3RXXA

Kpc-2 carbapenemase in complex with 3-npba
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
NLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Carbepenem-hydrolyzing beta-lactamase KPC
publication title Crystal structures of KPC-2 {beta}-lactamase in complex with 3-nitrophenyl boronic acid and the penam sulfone PSR-3-226.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 95
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3rxxA00
2Y2GA 3BFEA 1ERQA 4RA7A 1L0EA 4FSFA 4K0WA 5CGSA 4BLMA 4JF4A 4X6TA 4E3IA 1N9BA 1XA1A 1U60A 3C7VA 4KG6A 5CHUA 4S2IA 5EVID 1YM1A 1FCNA 3LEZA 4IEDA 1YLWA 2BG1A 3SH8A 3ZG0A 3E2KA 5EE8A 3WS4A 4LCLA 5GHZA 2OSUA 1BSGA 1SDNA 2RCXA 3DTMA 3FWLA 4N9KA 3HLBA 4GZBA 4Y0OA 3MKFA 1FCMA 3MKEA 4LV1A 3WS1A 1ALQA 4GN2A 1SHVA 2EXAA 3IXDA 3Q7ZA 3RXXA 1I2WA 3PTEA 4GKUA 5GL9A 2G2WA 4U0TA 1K57C 3UO9A 4S2MA 4DF6A 1K55C 1Q2QA 1TEMA 3A3JA 3OPRA 2WAFA 3VOYA 4HEFA 5HW3A 4DE3A 5I94A 2XH9A 3ZFZA 1PI4A 5G18A 5FATA 1BULA 2PU2A 5F83A 5HAQA 3GSGA 1JWZA 3Q7VB 1FR6A 4DE0A 1W79A 3ZCZA 2OLUA 4ZTKA 4R4RA 2WADA 1MXOA 2E8IA 2R9XA 1ZG4A 2C5WB 4XUXA 5E2GA 1W5DA 2Q9NA 1YMXA 1NJ4A 1RP5A 3O3VA 4R3JA 5HL1A 1HD8A 5E43A 2ZC3B 2XQZA 1GHIA 2XFSA 3LY4A 3V3SA 3W4QA 5J8XA 2ZM8A 2EX2A 2XD1A 2ZC4B 1MWTA 1SCWA 1NYYA 3VP0A 3FZCA 3VSKA 1GHMA 4PMAA 3WRZA 1LL5A 2WUQA 3RJUA 4R1GA 3N8RA 3UPNA 3B3XA 4OPQA 1LL9A 4JPMA 3C7UA 3PAEA 4S2NA 5DTTA 1FQGA 4X56A 3UN7A 2WGVA 2HP5A 3BRMA 4A5RA 1VM1A 4B88A 4GNUA 4WZ5A 5AQBA 4IBXA 3FKVA 4JXVA 3ZVTA 4KZ5A 1TDGA 1HTZA 5HAIA 3UDXA 4E6XA 5CEBA 1TVFA 4S2OA 2Y2KA 3VP2A 2JBFA 3QNCA 1BLSA 3BFGA 5AQ9A 3HL9A 4WELA 2J8YA 2VGJA 1J9MA 4H8RA 1BT5A 4LCMA 1ONHA 2DRWA 2WKEA 4JXGA 5EVLA 4EQIA 2WKIA 3IWOA 4UA6A 1FSYA 3P98A 4OPRA 2ZM0A 1K6SA 2EXBA 2XD5A 4P85A 5M1AA 3SS5A 3PBNA 1Y54A 3ITBA 5EPHA 1YT4A 5E2EA 5KZHA 3ZG5A 4S2LA 4XUZA 1XGJA 3GRJA 1AXBA 2C6WB 4HBUA 5A93A 4GOGA 3A3IA 4JLFA 3V5MA 4GD6A 4LV3A 5GLAA 4FH2A 3G31A 4N9LA 3GQZA 1YLJA 3W4OA 3WS0A 1XKZA 1M6KA 2EX8A 3NDGA 1RGYA 3NI9A 4N1HA 2J7VA 4MBHA 1EI5A 2HDRA 4L0LA 5DF9A 1BTLA 2P74A 3AGFA 4E3NA 3ZDJA 1ES4A 4OVDA 1MBLA 4EBPA 4BJPA 3IXBA 3PBRA 2WGWA 4S2KA 1TDLA 4WBGA 4UAAA 4E3KA 1EWZA 1KDSA 3IQAA 3MZFA 1L0FA 1GA0A 1L2SA 3C4OA 5KSCA 3NBLA 1NZUA 1CEGA 3G2YA 5TFQA 5FQIA 4GB7A 5KMWA 2QZ6A 1IYQA 3N8LA 4MBFA 4QY6A 2HPBA 4O7DA 4WZ4A 5M19A 2WZXA 1SKFA 1XA7A 2Z2LB 3LCEA 1KGEA 3MFDA 3ZG7B 2JE5A 3MXRA 2J9PA 5CGXA 4EBLA 1W8QA 2XR0A 3CG5A 4C75A 2XF3A 1JWPA 1BLCA 4E3LA 1PZOA 1ES2A 2ZD8A 1Q2PA 4C3QA 4RYEA 4Z9QA 5DF8A 1NXYA 1XXMA 3HLGA 4BL2A 1O7EA 4BD1A 1PW1A 4UA9A 4QY5A 5EVIB 1NYMA 4D2OA 5CRFA 4ZJ3A 4KG5A 4KZ4A 1PWCA 4QB8A 2WYXA 4KZ8A 2Y55A 3SH7A 1E3UD 2Y91A 2ZC7A 3GMWA 5EOOA 5F82A 5FQQA 1FR1A 4S2JA 3HUNA 1K56A 4N92A 2IWDA 4R4SA 2WGWB 1BZAA 1KVMA 3OPHA 5E2HA 3G30A 3VP3A 3UDFA 5EECA 4DE2A 1MPLA 2HDSA 1N4OA 4PM5A 3GTCA 3V39A 3IWIA 4B4ZA 3UPPA 4DXBA 1LHYA 4Y7PA 3CJMA 1EROA 4U0XA 2HP9A 4KZ9A 5CHMA 3ZGAB 4BENA 3HREA 3MZEA 3O88A 5D3OA 3IF6B 2HP6A 1DJAA 4QU3A 5TGFA 2WGIA 3VP1A 1KGGA 3VOZA 3QHYA 2Y59A 3LO7A 1L0DA 2FFYA 4JXSA 1S6RA 1DJBA 4UHUA 4K0XA 4OP8A 1WE4A 3VSLA 4QJGA 3OC2A 3BECA 1IKIA 4KQRA 1PW8A 1E4DA 3M6BA 4X68A 1LLBA 5A91A 1KGFA 3G32A 2Y2OA 5E2FA 5GLBA 4OPZA 3HLCA 1ES3A 1I2SA 4OLGA 5AQ7A 5FI2A 3SH9A 1SDEA 4P0MA 3NDEA 4P87A 3PBQA 3ZNYA 3QNBA 1PI5A 5M18A 1YLTA 1IYOA 1ZC2A 2ZQAA 1W8YA 4OOMA 3BLMA 3LY3A 4PM7A 3WS5A 2H0TA 3AGDA 1RCJA 1KE3A 4NETA 1ESUA 2EFXA 2ZM2A 4OH0A 5TR7A 1JWVA 4KQOA 4MLLA 4M3KA 1BUEA 1LI0A 4R3BA 1NRFA 3UE0A 4DE1A 4ZDXA 3TOIA 2V1ZA 3OPPA 1E25A 2H10A 3DWKA 3NC8A 4WEJA 3SS4A 4E3MA 1PZPA 1CK3A 5FAOA 2XFTA 1PWDA 1K4FA 2Y2HA 4PM9A 1IYPA 2XGNA 2X02A 2Y4AA 4QD4A 5EVIA 3SOIA 1MWSA 4X53A 3NY4A 1K54A 4YFMA 5GLDA 2WK0A 4OLDA 1K57A 1CI9A 3UE3A 3C5AA 1K4EA 3A3DA 1O07A 1BLHA 5BOHA 4OOLA 4OOYA 1ESIA 1ZKJA 3FYZA 4WYYA 5HX9A 1JVJA 2ZC5B 4JKTA 2I72A 3TG9A 3IWQA 5EOEA 1CEFA 2ZQ7A 3E2LA 4S2NC 4OP5A 2P9VB 4PM8A 4E6WA 2DCFA 1GHPA 4PM6A 2V20A 3CZDA 4MEZA 5CGWA 4F94A 2OLVA 4PPRA 3IXGA 3BFCA 4WZ5C 2HDQA 2A49A 4DKIA 1NZOA 2JCHA 4JXWA 4UA7A 5FA7A 3GV9A 3BFFA 3IF5A 1ONGA 3Q07A 4K91A 3C4PA 3IHAA 1E3UA 3HLEA 3IF6A 5HAPA 4GDBA 3HLDA 3N4IA 3S1YA 1XX2A 1KE4A 2IWCA 4LENA 3NIAA 1PWGA 1K25A 4MNRA 4WMCD 1MY8A 2EX6A 2Y2QA 1YQSA 3WS2A 5L2FA 3G2ZA 5FQMA 2G2UA 2X71A 3Q82A 5GHXA 4P6BA 3ZNTA 2Y2PA 5GLCA 1S0WA 1GA9A 1KDWA 2WKHA 5JYPA 4KZ3A 3N6IA 3DW0A 4RX2A 4JBFA 4FD8A 2H0YA 4E3OA 1PYYA 3MBZA 2XEPA 3PBTA 4RVAA 2ZQDA 2VGKA 4OQIA 2JC7A 5HFOA 2OV5A 3VFHA 2WAEA 3WRTA 5A92A 3IH9A 4R23A 3JYIA 3UE1A 1HZOA 5AQAA 3VFFA 2HDUA 5EVIC 1DJCA 3ITAA 1K54C 2V2FF 4FCFA 1G68A 2XLNA 1FOFA 3EQVA 4KENB 5CEDA 5FDHA 4B4XA 4QHCA 4IBRA 5FI6A 4DDSA 1MWUA 3Q81A 5FAQA 4FH4A 4ZAMA 3P09A 1ZG6A 1XPBA 4IVIA 2Y2JA 3ZG9B 3AGEA 3I7JA 5FASA 4WM9A 1IELA 3HBRA 3O86A 2GDNA 3BLSA 3WWXA 1ES5A 3MZDA 1IEMA 3IHBA 3S4XA 4C6YA 3BFDA 4DXCA 3O87A 1WYBA 4LV2A 4U3TA 2FFFB 1NY0A 3HUOA 5CERA 3W8KA 1GCEA 3N7WA 5FQ9A 3GVBA 1W7FA 2XK1A 3GR2A 5CXWA 5FQJA 2Q9MA 4BD0A 1K38A 3IF6C 5JYOA 3A3EA 1IKGA 3BYDA 4GD8A 2PBYA 4LV0A 5DTKA 1LI9A 2IWBA 3PAGA 4EV4A 4OQ0A 5DVAA 1Z6FA 4ZJ1A 3ZVWA 1JTDA 2P9VA 2Y2LA 1H8YA 3BM6A 3VMAA 4OONA 4HESA 1YMSA 1K56D 3DWZA 1MKIA 3M6HA 4EUZA 4Q8IA 5A90A 4WEKA 3Q1FA 4GDNA 2ZC6B 2BLSA 1CI8A 4KZ7A 4EBNA 2ZLYA 3EQUA 5U47A 3UDIA 2A3UA 5KSHA 1KVLA 2RL3A 3PBSA 4XXRA 4DRTA 1XGIA 4MBKA 4X55A 2ZQCA 3A3FA 1M40A 4S2PA 1H5XA 3D4FA 3HVFA 2WZZA 3M2KA 5F1GA 2ZJ9A 4Y0UA 3BEBA 3HLFA 4NK3A 3IXHA 1YLYA 3NCKA 4EWFA 1JTGA 5DTSA 2J9OA 1FCOA 3OZHA 1PIOA 2CC1A 4OPYA 4R0QA 5F1FA 5CECA 2Y2NA 5DF7A 4X69A 5FAPA 1H8ZA 3HLWA 4HBTA 2X01A 1I5QA 3N8SA 1XP4A 1IYSA 4ZBEA 1K55A 5EUAA 4KG2A 2B5RA 1K6RA 4KZBA 4E3JA 5HARA 3MXSA 4WMCA 5GHYA 4ZJ2A 1QMEA 3IT9A 3HUMA 3CMZA 1L0GA 1WYCA 4RX3A 2EX9A 4JF6A 2QMIA 5CHJA 4CPKA 4DDYA 1C3BA 1ERMA 2Y2MA 4ID4A 3ZG8B 4IVKA 3FKWA 3UPOA 4BQMA 4OQGA 3IH8A 1HVBA 5CTNA 5CTMA 1KE0A 4KZAA 3OCNA 2H5SA 2R9WA 1G6AA 3G34A 3TSGA 3UNWA 2Y2IA 1DY6A 3G35A 2QPNA 3Q7VA 3VP4A 5FI7A 4OQHA 3ISGA 2UWXA 1BLPA 2PU4A 4OKPA 5FSRA 3RXWA 1YLZA 3OPLA 4CJNA 3V3RA 5IHVA 1YLPA 4KQQA 1VQQA 1FSWA 1RGZA 3PBOA 4KZ6A 3G4PA 3S22A 3ZHHA 4YINA 1MWRA 4N1XA 3OCLA 2ZQ8A 4Y0TA 3UY6A 3FV7A 5FQKA 2EFUA 3V50A 4BL3A 2DNSA 2ZMAA 4JF5A 1OMEA 2XDMA 1QMFA 3SS3A 3M2JA 2Z2MB 3W4PA 2ZQ9A
chains in the Genus database with same CATH superfamily
1ERQA 1L0EA 4K0WA 2P08A 3CLOA 3S7PA 1N9BA 3EOIA 1MC0A 3ZG0A 2BG1A 3E2KA 5EE8A 1BSGA 3DTMA 4N9KA 1ACFA 4Y0OA 1LL8A 1FCMA 3WS1A 4GN2A 3IXDA 3RXXA 4GKUA 5GL9A 1YKDA 4PHTA 2G2WA 1K57C 3CAXA 1K55C 3A3JA 3OPRA 5HW3A 3ZFZA 5HAQA 1JWZA 4DE0A 3ZCZA 2OLUA 5F69A 1MXOA 2C5WB 4XUXA 5E2GA 5EFWA 1RP5A 3O3VA 5E43A 1GHIA 5J8XA 5FEGA 2PAVP 4NXFA 3BQAA 1LL5A 4PAUA 3IBRA 4GW9A 4B88A 4GNUA 3ZVTA 4KZ5A 1HTZA 4LRZE 5HAIA 3UDXA 3T1XA 1BLSA 4WELA 2GJ3A 2J8YA 2VGJA 1J9MA 1G28A 1ONHA 1P9RA 1D1JA 4MDZA 4HP4A 3R4KA 3PHYA 4BWIA 2VV7A 3RFBA 1K6SA 2PBDP 2W3EA 3DTIA 5E2EA 1NLZA 3H7WB 1AXBA 2C6WB 4K08A 1YLJA 2JKRM 1TS6A 3WS0A 1M6KA 5K5BA 3LIBA 2XROA 2J7VA 4MBHA 2O9AA 2KOIA 2LB9A 3KX0X 3EGDC 3T12B 4UAAA 4E3KA 1L0FA 1GA0A 3T50A 2JKFA 1NZUA 4H6JB 2NUTC 4GB7A 4FTXA 4EESA 4MBFA 1S1YA 4IUHA 2HPBA 3FPVA 3LEQA 3ZG7B 3MFDA 3C8CA 2JE5A 3VV4A 1W8QA 3RH8B 2XR0A 3DBAA 2XF3A 4E3LA 2VKSA 5DF8A 4BD1A 2BASA 3B33A 5EVIB 1NYMA 5CRFA 4QB8A 2J3TC 2ZC7A 3GMWA 5F82A 2GNXA 3HUNA 3E4QA 1BZAA 3IBJA 3G30A 5EECA 4RQ9A 2HDSA 5KIZA 5IT5A 1PFLA 2E8JA 3GTCA 1OTDA 3LFVA 3OBFA 3EGXC 4U0XA 1H0MA 5CHMA 5D3OA 2VEAA 1KGGA 5HDDA 3QHYA 4Q0IA 3MS6A 1L0DA 4JXSA 2V0UA 5FDSA 4IUKA 1IKIA 1PW8A 3MQOA 3M6BA 1KGFA 4DN0A 3G32A 4OLGA 5FI2A 3NDEA 3ZNYA 1PI5A 5M18A 4JGOA 1YLTA 3BQ8A 2ZQAA 3BLMA 4LLOB 3F1OB 3L9KA 2ZM2A 2G7UA 4MLLA 1BUEA 3T4JA 1ODVA 3CITA 4DE1A 2D01A 3OPPA 4E3MA 1PZPA 5FAOA 2Y2HA 2XGNA 2Y4AA 3EEHA 4OLDA 1K57A 1O07A 1BLHA 5BOHA 4OOLA 3FYZA 4WLAA 4WYYA 4JKTA 3UMEA 4Y17A 3IWQA 5EOEA 3E2LA 3H9WA 5L09A 4E6WA 3K3CA 2DCFA 2B02A 2V20A 3CZDA 4MEZA 5CGWA 1HLUP 3IXGA 4WZ5C 2A49A 4DKIA 4UA7A 2FH5A 3C4PA 3HLEA 2EA9A 3T4SA 2XRNA 3S1YA 1XX2A 1KE4A 3UE6A 1DP6A 4LENA 1PWGA 1K25A 4MNRA 1A0KA 3SW1A 1MY8A 2J3TD 2X71A 3Q82A 3VE3A 2QJ5A 4P6BA 1FIKA 4HH2A 1S0WA 1PNEA 1LSVA 3H82A 1GA9A 3N6IA 4JBFA 4FD8A 5F68A 1PYYA 3LIEA 1TS8A 3QP4A 2JC7A 4CQHA 3S7QA 2HJ9C 3WRTA 3IH9A 5HZHA 4R23A 3F1PA 5EVIC 1K54C 4NKPA 5CEDA 2XLNA 4NG2A 1FOFA 5FDHA 5TJJA 4QHCA 4DDSA 1MWUA 2MJ6A 4EXOA 3K3DA 5F5YA 4IVIA 2QJ7A 3AGEA 1TD5A 3I7JA 1SKOA 3HBRA 3O86A 3T4LA 1ES5A 1IEMA 3BFDA 4U3TA 5FQ9A 4GHIB 1W7FA 5C5KA 3GR2A 5HWVA 4MN6A 3UB8A 2JN7A 3A3EA 4I38A 1Z6FA 4I3IA 2V0WA 2P9VA 1H8YA 3BM6A 1IOUA 4Y15A 1K56D 2OAQ1 5A90A 5DFYA 4GDNA 2ZC6B 2BLSA 4KZ7A 3MR0A 3CUEC 3UDIA 2A3UA 3UB5P 5J3WA 4XXRA 2W3DA 1M40A 2WZZA 2ZJ9A 4NK3A 3BEBA 3P01A 1X0OA 3MFXA 4F3LA 1FCOA 3OZHA 2CC1A 2VA0A 4M4XA 4PKYG 1H8ZA 2X01A 1IYSA 5EUAA 2EWVA 4KG2A 1GSVA 5HARA 3MXSA 4ZJ2A 3CMZA 2HJEA 4JF6A 3LR3A 3BY9A 1C3BA 1TS7A 2XA7M 5CTMA 5CTNA 2H5SA 3TSGA 4Z1WA 1DY6A 3V67A 5FI7A 3ISGA 5J7EA 5HWTA 3ZQ5A 3KYZA 4QPRA 5IHVA 2JKRI 1VQQA 1VETB 4Y5FA 4KZ6A 5FL3A 4WL9A 4YNRA 3OCLA 2ZQ8A 3UY6A 5FQKA 2DNSA 3QP8A 4KQDA 2V8FA 4RA7A 4FSFA 4HH3A 3C7VA 5EVID 4KG6A 3SOIA 4S2IA 3LEZA 3SH8A 3WS4A 2OSUA 1SDNA 3MKFA 3T4KA 1SHVA 1I2WA 2PRFA 4DF6A 1Q2QA 4FOFA 3VOYA 2WAFA 4HEFA 2YKFA 5HDCA 4R4RA 3F1NB 2P7JA 3U4LP 2ZL1A 2W1RA 1YAXA 2Q9NA 2OWHA 1NJ4A 4R3JA 1T19A 5HL1A 2XQZA 1NLYA 3LY4A 3V3SA 3W4QA 4NXBA 1MWTA 1SCWA 1NYYA 3FZCA 3TW8A 4PMAA 3RJUA 1S66L 4R6LA 1FQGA 3TE8A 3BRMA 4A5RA 1VM1A 4WZ5A 3U2AA 3IS2A 1TDGA 5CEBA 4E6XA 2JBFA 3LYXA 2FZ0A 4H6JA 2V8CA 4H8RA 4LCMA 2DRWA 2DMWA 4JXGA 2UV0E 3IWOA 4UA6A 2ZM0A 2A24B 3SS5A 2LB5A 3ITBA 3ZG5A 4ETXA 5IU1A 4ARZB 4GOGA 3A3IA 1GSWA 4JLFA 4GD6A 3V5MA 4N9LA 1XKZA 1OTEA 4L9GA 1BYWA 1CQAA 2HDRA 4L0LA 5DF9A 1BTLA 3ZDJA 4OVDA 2XSSA 4PKYA 1STZA 4BJPA 3IXBA 3PBRA 3A0VA 3TRCA 4WBGA 1EWZA 1KDSA 3MZFA 1L3LA 2KDKA 5TBMB 5KSCA 1Y4OA 5TFQA 5HD5A 1OT6A 2QZ6A 1IYQA 3FC7A 4UQIS 3N8LA 4WZ4A 4O7DA 2WZXA 1DRMA 3MJQA 1KGEA 2L0WA 4JGRA 3MXRA 4Y13A 4C75A 1JWPA 2ZD8A 4RYEA 3QP6A 1XXMA 3HLGA 4R38A 4GS9B 2Y8HA 4D2OA 3QP2A 3CUEA 1K0KA 2WYXA 4KZ8A 2Y91A 5EOOA 1FR1A 2IWDA 2CMNA 3OPHA 5EVEA 2O99A 1N4OA 4PM5A 4EERA 1LHYA 4Y7PA 1EROA 1Y28A 2ZBBA 2Y59A 4K0XA 4OP8A 1WE4A 3UB6A 4QJGA 3PYPA 4KQRA 3VOLA 1LLBA 3KSHA 5A91A 3BJNA 4AFIA 1ES3A 5AQ7A 1SDEA 1XJ2A 1CJFA 1P97A 3QNBA 3IX8A 3L7HA 1W8YA 4PM7A 3CI6A 3MF0A 1LSXA 5TR7A 2PR6A 4KQOA 1S67L 1LI0A 2XA7S 1NRFA 4IJGA 1E25A 4HOIA 2H10A 3DWKA 4LRYC 4WEJA 1K4FA 2PD7A 1SZVA 3KYQA 3GECA 3UE3A 1K4EA 2PYRA 4OOYA 1ESIA 5HX9A 1OPXA 1CEFA 3OLOA 4PM8A 4PM6A 3BFCA 2W0NA 3ZYTA 3IF5A 1MKMA 2KLIA 3IF6A 5HAPA 2PYPA 4YWZA 2IWCA 3NOPC 2VLGA 4WMCD 2Y2QA 3WS2A 1YQSA 3W2ZA 4GCZA 2G2UA 5GHXA 4GHIA 1YPRA 2Y2PA 5GLCA 3DW0A 4RX2A 4E3OA 3PBTA 2O9BA 2VGKA 3EEAA 2VJWA 2WAEA 4P6ZM 3JYIA 3CWFA 3UE1A 3VFFA 3ITAA 1AWIA 3R7WB 4FCFA 1P9WA 2NUPC 4IBRA 5FI6A 3Q81A 5FAQA 4HP9A 3P09A 5FASA 4XT2B 4DXCA 5CERA 1VEUA 1GCEA 5FQJA 2Q9MA 1K38A 2Y79A 1IKGA 4GD8A 2PBYA 5DTKA 4EV4A 5DVAA 3PXPA 1Z09A 2Y2LA 1NWZA 1YMSA 4HESA 3DWZA 1MKIA 4YOFA 1CI8A 2ZLYA 1S4RA 1P0ZA 3EQUA 5U47A 2W1TB 1T1CA 5KSHA 2JHEA 2RL3A 1XGIA 4MBKA 4X55A 2ZQCA 3PR6A 3D4FA 3M2KA 5F1GA 4Y0UA 3JVUA 1YLYA 1JTGA 2J9OA 4EUVA 5DF7A 4X69A 5FAPA 3HLWA 4KUKA 1N9LA 4ZBEA 1K55A 1UWPX 4KZBA 3KSIA 4Y3IA 4WMCA 5HPIA 2HGVA 4RX3A 3KSFA 4CPKA 1ERMA 4IVKA 3GDIA 3ULFA 5LBRA 3C2WA 1G6AA 3UNWA 2Y2IA 3NOUC 1BLPA 3F1NA 4OKPA 3OPLA 1YLPA 1KOUA 4II7A 1XFNA 1MWRA 2AVXA 2ZMAA 4JF5A 3SS3A 1L0GA 4ESPA 4FUWA 3BFEA 5CGSA 4JF4A 4X6TA 1XJ4A 1U60A 3MQQA 3TG9A 4UQIM 4IEDA 2RCXA 3FWLA 3LIFA 3HLBA 1VHMA 4R3AA 3UO9A 1XJ3A 4S2MA 5I94A 4DE3A 2XH9A 1PI4A 5FATA 1BULA 5F83A 3GSGA 3Q7VB 1W79A 4ZTKA 2WADA 2PDRA 1W5DA 2W3HA 1HD8A 1F5MA 2XFSA 2ZM8A 2XD1A 2ZC4B 5HDSA 4ARZA 3VP0A 3WRZA 3KSGA 5L07A 4R1GA 3N8RA 3UPNA 1LL9A 5DTTA 4X56A 3E4PA 3UN7A 2HP5A 3LR4A 2J80A 3FKVA 2W27A 4S2OA 2Y2KA 5HD3A 2BTFP 5TBMA 4G3KA 3BFGA 3HL9A 3CHWP 1BT5A 4ZRRA 4D60A 2WKEA 4EQIA 2WKIA 1FSYA 4OPRA 2GX5A 2EXBA 2HF6A 2XD5A 1Y54A 5EPHA 5EM0A 5KZHA 4XUZA 1XGJA 5G4YA 5A93A 3T1QB 3GQZA 3T4QA 2EX8A 4KUOA 1RGYA 3NI9A 3RTYA 4EW7A 4B9OA 1OT9A 1EI5A 3AGFA 4E3NA 4O01A 1MBLA 4EBPA 4NXEA 4S2KA 5HWWA 2J3WA 3EWKA 3LIAA 1CEGA 3G2YA 2PR5A 3IX4A 3TJZC 4GJ4A 1F98A 4QY6A 5MC7A 3LIDA 1SKFA 2VV8A 4P6ZS 2Z2LB 2J9PA 2L4RA 2OAP1 3NJAA 3CG5A 4EETB 1BLCA 1ES2A 4Z9QA 4BL2A 3BW6A 4HIAA 3LI8A 4QY5A 4ZJ3A 4KG5A 4KZ4A 1PWCA 2K7SA 5DKLA 4NEED 2Y55A 4I5SA 3LI9A 1E3UD 1K56A 4N92A 4R4SA 2WGWB 2ZOIA 5A8BA 5E2HA 4HJ6A 1MPLA 1W63M 2K2NA 3IWIA 4DXBA 2W3GA 4KZ9A 3H7WA 3MZEA 3NECA 3G6OA 2HP6A 1DJAA 2WGIA 3VOZA 3LO7A 2HV1A 2IA2A 2WKRA 2PT7A 1S6RA 1DJBA 4ME4A 4UHUA 3IX3A 5I5LA 1G5UA 3H82B 1E4DA 4X68A 5DKKA 4L9EA 5E2FA 5GLBA 4P0MA 3PBQA 3A0SA 2VV6A 2WKQA 3T1SA 4MN5A 3LY3A 3WS5A 2H0TA 4NETA 4OH0A 3K2NA 3MSHA 4M3KA 5CX7A 4R3BA 3LICA 1J3WA 4ZDXA 5EM1A 3LR0A 1G6OA 4PM9A 1PWDA 1IYPA 4QD4A 5EVIA 3NY4A 1K54A 4DJ3A 2WK0A 3A3DA 3MXQA 3B47A 3VE4A 2ZQ7A 3MMHA 4S2NC 4OP5A 2VZWA 2P9VB 3R7WA 1NRJA 4MCWA 4PPRA 4JXWA 1JNUA 1MZUA 3BFFA 5FA7A 4DMZA 3HJKA 4K91A 3IHAA 1E3UA 3N4IA 5L2FA 3C38A 5FQMA 4Q0HA 3ZNTA 3E0YA 1KDWA 2WKHA 3FPWA 4CLCE 5JYPA 4KZ3A 2H0YA 4QWOA 2XEPA 4RVAA 1V9YA 5HFOA 2OV5A 5A92A 2V1BA 3S7NA 1HZOA 2W3FA 1DJCA 2V2FF 2W1TA 1XJ6A 2R78A 4KENB 4B4XA 3F1OA 3NOTC 2KX6A 4ZAMA 3UB9A 2QWSA 2Y2JA 4WM9A 2GDNA 3BLSA 2B95A 4C6YA 3O87A 3SZTA 3NHQA 4LV2A 1NY0A 3HUOA 3W8KA 2P04A 3N7WA 3GVBA 5CXWA 4BD0A 3DAVA 1LT0A 3T4TA 3BYDA 4LV0A 3PAGA 4OQ0A 5F6AA 4CLCB 4I39A 4ZJ1A 1JTDA 4HHDA 3VMAA 4OONA 3M6HA 4JGPA 1TF1A 3CPTB 1TS0A 1XFQA 3A3FA 1H5XA 3HVFA 3HLFA 1OTBA 3IXHA 3NCKA 5HPFA 2ZL1B 4OPYA 5F1FA 5CECA 4WF0A 1FILA 1XP4A 2QKPA 2B5RA 1K6RA 4E3JA 2M7VA 5GHYA 1QMEA 3IT9A 2YKHA 4X1MA 3HUMA 2EX9A 5CHJA 4HY8A 4ID4A 2V9AA 4BQMA 3T1RA 1VB6A 1HVBA 5AJGA 4KZAA 3OCNA 2QPNA 3Q7VA 3IS2B 4UEYA 5FSRA 3RXWA 4CJNA 3NULA 1FSWA 1RGZA 3PBOA 3G4PA 3ZHHA 3S7OA 4YINA 3E4OA 4Y0TA 3FV7A 4BL3A 3V50A 1OMEA 4LRXC 3M2JA 3P98A 2ZQ9A 2Y2GA 1OJ5A 4BLMA 2Z6CA 4E3IA 4Y2FA 1XA1A 5CHUA 1YM1A 1FCNA 1YLWA 4LCLA 1DP8A 5GHZA 1T18A 4GZBA 3MKEA 4LV1A 1ALQA 5AVFA 4IHQA 2EXAA 3Q7ZA 3PTEA 2EWWA 4U0TA 1PRQA 1TEMA 5G18A 3O5YA 3ICYA 2PU2A 1FR6A 2JKTI 1IFQA 3MQ0A 2E8IA 2R9XA 1ZG4A 3C30A 1YMXA 1YSPA 4G3VA 2ZC3B 2EX2A 3VSKA 1GHMA 2WUQA 5J4EA 4EEPA 3B3XA 4OPQA 4JPMA 3C7UA 3PAEA 4S2NA 2WGVA 4CLCC 5AQBA 3D9YA 4IBXA 4JXVA 1LSWA 2GZAA 4ETZA 2I9VA 1TVFA 4WUJA 1VETA 3LGOA 3VP2A 3QNCA 5AQ9A 3QP5A 3JVVA 4EU0A 5L8MA 2VGLM 5EVLA 3D72A 4I3AA 5M1AA 4P85A 3PBNA 1YT4A 4S2LA 3GRJA 4HBUA 2VK3A 4LV3A 5GLAA 4FH2A 1OJGA 3G31A 3W4OA 3NDGA 2Q0OA 4N1HA 2P74A 1ES4A 2K31A 2WGWA 1TDLA 3HCYA 3IQAA 1D06A 1L2SA 3C4OA 3NBLA 4X25A 4HNBA 5FQIA 5KMWA 2ACGA 5M19A 1XA7A 3LCEA 5CGXA 4EBLA 1H8MA 4B93A 4O8GA 4NXGA 1PZOA 1Q2PA 4C3QA 1NXYA 1O7EA 1N9NA 1PW1A 4UA9A 4LPZA 1DP9A 2ZMFA 3SH7A 1UGUA 5FQQA 4S2JA 1KVMA 1V9ZA 3VP3A 3UDFA 4DE2A 1W63Q 3V39A 3B42A 4B4ZA 2L1MA 3UPPA 2A24A 5G4ZA 3A0RA 3CJMA 2HZ5A 2HP9A 3ZGAB 4BENA 3HREA 3O88A 4CLCD 2PHYA 3IF6B 4QU3A 5TGFA 1CF0A 3VP1A 2PD8A 2FFYA 1S4SA 3BWLA 5DFXA 2D02A 3VSLA 3OC2A 3BECA 1T1BA 4O0PA 2Y2OA 4OPZA 3HLCA 1I2SA 4GLQA 3SH9A 4BMWA 3DTEA 4P87A 2INWA 3LR5A 1IYOA 1ZC2A 4OOMA 4R70A 3UMDA 1OTIA 3AGDA 1RCJA 1S1ZA 1KE3A 1T1AA 2H28A 1ESUA 2EFXA 2OOLA 1JWVA 4EEUA 4E04A 1D7EA 1GSXA 4WN5A 3UE0A 3TOIA 2V1ZA 5DJUA 3NC8A 3SS4A 1CK3A 5L10A 2XFTA 4GS9A 2X02A 1MWSA 4X53A 1VEUB 4YFMA 5GLDA 1CI9A 3C5AA 1ZKJA 2V1AA 1JVJA 2ZC5B 2I72A 1GHPA 4F94A 2OLVA 2HDQA 1NZOA 2JCHA 1ZTUA 3GV9A 1ONGA 2M1CA 2O9CA 3Q07A 4I3JA 4MMNA 4GDBA 3HLDA 3NIAA 2EX6A 3G2ZA 2JKTM 2VX8A 5HL6A 3QP1A 3P7NA 1WA9A 2A2LA 3T4OA 3MBZA 4CLCA 4BBTA 2QHKA 4LFUA 2ZQDA 4OQIA 3VFHA 3CPTA 5AQAA 4EQ1A 2HDUA 1G68A 1OTAA 3EQVA 4Q0JA 1H3QA 4LGWA 4FH4A 2QYBA 1ZG6A 1XPBA 1YSQA 3HJIA 3OOVA 3ZG9B 1IELA 4JGQA 3LUQA 3WWXA 3MZDA 3IHBA 3S4XA 1WYBA 2Z6DA 2FFFB 4HJ3A 2XK1A 3E98A 3IF6C 5JYOA 3BY8A 2IWBA 1LI9A 3ZVWA 4HQAA 4BBUA 5AVEA 5EV0A 1ZHHB 2VGLS 4MN7A 4BBVA 1N9OA 4EUZA 4Q8IA 4WEKA 3Q1FA 4EBNA 3F1PB 2WKPA 1KVLA 3PBSA 4HJ4A 4DRTA 4S2PA 1F2KA 3UB7A 4DJ2A 2ZMVA 1SKOB 4EWFA 5DTSA 5IS1A 1PIOA 4R0QA 2Y2NA 5FEFA 4HBTA 1I5QA 3N8SA 2O0YA 1EW0A 3D3OA 2M7UA 3DTKA 1UWNX 5HSQA 4G3WA 1WYCA 2QMIA 3KO6A 4DDYA 2Y2MA 2B18A 3ZG8B 3FKWA 3UPOA 5DJTA 4OQGA 1F9IA 3IH8A 2OWJA 1KE0A 2R9WA 3G34A 3JPUA 4HI4A 3G35A 3VP4A 4OQHA 2UWXA 2ZOHA 2PU4A 3KYEA 4L9FA 1YLZA 3V3RA 4KQQA 4XT2A 3S22A 4N1XA 4X1LA 2JKGA 2EFUA 4F3LB 2XDMA 1QMFA 2Z2MB 3W4PA 3FG8A
chains in the Genus database with same CATH topology
2Y2GA 3BFEA 1ERQA 4RA7A 1L0EA 4FSFA 4K0WA 5CGSA 4BLMA 4JF4A 4X6TA 4E3IA 1N9BA 1XA1A 1U60A 3C7VA 4KG6A 5CHUA 4S2IA 5EVID 1YM1A 1FCNA 3LEZA 4IEDA 1YLWA 2BG1A 3SH8A 3ZG0A 3E2KA 5EE8A 3WS4A 4LCLA 5GHZA 2OSUA 1BSGA 1SDNA 2RCXA 3DTMA 3FWLA 4N9KA 3HLBA 4GZBA 4Y0OA 3MKFA 1FCMA 3MKEA 4LV1A 3WS1A 1ALQA 4GN2A 1SHVA 2EXAA 3IXDA 3Q7ZA 3RXXA 1I2WA 3PTEA 4GKUA 5GL9A 2G2WA 4U0TA 1K57C 3UO9A 4S2MA 4DF6A 1K55C 1Q2QA 1TEMA 3A3JA 3OPRA 2WAFA 3VOYA 4HEFA 5HW3A 4DE3A 5I94A 2XH9A 3ZFZA 1PI4A 5G18A 5FATA 1BULA 2PU2A 5F83A 5HAQA 3GSGA 1JWZA 3Q7VB 1FR6A 4DE0A 1W79A 3ZCZA 2OLUA 4ZTKA 4R4RA 2WADA 1MXOA 2E8IA 2R9XA 1ZG4A 2C5WB 4XUXA 5E2GA 1W5DA 2Q9NA 1YMXA 1NJ4A 1RP5A 3O3VA 4R3JA 5HL1A 1HD8A 5E43A 2ZC3B 2XQZA 1GHIA 2XFSA 3LY4A 3V3SA 3W4QA 5J8XA 2ZM8A 2EX2A 2XD1A 2ZC4B 1MWTA 1SCWA 1NYYA 3VP0A 3FZCA 3VSKA 1GHMA 4PMAA 3WRZA 1LL5A 2WUQA 3RJUA 4R1GA 3N8RA 3UPNA 3B3XA 4OPQA 1LL9A 4JPMA 3C7UA 3PAEA 4S2NA 5DTTA 1FQGA 4X56A 3UN7A 2WGVA 2HP5A 3BRMA 4A5RA 1VM1A 4B88A 4GNUA 4WZ5A 5AQBA 4IBXA 3FKVA 4JXVA 3ZVTA 4KZ5A 1TDGA 1HTZA 5HAIA 3UDXA 4E6XA 5CEBA 1TVFA 4S2OA 2Y2KA 3VP2A 2JBFA 3QNCA 1BLSA 3BFGA 5AQ9A 3HL9A 4WELA 2J8YA 2VGJA 1J9MA 4H8RA 1BT5A 4LCMA 1ONHA 2DRWA 2WKEA 4JXGA 5EVLA 4EQIA 2WKIA 3IWOA 4UA6A 1FSYA 3P98A 4OPRA 2ZM0A 1K6SA 2EXBA 2XD5A 4P85A 5M1AA 3SS5A 3PBNA 1Y54A 3ITBA 5EPHA 1YT4A 5E2EA 5KZHA 3ZG5A 4S2LA 4XUZA 1XGJA 3GRJA 1AXBA 2C6WB 4HBUA 5A93A 4GOGA 3A3IA 4JLFA 3V5MA 4GD6A 4LV3A 5GLAA 4FH2A 3G31A 4N9LA 3GQZA 1YLJA 3W4OA 3WS0A 1XKZA 1M6KA 2EX8A 3NDGA 1RGYA 3NI9A 4N1HA 2J7VA 4MBHA 1EI5A 2HDRA 4L0LA 5DF9A 1BTLA 2P74A 3AGFA 4E3NA 3ZDJA 1ES4A 4OVDA 1MBLA 4EBPA 4BJPA 3IXBA 3PBRA 2WGWA 4S2KA 1TDLA 4WBGA 4UAAA 4E3KA 1EWZA 1KDSA 3IQAA 3MZFA 1L0FA 1GA0A 1L2SA 3C4OA 5KSCA 3NBLA 1NZUA 1CEGA 3G2YA 5TFQA 5FQIA 4GB7A 5KMWA 2QZ6A 1IYQA 3N8LA 4MBFA 4QY6A 2HPBA 4O7DA 4WZ4A 5M19A 2WZXA 1SKFA 1XA7A 2Z2LB 3LCEA 1KGEA 3MFDA 3ZG7B 2JE5A 3MXRA 2J9PA 5CGXA 4EBLA 1W8QA 2XR0A 3CG5A 4C75A 2XF3A 1JWPA 1BLCA 4E3LA 1PZOA 1ES2A 2ZD8A 1Q2PA 4C3QA 4RYEA 4Z9QA 5DF8A 1NXYA 1XXMA 3HLGA 4BL2A 1O7EA 4BD1A 1PW1A 4UA9A 4QY5A 5EVIB 1NYMA 4D2OA 5CRFA 4ZJ3A 4KG5A 4KZ4A 1PWCA 4QB8A 2WYXA 4KZ8A 2Y55A 3SH7A 1E3UD 2Y91A 2ZC7A 3GMWA 5EOOA 5F82A 5FQQA 1FR1A 4S2JA 3HUNA 1K56A 4N92A 2IWDA 4R4SA 2WGWB 1BZAA 1KVMA 3OPHA 5E2HA 3G30A 3VP3A 3UDFA 5EECA 4DE2A 1MPLA 2HDSA 1N4OA 4PM5A 3GTCA 3V39A 3IWIA 4B4ZA 3UPPA 4DXBA 1LHYA 4Y7PA 3CJMA 1EROA 4U0XA 2HP9A 4KZ9A 5CHMA 3ZGAB 4BENA 3HREA 3MZEA 3O88A 5D3OA 3IF6B 2HP6A 1DJAA 4QU3A 5TGFA 2WGIA 3VP1A 1KGGA 3VOZA 3QHYA 2Y59A 3LO7A 1L0DA 2FFYA 4JXSA 1S6RA 1DJBA 4UHUA 4K0XA 4OP8A 1WE4A 3VSLA 4QJGA 3OC2A 3BECA 1IKIA 4KQRA 1PW8A 1E4DA 3M6BA 4X68A 1LLBA 5A91A 1KGFA 3G32A 2Y2OA 5E2FA 5GLBA 4OPZA 3HLCA 1ES3A 1I2SA 4OLGA 5AQ7A 5FI2A 3SH9A 1SDEA 4P0MA 3NDEA 4P87A 3PBQA 3ZNYA 3QNBA 1PI5A 5M18A 1YLTA 1IYOA 1ZC2A 2ZQAA 1W8YA 4OOMA 3BLMA 3LY3A 4PM7A 3WS5A 2H0TA 3AGDA 1RCJA 1KE3A 4NETA 1ESUA 2EFXA 2ZM2A 4OH0A 5TR7A 1JWVA 4KQOA 4MLLA 4M3KA 1BUEA 1LI0A 4R3BA 1NRFA 3UE0A 4DE1A 4ZDXA 3TOIA 2V1ZA 3OPPA 1E25A 2H10A 3DWKA 3NC8A 4WEJA 3SS4A 4E3MA 1PZPA 1CK3A 5FAOA 2XFTA 1PWDA 1K4FA 2Y2HA 4PM9A 1IYPA 2XGNA 2X02A 2Y4AA 4QD4A 5EVIA 3SOIA 1MWSA 4X53A 3NY4A 1K54A 4YFMA 5GLDA 2WK0A 4OLDA 1K57A 1CI9A 3UE3A 3C5AA 1K4EA 3A3DA 1O07A 1BLHA 5BOHA 4OOLA 4OOYA 1ESIA 1ZKJA 3FYZA 4WYYA 5HX9A 1JVJA 2ZC5B 4JKTA 2I72A 3TG9A 3IWQA 5EOEA 1CEFA 2ZQ7A 3E2LA 4S2NC 4OP5A 2P9VB 4PM8A 4E6WA 2DCFA 1GHPA 4PM6A 2V20A 3CZDA 4MEZA 5CGWA 4F94A 2OLVA 4PPRA 3IXGA 3BFCA 4WZ5C 2HDQA 2A49A 4DKIA 1NZOA 2JCHA 4JXWA 4UA7A 5FA7A 3GV9A 3BFFA 3IF5A 1ONGA 3Q07A 4K91A 3C4PA 3IHAA 1E3UA 3HLEA 3IF6A 5HAPA 4GDBA 3HLDA 3N4IA 3S1YA 1XX2A 1KE4A 2IWCA 4LENA 3NIAA 1PWGA 1K25A 4MNRA 4WMCD 1MY8A 2EX6A 2Y2QA 1YQSA 3WS2A 5L2FA 3G2ZA 5FQMA 2G2UA 2X71A 3Q82A 5GHXA 4P6BA 3ZNTA 2Y2PA 5GLCA 1S0WA 1GA9A 1KDWA 2WKHA 5JYPA 4KZ3A 3N6IA 3DW0A 4RX2A 4JBFA 4FD8A 2H0YA 4E3OA 1PYYA 3MBZA 2XEPA 3PBTA 4RVAA 2ZQDA 2VGKA 4OQIA 2JC7A 5HFOA 2OV5A 3VFHA 2WAEA 3WRTA 5A92A 3IH9A 4R23A 3JYIA 3UE1A 1HZOA 5AQAA 3VFFA 2HDUA 5EVIC 1DJCA 3ITAA 1K54C 2V2FF 4FCFA 1G68A 2XLNA 1FOFA 3EQVA 4KENB 5CEDA 5FDHA 4B4XA 4QHCA 4IBRA 5FI6A 4DDSA 1MWUA 3Q81A 5FAQA 4FH4A 4ZAMA 3P09A 1ZG6A 1XPBA 4IVIA 2Y2JA 3ZG9B 3AGEA 3I7JA 5FASA 4WM9A 1IELA 3HBRA 3O86A 2GDNA 3BLSA 3WWXA 1ES5A 3MZDA 1IEMA 3IHBA 3S4XA 4C6YA 3BFDA 4DXCA 3O87A 1WYBA 4LV2A 4U3TA 2FFFB 1NY0A 3HUOA 5CERA 3W8KA 1GCEA 3N7WA 5FQ9A 3GVBA 1W7FA 2XK1A 3GR2A 5CXWA 5FQJA 2Q9MA 4BD0A 1K38A 3IF6C 5JYOA 3A3EA 1IKGA 3BYDA 4GD8A 2PBYA 4LV0A 5DTKA 1LI9A 2IWBA 3PAGA 4EV4A 4OQ0A 5DVAA 1Z6FA 4ZJ1A 3ZVWA 1JTDA 2P9VA 2Y2LA 1H8YA 3BM6A 3VMAA 4OONA 4HESA 1YMSA 1K56D 3DWZA 1MKIA 3M6HA 4EUZA 4Q8IA 5A90A 4WEKA 3Q1FA 4GDNA 2ZC6B 2BLSA 1CI8A 4KZ7A 4EBNA 2ZLYA 3EQUA 5U47A 3UDIA 2A3UA 5KSHA 1KVLA 2RL3A 3PBSA 4XXRA 4DRTA 1XGIA 4MBKA 4X55A 2ZQCA 3A3FA 1M40A 4S2PA 1H5XA 3D4FA 3HVFA 2WZZA 3M2KA 5F1GA 2ZJ9A 4Y0UA 3BEBA 3HLFA 4NK3A 3IXHA 1YLYA 3NCKA 4EWFA 1JTGA 5DTSA 2J9OA 1FCOA 3OZHA 1PIOA 2CC1A 4OPYA 4R0QA 5F1FA 5CECA 2Y2NA 5DF7A 4X69A 5FAPA 1H8ZA 3HLWA 4HBTA 2X01A 1I5QA 3N8SA 1XP4A 1IYSA 4ZBEA 1K55A 5EUAA 4KG2A 2B5RA 1K6RA 4KZBA 4E3JA 5HARA 3MXSA 4WMCA 5GHYA 4ZJ2A 1QMEA 3IT9A 3HUMA 3CMZA 1L0GA 1WYCA 4RX3A 2EX9A 4JF6A 2QMIA 5CHJA 4CPKA 4DDYA 1C3BA 1ERMA 2Y2MA 4ID4A 3ZG8B 4IVKA 3FKWA 3UPOA 4BQMA 4OQGA 3IH8A 1HVBA 5CTNA 5CTMA 1KE0A 4KZAA 3OCNA 2H5SA 2R9WA 1G6AA 3G34A 3TSGA 3UNWA 2Y2IA 1DY6A 3G35A 2QPNA 3Q7VA 3VP4A 5FI7A 4OQHA 3ISGA 2UWXA 1BLPA 2PU4A 4OKPA 5FSRA 3RXWA 1YLZA 3OPLA 4CJNA 3V3RA 5IHVA 1YLPA 4KQQA 1VQQA 1FSWA 1RGZA 3PBOA 4KZ6A 3G4PA 3S22A 3ZHHA 4YINA 1MWRA 4N1XA 3OCLA 2ZQ8A 4Y0TA 3UY6A 3FV7A 5FQKA 2EFUA 3V50A 4BL3A 2DNSA 2ZMAA 4JF5A 1OMEA 2XDMA 1QMFA 3SS3A 3M2JA 2Z2MB 3W4PA 2ZQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y2G A;  3BFE A;  1ERQ A;  4RA7 A;  1L0E A;  4FSF A;  4K0W A;  5CGS A;  4BLM A;  4JF4 A;  4X6T A;  4E3I A;  1N9B A;  1XA1 A;  1U60 A;  3C7V A;  4KG6 A;  5CHU A;  4S2I A;  5EVI D;  1YM1 A;  1FCN A;  3LEZ A;  4IED A;  1YLW A;  2BG1 A;  3SH8 A;  3ZG0 A;  3E2K A;  5EE8 A;  3WS4 A;  4LCL A;  5GHZ A;  2OSU A;  1BSG A;  1SDN A;  2RCX A;  3DTM A;  3FWL A;  4N9K A;  3HLB A;  4GZB A;  4Y0O A;  3MKF A;  1FCM A;  3MKE A;  4LV1 A;  3WS1 A;  1ALQ A;  4GN2 A;  1SHV A;  2EXA A;  3IXD A;  3Q7Z A;  3RXX A;  1I2W A;  3PTE A;  4GKU A;  5GL9 A;  2G2W A;  4U0T A;  1K57 C;  3UO9 A;  4S2M A;  4DF6 A;  1K55 C;  1Q2Q A;  1TEM A;  3A3J A;  3OPR A;  2WAF A;  3VOY A;  4HEF A;  5HW3 A;  4DE3 A;  5I94 A;  2XH9 A;  3ZFZ A;  1PI4 A;  5G18 A;  5FAT A;  1BUL A;  2PU2 A;  5F83 A;  5HAQ A;  3GSG A;  1JWZ A;  3Q7V B;  1FR6 A;  4DE0 A;  1W79 A;  3ZCZ A;  2OLU A;  4ZTK A;  4R4R A;  2WAD A;  1MXO A;  2E8I A;  2R9X A;  1ZG4 A;  2C5W B;  4XUX A;  5E2G A;  1W5D A;  2Q9N A;  1YMX A;  1NJ4 A;  1RP5 A;  3O3V A;  4R3J A;  5HL1 A;  1HD8 A;  5E43 A;  2ZC3 B;  2XQZ A;  1GHI A;  2XFS A;  3LY4 A;  3V3S A;  3W4Q A;  5J8X A;  2ZM8 A;  2EX2 A;  2XD1 A;  2ZC4 B;  1MWT A;  1SCW A;  1NYY A;  3VP0 A;  3FZC A;  3VSK A;  1GHM A;  4PMA A;  3WRZ A;  1LL5 A;  2WUQ A;  3RJU A;  4R1G A;  3N8R A;  3UPN A;  3B3X A;  4OPQ A;  1LL9 A;  4JPM A;  3C7U A;  3PAE A;  4S2N A;  5DTT A;  1FQG A;  4X56 A;  3UN7 A;  2WGV A;  2HP5 A;  3BRM A;  4A5R A;  1VM1 A;  4B88 A;  4GNU A;  4WZ5 A;  5AQB A;  4IBX A;  3FKV A;  4JXV A;  3ZVT A;  4KZ5 A;  1TDG A;  1HTZ A;  5HAI A;  3UDX A;  4E6X A;  5CEB A;  1TVF A;  4S2O A;  2Y2K A;  3VP2 A;  2JBF A;  3QNC A;  1BLS A;  3BFG A;  5AQ9 A;  3HL9 A;  4WEL A;  2J8Y A;  2VGJ A;  1J9M A;  4H8R A;  1BT5 A;  4LCM A;  1ONH A;  2DRW A;  2WKE A;  4JXG A;  5EVL A;  4EQI A;  2WKI A;  3IWO A;  4UA6 A;  1FSY A;  3P98 A;  4OPR A;  2ZM0 A;  1K6S A;  2EXB A;  2XD5 A;  4P85 A;  5M1A A;  3SS5 A;  3PBN A;  1Y54 A;  3ITB A;  5EPH A;  1YT4 A;  5E2E A;  5KZH A;  3ZG5 A;  4S2L A;  4XUZ A;  1XGJ A;  3GRJ A;  1AXB A;  2C6W B;  4HBU A;  5A93 A;  4GOG A;  3A3I A;  4JLF A;  3V5M A;  4GD6 A;  4LV3 A;  5GLA A;  4FH2 A;  3G31 A;  4N9L A;  3GQZ A;  1YLJ A;  3W4O A;  3WS0 A;  1XKZ A;  1M6K A;  2EX8 A;  3NDG A;  1RGY A;  3NI9 A;  4N1H A;  2J7V A;  4MBH A;  1EI5 A;  2HDR A;  4L0L A;  5DF9 A;  1BTL A;  2P74 A;  3AGF A;  4E3N A;  3ZDJ A;  1ES4 A;  4OVD A;  1MBL A;  4EBP A;  4BJP A;  3IXB A;  3PBR A;  2WGW A;  4S2K A;  1TDL A;  4WBG A;  4UAA A;  4E3K A;  1EWZ A;  1KDS A;  3IQA A;  3MZF A;  1L0F A;  1GA0 A;  1L2S A;  3C4O A;  5KSC A;  3NBL A;  1NZU A;  1CEG A;  3G2Y A;  5TFQ A;  5FQI A;  4GB7 A;  5KMW A;  2QZ6 A;  1IYQ A;  3N8L A;  4MBF A;  4QY6 A;  2HPB A;  4O7D A;  4WZ4 A;  5M19 A;  2WZX A;  1SKF A;  1XA7 A;  2Z2L B;  3LCE A;  1KGE A;  3MFD A;  3ZG7 B;  2JE5 A;  3MXR A;  2J9P A;  5CGX A;  4EBL A;  1W8Q A;  2XR0 A;  3CG5 A;  4C75 A;  2XF3 A;  1JWP A;  1BLC A;  4E3L A;  1PZO A;  1ES2 A;  2ZD8 A;  1Q2P A;  4C3Q A;  4RYE A;  4Z9Q A;  5DF8 A;  1NXY A;  1XXM A;  3HLG A;  4BL2 A;  1O7E A;  4BD1 A;  1PW1 A;  4UA9 A;  4QY5 A;  5EVI B;  1NYM A;  4D2O A;  5CRF A;  4ZJ3 A;  4KG5 A;  4KZ4 A;  1PWC A;  4QB8 A;  2WYX A;  4KZ8 A;  2Y55 A;  3SH7 A;  1E3U D;  2Y91 A;  2ZC7 A;  3GMW A;  5EOO A;  5F82 A;  5FQQ A;  1FR1 A;  4S2J A;  3HUN A;  1K56 A;  4N92 A;  2IWD A;  4R4S A;  2WGW B;  1BZA A;  1KVM A;  3OPH A;  5E2H A;  3G30 A;  3VP3 A;  3UDF A;  5EEC A;  4DE2 A;  1MPL A;  2HDS A;  1N4O A;  4PM5 A;  3GTC A;  3V39 A;  3IWI A;  4B4Z A;  3UPP A;  4DXB A;  1LHY A;  4Y7P A;  3CJM A;  1ERO A;  4U0X A;  2HP9 A;  4KZ9 A;  5CHM A;  3ZGA B;  4BEN A;  3HRE A;  3MZE A;  3O88 A;  5D3O A;  3IF6 B;  2HP6 A;  1DJA A;  4QU3 A;  5TGF A;  2WGI A;  3VP1 A;  1KGG A;  3VOZ A;  3QHY A;  2Y59 A;  3LO7 A;  1L0D A;  2FFY A;  4JXS A;  1S6R A;  1DJB A;  4UHU A;  4K0X A;  4OP8 A;  1WE4 A;  3VSL A;  4QJG A;  3OC2 A;  3BEC A;  1IKI A;  4KQR A;  1PW8 A;  1E4D A;  3M6B A;  4X68 A;  1LLB A;  5A91 A;  1KGF A;  3G32 A;  2Y2O A;  5E2F A;  5GLB A;  4OPZ A;  3HLC A;  1ES3 A;  1I2S A;  4OLG A;  5AQ7 A;  5FI2 A;  3SH9 A;  1SDE A;  4P0M A;  3NDE A;  4P87 A;  3PBQ A;  3ZNY A;  3QNB A;  1PI5 A;  5M18 A;  1YLT A;  1IYO A;  1ZC2 A;  2ZQA A;  1W8Y A;  4OOM A;  3BLM A;  3LY3 A;  4PM7 A;  3WS5 A;  2H0T A;  3AGD A;  1RCJ A;  1KE3 A;  4NET A;  1ESU A;  2EFX A;  2ZM2 A;  4OH0 A;  5TR7 A;  1JWV A;  4KQO A;  4MLL A;  4M3K A;  1BUE A;  1LI0 A;  4R3B A;  1NRF A;  3UE0 A;  4DE1 A;  4ZDX A;  3TOI A;  2V1Z A;  3OPP A;  1E25 A;  2H10 A;  3DWK A;  3NC8 A;  4WEJ A;  3SS4 A;  4E3M A;  1PZP A;  1CK3 A;  5FAO A;  2XFT A;  1PWD A;  1K4F A;  2Y2H A;  4PM9 A;  1IYP A;  2XGN A;  2X02 A;  2Y4A A;  4QD4 A;  5EVI A;  3SOI A;  1MWS A;  4X53 A;  3NY4 A;  1K54 A;  4YFM A;  5GLD A;  2WK0 A;  4OLD A;  1K57 A;  1CI9 A;  3UE3 A;  3C5A A;  1K4E A;  3A3D A;  1O07 A;  1BLH A;  5BOH A;  4OOL A;  4OOY A;  1ESI A;  1ZKJ A;  3FYZ A;  4WYY A;  5HX9 A;  1JVJ A;  2ZC5 B;  4JKT A;  2I72 A;  3TG9 A;  3IWQ A;  5EOE A;  1CEF A;  2ZQ7 A;  3E2L A;  4S2N C;  4OP5 A;  2P9V B;  4PM8 A;  4E6W A;  2DCF A;  1GHP A;  4PM6 A;  2V20 A;  3CZD A;  4MEZ A;  5CGW A;  4F94 A;  2OLV A;  4PPR A;  3IXG A;  3BFC A;  4WZ5 C;  2HDQ A;  2A49 A;  4DKI A;  1NZO A;  2JCH A;  4JXW A;  4UA7 A;  5FA7 A;  3GV9 A;  3BFF A;  3IF5 A;  1ONG A;  3Q07 A;  4K91 A;  3C4P A;  3IHA A;  1E3U A;  3HLE A;  3IF6 A;  5HAP A;  4GDB A;  3HLD A;  3N4I A;  3S1Y A;  1XX2 A;  1KE4 A;  2IWC A;  4LEN A;  3NIA A;  1PWG A;  1K25 A;  4MNR A;  4WMC D;  1MY8 A;  2EX6 A;  2Y2Q A;  1YQS A;  3WS2 A;  5L2F A;  3G2Z A;  5FQM A;  2G2U A;  2X71 A;  3Q82 A;  5GHX A;  4P6B A;  3ZNT A;  2Y2P A;  5GLC A;  1S0W A;  1GA9 A;  1KDW A;  2WKH A;  5JYP A;  4KZ3 A;  3N6I A;  3DW0 A;  4RX2 A;  4JBF A;  4FD8 A;  2H0Y A;  4E3O A;  1PYY A;  3MBZ A;  2XEP A;  3PBT A;  4RVA A;  2ZQD A;  2VGK A;  4OQI A;  2JC7 A;  5HFO A;  2OV5 A;  3VFH A;  2WAE A;  3WRT A;  5A92 A;  3IH9 A;  4R23 A;  3JYI A;  3UE1 A;  1HZO A;  5AQA A;  3VFF A;  2HDU A;  5EVI C;  1DJC A;  3ITA A;  1K54 C;  2V2F F;  4FCF A;  1G68 A;  2XLN A;  1FOF A;  3EQV A;  4KEN B;  5CED A;  5FDH A;  4B4X A;  4QHC A;  4IBR A;  5FI6 A;  4DDS A;  1MWU A;  3Q81 A;  5FAQ A;  4FH4 A;  4ZAM A;  3P09 A;  1ZG6 A;  1XPB A;  4IVI A;  2Y2J A;  3ZG9 B;  3AGE A;  3I7J A;  5FAS A;  4WM9 A;  1IEL A;  3HBR A;  3O86 A;  2GDN A;  3BLS A;  3WWX A;  1ES5 A;  3MZD A;  1IEM A;  3IHB A;  3S4X A;  4C6Y A;  3BFD A;  4DXC A;  3O87 A;  1WYB A;  4LV2 A;  4U3T A;  2FFF B;  1NY0 A;  3HUO A;  5CER A;  3W8K A;  1GCE A;  3N7W A;  5FQ9 A;  3GVB A;  1W7F A;  2XK1 A;  3GR2 A;  5CXW A;  5FQJ A;  2Q9M A;  4BD0 A;  1K38 A;  3IF6 C;  5JYO A;  3A3E A;  1IKG A;  3BYD A;  4GD8 A;  2PBY A;  4LV0 A;  5DTK A;  1LI9 A;  2IWB A;  3PAG A;  4EV4 A;  4OQ0 A;  5DVA A;  1Z6F A;  4ZJ1 A;  3ZVW A;  1JTD A;  2P9V A;  2Y2L A;  1H8Y A;  3BM6 A;  3VMA A;  4OON A;  4HES A;  1YMS A;  1K56 D;  3DWZ A;  1MKI A;  3M6H A;  4EUZ A;  4Q8I A;  5A90 A;  4WEK A;  3Q1F A;  4GDN A;  2ZC6 B;  2BLS A;  1CI8 A;  4KZ7 A;  4EBN A;  2ZLY A;  3EQU A;  5U47 A;  3UDI A;  2A3U A;  5KSH A;  1KVL A;  2RL3 A;  3PBS A;  4XXR A;  4DRT A;  1XGI A;  4MBK A;  4X55 A;  2ZQC A;  3A3F A;  1M40 A;  4S2P A;  1H5X A;  3D4F A;  3HVF A;  2WZZ A;  3M2K A;  5F1G A;  2ZJ9 A;  4Y0U A;  3BEB A;  3HLF A;  4NK3 A;  3IXH A;  1YLY A;  3NCK A;  4EWF A;  1JTG A;  5DTS A;  2J9O A;  1FCO A;  3OZH A;  1PIO A;  2CC1 A;  4OPY A;  4R0Q A;  5F1F A;  5CEC A;  2Y2N A;  5DF7 A;  4X69 A;  5FAP A;  1H8Z A;  3HLW A;  4HBT A;  2X01 A;  1I5Q A;  3N8S A;  1XP4 A;  1IYS A;  4ZBE A;  1K55 A;  5EUA A;  4KG2 A;  2B5R A;  1K6R A;  4KZB A;  4E3J A;  5HAR A;  3MXS A;  4WMC A;  5GHY A;  4ZJ2 A;  1QME A;  3IT9 A;  3HUM A;  3CMZ A;  1L0G A;  1WYC A;  4RX3 A;  2EX9 A;  4JF6 A;  2QMI A;  5CHJ A;  4CPK A;  4DDY A;  1C3B A;  1ERM A;  2Y2M A;  4ID4 A;  3ZG8 B;  4IVK A;  3FKW A;  3UPO A;  4BQM A;  4OQG A;  3IH8 A;  1HVB A;  5CTN A;  5CTM A;  1KE0 A;  4KZA A;  3OCN A;  2H5S A;  2R9W A;  1G6A A;  3G34 A;  3TSG A;  3UNW A;  2Y2I A;  1DY6 A;  3G35 A;  2QPN A;  3Q7V A;  3VP4 A;  5FI7 A;  4OQH A;  3ISG A;  2UWX A;  1BLP A;  2PU4 A;  4OKP A;  5FSR A;  3RXW A;  1YLZ A;  3OPL A;  4CJN A;  3V3R A;  5IHV A;  1YLP A;  4KQQ A;  1VQQ A;  1FSW A;  1RGZ A;  3PBO A;  4KZ6 A;  3G4P A;  3S22 A;  3ZHH A;  4YIN A;  1MWR A;  4N1X A;  3OCL A;  2ZQ8 A;  4Y0T A;  3UY6 A;  3FV7 A;  5FQK A;  2EFU A;  3V50 A;  4BL3 A;  2DNS A;  2ZMA A;  4JF5 A;  1OME A;  2XDM A;  1QMF A;  3SS3 A;  3M2J A;  2Z2M B;  3W4P A;  2ZQ9 A; 
#chains in the Genus database with same CATH topology
 1ERQ A;  1L0E A;  4K0W A;  2P08 A;  3CLO A;  3S7P A;  1N9B A;  3EOI A;  1MC0 A;  3ZG0 A;  2BG1 A;  3E2K A;  5EE8 A;  1BSG A;  3DTM A;  4N9K A;  1ACF A;  4Y0O A;  1LL8 A;  1FCM A;  3WS1 A;  4GN2 A;  3IXD A;  3RXX A;  4GKU A;  5GL9 A;  1YKD A;  4PHT A;  2G2W A;  1K57 C;  3CAX A;  1K55 C;  3A3J A;  3OPR A;  5HW3 A;  3ZFZ A;  5HAQ A;  1JWZ A;  4DE0 A;  3ZCZ A;  2OLU A;  5F69 A;  1MXO A;  2C5W B;  4XUX A;  5E2G A;  5EFW A;  1RP5 A;  3O3V A;  5E43 A;  1GHI A;  5J8X A;  5FEG A;  2PAV P;  4NXF A;  3BQA A;  1LL5 A;  4PAU A;  3IBR A;  4GW9 A;  4B88 A;  4GNU A;  3ZVT A;  4KZ5 A;  1HTZ A;  4LRZ E;  5HAI A;  3UDX A;  3T1X A;  1BLS A;  4WEL A;  2GJ3 A;  2J8Y A;  2VGJ A;  1J9M A;  1G28 A;  1ONH A;  1P9R A;  1D1J A;  4MDZ A;  4HP4 A;  3R4K A;  3PHY A;  4BWI A;  2VV7 A;  3RFB A;  1K6S A;  2PBD P;  2W3E A;  3DTI A;  5E2E A;  1NLZ A;  3H7W B;  1AXB A;  2C6W B;  4K08 A;  1YLJ A;  2JKR M;  1TS6 A;  3WS0 A;  1M6K A;  5K5B A;  3LIB A;  2XRO A;  2J7V A;  4MBH A;  2O9A A;  2KOI A;  2LB9 A;  3KX0 X;  3EGD C;  3T12 B;  4UAA A;  4E3K A;  1L0F A;  1GA0 A;  3T50 A;  2JKF A;  1NZU A;  4H6J B;  2NUT C;  4GB7 A;  4FTX A;  4EES A;  4MBF A;  1S1Y A;  4IUH A;  2HPB A;  3FPV A;  3LEQ A;  3ZG7 B;  3MFD A;  3C8C A;  2JE5 A;  3VV4 A;  1W8Q A;  3RH8 B;  2XR0 A;  3DBA A;  2XF3 A;  4E3L A;  2VKS A;  5DF8 A;  4BD1 A;  2BAS A;  3B33 A;  5EVI B;  1NYM A;  5CRF A;  4QB8 A;  2J3T C;  2ZC7 A;  3GMW A;  5F82 A;  2GNX A;  3HUN A;  3E4Q A;  1BZA A;  3IBJ A;  3G30 A;  5EEC A;  4RQ9 A;  2HDS A;  5KIZ A;  5IT5 A;  1PFL A;  2E8J A;  3GTC A;  1OTD A;  3LFV A;  3OBF A;  3EGX C;  4U0X A;  1H0M A;  5CHM A;  5D3O A;  2VEA A;  1KGG A;  5HDD A;  3QHY A;  4Q0I A;  3MS6 A;  1L0D A;  4JXS A;  2V0U A;  5FDS A;  4IUK A;  1IKI A;  1PW8 A;  3MQO A;  3M6B A;  1KGF A;  4DN0 A;  3G32 A;  4OLG A;  5FI2 A;  3NDE A;  3ZNY A;  1PI5 A;  5M18 A;  4JGO A;  1YLT A;  3BQ8 A;  2ZQA A;  3BLM A;  4LLO B;  3F1O B;  3L9K A;  2ZM2 A;  2G7U A;  4MLL A;  1BUE A;  3T4J A;  1ODV A;  3CIT A;  4DE1 A;  2D01 A;  3OPP A;  4E3M A;  1PZP A;  5FAO A;  2Y2H A;  2XGN A;  2Y4A A;  3EEH A;  4OLD A;  1K57 A;  1O07 A;  1BLH A;  5BOH A;  4OOL A;  3FYZ A;  4WLA A;  4WYY A;  4JKT A;  3UME A;  4Y17 A;  3IWQ A;  5EOE A;  3E2L A;  3H9W A;  5L09 A;  4E6W A;  3K3C A;  2DCF A;  2B02 A;  2V20 A;  3CZD A;  4MEZ A;  5CGW A;  1HLU P;  3IXG A;  4WZ5 C;  2A49 A;  4DKI A;  4UA7 A;  2FH5 A;  3C4P A;  3HLE A;  2EA9 A;  3T4S A;  2XRN A;  3S1Y A;  1XX2 A;  1KE4 A;  3UE6 A;  1DP6 A;  4LEN A;  1PWG A;  1K25 A;  4MNR A;  1A0K A;  3SW1 A;  1MY8 A;  2J3T D;  2X71 A;  3Q82 A;  3VE3 A;  2QJ5 A;  4P6B A;  1FIK A;  4HH2 A;  1S0W A;  1PNE A;  1LSV A;  3H82 A;  1GA9 A;  3N6I A;  4JBF A;  4FD8 A;  5F68 A;  1PYY A;  3LIE A;  1TS8 A;  3QP4 A;  2JC7 A;  4CQH A;  3S7Q A;  2HJ9 C;  3WRT A;  3IH9 A;  5HZH A;  4R23 A;  3F1P A;  5EVI C;  1K54 C;  4NKP A;  5CED A;  2XLN A;  4NG2 A;  1FOF A;  5FDH A;  5TJJ A;  4QHC A;  4DDS A;  1MWU A;  2MJ6 A;  4EXO A;  3K3D A;  5F5Y A;  4IVI A;  2QJ7 A;  3AGE A;  1TD5 A;  3I7J A;  1SKO A;  3HBR A;  3O86 A;  3T4L A;  1ES5 A;  1IEM A;  3BFD A;  4U3T A;  5FQ9 A;  4GHI B;  1W7F A;  5C5K A;  3GR2 A;  5HWV A;  4MN6 A;  3UB8 A;  2JN7 A;  3A3E A;  4I38 A;  1Z6F A;  4I3I A;  2V0W A;  2P9V A;  1H8Y A;  3BM6 A;  1IOU A;  4Y15 A;  1K56 D;  2OAQ 1;  5A90 A;  5DFY A;  4GDN A;  2ZC6 B;  2BLS A;  4KZ7 A;  3MR0 A;  3CUE C;  3UDI A;  2A3U A;  3UB5 P;  5J3W A;  4XXR A;  2W3D A;  1M40 A;  2WZZ A;  2ZJ9 A;  4NK3 A;  3BEB A;  3P01 A;  1X0O A;  3MFX A;  4F3L A;  1FCO A;  3OZH A;  2CC1 A;  2VA0 A;  4M4X A;  4PKY G;  1H8Z A;  2X01 A;  1IYS A;  5EUA A;  2EWV A;  4KG2 A;  1GSV A;  5HAR A;  3MXS A;  4ZJ2 A;  3CMZ A;  2HJE A;  4JF6 A;  3LR3 A;  3BY9 A;  1C3B A;  1TS7 A;  2XA7 M;  5CTM A;  5CTN A;  2H5S A;  3TSG A;  4Z1W A;  1DY6 A;  3V67 A;  5FI7 A;  3ISG A;  5J7E A;  5HWT A;  3ZQ5 A;  3KYZ A;  4QPR A;  5IHV A;  2JKR I;  1VQQ A;  1VET B;  4Y5F A;  4KZ6 A;  5FL3 A;  4WL9 A;  4YNR A;  3OCL A;  2ZQ8 A;  3UY6 A;  5FQK A;  2DNS A;  3QP8 A;  4KQD A;  2V8F A;  4RA7 A;  4FSF A;  4HH3 A;  3C7V A;  5EVI D;  4KG6 A;  3SOI A;  4S2I A;  3LEZ A;  3SH8 A;  3WS4 A;  2OSU A;  1SDN A;  3MKF A;  3T4K A;  1SHV A;  1I2W A;  2PRF A;  4DF6 A;  1Q2Q A;  4FOF A;  3VOY A;  2WAF A;  4HEF A;  2YKF A;  5HDC A;  4R4R A;  3F1N B;  2P7J A;  3U4L P;  2ZL1 A;  2W1R A;  1YAX A;  2Q9N A;  2OWH A;  1NJ4 A;  4R3J A;  1T19 A;  5HL1 A;  2XQZ A;  1NLY A;  3LY4 A;  3V3S A;  3W4Q A;  4NXB A;  1MWT A;  1SCW A;  1NYY A;  3FZC A;  3TW8 A;  4PMA A;  3RJU A;  1S66 L;  4R6L A;  1FQG A;  3TE8 A;  3BRM A;  4A5R A;  1VM1 A;  4WZ5 A;  3U2A A;  3IS2 A;  1TDG A;  5CEB A;  4E6X A;  2JBF A;  3LYX A;  2FZ0 A;  4H6J A;  2V8C A;  4H8R A;  4LCM A;  2DRW A;  2DMW A;  4JXG A;  2UV0 E;  3IWO A;  4UA6 A;  2ZM0 A;  2A24 B;  3SS5 A;  2LB5 A;  3ITB A;  3ZG5 A;  4ETX A;  5IU1 A;  4ARZ B;  4GOG A;  3A3I A;  1GSW A;  4JLF A;  4GD6 A;  3V5M A;  4N9L A;  1XKZ A;  1OTE A;  4L9G A;  1BYW A;  1CQA A;  2HDR A;  4L0L A;  5DF9 A;  1BTL A;  3ZDJ A;  4OVD A;  2XSS A;  4PKY A;  1STZ A;  4BJP A;  3IXB A;  3PBR A;  3A0V A;  3TRC A;  4WBG A;  1EWZ A;  1KDS A;  3MZF A;  1L3L A;  2KDK A;  5TBM B;  5KSC A;  1Y4O A;  5TFQ A;  5HD5 A;  1OT6 A;  2QZ6 A;  1IYQ A;  3FC7 A;  4UQI S;  3N8L A;  4WZ4 A;  4O7D A;  2WZX A;  1DRM A;  3MJQ A;  1KGE A;  2L0W A;  4JGR A;  3MXR A;  4Y13 A;  4C75 A;  1JWP A;  2ZD8 A;  4RYE A;  3QP6 A;  1XXM A;  3HLG A;  4R38 A;  4GS9 B;  2Y8H A;  4D2O A;  3QP2 A;  3CUE A;  1K0K A;  2WYX A;  4KZ8 A;  2Y91 A;  5EOO A;  1FR1 A;  2IWD A;  2CMN A;  3OPH A;  5EVE A;  2O99 A;  1N4O A;  4PM5 A;  4EER A;  1LHY A;  4Y7P A;  1ERO A;  1Y28 A;  2ZBB A;  2Y59 A;  4K0X A;  4OP8 A;  1WE4 A;  3UB6 A;  4QJG A;  3PYP A;  4KQR A;  3VOL A;  1LLB A;  3KSH A;  5A91 A;  3BJN A;  4AFI A;  1ES3 A;  5AQ7 A;  1SDE A;  1XJ2 A;  1CJF A;  1P97 A;  3QNB A;  3IX8 A;  3L7H A;  1W8Y A;  4PM7 A;  3CI6 A;  3MF0 A;  1LSX A;  5TR7 A;  2PR6 A;  4KQO A;  1S67 L;  1LI0 A;  2XA7 S;  1NRF A;  4IJG A;  1E25 A;  4HOI A;  2H10 A;  3DWK A;  4LRY C;  4WEJ A;  1K4F A;  2PD7 A;  1SZV A;  3KYQ A;  3GEC A;  3UE3 A;  1K4E A;  2PYR A;  4OOY A;  1ESI A;  5HX9 A;  1OPX A;  1CEF A;  3OLO A;  4PM8 A;  4PM6 A;  3BFC A;  2W0N A;  3ZYT A;  3IF5 A;  1MKM A;  2KLI A;  3IF6 A;  5HAP A;  2PYP A;  4YWZ A;  2IWC A;  3NOP C;  2VLG A;  4WMC D;  2Y2Q A;  3WS2 A;  1YQS A;  3W2Z A;  4GCZ A;  2G2U A;  5GHX A;  4GHI A;  1YPR A;  2Y2P A;  5GLC A;  3DW0 A;  4RX2 A;  4E3O A;  3PBT A;  2O9B A;  2VGK A;  3EEA A;  2VJW A;  2WAE A;  4P6Z M;  3JYI A;  3CWF A;  3UE1 A;  3VFF A;  3ITA A;  1AWI A;  3R7W B;  4FCF A;  1P9W A;  2NUP C;  4IBR A;  5FI6 A;  3Q81 A;  5FAQ A;  4HP9 A;  3P09 A;  5FAS A;  4XT2 B;  4DXC A;  5CER A;  1VEU A;  1GCE A;  5FQJ A;  2Q9M A;  1K38 A;  2Y79 A;  1IKG A;  4GD8 A;  2PBY A;  5DTK A;  4EV4 A;  5DVA A;  3PXP A;  1Z09 A;  2Y2L A;  1NWZ A;  1YMS A;  4HES A;  3DWZ A;  1MKI A;  4YOF A;  1CI8 A;  2ZLY A;  1S4R A;  1P0Z A;  3EQU A;  5U47 A;  2W1T B;  1T1C A;  5KSH A;  2JHE A;  2RL3 A;  1XGI A;  4MBK A;  4X55 A;  2ZQC A;  3PR6 A;  3D4F A;  3M2K A;  5F1G A;  4Y0U A;  3JVU A;  1YLY A;  1JTG A;  2J9O A;  4EUV A;  5DF7 A;  4X69 A;  5FAP A;  3HLW A;  4KUK A;  1N9L A;  4ZBE A;  1K55 A;  1UWP X;  4KZB A;  3KSI A;  4Y3I A;  4WMC A;  5HPI A;  2HGV A;  4RX3 A;  3KSF A;  4CPK A;  1ERM A;  4IVK A;  3GDI A;  3ULF A;  5LBR A;  3C2W A;  1G6A A;  3UNW A;  2Y2I A;  3NOU C;  1BLP A;  3F1N A;  4OKP A;  3OPL A;  1YLP A;  1KOU A;  4II7 A;  1XFN A;  1MWR A;  2AVX A;  2ZMA A;  4JF5 A;  3SS3 A;  1L0G A;  4ESP A;  4FUW A;  3BFE A;  5CGS A;  4JF4 A;  4X6T A;  1XJ4 A;  1U60 A;  3MQQ A;  3TG9 A;  4UQI M;  4IED A;  2RCX A;  3FWL A;  3LIF A;  3HLB A;  1VHM A;  4R3A A;  3UO9 A;  1XJ3 A;  4S2M A;  5I94 A;  4DE3 A;  2XH9 A;  1PI4 A;  5FAT A;  1BUL A;  5F83 A;  3GSG A;  3Q7V B;  1W79 A;  4ZTK A;  2WAD A;  2PDR A;  1W5D A;  2W3H A;  1HD8 A;  1F5M A;  2XFS A;  2ZM8 A;  2XD1 A;  2ZC4 B;  5HDS A;  4ARZ A;  3VP0 A;  3WRZ A;  3KSG A;  5L07 A;  4R1G A;  3N8R A;  3UPN A;  1LL9 A;  5DTT A;  4X56 A;  3E4P A;  3UN7 A;  2HP5 A;  3LR4 A;  2J80 A;  3FKV A;  2W27 A;  4S2O A;  2Y2K A;  5HD3 A;  2BTF P;  5TBM A;  4G3K A;  3BFG A;  3HL9 A;  3CHW P;  1BT5 A;  4ZRR A;  4D60 A;  2WKE A;  4EQI A;  2WKI A;  1FSY A;  4OPR A;  2GX5 A;  2EXB A;  2HF6 A;  2XD5 A;  1Y54 A;  5EPH A;  5EM0 A;  5KZH A;  4XUZ A;  1XGJ A;  5G4Y A;  5A93 A;  3T1Q B;  3GQZ A;  3T4Q A;  2EX8 A;  4KUO A;  1RGY A;  3NI9 A;  3RTY A;  4EW7 A;  4B9O A;  1OT9 A;  1EI5 A;  3AGF A;  4E3N A;  4O01 A;  1MBL A;  4EBP A;  4NXE A;  4S2K A;  5HWW A;  2J3W A;  3EWK A;  3LIA A;  1CEG A;  3G2Y A;  2PR5 A;  3IX4 A;  3TJZ C;  4GJ4 A;  1F98 A;  4QY6 A;  5MC7 A;  3LID A;  1SKF A;  2VV8 A;  4P6Z S;  2Z2L B;  2J9P A;  2L4R A;  2OAP 1;  3NJA A;  3CG5 A;  4EET B;  1BLC A;  1ES2 A;  4Z9Q A;  4BL2 A;  3BW6 A;  4HIA A;  3LI8 A;  4QY5 A;  4ZJ3 A;  4KG5 A;  4KZ4 A;  1PWC A;  2K7S A;  5DKL A;  4NEE D;  2Y55 A;  4I5S A;  3LI9 A;  1E3U D;  1K56 A;  4N92 A;  4R4S A;  2WGW B;  2ZOI A;  5A8B A;  5E2H A;  4HJ6 A;  1MPL A;  1W63 M;  2K2N A;  3IWI A;  4DXB A;  2W3G A;  4KZ9 A;  3H7W A;  3MZE A;  3NEC A;  3G6O A;  2HP6 A;  1DJA A;  2WGI A;  3VOZ A;  3LO7 A;  2HV1 A;  2IA2 A;  2WKR A;  2PT7 A;  1S6R A;  1DJB A;  4ME4 A;  4UHU A;  3IX3 A;  5I5L A;  1G5U A;  3H82 B;  1E4D A;  4X68 A;  5DKK A;  4L9E A;  5E2F A;  5GLB A;  4P0M A;  3PBQ A;  3A0S A;  2VV6 A;  2WKQ A;  3T1S A;  4MN5 A;  3LY3 A;  3WS5 A;  2H0T A;  4NET A;  4OH0 A;  3K2N A;  3MSH A;  4M3K A;  5CX7 A;  4R3B A;  3LIC A;  1J3W A;  4ZDX A;  5EM1 A;  3LR0 A;  1G6O A;  4PM9 A;  1PWD A;  1IYP A;  4QD4 A;  5EVI A;  3NY4 A;  1K54 A;  4DJ3 A;  2WK0 A;  3A3D A;  3MXQ A;  3B47 A;  3VE4 A;  2ZQ7 A;  3MMH A;  4S2N C;  4OP5 A;  2VZW A;  2P9V B;  3R7W A;  1NRJ A;  4MCW A;  4PPR A;  4JXW A;  1JNU A;  1MZU A;  3BFF A;  5FA7 A;  4DMZ A;  3HJK A;  4K91 A;  3IHA A;  1E3U A;  3N4I A;  5L2F A;  3C38 A;  5FQM A;  4Q0H A;  3ZNT A;  3E0Y A;  1KDW A;  2WKH A;  3FPW A;  4CLC E;  5JYP A;  4KZ3 A;  2H0Y A;  4QWO A;  2XEP A;  4RVA A;  1V9Y A;  5HFO A;  2OV5 A;  5A92 A;  2V1B A;  3S7N A;  1HZO A;  2W3F A;  1DJC A;  2V2F F;  2W1T A;  1XJ6 A;  2R78 A;  4KEN B;  4B4X A;  3F1O A;  3NOT C;  2KX6 A;  4ZAM A;  3UB9 A;  2QWS A;  2Y2J A;  4WM9 A;  2GDN A;  3BLS A;  2B95 A;  4C6Y A;  3O87 A;  3SZT A;  3NHQ A;  4LV2 A;  1NY0 A;  3HUO A;  3W8K A;  2P04 A;  3N7W A;  3GVB A;  5CXW A;  4BD0 A;  3DAV A;  1LT0 A;  3T4T A;  3BYD A;  4LV0 A;  3PAG A;  4OQ0 A;  5F6A A;  4CLC B;  4I39 A;  4ZJ1 A;  1JTD A;  4HHD A;  3VMA A;  4OON A;  3M6H A;  4JGP A;  1TF1 A;  3CPT B;  1TS0 A;  1XFQ A;  3A3F A;  1H5X A;  3HVF A;  3HLF A;  1OTB A;  3IXH A;  3NCK A;  5HPF A;  2ZL1 B;  4OPY A;  5F1F A;  5CEC A;  4WF0 A;  1FIL A;  1XP4 A;  2QKP A;  2B5R A;  1K6R A;  4E3J A;  2M7V A;  5GHY A;  1QME A;  3IT9 A;  2YKH A;  4X1M A;  3HUM A;  2EX9 A;  5CHJ A;  4HY8 A;  4ID4 A;  2V9A A;  4BQM A;  3T1R A;  1VB6 A;  1HVB A;  5AJG A;  4KZA A;  3OCN A;  2QPN A;  3Q7V A;  3IS2 B;  4UEY A;  5FSR A;  3RXW A;  4CJN A;  3NUL A;  1FSW A;  1RGZ A;  3PBO A;  3G4P A;  3ZHH A;  3S7O A;  4YIN A;  3E4O A;  4Y0T A;  3FV7 A;  4BL3 A;  3V50 A;  1OME A;  4LRX C;  3M2J A;  3P98 A;  2ZQ9 A;  2Y2G A;  1OJ5 A;  4BLM A;  2Z6C A;  4E3I A;  4Y2F A;  1XA1 A;  5CHU A;  1YM1 A;  1FCN A;  1YLW A;  4LCL A;  1DP8 A;  5GHZ A;  1T18 A;  4GZB A;  3MKE A;  4LV1 A;  1ALQ A;  5AVF A;  4IHQ A;  2EXA A;  3Q7Z A;  3PTE A;  2EWW A;  4U0T A;  1PRQ A;  1TEM A;  5G18 A;  3O5Y A;  3ICY A;  2PU2 A;  1FR6 A;  2JKT I;  1IFQ A;  3MQ0 A;  2E8I A;  2R9X A;  1ZG4 A;  3C30 A;  1YMX A;  1YSP A;  4G3V A;  2ZC3 B;  2EX2 A;  3VSK A;  1GHM A;  2WUQ A;  5J4E A;  4EEP A;  3B3X A;  4OPQ A;  4JPM A;  3C7U A;  3PAE A;  4S2N A;  2WGV A;  4CLC C;  5AQB A;  3D9Y A;  4IBX A;  4JXV A;  1LSW A;  2GZA A;  4ETZ A;  2I9V A;  1TVF A;  4WUJ A;  1VET A;  3LGO A;  3VP2 A;  3QNC A;  5AQ9 A;  3QP5 A;  3JVV A;  4EU0 A;  5L8M A;  2VGL M;  5EVL A;  3D72 A;  4I3A A;  5M1A A;  4P85 A;  3PBN A;  1YT4 A;  4S2L A;  3GRJ A;  4HBU A;  2VK3 A;  4LV3 A;  5GLA A;  4FH2 A;  1OJG A;  3G31 A;  3W4O A;  3NDG A;  2Q0O A;  4N1H A;  2P74 A;  1ES4 A;  2K31 A;  2WGW A;  1TDL A;  3HCY A;  3IQA A;  1D06 A;  1L2S A;  3C4O A;  3NBL A;  4X25 A;  4HNB A;  5FQI A;  5KMW A;  2ACG A;  5M19 A;  1XA7 A;  3LCE A;  5CGX A;  4EBL A;  1H8M A;  4B93 A;  4O8G A;  4NXG A;  1PZO A;  1Q2P A;  4C3Q A;  1NXY A;  1O7E A;  1N9N A;  1PW1 A;  4UA9 A;  4LPZ A;  1DP9 A;  2ZMF A;  3SH7 A;  1UGU A;  5FQQ A;  4S2J A;  1KVM A;  1V9Z A;  3VP3 A;  3UDF A;  4DE2 A;  1W63 Q;  3V39 A;  3B42 A;  4B4Z A;  2L1M A;  3UPP A;  2A24 A;  5G4Z A;  3A0R A;  3CJM A;  2HZ5 A;  2HP9 A;  3ZGA B;  4BEN A;  3HRE A;  3O88 A;  4CLC D;  2PHY A;  3IF6 B;  4QU3 A;  5TGF A;  1CF0 A;  3VP1 A;  2PD8 A;  2FFY A;  1S4S A;  3BWL A;  5DFX A;  2D02 A;  3VSL A;  3OC2 A;  3BEC A;  1T1B A;  4O0P A;  2Y2O A;  4OPZ A;  3HLC A;  1I2S A;  4GLQ A;  3SH9 A;  4BMW A;  3DTE A;  4P87 A;  2INW A;  3LR5 A;  1IYO A;  1ZC2 A;  4OOM A;  4R70 A;  3UMD A;  1OTI A;  3AGD A;  1RCJ A;  1S1Z A;  1KE3 A;  1T1A A;  2H28 A;  1ESU A;  2EFX A;  2OOL A;  1JWV A;  4EEU A;  4E04 A;  1D7E A;  1GSX A;  4WN5 A;  3UE0 A;  3TOI A;  2V1Z A;  5DJU A;  3NC8 A;  3SS4 A;  1CK3 A;  5L10 A;  2XFT A;  4GS9 A;  2X02 A;  1MWS A;  4X53 A;  1VEU B;  4YFM A;  5GLD A;  1CI9 A;  3C5A A;  1ZKJ A;  2V1A A;  1JVJ A;  2ZC5 B;  2I72 A;  1GHP A;  4F94 A;  2OLV A;  2HDQ A;  1NZO A;  2JCH A;  1ZTU A;  3GV9 A;  1ONG A;  2M1C A;  2O9C A;  3Q07 A;  4I3J A;  4MMN A;  4GDB A;  3HLD A;  3NIA A;  2EX6 A;  3G2Z A;  2JKT M;  2VX8 A;  5HL6 A;  3QP1 A;  3P7N A;  1WA9 A;  2A2L A;  3T4O A;  3MBZ A;  4CLC A;  4BBT A;  2QHK A;  4LFU A;  2ZQD A;  4OQI A;  3VFH A;  3CPT A;  5AQA A;  4EQ1 A;  2HDU A;  1G68 A;  1OTA A;  3EQV A;  4Q0J A;  1H3Q A;  4LGW A;  4FH4 A;  2QYB A;  1ZG6 A;  1XPB A;  1YSQ A;  3HJI A;  3OOV A;  3ZG9 B;  1IEL A;  4JGQ A;  3LUQ A;  3WWX A;  3MZD A;  3IHB A;  3S4X A;  1WYB A;  2Z6D A;  2FFF B;  4HJ3 A;  2XK1 A;  3E98 A;  3IF6 C;  5JYO A;  3BY8 A;  2IWB A;  1LI9 A;  3ZVW A;  4HQA A;  4BBU A;  5AVE A;  5EV0 A;  1ZHH B;  2VGL S;  4MN7 A;  4BBV A;  1N9O A;  4EUZ A;  4Q8I A;  4WEK A;  3Q1F A;  4EBN A;  3F1P B;  2WKP A;  1KVL A;  3PBS A;  4HJ4 A;  4DRT A;  4S2P A;  1F2K A;  3UB7 A;  4DJ2 A;  2ZMV A;  1SKO B;  4EWF A;  5DTS A;  5IS1 A;  1PIO A;  4R0Q A;  2Y2N A;  5FEF A;  4HBT A;  1I5Q A;  3N8S A;  2O0Y A;  1EW0 A;  3D3O A;  2M7U A;  3DTK A;  1UWN X;  5HSQ A;  4G3W A;  1WYC A;  2QMI A;  3KO6 A;  4DDY A;  2Y2M A;  2B18 A;  3ZG8 B;  3FKW A;  3UPO A;  5DJT A;  4OQG A;  1F9I A;  3IH8 A;  2OWJ A;  1KE0 A;  2R9W A;  3G34 A;  3JPU A;  4HI4 A;  3G35 A;  3VP4 A;  4OQH A;  2UWX A;  2ZOH A;  2PU4 A;  3KYE A;  4L9F A;  1YLZ A;  3V3R A;  4KQQ A;  4XT2 A;  3S22 A;  4N1X A;  4X1L A;  2JKG A;  2EFU A;  4F3L B;  2XDM A;  1QMF A;  2Z2M B;  3W4P A;  3FG8 A; 
#chains in the Genus database with same CATH homology
 2Y2G A;  3BFE A;  1ERQ A;  4RA7 A;  1L0E A;  4FSF A;  4K0W A;  5CGS A;  4BLM A;  4JF4 A;  4X6T A;  4E3I A;  1N9B A;  1XA1 A;  1U60 A;  3C7V A;  4KG6 A;  5CHU A;  4S2I A;  5EVI D;  1YM1 A;  1FCN A;  3LEZ A;  4IED A;  1YLW A;  2BG1 A;  3SH8 A;  3ZG0 A;  3E2K A;  5EE8 A;  3WS4 A;  4LCL A;  5GHZ A;  2OSU A;  1BSG A;  1SDN A;  2RCX A;  3DTM A;  3FWL A;  4N9K A;  3HLB A;  4GZB A;  4Y0O A;  3MKF A;  1FCM A;  3MKE A;  4LV1 A;  3WS1 A;  1ALQ A;  4GN2 A;  1SHV A;  2EXA A;  3IXD A;  3Q7Z A;  3RXX A;  1I2W A;  3PTE A;  4GKU A;  5GL9 A;  2G2W A;  4U0T A;  1K57 C;  3UO9 A;  4S2M A;  4DF6 A;  1K55 C;  1Q2Q A;  1TEM A;  3A3J A;  3OPR A;  2WAF A;  3VOY A;  4HEF A;  5HW3 A;  4DE3 A;  5I94 A;  2XH9 A;  3ZFZ A;  1PI4 A;  5G18 A;  5FAT A;  1BUL A;  2PU2 A;  5F83 A;  5HAQ A;  3GSG A;  1JWZ A;  3Q7V B;  1FR6 A;  4DE0 A;  1W79 A;  3ZCZ A;  2OLU A;  4ZTK A;  4R4R A;  2WAD A;  1MXO A;  2E8I A;  2R9X A;  1ZG4 A;  2C5W B;  4XUX A;  5E2G A;  1W5D A;  2Q9N A;  1YMX A;  1NJ4 A;  1RP5 A;  3O3V A;  4R3J A;  5HL1 A;  1HD8 A;  5E43 A;  2ZC3 B;  2XQZ A;  1GHI A;  2XFS A;  3LY4 A;  3V3S A;  3W4Q A;  5J8X A;  2ZM8 A;  2EX2 A;  2XD1 A;  2ZC4 B;  1MWT A;  1SCW A;  1NYY A;  3VP0 A;  3FZC A;  3VSK A;  1GHM A;  4PMA A;  3WRZ A;  1LL5 A;  2WUQ A;  3RJU A;  4R1G A;  3N8R A;  3UPN A;  3B3X A;  4OPQ A;  1LL9 A;  4JPM A;  3C7U A;  3PAE A;  4S2N A;  5DTT A;  1FQG A;  4X56 A;  3UN7 A;  2WGV A;  2HP5 A;  3BRM A;  4A5R A;  1VM1 A;  4B88 A;  4GNU A;  4WZ5 A;  5AQB A;  4IBX A;  3FKV A;  4JXV A;  3ZVT A;  4KZ5 A;  1TDG A;  1HTZ A;  5HAI A;  3UDX A;  4E6X A;  5CEB A;  1TVF A;  4S2O A;  2Y2K A;  3VP2 A;  2JBF A;  3QNC A;  1BLS A;  3BFG A;  5AQ9 A;  3HL9 A;  4WEL A;  2J8Y A;  2VGJ A;  1J9M A;  4H8R A;  1BT5 A;  4LCM A;  1ONH A;  2DRW A;  2WKE A;  4JXG A;  5EVL A;  4EQI A;  2WKI A;  3IWO A;  4UA6 A;  1FSY A;  3P98 A;  4OPR A;  2ZM0 A;  1K6S A;  2EXB A;  2XD5 A;  4P85 A;  5M1A A;  3SS5 A;  3PBN A;  1Y54 A;  3ITB A;  5EPH A;  1YT4 A;  5E2E A;  5KZH A;  3ZG5 A;  4S2L A;  4XUZ A;  1XGJ A;  3GRJ A;  1AXB A;  2C6W B;  4HBU A;  5A93 A;  4GOG A;  3A3I A;  4JLF A;  3V5M A;  4GD6 A;  4LV3 A;  5GLA A;  4FH2 A;  3G31 A;  4N9L A;  3GQZ A;  1YLJ A;  3W4O A;  3WS0 A;  1XKZ A;  1M6K A;  2EX8 A;  3NDG A;  1RGY A;  3NI9 A;  4N1H A;  2J7V A;  4MBH A;  1EI5 A;  2HDR A;  4L0L A;  5DF9 A;  1BTL A;  2P74 A;  3AGF A;  4E3N A;  3ZDJ A;  1ES4 A;  4OVD A;  1MBL A;  4EBP A;  4BJP A;  3IXB A;  3PBR A;  2WGW A;  4S2K A;  1TDL A;  4WBG A;  4UAA A;  4E3K A;  1EWZ A;  1KDS A;  3IQA A;  3MZF A;  1L0F A;  1GA0 A;  1L2S A;  3C4O A;  5KSC A;  3NBL A;  1NZU A;  1CEG A;  3G2Y A;  5TFQ A;  5FQI A;  4GB7 A;  5KMW A;  2QZ6 A;  1IYQ A;  3N8L A;  4MBF A;  4QY6 A;  2HPB A;  4O7D A;  4WZ4 A;  5M19 A;  2WZX A;  1SKF A;  1XA7 A;  2Z2L B;  3LCE A;  1KGE A;  3MFD A;  3ZG7 B;  2JE5 A;  3MXR A;  2J9P A;  5CGX A;  4EBL A;  1W8Q A;  2XR0 A;  3CG5 A;  4C75 A;  2XF3 A;  1JWP A;  1BLC A;  4E3L A;  1PZO A;  1ES2 A;  2ZD8 A;  1Q2P A;  4C3Q A;  4RYE A;  4Z9Q A;  5DF8 A;  1NXY A;  1XXM A;  3HLG A;  4BL2 A;  1O7E A;  4BD1 A;  1PW1 A;  4UA9 A;  4QY5 A;  5EVI B;  1NYM A;  4D2O A;  5CRF A;  4ZJ3 A;  4KG5 A;  4KZ4 A;  1PWC A;  4QB8 A;  2WYX A;  4KZ8 A;  2Y55 A;  3SH7 A;  1E3U D;  2Y91 A;  2ZC7 A;  3GMW A;  5EOO A;  5F82 A;  5FQQ A;  1FR1 A;  4S2J A;  3HUN A;  1K56 A;  4N92 A;  2IWD A;  4R4S A;  2WGW B;  1BZA A;  1KVM A;  3OPH A;  5E2H A;  3G30 A;  3VP3 A;  3UDF A;  5EEC A;  4DE2 A;  1MPL A;  2HDS A;  1N4O A;  4PM5 A;  3GTC A;  3V39 A;  3IWI A;  4B4Z A;  3UPP A;  4DXB A;  1LHY A;  4Y7P A;  3CJM A;  1ERO A;  4U0X A;  2HP9 A;  4KZ9 A;  5CHM A;  3ZGA B;  4BEN A;  3HRE A;  3MZE A;  3O88 A;  5D3O A;  3IF6 B;  2HP6 A;  1DJA A;  4QU3 A;  5TGF A;  2WGI A;  3VP1 A;  1KGG A;  3VOZ A;  3QHY A;  2Y59 A;  3LO7 A;  1L0D A;  2FFY A;  4JXS A;  1S6R A;  1DJB A;  4UHU A;  4K0X A;  4OP8 A;  1WE4 A;  3VSL A;  4QJG A;  3OC2 A;  3BEC A;  1IKI A;  4KQR A;  1PW8 A;  1E4D A;  3M6B A;  4X68 A;  1LLB A;  5A91 A;  1KGF A;  3G32 A;  2Y2O A;  5E2F A;  5GLB A;  4OPZ A;  3HLC A;  1ES3 A;  1I2S A;  4OLG A;  5AQ7 A;  5FI2 A;  3SH9 A;  1SDE A;  4P0M A;  3NDE A;  4P87 A;  3PBQ A;  3ZNY A;  3QNB A;  1PI5 A;  5M18 A;  1YLT A;  1IYO A;  1ZC2 A;  2ZQA A;  1W8Y A;  4OOM A;  3BLM A;  3LY3 A;  4PM7 A;  3WS5 A;  2H0T A;  3AGD A;  1RCJ A;  1KE3 A;  4NET A;  1ESU A;  2EFX A;  2ZM2 A;  4OH0 A;  5TR7 A;  1JWV A;  4KQO A;  4MLL A;  4M3K A;  1BUE A;  1LI0 A;  4R3B A;  1NRF A;  3UE0 A;  4DE1 A;  4ZDX A;  3TOI A;  2V1Z A;  3OPP A;  1E25 A;  2H10 A;  3DWK A;  3NC8 A;  4WEJ A;  3SS4 A;  4E3M A;  1PZP A;  1CK3 A;  5FAO A;  2XFT A;  1PWD A;  1K4F A;  2Y2H A;  4PM9 A;  1IYP A;  2XGN A;  2X02 A;  2Y4A A;  4QD4 A;  5EVI A;  3SOI A;  1MWS A;  4X53 A;  3NY4 A;  1K54 A;  4YFM A;  5GLD A;  2WK0 A;  4OLD A;  1K57 A;  1CI9 A;  3UE3 A;  3C5A A;  1K4E A;  3A3D A;  1O07 A;  1BLH A;  5BOH A;  4OOL A;  4OOY A;  1ESI A;  1ZKJ A;  3FYZ A;  4WYY A;  5HX9 A;  1JVJ A;  2ZC5 B;  4JKT A;  2I72 A;  3TG9 A;  3IWQ A;  5EOE A;  1CEF A;  2ZQ7 A;  3E2L A;  4S2N C;  4OP5 A;  2P9V B;  4PM8 A;  4E6W A;  2DCF A;  1GHP A;  4PM6 A;  2V20 A;  3CZD A;  4MEZ A;  5CGW A;  4F94 A;  2OLV A;  4PPR A;  3IXG A;  3BFC A;  4WZ5 C;  2HDQ A;  2A49 A;  4DKI A;  1NZO A;  2JCH A;  4JXW A;  4UA7 A;  5FA7 A;  3GV9 A;  3BFF A;  3IF5 A;  1ONG A;  3Q07 A;  4K91 A;  3C4P A;  3IHA A;  1E3U A;  3HLE A;  3IF6 A;  5HAP A;  4GDB A;  3HLD A;  3N4I A;  3S1Y A;  1XX2 A;  1KE4 A;  2IWC A;  4LEN A;  3NIA A;  1PWG A;  1K25 A;  4MNR A;  4WMC D;  1MY8 A;  2EX6 A;  2Y2Q A;  1YQS A;  3WS2 A;  5L2F A;  3G2Z A;  5FQM A;  2G2U A;  2X71 A;  3Q82 A;  5GHX A;  4P6B A;  3ZNT A;  2Y2P A;  5GLC A;  1S0W A;  1GA9 A;  1KDW A;  2WKH A;  5JYP A;  4KZ3 A;  3N6I A;  3DW0 A;  4RX2 A;  4JBF A;  4FD8 A;  2H0Y A;  4E3O A;  1PYY A;  3MBZ A;  2XEP A;  3PBT A;  4RVA A;  2ZQD A;  2VGK A;  4OQI A;  2JC7 A;  5HFO A;  2OV5 A;  3VFH A;  2WAE A;  3WRT A;  5A92 A;  3IH9 A;  4R23 A;  3JYI A;  3UE1 A;  1HZO A;  5AQA A;  3VFF A;  2HDU A;  5EVI C;  1DJC A;  3ITA A;  1K54 C;  2V2F F;  4FCF A;  1G68 A;  2XLN A;  1FOF A;  3EQV A;  4KEN B;  5CED A;  5FDH A;  4B4X A;  4QHC A;  4IBR A;  5FI6 A;  4DDS A;  1MWU A;  3Q81 A;  5FAQ A;  4FH4 A;  4ZAM A;  3P09 A;  1ZG6 A;  1XPB A;  4IVI A;  2Y2J A;  3ZG9 B;  3AGE A;  3I7J A;  5FAS A;  4WM9 A;  1IEL A;  3HBR A;  3O86 A;  2GDN A;  3BLS A;  3WWX A;  1ES5 A;  3MZD A;  1IEM A;  3IHB A;  3S4X A;  4C6Y A;  3BFD A;  4DXC A;  3O87 A;  1WYB A;  4LV2 A;  4U3T A;  2FFF B;  1NY0 A;  3HUO A;  5CER A;  3W8K A;  1GCE A;  3N7W A;  5FQ9 A;  3GVB A;  1W7F A;  2XK1 A;  3GR2 A;  5CXW A;  5FQJ A;  2Q9M A;  4BD0 A;  1K38 A;  3IF6 C;  5JYO A;  3A3E A;  1IKG A;  3BYD A;  4GD8 A;  2PBY A;  4LV0 A;  5DTK A;  1LI9 A;  2IWB A;  3PAG A;  4EV4 A;  4OQ0 A;  5DVA A;  1Z6F A;  4ZJ1 A;  3ZVW A;  1JTD A;  2P9V A;  2Y2L A;  1H8Y A;  3BM6 A;  3VMA A;  4OON A;  4HES A;  1YMS A;  1K56 D;  3DWZ A;  1MKI A;  3M6H A;  4EUZ A;  4Q8I A;  5A90 A;  4WEK A;  3Q1F A;  4GDN A;  2ZC6 B;  2BLS A;  1CI8 A;  4KZ7 A;  4EBN A;  2ZLY A;  3EQU A;  5U47 A;  3UDI A;  2A3U A;  5KSH A;  1KVL A;  2RL3 A;  3PBS A;  4XXR A;  4DRT A;  1XGI A;  4MBK A;  4X55 A;  2ZQC A;  3A3F A;  1M40 A;  4S2P A;  1H5X A;  3D4F A;  3HVF A;  2WZZ A;  3M2K A;  5F1G A;  2ZJ9 A;  4Y0U A;  3BEB A;  3HLF A;  4NK3 A;  3IXH A;  1YLY A;  3NCK A;  4EWF A;  1JTG A;  5DTS A;  2J9O A;  1FCO A;  3OZH A;  1PIO A;  2CC1 A;  4OPY A;  4R0Q A;  5F1F A;  5CEC A;  2Y2N A;  5DF7 A;  4X69 A;  5FAP A;  1H8Z A;  3HLW A;  4HBT A;  2X01 A;  1I5Q A;  3N8S A;  1XP4 A;  1IYS A;  4ZBE A;  1K55 A;  5EUA A;  4KG2 A;  2B5R A;  1K6R A;  4KZB A;  4E3J A;  5HAR A;  3MXS A;  4WMC A;  5GHY A;  4ZJ2 A;  1QME A;  3IT9 A;  3HUM A;  3CMZ A;  1L0G A;  1WYC A;  4RX3 A;  2EX9 A;  4JF6 A;  2QMI A;  5CHJ A;  4CPK A;  4DDY A;  1C3B A;  1ERM A;  2Y2M A;  4ID4 A;  3ZG8 B;  4IVK A;  3FKW A;  3UPO A;  4BQM A;  4OQG A;  3IH8 A;  1HVB A;  5CTN A;  5CTM A;  1KE0 A;  4KZA A;  3OCN A;  2H5S A;  2R9W A;  1G6A A;  3G34 A;  3TSG A;  3UNW A;  2Y2I A;  1DY6 A;  3G35 A;  2QPN A;  3Q7V A;  3VP4 A;  5FI7 A;  4OQH A;  3ISG A;  2UWX A;  1BLP A;  2PU4 A;  4OKP A;  5FSR A;  3RXW A;  1YLZ A;  3OPL A;  4CJN A;  3V3R A;  5IHV A;  1YLP A;  4KQQ A;  1VQQ A;  1FSW A;  1RGZ A;  3PBO A;  4KZ6 A;  3G4P A;  3S22 A;  3ZHH A;  4YIN A;  1MWR A;  4N1X A;  3OCL A;  2ZQ8 A;  4Y0T A;  3UY6 A;  3FV7 A;  5FQK A;  2EFU A;  3V50 A;  4BL3 A;  2DNS A;  2ZMA A;  4JF5 A;  1OME A;  2XDM A;  1QMF A;  3SS3 A;  3M2J A;  2Z2M B;  3W4P A;  2ZQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...