A;  3FKV A;  5E2G A;  1FOF A;  5FDH A;  4B4Z A;  4OQG A;  5M19 A;  2HP5 A;  4U0T A;  3ZG8 B;  3A3E A;  5CXW A;  5CGW A;  4HES A;  4L0L A;  3VFF A;  5EVI D;  5EE8 A;  4WEK A;  3VOY A;  1K6S A;  5EVL A;  3LEZ A;  3ZG0 A;  4DDS A;  2XR0 A;  3BFE A;  1RGY A;  1YMS A;  3GMW A;  1S0W A;  1IYS A;  3FKW A;  3P98 A;  2Y2N A;  1WE4 A;  4LV2 A;  4X55 A;  2IWD A;  5CTN A;  2Y2K A;  3EQU A;  1JTD A;  5FQ9 A;  4OQI A;  4C75 A;  4DKI A;  4ZAM A;  5GLC A;  3GQZ A;  3FWL A;  4GN2 A;  3IHB A;  4U3T A;  5GHZ A;  2EXB A;  4OON A;  4S2L A;  4OQH A;  3BEC A;  3UY6 A;  1SCW A;  1O07 A;  1W5D A;  1YLY A;  5FAQ A;  5FA7 A;  2V1Z A;  2QZ6 A;  3G2Z A;  1YLW A;  2PU2 A;  5GHY A;  3VOZ A;  2Y91 A;  4IVI A;  3VP3 A;  4P6B A;  1QME A;  2A3U A;  1ZC2 A;  2Q9M A;  4ZJ3 A;  4Y0O A;  3P09 A;  1SDE A;  3HUM A;  3WS4 A;  4GKU A;  3BM6 A;  4E3N A;  4DF6 A;  3WS1 A;  1GCE A;  5FAO A;  5CGS A;  5AQ7 A;  3IXH A;  4JF6 A;  3UDX A;  4X56 A;  2Y59 A;  2XQZ A;  2EXA A;  1IYQ A;  2ZQ7 A;  3UDF A;  3W4P A;  4FD8 A;  1XA7 A;  4IVK A;  4B4X A;  5JYP A;  3TG9 A;  1ERO A;  1FCN A;  1M6K A;  4FSF A;  5D3O A;  1I5Q A;  3GVB A;  1K25 A;  2X71 A;  3MBZ A;  4DDY A;  1RCJ A;  2ZM2 A;  3AGD A;  2Y2G A;  5M18 A;  4GDN A;  3D4F A;  2ZM0 A;  3LY3 A;  3ZG5 A;  4XUX A;  3BFD A;  2OSU A;  3UO9 A;  3ZVW A;  1BLP A;  4X6T A;  1MPL A;  3IWQ A;  5HAP A;  2HP6 A;  5CHM A;  1BUL A;  1PW1 A;  1EI5 A;  1ES3 A;  3WS5 A;  1C3B A;  1Q2P A;  1TDG A;  2Y55 A;  3DWK A;  3O87 A;  2DCF A;  3HLW A;  1FR6 A;  3DTM A;  2EFX A;  4MBF A;  3GR2 A;  1HTZ A;  3NDE A;  1FCM A;  3N8S A;  3PBR A;  5GLA A;  4DXB A;  4MBK A;  4UHU A;  3TSG A;  3VP4 A;  1SKF A;  2QMI A;  4RX3 A;  2WGW A;  1GA0 A;  2XDM A;  3BLM A;  5FI2 A;  3WS0 A;  4GD6 A;  2ZC7 A;  4JXS A;  3IHA A;  2H0Y A;  4KZ8 A;  3O88 A;  3SS3 A;  1XX2 A;  4PM9 A;  5KZH A;  5DTK A;  1NY0 A;  1N4O A;  4OOL A;  3RXX A;  1PWC A;  2JC7 A;  1BTL A;  4WEJ A;  5CHJ A;  3ZFZ A;  2V2F F;  4LEN A;  3NBL A;  1H8Z A;  2Z2M B;  1GHP A;  4EBP A;  4OKP A;  4BL2 A;  5A93 A;  3SS4 A;  5EPH A;  3OC2 A;  4UA7 A;  5BOH A;  4S2P A;  2FFF B;  2EX8 A;  5EVI B;  4R3B A;  1BZA A;  1CI8 A;  2P74 A;  3M2K A;  3Q7V B;  4OPQ A;  4Y0U A;  5CHU A;  1LI9 A;  3V39 A;  5KSH A;  2G2W A;  3Q7V A;  4WYY A;  3ZCZ A;  4QD4 A;  3M2J A;  2B5R A;  3AGE A;  1AXB A;  4JXV A;  2WKH A;  3NY4 A;  2ZMA A;  4N92 A;  4S2O A;  3UE3 A;  5KMW A;  4UA6 A;  1RP5 A;  2J8Y A;  1K54 C;  3VSK A;  2JCH A;  2H5S A;  3IWI A;  2WGI A;  4BQM A;  3IXB A;  5CRF A;  3DWZ A;  1I2W A;  3NCK A;  1CEF A;  2FFY A;  4U0X A;  4YIN A;  4KZ3 A;  4KG2 A;  4S2K A;  3BYD A;  4PMA A;  5EVI C;  3ZHH A;  4E3L A;  4WBG A;  5GL9 A;  3HL9 A;  4Y7P A;  4OPZ A;  4R4R A;  1CK3 A;  4EWF A;  4IBX A;  4DE1 A;  3A3I A;  1N9B A;  4A5R A;  1IYP A;  1MBL A;  2XH9 A;  4S2J A;  5GLD A;  3OCL A;  4DRT A;  4GZB A;  5I94 A;  5EOO A;  5AQB A;  4CPK A;  1KE3 A;  4BL3 A;  4F94 A;  4XUZ A;  1MWT A;  4DE3 A;  1LLB A;  5E43 A;  1XKZ A;  2Y2I A;  4FH2 A;  3FZC A;  2ZD8 A;  4HBT A;  4EBN A;  5JYO A;  1JWZ A;  2WKI A;  2PU4 A;  1MWU A;  1I2S A;  1W7F A;  2ZC3 B;  1L0E A;  5GHX A;  1JTG A;  4KZ5 A;  4PPR A;  4LV1 A;  2HDU A;  2ZLY A;  5EUA A;  3CJM A;  4WEL A;  2XFT A;  2ZM8 A;  4E6W A;  3OPR A;  1BLS A;  2WZX A;  5TGF A;  3UDI A;  4K0X A;  3I7J A;  5CGX A;  4JXW A;  4IED A;  1E3U A;  3G35 A;  4OP8 A;  3IWO A;  4E3O A;  3MZE A;  3HBR A;  5CED A;  4UA9 A;  1BT5 A;  3E2L A;  4DXC A;  3G2Y A;  2E8I A;  5U47 A;  5E2H A;  2DRW A;  5F83 A;  2XF3 A;  1YLP A;  3OZH A;  4S2N A;  3MZD A;  4E6X A;  4XXR A;  5FAT A;  1SHV A;  1KGF A;  3C5A A;  2Y4A A;  3SH8 A;  1DY6 A;  1BUE A;  1PYY A;  5DF9 A;  1K4E A;  2H10 A;  1YM1 A;  3HRE A;  3PBN A;  4OP5 A;  3NI9 A;  1BSG A;  4P85 A;  1WYC A;  3Q7Z A;  4C6Y A;  2VGJ A;  4Q8I A;  3B3X A;  4R0Q A;  4M3K A;  3UPN A;  4JXG A;  5E2F A;  1PIO A;  3N4I A;  4P0M A;  1W8Q A;  1FQG A;  4KZB A;  3SH7 A;  3G4P A;  5EEC A;  4JF4 A;  4JF5 A;  4P87 A;  4S2N C;  3WWX A;  4N9K A;  2X01 A;  5FQK A;  2UWX A;  4KZA A;  3N6I A;  1E3U D;  2WAE A;  1CEG A;  3PBO A;  3UE0 A;  4QU3 A;  1IEL A;  4RVA A;  5HAQ A;  1HVB A;  2JBF A;  2EFU A;  2GDN A;  1ZKJ A;  3IH8 A;  2J7V A;  1H8Y A;  1ES4 A;  5DF8 A;  4KZ9 A;  4R23 A;  4N9L A;  1NYM A;  2EX6 A;  1E25 A;  4MEZ A;  3ZNT A;  4K0W A;  5HX9 A;  2WGW B;  4O7D A;  3WRT A;  4GD8 A;  2WAF A;  2ZQD A;  4E3I A;  5A92 A;  1HZO A;  3VMA A;  4C3Q A;  3GV9 A;  3ISG A;  1NZO A;  4BD0 A;  4DE2 A;  3IF6 B;  3PBQ A;  1MY8 A;  2OLU A;  3AGF A;  3IF6 A;  4CJN A;  3S22 A;  3ZGA B;  4RYE A;  2H0T A;  1ES2 A;  3G32 A;  1EWZ A;  2Z2L B;  1FSW A;  5FSR A;  5J8X A;  1KVL A;  1Y54 A;  2ZQ9 A;  3HUN A;  4KEN B;  3WRZ A;  4EBL A;  4WZ5 A;  5FQQ A;  3Q81 A;  3C4O A;  2Y2J A;  1MWS A;  3PAE A;  1ERQ A;  4JBF A;  3RJU A;  3UE1 A;  1NYY A;  4JKT A;  3CG5 A;  4PM8 A;  3QNC A;  5FQI A;  4Z9Q A;  1GA9 A;  1BLH A;  1CI9 A;  1DJA A;  2IWB A;  3IXG A;  2JE5 A;  1ZG6 A;  3NIA A;  4BJP A;  3HLF A;  1KVM A;  3V5M A;  1GHI A;  3BFC A;  3MKE A;  1DJC A;  2I72 A;  2Y2H A;  5CTM A;  4D2O A;  3M6B A;  4PM6 A;  4N1X A;  1XGI A;  3IF6 C;  2EX2 A;  1FCO A;  4R1G A;  3ITB A;  4BD1 A;  3W4O A;  3G30 A;  4OPY A;  4S2M A;  2EX9 A;  5FAS A;  1ES5 A;  4GOG A;  1Z6F A;  2WZZ A;  4NK3 A;  4PM7 A;  2HPB A;  1YMX A;  4QY5 A;  4WZ5 C;  3PTE A;  3PAG A;  5GLB A;  5TR7 A;  3HLB A;  1HD8 A;  3G31 A;  2OLV A;  4FCF A;  2VGK A;  4LCL A;  2HDR A;  4BLM A;  1U60 A;  5DF7 A;  1PW8 A;  3LCE A;  4KQR A;  3S1Y A;  1WYB A;  3ZG9 B;  4KZ6 A;  3N8R A;  3MFD A;  2PBY A;  5DTT A;  3JYI A;  2RL3 A;  3OPL A;  5CEB A;  4LCM A;  3BLS A;  5HW3 A;  3OCN A;  3M6H A;  1L2S A;  1DJB A;  4GNU A;  4WMC A;  5AQA A;  3HUO A;  1MXO A;  3MKF A;  1XXM A;  1MKI A;  1NJ4 A;  3QNB A;  4KQO A;  2XFS A;  2WGV A;  3WS2 A;  2BLS A;  3FYZ A;  2Y2M A;  3VSL A;  3G34 A;  1IKI A;  1PI4 A;  3HVF A;  4R4S A;  1G6A A;  5TFQ A;  1LL5 A;  3DW0 A;  3BFF A;  4BEN A;  2R9X A;  3W4Q A;  2XLN A;  4EUZ A;  1K56 A;  1E4D A;  1YLT A;  4QY6 A;  3UNW A;  3OPP A;  1K55 A;  4ZJ2 A;  3SH9 A;  3LO7 A;  5FI7 A;  5FQM A;  3VFH A;  4ZDX A;  1NXY A;  2HDQ A;  3HLC A;  1NRF A;  5HAR A;  3ZVT A;  2C5W B;  3MXS A;  3NC8 A;  1O7E A;  3V3R A;  3IXD A;  3C7V A;  1PZP A;  1XA1 A;  2QPN A;  2Y2O A;  2ZC4 B;  3N7W A;  3SS5 A;  4KG5 A;  1GHM A;  1KE4 A;  1TEM A;  2V20 A;  3C7U A;  5EOE A;  5F82 A;  3VP2 A;  4OPR A;  1JWV A;  2Y2P A;  3UN7 A;  3ZDJ A;  4KG6 A;  3RXW A;  3VP1 A;  2ZQC A;  4X68 A;  3PBT A;  4WMC D;  3LY4 A;  4K91 A;  1KDS A;  1ONG A;  3OPH A;  1K55 C;  3UPP A;  1KGE A;  3MXR A;  2BG1 A;  2XEP A;  1L0F A;  1XPB A;  2RCX A;  1LI0 A;  4UAA A;  1Q2Q A;  4OH0 A;  4KQQ A;  3O3V A;  1PI5 A;  1YLZ A;  4OQ0 A;  1H5X A;  5F1G A;  4E3M A;  3PBS A;  2Y2Q A;  4YFM A;  3VP0 A;  1S6R A;  1ALQ A;  4JPM A;  1SDN A;  3UPO A;  1K56 D;  4E3K A;  2HDS A;  1BLC A;  3C4P A;  1K38 A;  3FV7 A;  2Q9N A;  4EQI A;  3HLE A;  4MNR A;  2OV5 A;  4E3J A;  1M40 A;  1PWD A;  2IWC A;  4S2I A;  5A90 A;  5HL1 A;  3E2K A;  2HP9 A;  1TVF A;  2XK1 A;  1IEM A;  4JLF A;  4RX2 A;  1PZO A;  5FAP A;  2WYX A;  1K4F A;  3ZNY A;  5CER A;  2R9W A;  1W8Y A;  1KE0 A;  4KZ7 A;  2C6W B;  3CMZ A;  1YQS A;  2ZC6 B;  4X69 A;  3SOI A;  5A91 A;  4NET A;  2WKE A;  2ZQA A;  2G2U A;  3A3J A;  3EQV A;  1OME A;  4H8R A;  3HLG A;  3Q82 A;  2XD5 A;  4ZTK A;  4EV4 A;  3S4X A;  2WK0 A;  1L0D A;  3A3F A;  5DVA A;  4OLG A;  4MLL A;  3CZD A;  4ZJ1 A;  4OOY A;  3N8L A;  4QHC A;  2A49 A;  1RGZ A;  4LV0 A;  1K6R A;  3GRJ A;  1XP4 A;  4MBH A;  1FR1 A;  3NDG A;  3V3S A;  3O86 A;  4GB7 A;  5CEC A;  3GSG A;  3IQA A;  4X53 A;  4IBR A;  3V50 A;  3W8K A;  4DE0 A;  1PWG A;  1G68 A;  5F1F A;  1FSY A;  1ESU A;  2ZJ9 A;  2ZQ8 A;  1JWP A;  1L0G A;  1K54 A;  3GTC A;  4B88 A;  3MZF A;  3ITA A;  3BEB A;  1IYO A;  1K57 A;  2P9V B;  4OVD A;  4PM5 A;  5AQ9 A;  1KDW A;  4WM9 A;  1IKG A;  2P9V A;  1VM1 A;  3IT9 A;  2WUQ A;  4HBU A;  1VQQ A;  2DNS A;  1NZU A;  1QMF A;  4FH4 A;  5E2E A;  3Q1F A;  5FQJ A;  5G18 A;  1XGJ A;  5EVI A;  5HAI A;  2Y2L A;  1LL9 A;  4WZ4 A;  4RA7 A;  3BFG A;  5HFO A;  5IHV A;  4ID4 A;  3Q07 A;  1ESI A;  2WAD A;  2X02 A;  1ERM A;  4OOM A;  5M1A A;  1YLJ A;  3IF5 A;  1MWR A;  2J9O A;  5FI6 A;  1TDL A;  3QHY A;  2XD1 A;  1LHY A;  2CC1 A;  4GDB A;  4KZ4 A;  4OLD A;  2ZC5 B;  3HLD A;  3ZG7 B;  4QJG A;  1K57 C;  4HEF A;  4QB8 A;  1JVJ A;  3BRM A;  2J9P A;  4LV3 A;  5L2F A;  1J9M A;  3A3D A;  4R3J A;  5DTS A;  1W79 A;  5KSC A;  3TOI A;  4Y0T A;  2XGN A;  1YT4 A;  1KGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...