1BLCA

Inhibition of beta-lactamase by clavulanate: trapped intermediates in cryocrystallographic studies
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Inhibition of beta-lactamase by clavulanate. Trapped intermediates in cryocrystallographic studies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(acting in cyclic amides)
total genus 95
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1993-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1blcA00
1L0EA 1YLTA 4FD8A 1XXMA 1LI0A 1LLBA 1LL9A 1XX2A 1TDGA 4R3BA 3S1YA 2OLUA 3EQVA 5FQQA 2Q9MA 5CEDA 2XD1A 1CI9A 4OOLA 1CEFA 4RVAA 1XGIA 4X69A 2HP5A 4OP5A 2EFUA 1FCNA 2G2WA 2HP6A 2P9VA 3BFFA 1NZOA 3O86A 4KZ9A 4QD4A 1L2SA 3IXGA 4R3JA 2FFFB 3N8LA 1SHVA 4LCMA 4GDBA 4FH4A 5EVIC 3VFFA 3IF6B 4GDNA 4QB8A 4E3JA 5FI6A 1AXBA 4DXBA 5JYOA 3NIAA 5GLCA 3UDIA 1PI4A 3TG9A 4C75A 3G2ZA 1W8YA 1JTDA 3HBRA 3Q82A 1IYOA 3BECA 5GHXA 3WS0A 1K4EA 2R9XA 4R0QA 4Q8IA 3PBSA 3UO9A 5J8XA 3QHYA 5GHYA 4KQOA 2Y2IA 2ZQ9A 1Z6FA 3MFDA 4M3KA 2ZQ7A 1HVBA 5HFOA 1BULA 4WMCD 1GCEA 5F82A 4X53A 1SCWA 3IXBA 4GZBA 3RJUA 3VMAA 3C7VA 4OQHA 5FQIA 2BLSA 2DCFA 3VOYA 5DF8A 4H8RA 3NY4A 3ZG7B 5DF9A 3BFEA 3FKWA 1I2SA 2Y2LA 1FR1A 1KGEA 5CGWA 5M1AA 5FDHA 2BG1A 3G34A 3HUMA 4JXWA 2ZQAA 3OC2A 1QMFA 5D3OA 4A5RA 4GOGA 2Y2NA 4GN2A 4E3OA 3A3IA 1IEMA 3ZHHA 2XDMA 4RYEA 3QNBA 2JBFA 4P87A 5EVIB 3O87A 4BD0A 3LO7A 1IELA 4R23A 1S0WA 3MKEA 1N4OA 4FH2A 2H0YA 1NY0A 3VP3A 1K38A 5CGSA 3V3SA 1J9MA 5FATA 3M2JA 3OPRA 5GL9A 1ERMA 1NYYA 3IQAA 4JF6A 2IWDA 3OPHA 1SDEA 4YFMA 4FSFA 4X68A 4BENA 5TFQA 5HARA 3Q81A 2CC1A 3FKVA 1K57A 4NETA 3C4OA 1W8QA 3NDGA 5U47A 4PM9A 3SS4A 3AGDA 5CEBA 4B4ZA 3UE3A 4P0MA 1YLYA 2Y4AA 5AQ7A 2J7VA 3HLWA 4GKUA 5FASA 3VSKA 4BJPA 3HVFA 1KGGA 5F1GA 5GHZA 4KG5A 4S2LA 4C6YA 5GLAA 4YINA 5GLBA 5EPHA 5HAPA 4WEJA 1ES4A 2C6WB 2WGWA 1XKZA 3IHBA 4JF5A 5KSHA 2Y2QA 4OPQA 5HAIA 3UNWA 3BRMA 1XA7A 2JC7A 5F1FA 4BLMA 3HLCA 3LY3A 2HDQA 2FFYA 1K57C 1GHPA 4LV2A 2XFTA 4ZTKA 2HPBA 3GSGA 3BEBA 1KE3A 4Y0TA 4LV3A 5KSCA 3NBLA 3N6IA 3BFCA 1E3UA 3G32A 5FA7A 4XXRA 5E2FA 5AQ9A 4EUZA 4IVKA 2V2FF 1K25A 3ZG8B 2Z2LB 1PWDA 2ZM8A 1DJCA 4UA6A 4LV1A 1XP4A 3N8SA 5EVLA 2H0TA 3ZG9B 2A3UA 4WEKA 3VP1A 4OQ0A 1PZPA 1PW1A 1Q2PA 3G2YA 2Y2PA 4IEDA 1CK3A 3M2KA 5HX9A 3ZVWA 3UPNA 2QPNA 4OOMA 1FSWA 5FSRA 2ZM2A 3N7WA 4BL3A 4QY6A 5A91A 3E2KA 3IWOA 3M6BA 3ZFZA 1XA1A 1N9BA 4PMAA 4PM7A 1KE4A 4MLLA 1FQGA 2JCHA 3DW0A 3G31A 2VGJA 3OCLA 2EX8A 4JLFA 3GTCA 4LV0A 4IBXA 4E3NA 4QJGA 3G35A 1S6RA 3TSGA 2HDRA 1M6KA 3TOIA 2QZ6A 1ESIA 5HW3A 3PBRA 1K55A 2Q9NA 3VP0A 4JPMA 4KQRA 4Y0OA 3WRZA 4E6WA 4R1GA 5I94A 4PM8A 5AQAA 1SDNA 2XD5A 2Y2KA 4R4RA 2PBYA 1K6SA 2Y2OA 4QY5A 1YLPA 5TR7A 3M6HA 1ALQA 4S2IA 1MKIA 4E3IA 3GR2A 3UDXA 2E8IA 1GA0A 2X01A 4CJNA 4R4SA 5FQKA 2C5WB 1FSYA 1MY8A 4KZ6A 4UAAA 1HZOA 3C4PA 2P74A 2ZC4B 1JVJA 1MWUA 3SH9A 5DF7A 1MXOA 2WGWB 4WYYA 1SKFA 1PWCA 3FV7A 3AGEA 1HTZA 4WM9A 2H10A 2OLVA 3FYZA 4OQIA 1K55C 4S2NA 1I5QA 5E2GA 3IWQA 3VOZA 1WE4A 4OQGA 4GNUA 3O3VA 4FCFA 2R9WA 2XEPA 1VM1A 4RX2A 2GDNA 2Y2MA 3Q7ZA 1OMEA 1L0FA 3ZDJA 4HBUA 5A92A 2IWBA 5EECA 2WZXA 3S22A 5DTKA 5HAQA 2WKHA 2XR0A 2Y55A 3A3JA 3OZHA 5A93A 4E3LA 3CG5A 4RX3A 4DE1A 1JWVA 3VP4A 2WAFA 3ZGAB 5EVID 3PAGA 3A3EA 4K0XA 4WBGA 3HUNA 1EROA 3EQUA 4ID4A 1Y54A 4ZBEA 4E3MA 1K56D 1G6AA 3PBNA 4S2NC 3ZG0A 1YLZA 2XQZA 3C7UA 3MXSA 3MZFA 5DTSA 3PAEA 1MPLA 4HBTA 1DY6A 3IXHA 4ZJ3A 5CHJA 3IXDA 1KE0A 2XFSA 3GVBA 3E2LA 5FAQA 3BM6A 4S2JA 3SH7A 3VFHA 1KVLA 2RCXA 2X71A 3WS1A 4OPRA 3V50A 2WYXA 1YMXA 3SH8A 2ZC7A 1BUEA 4OP8A 5E43A 1E25A 3A3FA 1QMEA 5GLDA 2UWXA 2WAEA 4E6XA 4KENB 2WZZA 4MNRA 4GD8A 1K4FA 4QHCA 4KZBA 1PWGA 3IH8A 1ZKJA 3O88A 2DRWA 1YM1A 1PW8A 2RL3A 3SS5A 3JYIA 3PBOA 1WYCA 1IYQA 1ZC2A 1L0DA 2ZJ9A 1RP5A 2XGNA 1MWTA 1PZOA 2ZD8A 5KZHA 1FR6A 2ZQCA 5FQMA 1H8ZA 1E4DA 1MWRA 1BTLA 1PYYA 4LENA 1W79A 2J8YA 2ZC6B 3ITBA 4BD1A 4CPKA 4HEFA 1ES3A 4D2OA 4WMCA 3LEZA 2HDUA 2WK0A 2J9PA 4ZJ2A 2Y2GA 4N9KA 4RA7A 2VGKA 3ISGA 1XGJA 4QU3A 3Q7VA 2EXBA 1LL5A 3Q07A 4WZ5A 1K54A 4OPZA 1YT4A 4Y7PA 4ZAMA 5EOEA 5CTMA 2Z2MB 1MBLA 2WUQA 2ZMAA 3OPLA 4KG2A 4DE0A 3WS4A 5CRFA 1NRFA 1TEMA 2ZQDA 1RGZA 3D4FA 4N1XA 5A90A 1FOFA 1EWZA 1JTGA 4DE3A 3NC8A 4JXGA 1DJAA 4PPRA 3HREA 1IYPA 5E2HA 2WADA 5TGFA 4B88A 2ZC3B 3HLDA 3OPPA 3UPPA 1BT5A 2DNSA 2EX6A 3LY4A 3N4IA 4HESA 3UY6A 3WRTA 4XUZA 2ZM0A 3W4OA 5FI7A 3WS5A 4OLDA 3NI9A 4GD6A 1GHIA 5CGXA 4E3KA 1BSGA 2PU4A 2ZQ8A 5CHUA 4JF4A 4WZ5C 1K54C 3OCNA 1ESUA 1YQSA 2EXAA 4Y0UA 5KMWA 1IKGA 3MKFA 3BLMA 1NJ4A 4KQQA 5FAOA 1LI9A 3C5AA 3BYDA 3DWKA 1O7EA 3Q1FA 1MWSA 4UHUA 2OSUA 2ZC5B 2HP9A 4JXVA 3HLBA 4KZ8A 5FAPA 3IHAA 3GMWA 1KDWA 3IWIA 3VSLA 3CJMA 2OV5A 5HL1A 3V39A 2EFXA 4KZ3A 4WELA 1H8YA 2XH9A 3MZDA 4P85A 2JE5A 3V3RA 3ZG5A 1ZG6A 3CZDA 3NCKA 1NZUA 4MBHA 4DKIA 4N1HA 1ES2A 1IKIA 1ES5A 3V5MA 1XPBA 1YMSA 2Y91A 1TDLA 2Y2HA 1LHYA 3ZNTA 4MEZA 4U0TA 4DDYA 4N9LA 4OKPA 3W4QA 3ZCZA 1RGYA 2Y59A 4C3QA 4BQMA 4OPYA 1HD8A 2B5RA 4N92A 1YLWA 3W8KA 1ZG4A 3P98A 3UDFA 4X56A 2EX2A 4B4XA 1BLPA 4DXCA 2EX9A 4OH0A 1BLSA 1E3UD 4OLGA 4S2KA 5CECA 4GB7A 1FCMA 5FI2A 4PM6A 3Q7VB 5FQ9A 3G4PA 4XUXA 1JWZA 3QNCA 3CMZA 1H5XA 5EUAA 1FCOA 3IT9A 3ZNYA 5EOOA 1W7FA 3WWXA 4MBKA 3RXXA 1NXYA 3DTMA 1ONGA 3S4XA 2WKEA 4JXSA 5AQBA 3HUOA 4JKTA 3FWLA 5F83A 4ZJ1A 5FQJA 3WS2A 4P6BA 1WYBA 1YLJA 1DJBA 1C3BA 1IYSA 1K6RA 2H5SA 4KG6A 3RXWA 4EWFA 4WZ4A 1ERQA 2ZLYA 4BL2A 1PI5A 4F94A 5M19A 2XK1A 3IF5A 3N8RA 4OVDA 3FZCA 4EBPA 1I2WA 4X6TA 5CXWA 1GHMA 4DRTA 1KGFA 4KZ7A 3UPOA 3BFDA 1VQQA 3G30A 2I72A 3B3XA 3PBQA 1BLCA 1G68A 3W4PA 2XLNA 4U3TA 3IF6A 3IH9A 1M40A 1BLHA 4OONA 4EBNA 2G2UA 4K0WA 3DWZA 4DE2A 2V20A 3PTEA 1TVFA 4PM5A 3HL9A 4JBFA 4OOYA 4Z9QA 5L2FA 2P9VB 3BLSA 4IBRA 3SS3A 5BOHA 4L0LA 4S2PA 4UA9A 5CTNA 3VP2A 4ZDXA 1W5DA 2WGIA 3GRJA 3AGFA 1RCJA 4KZAA 2J9OA 2A49A 3GV9A 1CEGA 4S2OA 1BZAA 3ITAA 3HLEA 3MXRA 2XF3A 3SOIA 4DF6A 3BFGA 4S2MA 3IF6C 3MZEA 3MBZA 1KDSA 3P09A 4EQIA 4UA7A 1JWPA 5CERA 4KZ5A 5JYPA 3HLFA 4NK3A 1O07A 2QMIA 3UE1A 3UN7A 5G18A 1KVMA 4EBLA 1NYMA 2V1ZA 3LCEA 4O7DA 5DVAA 1Q2QA 1ONHA 4X55A 4DDSA 2PU2A 3HLGA 1PIOA 4U0XA 2IWCA 3ZVTA 1GA9A 2WKIA 4KZ4A 5EE8A 2HDSA 4MBFA 3A3DA 3GQZA 4K91A 4EV4A 1U60A 5EVIA 3NDEA 2Y2JA 5E2EA 1CI8A 3UE0A 5M18A 2WGVA 3PBTA 5DTTA 2X02A 4LCLA 5IHVA 1L0GA 4IVIA 1K56A 5CHMA 3I7JA 1EI5A
chains in the Genus database with same CATH superfamily
1XXMA 3SZTA 4GHIB 1TDGA 3TRCA 1JNUA 2A24B 2PT7A 3T1QB 4EUVA 2HP6A 2PDRA 2EWVA 5FL3A 1L2SA 1SHVA 5EVIC 1BYWA 5JYOA 3NIAA 3UDIA 2ZL1A 3TG9A 4C75A 2JN7A 3Q82A 2P7JA 5GHXA 1K4EA 5GHYA 2Y2IA 2J3TD 2ZQ9A 3MFDA 4M4XA 5HFOA 2ZOIA 5EV0A 4X53A 1SCWA 3IXBA 3RJUA 3VMAA 2BLSA 3VOYA 5DF8A 3NY4A 1TS6A 5FDSA 5DF9A 3FKWA 1KGEA 2BG1A 4JXWA 4A5RA 2Y2NA 3MS6A 4I3JA 3GECA 4GCZA 4R23A 1S0WA 2H0YA 1NY0A 1ACFA 3S7QA 3VP3A 5CGSA 1NRJA 1ERMA 4JF6A 1HLUP 4YNRA 5DFYA 1VETB 1K57A 1FIKA 4MMNA 1LSVA 4MN5A 4PM9A 4B4ZA 4P0MA 5HSQA 1YLYA 4G3WA 5AQ7A 2V8CA 4GKUA 4BJPA 1KGGA 5F1GA 4KG5A 1X0OA 5EPHA 5HAPA 5EM1A 4WEJA 1ES4A 2WGWA 5HAIA 1OT6A 3UMEA 3HLCA 2HPBA 2Z6DA 3BEBA 3T1XA 2VLGA 2QWSA 4H6JB 5AQ9A 2W27A 4EUZA 4UA6A 3N8SA 5EVLA 3ZG9B 1ODVA 3VP1A 2OAP1 4IEDA 3QP8A 1CK3A 3M2KA 5HX9A 3ZVWA 5FSRA 4QY6A 4PKYG 3ZFZA 3CUEC 4R3AA 2JCHA 3DW0A 2VGJA 4QPRA 3GTCA 3TOIA 5HW3A 3BJNA 3VP0A 4JPMA 4Y0OA 4HP4A 4E6WA 1SDNA 2XD5A 4ARZA 3OLOA 2Y2OA 1YLPA 2KOIA 4S2IA 1IFQA 4R4SA 4LGWA 5FQKA 4KZ6A 1FSYA 4DN0A 1HZOA 1CF0A 2P74A 2ZC4B 1MWUA 3K3DA 5EFWA 3FYZA 4S2NA 3UB8A 1I5QA 4OQGA 3O3VA 4RX2A 1XJ2A 1L0FA 3ZDJA 3IX4A 3LIBA 1F98A 5EECA 2WZXA 3KX0X 5HWTA 5HAQA 5HDCA 3OZHA 3UMDA 5A93A 4DE1A 3VP4A 2WAFA 1DP9A 2K2NA 4K0XA 3A3EA 4WBGA 5IU1A 3B42A 1EROA 1K56D 1YLZA 2XQZA 3C7UA 5DTSA 4HBTA 3IXHA 4R38A 4LFUA 2X71A 4OPRA 2WKPA 2WYXA 1YMXA 1P0ZA 3VOLA 3NOPC 4E6XA 2QJ7A 4QHCA 1G28A 1YM1A 1V9YA 4X1LA 5J7EA 3JYIA 1WYCA 1IYQA 3UE6A 2ZQCA 1H8ZA 1BTLA 1PYYA 1W79A 3ITBA 2ZC6B 5HWVA 4BD1A 4CPKA 4D2OA 2HDUA 2WK0A 5TBMA 2J9PA 4ZJ2A 4WLAA 3Q7VA 5G4YA 4WZ5A 4OPZA 3H9WA 1MBLA 3MXQA 4DE0A 1Y4OA 1NRFA 1FOFA 3NC8A 4JXGA 1DJAA 3T4TA 5C5KA 4ETZA 1S4SA 1IYPA 5TGFA 2WADA 3UPPA 2ZM0A 3WS5A 4KUOA 4Y3IA 3NI9A 3B47A 1GHIA 5CGXA 4E3KA 1BSGA 4HJ3A 2JKFA 1T18A 1XJ6A 1YQSA 3OCNA 1UGUA 2HJEA 3QP5A 1YAXA 1O7EA 4RQ9A 2VEAA 4R70A 2YKHA 4NXFA 4JXVA 4KZ8A 3IBRA 2GNXA 4UQIS 3GMWA 1S66L 4ME4A 4EW7A 5HL1A 2OV5A 1L3LA 4EXOA 3V3RA 4DKIA 4MBHA 1XPBA 1TDLA 2Y2HA 4MEZA 4U0TA 4JGRA 4DDYA 4N9LA 1OTDA 4N92A 1BLPA 4Y17A 4OH0A 1E3UD 2L4RA 3JPUA 5FQ9A 4XUXA 1JWZA 2Q0OA 3QNCA 3R7WB 3ULFA 3ZNYA 5AVEA 2H28A 1W7FA 1TS8A 3WWXA 3BW6A 3RXXA 1SKOB 1ONGA 3DTMA 2QJ5A 2WKEA 4JXSA 4JKTA 3FG8A 2EA9A 5J4EA 1YLJA 1C3BA 4HJ6A 4KG6A 4EWFA 2A24A 2IA2A 4F94A 5FEGA 4EBPA 3A0RA 4X6TA 1KGFA 4YWZA 3B3XA 2PD8A 4EBNA 3HJIA 3DWZA 1VEUB 4PM5A 4Z9QA 4JBFA 4OOYA 2P9VB 3BLSA 4LRXC 4UA9A 1W5DA 2WGIA 4CLCA 4S2OA 4L9EA 3SOIA 2O9CA 3IF6C 4UA7A 4NKPA 5JYPA 3HLFA 2QMIA 3UE1A 3NECA 3MQQA 5L07A 4UQIM 1NYMA 5DVAA 3LCEA 3UB7A 4X55A 1PIOA 2J80A 2IWCA 3F1NB 2FZ0A 4KZ4A 4EV4A 5M18A 3NDEA 2Y2JA 3MMHA 2X02A 3BQ8A 1K56A 5CHMA 3CAXA 1OT9A 3LIEA 1LL9A 1XX2A 3EQVA 5CEDA 2Q9MA 4OOLA 1CEFA 3CWFA 1XGIA 2HP5A 2W3DA 3L7HA 4QD4A 3IXGA 2FFFB 3N8LA 3VFFA 4GDNA 4E3JA 1AXBA 5EVEA 5GLCA 1PI4A 2O9BA 3KYQA 1OTAA 1JTDA 1AWIA 1IYOA 1GSXA 4R0QA 3PBSA 5J8XA 1TF1A 1Z6FA 4MDZA 2ZQ7A 1HVBA 2Y8HA 1BULA 4H6JA 5F82A 5FQIA 4JGOA 1YPRA 2BASA 3BFEA 1I2SA 2LB5A 4BMWA 1QMFA 5D3OA 4GOGA 2OOLA 4E3OA 3A3IA 1IEMA 2XDMA 4P87A 5EVIB 3TE8A 1GSWA 3TW8A 3MKEA 4FH2A 2JHEA 4Y15A 1NYYA 3OPHA 1P9RA 4FSFA 4BENA 1D7EA 2CC1A 3FKVA 4NETA 3C4OA 3LIAA 1SZVA 3SS4A 5CEBA 1TS7A 3T4QA 5J3WA 3S7PA 4NG2A 1J3WA 4UEYA 4FUWA 3MQOA 1XA7A 3A0SA 2HDQA 2FFYA 3NJAA 2ZOHA 1T1CA 3BY8A 2LB9A 4BWIA 2VZWA 4Y0TA 4LV3A 3NBLA 3BFCA 1E3UA 2NUTC 3G32A 2V2FF 1K25A 3ZG8B 1PWDA 2W3EA 2O9AA 2H0TA 5DJUA 4WEKA 1S67L 1PZPA 2VV7A 3G2YA 3NHQA 2Y2PA 5F6AA 3UPNA 2QHKA 4IUHA 2W1TA 3IWOA 3BY9A 5A91A 5HPIA 1N9BA 4PMAA 3FC7A 4DMZA 1FQGA 3G31A 4E3NA 2JKTI 4QJGA 3TSGA 1DRMA 2QZ6A 3QP1A 4HY8A 3PBRA 1K55A 3EEHA 2KLIA 3P01A 4PM8A 5AQAA 4R4RA 1NLYA 2GJ3A 4QY5A 3HJKA 3UB9A 3M6HA 4GS9B 2W3FA 1ALQA 1MKIA 3F1OB 2C5WB 4UAAA 3FPVA 4HP9A 1JVJA 3SH9A 1PNEA 1PWCA 3AGEA 4G3VA 1HTZA 4Q0HA 4OQIA 5E2GA 3VOZA 1MKMA 1VM1A 2GDNA 4ZRRA 4K08A 3S22A 2XR0A 2Y55A 3CG5A 2UV0E 5EVID 1DP6A 1Y54A 1OTIA 3ZG0A 1STZA 3G6OA 3MZFA 1MPLA 5CHJA 1WA9A 5FAQA 3E2LA 4S2JA 1CQAA 3VFHA 4Y13A 2RCXA 5LBRA 4BBTA 3WS1A 1E25A 3A3FA 5GLDA 2WAEA 2WZZA 4GD8A 4KZBA 1A0KA 1PW8A 4GJ4A 4MN6A 1L0DA 4JGQA 2V0UA 2ZJ9A 2XGNA 1MWTA 5KZHA 4EEPA 4IJGA 3P7NA 2J8YA 1ES3A 2QKPA 3KSHA 2Y2GA 1OPXA 1XGJA 2WKQA 4IHQA 3R7WA 3GDIA 2OAQ1 4ZAMA 2PYRA 2Z2MB 2WUQA 2JKGA 2P08A 3NOUC 3D4FA 2ZBBA 1EWZA 1JTGA 4DE3A 4PPRA 5E2HA 4NXGA 1BT5A 2EX6A 3LY4A 3WRTA 4XUZA 2ACGA 3W4OA 5FI7A 2KX6A 2PR6A 5DFXA 5CHUA 2XA7S 1K54C 1ESUA 1IKGA 3MKFA 1NJ4A 5FAOA 3C5AA 3BYDA 1VEUA 3Q1FA 2HP9A 3HLBA 4Y5FA 3MF0A 3OBFA 3IWIA 3LUQA 1LSWA 4HOIA 4B93A 3V39A 4WELA 1H8YA 3ZG5A 4LPZA 3VV4A 1ES2A 1IKIA 3V5MA 2I9VA 4O8GA 1UWPX 3ZCZA 3W4QA 1RGYA 3H82B 4C3QA 4BQMA 2OWJA 3ICYA 5HDSA 2B5RA 3KYEA 3UDFA 4DXCA 2EX2A 3F1NA 3QP2A 2PRFA 1FCMA 5FI2A 4PM6A 3ZYTA 1H5XA 3H7WA 1MZUA 4MBKA 3LI9A 2V8FA 3S4XA 5AQBA 4HH3A 1DJBA 3RXWA 1K6RA 3U2AA 1PI5A 2V9AA 3IF5A 3PXPA 2PBDP 5CXWA 4KZ7A 3PBQA 2JKRI 4U3TA 1S1YA 3C30A 5DJTA 1M40A 1BLHA 2K7SA 2B02A 4K0WA 2V20A 4PKYA 3LEQA 1TVFA 5L2FA 4IBRA 3SS3A 4L0LA 2Z6CA 1FILA 3GRJA 3AGFA 1RCJA 2M1CA 2J9OA 3LFVA 2XA7M 2BTFP 4S2MA 2VX8A 1JWPA 1LT0A 4NK3A 1O07A 4EBLA 4O7DA 4WF0A 2PU2A 3HLGA 1GA9A 3T12B 2WKIA 5K5BA 4MBFA 3GQZA 5EVIA 5E2EA 2GZAA 4IVIA 2G7UA 3V67A 1EI5A 1L0EA 1YLTA 4FD8A 4L9FA 3S1YA 2XD1A 4RVAA 4X69A 1TD5A 3CPTA 2G2WA 3BFFA 1NZOA 3MFXA 3O86A 4R3JA 4LCMA 4FH4A 2J3WA 3IF6B 4QB8A 3HCYA 5FI6A 4DXBA 2B18A 3G2ZA 4Q8IA 2PD7A 3UO9A 1F9IA 3QHYA 3CITA 4KQOA 1T19A 4NEED 2W3GA 3DTKA 1GCEA 4EEUA 4GZBA 3C7VA 4OQHA 2L0WA 4H8RA 2XSSA 3ZQ5A 1FR1A 5M1AA 3E0YA 5FDHA 3RH8B 3G34A 3HUMA 4GHIA 4GN2A 3QNBA 2JBFA 4EERA 4BD0A 3LO7A 3F1PB 1K38A 1PFLA 3V3SA 1J9MA 5FATA 4FTXA 3OPRA 5GL9A 4HIAA 4F3LB 3IQAA 3IS2B 3C8CA 4YFMA 2HGVA 4X68A 5TFQA 5HARA 3Q81A 1W8QA 5U47A 3AGDA 3UE3A 4GS9A 1NLZA 1ZHHB 3F1OA 1KOUA 5FASA 5GHZA 4S2LA 5GLBA 3JVUA 4HJ4A 2C6WB 3IHBA 5F5YA 1XKZA 4JF5A 4YOFA 3UNWA 3BRMA 1XFNA 2W0NA 1YKDA 2JC7A 2EWWA 2V1AA 4BLMA 1D06A 3LY3A 1K57C 1GHPA 2XFTA 3CUEA 1KE3A 5KSCA 3UB6A 3N6IA 5FA7A 5E2FA 1N9NA 4LV1A 2PYPA 4WUJA 4OQ0A 1W63M 1PW1A 1Q2PA 1MC0A 3CLOA 3QP6A 4BL3A 1FSWA 3N7WA 1VETA 3E2KA 1K0KA 1KE4A 4LV0A 4IBXA 3G35A 1ESIA 5HL6A 1F5MA 4KQRA 5I94A 4DJ3A 4NXEA 1GSVA 2PBYA 1K6SA 3C38A 2PAVP 4E3IA 3GR2A 3UDXA 2E8JA 1W63Q 2E8IA 2X01A 4CJNA 4EU0A 3C4PA 5DF7A 4WYYA 4WM9A 2D02A 4I3IA 2H10A 3IWQA 5HPFA 4GNUA 4FCFA 2R9WA 1N9OA 5A92A 2YKFA 2IWBA 5DTKA 1H0MA 1IOUA 3S7OA 5TBMB 1H8MA 1LSXA 3ZGAB 4LLOB 3HUNA 2V1BA 4AFIA 4S2NC 1G6AA 3MXSA 4EQ1A 3PAEA 1DY6A 2V0WA 4ZJ3A 3IXDA 1KE0A 3BM6A 2PR5A 3SH8A 2ZC7A 4OP8A 5E43A 2UWXA 4MNRA 1K4FA 5IT5A 3IH8A 1NWZA 5HD5A 3O88A 3LI8A 2DRWA 2W1RA 3SS5A 3PBOA 1RP5A 4PAUA 4KQDA 1FR6A 3MJQA 5CX7A 1E4DA 1MWRA 3H82A 4R6LA 3MR0A 1F2KA 4HEFA 3EWKA 4I38A 3EGDC 3DAVA 4Y7PA 4WN5A 5CTMA 2ZMAA 4KG2A 3WS4A 2ZQDA 1RGZA 4N1XA 5A90A 3HREA 2J3TC 2VV8A 3R4KA 3KO6A 3JVVA 3OPPA 2DNSA 4II7A 1S4RA 2QYBA 4GD6A 5DKKA 2K31A 4WZ5C 2EXAA 3BLMA 3DWKA 1MWSA 2OSUA 2ZC5B 5FAPA 3IHAA 1KDWA 3VSLA 3CJMA 4DJ2A 1EW0A 2P04A 4P85A 2JE5A 1ZG6A 3NCKA 3DTEA 3T4OA 1D1JA 2HZ5A 2L1MA 4CLCE 1LHYA 4LRZE 4OKPA 2Y59A 4CLCB 1YLWA 3W8KA 1ZG4A 4WL9A 4X56A 4B4XA 1BLSA 3O5YA 3G4PA 3CMZA 5EUAA 1FCOA 3IT9A 1YSQA 4MCWA 4X1MA 1NXYA 3HUOA 5FQJA 1OTEA 4P6BA 2H5SA 4BL2A 2XK1A 4OVDA 3FZCA 1I2WA 1Z09A 4DRTA 1GHMA 3UPOA 2I72A 4E04A 1ZTUA 3UB5P 1G68A 3W4PA 2XLNA 3IF6A 3IH9A 4OONA 3IX3A 2G2UA 3LGOA 5L09A 3MQ0A 3HL9A 2W3HA 3T1RA 3S7NA 1V9ZA 1UWNX 4KZAA 2JKTM 3LR0A 5A8BA 3GV9A 1OJGA 1BZAA 4GW9A 3HLEA 2VK3A 4D60A 3MBZA 5CERA 4KZ5A 3UN7A 4HHDA 2V1ZA 3LR4A 1Q2QA 1ONHA 4DDSA 1SKOA 3PR6A 5EE8A 2HDSA 3A3DA 3EGXC 1CI8A 3UE0A 4CLCC 2WGVA 3F1PA 5DTTA 4LCLA 4XT2B 3LR5A 1T1AA 5MC7A 3I7JA 5FQMA 4F3LA 5F69A 3OOVA 3IS2A 1LI0A 1LLBA 4I5SA 4R3BA 2OLUA 5FQQA 3EEAA 1CI9A 4I3AA 4OP5A 3MSHA 2EFUA 1FCNA 2PHYA 4P6ZS 2P9VA 4KZ9A 4L9GA 5I5LA 4GDBA 5TJJA 3LR3A 1S1ZA 2MJ6A 2XRNA 1LL8A 1XFQA 1W8YA 3HBRA 3BECA 3WS0A 2R9XA 5F68A 4M3KA 4CLCD 4GLQA 1YSPA 4WMCD 4EETB 3LYXA 2DCFA 2FH5A 3ZG7B 5CGWA 2Y2LA 3NULA 2ZQAA 3OC2A 3T4SA 3VE4A 3ZHHA 4RYEA 3O87A 2M7VA 4IUKA 1IELA 1N4OA 2ZMFA 3M2JA 2IWDA 1SDEA 3BWLA 2W1TB 3NDGA 1XJ3A 2Y4AA 2J7VA 3HLWA 3VSKA 3HVFA 4C6YA 5GLAA 4EESA 4YINA 4LRYC 4PHTA 5KSHA 1N9LA 2Y2QA 4OPQA 2ZL1B 3A0VA 5F1FA 2M7UA 4P6ZM 4LV2A 4ZTKA 3GSGA 4XXRA 4IVKA 2VGLS 2Z2LB 2ZM8A 1DJCA 3T50A 1XP4A 1CJFA 1OJ5A 2A3UA 3VE3A 1P97A 2QPNA 4OOMA 2O0YA 2ZM2A 4HNBA 3PYPA 3M6BA 2D01A 3E4QA 1XA1A 4PM7A 3EOIA 4MLLA 3OCLA 2EX8A 4JLFA 1VB6A 1S6RA 2HDRA 1M6KA 3CHWP 2NUPC 2Q9NA 3WRZA 3KSFA 4R1GA 3LIFA 2Y2KA 3E98A 3U4LP 5TR7A 5HZHA 1GA0A 1MY8A 2KDKA 1MXOA 2WGWB 4ETXA 1SKFA 3FV7A 2JKRM 3D9YA 3PHYA 2OLVA 1K55C 2HV1A 1WE4A 2O99A 4NXBA 3IBJA 3RTYA 1G6OA 2XEPA 2HF6A 2Y2MA 3Q7ZA 1OMEA 4HBUA 2WKHA 2VJWA 3A3JA 1XJ4A 3BQAA 5IS1A 4E3LA 4RX3A 1JWVA 4BBVA 3E4PA 3DBAA 5L10A 3PAGA 1P9WA 3EQUA 4ID4A 4JGPA 4ZBEA 4E3MA 3PBNA 3SW1A 4I39A 1T1BA 2XFSA 3GVBA 3SH7A 1KVLA 2B95A 3CI6A 2VGLM 4ESPA 3V50A 2XROA 1BUEA 1QMEA 3W2ZA 2OWHA 5HWWA 4KENB 3D3OA 1PWGA 4ARZB 3C2WA 4Q0JA 1ZKJA 1VHMA 2RL3A 1ZC2A 4HQAA 1PZOA 2ZD8A 4G3KA 4LENA 4HH2A 3TJZC 4WMCA 3LEZA 3QP4A 3LIDA 5HDDA 4N9KA 4RA7A 2VGKA 3ISGA 4QU3A 2EXBA 1LL5A 3Q07A 2DMWA 1K54A 3IX8A 1YT4A 5EOEA 3OPLA 5CRFA 1TEMA 4BBUA 5AJGA 2AVXA 4B88A 2ZC3B 3HLDA 4HESA 3N4IA 3UY6A 3H7WB 4OLDA 3T4JA 4B9OA 5G4ZA 2PU4A 2ZQ8A 1OTBA 4JF4A 2Y79A 5EM0A 4Y0UA 5KMWA 4KQQA 1LI9A 3KSIA 4UHUA 3K3CA 2CMNA 4O01A 2EFXA 4KZ3A 3FPWA 2XH9A 3MZDA 3CZDA 4CQHA 1NZUA 4N1HA 1ES5A 1YMSA 2Y91A 2HJ9C 3D72A 4MN7A 5KIZA 3ZNTA 3K2NA 4KUKA 4OPYA 1HD8A 2WKRA 3KSGA 2VA0A 3P98A 3E4OA 2EX9A 5L8MA 1G5UA 4OLGA 4S2KA 5CECA 4GB7A 3NOTC 3Q7VB 5DKLA 4O0PA 4XT2A 5EOOA 5F83A 3FWLA 4ZJ1A 3WS2A 1WYBA 3B33A 1IYSA 1DP8A 5AVFA 4WZ4A 1ERQA 4Y2FA 2ZLYA 5M19A 3N8RA 4Z1WA 3RFBA 3BFDA 1VQQA 3G30A 3KYZA 1BLCA 2GX5A 4DE2A 3PTEA 3CPTB 2VV6A 5BOHA 4S2PA 5CTNA 3VP2A 4ZDXA 1TS0A 4HI4A 4FOFA 2A49A 2INWA 3T4KA 1CEGA 1H3QA 3ITAA 3MXRA 2XF3A 2A2LA 4DF6A 3BFGA 2VKSA 3MZEA 3L9KA 1KDSA 3P09A 4EQIA 5G18A 5FEFA 3LICA 1KVMA 3T4LA 4X25A 4Q0IA 4U0XA 3ZVTA 4K91A 3DTIA 1U60A 1PRQA 2R78A 3PBTA 1Y28A 5IHVA 1L0GA 4QWOA 5HD3A 2ZMVA 3T1SA
chains in the Genus database with same CATH topology
1L0EA 1YLTA 4FD8A 1XXMA 1LI0A 1LLBA 1LL9A 1XX2A 1TDGA 4R3BA 3S1YA 2OLUA 3EQVA 5FQQA 2Q9MA 5CEDA 2XD1A 1CI9A 4OOLA 1CEFA 4RVAA 1XGIA 4X69A 2HP5A 4OP5A 2EFUA 1FCNA 2G2WA 2HP6A 2P9VA 3BFFA 1NZOA 3O86A 4KZ9A 4QD4A 1L2SA 3IXGA 4R3JA 2FFFB 3N8LA 1SHVA 4LCMA 4GDBA 4FH4A 5EVIC 3VFFA 3IF6B 4GDNA 4QB8A 4E3JA 5FI6A 1AXBA 4DXBA 5JYOA 3NIAA 5GLCA 3UDIA 1PI4A 3TG9A 4C75A 3G2ZA 1W8YA 1JTDA 3HBRA 3Q82A 1IYOA 3BECA 5GHXA 3WS0A 1K4EA 2R9XA 4R0QA 4Q8IA 3PBSA 3UO9A 5J8XA 3QHYA 5GHYA 4KQOA 2Y2IA 2ZQ9A 1Z6FA 3MFDA 4M3KA 2ZQ7A 1HVBA 5HFOA 1BULA 4WMCD 1GCEA 5F82A 4X53A 1SCWA 3IXBA 4GZBA 3RJUA 3VMAA 3C7VA 4OQHA 5FQIA 2BLSA 2DCFA 3VOYA 5DF8A 4H8RA 3NY4A 3ZG7B 5DF9A 3BFEA 3FKWA 1I2SA 2Y2LA 1FR1A 1KGEA 5CGWA 5M1AA 5FDHA 2BG1A 3G34A 3HUMA 4JXWA 2ZQAA 3OC2A 1QMFA 5D3OA 4A5RA 4GOGA 2Y2NA 4GN2A 4E3OA 3A3IA 1IEMA 3ZHHA 2XDMA 4RYEA 3QNBA 2JBFA 4P87A 5EVIB 3O87A 4BD0A 3LO7A 1IELA 4R23A 1S0WA 3MKEA 1N4OA 4FH2A 2H0YA 1NY0A 3VP3A 1K38A 5CGSA 3V3SA 1J9MA 5FATA 3M2JA 3OPRA 5GL9A 1ERMA 1NYYA 3IQAA 4JF6A 2IWDA 3OPHA 1SDEA 4YFMA 4FSFA 4X68A 4BENA 5TFQA 5HARA 3Q81A 2CC1A 3FKVA 1K57A 4NETA 3C4OA 1W8QA 3NDGA 5U47A 4PM9A 3SS4A 3AGDA 5CEBA 4B4ZA 3UE3A 4P0MA 1YLYA 2Y4AA 5AQ7A 2J7VA 3HLWA 4GKUA 5FASA 3VSKA 4BJPA 3HVFA 1KGGA 5F1GA 5GHZA 4KG5A 4S2LA 4C6YA 5GLAA 4YINA 5GLBA 5EPHA 5HAPA 4WEJA 1ES4A 2C6WB 2WGWA 1XKZA 3IHBA 4JF5A 5KSHA 2Y2QA 4OPQA 5HAIA 3UNWA 3BRMA 1XA7A 2JC7A 5F1FA 4BLMA 3HLCA 3LY3A 2HDQA 2FFYA 1K57C 1GHPA 4LV2A 2XFTA 4ZTKA 2HPBA 3GSGA 3BEBA 1KE3A 4Y0TA 4LV3A 5KSCA 3NBLA 3N6IA 3BFCA 1E3UA 3G32A 5FA7A 4XXRA 5E2FA 5AQ9A 4EUZA 4IVKA 2V2FF 1K25A 3ZG8B 2Z2LB 1PWDA 2ZM8A 1DJCA 4UA6A 4LV1A 1XP4A 3N8SA 5EVLA 2H0TA 3ZG9B 2A3UA 4WEKA 3VP1A 4OQ0A 1PZPA 1PW1A 1Q2PA 3G2YA 2Y2PA 4IEDA 1CK3A 3M2KA 5HX9A 3ZVWA 3UPNA 2QPNA 4OOMA 1FSWA 5FSRA 2ZM2A 3N7WA 4BL3A 4QY6A 5A91A 3E2KA 3IWOA 3M6BA 3ZFZA 1XA1A 1N9BA 4PMAA 4PM7A 1KE4A 4MLLA 1FQGA 2JCHA 3DW0A 3G31A 2VGJA 3OCLA 2EX8A 4JLFA 3GTCA 4LV0A 4IBXA 4E3NA 4QJGA 3G35A 1S6RA 3TSGA 2HDRA 1M6KA 3TOIA 2QZ6A 1ESIA 5HW3A 3PBRA 1K55A 2Q9NA 3VP0A 4JPMA 4KQRA 4Y0OA 3WRZA 4E6WA 4R1GA 5I94A 4PM8A 5AQAA 1SDNA 2XD5A 2Y2KA 4R4RA 2PBYA 1K6SA 2Y2OA 4QY5A 1YLPA 5TR7A 3M6HA 1ALQA 4S2IA 1MKIA 4E3IA 3GR2A 3UDXA 2E8IA 1GA0A 2X01A 4CJNA 4R4SA 5FQKA 2C5WB 1FSYA 1MY8A 4KZ6A 4UAAA 1HZOA 3C4PA 2P74A 2ZC4B 1JVJA 1MWUA 3SH9A 5DF7A 1MXOA 2WGWB 4WYYA 1SKFA 1PWCA 3FV7A 3AGEA 1HTZA 4WM9A 2H10A 2OLVA 3FYZA 4OQIA 1K55C 4S2NA 1I5QA 5E2GA 3IWQA 3VOZA 1WE4A 4OQGA 4GNUA 3O3VA 4FCFA 2R9WA 2XEPA 1VM1A 4RX2A 2GDNA 2Y2MA 3Q7ZA 1OMEA 1L0FA 3ZDJA 4HBUA 5A92A 2IWBA 5EECA 2WZXA 3S22A 5DTKA 5HAQA 2WKHA 2XR0A 2Y55A 3A3JA 3OZHA 5A93A 4E3LA 3CG5A 4RX3A 4DE1A 1JWVA 3VP4A 2WAFA 3ZGAB 5EVID 3PAGA 3A3EA 4K0XA 4WBGA 3HUNA 1EROA 3EQUA 4ID4A 1Y54A 4ZBEA 4E3MA 1K56D 1G6AA 3PBNA 4S2NC 3ZG0A 1YLZA 2XQZA 3C7UA 3MXSA 3MZFA 5DTSA 3PAEA 1MPLA 4HBTA 1DY6A 3IXHA 4ZJ3A 5CHJA 3IXDA 1KE0A 2XFSA 3GVBA 3E2LA 5FAQA 3BM6A 4S2JA 3SH7A 3VFHA 1KVLA 2RCXA 2X71A 3WS1A 4OPRA 3V50A 2WYXA 1YMXA 3SH8A 2ZC7A 1BUEA 4OP8A 5E43A 1E25A 3A3FA 1QMEA 5GLDA 2UWXA 2WAEA 4E6XA 4KENB 2WZZA 4MNRA 4GD8A 1K4FA 4QHCA 4KZBA 1PWGA 3IH8A 1ZKJA 3O88A 2DRWA 1YM1A 1PW8A 2RL3A 3SS5A 3JYIA 3PBOA 1WYCA 1IYQA 1ZC2A 1L0DA 2ZJ9A 1RP5A 2XGNA 1MWTA 1PZOA 2ZD8A 5KZHA 1FR6A 2ZQCA 5FQMA 1H8ZA 1E4DA 1MWRA 1BTLA 1PYYA 4LENA 1W79A 2J8YA 2ZC6B 3ITBA 4BD1A 4CPKA 4HEFA 1ES3A 4D2OA 4WMCA 3LEZA 2HDUA 2WK0A 2J9PA 4ZJ2A 2Y2GA 4N9KA 4RA7A 2VGKA 3ISGA 1XGJA 4QU3A 3Q7VA 2EXBA 1LL5A 3Q07A 4WZ5A 1K54A 4OPZA 1YT4A 4Y7PA 4ZAMA 5EOEA 5CTMA 2Z2MB 1MBLA 2WUQA 2ZMAA 3OPLA 4KG2A 4DE0A 3WS4A 5CRFA 1NRFA 1TEMA 2ZQDA 1RGZA 3D4FA 4N1XA 5A90A 1FOFA 1EWZA 1JTGA 4DE3A 3NC8A 4JXGA 1DJAA 4PPRA 3HREA 1IYPA 5E2HA 2WADA 5TGFA 4B88A 2ZC3B 3HLDA 3OPPA 3UPPA 1BT5A 2DNSA 2EX6A 3LY4A 3N4IA 4HESA 3UY6A 3WRTA 4XUZA 2ZM0A 3W4OA 5FI7A 3WS5A 4OLDA 3NI9A 4GD6A 1GHIA 5CGXA 4E3KA 1BSGA 2PU4A 2ZQ8A 5CHUA 4JF4A 4WZ5C 1K54C 3OCNA 1ESUA 1YQSA 2EXAA 4Y0UA 5KMWA 1IKGA 3MKFA 3BLMA 1NJ4A 4KQQA 5FAOA 1LI9A 3C5AA 3BYDA 3DWKA 1O7EA 3Q1FA 1MWSA 4UHUA 2OSUA 2ZC5B 2HP9A 4JXVA 3HLBA 4KZ8A 5FAPA 3IHAA 3GMWA 1KDWA 3IWIA 3VSLA 3CJMA 2OV5A 5HL1A 3V39A 2EFXA 4KZ3A 4WELA 1H8YA 2XH9A 3MZDA 4P85A 2JE5A 3V3RA 3ZG5A 1ZG6A 3CZDA 3NCKA 1NZUA 4MBHA 4DKIA 4N1HA 1ES2A 1IKIA 1ES5A 3V5MA 1XPBA 1YMSA 2Y91A 1TDLA 2Y2HA 1LHYA 3ZNTA 4MEZA 4U0TA 4DDYA 4N9LA 4OKPA 3W4QA 3ZCZA 1RGYA 2Y59A 4C3QA 4BQMA 4OPYA 1HD8A 2B5RA 4N92A 1YLWA 3W8KA 1ZG4A 3P98A 3UDFA 4X56A 2EX2A 4B4XA 1BLPA 4DXCA 2EX9A 4OH0A 1BLSA 1E3UD 4OLGA 4S2KA 5CECA 4GB7A 1FCMA 5FI2A 4PM6A 3Q7VB 5FQ9A 3G4PA 4XUXA 1JWZA 3QNCA 3CMZA 1H5XA 5EUAA 1FCOA 3IT9A 3ZNYA 5EOOA 1W7FA 3WWXA 4MBKA 3RXXA 1NXYA 3DTMA 1ONGA 3S4XA 2WKEA 4JXSA 5AQBA 3HUOA 4JKTA 3FWLA 5F83A 4ZJ1A 5FQJA 3WS2A 4P6BA 1WYBA 1YLJA 1DJBA 1C3BA 1IYSA 1K6RA 2H5SA 4KG6A 3RXWA 4EWFA 4WZ4A 1ERQA 2ZLYA 4BL2A 1PI5A 4F94A 5M19A 2XK1A 3IF5A 3N8RA 4OVDA 3FZCA 4EBPA 1I2WA 4X6TA 5CXWA 1GHMA 4DRTA 1KGFA 4KZ7A 3UPOA 3BFDA 1VQQA 3G30A 2I72A 3B3XA 3PBQA 1BLCA 1G68A 3W4PA 2XLNA 4U3TA 3IF6A 3IH9A 1M40A 1BLHA 4OONA 4EBNA 2G2UA 4K0WA 3DWZA 4DE2A 2V20A 3PTEA 1TVFA 4PM5A 3HL9A 4JBFA 4OOYA 4Z9QA 5L2FA 2P9VB 3BLSA 4IBRA 3SS3A 5BOHA 4L0LA 4S2PA 4UA9A 5CTNA 3VP2A 4ZDXA 1W5DA 2WGIA 3GRJA 3AGFA 1RCJA 4KZAA 2J9OA 2A49A 3GV9A 1CEGA 4S2OA 1BZAA 3ITAA 3HLEA 3MXRA 2XF3A 3SOIA 4DF6A 3BFGA 4S2MA 3IF6C 3MZEA 3MBZA 1KDSA 3P09A 4EQIA 4UA7A 1JWPA 5CERA 4KZ5A 5JYPA 3HLFA 4NK3A 1O07A 2QMIA 3UE1A 3UN7A 5G18A 1KVMA 4EBLA 1NYMA 2V1ZA 3LCEA 4O7DA 5DVAA 1Q2QA 1ONHA 4X55A 4DDSA 2PU2A 3HLGA 1PIOA 4U0XA 2IWCA 3ZVTA 1GA9A 2WKIA 4KZ4A 5EE8A 2HDSA 4MBFA 3A3DA 3GQZA 4K91A 4EV4A 1U60A 5EVIA 3NDEA 2Y2JA 5E2EA 1CI8A 3UE0A 5M18A 2WGVA 3PBTA 5DTTA 2X02A 4LCLA 5IHVA 1L0GA 4IVIA 1K56A 5CHMA 3I7JA 1EI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0E A;  1YLT A;  4FD8 A;  1XXM A;  1LI0 A;  1LLB A;  1LL9 A;  1XX2 A;  1TDG A;  4R3B A;  3S1Y A;  2OLU A;  3EQV A;  5FQQ A;  2Q9M A;  5CED A;  2XD1 A;  1CI9 A;  4OOL A;  1CEF A;  4RVA A;  1XGI A;  4X69 A;  2HP5 A;  4OP5 A;  2EFU A;  1FCN A;  2G2W A;  2HP6 A;  2P9V A;  3BFF A;  1NZO A;  3O86 A;  4KZ9 A;  4QD4 A;  1L2S A;  3IXG A;  4R3J A;  2FFF B;  3N8L A;  1SHV A;  4LCM A;  4GDB A;  4FH4 A;  5EVI C;  3VFF A;  3IF6 B;  4GDN A;  4QB8 A;  4E3J A;  5FI6 A;  1AXB A;  4DXB A;  5JYO A;  3NIA A;  5GLC A;  3UDI A;  1PI4 A;  3TG9 A;  4C75 A;  3G2Z A;  1W8Y A;  1JTD A;  3HBR A;  3Q82 A;  1IYO A;  3BEC A;  5GHX A;  3WS0 A;  1K4E A;  2R9X A;  4R0Q A;  4Q8I A;  3PBS A;  3UO9 A;  5J8X A;  3QHY A;  5GHY A;  4KQO A;  2Y2I A;  2ZQ9 A;  1Z6F A;  3MFD A;  4M3K A;  2ZQ7 A;  1HVB A;  5HFO A;  1BUL A;  4WMC D;  1GCE A;  5F82 A;  4X53 A;  1SCW A;  3IXB A;  4GZB A;  3RJU A;  3VMA A;  3C7V A;  4OQH A;  5FQI A;  2BLS A;  2DCF A;  3VOY A;  5DF8 A;  4H8R A;  3NY4 A;  3ZG7 B;  5DF9 A;  3BFE A;  3FKW A;  1I2S A;  2Y2L A;  1FR1 A;  1KGE A;  5CGW A;  5M1A A;  5FDH A;  2BG1 A;  3G34 A;  3HUM A;  4JXW A;  2ZQA A;  3OC2 A;  1QMF A;  5D3O A;  4A5R A;  4GOG A;  2Y2N A;  4GN2 A;  4E3O A;  3A3I A;  1IEM A;  3ZHH A;  2XDM A;  4RYE A;  3QNB A;  2JBF A;  4P87 A;  5EVI B;  3O87 A;  4BD0 A;  3LO7 A;  1IEL A;  4R23 A;  1S0W A;  3MKE A;  1N4O A;  4FH2 A;  2H0Y A;  1NY0 A;  3VP3 A;  1K38 A;  5CGS A;  3V3S A;  1J9M A;  5FAT A;  3M2J A;  3OPR A;  5GL9 A;  1ERM A;  1NYY A;  3IQA A;  4JF6 A;  2IWD A;  3OPH A;  1SDE A;  4YFM A;  4FSF A;  4X68 A;  4BEN A;  5TFQ A;  5HAR A;  3Q81 A;  2CC1 A;  3FKV A;  1K57 A;  4NET A;  3C4O A;  1W8Q A;  3NDG A;  5U47 A;  4PM9 A;  3SS4 A;  3AGD A;  5CEB A;  4B4Z A;  3UE3 A;  4P0M A;  1YLY A;  2Y4A A;  5AQ7 A;  2J7V A;  3HLW A;  4GKU A;  5FAS A;  3VSK A;  4BJP A;  3HVF A;  1KGG A;  5F1G A;  5GHZ A;  4KG5 A;  4S2L A;  4C6Y A;  5GLA A;  4YIN A;  5GLB A;  5EPH A;  5HAP A;  4WEJ A;  1ES4 A;  2C6W B;  2WGW A;  1XKZ A;  3IHB A;  4JF5 A;  5KSH A;  2Y2Q A;  4OPQ A;  5HAI A;  3UNW A;  3BRM A;  1XA7 A;  2JC7 A;  5F1F A;  4BLM A;  3HLC A;  3LY3 A;  2HDQ A;  2FFY A;  1K57 C;  1GHP A;  4LV2 A;  2XFT A;  4ZTK A;  2HPB A;  3GSG A;  3BEB A;  1KE3 A;  4Y0T A;  4LV3 A;  5KSC A;  3NBL A;  3N6I A;  3BFC A;  1E3U A;  3G32 A;  5FA7 A;  4XXR A;  5E2F A;  5AQ9 A;  4EUZ A;  4IVK A;  2V2F F;  1K25 A;  3ZG8 B;  2Z2L B;  1PWD A;  2ZM8 A;  1DJC A;  4UA6 A;  4LV1 A;  1XP4 A;  3N8S A;  5EVL A;  2H0T A;  3ZG9 B;  2A3U A;  4WEK A;  3VP1 A;  4OQ0 A;  1PZP A;  1PW1 A;  1Q2P A;  3G2Y A;  2Y2P A;  4IED A;  1CK3 A;  3M2K A;  5HX9 A;  3ZVW A;  3UPN A;  2QPN A;  4OOM A;  1FSW A;  5FSR A;  2ZM2 A;  3N7W A;  4BL3 A;  4QY6 A;  5A91 A;  3E2K A;  3IWO A;  3M6B A;  3ZFZ A;  1XA1 A;  1N9B A;  4PMA A;  4PM7 A;  1KE4 A;  4MLL A;  1FQG A;  2JCH A;  3DW0 A;  3G31 A;  2VGJ A;  3OCL A;  2EX8 A;  4JLF A;  3GTC A;  4LV0 A;  4IBX A;  4E3N A;  4QJG A;  3G35 A;  1S6R A;  3TSG A;  2HDR A;  1M6K A;  3TOI A;  2QZ6 A;  1ESI A;  5HW3 A;  3PBR A;  1K55 A;  2Q9N A;  3VP0 A;  4JPM A;  4KQR A;  4Y0O A;  3WRZ A;  4E6W A;  4R1G A;  5I94 A;  4PM8 A;  5AQA A;  1SDN A;  2XD5 A;  2Y2K A;  4R4R A;  2PBY A;  1K6S A;  2Y2O A;  4QY5 A;  1YLP A;  5TR7 A;  3M6H A;  1ALQ A;  4S2I A;  1MKI A;  4E3I A;  3GR2 A;  3UDX A;  2E8I A;  1GA0 A;  2X01 A;  4CJN A;  4R4S A;  5FQK A;  2C5W B;  1FSY A;  1MY8 A;  4KZ6 A;  4UAA A;  1HZO A;  3C4P A;  2P74 A;  2ZC4 B;  1JVJ A;  1MWU A;  3SH9 A;  5DF7 A;  1MXO A;  2WGW B;  4WYY A;  1SKF A;  1PWC A;  3FV7 A;  3AGE A;  1HTZ A;  4WM9 A;  2H10 A;  2OLV A;  3FYZ A;  4OQI A;  1K55 C;  4S2N A;  1I5Q A;  5E2G A;  3IWQ A;  3VOZ A;  1WE4 A;  4OQG A;  4GNU A;  3O3V A;  4FCF A;  2R9W A;  2XEP A;  1VM1 A;  4RX2 A;  2GDN A;  2Y2M A;  3Q7Z A;  1OME A;  1L0F A;  3ZDJ A;  4HBU A;  5A92 A;  2IWB A;  5EEC A;  2WZX A;  3S22 A;  5DTK A;  5HAQ A;  2WKH A;  2XR0 A;  2Y55 A;  3A3J A;  3OZH A;  5A93 A;  4E3L A;  3CG5 A;  4RX3 A;  4DE1 A;  1JWV A;  3VP4 A;  2WAF A;  3ZGA B;  5EVI D;  3PAG A;  3A3E A;  4K0X A;  4WBG A;  3HUN A;  1ERO A;  3EQU A;  4ID4 A;  1Y54 A;  4ZBE A;  4E3M A;  1K56 D;  1G6A A;  3PBN A;  4S2N C;  3ZG0 A;  1YLZ A;  2XQZ A;  3C7U A;  3MXS A;  3MZF A;  5DTS A;  3PAE A;  1MPL A;  4HBT A;  1DY6 A;  3IXH A;  4ZJ3 A;  5CHJ A;  3IXD A;  1KE0 A;  2XFS A;  3GVB A;  3E2L A;  5FAQ A;  3BM6 A;  4S2J A;  3SH7 A;  3VFH A;  1KVL A;  2RCX A;  2X71 A;  3WS1 A;  4OPR A;  3V50 A;  2WYX A;  1YMX A;  3SH8 A;  2ZC7 A;  1BUE A;  4OP8 A;  5E43 A;  1E25 A;  3A3F A;  1QME A;  5GLD A;  2UWX A;  2WAE A;  4E6X A;  4KEN B;  2WZZ A;  4MNR A;  4GD8 A;  1K4F A;  4QHC A;  4KZB A;  1PWG A;  3IH8 A;  1ZKJ A;  3O88 A;  2DRW A;  1YM1 A;  1PW8 A;  2RL3 A;  3SS5 A;  3JYI A;  3PBO A;  1WYC A;  1IYQ A;  1ZC2 A;  1L0D A;  2ZJ9 A;  1RP5 A;  2XGN A;  1MWT A;  1PZO A;  2ZD8 A;  5KZH A;  1FR6 A;  2ZQC A;  5FQM A;  1H8Z A;  1E4D A;  1MWR A;  1BTL A;  1PYY A;  4LEN A;  1W79 A;  2J8Y A;  2ZC6 B;  3ITB A;  4BD1 A;  4CPK A;  4HEF A;  1ES3 A;  4D2O A;  4WMC A;  3LEZ A;  2HDU A;  2WK0 A;  2J9P A;  4ZJ2 A;  2Y2G A;  4N9K A;  4RA7 A;  2VGK A;  3ISG A;  1XGJ A;  4QU3 A;  3Q7V A;  2EXB A;  1LL5 A;  3Q07 A;  4WZ5 A;  1K54 A;  4OPZ A;  1YT4 A;  4Y7P A;  4ZAM A;  5EOE A;  5CTM A;  2Z2M B;  1MBL A;  2WUQ A;  2ZMA A;  3OPL A;  4KG2 A;  4DE0 A;  3WS4 A;  5CRF A;  1NRF A;  1TEM A;  2ZQD A;  1RGZ A;  3D4F A;  4N1X A;  5A90 A;  1FOF A;  1EWZ A;  1JTG A;  4DE3 A;  3NC8 A;  4JXG A;  1DJA A;  4PPR A;  3HRE A;  1IYP A;  5E2H A;  2WAD A;  5TGF A;  4B88 A;  2ZC3 B;  3HLD A;  3OPP A;  3UPP A;  1BT5 A;  2DNS A;  2EX6 A;  3LY4 A;  3N4I A;  4HES A;  3UY6 A;  3WRT A;  4XUZ A;  2ZM0 A;  3W4O A;  5FI7 A;  3WS5 A;  4OLD A;  3NI9 A;  4GD6 A;  1GHI A;  5CGX A;  4E3K A;  1BSG A;  2PU4 A;  2ZQ8 A;  5CHU A;  4JF4 A;  4WZ5 C;  1K54 C;  3OCN A;  1ESU A;  1YQS A;  2EXA A;  4Y0U A;  5KMW A;  1IKG A;  3MKF A;  3BLM A;  1NJ4 A;  4KQQ A;  5FAO A;  1LI9 A;  3C5A A;  3BYD A;  3DWK A;  1O7E A;  3Q1F A;  1MWS A;  4UHU A;  2OSU A;  2ZC5 B;  2HP9 A;  4JXV A;  3HLB A;  4KZ8 A;  5FAP A;  3IHA A;  3GMW A;  1KDW A;  3IWI A;  3VSL A;  3CJM A;  2OV5 A;  5HL1 A;  3V39 A;  2EFX A;  4KZ3 A;  4WEL A;  1H8Y A;  2XH9 A;  3MZD A;  4P85 A;  2JE5 A;  3V3R A;  3ZG5 A;  1ZG6 A;  3CZD A;  3NCK A;  1NZU A;  4MBH A;  4DKI A;  4N1H A;  1ES2 A;  1IKI A;  1ES5 A;  3V5M A;  1XPB A;  1YMS A;  2Y91 A;  1TDL A;  2Y2H A;  1LHY A;  3ZNT A;  4MEZ A;  4U0T A;  4DDY A;  4N9L A;  4OKP A;  3W4Q A;  3ZCZ A;  1RGY A;  2Y59 A;  4C3Q A;  4BQM A;  4OPY A;  1HD8 A;  2B5R A;  4N92 A;  1YLW A;  3W8K A;  1ZG4 A;  3P98 A;  3UDF A;  4X56 A;  2EX2 A;  4B4X A;  1BLP A;  4DXC A;  2EX9 A;  4OH0 A;  1BLS A;  1E3U D;  4OLG A;  4S2K A;  5CEC A;  4GB7 A;  1FCM A;  5FI2 A;  4PM6 A;  3Q7V B;  5FQ9 A;  3G4P A;  4XUX A;  1JWZ A;  3QNC A;  3CMZ A;  1H5X A;  5EUA A;  1FCO A;  3IT9 A;  3ZNY A;  5EOO A;  1W7F A;  3WWX A;  4MBK A;  3RXX A;  1NXY A;  3DTM A;  1ONG A;  3S4X A;  2WKE A;  4JXS A;  5AQB A;  3HUO A;  4JKT A;  3FWL A;  5F83 A;  4ZJ1 A;  5FQJ A;  3WS2 A;  4P6B A;  1WYB A;  1YLJ A;  1DJB A;  1C3B A;  1IYS A;  1K6R A;  2H5S A;  4KG6 A;  3RXW A;  4EWF A;  4WZ4 A;  1ERQ A;  2ZLY A;  4BL2 A;  1PI5 A;  4F94 A;  5M19 A;  2XK1 A;  3IF5 A;  3N8R A;  4OVD A;  3FZC A;  4EBP A;  1I2W A;  4X6T A;  5CXW A;  1GHM A;  4DRT A;  1KGF A;  4KZ7 A;  3UPO A;  3BFD A;  1VQQ A;  3G30 A;  2I72 A;  3B3X A;  3PBQ A;  1BLC A;  1G68 A;  3W4P A;  2XLN A;  4U3T A;  3IF6 A;  3IH9 A;  1M40 A;  1BLH A;  4OON A;  4EBN A;  2G2U A;  4K0W A;  3DWZ A;  4DE2 A;  2V20 A;  3PTE A;  1TVF A;  4PM5 A;  3HL9 A;  4JBF A;  4OOY A;  4Z9Q A;  5L2F A;  2P9V B;  3BLS A;  4IBR A;  3SS3 A;  5BOH A;  4L0L A;  4S2P A;  4UA9 A;  5CTN A;  3VP2 A;  4ZDX A;  1W5D A;  2WGI A;  3GRJ A;  3AGF A;  1RCJ A;  4KZA A;  2J9O A;  2A49 A;  3GV9 A;  1CEG A;  4S2O A;  1BZA A;  3ITA A;  3HLE A;  3MXR A;  2XF3 A;  3SOI A;  4DF6 A;  3BFG A;  4S2M A;  3IF6 C;  3MZE A;  3MBZ A;  1KDS A;  3P09 A;  4EQI A;  4UA7 A;  1JWP A;  5CER A;  4KZ5 A;  5JYP A;  3HLF A;  4NK3 A;  1O07 A;  2QMI A;  3UE1 A;  3UN7 A;  5G18 A;  1KVM A;  4EBL A;  1NYM A;  2V1Z A;  3LCE A;  4O7D A;  5DVA A;  1Q2Q A;  1ONH A;  4X55 A;  4DDS A;  2PU2 A;  3HLG A;  1PIO A;  4U0X A;  2IWC A;  3ZVT A;  1GA9 A;  2WKI A;  4KZ4 A;  5EE8 A;  2HDS A;  4MBF A;  3A3D A;  3GQZ A;  4K91 A;  4EV4 A;  1U60 A;  5EVI A;  3NDE A;  2Y2J A;  5E2E A;  1CI8 A;  3UE0 A;  5M18 A;  2WGV A;  3PBT A;  5DTT A;  2X02 A;  4LCL A;  5IHV A;  1L0G A;  4IVI A;  1K56 A;  5CHM A;  3I7J A;  1EI5 A; 
#chains in the Genus database with same CATH topology
 1XXM A;  3SZT A;  4GHI B;  1TDG A;  3TRC A;  1JNU A;  2A24 B;  2PT7 A;  3T1Q B;  4EUV A;  2HP6 A;  2PDR A;  2EWV A;  5FL3 A;  1L2S A;  1SHV A;  5EVI C;  1BYW A;  5JYO A;  3NIA A;  3UDI A;  2ZL1 A;  3TG9 A;  4C75 A;  2JN7 A;  3Q82 A;  2P7J A;  5GHX A;  1K4E A;  5GHY A;  2Y2I A;  2J3T D;  2ZQ9 A;  3MFD A;  4M4X A;  5HFO A;  2ZOI A;  5EV0 A;  4X53 A;  1SCW A;  3IXB A;  3RJU A;  3VMA A;  2BLS A;  3VOY A;  5DF8 A;  3NY4 A;  1TS6 A;  5FDS A;  5DF9 A;  3FKW A;  1KGE A;  2BG1 A;  4JXW A;  4A5R A;  2Y2N A;  3MS6 A;  4I3J A;  3GEC A;  4GCZ A;  4R23 A;  1S0W A;  2H0Y A;  1NY0 A;  1ACF A;  3S7Q A;  3VP3 A;  5CGS A;  1NRJ A;  1ERM A;  4JF6 A;  1HLU P;  4YNR A;  5DFY A;  1VET B;  1K57 A;  1FIK A;  4MMN A;  1LSV A;  4MN5 A;  4PM9 A;  4B4Z A;  4P0M A;  5HSQ A;  1YLY A;  4G3W A;  5AQ7 A;  2V8C A;  4GKU A;  4BJP A;  1KGG A;  5F1G A;  4KG5 A;  1X0O A;  5EPH A;  5HAP A;  5EM1 A;  4WEJ A;  1ES4 A;  2WGW A;  5HAI A;  1OT6 A;  3UME A;  3HLC A;  2HPB A;  2Z6D A;  3BEB A;  3T1X A;  2VLG A;  2QWS A;  4H6J B;  5AQ9 A;  2W27 A;  4EUZ A;  4UA6 A;  3N8S A;  5EVL A;  3ZG9 B;  1ODV A;  3VP1 A;  2OAP 1;  4IED A;  3QP8 A;  1CK3 A;  3M2K A;  5HX9 A;  3ZVW A;  5FSR A;  4QY6 A;  4PKY G;  3ZFZ A;  3CUE C;  4R3A A;  2JCH A;  3DW0 A;  2VGJ A;  4QPR A;  3GTC A;  3TOI A;  5HW3 A;  3BJN A;  3VP0 A;  4JPM A;  4Y0O A;  4HP4 A;  4E6W A;  1SDN A;  2XD5 A;  4ARZ A;  3OLO A;  2Y2O A;  1YLP A;  2KOI A;  4S2I A;  1IFQ A;  4R4S A;  4LGW A;  5FQK A;  4KZ6 A;  1FSY A;  4DN0 A;  1HZO A;  1CF0 A;  2P74 A;  2ZC4 B;  1MWU A;  3K3D A;  5EFW A;  3FYZ A;  4S2N A;  3UB8 A;  1I5Q A;  4OQG A;  3O3V A;  4RX2 A;  1XJ2 A;  1L0F A;  3ZDJ A;  3IX4 A;  3LIB A;  1F98 A;  5EEC A;  2WZX A;  3KX0 X;  5HWT A;  5HAQ A;  5HDC A;  3OZH A;  3UMD A;  5A93 A;  4DE1 A;  3VP4 A;  2WAF A;  1DP9 A;  2K2N A;  4K0X A;  3A3E A;  4WBG A;  5IU1 A;  3B42 A;  1ERO A;  1K56 D;  1YLZ A;  2XQZ A;  3C7U A;  5DTS A;  4HBT A;  3IXH A;  4R38 A;  4LFU A;  2X71 A;  4OPR A;  2WKP A;  2WYX A;  1YMX A;  1P0Z A;  3VOL A;  3NOP C;  4E6X A;  2QJ7 A;  4QHC A;  1G28 A;  1YM1 A;  1V9Y A;  4X1L A;  5J7E A;  3JYI A;  1WYC A;  1IYQ A;  3UE6 A;  2ZQC A;  1H8Z A;  1BTL A;  1PYY A;  1W79 A;  3ITB A;  2ZC6 B;  5HWV A;  4BD1 A;  4CPK A;  4D2O A;  2HDU A;  2WK0 A;  5TBM A;  2J9P A;  4ZJ2 A;  4WLA A;  3Q7V A;  5G4Y A;  4WZ5 A;  4OPZ A;  3H9W A;  1MBL A;  3MXQ A;  4DE0 A;  1Y4O A;  1NRF A;  1FOF A;  3NC8 A;  4JXG A;  1DJA A;  3T4T A;  5C5K A;  4ETZ A;  1S4S A;  1IYP A;  5TGF A;  2WAD A;  3UPP A;  2ZM0 A;  3WS5 A;  4KUO A;  4Y3I A;  3NI9 A;  3B47 A;  1GHI A;  5CGX A;  4E3K A;  1BSG A;  4HJ3 A;  2JKF A;  1T18 A;  1XJ6 A;  1YQS A;  3OCN A;  1UGU A;  2HJE A;  3QP5 A;  1YAX A;  1O7E A;  4RQ9 A;  2VEA A;  4R70 A;  2YKH A;  4NXF A;  4JXV A;  4KZ8 A;  3IBR A;  2GNX A;  4UQI S;  3GMW A;  1S66 L;  4ME4 A;  4EW7 A;  5HL1 A;  2OV5 A;  1L3L A;  4EXO A;  3V3R A;  4DKI A;  4MBH A;  1XPB A;  1TDL A;  2Y2H A;  4MEZ A;  4U0T A;  4JGR A;  4DDY A;  4N9L A;  1OTD A;  4N92 A;  1BLP A;  4Y17 A;  4OH0 A;  1E3U D;  2L4R A;  3JPU A;  5FQ9 A;  4XUX A;  1JWZ A;  2Q0O A;  3QNC A;  3R7W B;  3ULF A;  3ZNY A;  5AVE A;  2H28 A;  1W7F A;  1TS8 A;  3WWX A;  3BW6 A;  3RXX A;  1SKO B;  1ONG A;  3DTM A;  2QJ5 A;  2WKE A;  4JXS A;  4JKT A;  3FG8 A;  2EA9 A;  5J4E A;  1YLJ A;  1C3B A;  4HJ6 A;  4KG6 A;  4EWF A;  2A24 A;  2IA2 A;  4F94 A;  5FEG A;  4EBP A;  3A0R A;  4X6T A;  1KGF A;  4YWZ A;  3B3X A;  2PD8 A;  4EBN A;  3HJI A;  3DWZ A;  1VEU B;  4PM5 A;  4Z9Q A;  4JBF A;  4OOY A;  2P9V B;  3BLS A;  4LRX C;  4UA9 A;  1W5D A;  2WGI A;  4CLC A;  4S2O A;  4L9E A;  3SOI A;  2O9C A;  3IF6 C;  4UA7 A;  4NKP A;  5JYP A;  3HLF A;  2QMI A;  3UE1 A;  3NEC A;  3MQQ A;  5L07 A;  4UQI M;  1NYM A;  5DVA A;  3LCE A;  3UB7 A;  4X55 A;  1PIO A;  2J80 A;  2IWC A;  3F1N B;  2FZ0 A;  4KZ4 A;  4EV4 A;  5M18 A;  3NDE A;  2Y2J A;  3MMH A;  2X02 A;  3BQ8 A;  1K56 A;  5CHM A;  3CAX A;  1OT9 A;  3LIE A;  1LL9 A;  1XX2 A;  3EQV A;  5CED A;  2Q9M A;  4OOL A;  1CEF A;  3CWF A;  1XGI A;  2HP5 A;  2W3D A;  3L7H A;  4QD4 A;  3IXG A;  2FFF B;  3N8L A;  3VFF A;  4GDN A;  4E3J A;  1AXB A;  5EVE A;  5GLC A;  1PI4 A;  2O9B A;  3KYQ A;  1OTA A;  1JTD A;  1AWI A;  1IYO A;  1GSX A;  4R0Q A;  3PBS A;  5J8X A;  1TF1 A;  1Z6F A;  4MDZ A;  2ZQ7 A;  1HVB A;  2Y8H A;  1BUL A;  4H6J A;  5F82 A;  5FQI A;  4JGO A;  1YPR A;  2BAS A;  3BFE A;  1I2S A;  2LB5 A;  4BMW A;  1QMF A;  5D3O A;  4GOG A;  2OOL A;  4E3O A;  3A3I A;  1IEM A;  2XDM A;  4P87 A;  5EVI B;  3TE8 A;  1GSW A;  3TW8 A;  3MKE A;  4FH2 A;  2JHE A;  4Y15 A;  1NYY A;  3OPH A;  1P9R A;  4FSF A;  4BEN A;  1D7E A;  2CC1 A;  3FKV A;  4NET A;  3C4O A;  3LIA A;  1SZV A;  3SS4 A;  5CEB A;  1TS7 A;  3T4Q A;  5J3W A;  3S7P A;  4NG2 A;  1J3W A;  4UEY A;  4FUW A;  3MQO A;  1XA7 A;  3A0S A;  2HDQ A;  2FFY A;  3NJA A;  2ZOH A;  1T1C A;  3BY8 A;  2LB9 A;  4BWI A;  2VZW A;  4Y0T A;  4LV3 A;  3NBL A;  3BFC A;  1E3U A;  2NUT C;  3G32 A;  2V2F F;  1K25 A;  3ZG8 B;  1PWD A;  2W3E A;  2O9A A;  2H0T A;  5DJU A;  4WEK A;  1S67 L;  1PZP A;  2VV7 A;  3G2Y A;  3NHQ A;  2Y2P A;  5F6A A;  3UPN A;  2QHK A;  4IUH A;  2W1T A;  3IWO A;  3BY9 A;  5A91 A;  5HPI A;  1N9B A;  4PMA A;  3FC7 A;  4DMZ A;  1FQG A;  3G31 A;  4E3N A;  2JKT I;  4QJG A;  3TSG A;  1DRM A;  2QZ6 A;  3QP1 A;  4HY8 A;  3PBR A;  1K55 A;  3EEH A;  2KLI A;  3P01 A;  4PM8 A;  5AQA A;  4R4R A;  1NLY A;  2GJ3 A;  4QY5 A;  3HJK A;  3UB9 A;  3M6H A;  4GS9 B;  2W3F A;  1ALQ A;  1MKI A;  3F1O B;  2C5W B;  4UAA A;  3FPV A;  4HP9 A;  1JVJ A;  3SH9 A;  1PNE A;  1PWC A;  3AGE A;  4G3V A;  1HTZ A;  4Q0H A;  4OQI A;  5E2G A;  3VOZ A;  1MKM A;  1VM1 A;  2GDN A;  4ZRR A;  4K08 A;  3S22 A;  2XR0 A;  2Y55 A;  3CG5 A;  2UV0 E;  5EVI D;  1DP6 A;  1Y54 A;  1OTI A;  3ZG0 A;  1STZ A;  3G6O A;  3MZF A;  1MPL A;  5CHJ A;  1WA9 A;  5FAQ A;  3E2L A;  4S2J A;  1CQA A;  3VFH A;  4Y13 A;  2RCX A;  5LBR A;  4BBT A;  3WS1 A;  1E25 A;  3A3F A;  5GLD A;  2WAE A;  2WZZ A;  4GD8 A;  4KZB A;  1A0K A;  1PW8 A;  4GJ4 A;  4MN6 A;  1L0D A;  4JGQ A;  2V0U A;  2ZJ9 A;  2XGN A;  1MWT A;  5KZH A;  4EEP A;  4IJG A;  3P7N A;  2J8Y A;  1ES3 A;  2QKP A;  3KSH A;  2Y2G A;  1OPX A;  1XGJ A;  2WKQ A;  4IHQ A;  3R7W A;  3GDI A;  2OAQ 1;  4ZAM A;  2PYR A;  2Z2M B;  2WUQ A;  2JKG A;  2P08 A;  3NOU C;  3D4F A;  2ZBB A;  1EWZ A;  1JTG A;  4DE3 A;  4PPR A;  5E2H A;  4NXG A;  1BT5 A;  2EX6 A;  3LY4 A;  3WRT A;  4XUZ A;  2ACG A;  3W4O A;  5FI7 A;  2KX6 A;  2PR6 A;  5DFX A;  5CHU A;  2XA7 S;  1K54 C;  1ESU A;  1IKG A;  3MKF A;  1NJ4 A;  5FAO A;  3C5A A;  3BYD A;  1VEU A;  3Q1F A;  2HP9 A;  3HLB A;  4Y5F A;  3MF0 A;  3OBF A;  3IWI A;  3LUQ A;  1LSW A;  4HOI A;  4B93 A;  3V39 A;  4WEL A;  1H8Y A;  3ZG5 A;  4LPZ A;  3VV4 A;  1ES2 A;  1IKI A;  3V5M A;  2I9V A;  4O8G A;  1UWP X;  3ZCZ A;  3W4Q A;  1RGY A;  3H82 B;  4C3Q A;  4BQM A;  2OWJ A;  3ICY A;  5HDS A;  2B5R A;  3KYE A;  3UDF A;  4DXC A;  2EX2 A;  3F1N A;  3QP2 A;  2PRF A;  1FCM A;  5FI2 A;  4PM6 A;  3ZYT A;  1H5X A;  3H7W A;  1MZU A;  4MBK A;  3LI9 A;  2V8F A;  3S4X A;  5AQB A;  4HH3 A;  1DJB A;  3RXW A;  1K6R A;  3U2A A;  1PI5 A;  2V9A A;  3IF5 A;  3PXP A;  2PBD P;  5CXW A;  4KZ7 A;  3PBQ A;  2JKR I;  4U3T A;  1S1Y A;  3C30 A;  5DJT A;  1M40 A;  1BLH A;  2K7S A;  2B02 A;  4K0W A;  2V20 A;  4PKY A;  3LEQ A;  1TVF A;  5L2F A;  4IBR A;  3SS3 A;  4L0L A;  2Z6C A;  1FIL A;  3GRJ A;  3AGF A;  1RCJ A;  2M1C A;  2J9O A;  3LFV A;  2XA7 M;  2BTF P;  4S2M A;  2VX8 A;  1JWP A;  1LT0 A;  4NK3 A;  1O07 A;  4EBL A;  4O7D A;  4WF0 A;  2PU2 A;  3HLG A;  1GA9 A;  3T12 B;  2WKI A;  5K5B A;  4MBF A;  3GQZ A;  5EVI A;  5E2E A;  2GZA A;  4IVI A;  2G7U A;  3V67 A;  1EI5 A;  1L0E A;  1YLT A;  4FD8 A;  4L9F A;  3S1Y A;  2XD1 A;  4RVA A;  4X69 A;  1TD5 A;  3CPT A;  2G2W A;  3BFF A;  1NZO A;  3MFX A;  3O86 A;  4R3J A;  4LCM A;  4FH4 A;  2J3W A;  3IF6 B;  4QB8 A;  3HCY A;  5FI6 A;  4DXB A;  2B18 A;  3G2Z A;  4Q8I A;  2PD7 A;  3UO9 A;  1F9I A;  3QHY A;  3CIT A;  4KQO A;  1T19 A;  4NEE D;  2W3G A;  3DTK A;  1GCE A;  4EEU A;  4GZB A;  3C7V A;  4OQH A;  2L0W A;  4H8R A;  2XSS A;  3ZQ5 A;  1FR1 A;  5M1A A;  3E0Y A;  5FDH A;  3RH8 B;  3G34 A;  3HUM A;  4GHI A;  4GN2 A;  3QNB A;  2JBF A;  4EER A;  4BD0 A;  3LO7 A;  3F1P B;  1K38 A;  1PFL A;  3V3S A;  1J9M A;  5FAT A;  4FTX A;  3OPR A;  5GL9 A;  4HIA A;  4F3L B;  3IQA A;  3IS2 B;  3C8C A;  4YFM A;  2HGV A;  4X68 A;  5TFQ A;  5HAR A;  3Q81 A;  1W8Q A;  5U47 A;  3AGD A;  3UE3 A;  4GS9 A;  1NLZ A;  1ZHH B;  3F1O A;  1KOU A;  5FAS A;  5GHZ A;  4S2L A;  5GLB A;  3JVU A;  4HJ4 A;  2C6W B;  3IHB A;  5F5Y A;  1XKZ A;  4JF5 A;  4YOF A;  3UNW A;  3BRM A;  1XFN A;  2W0N A;  1YKD A;  2JC7 A;  2EWW A;  2V1A A;  4BLM A;  1D06 A;  3LY3 A;  1K57 C;  1GHP A;  2XFT A;  3CUE A;  1KE3 A;  5KSC A;  3UB6 A;  3N6I A;  5FA7 A;  5E2F A;  1N9N A;  4LV1 A;  2PYP A;  4WUJ A;  4OQ0 A;  1W63 M;  1PW1 A;  1Q2P A;  1MC0 A;  3CLO A;  3QP6 A;  4BL3 A;  1FSW A;  3N7W A;  1VET A;  3E2K A;  1K0K A;  1KE4 A;  4LV0 A;  4IBX A;  3G35 A;  1ESI A;  5HL6 A;  1F5M A;  4KQR A;  5I94 A;  4DJ3 A;  4NXE A;  1GSV A;  2PBY A;  1K6S A;  3C38 A;  2PAV P;  4E3I A;  3GR2 A;  3UDX A;  2E8J A;  1W63 Q;  2E8I A;  2X01 A;  4CJN A;  4EU0 A;  3C4P A;  5DF7 A;  4WYY A;  4WM9 A;  2D02 A;  4I3I A;  2H10 A;  3IWQ A;  5HPF A;  4GNU A;  4FCF A;  2R9W A;  1N9O A;  5A92 A;  2YKF A;  2IWB A;  5DTK A;  1H0M A;  1IOU A;  3S7O A;  5TBM B;  1H8M A;  1LSX A;  3ZGA B;  4LLO B;  3HUN A;  2V1B A;  4AFI A;  4S2N C;  1G6A A;  3MXS A;  4EQ1 A;  3PAE A;  1DY6 A;  2V0W A;  4ZJ3 A;  3IXD A;  1KE0 A;  3BM6 A;  2PR5 A;  3SH8 A;  2ZC7 A;  4OP8 A;  5E43 A;  2UWX A;  4MNR A;  1K4F A;  5IT5 A;  3IH8 A;  1NWZ A;  5HD5 A;  3O88 A;  3LI8 A;  2DRW A;  2W1R A;  3SS5 A;  3PBO A;  1RP5 A;  4PAU A;  4KQD A;  1FR6 A;  3MJQ A;  5CX7 A;  1E4D A;  1MWR A;  3H82 A;  4R6L A;  3MR0 A;  1F2K A;  4HEF A;  3EWK A;  4I38 A;  3EGD C;  3DAV A;  4Y7P A;  4WN5 A;  5CTM A;  2ZMA A;  4KG2 A;  3WS4 A;  2ZQD A;  1RGZ A;  4N1X A;  5A90 A;  3HRE A;  2J3T C;  2VV8 A;  3R4K A;  3KO6 A;  3JVV A;  3OPP A;  2DNS A;  4II7 A;  1S4R A;  2QYB A;  4GD6 A;  5DKK A;  2K31 A;  4WZ5 C;  2EXA A;  3BLM A;  3DWK A;  1MWS A;  2OSU A;  2ZC5 B;  5FAP A;  3IHA A;  1KDW A;  3VSL A;  3CJM A;  4DJ2 A;  1EW0 A;  2P04 A;  4P85 A;  2JE5 A;  1ZG6 A;  3NCK A;  3DTE A;  3T4O A;  1D1J A;  2HZ5 A;  2L1M A;  4CLC E;  1LHY A;  4LRZ E;  4OKP A;  2Y59 A;  4CLC B;  1YLW A;  3W8K A;  1ZG4 A;  4WL9 A;  4X56 A;  4B4X A;  1BLS A;  3O5Y A;  3G4P A;  3CMZ A;  5EUA A;  1FCO A;  3IT9 A;  1YSQ A;  4MCW A;  4X1M A;  1NXY A;  3HUO A;  5FQJ A;  1OTE A;  4P6B A;  2H5S A;  4BL2 A;  2XK1 A;  4OVD A;  3FZC A;  1I2W A;  1Z09 A;  4DRT A;  1GHM A;  3UPO A;  2I72 A;  4E04 A;  1ZTU A;  3UB5 P;  1G68 A;  3W4P A;  2XLN A;  3IF6 A;  3IH9 A;  4OON A;  3IX3 A;  2G2U A;  3LGO A;  5L09 A;  3MQ0 A;  3HL9 A;  2W3H A;  3T1R A;  3S7N A;  1V9Z A;  1UWN X;  4KZA A;  2JKT M;  3LR0 A;  5A8B A;  3GV9 A;  1OJG A;  1BZA A;  4GW9 A;  3HLE A;  2VK3 A;  4D60 A;  3MBZ A;  5CER A;  4KZ5 A;  3UN7 A;  4HHD A;  2V1Z A;  3LR4 A;  1Q2Q A;  1ONH A;  4DDS A;  1SKO A;  3PR6 A;  5EE8 A;  2HDS A;  3A3D A;  3EGX C;  1CI8 A;  3UE0 A;  4CLC C;  2WGV A;  3F1P A;  5DTT A;  4LCL A;  4XT2 B;  3LR5 A;  1T1A A;  5MC7 A;  3I7J A;  5FQM A;  4F3L A;  5F69 A;  3OOV A;  3IS2 A;  1LI0 A;  1LLB A;  4I5S A;  4R3B A;  2OLU A;  5FQQ A;  3EEA A;  1CI9 A;  4I3A A;  4OP5 A;  3MSH A;  2EFU A;  1FCN A;  2PHY A;  4P6Z S;  2P9V A;  4KZ9 A;  4L9G A;  5I5L A;  4GDB A;  5TJJ A;  3LR3 A;  1S1Z A;  2MJ6 A;  2XRN A;  1LL8 A;  1XFQ A;  1W8Y A;  3HBR A;  3BEC A;  3WS0 A;  2R9X A;  5F68 A;  4M3K A;  4CLC D;  4GLQ A;  1YSP A;  4WMC D;  4EET B;  3LYX A;  2DCF A;  2FH5 A;  3ZG7 B;  5CGW A;  2Y2L A;  3NUL A;  2ZQA A;  3OC2 A;  3T4S A;  3VE4 A;  3ZHH A;  4RYE A;  3O87 A;  2M7V A;  4IUK A;  1IEL A;  1N4O A;  2ZMF A;  3M2J A;  2IWD A;  1SDE A;  3BWL A;  2W1T B;  3NDG A;  1XJ3 A;  2Y4A A;  2J7V A;  3HLW A;  3VSK A;  3HVF A;  4C6Y A;  5GLA A;  4EES A;  4YIN A;  4LRY C;  4PHT A;  5KSH A;  1N9L A;  2Y2Q A;  4OPQ A;  2ZL1 B;  3A0V A;  5F1F A;  2M7U A;  4P6Z M;  4LV2 A;  4ZTK A;  3GSG A;  4XXR A;  4IVK A;  2VGL S;  2Z2L B;  2ZM8 A;  1DJC A;  3T50 A;  1XP4 A;  1CJF A;  1OJ5 A;  2A3U A;  3VE3 A;  1P97 A;  2QPN A;  4OOM A;  2O0Y A;  2ZM2 A;  4HNB A;  3PYP A;  3M6B A;  2D01 A;  3E4Q A;  1XA1 A;  4PM7 A;  3EOI A;  4MLL A;  3OCL A;  2EX8 A;  4JLF A;  1VB6 A;  1S6R A;  2HDR A;  1M6K A;  3CHW P;  2NUP C;  2Q9N A;  3WRZ A;  3KSF A;  4R1G A;  3LIF A;  2Y2K A;  3E98 A;  3U4L P;  5TR7 A;  5HZH A;  1GA0 A;  1MY8 A;  2KDK A;  1MXO A;  2WGW B;  4ETX A;  1SKF A;  3FV7 A;  2JKR M;  3D9Y A;  3PHY A;  2OLV A;  1K55 C;  2HV1 A;  1WE4 A;  2O99 A;  4NXB A;  3IBJ A;  3RTY A;  1G6O A;  2XEP A;  2HF6 A;  2Y2M A;  3Q7Z A;  1OME A;  4HBU A;  2WKH A;  2VJW A;  3A3J A;  1XJ4 A;  3BQA A;  5IS1 A;  4E3L A;  4RX3 A;  1JWV A;  4BBV A;  3E4P A;  3DBA A;  5L10 A;  3PAG A;  1P9W A;  3EQU A;  4ID4 A;  4JGP A;  4ZBE A;  4E3M A;  3PBN A;  3SW1 A;  4I39 A;  1T1B A;  2XFS A;  3GVB A;  3SH7 A;  1KVL A;  2B95 A;  3CI6 A;  2VGL M;  4ESP A;  3V50 A;  2XRO A;  1BUE A;  1QME A;  3W2Z A;  2OWH A;  5HWW A;  4KEN B;  3D3O A;  1PWG A;  4ARZ B;  3C2W A;  4Q0J A;  1ZKJ A;  1VHM A;  2RL3 A;  1ZC2 A;  4HQA A;  1PZO A;  2ZD8 A;  4G3K A;  4LEN A;  4HH2 A;  3TJZ C;  4WMC A;  3LEZ A;  3QP4 A;  3LID A;  5HDD A;  4N9K A;  4RA7 A;  2VGK A;  3ISG A;  4QU3 A;  2EXB A;  1LL5 A;  3Q07 A;  2DMW A;  1K54 A;  3IX8 A;  1YT4 A;  5EOE A;  3OPL A;  5CRF A;  1TEM A;  4BBU A;  5AJG A;  2AVX A;  4B88 A;  2ZC3 B;  3HLD A;  4HES A;  3N4I A;  3UY6 A;  3H7W B;  4OLD A;  3T4J A;  4B9O A;  5G4Z A;  2PU4 A;  2ZQ8 A;  1OTB A;  4JF4 A;  2Y79 A;  5EM0 A;  4Y0U A;  5KMW A;  4KQQ A;  1LI9 A;  3KSI A;  4UHU A;  3K3C A;  2CMN A;  4O01 A;  2EFX A;  4KZ3 A;  3FPW A;  2XH9 A;  3MZD A;  3CZD A;  4CQH A;  1NZU A;  4N1H A;  1ES5 A;  1YMS A;  2Y91 A;  2HJ9 C;  3D72 A;  4MN7 A;  5KIZ A;  3ZNT A;  3K2N A;  4KUK A;  4OPY A;  1HD8 A;  2WKR A;  3KSG A;  2VA0 A;  3P98 A;  3E4O A;  2EX9 A;  5L8M A;  1G5U A;  4OLG A;  4S2K A;  5CEC A;  4GB7 A;  3NOT C;  3Q7V B;  5DKL A;  4O0P A;  4XT2 A;  5EOO A;  5F83 A;  3FWL A;  4ZJ1 A;  3WS2 A;  1WYB A;  3B33 A;  1IYS A;  1DP8 A;  5AVF A;  4WZ4 A;  1ERQ A;  4Y2F A;  2ZLY A;  5M19 A;  3N8R A;  4Z1W A;  3RFB A;  3BFD A;  1VQQ A;  3G30 A;  3KYZ A;  1BLC A;  2GX5 A;  4DE2 A;  3PTE A;  3CPT B;  2VV6 A;  5BOH A;  4S2P A;  5CTN A;  3VP2 A;  4ZDX A;  1TS0 A;  4HI4 A;  4FOF A;  2A49 A;  2INW A;  3T4K A;  1CEG A;  1H3Q A;  3ITA A;  3MXR A;  2XF3 A;  2A2L A;  4DF6 A;  3BFG A;  2VKS A;  3MZE A;  3L9K A;  1KDS A;  3P09 A;  4EQI A;  5G18 A;  5FEF A;  3LIC A;  1KVM A;  3T4L A;  4X25 A;  4Q0I A;  4U0X A;  3ZVT A;  4K91 A;  3DTI A;  1U60 A;  1PRQ A;  2R78 A;  3PBT A;  1Y28 A;  5IHV A;  1L0G A;  4QWO A;  5HD3 A;  2ZMV A;  3T1S A; 
#chains in the Genus database with same CATH homology
 1L0E A;  1YLT A;  4FD8 A;  1XXM A;  1LI0 A;  1LLB A;  1LL9 A;  1XX2 A;  1TDG A;  4R3B A;  3S1Y A;  2OLU A;  3EQV A;  5FQQ A;  2Q9M A;  5CED A;  2XD1 A;  1CI9 A;  4OOL A;  1CEF A;  4RVA A;  1XGI A;  4X69 A;  2HP5 A;  4OP5 A;  2EFU A;  1FCN A;  2G2W A;  2HP6 A;  2P9V A;  3BFF A;  1NZO A;  3O86 A;  4KZ9 A;  4QD4 A;  1L2S A;  3IXG A;  4R3J A;  2FFF B;  3N8L A;  1SHV A;  4LCM A;  4GDB A;  4FH4 A;  5EVI C;  3VFF A;  3IF6 B;  4GDN A;  4QB8 A;  4E3J A;  5FI6 A;  1AXB A;  4DXB A;  5JYO A;  3NIA A;  5GLC A;  3UDI A;  1PI4 A;  3TG9 A;  4C75 A;  3G2Z A;  1W8Y A;  1JTD A;  3HBR A;  3Q82 A;  1IYO A;  3BEC A;  5GHX A;  3WS0 A;  1K4E A;  2R9X A;  4R0Q A;  4Q8I A;  3PBS A;  3UO9 A;  5J8X A;  3QHY A;  5GHY A;  4KQO A;  2Y2I A;  2ZQ9 A;  1Z6F A;  3MFD A;  4M3K A;  2ZQ7 A;  1HVB A;  5HFO A;  1BUL A;  4WMC D;  1GCE A;  5F82 A;  4X53 A;  1SCW A;  3IXB A;  4GZB A;  3RJU A;  3VMA A;  3C7V A;  4OQH A;  5FQI A;  2BLS A;  2DCF A;  3VOY A;  5DF8 A;  4H8R A;  3NY4 A;  3ZG7 B;  5DF9 A;  3BFE A;  3FKW A;  1I2S A;  2Y2L A;  1FR1 A;  1KGE A;  5CGW A;  5M1A A;  5FDH A;  2BG1 A;  3G34 A;  3HUM A;  4JXW A;  2ZQA A;  3OC2 A;  1QMF A;  5D3O A;  4A5R A;  4GOG A;  2Y2N A;  4GN2 A;  4E3O A;  3A3I A;  1IEM A;  3ZHH A;  2XDM A;  4RYE A;  3QNB A;  2JBF A;  4P87 A;  5EVI B;  3O87 A;  4BD0 A;  3LO7 A;  1IEL A;  4R23 A;  1S0W A;  3MKE A;  1N4O A;  4FH2 A;  2H0Y A;  1NY0 A;  3VP3 A;  1K38 A;  5CGS A;  3V3S A;  1J9M A;  5FAT A;  3M2J A;  3OPR A;  5GL9 A;  1ERM A;  1NYY A;  3IQA A;  4JF6 A;  2IWD A;  3OPH A;  1SDE A;  4YFM A;  4FSF A;  4X68 A;  4BEN A;  5TFQ A;  5HAR A;  3Q81 A;  2CC1 A;  3FKV A;  1K57 A;  4NET A;  3C4O A;  1W8Q A;  3NDG A;  5U47 A;  4PM9 A;  3SS4 A;  3AGD A;  5CEB A;  4B4Z A;  3UE3 A;  4P0M A;  1YLY A;  2Y4A A;  5AQ7 A;  2J7V A;  3HLW A;  4GKU A;  5FAS A;  3VSK A;  4BJP A;  3HVF A;  1KGG A;  5F1G A;  5GHZ A;  4KG5 A;  4S2L A;  4C6Y A;  5GLA A;  4YIN A;  5GLB A;  5EPH A;  5HAP A;  4WEJ A;  1ES4 A;  2C6W B;  2WGW A;  1XKZ A;  3IHB A;  4JF5 A;  5KSH A;  2Y2Q A;  4OPQ A;  5HAI A;  3UNW A;  3BRM A;  1XA7 A;  2JC7 A;  5F1F A;  4BLM A;  3HLC A;  3LY3 A;  2HDQ A;  2FFY A;  1K57 C;  1GHP A;  4LV2 A;  2XFT A;  4ZTK A;  2HPB A;  3GSG A;  3BEB A;  1KE3 A;  4Y0T A;  4LV3 A;  5KSC A;  3NBL A;  3N6I A;  3BFC A;  1E3U A;  3G32 A;  5FA7 A;  4XXR A;  5E2F A;  5AQ9 A;  4EUZ A;  4IVK A;  2V2F F;  1K25 A;  3ZG8 B;  2Z2L B;  1PWD A;  2ZM8 A;  1DJC A;  4UA6 A;  4LV1 A;  1XP4 A;  3N8S A;  5EVL A;  2H0T A;  3ZG9 B;  2A3U A;  4WEK A;  3VP1 A;  4OQ0 A;  1PZP A;  1PW1 A;  1Q2P A;  3G2Y A;  2Y2P A;  4IED A;  1CK3 A;  3M2K A;  5HX9 A;  3ZVW A;  3UPN A;  2QPN A;  4OOM A;  1FSW A;  5FSR A;  2ZM2 A;  3N7W A;  4BL3 A;  4QY6 A;  5A91 A;  3E2K A;  3IWO A;  3M6B A;  3ZFZ A;  1XA1 A;  1N9B A;  4PMA A;  4PM7 A;  1KE4 A;  4MLL A;  1FQG A;  2JCH A;  3DW0 A;  3G31 A;  2VGJ A;  3OCL A;  2EX8 A;  4JLF A;  3GTC A;  4LV0 A;  4IBX A;  4E3N A;  4QJG A;  3G35 A;  1S6R A;  3TSG A;  2HDR A;  1M6K A;  3TOI A;  2QZ6 A;  1ESI A;  5HW3 A;  3PBR A;  1K55 A;  2Q9N A;  3VP0 A;  4JPM A;  4KQR A;  4Y0O A;  3WRZ A;  4E6W A;  4R1G A;  5I94 A;  4PM8 A;  5AQA A;  1SDN A;  2XD5 A;  2Y2K A;  4R4R A;  2PBY A;  1K6S A;  2Y2O A;  4QY5 A;  1YLP A;  5TR7 A;  3M6H A;  1ALQ A;  4S2I A;  1MKI A;  4E3I A;  3GR2 A;  3UDX A;  2E8I A;  1GA0 A;  2X01 A;  4CJN A;  4R4S A;  5FQK A;  2C5W B;  1FSY A;  1MY8 A;  4KZ6 A;  4UAA A;  1HZO A;  3C4P A;  2P74 A;  2ZC4 B;  1JVJ A;  1MWU A;  3SH9 A;  5DF7 A;  1MXO A;  2WGW B;  4WYY A;  1SKF A;  1PWC A;  3FV7 A;  3AGE A;  1HTZ A;  4WM9 A;  2H10 A;  2OLV A;  3FYZ A;  4OQI A;  1K55 C;  4S2N A;  1I5Q A;  5E2G A;  3IWQ A;  3VOZ A;  1WE4 A;  4OQG A;  4GNU A;  3O3V A;  4FCF A;  2R9W A;  2XEP A;  1VM1 A;  4RX2 A;  2GDN A;  2Y2M A;  3Q7Z A;  1OME A;  1L0F A;  3ZDJ A;  4HBU A;  5A92 A;  2IWB A;  5EEC A;  2WZX A;  3S22 A;  5DTK A;  5HAQ A;  2WKH A;  2XR0 A;  2Y55 A;  3A3J A;  3OZH A;  5A93 A;  4E3L A;  3CG5 A;  4RX3 A;  4DE1 A;  1JWV A;  3VP4 A;  2WAF A;  3ZGA B;  5EVI D;  3PAG A;  3A3E A;  4K0X A;  4WBG A;  3HUN A;  1ERO A;  3EQU A;  4ID4 A;  1Y54 A;  4ZBE A;  4E3M A;  1K56 D;  1G6A A;  3PBN A;  4S2N C;  3ZG0 A;  1YLZ A;  2XQZ A;  3C7U A;  3MXS A;  3MZF A;  5DTS A;  3PAE A;  1MPL A;  4HBT A;  1DY6 A;  3IXH A;  4ZJ3 A;  5CHJ A;  3IXD A;  1KE0 A;  2XFS A;  3GVB A;  3E2L A;  5FAQ A;  3BM6 A;  4S2J A;  3SH7 A;  3VFH A;  1KVL A;  2RCX A;  2X71 A;  3WS1 A;  4OPR A;  3V50 A;  2WYX A;  1YMX A;  3SH8 A;  2ZC7 A;  1BUE A;  4OP8 A;  5E43 A;  1E25 A;  3A3F A;  1QME A;  5GLD A;  2UWX A;  2WAE A;  4E6X A;  4KEN B;  2WZZ A;  4MNR A;  4GD8 A;  1K4F A;  4QHC A;  4KZB A;  1PWG A;  3IH8 A;  1ZKJ A;  3O88 A;  2DRW A;  1YM1 A;  1PW8 A;  2RL3 A;  3SS5 A;  3JYI A;  3PBO A;  1WYC A;  1IYQ A;  1ZC2 A;  1L0D A;  2ZJ9 A;  1RP5 A;  2XGN A;  1MWT A;  1PZO A;  2ZD8 A;  5KZH A;  1FR6 A;  2ZQC A;  5FQM A;  1H8Z A;  1E4D A;  1MWR A;  1BTL A;  1PYY A;  4LEN A;  1W79 A;  2J8Y A;  2ZC6 B;  3ITB A;  4BD1 A;  4CPK A;  4HEF A;  1ES3 A;  4D2O A;  4WMC A;  3LEZ A;  2HDU A;  2WK0 A;  2J9P A;  4ZJ2 A;  2Y2G A;  4N9K A;  4RA7 A;  2VGK A;  3ISG A;  1XGJ A;  4QU3 A;  3Q7V A;  2EXB A;  1LL5 A;  3Q07 A;  4WZ5 A;  1K54 A;  4OPZ A;  1YT4 A;  4Y7P A;  4ZAM A;  5EOE A;  5CTM A;  2Z2M B;  1MBL A;  2WUQ A;  2ZMA A;  3OPL A;  4KG2 A;  4DE0 A;  3WS4 A;  5CRF A;  1NRF A;  1TEM A;  2ZQD A;  1RGZ A;  3D4F A;  4N1X A;  5A90 A;  1FOF A;  1EWZ A;  1JTG A;  4DE3 A;  3NC8 A;  4JXG A;  1DJA A;  4PPR A;  3HRE A;  1IYP A;  5E2H A;  2WAD A;  5TGF A;  4B88 A;  2ZC3 B;  3HLD A;  3OPP A;  3UPP A;  1BT5 A;  2DNS A;  2EX6 A;  3LY4 A;  3N4I A;  4HES A;  3UY6 A;  3WRT A;  4XUZ A;  2ZM0 A;  3W4O A;  5FI7 A;  3WS5 A;  4OLD A;  3NI9 A;  4GD6 A;  1GHI A;  5CGX A;  4E3K A;  1BSG A;  2PU4 A;  2ZQ8 A;  5CHU A;  4JF4 A;  4WZ5 C;  1K54 C;  3OCN A;  1ESU A;  1YQS A;  2EXA A;  4Y0U A;  5KMW A;  1IKG A;  3MKF A;  3BLM A;  1NJ4 A;  4KQQ A;  5FAO A;  1LI9 A;  3C5A A;  3BYD A;  3DWK A;  1O7E A;  3Q1F A;  1MWS A;  4UHU A;  2OSU A;  2ZC5 B;  2HP9 A;  4JXV A;  3HLB A;  4KZ8 A;  5FAP A;  3IHA A;  3GMW A;  1KDW A;  3IWI A;  3VSL A;  3CJM A;  2OV5 A;  5HL1 A;  3V39 A;  2EFX A;  4KZ3 A;  4WEL A;  1H8Y A;  2XH9 A;  3MZD A;  4P85 A;  2JE5 A;  3V3R A;  3ZG5 A;  1ZG6 A;  3CZD A;  3NCK A;  1NZU A;  4MBH A;  4DKI A;  4N1H A;  1ES2 A;  1IKI A;  1ES5 A;  3V5M A;  1XPB A;  1YMS A;  2Y91 A;  1TDL A;  2Y2H A;  1LHY A;  3ZNT A;  4MEZ A;  4U0T A;  4DDY A;  4N9L A;  4OKP A;  3W4Q A;  3ZCZ A;  1RGY A;  2Y59 A;  4C3Q A;  4BQM A;  4OPY A;  1HD8 A;  2B5R A;  4N92 A;  1YLW A;  3W8K A;  1ZG4 A;  3P98 A;  3UDF A;  4X56 A;  2EX2 A;  4B4X A;  1BLP A;  4DXC A;  2EX9 A;  4OH0 A;  1BLS A;  1E3U D;  4OLG A;  4S2K A;  5CEC A;  4GB7 A;  1FCM A;  5FI2 A;  4PM6 A;  3Q7V B;  5FQ9 A;  3G4P A;  4XUX A;  1JWZ A;  3QNC A;  3CMZ A;  1H5X A;  5EUA A;  1FCO A;  3IT9 A;  3ZNY A;  5EOO A;  1W7F A;  3WWX A;  4MBK A;  3RXX A;  1NXY A;  3DTM A;  1ONG A;  3S4X A;  2WKE A;  4JXS A;  5AQB A;  3HUO A;  4JKT A;  3FWL A;  5F83 A;  4ZJ1 A;  5FQJ A;  3WS2 A;  4P6B A;  1WYB A;  1YLJ A;  1DJB A;  1C3B A;  1IYS A;  1K6R A;  2H5S A;  4KG6 A;  3RXW A;  4EWF A;  4WZ4 A;  1ERQ A;  2ZLY A;  4BL2 A;  1PI5 A;  4F94 A;  5M19 A;  2XK1 A;  3IF5 A;  3N8R A;  4OVD A;  3FZC A;  4EBP A;  1I2W A;  4X6T A;  5CXW A;  1GHM A;  4DRT A;  1KGF A;  4KZ7 A;  3UPO A;  3BFD A;  1VQQ A;  3G30 A;  2I72 A;  3B3X A;  3PBQ A;  1BLC A;  1G68 A;  3W4P A;  2XLN A;  4U3T A;  3IF6 A;  3IH9 A;  1M40 A;  1BLH A;  4OON A;  4EBN A;  2G2U A;  4K0W A;  3DWZ A;  4DE2 A;  2V20 A;  3PTE A;  1TVF A;  4PM5 A;  3HL9 A;  4JBF A;  4OOY A;  4Z9Q A;  5L2F A;  2P9V B;  3BLS A;  4IBR A;  3SS3 A;  5BOH A;  4L0L A;  4S2P A;  4UA9 A;  5CTN A;  3VP2 A;  4ZDX A;  1W5D A;  2WGI A;  3GRJ A;  3AGF A;  1RCJ A;  4KZA A;  2J9O A;  2A49 A;  3GV9 A;  1CEG A;  4S2O A;  1BZA A;  3ITA A;  3HLE A;  3MXR A;  2XF3 A;  3SOI A;  4DF6 A;  3BFG A;  4S2M A;  3IF6 C;  3MZE A;  3MBZ A;  1KDS A;  3P09 A;  4EQI A;  4UA7 A;  1JWP A;  5CER A;  4KZ5 A;  5JYP A;  3HLF A;  4NK3 A;  1O07 A;  2QMI A;  3UE1 A;  3UN7 A;  5G18 A;  1KVM A;  4EBL A;  1NYM A;  2V1Z A;  3LCE A;  4O7D A;  5DVA A;  1Q2Q A;  1ONH A;  4X55 A;  4DDS A;  2PU2 A;  3HLG A;  1PIO A;  4U0X A;  2IWC A;  3ZVT A;  1GA9 A;  2WKI A;  4KZ4 A;  5EE8 A;  2HDS A;  4MBF A;  3A3D A;  3GQZ A;  4K91 A;  4EV4 A;  1U60 A;  5EVI A;  3NDE A;  2Y2J A;  5E2E A;  1CI8 A;  3UE0 A;  5M18 A;  2WGV A;  3PBT A;  5DTT A;  2X02 A;  4LCL A;  5IHV A;  1L0G A;  4IVI A;  1K56 A;  5CHM A;  3I7J A;  1EI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...