1BLCA

Inhibition of beta-lactamase by clavulanate: trapped intermediates in cryocrystallographic studies
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELNYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Inhibition of beta-lactamase by clavulanate. Trapped intermediates in cryocrystallographic studies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(acting in cyclic amides)
total genus 95
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1993-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1blcA00
2ZM0A 5DF8A 3A3JA 4H8RA 1PWGA 4F94A 3BYDA 2XLNA 3ZVWA 4JKTA 3OPPA 4B88A 3W4OA 1FOFA 2ZQ8A 2ZQCA 4OLGA 5CTMA 2HDUA 3AGDA 4WEJA 5TGFA 5A92A 3PBOA 1MWUA 3VFHA 3ZNYA 2V20A 1NXYA 1GHIA 3BFGA 3PBTA 3PTEA 3G2ZA 3BFFA 3LY4A 3V5MA 4ZTKA 2A49A 1XX2A 3HLFA 1W8QA 3OPHA 3Q82A 4OQHA 5EE8A 4PPRA 4DE3A 1RCJA 4ZAMA 3NBLA 2Y2MA 3NDEA 4OOMA 3WS2A 4EWFA 4ID4A 1Z6FA 5GLAA 3BFCA 4ZDXA 5EPHA 2R9WA 3ZFZA 1RGZA 4OQGA 5KSHA 1FCMA 1H5XA 4E3IA 1BULA 3Q7VA 3ZGAB 5GHYA 2IWDA 4OKPA 1G6AA 3GRJA 2Z2MB 3PBSA 1CI9A 1SDNA 3M6BA 3WS5A 4JXVA 2H5SA 4X53A 1M40A 4OPZA 5FAPA 1FR1A 4XXRA 5DF7A 4DE2A 4RA7A 2XGNA 3A3FA 3MZFA 1FSYA 4CJNA 5A93A 4FD8A 5CGWA 4DF6A 3GTCA 3HUMA 1G68A 3OCNA 1KE0A 4FSFA 1CEFA 1S6RA 3PBQA 5AQ9A 5CEBA 3E2KA 2QMIA 1K6RA 1ES3A 4LV0A 5M1AA 3LEZA 4BL2A 2WAEA 1ES4A 5GLBA 3MKEA 3VP0A 2ZC4B 5GL9A 2Y55A 1TEMA 4UAAA 3P98A 1DJCA 3ZDJA 2WKIA 3P09A 5FA7A 3V39A 4KG5A 2XF3A 4PM7A 3VOZA 3FZCA 5CHJA 4YINA 3VMAA 1L0FA 4HBTA 5EOOA 4PMAA 1YMXA 5EVIC 1MWTA 1ONHA 4UA7A 2ZQAA 3VSLA 1FR6A 3OPRA 5M18A 3HREA 3HBRA 1IYOA 3GV9A 1ALQA 1GCEA 1O7EA 1FQGA 1PYYA 5AQBA 4QU3A 2CC1A 1CI8A 1Q2QA 4KZ7A 5GHXA 5FQ9A 4WEKA 2HDQA 1WYCA 4JXSA 1I2SA 2WADA 3D4FA 4GKUA 4GDBA 5HX9A 3V3SA 4LCMA 4OOLA 4S2LA 1KGFA 4OPYA 5DTKA 2R9XA 1BLPA 1W8YA 3A3IA 4N1XA 4WBGA 2JC7A 4GOGA 1TDLA 2WYXA 3UE1A 2P9VB 2HPBA 3M2KA 3N8LA 5L2FA 2V1ZA 4BLMA 1SHVA 2WK0A 4MNRA 1BTLA 3IHAA 4HBUA 4WMCA 3ZG9B 4KQOA 3HLCA 3AGFA 4GZBA 3DTMA 3V3RA 1BUEA 3QNCA 1J9MA 4S2OA 3Q1FA 4Y7PA 3ZHHA 4DDYA 1K54C 4O7DA 3IH9A 2XR0A 4R23A 1U60A 5FAOA 4QY5A 5FQKA 1Y54A 3RXXA 3UE3A 1BLHA 3ZG8B 1KGGA 4Y0UA 3A3DA 3SS5A 4OPRA 1DJAA 4MEZA 4Q8IA 1O07A 5EVIB 4EBLA 2HP9A 4ZJ1A 3TG9A 3C4OA 4PM8A 3IF6A 4Z9QA 3N8RA 3UDIA 3UNWA 4S2KA 2EX8A 1H8ZA 4KZ4A 2OSUA 3HUOA 4C6YA 1ES5A 2EX9A 2PU4A 3HLEA 3PBNA 4WYYA 5FQJA 3HL9A 2XH9A 4BQMA 3HLBA 1VQQA 4WELA 4GB7A 2ZC7A 1RP5A 3BM6A 1BSGA 4GDNA 2Y2QA 3LO7A 1JVJA 3N4IA 4MBFA 3SH7A 1KVLA 1DY6A 2WGIA 5F1GA 5U47A 5CXWA 4DDSA 1FCOA 1KE4A 1IYPA 1GHMA 2ZC3B 3O87A 4S2IA 3IH8A 4K0XA 1PZOA 2Y91A 1W5DA 5CGXA 4RX3A 3NDGA 5FI6A 2Q9NA 3QNBA 4KQQA 5GLCA 3BLSA 4BENA 3B3XA 1ZG6A 4QD4A 4WM9A 5IHVA 4XUXA 4ZBEA 4R3BA 1E3UA 2H10A 1LL5A 1CK3A 4S2PA 5FSRA 2XD1A 4NETA 3WS4A 5F83A 2P74A 3SH8A 2DNSA 5D3OA 4B4ZA 1XXMA 1IYQA 4JBFA 1PW1A 2C6WB 3IWIA 3A3EA 5I94A 3ISGA 4PM6A 3UPPA 1BLSA 4X68A 4R4RA 4RVAA 2X01A 3SOIA 1ZKJA 1KGEA 2OLVA 4MBKA 3VFFA 2XDMA 1WYBA 1E4DA 3LCEA 1ONGA 1Q2PA 2B5RA 3FKVA 5TFQA 4KZ5A 1N4OA 3C5AA 2H0TA 1KDSA 4EBPA 5EUAA 2HP6A 1TDGA 4GNUA 4UA9A 3N7WA 2BLSA 1NYYA 4IVKA 1PIOA 4X55A 1YM1A 3CMZA 3Q7ZA 4BD0A 4BD1A 4E3LA 4OP5A 4U0TA 1SKFA 5DTSA 1K56A 2Y2GA 4D2OA 4L0LA 1ZG4A 3GQZA 5DF9A 4R4SA 4UA6A 4KZAA 3UE0A 5CGSA 3MZDA 1XGIA 4KENB 2WZXA 2QPNA 4E6WA 4QB8A 4HESA 1GA9A 1YMSA 1PWCA 1ESUA 4M3KA 3PAGA 4KQRA 4LV1A 4EV4A 3MZEA 1EI5A 1MY8A 1BZAA 2Y2OA 2PBYA 1EROA 1YLTA 3TSGA 3UPNA 4MLLA 4QJGA 2EXBA 4IVIA 1RGYA 2UWXA 4JPMA 4X69A 2J7VA 3BEBA 3IQAA 3NIAA 2Y2HA 1K4FA 3VP3A 4DXCA 3MKFA 5HAPA 5BOHA 5DVAA 2C5WB 5E2FA 1M6KA 1NYMA 4K0WA 3VP1A 4N92A 2Y2JA 2P9VA 2BG1A 3NI9A 4OPQA 5A90A 2Y4AA 2Y2PA 4LV3A 1K6SA 3ZG5A 1XA1A 4E3JA 2Y59A 4E6XA 1OMEA 1QMEA 1YT4A 3HLWA 2JCHA 4FH2A 1VM1A 2J9OA 1ERMA 2G2UA 4DXBA 5JYOA 3IXBA 5JYPA 5M19A 3N6IA 3WS0A 5EVIA 2X71A 2XK1A 1S0WA 1HVBA 3ZVTA 3W4PA 1IYSA 1K57C 4R0QA 3IT9A 3JYIA 4RYEA 3O86A 3O88A 3EQUA 3IXGA 1NY0A 5HFOA 4PM9A 5A91A 1K55C 1LI0A 2Q9MA 3IF5A 1FCNA 3G31A 4Y0TA 4N9LA 3LY3A 5HW3A 2WKEA 3ITBA 2WGWB 4KZBA 4U3TA 1LLBA 1XGJA 2Y2LA 3W8KA 3WRTA 3VP2A 2Y2IA 2EXAA 1I5QA 4QY6A 4S2NC 3DW0A 3S22A 2Y2NA 3Q81A 3WS1A 4DE1A 1K57A 3VOYA 5CEDA 3MBZA 4E3OA 2XFTA 2J9PA 2JE5A 2OV5A 3SS4A 4X56A 1SCWA 2ZM2A 4JLFA 5F1FA 3G4PA 2DRWA 1XPBA 5E43A 2EX2A 3GVBA 1K54A 1HD8A 3E2LA 4WMCD 4WZ5C 2WKHA 4JXWA 1YLJA 3UDXA 3GMWA 3DWZA 3NC8A 1MWRA 2JBFA 1AXBA 3IWOA 3ZNTA 4P87A 4E3NA 1L0DA 1MXOA 2QZ6A 4KG6A 3CZDA 5CERA 2IWBA 4P0MA 1PI5A 3WRZA 4OH0A 3M2JA 4OVDA 3IXHA 4EUZA 5HL1A 1KDWA 4PM5A 3BFDA 3HLDA 1L0GA 3ZG7B 1MWSA 2XQZA 2VGJA 3FV7A 2X02A 3IF6B 5FQMA 3BLMA 4JF5A 3C4PA 1ERQA 3GSGA 4GN2A 3RJUA 3TOIA 4C3QA 4R1GA 2WZZA 1L0EA 1K4EA 2Z2LB 1ZC2A 2EX6A 3VP4A 1JTGA 1IELA 3CG5A 1FSWA 3FKWA 1MBLA 1YLPA 5AQAA 2ZD8A 3GR2A 4ZJ2A 1XKZA 3C7UA 3Q07A 2WUQA 3V50A 1MPLA 5J8XA 3NY4A 3HLGA 1BLCA 2RCXA 5HARA 1W7FA 3UY6A 5E2EA 4YFMA 1E3UD 3NCKA 1YLZA 1BT5A 5E2HA 5HAIA 5EOEA 3IWQA 2FFFB 4GD6A 4KZ9A 1PWDA 2ZLYA 2EFUA 3BECA 5GLDA 1CEGA 2J8YA 4RX2A 2HDSA 3UN7A 2ZQDA 3FYZA 4C75A 2FFYA 4IBXA 1DJBA 4P85A 4BJPA 1JWVA 4N9KA 5HAQA 4A5RA 2A3UA 4BL3A 1YLYA 2WGVA 1QMFA 3PBRA 2ZC6B 5G18A 3OPLA 1ES2A 4GD8A 5CTNA 4ZJ3A 4DE0A 4X6TA 3HVFA 3Q7VB 3M6HA 4JXGA 4LV2A 3MXSA 3C7VA 4OQ0A 2RL3A 3O3VA 4IEDA 3S1YA 4Y0OA 5E2GA 1K25A 3G35A 3G34A 1K56D 4LCLA 5CECA 1I2WA 2ZJ9A 4QHCA 5EECA 3WWXA 4DRTA 2H0YA 1NZUA 1PZPA 1YLWA 5FASA 4B4XA 4IBRA 4K91A 4E3KA 2ZM8A 5FI2A 3S4XA 3VSKA 2WGWA 2ZMAA 1E25A 1PI4A 4S2JA 5EVLA 4DKIA 5FATA 4JF4A 3G30A 2HDRA 3RXWA 5FQQA 2VGKA 5FI7A 1HTZA 2DCFA 1MKIA 1ESIA 2V2FF 2Y2KA 3HUNA 3OC2A 3UPOA 1KE3A 4R3JA 1WE4A 4OP8A 1EWZA 4P6BA 3ITAA 5KMWA 3QHYA 2ZQ7A 1NJ4A 3OZHA 5FAQA 2WAFA 2EFXA 3IXDA 4EBNA 1JWPA 5DTTA 4E3MA 4N1HA 5FQIA 1C3BA 4OLDA 3N8SA 1XP4A 4NK3A 2XFSA 5CHUA 4CPKA 1NZOA 1GA0A 2I72A 2XEPA 2OLUA 5CHMA 3ZCZA 2IWCA 4FCFA 3OCLA 2G2WA 3IF6C 3CJMA 4S2MA 2HP5A 1SDEA 1LHYA 4KZ3A 3SH9A 2E8IA 4WZ4A 5EVID 3MXRA 4OONA 1YQSA 4FH4A 3DWKA 3MFDA 1K38A 3IHBA 3UO9A 4EQIA 2ZC5B 5TR7A 1K55A 1HZOA 1W79A 4KZ8A 5FDHA 3I7JA 3SS3A 3BFEA 1LI9A 5F82A 3G2YA 1JWZA 3BRMA 5KZHA 1IKIA 1KVMA 4U0XA 3UDFA 3PAEA 3ZG0A 4XUZA 1GHPA 4HEFA 5GHZA 3FWLA 4OOYA 1XA7A 2GDNA 1JTDA 4KZ6A 1NRFA 4S2NA 4MBHA 1IKGA 3EQVA 3W4QA 1PW8A 4UHUA 1TVFA 2PU2A 3AGEA 1IEMA 4LENA 5CRFA 1LL9A 4OQIA 3G32A 5AQ7A 4WZ5A 1L2SA 1H8YA 2XD5A 4KG2A 4JF6A 2ZQ9A 5KSCA 1N9BA
chains in the Genus database with same CATH superfamily
4CLCA 1YSQA 3T1SA 4OLGA 3AGDA 3ZNYA 3P01A 1GHIA 3G2ZA 2A49A 4OQHA 3Q82A 2KDKA 4FTXA 3NDEA 3QP4A 3MQ0A 1Z6FA 3H7WA 4UEYA 1FCMA 1H3QA 2Y79A 1OT6A 3ZGAB 3GRJA 5EFWA 1CI9A 2H5SA 5HZHA 5DF7A 4RA7A 2W0NA 4CJNA 2W1TB 3GTCA 2P08A 4FSFA 1OTBA 5AQ9A 5EM1A 5CEBA 3E2KA 5EV0A 1VETA 4BL2A 3K2NA 1YSPA 2ZC4B 5GL9A 4Y13A 1DJCA 2WKIA 5FA7A 2OWHA 3NECA 3T1RA 2XF3A 4PM7A 3VMAA 4YINA 5EVIC 2ZQAA 1FR6A 3KYZA 3HBRA 1ALQA 4H6JA 4JGQA 4WEKA 2HDQA 4GKUA 5DTKA 1W8YA 3TW8A 1TDLA 4O8GA 1SHVA 3DTMA 4XT2B 3V3RA 5EVEA 1BUEA 3QNCA 2O9BA 3Q1FA 4Y7PA 3ZHHA 1K54C 4E04A 3UE3A 3SS5A 4Y0UA 3T50A 3DBAA 3TG9A 4Z9QA 1H8ZA 3MXQA 4GCZA 2PU4A 5FDSA 3F1NA 3HLBA 4WELA 4GB7A 3A0VA 1A0KA 4GDNA 4EERA 4MBFA 1KVLA 2ZC3B 1PZOA 1W5DA 2PT7A 3QNBA 3E98A 5IHVA 1DP8A 1E3UA 2H10A 4FUWA 4S2PA 3CPTA 5FSRA 3SH8A 4B4ZA 5D3OA 1XXMA 1IYQA 5J7EA 1YPRA 4JBFA 5G4ZA 4II7A 2C6WB 2PYPA 3IWIA 3ISGA 4PM6A 3MJQA 2X01A 3SOIA 1ZKJA 2JKRI 2YKHA 3BY8A 4KZ5A 2H0TA 1KDSA 2BLSA 4P6ZM 3F1OB 3QP1A 4EESA 4U0TA 4D2OA 1ZG4A 5DF9A 5HWWA 4R4SA 5FEFA 4KZAA 4KENB 2QPNA 4X1LA 3FC7A 5DKLA 1LL8A 1EI5A 2Y2OA 3ICYA 4QJGA 1RGYA 2UWXA 2J3TC 4Y17A 2Y2HA 1K4FA 4D60A 3MKFA 1P97A 5BOHA 5HAPA 2Y2JA 2BG1A 5A90A 4I3AA 3ZG5A 3T4SA 2HZ5A 2J9OA 1ERMA 5M19A 2PR5A 5EVIA 1VETB 1IYSA 1SZVA 3O86A 2V1BA 2V1AA 1XFQA 1DP6A 2WGWB 1LLBA 1XGJA 3WRTA 2EWWA 1VEUA 2ZL1A 2VV6A 1K57A 4H6JB 4E3OA 3SS4A 5E43A 1V9ZA 1K54A 1HD8A 3E2LA 4WMCD 4IHQA 5HPIA 4EETB 2B02A 3LGOA 4E3NA 1MXOA 3CZDA 2IWBA 1KDWA 1LSXA 2G7UA 1MWSA 3LI9A 3SW1A 3HCYA 2HJEA 1ZHHB 3FV7A 2X02A 2P7JA 4JF5A 3C4PA 4C3QA 4DJ2A 4R1GA 1L0EA 1K4EA 3CG5A 4ZJ2A 1XKZA 3Q07A 4Q0HA 2WUQA 5L10A 3V50A 4MCWA 1WA9A 4O01A 3NY4A 2RCXA 5HARA 3UY6A 3KX0X 3NCKA 1BT5A 3MQOA 5EOEA 4P6ZS 1OJ5A 2J8YA 4RX2A 2DMWA 2FFYA 4P85A 4GHIB 3UB5P 4BJPA 4BL3A 2WGVA 3C2WA 2ZC6B 4GD8A 4DE0A 3KSIA 2W27A 3M6HA 4JXGA 4LV2A 2RL3A 5E2GA 3G35A 4Z1WA 1K56D 2ZJ9A 1YLWA 1CQAA 4IBRA 4E3KA 3KYQA 4PKYG 4G3WA 3OBFA 3G30A 4ARZA 2VGKA 2VKSA 4Q0JA 2V2FF 3A0RA 4G3KA 4OP8A 3ITAA 3OZHA 5FAQA 1Y4OA 3IXDA 3T1XA 5DTTA 4IJGA 4OLDA 2XFSA 2L4RA 2I72A 3QP5A 3D9YA 3IF6C 2JHEA 3SH9A 3BJNA 1YQSA 4EQIA 2W3DA 2ZC5B 5TR7A 3SS3A 1W79A 5F82A 5KZHA 1IKIA 1KVMA 3PAEA 2O9CA 3T1QB 5GHZA 3FWLA 4KZ6A 1GSXA 5HDSA 2VLGA 2HJ9C 3W4QA 1L2SA 5KSCA 2ZL1B 1PWGA 4MDZA 3BYDA 2WKRA 4YNRA 4B88A 3W4OA 2ZQ8A 2ZQCA 5CTMA 3LR4A 2MJ6A 5TGFA 1MWUA 3VFHA 2L0WA 2V20A 3PTEA 3LY4A 3V5MA 1X0OA 4ZTKA 1XX2A 4EU0A 3OPHA 4DE3A 3IBJA 1RCJA 4R38A 3C30A 4ID4A 5GLAA 3BFCA 4ZDXA 5KSHA 1H5XA 4E3IA 2IWDA 4B93A 2INWA 4OKPA 3MQQA 4MN7A 3M6BA 3WS5A 4JXVA 4X53A 1FR1A 2QWSA 3A3FA 3LR3A 1FSYA 1P9WA 3HUMA 4Y5FA 4LV0A 3LEZA 2W3HA 3V39A 3MSHA 3FZCA 5CHJA 4HBTA 1D06A 1YMXA 1MWTA 5HDCA 3HREA 4HQAA 3GV9A 1O7EA 4LFUA 1FQGA 2CC1A 4ZRRA 5FQ9A 3FG8A 5HX9A 1WYCA 3WS1A 4OOLA 4OPYA 2R9XA 5EM0A 5J4EA 2VJWA 3A3IA 4WBGA 2JC7A 2WYXA 2HPBA 4R70A 3N8LA 4K08A 1UWNX 2E8JA 1XJ4A 2XSSA 4MNRA 1BTLA 4HBUA 3HLCA 3AGFA 2QJ5A 4GZBA 4LRXC 1J9MA 2JKGA 4GS9A 2XR0A 5FQKA 3ZG8B 1KGGA 1O07A 2V0WA 1T1BA 4ZJ1A 3IF6A 2EX8A 4KZ4A 4C6YA 3HLEA 4WYYA 4BQMA 1P9RA 2ZC7A 3T4QA 3BM6A 3N4IA 1JVJA 3SH7A 3DTEA 5F1GA 5CXWA 1IYPA 2Z6CA 4S2IA 3IH8A 1OTAA 3R7WA 4ESPA 2Q9NA 1YAXA 1ZG6A 4NXFA 4X25A 3CAXA 1CK3A 1TS7A 3H9WA 2DNSA 1S1YA 1PW1A 2LB9A 4CLCD 3UPPA 1BLSA 4R4RA 1KGEA 2OLVA 4WUJA 1ONGA 1T19A 1N4OA 5KIZA 2I9VA 4GNUA 1TDGA 3VE3A 1Y28A 2PD7A 4HP4A 3LEQA 4X55A 3Q7ZA 4LLOB 4BD0A 4E3LA 4DN0A 3GQZA 2JKTI 3F1PB 5CGSA 3MZDA 5HD5A 4E6WA 1YMSA 1PWCA 4M3KA 3PAGA 4LV1A 1BZAA 4NXEA 3UPNA 2EXBA 2P04A 4JPMA 4X69A 2J7VA 3BEBA 3LYXA 3RTYA 2XA7M 3B42A 5E2FA 3O5YA 4K0WA 3VP1A 4N92A 2P9VA 4OPQA 2Y2PA 1SKOA 1XA1A 2W3EA 1OMEA 1QMEA 3IS2A 2D02A 1YT4A 2OWJA 2JCHA 1VM1A 2O0YA 1F9IA 4Y15A 5JYPA 3ZVTA 1HVBA 3W4PA 1K57C 1OTIA 4MN5A 3JYIA 4BBVA 5HFOA 4PM9A 2Q9MA 3LIBA 3G31A 2A2LA 3H82B 3R4KA 3E0YA 2Y2IA 5AJGA 3BQ8A 4HHDA 1I5QA 2D01A 4S2NC 3S22A 4DE1A 4KUOA 3TJZC 2J9PA 3ZQ5A 4X56A 3EEAA 5F1FA 4YWZA 1XPBA 2EX2A 3GVBA 2WKHA 1YLJA 3EOIA 3HJKA 3NHQA 3GMWA 3NC8A 1OJGA 1MWRA 1N9LA 4P87A 2A24A 4P0MA 3WRZA 4OH0A 3IXHA 4EUZA 3MFXA 3BFDA 2IA2A 3FPWA 2XQZA 3IF6B 5FQMA 3BLMA 1EW0A 1ERQA 4GN2A 2WZZA 2PR6A 3EEHA 1FSWA 3GR2A 3EWKA 2ZBBA 4CLCB 1W7FA 3S7PA 5E2EA 4YFMA 1E3UD 4L9GA 1YLZA 2LB5A 5E2HA 3IWQA 2FFFB 2EFUA 3BECA 5GLDA 1CEGA 2VGLM 2B18A 1F2KA 4N9KA 2A3UA 1YLYA 3H7WB 1QMFA 3S7OA 3LR0A 1LT0A 5G18A 5CTNA 3PXPA 4LGWA 4BBUA 5MC7A 5CECA 2XA7S 1I2WA 3WWXA 2QYBA 2EA9A 1PZPA 2V0UA 5FASA 4B4XA 4K91A 2ZM8A 1W63Q 4JGRA 5FI2A 3UE6A 2BTFP 3VSKA 3T12B 2ZMAA 4DKIA 4WL9A 3RXWA 5FQQA 3VV4A 4IUHA 3CITA 4EW7A 3HUNA 1KE3A 1PNEA 1WE4A 5A8BA 1EWZA 1S67L 3B33A 1NJ4A 2WAFA 4N1HA 3N8SA 2J80A 1XP4A 4CQHA 2OLUA 3ZCZA 4F3LA 4MN6A 5TBMA 2E8IA 1SKOB 5EVID 3MXRA 1S4RA 3IS2B 3MFDA 1HZOA 3I7JA 3BFEA 1LI9A 2JKFA 4U0XA 3ULFA 2ZMVA 1OTEA 1JTDA 1NRFA 1NRJA 4S2NA 4HJ3A 4MBHA 1IKGA 3EQVA 1IEMA 4OQIA 2VK3A 2XD5A 3OLOA 2ZQ9A 3DAVA 1N9BA 3NULA 4F94A 3JPUA 2XLNA 3ZVWA 4JKTA 2VX8A 2HF6A 3F1NB 2HDUA 3T4LA 4WEJA 3BFGA 4LRZE 1FIKA 5L8MA 1JNUA 5EE8A 4PPRA 4EWFA 2ZMFA 2Y2MA 3NBLA 4OOMA 2GZAA 3Q7VA 3CPTB 2ZOHA 5GHYA 4NXBA 2Z6DA 1G6AA 2VGLS 1SDNA 1M40A 4OPZA 2B95A 4XXRA 4DE2A 3MZFA 4DF6A 1G68A 4EUVA 3T4OA 3OCNA 1KE0A 1S6RA 3PBQA 5K5BA 2QMIA 1ES3A 5G4YA 2WAEA 1ES4A 5GLBA 3MKEA 2Y55A 1TEMA 4UAAA 3IX4A 2VV7A 4LRYC 3P7NA 1L0FA 5EOOA 3NOTC 1ONHA 2AVXA 4GW9A 3LIDA 2WKQA 3VSLA 5IT5A 5M18A 5DFXA 2XRNA 1IYOA 4M4XA 1GCEA 2V9AA 2BASA 1Q2QA 1VHMA 4KZ7A 5GHXA 3UMEA 1I2SA 3D4FA 4S2LA 1KGFA 4N1XA 3LUQA 2J3TD 3M2KA 1TF1A 2V1ZA 4BLMA 4HJ6A 3RH8B 3ZG9B 3FPVA 4KQOA 2EWVA 4R23A 5FAOA 3W2ZA 3ZNTA 3RXXA 1BLHA 3A3DA 4OPRA 1D7EA 2YKFA 5EVIB 3S7QA 3DTIA 4PM8A 2OSUA 2PAVP 3MMHA 2EX9A 3PBNA 1T18A 3HL9A 2XH9A 1OTDA 4R3AA 3LO7A 1VEUB 2WGIA 4F3LB 5TBMB 1FCOA 3LIAA 4PKYA 3O87A 4K0XA 5HL6A 4UQIM 4RQ9A 3NDGA 5FI6A 4KQQA 3BLSA 4WM9A 1LL5A 1H0MA 1DRMA 2XD1A 3WS4A 2P74A 3VOLA 3QP8A 2FZ0A 4I38A 4I3JA 1MC0A 3KSGA 5FL3A 3CLOA 3D3OA 1XJ3A 2W1TA 4RVAA 4X68A 4MBKA 3VFFA 2XDMA 1E4DA 3LCEA 3FKVA 5TFQA 3C5AA 3NOPC 3UB8A 2HP6A 3K3CA 3N7WA 3C8CA 1NYYA 3PHYA 1PIOA 2GNXA 2CMNA 1F98A 1YM1A 3CMZA 5J3WA 2M1CA 4QWOA 4OP5A 1CF0A 1SKFA 5DTSA 2Y2GA 4ETZA 4L0LA 3UE0A 1XGIA 2WZXA 1GA9A 2O99A 3L9KA 1ESUA 3CHWP 3E4PA 4KQRA 3MZEA 1MY8A 2PBYA 1EROA 1YLTA 4MLLA 5AVFA 1V9YA 3IQAA 4KQDA 4DXCA 5DVAA 2C5WB 1M6KA 1NYMA 4NG2A 3NI9A 2L1MA 2WKPA 2UV0E 3CI6A 3E4OA 4E3JA 4E6XA 4XT2A 3HLWA 4HNBA 4FH2A 3EGXC 2G2UA 4DXBA 3IXBA 2VEAA 1S0WA 3IT9A 4RYEA 4EXOA 3O88A 3IXGA 5A91A 1LI0A 3IF5A 4Y0TA 4N9LA 3VE4A 4U3TA 2FH5A 2Y2LA 5IU1A 3W8KA 4ARZB 2VV8A 3VP2A 2EXAA 4QY6A 2VZWA 2Y2NA 3Q81A 3VOYA 3GDIA 2XFTA 4L9EA 1ZTUA 2JE5A 2OV5A 2ZM2A 4JLFA 2DRWA 3KSHA 2VA0A 5F5YA 5FEGA 4JXWA 3UDXA 3MR0A 2ACGA 1AXBA 3D72A 3IWOA 2M7VA 3V67A 1L0DA 2QZ6A 4KG6A 1D1JA 2HV1A 1PI5A 5HL1A 4OVDA 3M2JA 5I5LA 4UQIS 4CLCE 1L0GA 1TS8A 3MF0A 3UB6A 3NJAA 3TOIA 1XJ2A 1ZC2A 4O0PA 3F1OA 1YLPA 5AQAA 1NWZA 3G6OA 1MPLA 5J8XA 1MZUA 4WN5A 2HGVA 5DJUA 3JVUA 5HAIA 4GD6A 4KZ9A 2ZLYA 2HDSA 4ETXA 2QHKA 4IBXA 4PAUA 3LIEA 1JWVA 4A5RA 1Z09A 1TD5A 3PBRA 1ES2A 1K0KA 1LSVA 3MXSA 3C7VA 1GSWA 4Y0OA 2R78A 3G34A 3OOVA 4DRTA 1NZUA 4ME4A 4R6LA 3EGDC 1TS6A 1TS0A 4HH2A 4B9OA 3S4XA 1ODVA 4I39A 2WGWA 1E25A 1PI4A 1PRQA 2HDRA 5FI7A 3LICA 2XROA 1MKIA 1G6OA 3UPOA 3U4LP 2PRFA 3QHYA 1NLZA 4NEED 4BBTA 1FILA 1JWPA 3K3DA 5FQIA 1L3LA 5CHUA 4FOFA 1NZOA 1GA0A 4L9FA 2IWCA 4FCFA 3L7HA 3KYEA 3UB7A 4EEPA 1LHYA 4Q0IA 3KO6A 3PYPA 5IS1A 3DWKA 4KZ8A 4HP9A 4LPZA 3G2YA 1JWZA 3BRMA 5L07A 2GDNA 1T1CA 2PBDP 1S1ZA 3A0SA 2Q0OA 4GS9B 1LL9A 4NXGA 3G32A 5AQ7A 3GECA 4I5SA 2ZM0A 5DF8A 3A3JA 4I3IA 3UB9A 4H8RA 2M7UA 3OPPA 1FOFA 1G28A 5A92A 3PBOA 1NXYA 4JGOA 1XFNA 3PBTA 1UGUA 3BFFA 3HLFA 1W8QA 4GHIA 4ZAMA 3WS2A 3R7WB 5EPHA 2R9WA 3ZFZA 1RGZA 4OQGA 2PD8A 2QKPA 1BULA 1UWPX 5LBRA 2PHYA 2Z2MB 3PBSA 2ZOIA 5DFYA 3T4KA 5FAPA 1T1AA 2XGNA 5A93A 4FD8A 3KSFA 5CGWA 5HDDA 1CEFA 1K6RA 5M1AA 3VP0A 3P98A 3ZDJA 3P09A 4KG5A 3TE8A 4PMAA 4HIAA 5HPFA 4KUKA 4UA7A 5DJTA 3OPRA 1PYYA 5AQBA 2JKTM 4QU3A 1CI8A 3BWLA 4HI4A 3VOZA 3LFVA 2WADA 4JXSA 4GDBA 3V3SA 4LCMA 2NUTC 5DKKA 3QP6A 1BLPA 3CUEC 4GOGA 3ZYTA 3UE1A 2P9VB 5L2FA 2KOIA 1N9NA 2WK0A 3IHAA 4WMCA 4S2OA 5TJJA 4DDYA 3IBRA 4O7DA 3S7NA 3IH9A 1U60A 1H8MA 4QY5A 1Y54A 4IUKA 1OPXA 1DJAA 4MEZA 4Q8IA 4EBLA 2HP9A 4EQ1A 3C4OA 1ACFA 3UNWA 3N8RA 3UDIA 4S2KA 3HUOA 2GJ3A 1ES5A 5FQJA 1PFLA 4QPRA 1VQQA 2QJ7A 1RP5A 2KX6A 2OOLA 1BSGA 4GLQA 5AVEA 2Y2QA 3BY9A 1DY6A 5U47A 3T4TA 1S66L 4DDSA 1KE4A 1GHMA 2H28A 1KOUA 2Y91A 5CGXA 4RX3A 2OAQ1 2GX5A 5GLCA 4BENA 3B3XA 4QD4A 3BQAA 4XUXA 4R3BA 4ZBEA 5C5KA 4NETA 4WLAA 5F83A 5HWTA 1VB6A 2A24B 3TRCA 3A3EA 4DJ3A 5I94A 1YKDA 4PHTA 4AFIA 1WYBA 1Q2PA 2B5RA 3IX3A 4EBPA 5EUAA 4UA9A 4BMWA 4IVKA 1BYWA 1STZA 4BD1A 1HLUP 1K56A 5HD3A 1G5UA 4UA6A 4JGPA 1S4SA 4QB8A 4HESA 1OT9A 4HY8A 4EV4A 5HWVA 2JKRM 3TSGA 4IVIA 3SZTA 3NIAA 3VP3A 2NUPC 5L09A 4MMNA 3UMDA 2Y4AA 1AWIA 4HH3A 4LV3A 1K6SA 4NKPA 2Y59A 3RFBA 3LI8A 5JYOA 3CWFA 3N6IA 3WS0A 2X71A 2XK1A 1GSVA 3DTKA 4R0QA 2JN7A 3EQUA 1NY0A 3B47A 1NLYA 4HOIA 1W63M 1K55C 3NOUC 1FCNA 3LY3A 5HW3A 2WKEA 3ITBA 4KZBA 3LIFA 5HSQA 4X1MA 3CUEA 4WF0A 3DW0A 3IX8A 5CEDA 2PDRA 3MBZA 3MS6A 1J3WA 1SCWA 1DP9A 3G4PA 4WZ5C 5CX7A 4CLCC 3DWZA 2JBFA 5CERA 4PM5A 3HLDA 3ZG7B 2W3GA 2VGJA 1F5MA 3C38A 3GSGA 3RJUA 2Z2LB 1IFQA 2EX6A 2J3WA 3VP4A 1JTGA 1IELA 2O9AA 3FKWA 1MBLA 2ZD8A 1XJ6A 3C7UA 1N9OA 3F1PA 3HLGA 1BLCA 2K7SA 2W1RA 5F68A 1PWDA 5F69A 5F6AA 3UN7A 1CJFA 2ZQDA 3FYZA 4C75A 2V8FA 1DJBA 2PYRA 2V8CA 4HJ4A 5HAQA 1IOUA 2K2NA 1LSWA 1MKMA 3OPLA 4ZJ3A 4X6TA 3HVFA 3Q7VB 4GJ4A 4OQ0A 3O3VA 4IEDA 3S1YA 1K25A 3BW6A 4Y3IA 4LCLA 4QHCA 5EECA 2H0YA 3HJIA 2OAP1 3U2AA 3PR6A 3H82A 3QP2A 4S2JA 5EVLA 5FATA 4JF4A 4Y2FA 3LR5A 1HTZA 2DCFA 3OC2A 1ESIA 2Y2KA 4R3JA 4YOFA 5KMWA 4P6BA 4DMZA 2ZQ7A 2EFXA 4EBNA 2KLIA 4E3MA 1C3BA 4NK3A 3T4JA 4CPKA 2XEPA 5CHMA 3OCLA 2Y8HA 2G2WA 3E4QA 3CJMA 4S2MA 2HP5A 1SDEA 4KZ3A 4EEUA 4WZ4A 4OONA 4FH4A 1K38A 3IHBA 3UO9A 1K55A 5FDHA 3UDFA 4G3VA 4XUZA 3ZG0A 1GHPA 4HEFA 3JVVA 4OOYA 1XA7A 1P0ZA 2K31A 4BWIA 1PW8A 4UHUA 1TVFA 2PU2A 3AGEA 4LENA 5CRFA 2W3FA 4WZ5A 1H8YA 4KG2A 4JF6A
chains in the Genus database with same CATH topology
2ZM0A 5DF8A 3A3JA 4H8RA 1PWGA 4F94A 3BYDA 2XLNA 3ZVWA 4JKTA 3OPPA 4B88A 3W4OA 1FOFA 2ZQ8A 2ZQCA 4OLGA 5CTMA 2HDUA 3AGDA 4WEJA 5TGFA 5A92A 3PBOA 1MWUA 3VFHA 3ZNYA 2V20A 1NXYA 1GHIA 3BFGA 3PBTA 3PTEA 3G2ZA 3BFFA 3LY4A 3V5MA 4ZTKA 2A49A 1XX2A 3HLFA 1W8QA 3OPHA 3Q82A 4OQHA 5EE8A 4PPRA 4DE3A 1RCJA 4ZAMA 3NBLA 2Y2MA 3NDEA 4OOMA 3WS2A 4EWFA 4ID4A 1Z6FA 5GLAA 3BFCA 4ZDXA 5EPHA 2R9WA 3ZFZA 1RGZA 4OQGA 5KSHA 1FCMA 1H5XA 4E3IA 1BULA 3Q7VA 3ZGAB 5GHYA 2IWDA 4OKPA 1G6AA 3GRJA 2Z2MB 3PBSA 1CI9A 1SDNA 3M6BA 3WS5A 4JXVA 2H5SA 4X53A 1M40A 4OPZA 5FAPA 1FR1A 4XXRA 5DF7A 4DE2A 4RA7A 2XGNA 3A3FA 3MZFA 1FSYA 4CJNA 5A93A 4FD8A 5CGWA 4DF6A 3GTCA 3HUMA 1G68A 3OCNA 1KE0A 4FSFA 1CEFA 1S6RA 3PBQA 5AQ9A 5CEBA 3E2KA 2QMIA 1K6RA 1ES3A 4LV0A 5M1AA 3LEZA 4BL2A 2WAEA 1ES4A 5GLBA 3MKEA 3VP0A 2ZC4B 5GL9A 2Y55A 1TEMA 4UAAA 3P98A 1DJCA 3ZDJA 2WKIA 3P09A 5FA7A 3V39A 4KG5A 2XF3A 4PM7A 3VOZA 3FZCA 5CHJA 4YINA 3VMAA 1L0FA 4HBTA 5EOOA 4PMAA 1YMXA 5EVIC 1MWTA 1ONHA 4UA7A 2ZQAA 3VSLA 1FR6A 3OPRA 5M18A 3HREA 3HBRA 1IYOA 3GV9A 1ALQA 1GCEA 1O7EA 1FQGA 1PYYA 5AQBA 4QU3A 2CC1A 1CI8A 1Q2QA 4KZ7A 5GHXA 5FQ9A 4WEKA 2HDQA 1WYCA 4JXSA 1I2SA 2WADA 3D4FA 4GKUA 4GDBA 5HX9A 3V3SA 4LCMA 4OOLA 4S2LA 1KGFA 4OPYA 5DTKA 2R9XA 1BLPA 1W8YA 3A3IA 4N1XA 4WBGA 2JC7A 4GOGA 1TDLA 2WYXA 3UE1A 2P9VB 2HPBA 3M2KA 3N8LA 5L2FA 2V1ZA 4BLMA 1SHVA 2WK0A 4MNRA 1BTLA 3IHAA 4HBUA 4WMCA 3ZG9B 4KQOA 3HLCA 3AGFA 4GZBA 3DTMA 3V3RA 1BUEA 3QNCA 1J9MA 4S2OA 3Q1FA 4Y7PA 3ZHHA 4DDYA 1K54C 4O7DA 3IH9A 2XR0A 4R23A 1U60A 5FAOA 4QY5A 5FQKA 1Y54A 3RXXA 3UE3A 1BLHA 3ZG8B 1KGGA 4Y0UA 3A3DA 3SS5A 4OPRA 1DJAA 4MEZA 4Q8IA 1O07A 5EVIB 4EBLA 2HP9A 4ZJ1A 3TG9A 3C4OA 4PM8A 3IF6A 4Z9QA 3N8RA 3UDIA 3UNWA 4S2KA 2EX8A 1H8ZA 4KZ4A 2OSUA 3HUOA 4C6YA 1ES5A 2EX9A 2PU4A 3HLEA 3PBNA 4WYYA 5FQJA 3HL9A 2XH9A 4BQMA 3HLBA 1VQQA 4WELA 4GB7A 2ZC7A 1RP5A 3BM6A 1BSGA 4GDNA 2Y2QA 3LO7A 1JVJA 3N4IA 4MBFA 3SH7A 1KVLA 1DY6A 2WGIA 5F1GA 5U47A 5CXWA 4DDSA 1FCOA 1KE4A 1IYPA 1GHMA 2ZC3B 3O87A 4S2IA 3IH8A 4K0XA 1PZOA 2Y91A 1W5DA 5CGXA 4RX3A 3NDGA 5FI6A 2Q9NA 3QNBA 4KQQA 5GLCA 3BLSA 4BENA 3B3XA 1ZG6A 4QD4A 4WM9A 5IHVA 4XUXA 4ZBEA 4R3BA 1E3UA 2H10A 1LL5A 1CK3A 4S2PA 5FSRA 2XD1A 4NETA 3WS4A 5F83A 2P74A 3SH8A 2DNSA 5D3OA 4B4ZA 1XXMA 1IYQA 4JBFA 1PW1A 2C6WB 3IWIA 3A3EA 5I94A 3ISGA 4PM6A 3UPPA 1BLSA 4X68A 4R4RA 4RVAA 2X01A 3SOIA 1ZKJA 1KGEA 2OLVA 4MBKA 3VFFA 2XDMA 1WYBA 1E4DA 3LCEA 1ONGA 1Q2PA 2B5RA 3FKVA 5TFQA 4KZ5A 1N4OA 3C5AA 2H0TA 1KDSA 4EBPA 5EUAA 2HP6A 1TDGA 4GNUA 4UA9A 3N7WA 2BLSA 1NYYA 4IVKA 1PIOA 4X55A 1YM1A 3CMZA 3Q7ZA 4BD0A 4BD1A 4E3LA 4OP5A 4U0TA 1SKFA 5DTSA 1K56A 2Y2GA 4D2OA 4L0LA 1ZG4A 3GQZA 5DF9A 4R4SA 4UA6A 4KZAA 3UE0A 5CGSA 3MZDA 1XGIA 4KENB 2WZXA 2QPNA 4E6WA 4QB8A 4HESA 1GA9A 1YMSA 1PWCA 1ESUA 4M3KA 3PAGA 4KQRA 4LV1A 4EV4A 3MZEA 1EI5A 1MY8A 1BZAA 2Y2OA 2PBYA 1EROA 1YLTA 3TSGA 3UPNA 4MLLA 4QJGA 2EXBA 4IVIA 1RGYA 2UWXA 4JPMA 4X69A 2J7VA 3BEBA 3IQAA 3NIAA 2Y2HA 1K4FA 3VP3A 4DXCA 3MKFA 5HAPA 5BOHA 5DVAA 2C5WB 5E2FA 1M6KA 1NYMA 4K0WA 3VP1A 4N92A 2Y2JA 2P9VA 2BG1A 3NI9A 4OPQA 5A90A 2Y4AA 2Y2PA 4LV3A 1K6SA 3ZG5A 1XA1A 4E3JA 2Y59A 4E6XA 1OMEA 1QMEA 1YT4A 3HLWA 2JCHA 4FH2A 1VM1A 2J9OA 1ERMA 2G2UA 4DXBA 5JYOA 3IXBA 5JYPA 5M19A 3N6IA 3WS0A 5EVIA 2X71A 2XK1A 1S0WA 1HVBA 3ZVTA 3W4PA 1IYSA 1K57C 4R0QA 3IT9A 3JYIA 4RYEA 3O86A 3O88A 3EQUA 3IXGA 1NY0A 5HFOA 4PM9A 5A91A 1K55C 1LI0A 2Q9MA 3IF5A 1FCNA 3G31A 4Y0TA 4N9LA 3LY3A 5HW3A 2WKEA 3ITBA 2WGWB 4KZBA 4U3TA 1LLBA 1XGJA 2Y2LA 3W8KA 3WRTA 3VP2A 2Y2IA 2EXAA 1I5QA 4QY6A 4S2NC 3DW0A 3S22A 2Y2NA 3Q81A 3WS1A 4DE1A 1K57A 3VOYA 5CEDA 3MBZA 4E3OA 2XFTA 2J9PA 2JE5A 2OV5A 3SS4A 4X56A 1SCWA 2ZM2A 4JLFA 5F1FA 3G4PA 2DRWA 1XPBA 5E43A 2EX2A 3GVBA 1K54A 1HD8A 3E2LA 4WMCD 4WZ5C 2WKHA 4JXWA 1YLJA 3UDXA 3GMWA 3DWZA 3NC8A 1MWRA 2JBFA 1AXBA 3IWOA 3ZNTA 4P87A 4E3NA 1L0DA 1MXOA 2QZ6A 4KG6A 3CZDA 5CERA 2IWBA 4P0MA 1PI5A 3WRZA 4OH0A 3M2JA 4OVDA 3IXHA 4EUZA 5HL1A 1KDWA 4PM5A 3BFDA 3HLDA 1L0GA 3ZG7B 1MWSA 2XQZA 2VGJA 3FV7A 2X02A 3IF6B 5FQMA 3BLMA 4JF5A 3C4PA 1ERQA 3GSGA 4GN2A 3RJUA 3TOIA 4C3QA 4R1GA 2WZZA 1L0EA 1K4EA 2Z2LB 1ZC2A 2EX6A 3VP4A 1JTGA 1IELA 3CG5A 1FSWA 3FKWA 1MBLA 1YLPA 5AQAA 2ZD8A 3GR2A 4ZJ2A 1XKZA 3C7UA 3Q07A 2WUQA 3V50A 1MPLA 5J8XA 3NY4A 3HLGA 1BLCA 2RCXA 5HARA 1W7FA 3UY6A 5E2EA 4YFMA 1E3UD 3NCKA 1YLZA 1BT5A 5E2HA 5HAIA 5EOEA 3IWQA 2FFFB 4GD6A 4KZ9A 1PWDA 2ZLYA 2EFUA 3BECA 5GLDA 1CEGA 2J8YA 4RX2A 2HDSA 3UN7A 2ZQDA 3FYZA 4C75A 2FFYA 4IBXA 1DJBA 4P85A 4BJPA 1JWVA 4N9KA 5HAQA 4A5RA 2A3UA 4BL3A 1YLYA 2WGVA 1QMFA 3PBRA 2ZC6B 5G18A 3OPLA 1ES2A 4GD8A 5CTNA 4ZJ3A 4DE0A 4X6TA 3HVFA 3Q7VB 3M6HA 4JXGA 4LV2A 3MXSA 3C7VA 4OQ0A 2RL3A 3O3VA 4IEDA 3S1YA 4Y0OA 5E2GA 1K25A 3G35A 3G34A 1K56D 4LCLA 5CECA 1I2WA 2ZJ9A 4QHCA 5EECA 3WWXA 4DRTA 2H0YA 1NZUA 1PZPA 1YLWA 5FASA 4B4XA 4IBRA 4K91A 4E3KA 2ZM8A 5FI2A 3S4XA 3VSKA 2WGWA 2ZMAA 1E25A 1PI4A 4S2JA 5EVLA 4DKIA 5FATA 4JF4A 3G30A 2HDRA 3RXWA 5FQQA 2VGKA 5FI7A 1HTZA 2DCFA 1MKIA 1ESIA 2V2FF 2Y2KA 3HUNA 3OC2A 3UPOA 1KE3A 4R3JA 1WE4A 4OP8A 1EWZA 4P6BA 3ITAA 5KMWA 3QHYA 2ZQ7A 1NJ4A 3OZHA 5FAQA 2WAFA 2EFXA 3IXDA 4EBNA 1JWPA 5DTTA 4E3MA 4N1HA 5FQIA 1C3BA 4OLDA 3N8SA 1XP4A 4NK3A 2XFSA 5CHUA 4CPKA 1NZOA 1GA0A 2I72A 2XEPA 2OLUA 5CHMA 3ZCZA 2IWCA 4FCFA 3OCLA 2G2WA 3IF6C 3CJMA 4S2MA 2HP5A 1SDEA 1LHYA 4KZ3A 3SH9A 2E8IA 4WZ4A 5EVID 3MXRA 4OONA 1YQSA 4FH4A 3DWKA 3MFDA 1K38A 3IHBA 3UO9A 4EQIA 2ZC5B 5TR7A 1K55A 1HZOA 1W79A 4KZ8A 5FDHA 3I7JA 3SS3A 3BFEA 1LI9A 5F82A 3G2YA 1JWZA 3BRMA 5KZHA 1IKIA 1KVMA 4U0XA 3UDFA 3PAEA 3ZG0A 4XUZA 1GHPA 4HEFA 5GHZA 3FWLA 4OOYA 1XA7A 2GDNA 1JTDA 4KZ6A 1NRFA 4S2NA 4MBHA 1IKGA 3EQVA 3W4QA 1PW8A 4UHUA 1TVFA 2PU2A 3AGEA 1IEMA 4LENA 5CRFA 1LL9A 4OQIA 3G32A 5AQ7A 4WZ5A 1L2SA 1H8YA 2XD5A 4KG2A 4JF6A 2ZQ9A 5KSCA 1N9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM0 A;  5DF8 A;  3A3J A;  4H8R A;  1PWG A;  4F94 A;  3BYD A;  2XLN A;  3ZVW A;  4JKT A;  3OPP A;  4B88 A;  3W4O A;  1FOF A;  2ZQ8 A;  2ZQC A;  4OLG A;  5CTM A;  2HDU A;  3AGD A;  4WEJ A;  5TGF A;  5A92 A;  3PBO A;  1MWU A;  3VFH A;  3ZNY A;  2V20 A;  1NXY A;  1GHI A;  3BFG A;  3PBT A;  3PTE A;  3G2Z A;  3BFF A;  3LY4 A;  3V5M A;  4ZTK A;  2A49 A;  1XX2 A;  3HLF A;  1W8Q A;  3OPH A;  3Q82 A;  4OQH A;  5EE8 A;  4PPR A;  4DE3 A;  1RCJ A;  4ZAM A;  3NBL A;  2Y2M A;  3NDE A;  4OOM A;  3WS2 A;  4EWF A;  4ID4 A;  1Z6F A;  5GLA A;  3BFC A;  4ZDX A;  5EPH A;  2R9W A;  3ZFZ A;  1RGZ A;  4OQG A;  5KSH A;  1FCM A;  1H5X A;  4E3I A;  1BUL A;  3Q7V A;  3ZGA B;  5GHY A;  2IWD A;  4OKP A;  1G6A A;  3GRJ A;  2Z2M B;  3PBS A;  1CI9 A;  1SDN A;  3M6B A;  3WS5 A;  4JXV A;  2H5S A;  4X53 A;  1M40 A;  4OPZ A;  5FAP A;  1FR1 A;  4XXR A;  5DF7 A;  4DE2 A;  4RA7 A;  2XGN A;  3A3F A;  3MZF A;  1FSY A;  4CJN A;  5A93 A;  4FD8 A;  5CGW A;  4DF6 A;  3GTC A;  3HUM A;  1G68 A;  3OCN A;  1KE0 A;  4FSF A;  1CEF A;  1S6R A;  3PBQ A;  5AQ9 A;  5CEB A;  3E2K A;  2QMI A;  1K6R A;  1ES3 A;  4LV0 A;  5M1A A;  3LEZ A;  4BL2 A;  2WAE A;  1ES4 A;  5GLB A;  3MKE A;  3VP0 A;  2ZC4 B;  5GL9 A;  2Y55 A;  1TEM A;  4UAA A;  3P98 A;  1DJC A;  3ZDJ A;  2WKI A;  3P09 A;  5FA7 A;  3V39 A;  4KG5 A;  2XF3 A;  4PM7 A;  3VOZ A;  3FZC A;  5CHJ A;  4YIN A;  3VMA A;  1L0F A;  4HBT A;  5EOO A;  4PMA A;  1YMX A;  5EVI C;  1MWT A;  1ONH A;  4UA7 A;  2ZQA A;  3VSL A;  1FR6 A;  3OPR A;  5M18 A;  3HRE A;  3HBR A;  1IYO A;  3GV9 A;  1ALQ A;  1GCE A;  1O7E A;  1FQG A;  1PYY A;  5AQB A;  4QU3 A;  2CC1 A;  1CI8 A;  1Q2Q A;  4KZ7 A;  5GHX A;  5FQ9 A;  4WEK A;  2HDQ A;  1WYC A;  4JXS A;  1I2S A;  2WAD A;  3D4F A;  4GKU A;  4GDB A;  5HX9 A;  3V3S A;  4LCM A;  4OOL A;  4S2L A;  1KGF A;  4OPY A;  5DTK A;  2R9X A;  1BLP A;  1W8Y A;  3A3I A;  4N1X A;  4WBG A;  2JC7 A;  4GOG A;  1TDL A;  2WYX A;  3UE1 A;  2P9V B;  2HPB A;  3M2K A;  3N8L A;  5L2F A;  2V1Z A;  4BLM A;  1SHV A;  2WK0 A;  4MNR A;  1BTL A;  3IHA A;  4HBU A;  4WMC A;  3ZG9 B;  4KQO A;  3HLC A;  3AGF A;  4GZB A;  3DTM A;  3V3R A;  1BUE A;  3QNC A;  1J9M A;  4S2O A;  3Q1F A;  4Y7P A;  3ZHH A;  4DDY A;  1K54 C;  4O7D A;  3IH9 A;  2XR0 A;  4R23 A;  1U60 A;  5FAO A;  4QY5 A;  5FQK A;  1Y54 A;  3RXX A;  3UE3 A;  1BLH A;  3ZG8 B;  1KGG A;  4Y0U A;  3A3D A;  3SS5 A;  4OPR A;  1DJA A;  4MEZ A;  4Q8I A;  1O07 A;  5EVI B;  4EBL A;  2HP9 A;  4ZJ1 A;  3TG9 A;  3C4O A;  4PM8 A;  3IF6 A;  4Z9Q A;  3N8R A;  3UDI A;  3UNW A;  4S2K A;  2EX8 A;  1H8Z A;  4KZ4 A;  2OSU A;  3HUO A;  4C6Y A;  1ES5 A;  2EX9 A;  2PU4 A;  3HLE A;  3PBN A;  4WYY A;  5FQJ A;  3HL9 A;  2XH9 A;  4BQM A;  3HLB A;  1VQQ A;  4WEL A;  4GB7 A;  2ZC7 A;  1RP5 A;  3BM6 A;  1BSG A;  4GDN A;  2Y2Q A;  3LO7 A;  1JVJ A;  3N4I A;  4MBF A;  3SH7 A;  1KVL A;  1DY6 A;  2WGI A;  5F1G A;  5U47 A;  5CXW A;  4DDS A;  1FCO A;  1KE4 A;  1IYP A;  1GHM A;  2ZC3 B;  3O87 A;  4S2I A;  3IH8 A;  4K0X A;  1PZO A;  2Y91 A;  1W5D A;  5CGX A;  4RX3 A;  3NDG A;  5FI6 A;  2Q9N A;  3QNB A;  4KQQ A;  5GLC A;  3BLS A;  4BEN A;  3B3X A;  1ZG6 A;  4QD4 A;  4WM9 A;  5IHV A;  4XUX A;  4ZBE A;  4R3B A;  1E3U A;  2H10 A;  1LL5 A;  1CK3 A;  4S2P A;  5FSR A;  2XD1 A;  4NET A;  3WS4 A;  5F83 A;  2P74 A;  3SH8 A;  2DNS A;  5D3O A;  4B4Z A;  1XXM A;  1IYQ A;  4JBF A;  1PW1 A;  2C6W B;  3IWI A;  3A3E A;  5I94 A;  3ISG A;  4PM6 A;  3UPP A;  1BLS A;  4X68 A;  4R4R A;  4RVA A;  2X01 A;  3SOI A;  1ZKJ A;  1KGE A;  2OLV A;  4MBK A;  3VFF A;  2XDM A;  1WYB A;  1E4D A;  3LCE A;  1ONG A;  1Q2P A;  2B5R A;  3FKV A;  5TFQ A;  4KZ5 A;  1N4O A;  3C5A A;  2H0T A;  1KDS A;  4EBP A;  5EUA A;  2HP6 A;  1TDG A;  4GNU A;  4UA9 A;  3N7W A;  2BLS A;  1NYY A;  4IVK A;  1PIO A;  4X55 A;  1YM1 A;  3CMZ A;  3Q7Z A;  4BD0 A;  4BD1 A;  4E3L A;  4OP5 A;  4U0T A;  1SKF A;  5DTS A;  1K56 A;  2Y2G A;  4D2O A;  4L0L A;  1ZG4 A;  3GQZ A;  5DF9 A;  4R4S A;  4UA6 A;  4KZA A;  3UE0 A;  5CGS A;  3MZD A;  1XGI A;  4KEN B;  2WZX A;  2QPN A;  4E6W A;  4QB8 A;  4HES A;  1GA9 A;  1YMS A;  1PWC A;  1ESU A;  4M3K A;  3PAG A;  4KQR A;  4LV1 A;  4EV4 A;  3MZE A;  1EI5 A;  1MY8 A;  1BZA A;  2Y2O A;  2PBY A;  1ERO A;  1YLT A;  3TSG A;  3UPN A;  4MLL A;  4QJG A;  2EXB A;  4IVI A;  1RGY A;  2UWX A;  4JPM A;  4X69 A;  2J7V A;  3BEB A;  3IQA A;  3NIA A;  2Y2H A;  1K4F A;  3VP3 A;  4DXC A;  3MKF A;  5HAP A;  5BOH A;  5DVA A;  2C5W B;  5E2F A;  1M6K A;  1NYM A;  4K0W A;  3VP1 A;  4N92 A;  2Y2J A;  2P9V A;  2BG1 A;  3NI9 A;  4OPQ A;  5A90 A;  2Y4A A;  2Y2P A;  4LV3 A;  1K6S A;  3ZG5 A;  1XA1 A;  4E3J A;  2Y59 A;  4E6X A;  1OME A;  1QME A;  1YT4 A;  3HLW A;  2JCH A;  4FH2 A;  1VM1 A;  2J9O A;  1ERM A;  2G2U A;  4DXB A;  5JYO A;  3IXB A;  5JYP A;  5M19 A;  3N6I A;  3WS0 A;  5EVI A;  2X71 A;  2XK1 A;  1S0W A;  1HVB A;  3ZVT A;  3W4P A;  1IYS A;  1K57 C;  4R0Q A;  3IT9 A;  3JYI A;  4RYE A;  3O86 A;  3O88 A;  3EQU A;  3IXG A;  1NY0 A;  5HFO A;  4PM9 A;  5A91 A;  1K55 C;  1LI0 A;  2Q9M A;  3IF5 A;  1FCN A;  3G31 A;  4Y0T A;  4N9L A;  3LY3 A;  5HW3 A;  2WKE A;  3ITB A;  2WGW B;  4KZB A;  4U3T A;  1LLB A;  1XGJ A;  2Y2L A;  3W8K A;  3WRT A;  3VP2 A;  2Y2I A;  2EXA A;  1I5Q A;  4QY6 A;  4S2N C;  3DW0 A;  3S22 A;  2Y2N A;  3Q81 A;  3WS1 A;  4DE1 A;  1K57 A;  3VOY A;  5CED A;  3MBZ A;  4E3O A;  2XFT A;  2J9P A;  2JE5 A;  2OV5 A;  3SS4 A;  4X56 A;  1SCW A;  2ZM2 A;  4JLF A;  5F1F A;  3G4P A;  2DRW A;  1XPB A;  5E43 A;  2EX2 A;  3GVB A;  1K54 A;  1HD8 A;  3E2L A;  4WMC D;  4WZ5 C;  2WKH A;  4JXW A;  1YLJ A;  3UDX A;  3GMW A;  3DWZ A;  3NC8 A;  1MWR A;  2JBF A;  1AXB A;  3IWO A;  3ZNT A;  4P87 A;  4E3N A;  1L0D A;  1MXO A;  2QZ6 A;  4KG6 A;  3CZD A;  5CER A;  2IWB A;  4P0M A;  1PI5 A;  3WRZ A;  4OH0 A;  3M2J A;  4OVD A;  3IXH A;  4EUZ A;  5HL1 A;  1KDW A;  4PM5 A;  3BFD A;  3HLD A;  1L0G A;  3ZG7 B;  1MWS A;  2XQZ A;  2VGJ A;  3FV7 A;  2X02 A;  3IF6 B;  5FQM A;  3BLM A;  4JF5 A;  3C4P A;  1ERQ A;  3GSG A;  4GN2 A;  3RJU A;  3TOI A;  4C3Q A;  4R1G A;  2WZZ A;  1L0E A;  1K4E A;  2Z2L B;  1ZC2 A;  2EX6 A;  3VP4 A;  1JTG A;  1IEL A;  3CG5 A;  1FSW A;  3FKW A;  1MBL A;  1YLP A;  5AQA A;  2ZD8 A;  3GR2 A;  4ZJ2 A;  1XKZ A;  3C7U A;  3Q07 A;  2WUQ A;  3V50 A;  1MPL A;  5J8X A;  3NY4 A;  3HLG A;  1BLC A;  2RCX A;  5HAR A;  1W7F A;  3UY6 A;  5E2E A;  4YFM A;  1E3U D;  3NCK A;  1YLZ A;  1BT5 A;  5E2H A;  5HAI A;  5EOE A;  3IWQ A;  2FFF B;  4GD6 A;  4KZ9 A;  1PWD A;  2ZLY A;  2EFU A;  3BEC A;  5GLD A;  1CEG A;  2J8Y A;  4RX2 A;  2HDS A;  3UN7 A;  2ZQD A;  3FYZ A;  4C75 A;  2FFY A;  4IBX A;  1DJB A;  4P85 A;  4BJP A;  1JWV A;  4N9K A;  5HAQ A;  4A5R A;  2A3U A;  4BL3 A;  1YLY A;  2WGV A;  1QMF A;  3PBR A;  2ZC6 B;  5G18 A;  3OPL A;  1ES2 A;  4GD8 A;  5CTN A;  4ZJ3 A;  4DE0 A;  4X6T A;  3HVF A;  3Q7V B;  3M6H A;  4JXG A;  4LV2 A;  3MXS A;  3C7V A;  4OQ0 A;  2RL3 A;  3O3V A;  4IED A;  3S1Y A;  4Y0O A;  5E2G A;  1K25 A;  3G35 A;  3G34 A;  1K56 D;  4LCL A;  5CEC A;  1I2W A;  2ZJ9 A;  4QHC A;  5EEC A;  3WWX A;  4DRT A;  2H0Y A;  1NZU A;  1PZP A;  1YLW A;  5FAS A;  4B4X A;  4IBR A;  4K91 A;  4E3K A;  2ZM8 A;  5FI2 A;  3S4X A;  3VSK A;  2WGW A;  2ZMA A;  1E25 A;  1PI4 A;  4S2J A;  5EVL A;  4DKI A;  5FAT A;  4JF4 A;  3G30 A;  2HDR A;  3RXW A;  5FQQ A;  2VGK A;  5FI7 A;  1HTZ A;  2DCF A;  1MKI A;  1ESI A;  2V2F F;  2Y2K A;  3HUN A;  3OC2 A;  3UPO A;  1KE3 A;  4R3J A;  1WE4 A;  4OP8 A;  1EWZ A;  4P6B A;  3ITA A;  5KMW A;  3QHY A;  2ZQ7 A;  1NJ4 A;  3OZH A;  5FAQ A;  2WAF A;  2EFX A;  3IXD A;  4EBN A;  1JWP A;  5DTT A;  4E3M A;  4N1H A;  5FQI A;  1C3B A;  4OLD A;  3N8S A;  1XP4 A;  4NK3 A;  2XFS A;  5CHU A;  4CPK A;  1NZO A;  1GA0 A;  2I72 A;  2XEP A;  2OLU A;  5CHM A;  3ZCZ A;  2IWC A;  4FCF A;  3OCL A;  2G2W A;  3IF6 C;  3CJM A;  4S2M A;  2HP5 A;  1SDE A;  1LHY A;  4KZ3 A;  3SH9 A;  2E8I A;  4WZ4 A;  5EVI D;  3MXR A;  4OON A;  1YQS A;  4FH4 A;  3DWK A;  3MFD A;  1K38 A;  3IHB A;  3UO9 A;  4EQI A;  2ZC5 B;  5TR7 A;  1K55 A;  1HZO A;  1W79 A;  4KZ8 A;  5FDH A;  3I7J A;  3SS3 A;  3BFE A;  1LI9 A;  5F82 A;  3G2Y A;  1JWZ A;  3BRM A;  5KZH A;  1IKI A;  1KVM A;  4U0X A;  3UDF A;  3PAE A;  3ZG0 A;  4XUZ A;  1GHP A;  4HEF A;  5GHZ A;  3FWL A;  4OOY A;  1XA7 A;  2GDN A;  1JTD A;  4KZ6 A;  1NRF A;  4S2N A;  4MBH A;  1IKG A;  3EQV A;  3W4Q A;  1PW8 A;  4UHU A;  1TVF A;  2PU2 A;  3AGE A;  1IEM A;  4LEN A;  5CRF A;  1LL9 A;  4OQI A;  3G32 A;  5AQ7 A;  4WZ5 A;  1L2S A;  1H8Y A;  2XD5 A;  4KG2 A;  4JF6 A;  2ZQ9 A;  5KSC A;  1N9B A; 
#chains in the Genus database with same CATH topology
 4CLC A;  1YSQ A;  3T1S A;  4OLG A;  3AGD A;  3ZNY A;  3P01 A;  1GHI A;  3G2Z A;  2A49 A;  4OQH A;  3Q82 A;  2KDK A;  4FTX A;  3NDE A;  3QP4 A;  3MQ0 A;  1Z6F A;  3H7W A;  4UEY A;  1FCM A;  1H3Q A;  2Y79 A;  1OT6 A;  3ZGA B;  3GRJ A;  5EFW A;  1CI9 A;  2H5S A;  5HZH A;  5DF7 A;  4RA7 A;  2W0N A;  4CJN A;  2W1T B;  3GTC A;  2P08 A;  4FSF A;  1OTB A;  5AQ9 A;  5EM1 A;  5CEB A;  3E2K A;  5EV0 A;  1VET A;  4BL2 A;  3K2N A;  1YSP A;  2ZC4 B;  5GL9 A;  4Y13 A;  1DJC A;  2WKI A;  5FA7 A;  2OWH A;  3NEC A;  3T1R A;  2XF3 A;  4PM7 A;  3VMA A;  4YIN A;  5EVI C;  2ZQA A;  1FR6 A;  3KYZ A;  3HBR A;  1ALQ A;  4H6J A;  4JGQ A;  4WEK A;  2HDQ A;  4GKU A;  5DTK A;  1W8Y A;  3TW8 A;  1TDL A;  4O8G A;  1SHV A;  3DTM A;  4XT2 B;  3V3R A;  5EVE A;  1BUE A;  3QNC A;  2O9B A;  3Q1F A;  4Y7P A;  3ZHH A;  1K54 C;  4E04 A;  3UE3 A;  3SS5 A;  4Y0U A;  3T50 A;  3DBA A;  3TG9 A;  4Z9Q A;  1H8Z A;  3MXQ A;  4GCZ A;  2PU4 A;  5FDS A;  3F1N A;  3HLB A;  4WEL A;  4GB7 A;  3A0V A;  1A0K A;  4GDN A;  4EER A;  4MBF A;  1KVL A;  2ZC3 B;  1PZO A;  1W5D A;  2PT7 A;  3QNB A;  3E98 A;  5IHV A;  1DP8 A;  1E3U A;  2H10 A;  4FUW A;  4S2P A;  3CPT A;  5FSR A;  3SH8 A;  4B4Z A;  5D3O A;  1XXM A;  1IYQ A;  5J7E A;  1YPR A;  4JBF A;  5G4Z A;  4II7 A;  2C6W B;  2PYP A;  3IWI A;  3ISG A;  4PM6 A;  3MJQ A;  2X01 A;  3SOI A;  1ZKJ A;  2JKR I;  2YKH A;  3BY8 A;  4KZ5 A;  2H0T A;  1KDS A;  2BLS A;  4P6Z M;  3F1O B;  3QP1 A;  4EES A;  4U0T A;  4D2O A;  1ZG4 A;  5DF9 A;  5HWW A;  4R4S A;  5FEF A;  4KZA A;  4KEN B;  2QPN A;  4X1L A;  3FC7 A;  5DKL A;  1LL8 A;  1EI5 A;  2Y2O A;  3ICY A;  4QJG A;  1RGY A;  2UWX A;  2J3T C;  4Y17 A;  2Y2H A;  1K4F A;  4D60 A;  3MKF A;  1P97 A;  5BOH A;  5HAP A;  2Y2J A;  2BG1 A;  5A90 A;  4I3A A;  3ZG5 A;  3T4S A;  2HZ5 A;  2J9O A;  1ERM A;  5M19 A;  2PR5 A;  5EVI A;  1VET B;  1IYS A;  1SZV A;  3O86 A;  2V1B A;  2V1A A;  1XFQ A;  1DP6 A;  2WGW B;  1LLB A;  1XGJ A;  3WRT A;  2EWW A;  1VEU A;  2ZL1 A;  2VV6 A;  1K57 A;  4H6J B;  4E3O A;  3SS4 A;  5E43 A;  1V9Z A;  1K54 A;  1HD8 A;  3E2L A;  4WMC D;  4IHQ A;  5HPI A;  4EET B;  2B02 A;  3LGO A;  4E3N A;  1MXO A;  3CZD A;  2IWB A;  1KDW A;  1LSX A;  2G7U A;  1MWS A;  3LI9 A;  3SW1 A;  3HCY A;  2HJE A;  1ZHH B;  3FV7 A;  2X02 A;  2P7J A;  4JF5 A;  3C4P A;  4C3Q A;  4DJ2 A;  4R1G A;  1L0E A;  1K4E A;  3CG5 A;  4ZJ2 A;  1XKZ A;  3Q07 A;  4Q0H A;  2WUQ A;  5L10 A;  3V50 A;  4MCW A;  1WA9 A;  4O01 A;  3NY4 A;  2RCX A;  5HAR A;  3UY6 A;  3KX0 X;  3NCK A;  1BT5 A;  3MQO A;  5EOE A;  4P6Z S;  1OJ5 A;  2J8Y A;  4RX2 A;  2DMW A;  2FFY A;  4P85 A;  4GHI B;  3UB5 P;  4BJP A;  4BL3 A;  2WGV A;  3C2W A;  2ZC6 B;  4GD8 A;  4DE0 A;  3KSI A;  2W27 A;  3M6H A;  4JXG A;  4LV2 A;  2RL3 A;  5E2G A;  3G35 A;  4Z1W A;  1K56 D;  2ZJ9 A;  1YLW A;  1CQA A;  4IBR A;  4E3K A;  3KYQ A;  4PKY G;  4G3W A;  3OBF A;  3G30 A;  4ARZ A;  2VGK A;  2VKS A;  4Q0J A;  2V2F F;  3A0R A;  4G3K A;  4OP8 A;  3ITA A;  3OZH A;  5FAQ A;  1Y4O A;  3IXD A;  3T1X A;  5DTT A;  4IJG A;  4OLD A;  2XFS A;  2L4R A;  2I72 A;  3QP5 A;  3D9Y A;  3IF6 C;  2JHE A;  3SH9 A;  3BJN A;  1YQS A;  4EQI A;  2W3D A;  2ZC5 B;  5TR7 A;  3SS3 A;  1W79 A;  5F82 A;  5KZH A;  1IKI A;  1KVM A;  3PAE A;  2O9C A;  3T1Q B;  5GHZ A;  3FWL A;  4KZ6 A;  1GSX A;  5HDS A;  2VLG A;  2HJ9 C;  3W4Q A;  1L2S A;  5KSC A;  2ZL1 B;  1PWG A;  4MDZ A;  3BYD A;  2WKR A;  4YNR A;  4B88 A;  3W4O A;  2ZQ8 A;  2ZQC A;  5CTM A;  3LR4 A;  2MJ6 A;  5TGF A;  1MWU A;  3VFH A;  2L0W A;  2V20 A;  3PTE A;  3LY4 A;  3V5M A;  1X0O A;  4ZTK A;  1XX2 A;  4EU0 A;  3OPH A;  4DE3 A;  3IBJ A;  1RCJ A;  4R38 A;  3C30 A;  4ID4 A;  5GLA A;  3BFC A;  4ZDX A;  5KSH A;  1H5X A;  4E3I A;  2IWD A;  4B93 A;  2INW A;  4OKP A;  3MQQ A;  4MN7 A;  3M6B A;  3WS5 A;  4JXV A;  4X53 A;  1FR1 A;  2QWS A;  3A3F A;  3LR3 A;  1FSY A;  1P9W A;  3HUM A;  4Y5F A;  4LV0 A;  3LEZ A;  2W3H A;  3V39 A;  3MSH A;  3FZC A;  5CHJ A;  4HBT A;  1D06 A;  1YMX A;  1MWT A;  5HDC A;  3HRE A;  4HQA A;  3GV9 A;  1O7E A;  4LFU A;  1FQG A;  2CC1 A;  4ZRR A;  5FQ9 A;  3FG8 A;  5HX9 A;  1WYC A;  3WS1 A;  4OOL A;  4OPY A;  2R9X A;  5EM0 A;  5J4E A;  2VJW A;  3A3I A;  4WBG A;  2JC7 A;  2WYX A;  2HPB A;  4R70 A;  3N8L A;  4K08 A;  1UWN X;  2E8J A;  1XJ4 A;  2XSS A;  4MNR A;  1BTL A;  4HBU A;  3HLC A;  3AGF A;  2QJ5 A;  4GZB A;  4LRX C;  1J9M A;  2JKG A;  4GS9 A;  2XR0 A;  5FQK A;  3ZG8 B;  1KGG A;  1O07 A;  2V0W A;  1T1B A;  4ZJ1 A;  3IF6 A;  2EX8 A;  4KZ4 A;  4C6Y A;  3HLE A;  4WYY A;  4BQM A;  1P9R A;  2ZC7 A;  3T4Q A;  3BM6 A;  3N4I A;  1JVJ A;  3SH7 A;  3DTE A;  5F1G A;  5CXW A;  1IYP A;  2Z6C A;  4S2I A;  3IH8 A;  1OTA A;  3R7W A;  4ESP A;  2Q9N A;  1YAX A;  1ZG6 A;  4NXF A;  4X25 A;  3CAX A;  1CK3 A;  1TS7 A;  3H9W A;  2DNS A;  1S1Y A;  1PW1 A;  2LB9 A;  4CLC D;  3UPP A;  1BLS A;  4R4R A;  1KGE A;  2OLV A;  4WUJ A;  1ONG A;  1T19 A;  1N4O A;  5KIZ A;  2I9V A;  4GNU A;  1TDG A;  3VE3 A;  1Y28 A;  2PD7 A;  4HP4 A;  3LEQ A;  4X55 A;  3Q7Z A;  4LLO B;  4BD0 A;  4E3L A;  4DN0 A;  3GQZ A;  2JKT I;  3F1P B;  5CGS A;  3MZD A;  5HD5 A;  4E6W A;  1YMS A;  1PWC A;  4M3K A;  3PAG A;  4LV1 A;  1BZA A;  4NXE A;  3UPN A;  2EXB A;  2P04 A;  4JPM A;  4X69 A;  2J7V A;  3BEB A;  3LYX A;  3RTY A;  2XA7 M;  3B42 A;  5E2F A;  3O5Y A;  4K0W A;  3VP1 A;  4N92 A;  2P9V A;  4OPQ A;  2Y2P A;  1SKO A;  1XA1 A;  2W3E A;  1OME A;  1QME A;  3IS2 A;  2D02 A;  1YT4 A;  2OWJ A;  2JCH A;  1VM1 A;  2O0Y A;  1F9I A;  4Y15 A;  5JYP A;  3ZVT A;  1HVB A;  3W4P A;  1K57 C;  1OTI A;  4MN5 A;  3JYI A;  4BBV A;  5HFO A;  4PM9 A;  2Q9M A;  3LIB A;  3G31 A;  2A2L A;  3H82 B;  3R4K A;  3E0Y A;  2Y2I A;  5AJG A;  3BQ8 A;  4HHD A;  1I5Q A;  2D01 A;  4S2N C;  3S22 A;  4DE1 A;  4KUO A;  3TJZ C;  2J9P A;  3ZQ5 A;  4X56 A;  3EEA A;  5F1F A;  4YWZ A;  1XPB A;  2EX2 A;  3GVB A;  2WKH A;  1YLJ A;  3EOI A;  3HJK A;  3NHQ A;  3GMW A;  3NC8 A;  1OJG A;  1MWR A;  1N9L A;  4P87 A;  2A24 A;  4P0M A;  3WRZ A;  4OH0 A;  3IXH A;  4EUZ A;  3MFX A;  3BFD A;  2IA2 A;  3FPW A;  2XQZ A;  3IF6 B;  5FQM A;  3BLM A;  1EW0 A;  1ERQ A;  4GN2 A;  2WZZ A;  2PR6 A;  3EEH A;  1FSW A;  3GR2 A;  3EWK A;  2ZBB A;  4CLC B;  1W7F A;  3S7P A;  5E2E A;  4YFM A;  1E3U D;  4L9G A;  1YLZ A;  2LB5 A;  5E2H A;  3IWQ A;  2FFF B;  2EFU A;  3BEC A;  5GLD A;  1CEG A;  2VGL M;  2B18 A;  1F2K A;  4N9K A;  2A3U A;  1YLY A;  3H7W B;  1QMF A;  3S7O A;  3LR0 A;  1LT0 A;  5G18 A;  5CTN A;  3PXP A;  4LGW A;  4BBU A;  5MC7 A;  5CEC A;  2XA7 S;  1I2W A;  3WWX A;  2QYB A;  2EA9 A;  1PZP A;  2V0U A;  5FAS A;  4B4X A;  4K91 A;  2ZM8 A;  1W63 Q;  4JGR A;  5FI2 A;  3UE6 A;  2BTF P;  3VSK A;  3T12 B;  2ZMA A;  4DKI A;  4WL9 A;  3RXW A;  5FQQ A;  3VV4 A;  4IUH A;  3CIT A;  4EW7 A;  3HUN A;  1KE3 A;  1PNE A;  1WE4 A;  5A8B A;  1EWZ A;  1S67 L;  3B33 A;  1NJ4 A;  2WAF A;  4N1H A;  3N8S A;  2J80 A;  1XP4 A;  4CQH A;  2OLU A;  3ZCZ A;  4F3L A;  4MN6 A;  5TBM A;  2E8I A;  1SKO B;  5EVI D;  3MXR A;  1S4R A;  3IS2 B;  3MFD A;  1HZO A;  3I7J A;  3BFE A;  1LI9 A;  2JKF A;  4U0X A;  3ULF A;  2ZMV A;  1OTE A;  1JTD A;  1NRF A;  1NRJ A;  4S2N A;  4HJ3 A;  4MBH A;  1IKG A;  3EQV A;  1IEM A;  4OQI A;  2VK3 A;  2XD5 A;  3OLO A;  2ZQ9 A;  3DAV A;  1N9B A;  3NUL A;  4F94 A;  3JPU A;  2XLN A;  3ZVW A;  4JKT A;  2VX8 A;  2HF6 A;  3F1N B;  2HDU A;  3T4L A;  4WEJ A;  3BFG A;  4LRZ E;  1FIK A;  5L8M A;  1JNU A;  5EE8 A;  4PPR A;  4EWF A;  2ZMF A;  2Y2M A;  3NBL A;  4OOM A;  2GZA A;  3Q7V A;  3CPT B;  2ZOH A;  5GHY A;  4NXB A;  2Z6D A;  1G6A A;  2VGL S;  1SDN A;  1M40 A;  4OPZ A;  2B95 A;  4XXR A;  4DE2 A;  3MZF A;  4DF6 A;  1G68 A;  4EUV A;  3T4O A;  3OCN A;  1KE0 A;  1S6R A;  3PBQ A;  5K5B A;  2QMI A;  1ES3 A;  5G4Y A;  2WAE A;  1ES4 A;  5GLB A;  3MKE A;  2Y55 A;  1TEM A;  4UAA A;  3IX4 A;  2VV7 A;  4LRY C;  3P7N A;  1L0F A;  5EOO A;  3NOT C;  1ONH A;  2AVX A;  4GW9 A;  3LID A;  2WKQ A;  3VSL A;  5IT5 A;  5M18 A;  5DFX A;  2XRN A;  1IYO A;  4M4X A;  1GCE A;  2V9A A;  2BAS A;  1Q2Q A;  1VHM A;  4KZ7 A;  5GHX A;  3UME A;  1I2S A;  3D4F A;  4S2L A;  1KGF A;  4N1X A;  3LUQ A;  2J3T D;  3M2K A;  1TF1 A;  2V1Z A;  4BLM A;  4HJ6 A;  3RH8 B;  3ZG9 B;  3FPV A;  4KQO A;  2EWV A;  4R23 A;  5FAO A;  3W2Z A;  3ZNT A;  3RXX A;  1BLH A;  3A3D A;  4OPR A;  1D7E A;  2YKF A;  5EVI B;  3S7Q A;  3DTI A;  4PM8 A;  2OSU A;  2PAV P;  3MMH A;  2EX9 A;  3PBN A;  1T18 A;  3HL9 A;  2XH9 A;  1OTD A;  4R3A A;  3LO7 A;  1VEU B;  2WGI A;  4F3L B;  5TBM B;  1FCO A;  3LIA A;  4PKY A;  3O87 A;  4K0X A;  5HL6 A;  4UQI M;  4RQ9 A;  3NDG A;  5FI6 A;  4KQQ A;  3BLS A;  4WM9 A;  1LL5 A;  1H0M A;  1DRM A;  2XD1 A;  3WS4 A;  2P74 A;  3VOL A;  3QP8 A;  2FZ0 A;  4I38 A;  4I3J A;  1MC0 A;  3KSG A;  5FL3 A;  3CLO A;  3D3O A;  1XJ3 A;  2W1T A;  4RVA A;  4X68 A;  4MBK A;  3VFF A;  2XDM A;  1E4D A;  3LCE A;  3FKV A;  5TFQ A;  3C5A A;  3NOP C;  3UB8 A;  2HP6 A;  3K3C A;  3N7W A;  3C8C A;  1NYY A;  3PHY A;  1PIO A;  2GNX A;  2CMN A;  1F98 A;  1YM1 A;  3CMZ A;  5J3W A;  2M1C A;  4QWO A;  4OP5 A;  1CF0 A;  1SKF A;  5DTS A;  2Y2G A;  4ETZ A;  4L0L A;  3UE0 A;  1XGI A;  2WZX A;  1GA9 A;  2O99 A;  3L9K A;  1ESU A;  3CHW P;  3E4P A;  4KQR A;  3MZE A;  1MY8 A;  2PBY A;  1ERO A;  1YLT A;  4MLL A;  5AVF A;  1V9Y A;  3IQA A;  4KQD A;  4DXC A;  5DVA A;  2C5W B;  1M6K A;  1NYM A;  4NG2 A;  3NI9 A;  2L1M A;  2WKP A;  2UV0 E;  3CI6 A;  3E4O A;  4E3J A;  4E6X A;  4XT2 A;  3HLW A;  4HNB A;  4FH2 A;  3EGX C;  2G2U A;  4DXB A;  3IXB A;  2VEA A;  1S0W A;  3IT9 A;  4RYE A;  4EXO A;  3O88 A;  3IXG A;  5A91 A;  1LI0 A;  3IF5 A;  4Y0T A;  4N9L A;  3VE4 A;  4U3T A;  2FH5 A;  2Y2L A;  5IU1 A;  3W8K A;  4ARZ B;  2VV8 A;  3VP2 A;  2EXA A;  4QY6 A;  2VZW A;  2Y2N A;  3Q81 A;  3VOY A;  3GDI A;  2XFT A;  4L9E A;  1ZTU A;  2JE5 A;  2OV5 A;  2ZM2 A;  4JLF A;  2DRW A;  3KSH A;  2VA0 A;  5F5Y A;  5FEG A;  4JXW A;  3UDX A;  3MR0 A;  2ACG A;  1AXB A;  3D72 A;  3IWO A;  2M7V A;  3V67 A;  1L0D A;  2QZ6 A;  4KG6 A;  1D1J A;  2HV1 A;  1PI5 A;  5HL1 A;  4OVD A;  3M2J A;  5I5L A;  4UQI S;  4CLC E;  1L0G A;  1TS8 A;  3MF0 A;  3UB6 A;  3NJA A;  3TOI A;  1XJ2 A;  1ZC2 A;  4O0P A;  3F1O A;  1YLP A;  5AQA A;  1NWZ A;  3G6O A;  1MPL A;  5J8X A;  1MZU A;  4WN5 A;  2HGV A;  5DJU A;  3JVU A;  5HAI A;  4GD6 A;  4KZ9 A;  2ZLY A;  2HDS A;  4ETX A;  2QHK A;  4IBX A;  4PAU A;  3LIE A;  1JWV A;  4A5R A;  1Z09 A;  1TD5 A;  3PBR A;  1ES2 A;  1K0K A;  1LSV A;  3MXS A;  3C7V A;  1GSW A;  4Y0O A;  2R78 A;  3G34 A;  3OOV A;  4DRT A;  1NZU A;  4ME4 A;  4R6L A;  3EGD C;  1TS6 A;  1TS0 A;  4HH2 A;  4B9O A;  3S4X A;  1ODV A;  4I39 A;  2WGW A;  1E25 A;  1PI4 A;  1PRQ A;  2HDR A;  5FI7 A;  3LIC A;  2XRO A;  1MKI A;  1G6O A;  3UPO A;  3U4L P;  2PRF A;  3QHY A;  1NLZ A;  4NEE D;  4BBT A;  1FIL A;  1JWP A;  3K3D A;  5FQI A;  1L3L A;  5CHU A;  4FOF A;  1NZO A;  1GA0 A;  4L9F A;  2IWC A;  4FCF A;  3L7H A;  3KYE A;  3UB7 A;  4EEP A;  1LHY A;  4Q0I A;  3KO6 A;  3PYP A;  5IS1 A;  3DWK A;  4KZ8 A;  4HP9 A;  4LPZ A;  3G2Y A;  1JWZ A;  3BRM A;  5L07 A;  2GDN A;  1T1C A;  2PBD P;  1S1Z A;  3A0S A;  2Q0O A;  4GS9 B;  1LL9 A;  4NXG A;  3G32 A;  5AQ7 A;  3GEC A;  4I5S A;  2ZM0 A;  5DF8 A;  3A3J A;  4I3I A;  3UB9 A;  4H8R A;  2M7U A;  3OPP A;  1FOF A;  1G28 A;  5A92 A;  3PBO A;  1NXY A;  4JGO A;  1XFN A;  3PBT A;  1UGU A;  3BFF A;  3HLF A;  1W8Q A;  4GHI A;  4ZAM A;  3WS2 A;  3R7W B;  5EPH A;  2R9W A;  3ZFZ A;  1RGZ A;  4OQG A;  2PD8 A;  2QKP A;  1BUL A;  1UWP X;  5LBR A;  2PHY A;  2Z2M B;  3PBS A;  2ZOI A;  5DFY A;  3T4K A;  5FAP A;  1T1A A;  2XGN A;  5A93 A;  4FD8 A;  3KSF A;  5CGW A;  5HDD A;  1CEF A;  1K6R A;  5M1A A;  3VP0 A;  3P98 A;  3ZDJ A;  3P09 A;  4KG5 A;  3TE8 A;  4PMA A;  4HIA A;  5HPF A;  4KUK A;  4UA7 A;  5DJT A;  3OPR A;  1PYY A;  5AQB A;  2JKT M;  4QU3 A;  1CI8 A;  3BWL A;  4HI4 A;  3VOZ A;  3LFV A;  2WAD A;  4JXS A;  4GDB A;  3V3S A;  4LCM A;  2NUT C;  5DKK A;  3QP6 A;  1BLP A;  3CUE C;  4GOG A;  3ZYT A;  3UE1 A;  2P9V B;  5L2F A;  2KOI A;  1N9N A;  2WK0 A;  3IHA A;  4WMC A;  4S2O A;  5TJJ A;  4DDY A;  3IBR A;  4O7D A;  3S7N A;  3IH9 A;  1U60 A;  1H8M A;  4QY5 A;  1Y54 A;  4IUK A;  1OPX A;  1DJA A;  4MEZ A;  4Q8I A;  4EBL A;  2HP9 A;  4EQ1 A;  3C4O A;  1ACF A;  3UNW A;  3N8R A;  3UDI A;  4S2K A;  3HUO A;  2GJ3 A;  1ES5 A;  5FQJ A;  1PFL A;  4QPR A;  1VQQ A;  2QJ7 A;  1RP5 A;  2KX6 A;  2OOL A;  1BSG A;  4GLQ A;  5AVE A;  2Y2Q A;  3BY9 A;  1DY6 A;  5U47 A;  3T4T A;  1S66 L;  4DDS A;  1KE4 A;  1GHM A;  2H28 A;  1KOU A;  2Y91 A;  5CGX A;  4RX3 A;  2OAQ 1;  2GX5 A;  5GLC A;  4BEN A;  3B3X A;  4QD4 A;  3BQA A;  4XUX A;  4R3B A;  4ZBE A;  5C5K A;  4NET A;  4WLA A;  5F83 A;  5HWT A;  1VB6 A;  2A24 B;  3TRC A;  3A3E A;  4DJ3 A;  5I94 A;  1YKD A;  4PHT A;  4AFI A;  1WYB A;  1Q2P A;  2B5R A;  3IX3 A;  4EBP A;  5EUA A;  4UA9 A;  4BMW A;  4IVK A;  1BYW A;  1STZ A;  4BD1 A;  1HLU P;  1K56 A;  5HD3 A;  1G5U A;  4UA6 A;  4JGP A;  1S4S A;  4QB8 A;  4HES A;  1OT9 A;  4HY8 A;  4EV4 A;  5HWV A;  2JKR M;  3TSG A;  4IVI A;  3SZT A;  3NIA A;  3VP3 A;  2NUP C;  5L09 A;  4MMN A;  3UMD A;  2Y4A A;  1AWI A;  4HH3 A;  4LV3 A;  1K6S A;  4NKP A;  2Y59 A;  3RFB A;  3LI8 A;  5JYO A;  3CWF A;  3N6I A;  3WS0 A;  2X71 A;  2XK1 A;  1GSV A;  3DTK A;  4R0Q A;  2JN7 A;  3EQU A;  1NY0 A;  3B47 A;  1NLY A;  4HOI A;  1W63 M;  1K55 C;  3NOU C;  1FCN A;  3LY3 A;  5HW3 A;  2WKE A;  3ITB A;  4KZB A;  3LIF A;  5HSQ A;  4X1M A;  3CUE A;  4WF0 A;  3DW0 A;  3IX8 A;  5CED A;  2PDR A;  3MBZ A;  3MS6 A;  1J3W A;  1SCW A;  1DP9 A;  3G4P A;  4WZ5 C;  5CX7 A;  4CLC C;  3DWZ A;  2JBF A;  5CER A;  4PM5 A;  3HLD A;  3ZG7 B;  2W3G A;  2VGJ A;  1F5M A;  3C38 A;  3GSG A;  3RJU A;  2Z2L B;  1IFQ A;  2EX6 A;  2J3W A;  3VP4 A;  1JTG A;  1IEL A;  2O9A A;  3FKW A;  1MBL A;  2ZD8 A;  1XJ6 A;  3C7U A;  1N9O A;  3F1P A;  3HLG A;  1BLC A;  2K7S A;  2W1R A;  5F68 A;  1PWD A;  5F69 A;  5F6A A;  3UN7 A;  1CJF A;  2ZQD A;  3FYZ A;  4C75 A;  2V8F A;  1DJB A;  2PYR A;  2V8C A;  4HJ4 A;  5HAQ A;  1IOU A;  2K2N A;  1LSW A;  1MKM A;  3OPL A;  4ZJ3 A;  4X6T A;  3HVF A;  3Q7V B;  4GJ4 A;  4OQ0 A;  3O3V A;  4IED A;  3S1Y A;  1K25 A;  3BW6 A;  4Y3I A;  4LCL A;  4QHC A;  5EEC A;  2H0Y A;  3HJI A;  2OAP 1;  3U2A A;  3PR6 A;  3H82 A;  3QP2 A;  4S2J A;  5EVL A;  5FAT A;  4JF4 A;  4Y2F A;  3LR5 A;  1HTZ A;  2DCF A;  3OC2 A;  1ESI A;  2Y2K A;  4R3J A;  4YOF A;  5KMW A;  4P6B A;  4DMZ A;  2ZQ7 A;  2EFX A;  4EBN A;  2KLI A;  4E3M A;  1C3B A;  4NK3 A;  3T4J A;  4CPK A;  2XEP A;  5CHM A;  3OCL A;  2Y8H A;  2G2W A;  3E4Q A;  3CJM A;  4S2M A;  2HP5 A;  1SDE A;  4KZ3 A;  4EEU A;  4WZ4 A;  4OON A;  4FH4 A;  1K38 A;  3IHB A;  3UO9 A;  1K55 A;  5FDH A;  3UDF A;  4G3V A;  4XUZ A;  3ZG0 A;  1GHP A;  4HEF A;  3JVV A;  4OOY A;  1XA7 A;  1P0Z A;  2K31 A;  4BWI A;  1PW8 A;  4UHU A;  1TVF A;  2PU2 A;  3AGE A;  4LEN A;  5CRF A;  2W3F A;  4WZ5 A;  1H8Y A;  4KG2 A;  4JF6 A; 
#chains in the Genus database with same CATH homology
 2ZM0 A;  5DF8 A;  3A3J A;  4H8R A;  1PWG A;  4F94 A;  3BYD A;  2XLN A;  3ZVW A;  4JKT A;  3OPP A;  4B88 A;  3W4O A;  1FOF A;  2ZQ8 A;  2ZQC A;  4OLG A;  5CTM A;  2HDU A;  3AGD A;  4WEJ A;  5TGF A;  5A92 A;  3PBO A;  1MWU A;  3VFH A;  3ZNY A;  2V20 A;  1NXY A;  1GHI A;  3BFG A;  3PBT A;  3PTE A;  3G2Z A;  3BFF A;  3LY4 A;  3V5M A;  4ZTK A;  2A49 A;  1XX2 A;  3HLF A;  1W8Q A;  3OPH A;  3Q82 A;  4OQH A;  5EE8 A;  4PPR A;  4DE3 A;  1RCJ A;  4ZAM A;  3NBL A;  2Y2M A;  3NDE A;  4OOM A;  3WS2 A;  4EWF A;  4ID4 A;  1Z6F A;  5GLA A;  3BFC A;  4ZDX A;  5EPH A;  2R9W A;  3ZFZ A;  1RGZ A;  4OQG A;  5KSH A;  1FCM A;  1H5X A;  4E3I A;  1BUL A;  3Q7V A;  3ZGA B;  5GHY A;  2IWD A;  4OKP A;  1G6A A;  3GRJ A;  2Z2M B;  3PBS A;  1CI9 A;  1SDN A;  3M6B A;  3WS5 A;  4JXV A;  2H5S A;  4X53 A;  1M40 A;  4OPZ A;  5FAP A;  1FR1 A;  4XXR A;  5DF7 A;  4DE2 A;  4RA7 A;  2XGN A;  3A3F A;  3MZF A;  1FSY A;  4CJN A;  5A93 A;  4FD8 A;  5CGW A;  4DF6 A;  3GTC A;  3HUM A;  1G68 A;  3OCN A;  1KE0 A;  4FSF A;  1CEF A;  1S6R A;  3PBQ A;  5AQ9 A;  5CEB A;  3E2K A;  2QMI A;  1K6R A;  1ES3 A;  4LV0 A;  5M1A A;  3LEZ A;  4BL2 A;  2WAE A;  1ES4 A;  5GLB A;  3MKE A;  3VP0 A;  2ZC4 B;  5GL9 A;  2Y55 A;  1TEM A;  4UAA A;  3P98 A;  1DJC A;  3ZDJ A;  2WKI A;  3P09 A;  5FA7 A;  3V39 A;  4KG5 A;  2XF3 A;  4PM7 A;  3VOZ A;  3FZC A;  5CHJ A;  4YIN A;  3VMA A;  1L0F A;  4HBT A;  5EOO A;  4PMA A;  1YMX A;  5EVI C;  1MWT A;  1ONH A;  4UA7 A;  2ZQA A;  3VSL A;  1FR6 A;  3OPR A;  5M18 A;  3HRE A;  3HBR A;  1IYO A;  3GV9 A;  1ALQ A;  1GCE A;  1O7E A;  1FQG A;  1PYY A;  5AQB A;  4QU3 A;  2CC1 A;  1CI8 A;  1Q2Q A;  4KZ7 A;  5GHX A;  5FQ9 A;  4WEK A;  2HDQ A;  1WYC A;  4JXS A;  1I2S A;  2WAD A;  3D4F A;  4GKU A;  4GDB A;  5HX9 A;  3V3S A;  4LCM A;  4OOL A;  4S2L A;  1KGF A;  4OPY A;  5DTK A;  2R9X A;  1BLP A;  1W8Y A;  3A3I A;  4N1X A;  4WBG A;  2JC7 A;  4GOG A;  1TDL A;  2WYX A;  3UE1 A;  2P9V B;  2HPB A;  3M2K A;  3N8L A;  5L2F A;  2V1Z A;  4BLM A;  1SHV A;  2WK0 A;  4MNR A;  1BTL A;  3IHA A;  4HBU A;  4WMC A;  3ZG9 B;  4KQO A;  3HLC A;  3AGF A;  4GZB A;  3DTM A;  3V3R A;  1BUE A;  3QNC A;  1J9M A;  4S2O A;  3Q1F A;  4Y7P A;  3ZHH A;  4DDY A;  1K54 C;  4O7D A;  3IH9 A;  2XR0 A;  4R23 A;  1U60 A;  5FAO A;  4QY5 A;  5FQK A;  1Y54 A;  3RXX A;  3UE3 A;  1BLH A;  3ZG8 B;  1KGG A;  4Y0U A;  3A3D A;  3SS5 A;  4OPR A;  1DJA A;  4MEZ A;  4Q8I A;  1O07 A;  5EVI B;  4EBL A;  2HP9 A;  4ZJ1 A;  3TG9 A;  3C4O A;  4PM8 A;  3IF6 A;  4Z9Q A;  3N8R A;  3UDI A;  3UNW A;  4S2K A;  2EX8 A;  1H8Z A;  4KZ4 A;  2OSU A;  3HUO A;  4C6Y A;  1ES5 A;  2EX9 A;  2PU4 A;  3HLE A;  3PBN A;  4WYY A;  5FQJ A;  3HL9 A;  2XH9 A;  4BQM A;  3HLB A;  1VQQ A;  4WEL A;  4GB7 A;  2ZC7 A;  1RP5 A;  3BM6 A;  1BSG A;  4GDN A;  2Y2Q A;  3LO7 A;  1JVJ A;  3N4I A;  4MBF A;  3SH7 A;  1KVL A;  1DY6 A;  2WGI A;  5F1G A;  5U47 A;  5CXW A;  4DDS A;  1FCO A;  1KE4 A;  1IYP A;  1GHM A;  2ZC3 B;  3O87 A;  4S2I A;  3IH8 A;  4K0X A;  1PZO A;  2Y91 A;  1W5D A;  5CGX A;  4RX3 A;  3NDG A;  5FI6 A;  2Q9N A;  3QNB A;  4KQQ A;  5GLC A;  3BLS A;  4BEN A;  3B3X A;  1ZG6 A;  4QD4 A;  4WM9 A;  5IHV A;  4XUX A;  4ZBE A;  4R3B A;  1E3U A;  2H10 A;  1LL5 A;  1CK3 A;  4S2P A;  5FSR A;  2XD1 A;  4NET A;  3WS4 A;  5F83 A;  2P74 A;  3SH8 A;  2DNS A;  5D3O A;  4B4Z A;  1XXM A;  1IYQ A;  4JBF A;  1PW1 A;  2C6W B;  3IWI A;  3A3E A;  5I94 A;  3ISG A;  4PM6 A;  3UPP A;  1BLS A;  4X68 A;  4R4R A;  4RVA A;  2X01 A;  3SOI A;  1ZKJ A;  1KGE A;  2OLV A;  4MBK A;  3VFF A;  2XDM A;  1WYB A;  1E4D A;  3LCE A;  1ONG A;  1Q2P A;  2B5R A;  3FKV A;  5TFQ A;  4KZ5 A;  1N4O A;  3C5A A;  2H0T A;  1KDS A;  4EBP A;  5EUA A;  2HP6 A;  1TDG A;  4GNU A;  4UA9 A;  3N7W A;  2BLS A;  1NYY A;  4IVK A;  1PIO A;  4X55 A;  1YM1 A;  3CMZ A;  3Q7Z A;  4BD0 A;  4BD1 A;  4E3L A;  4OP5 A;  4U0T A;  1SKF A;  5DTS A;  1K56 A;  2Y2G A;  4D2O A;  4L0L A;  1ZG4 A;  3GQZ A;  5DF9 A;  4R4S A;  4UA6 A;  4KZA A;  3UE0 A;  5CGS A;  3MZD A;  1XGI A;  4KEN B;  2WZX A;  2QPN A;  4E6W A;  4QB8 A;  4HES A;  1GA9 A;  1YMS A;  1PWC A;  1ESU A;  4M3K A;  3PAG A;  4KQR A;  4LV1 A;  4EV4 A;  3MZE A;  1EI5 A;  1MY8 A;  1BZA A;  2Y2O A;  2PBY A;  1ERO A;  1YLT A;  3TSG A;  3UPN A;  4MLL A;  4QJG A;  2EXB A;  4IVI A;  1RGY A;  2UWX A;  4JPM A;  4X69 A;  2J7V A;  3BEB A;  3IQA A;  3NIA A;  2Y2H A;  1K4F A;  3VP3 A;  4DXC A;  3MKF A;  5HAP A;  5BOH A;  5DVA A;  2C5W B;  5E2F A;  1M6K A;  1NYM A;  4K0W A;  3VP1 A;  4N92 A;  2Y2J A;  2P9V A;  2BG1 A;  3NI9 A;  4OPQ A;  5A90 A;  2Y4A A;  2Y2P A;  4LV3 A;  1K6S A;  3ZG5 A;  1XA1 A;  4E3J A;  2Y59 A;  4E6X A;  1OME A;  1QME A;  1YT4 A;  3HLW A;  2JCH A;  4FH2 A;  1VM1 A;  2J9O A;  1ERM A;  2G2U A;  4DXB A;  5JYO A;  3IXB A;  5JYP A;  5M19 A;  3N6I A;  3WS0 A;  5EVI A;  2X71 A;  2XK1 A;  1S0W A;  1HVB A;  3ZVT A;  3W4P A;  1IYS A;  1K57 C;  4R0Q A;  3IT9 A;  3JYI A;  4RYE A;  3O86 A;  3O88 A;  3EQU A;  3IXG A;  1NY0 A;  5HFO A;  4PM9 A;  5A91 A;  1K55 C;  1LI0 A;  2Q9M A;  3IF5 A;  1FCN A;  3G31 A;  4Y0T A;  4N9L A;  3LY3 A;  5HW3 A;  2WKE A;  3ITB A;  2WGW B;  4KZB A;  4U3T A;  1LLB A;  1XGJ A;  2Y2L A;  3W8K A;  3WRT A;  3VP2 A;  2Y2I A;  2EXA A;  1I5Q A;  4QY6 A;  4S2N C;  3DW0 A;  3S22 A;  2Y2N A;  3Q81 A;  3WS1 A;  4DE1 A;  1K57 A;  3VOY A;  5CED A;  3MBZ A;  4E3O A;  2XFT A;  2J9P A;  2JE5 A;  2OV5 A;  3SS4 A;  4X56 A;  1SCW A;  2ZM2 A;  4JLF A;  5F1F A;  3G4P A;  2DRW A;  1XPB A;  5E43 A;  2EX2 A;  3GVB A;  1K54 A;  1HD8 A;  3E2L A;  4WMC D;  4WZ5 C;  2WKH A;  4JXW A;  1YLJ A;  3UDX A;  3GMW A;  3DWZ A;  3NC8 A;  1MWR A;  2JBF A;  1AXB A;  3IWO A;  3ZNT A;  4P87 A;  4E3N A;  1L0D A;  1MXO A;  2QZ6 A;  4KG6 A;  3CZD A;  5CER A;  2IWB A;  4P0M A;  1PI5 A;  3WRZ A;  4OH0 A;  3M2J A;  4OVD A;  3IXH A;  4EUZ A;  5HL1 A;  1KDW A;  4PM5 A;  3BFD A;  3HLD A;  1L0G A;  3ZG7 B;  1MWS A;  2XQZ A;  2VGJ A;  3FV7 A;  2X02 A;  3IF6 B;  5FQM A;  3BLM A;  4JF5 A;  3C4P A;  1ERQ A;  3GSG A;  4GN2 A;  3RJU A;  3TOI A;  4C3Q A;  4R1G A;  2WZZ A;  1L0E A;  1K4E A;  2Z2L B;  1ZC2 A;  2EX6 A;  3VP4 A;  1JTG A;  1IEL A;  3CG5 A;  1FSW A;  3FKW A;  1MBL A;  1YLP A;  5AQA A;  2ZD8 A;  3GR2 A;  4ZJ2 A;  1XKZ A;  3C7U A;  3Q07 A;  2WUQ A;  3V50 A;  1MPL A;  5J8X A;  3NY4 A;  3HLG A;  1BLC A;  2RCX A;  5HAR A;  1W7F A;  3UY6 A;  5E2E A;  4YFM A;  1E3U D;  3NCK A;  1YLZ A;  1BT5 A;  5E2H A;  5HAI A;  5EOE A;  3IWQ A;  2FFF B;  4GD6 A;  4KZ9 A;  1PWD A;  2ZLY A;  2EFU A;  3BEC A;  5GLD A;  1CEG A;  2J8Y A;  4RX2 A;  2HDS A;  3UN7 A;  2ZQD A;  3FYZ A;  4C75 A;  2FFY A;  4IBX A;  1DJB A;  4P85 A;  4BJP A;  1JWV A;  4N9K A;  5HAQ A;  4A5R A;  2A3U A;  4BL3 A;  1YLY A;  2WGV A;  1QMF A;  3PBR A;  2ZC6 B;  5G18 A;  3OPL A;  1ES2 A;  4GD8 A;  5CTN A;  4ZJ3 A;  4DE0 A;  4X6T A;  3HVF A;  3Q7V B;  3M6H A;  4JXG A;  4LV2 A;  3MXS A;  3C7V A;  4OQ0 A;  2RL3 A;  3O3V A;  4IED A;  3S1Y A;  4Y0O A;  5E2G A;  1K25 A;  3G35 A;  3G34 A;  1K56 D;  4LCL A;  5CEC A;  1I2W A;  2ZJ9 A;  4QHC A;  5EEC A;  3WWX A;  4DRT A;  2H0Y A;  1NZU A;  1PZP A;  1YLW A;  5FAS A;  4B4X A;  4IBR A;  4K91 A;  4E3K A;  2ZM8 A;  5FI2 A;  3S4X A;  3VSK A;  2WGW A;  2ZMA A;  1E25 A;  1PI4 A;  4S2J A;  5EVL A;  4DKI A;  5FAT A;  4JF4 A;  3G30 A;  2HDR A;  3RXW A;  5FQQ A;  2VGK A;  5FI7 A;  1HTZ A;  2DCF A;  1MKI A;  1ESI A;  2V2F F;  2Y2K A;  3HUN A;  3OC2 A;  3UPO A;  1KE3 A;  4R3J A;  1WE4 A;  4OP8 A;  1EWZ A;  4P6B A;  3ITA A;  5KMW A;  3QHY A;  2ZQ7 A;  1NJ4 A;  3OZH A;  5FAQ A;  2WAF A;  2EFX A;  3IXD A;  4EBN A;  1JWP A;  5DTT A;  4E3M A;  4N1H A;  5FQI A;  1C3B A;  4OLD A;  3N8S A;  1XP4 A;  4NK3 A;  2XFS A;  5CHU A;  4CPK A;  1NZO A;  1GA0 A;  2I72 A;  2XEP A;  2OLU A;  5CHM A;  3ZCZ A;  2IWC A;  4FCF A;  3OCL A;  2G2W A;  3IF6 C;  3CJM A;  4S2M A;  2HP5 A;  1SDE A;  1LHY A;  4KZ3 A;  3SH9 A;  2E8I A;  4WZ4 A;  5EVI D;  3MXR A;  4OON A;  1YQS A;  4FH4 A;  3DWK A;  3MFD A;  1K38 A;  3IHB A;  3UO9 A;  4EQI A;  2ZC5 B;  5TR7 A;  1K55 A;  1HZO A;  1W79 A;  4KZ8 A;  5FDH A;  3I7J A;  3SS3 A;  3BFE A;  1LI9 A;  5F82 A;  3G2Y A;  1JWZ A;  3BRM A;  5KZH A;  1IKI A;  1KVM A;  4U0X A;  3UDF A;  3PAE A;  3ZG0 A;  4XUZ A;  1GHP A;  4HEF A;  5GHZ A;  3FWL A;  4OOY A;  1XA7 A;  2GDN A;  1JTD A;  4KZ6 A;  1NRF A;  4S2N A;  4MBH A;  1IKG A;  3EQV A;  3W4Q A;  1PW8 A;  4UHU A;  1TVF A;  2PU2 A;  3AGE A;  1IEM A;  4LEN A;  5CRF A;  1LL9 A;  4OQI A;  3G32 A;  5AQ7 A;  4WZ5 A;  1L2S A;  1H8Y A;  2XD5 A;  4KG2 A;  4JF6 A;  2ZQ9 A;  5KSC A;  1N9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...