3RXXA

Kpc-2 carbapenemase in complex with 3-npba
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
NLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYRAEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAELSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTSSPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVYGTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbepenem-hydrolyzing beta-lactamase KPC
publication title Crystal structures of KPC-2 {beta}-lactamase in complex with 3-nitrophenyl boronic acid and the penam sulfone PSR-3-226.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase/hydrolase inhibitor
total genus 95
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3rxxA00
3V39A 4P85A 2X71A 1NXYA 3OZHA 4EQIA 2RL3A 4JXGA 1MWRA 3ZG8B 4KZ6A 4R4SA 4U0TA 1YMSA 2P9VB 1KGFA 3NY4A 4JLFA 1FOFA 3QNCA 1RGYA 2PU4A 4EV4A 1DJBA 5KZHA 4KZ5A 2H0YA 2HP9A 1EROA 3IT9A 3O88A 2Y59A 1W79A 2HDUA 1K54C 3IWQA 1K38A 3QHYA 4GOGA 1YMXA 2BLSA 1MBLA 3Q07A 2PBYA 1PWGA 5CHMA 3IHBA 3MXSA 3UDIA 5EUAA 2P74A 4N1HA 3M2JA 4RVAA 4D2OA 3HBRA 3OCLA 4DE2A 4A5RA 3ZNYA 4ID4A 1I2WA 2Q9NA 2J9OA 1NZUA 2Y2KA 3W8KA 4BENA 1KDWA 3BRMA 3UN7A 3LY4A 3MZDA 2XD5A 5FA7A 2HDQA 4RYEA 3RXWA 3VOZA 3S4XA 3BYDA 4RX3A 1GA0A 2JBFA 3SS4A 2HPBA 4YINA 4LV1A 4O7DA 4X56A 4H8RA 2WYXA 3UY6A 4C6YA 1TVFA 5GHZA 1K6RA 1XPBA 4PM5A 1EWZA 3FZCA 2WUQA 3QNBA 4RA7A 4BD0A 3P09A 3CMZA 4IVKA 4KZ3A 4E3OA 1G6AA 3UDXA 1MPLA 4E6WA 4ZTKA 1OMEA 4OLGA 3A3DA 1K57A 1IYQA 1PZOA 5A93A 3SH8A 4MBHA 4S2NA 1IYSA 3UE1A 5DVAA 1YLJA 1CI9A 4X68A 1I2SA 1KVMA 3BLMA 2XK1A 1FCOA 2QMIA 2RCXA 5D3OA 2FFFB 5M1AA 4Q8IA 3NC8A 3NI9A 5FQIA 2ZD8A 2ZM8A 5CERA 5I94A 3C4OA 4JF6A 2XEPA 3C7VA 4PM8A 4ZJ3A 3WRZA 1LHYA 5HAQA 1ZKJA 3W4QA 4X53A 4BL2A 1VQQA 5EVIC 3HLCA 5FAQA 2Q9MA 4ZBEA 3ZNTA 3G2YA 4B4ZA 4OQIA 4PM7A 4ZJ1A 3O87A 2R9WA 4XUXA 4EUZA 1JWPA 5CECA 3MFDA 1MKIA 2E8IA 4OQHA 2Y2QA 2Y4AA 5FAOA 2ZC3B 2Y2IA 5M18A 3MZFA 4HBUA 1ONHA 5AQ9A 5CGXA 1PIOA 4OPRA 2ZC5B 1J9MA 1L0DA 3S22A 3LY3A 3N8LA 5FQMA 2Z2MB 5IHVA 2C5WB 3HUOA 1L0FA 1ES3A 4RX2A 4DRTA 3TOIA 4KZAA 2XF3A 1PWCA 3OPLA 3WS0A 1TEMA 5KSCA 1QMEA 1BSGA 3NDEA 2A49A 3N8SA 1S6RA 5E2HA 3IXGA 4M3KA 2DRWA 3IF5A 1K56A 3MZEA 1ES2A 1W7FA 3SH9A 4QU3A 3NCKA 3Q1FA 5FAPA 2XLNA 4WYYA 3UE0A 3HLGA 4GD8A 1IYPA 1K56D 3OPPA 5F83A 3Q7VB 2WKEA 3VP2A 3UPOA 3HLFA 4UA6A 1HZOA 4FD8A 5HL1A 3EQUA 1RCJA 3UPPA 5AQAA 5DF7A 4OKPA 4QY6A 4C75A 2EXBA 3FKVA 1RP5A 1XXMA 1JWZA 1K4FA 1Y54A 5DF8A 5FI7A 3HUMA 3DTMA 4GN2A 3MXRA 2EX2A 2Y55A 1L0EA 3DWZA 4KQRA 2GDNA 3BFDA 3ZFZA 2ZJ9A 1FQGA 3IHAA 2V20A 2ZMAA 4ZAMA 5FASA 3PBOA 3TSGA 1U60A 4DDYA 5FDHA 2ZM0A 1ALQA 3A3JA 1XGIA 3Q7ZA 5HX9A 3WS5A 1L0GA 2XFTA 4N9KA 3GRJA 1E4DA 1ERMA 1ZC2A 2WGWB 2XD1A 4BD1A 1XX2A 2VGKA 4E3IA 4WZ4A 5EVIB 1LI0A 3M6BA 4BL3A 2IWDA 4MBKA 1H5XA 1MWSA 1YLYA 1ESIA 1K55A 2Y2HA 3I7JA 3VSLA 1MWTA 3WS2A 1IKGA 5EOEA 1K57C 4MLLA 1ZG6A 3N4IA 3HLBA 1VM1A 1IYOA 1FSWA 3IF6A 1PI5A 2WGVA 3BFCA 4X6TA 4S2NC 4P87A 5E2FA 4DDSA 4C3QA 4WM9A 4UAAA 4S2IA 1G68A 4IBXA 4QY5A 3IH8A 3MKFA 3MKEA 2V2FF 2HDRA 2J8YA 4QHCA 2VGJA 3PAGA 1BULA 3DWKA 5FQ9A 3G2ZA 1YLTA 2EX6A 3OCNA 1PW1A 4LV2A 3NBLA 1ZG4A 4N1XA 4E3JA 3W4OA 2UWXA 4KZ9A 3N7WA 2XQZA 3SS3A 3G4PA 4WBGA 5DTKA 4EWFA 5FATA 3N6IA 4QD4A 1S0WA 4KZ7A 4IEDA 3O86A 4OP8A 3PBQA 1XGJA 4GNUA 2WKHA 4R23A 4FCFA 4HEFA 1YQSA 4R1GA 1FR6A 1Z6FA 2R9XA 5E43A 4OH0A 1XA7A 1MXOA 3C7UA 3M6HA 3G35A 4UA7A 1BLSA 1LLBA 2OV5A 1SDNA 2Y2GA 3GMWA 3HL9A 4Y7PA 2XGNA 5F1GA 4WZ5C 3ZG5A 4DE1A 4OP5A 1W8YA 2JE5A 5CEDA 3G34A 3SOIA 4PMAA 1MY8A 1N4OA 3ISGA 4CJNA 4JF5A 4KG5A 4BJPA 4JF4A 2Y2MA 4OLDA 1XA1A 5L2FA 3NDGA 4EBPA 1E25A 5A90A 5E2GA 2ZQAA 5FQQA 4LV3A 5CRFA 1HVBA 3PAEA 1NJ4A 1K4EA 1NRFA 4E3MA 3VP4A 4JBFA 4LV0A 4OVDA 3C5AA 3V3SA 4EBLA 3Q82A 1K25A 1FCMA 1PW8A 1PZPA 1AXBA 4JPMA 1YLZA 3MBZA 4E3KA 2HDSA 4U0XA 1TDLA 1KGGA 2H5SA 3HVFA 1HTZA 5F1FA 4JKTA 3Q7VA 1JVJA 4BQMA 2X02A 4OQGA 5GLBA 1YM1A 3N8RA 3A3FA 3IXDA 2Y2OA 2ZLYA 3BFGA 3GR2A 2DCFA 4OOYA 4GDBA 3UPNA 4X55A 5CEBA 3E2LA 5GHYA 2XDMA 4GD6A 1BLPA 2WK0A 3GTCA 2OLVA 3CG5A 4S2PA 5CGSA 1WYCA 1K55C 5AQBA 3BFEA 3IWIA 4PM6A 5EOOA 3O3VA 5CTNA 4KQQA 4PPRA 1EI5A 4GDNA 2ZC6B 4S2OA 5M19A 1IKIA 5TFQA 1K6SA 3A3IA 3ZG9B 3BM6A 3VP1A 4F94A 3IF6C 1O7EA 3HUNA 5CHUA 5CTMA 3GSGA 4ZJ2A 3GV9A 3AGDA 2FFYA 2H10A 2ZC4B 4KZ8A 3UNWA 1YLWA 2WGWA 1PI4A 1NY0A 2C6WB 3OC2A 4KQOA 3CJMA 3A3EA 3P98A 3BEBA 2WZZA 4R3JA 5GLAA 2P9VA 3FKWA 4GZBA 5HAIA 1YT4A 4K0XA 3Q81A 3ZGAB 1FSYA 2ZQDA 3HREA 2QPNA 3HLWA 2WKIA 2OLUA 3D4FA 3DW0A 5E2EA 1KGEA 5DTTA 3FV7A 3OPRA 4UA9A 1QMFA 4OOLA 1KVLA 1NYMA 3M2KA 1ESUA 1H8ZA 4LENA 3G32A 1SDEA 5JYPA 1KE0A 4K0WA 1C3BA 3ZCZA 2BG1A 5HW3A 1BUEA 4UHUA 3V50A 1N9BA 1ERQA 4GB7A 1KE3A 4FH4A 3WS1A 3VFFA 4WEJA 2EFXA 2XH9A 4X69A 1FCNA 1Q2QA 3VSKA 3ITAA 2ZQ9A 1BZAA 1PWDA 4R0QA 1H8YA 4DF6A 1M40A 3PTEA 2PU2A 1SCWA 2XR0A 5GHXA 4OONA 4S2LA 4E6XA 2HP6A 3TG9A 2G2UA 4OPYA 2JCHA 5EE8A 2Z2LB 1JTGA 3FYZA 5HFOA 3IQAA 3UDFA 4FSFA 5J8XA 4R3BA 2ZC7A 4ZDXA 4DKIA 5HARA 1W5DA 2WZXA 3ZG7B 4CPKA 1GCEA 4Y0OA 4NETA 2JC7A 1YLPA 5BOHA 5HAPA 5G18A 5GLDA 4S2KA 5A92A 3RJUA 1BTLA 4HBTA 3ZG0A 4N92A 4OPQA 4QB8A 2QZ6A 4MNRA 2Y2LA 4DE3A 1JTDA 3W4PA 2ZQ7A 1I5QA 3IF6B 3NIAA 1Q2PA 5DF9A 4KG6A 1TDGA 3EQVA 1LI9A 3VP0A 2EXAA 2V1ZA 3IXBA 4OQ0A 3ZDJA 2EX9A 2X01A 3GQZA 1GHMA 3IXHA 4DXBA 1RGZA 3WS4A 1SHVA 1M6KA 2Y2NA 1E3UA 3SS5A 3C4PA 4DXCA 1FR1A 4K91A 4OPZA 3BECA 3V3RA 4XXRA 3LO7A 4YFMA 1DJAA 1E3UD 4FH2A 4N9LA 4Y0TA 2ZQ8A 1GA9A 1K54A 1L2SA 3PBSA 3PBRA 1JWVA 5FI2A 5JYOA 3ZVWA 3FWLA 2CC1A 4MBFA 2HP5A 5KMWA 2J9PA 3VP3A 4L0LA 4OOMA 3CZDA 1ES4A 3B3XA 3OPHA 3PBNA 4LCLA 4S2JA 4E3NA 4U3TA 1GHPA 4JXVA 2Y2PA 5EVLA 1ONGA 5CGWA 2OSUA 4P0MA 4WMCA 5TR7A 3VMAA 3UO9A 1WYBA 3JYIA 2EX8A 4KZBA 2A3UA 3PBTA 4KG2A 3G30A 1NYYA 4Z9QA 4EBNA 4WMCD 5DTSA 4R4RA 3LEZA 4NK3A 1IEMA 4KENB 3UE3A 3RXXA 4PM9A 1LL5A 1HD8A 1WE4A 2I72A 3WRTA 1ES5A 5KSHA 2H0TA 5CHJA 1LL9A 1W8QA 4LCMA 4IBRA 4XUZA 3AGEA 5EPHA 2XFSA 5EECA 3SH7A 4DE0A 4IVIA 4WELA 1KE4A 1XKZA 1PYYA 4GKUA 1DY6A 1CEFA 3WWXA 3BLSA 3ITBA 3BFFA 1BLCA 1NZOA 4S2MA 5FI6A 1CEGA 4WZ5A 4Y0UA 3G31A 4MEZA 5GLCA 3GVBA 3AGFA 2WADA 5FQKA 2DNSA 1CI8A 3IWOA 1BT5A 5AQ7A 2G2WA 4WEKA 3VOYA 1O07A 3HLDA 4E3LA 5EVIA 1XP4A 1BLHA 5TGFA 2Y2JA 2WGIA 5FQJA 4P6BA 4B88A 2EFUA 5F82A 1IELA 3LCEA 3VFHA 4BLMA 5EVID 2J7VA 2ZM2A 2IWCA 4HESA 1DJCA 4JXWA 2ZQCA 4JXSA 1SKFA 3ZVTA 1MWUA 3S1YA 3V5MA 4KZ4A 2WAEA 3HLEA 2WAFA 4B4XA 5A91A 3ZHHA 1GHIA 2Y91A 5GL9A 5CXWA 2IWBA 3E2KA 2B5RA 4QJGA 5U47A 1CK3A 3IH9A 5FSRA 1KDSA
chains in the Genus database with same CATH superfamily
3V39A 4P85A 2HJ9C 3CITA 4G3VA 2W3DA 3BJNA 4I3IA 4U0TA 4HP9A 4HIAA 4R38A 4P6ZM 2HP9A 3IT9A 4I5SA 1ACFA 1W79A 3IWQA 4PKYG 5HSQA 3UDIA 4HY8A 4GS9A 2P74A 3OCLA 4ID4A 2WKPA 1OPXA 3BRMA 1T1CA 2XD5A 4RYEA 3BYDA 3MQOA 3E4PA 3TJZC 4CLCD 2BTFP 4C6YA 2WYXA 4WUJA 3P09A 3IS2B 5TBMA 1MPLA 4E6WA 1S67L 1SZVA 1OMEA 3A3DA 1PZOA 3KYEA 3UE1A 4K08A 1KVMA 3L9KA 4Q8IA 2FFFB 5FQIA 4H6JA 5CERA 4NEED 3C4OA 4PM8A 4L9EA 3W4QA 4X53A 4MDZA 3HLCA 2Q9MA 4ZBEA 4OQIA 3O87A 5CECA 3MFDA 3UB8A 2OOLA 2Y2IA 5M18A 1S4RA 2HZ5A 1J9MA 3LY3A 3N8LA 5IHVA 1ES3A 4RX2A 1GSVA 5FDSA 1TEMA 1QMEA 2FZ0A 4Q0HA 2J80A 1S6RA 2PT7A 3IXGA 2DRWA 1K56A 1ES2A 3NCKA 4WYYA 4YNRA 1IYPA 3OPPA 3VP2A 3F1OA 3HLFA 3EQUA 1GSWA 1OJGA 3U2AA 2XROA 3UPPA 2DMWA 5DF7A 4C75A 1N9LA 2QHKA 1XXMA 1JWZA 3BQ8A 3C2WA 3DTMA 3IBJA 4Y2FA 2GDNA 3ZFZA 1NLYA 4ZAMA 3IBRA 5FDHA 2ZM0A 5DJTA 3A3JA 3D72A 3WS5A 4BD1A 2VGKA 3FG8A 4WZ4A 4MBKA 1ESIA 3I7JA 5EM1A 1MWTA 3WS2A 5J7EA 1ZG6A 3N4IA 1VM1A 5F69A 2Y79A 3R4KA 4IUKA 2Z6CA 4P87A 5E2FA 4WM9A 2M7VA 4QY5A 3IH8A 3IS2A 2HDRA 5IS1A 3G2ZA 1YLTA 4LV2A 1ZG4A 4N1XA 4BBTA 3SS3A 3KSHA 5DTKA 3NOUC 4OP8A 1WA9A 2WKHA 1LL8A 4FOFA 4JGPA 1FR6A 1V9YA 4OH0A 4RQ9A 2OAP1 4UA7A 1BLSA 3HL9A 4Y7PA 5G4ZA 2JE5A 3H82A 4BJPA 2Y2MA 4EBPA 1E25A 3KSFA 5E2GA 3IX8A 3PAEA 2L0WA 3T4OA 2XRNA 1K4EA 1NRFA 4E3MA 2PD7A 3V3SA 4EBLA 4LRXC 2EA9A 1AXBA 4JPMA 1YLZA 2HDSA 2Z6DA 4U0XA 1ZHHB 2X02A 2A2LA 2HJEA 4F3LB 3BFGA 3GR2A 2DCFA 1CJFA 2JN7A 2OWJA 3BQAA 5CGSA 3GTCA 1G6OA 4IUHA 1WYCA 1LT0A 3BFEA 4PM6A 3LIEA 4PPRA 2A24A 4S2OA 4NXGA 5CTMA 3AGDA 2H10A 2HF6A 2ZC4B 3CLOA 1H0MA 3A0VA 4KQOA 2C6WB 1XFQA 3DBAA 5TJJA 3P98A 3BEBA 3H9WA 5HAIA 2P9VA 1Y28A 2B18A 1KGEA 5DTTA 1KVLA 2QJ5A 5JYPA 3ZCZA 2BG1A 1BUEA 1KE3A 4WEJA 2V9AA 2XH9A 1Q2QA 1HLUP 3VSKA 2W27A 4GHIA 2OWHA 1H8YA 4DF6A 1M40A 2XR0A 4S2LA 3TG9A 2G2UA 4KUOA 1KOUA 4HJ3A 3UDFA 2ZC7A 3MR0A 5HARA 4Y0OA 4XT2B 4GJ4A 3KO6A 4OPQA 4DE3A 2PD8A 5HWTA 3IF6B 5J3WA 1Q2PA 4KG6A 2QKPA 1A0KA 4DXBA 1RGZA 4AFIA 1SHVA 1M6KA 4PAUA 4UQIS 4Y13A 4O8GA 3DTIA 4XXRA 3LO7A 1E3UD 4FH2A 1JWVA 3VP3A 4R6LA 5DJUA 1ES4A 4U3TA 4GW9A 2Y2PA 3V67A 5CGWA 2OSUA 4WMCA 3VMAA 3EEAA 3PBTA 5AJGA 2J3TD 4MCWA 5DTSA 4NK3A 3DAVA 1AWIA 1LL5A 3MJQA 1WE4A 2I72A 3F1NB 5G4YA 4G3KA 2H0TA 3ZQ5A 5CHJA 1LL9A 1W8QA 5MC7A 4IBRA 4ZRRA 2W0NA 1XKZA 1PYYA 1DY6A 3BLSA 2O99A 3E98A 5AVEA 3G31A 3NULA 4MEZA 2WADA 2DNSA 3VOYA 5L07A 1O07A 3HLDA 1BLHA 5TGFA 2Y2JA 5FQJA 1XJ3A 2XA7M 3LCEA 5EVID 2VGLS 1G5UA 2ZQCA 3V5MA 4KZ4A 2WAEA 3HLEA 2WAFA 2CMNA 1VETB 2ACGA 1CK3A 3IH9A 2QJ7A 4YWZA 2R78A 2X71A 1XJ2A 4EEUA 1NXYA 3OZHA 2RL3A 1FIKA 3CAXA 4KZ6A 1TS6A 3NY4A 4JLFA 2H0YA 5HZHA 1K38A 1PWGA 5CHMA 3MXSA 1STZA 4N1HA 4D2OA 3HBRA 4DE2A 4A5RA 1I2WA 2Q9NA 1NZUA 4BENA 4KQDA 5FA7A 2HDQA 3VOZA 3S4XA 4WN5A 3BY8A 1MZUA 1GA0A 2JBFA 2HPBA 4LV1A 3F1PA 4IVKA 1D1JA 3UDXA 4YOFA 1IYQA 3SH8A 2W3GA 1IYSA 3LR5A 4X68A 4BD0A 2XK1A 3NOTC 5D3OA 1FILA 2RCXA 3NI9A 2ZM8A 5I94A 2XEPA 1XJ6A 3C7VA 3C30A 1VQQA 3HCYA 1YSPA 2JKTI 3ZNTA 3G2YA 4B4ZA 2O9AA 4ZJ1A 2R9WA 4XUXA 2H28A 4HH2A 1MKIA 2Y2QA 2Y4AA 3MZFA 4ARZA 4HOIA 5AQ9A 5CGXA 4HNBA 4DRTA 3NDEA 2PYRA 4X1LA 1P9RA 1W7FA 1S1YA 3Q1FA 3A0RA 4HHDA 3T1SA 3OLOA 3UPOA 4Y5FA 3LUQA 5HL1A 2W3EA 4OKPA 1VETA 3FKVA 1RP5A 3LIFA 3GDIA 3BFDA 4HQAA 1FQGA 3IHAA 2V20A 5FASA 3PBOA 1XGIA 3Q7ZA 3T4QA 2XFTA 3QP6A 4KUKA 2WGWB 5EVIB 2IWDA 1IKGA 2P08A 1H8MA 1IYOA 3LGOA 3LR3A 4R3AA 2WGVA 5F68A 1IOUA 4S2IA 3E0YA 3MKFA 3MKEA 4QHCA 2VGJA 3RFBA 1BULA 3CWFA 2VV8A 3BW6A 3N7WA 1UWNX 2XQZA 1OTIA 4WBGA 4LRZE 3EGDC 3N6IA 1SKOA 3QP4A 4R23A 4FCFA 1YQSA 5E43A 1XA7A 1MXOA 2OV5A 3G35A 1PRQA 1LLBA 1SDNA 5F1GA 2K31A 4WZ5C 2PR5A 3G34A 3PYPA 3UB9A 1MY8A 1N4OA 2XSSA 1XA1A 5L2FA 4CLCE 3LEQA 2ZQAA 3K3DA 5FQQA 5CRFA 2EWVA 1F9IA 1K25A 1PW8A 3BY9A 1PZPA 2ZBBA 3QP1A 5F1FA 3BWLA 3HJKA 4BQMA 3C8CA 1YM1A 3A3FA 3UMDA 5I5LA 3E2LA 5GHYA 2OAQ1 2WK0A 2OLVA 2JKFA 3IWIA 4KQQA 5M19A 5TFQA 1K6SA 3ZG9B 4F94A 3CI6A 3EOIA 1O7EA 3GV9A 2KOIA 4KZ8A 2FFYA 1YLWA 2WGWA 1PI4A 1NY0A 4GZBA 3FKWA 1YT4A 4K0XA 3Q81A 3D4FA 3DW0A 5E2EA 3FV7A 3OPRA 4UA9A 4CQHA 3M2KA 3JPUA 5IU1A 1C3BA 1DRMA 4UHUA 3T4LA 1ERQA 4GB7A 2P04A 1PNEA 5L8MA 3E4QA 2ZQ9A 2PU2A 5FL3A 2Z2LB 5HFOA 4FSFA 3VV4A 5J8XA 2WKRA 4DKIA 3LR0A 4NETA 2JC7A 5HAPA 4S2KA 2PHYA 5A92A 3ZG0A 4N92A 4QB8A 1OTEA 2Y2LA 3W4PA 3G6OA 3SZTA 1TDGA 2V1ZA 3IXHA 5HPFA 4CLCB 2Y2NA 3C4PA 4DXCA 1YKDA 1DJAA 3P01A 4N9LA 2ZQ8A 3PBRA 1K54A 1L2SA 3PBSA 4BMWA 5FI2A 1GSXA 4MBFA 4NXBA 4OOMA 3CZDA 2VV7A 3VOLA 4FTXA 2D02A 1ONGA 4KZBA 4EBNA 4R4RA 3LEZA 1OT6A 1HD8A 3WRTA 4M4XA 3RTYA 4NG2A 2EWWA 4LCMA 5EPHA 4WELA 2G7UA 3WWXA 3ITBA 1NZOA 4LGWA 3PR6A 2I9VA 3AGFA 1CI8A 1BT5A 5AQ7A 1ZTUA 4IHQA 4P6BA 1IELA 3VFHA 3TE8A 2J7VA 2K7SA 4HESA 4JXSA 1MWUA 3S1YA 3QP5A 4ETXA 4L9GA 3IX3A 2INWA 1GHIA 2Y91A 5GL9A 4ME4A 1K0KA 2B5RA 5U47A 4Y17A 3LIAA 1OTBA 4HJ4A 3B47A 3T12B 4EQIA 4JXGA 1MWRA 3ZG8B 5HL6A 4R4SA 1W63M 1KGFA 1FOFA 3QNCA 1TD5A 2M7UA 1RGYA 1T19A 2PU4A 4X1MA 2O0YA 2W1TB 4EV4A 5KZHA 1EROA 3O88A 3S7OA 2Y59A 2HDUA 1K54C 4GOGA 1LSVA 1MBLA 4DMZA 3IHBA 5CX7A 3W2ZA 2J9OA 2W1RA 2Y2KA 3W8KA 3MXQA 1KDWA 3MZDA 2PAVP 4RX3A 4YINA 1TVFA 2V0UA 1K6RA 5GHZA 4PM5A 1EWZA 2WUQA 3QNBA 2V8FA 3JVVA 5HDCA 3C38A 4KZ3A 3T4TA 1H3QA 3B33A 4ZTKA 2FH5A 1K57A 3L7HA 5A93A 2W3FA 2KX6A 2WKQA 4MBHA 1YLJA 1I2SA 3BLMA 3NC8A 5LBRA 4JF6A 4F3LA 4WL9A 4ZJ3A 1LHYA 1ZKJA 1NLZA 3JVUA 4PM7A 4EUZA 1JWPA 2E8IA 4OQHA 5FAOA 2ZC3B 3TRCA 3K3CA 4HBUA 1ONHA 4FUWA 1VB6A 1PIOA 5HD3A 2ZC5B 1L0DA 3S22A 3LIBA 5DFYA 3HUOA 1OTAA 3TOIA 4KZAA 1D06A 5DFXA 3N8SA 4P6ZS 3IF5A 3MZEA 5FAPA 3UE0A 3KSGA 3HLGA 3OBFA 3FPVA 4GD8A 3VE3A 1K56D 3Q7VB 1HZOA 1RCJA 2AVXA 2P7JA 4Q0IA 5AQAA 4QY6A 2EXBA 3NECA 4BWIA 1Y54A 1K4FA 5DF8A 5FI7A 3HUMA 4GN2A 2Y55A 3DWZA 2ZJ9A 3TSGA 3FPWA 1U60A 5HX9A 4E04A 4N9KA 3GRJA 1E4DA 1ERMA 2XD1A 2VX8A 2VJWA 4XT2A 1LI0A 4QWOA 1H5XA 1K55A 3VSLA 1F5MA 5K5BA 4NXFA 1K57C 2KLIA 5DKKA 3HLBA 4PKYA 2VKSA 3D3OA 1FSWA 3LIDA 3IF6A 1T18A 2ZL1B 3E4OA 4X6TA 2PRFA 4DDSA 4C3QA 3CUEA 1PFLA 4UAAA 2ZOHA 1G68A 4IBXA 5FQ9A 2V2FF 3DWKA 2EX6A 5HDSA 3OCNA 1PW1A 2YKFA 2UWXA 3GECA 4KZ9A 1YSQA 3KSIA 2JKRM 1BYWA 4EWFA 2B02A 1TF1A 3R7WB 4QD4A 1S0WA 4IEDA 3O86A 4GLQA 1XGJA 4GNUA 4EESA 4HEFA 4GS9B 4MN6A 4R1GA 4EERA 3C7UA 2Y2GA 3GMWA 3ZG5A 3F1NA 3ZYTA 1T1AA 5CEDA 3SOIA 2D01A 1W63Q 3ISGA 4CJNA 4KG5A 4OLDA 5FEGA 5A90A 1MKMA 4DJ3A 4LV3A 5F5YA 1HVBA 5TBMB 3VP4A 4LV0A 2GZAA 2M1CA 3Q82A 3NJAA 1NRJA 4NKPA 5IT5A 2GJ3A 5FEFA 2H5SA 1HTZA 4GCZA 3Q7VA 4H6JB 4OQGA 5GLBA 3IXDA 4IJGA 2Y2OA 4OOYA 3UPNA 4GDBA 4X55A 3T4SA 5CEBA 2VEAA 3EWKA 4S2PA 5AQBA 1K55C 4HJ6A 1S1ZA 2IA2A 3O3VA 4GDNA 4UQIM 4ETZA 4D60A 3A3IA 2W3HA 3IF6C 2YKHA 3HUNA 5CHUA 5HWWA 3GSGA 3CUEC 4ZJ2A 3UNWA 3OC2A 3CJMA 3A3EA 5GLAA 5A8BA 4NXEA 4MN7A 3CHWP 2BASA 1FSYA 2ZQDA 1Y4OA 3HREA 3DTKA 3MMHA 4JGOA 2ZL1A 4HI4A 1NYMA 1ESUA 2HGVA 3F1OB 1DP9A 1H8ZA 3KYQA 4LENA 3MS6A 1KE0A 3TW8A 1J3WA 4FH4A 3WS1A 2EFXA 4WLAA 1BZAA 3MSHA 1OJ5A 4OONA 3R7WA 2K2NA 4OPYA 2JCHA 3IQAA 1V9ZA 2NUPC 4R3BA 4ZDXA 1W5DA 2WZXA 4CPKA 1GCEA 4O01A 3SW1A 1YLPA 1L3LA 1BTLA 4HBTA 1P9WA 4MN5A 4LPZA 2VGLM 5HDDA 3ULFA 2ZQ7A 2GX5A 1OT9A 3NIAA 5DF9A 4G3WA 3EQVA 2EX9A 2X01A 1YAXA 3WS4A 1E3UA 1FR1A 4K91A 3V3RA 4YFMA 4Y15A 3MQ0A 2HP5A 1ODVA 4I38A 3B3XA 4E3NA 4S2JA 4LCLA 1GHPA 5EVLA 4P0MA 3UO9A 1WYBA 3JYIA 2EX8A 4EETB 4KG2A 3G30A 1NYYA 4WMCD 4KENB 3RXXA 1D7EA 5EM0A 5KSHA 3H82B 3LYXA 3AGEA 2XFSA 3SH7A 1S4SA 4IVIA 3U4LP 1KE4A 4GKUA 3P7NA 3BFFA 4B93A 1BLCA 2JHEA 4I3AA 5FI6A 2LB5A 4WF0A 1Z09A 5FQKA 1UWPX 2G2WA 4WEKA 5EVIA 2PBDP 2EFUA 3FC7A 3D9YA 2ZM2A 1XJ4A 5KIZA 3ZVTA 4X25A 4B4XA 3ZHHA 2A24B 5CXWA 2IWBA 5L10A 5C5KA 4LRYC 1VEUB 1KDSA 2UV0E 1T1BA 1YMSA 1F2KA 2P9VB 3CPTB 1DJBA 4KZ5A 3QHYA 1YMXA 2BLSA 3Q07A 2PBYA 3UB6A 4DN0A 4HP4A 5EUAA 1DP6A 3T1XA 2ZMVA 3M2JA 4RVAA 1DP8A 3ZNYA 4EXOA 3UN7A 3LY4A 5L09A 3RXWA 2J3TC 1CF0A 2Y8HA 3SS4A 2KDKA 2Q0OA 4GHIB 4O7DA 4X56A 4H8RA 3UY6A 1XPBA 1TS7A 3FZCA 4RA7A 3CMZA 1UGUA 5J4EA 4E3OA 1G6AA 4EQ1A 4OLGA 1NWZA 4S2NA 5DVAA 1CI9A 5HAQA 1LSXA 1FCOA 2QMIA 5M1AA 2VV6A 4LFUA 2O9BA 4JGQA 2ZD8A 2XA7S 3WRZA 4LLOB 4BL2A 3QP8A 2ZMFA 5EVIC 5FAQA 4I39A 3NHQA 3QP2A 3T1RA 3DTEA 3PXPA 3RH8B 3ICYA 2PYPA 4OPRA 1P0ZA 5FQMA 2Z2MB 2C5WB 1G28A 1L0FA 2HV1A 2XF3A 1PWCA 3OPLA 3WS0A 5KSCA 1BSGA 4I3JA 2J3WA 2A49A 1YPRA 5E2HA 4M3KA 3SH9A 4QU3A 3S7PA 2XLNA 5F6AA 5F83A 2WKEA 1MC0A 4UA6A 2E8JA 4FD8A 4L9FA 1VEUA 1CQAA 3MXRA 2EX2A 4KQRA 1IFQA 1L0EA 2LB9A 2ZMAA 4B9OA 4DDYA 3CPTA 1ALQA 1L0GA 1ZC2A 1XX2A 3LICA 4E3IA 5DKLA 3M6BA 4BL3A 1MWSA 1YLYA 2Y2HA 4BBUA 1X0OA 5EOEA 4MLLA 1PI5A 3BFCA 4S2NC 4Y3IA 3PHYA 3T1QB 4MMNA 3UMEA 2MJ6A 4CLCA 2J8YA 3PAGA 3NBLA 4E3JA 1JNUA 3O5YA 3W4OA 3G4PA 2VA0A 4EUVA 5FATA 2VZWA 1LSWA 4KZ7A 3PBQA 4QPRA 3B42A 1Z6FA 2R9XA 4Q0JA 5EVEA 3M6HA 2XGNA 4DE1A 4OP5A 1W8YA 1EW0A 3LI9A 4PMAA 4JF5A 4JF4A 3HJIA 3OOVA 3NDGA 5EFWA 3F1PB 5HWVA 1NJ4A 3UB7A 4JBFA 4ESPA 4OVDA 3C5AA 1FCMA 3K2NA 3MBZA 4E3KA 1TDLA 1KGGA 3HVFA 5AVFA 1XFNA 4JKTA 1JVJA 3N8RA 2ZLYA 2O9CA 3T4KA 2V8CA 3IX4A 3S7NA 1S66L 2XDMA 4GD6A 3S7QA 1BLPA 3CG5A 5EOOA 5CTNA 1EI5A 2VK3A 2ZC6B 1IKIA 3BM6A 3VP1A 4ARZB 2L1MA 2PDRA 3UB5P 3H7WB 3EGXC 4CLCC 2WZZA 4R3JA 3ZGAB 2V0WA 2W1TA 2QPNA 3HLWA 2WKIA 2OLUA 1QMFA 4OOLA 2L4RA 3UE6A 4Z1WA 3G32A 1SDEA 4K0WA 5HW3A 3V50A 1N9BA 3VFFA 1TS0A 4X69A 1FCNA 3ITAA 1PWDA 4R0QA 5HPIA 3PTEA 1SCWA 1N9OA 5GHXA 1TS8A 4E6XA 2HP6A 2JKRI 1OTDA 3KYZA 5EE8A 3T4JA 1JTGA 3FYZA 5EV0A 3ZG7B 5BOHA 2QWSA 5G18A 5GLDA 3RJUA 2ZOIA 2QZ6A 4MNRA 1JTDA 1N9NA 1I5QA 5HD5A 3LI8A 1LI9A 3VP0A 2EXAA 3IXBA 4OQ0A 4PHTA 3ZDJA 3KX0X 2VLGA 3GQZA 1GHMA 1P97A 3SS5A 4OPZA 3BECA 3MF0A 2QYBA 2NUTC 4Y0TA 1GA9A 4BBVA 4O0PA 5JYOA 3ZVWA 3FWLA 2CC1A 3A0SA 5KMWA 2J9PA 4L0LA 1SKOB 3OPHA 3PBNA 2B95A 4JXVA 1VHMA 4EW7A 2V1AA 3NOPC 5TR7A 2A3UA 4HH3A 4Z9QA 4EU0A 1IEMA 3UE3A 4PM9A 1ES5A 3MFXA 2JKTM 3MQQA 4XUZA 3LFVA 5EECA 4DE0A 4II7A 3H7WA 1CEFA 2GNXA 4JGRA 3T50A 2JKGA 4S2MA 2V1BA 1CEGA 4WZ5A 4Y0UA 4R70A 5GLCA 3GVBA 4DJ2A 3IWOA 4E3LA 1XP4A 3VE4A 2WGIA 4B88A 5F82A 1F98A 4BLMA 2IWCA 1DJCA 4JXWA 1SKFA 4EEPA 4UEYA 5A91A 3EEHA 2PR6A 3E2KA 4QJGA 3LR4A 5FSRA
chains in the Genus database with same CATH topology
3V39A 4P85A 2X71A 1NXYA 3OZHA 4EQIA 2RL3A 4JXGA 1MWRA 3ZG8B 4KZ6A 4R4SA 4U0TA 1YMSA 2P9VB 1KGFA 3NY4A 4JLFA 1FOFA 3QNCA 1RGYA 2PU4A 4EV4A 1DJBA 5KZHA 4KZ5A 2H0YA 2HP9A 1EROA 3IT9A 3O88A 2Y59A 1W79A 2HDUA 1K54C 3IWQA 1K38A 3QHYA 4GOGA 1YMXA 2BLSA 1MBLA 3Q07A 2PBYA 1PWGA 5CHMA 3IHBA 3MXSA 3UDIA 5EUAA 2P74A 4N1HA 3M2JA 4RVAA 4D2OA 3HBRA 3OCLA 4DE2A 4A5RA 3ZNYA 4ID4A 1I2WA 2Q9NA 2J9OA 1NZUA 2Y2KA 3W8KA 4BENA 1KDWA 3BRMA 3UN7A 3LY4A 3MZDA 2XD5A 5FA7A 2HDQA 4RYEA 3RXWA 3VOZA 3S4XA 3BYDA 4RX3A 1GA0A 2JBFA 3SS4A 2HPBA 4YINA 4LV1A 4O7DA 4X56A 4H8RA 2WYXA 3UY6A 4C6YA 1TVFA 5GHZA 1K6RA 1XPBA 4PM5A 1EWZA 3FZCA 2WUQA 3QNBA 4RA7A 4BD0A 3P09A 3CMZA 4IVKA 4KZ3A 4E3OA 1G6AA 3UDXA 1MPLA 4E6WA 4ZTKA 1OMEA 4OLGA 3A3DA 1K57A 1IYQA 1PZOA 5A93A 3SH8A 4MBHA 4S2NA 1IYSA 3UE1A 5DVAA 1YLJA 1CI9A 4X68A 1I2SA 1KVMA 3BLMA 2XK1A 1FCOA 2QMIA 2RCXA 5D3OA 2FFFB 5M1AA 4Q8IA 3NC8A 3NI9A 5FQIA 2ZD8A 2ZM8A 5CERA 5I94A 3C4OA 4JF6A 2XEPA 3C7VA 4PM8A 4ZJ3A 3WRZA 1LHYA 5HAQA 1ZKJA 3W4QA 4X53A 4BL2A 1VQQA 5EVIC 3HLCA 5FAQA 2Q9MA 4ZBEA 3ZNTA 3G2YA 4B4ZA 4OQIA 4PM7A 4ZJ1A 3O87A 2R9WA 4XUXA 4EUZA 1JWPA 5CECA 3MFDA 1MKIA 2E8IA 4OQHA 2Y2QA 2Y4AA 5FAOA 2ZC3B 2Y2IA 5M18A 3MZFA 4HBUA 1ONHA 5AQ9A 5CGXA 1PIOA 4OPRA 2ZC5B 1J9MA 1L0DA 3S22A 3LY3A 3N8LA 5FQMA 2Z2MB 5IHVA 2C5WB 3HUOA 1L0FA 1ES3A 4RX2A 4DRTA 3TOIA 4KZAA 2XF3A 1PWCA 3OPLA 3WS0A 1TEMA 5KSCA 1QMEA 1BSGA 3NDEA 2A49A 3N8SA 1S6RA 5E2HA 3IXGA 4M3KA 2DRWA 3IF5A 1K56A 3MZEA 1ES2A 1W7FA 3SH9A 4QU3A 3NCKA 3Q1FA 5FAPA 2XLNA 4WYYA 3UE0A 3HLGA 4GD8A 1IYPA 1K56D 3OPPA 5F83A 3Q7VB 2WKEA 3VP2A 3UPOA 3HLFA 4UA6A 1HZOA 4FD8A 5HL1A 3EQUA 1RCJA 3UPPA 5AQAA 5DF7A 4OKPA 4QY6A 4C75A 2EXBA 3FKVA 1RP5A 1XXMA 1JWZA 1K4FA 1Y54A 5DF8A 5FI7A 3HUMA 3DTMA 4GN2A 3MXRA 2EX2A 2Y55A 1L0EA 3DWZA 4KQRA 2GDNA 3BFDA 3ZFZA 2ZJ9A 1FQGA 3IHAA 2V20A 2ZMAA 4ZAMA 5FASA 3PBOA 3TSGA 1U60A 4DDYA 5FDHA 2ZM0A 1ALQA 3A3JA 1XGIA 3Q7ZA 5HX9A 3WS5A 1L0GA 2XFTA 4N9KA 3GRJA 1E4DA 1ERMA 1ZC2A 2WGWB 2XD1A 4BD1A 1XX2A 2VGKA 4E3IA 4WZ4A 5EVIB 1LI0A 3M6BA 4BL3A 2IWDA 4MBKA 1H5XA 1MWSA 1YLYA 1ESIA 1K55A 2Y2HA 3I7JA 3VSLA 1MWTA 3WS2A 1IKGA 5EOEA 1K57C 4MLLA 1ZG6A 3N4IA 3HLBA 1VM1A 1IYOA 1FSWA 3IF6A 1PI5A 2WGVA 3BFCA 4X6TA 4S2NC 4P87A 5E2FA 4DDSA 4C3QA 4WM9A 4UAAA 4S2IA 1G68A 4IBXA 4QY5A 3IH8A 3MKFA 3MKEA 2V2FF 2HDRA 2J8YA 4QHCA 2VGJA 3PAGA 1BULA 3DWKA 5FQ9A 3G2ZA 1YLTA 2EX6A 3OCNA 1PW1A 4LV2A 3NBLA 1ZG4A 4N1XA 4E3JA 3W4OA 2UWXA 4KZ9A 3N7WA 2XQZA 3SS3A 3G4PA 4WBGA 5DTKA 4EWFA 5FATA 3N6IA 4QD4A 1S0WA 4KZ7A 4IEDA 3O86A 4OP8A 3PBQA 1XGJA 4GNUA 2WKHA 4R23A 4FCFA 4HEFA 1YQSA 4R1GA 1FR6A 1Z6FA 2R9XA 5E43A 4OH0A 1XA7A 1MXOA 3C7UA 3M6HA 3G35A 4UA7A 1BLSA 1LLBA 2OV5A 1SDNA 2Y2GA 3GMWA 3HL9A 4Y7PA 2XGNA 5F1GA 4WZ5C 3ZG5A 4DE1A 4OP5A 1W8YA 2JE5A 5CEDA 3G34A 3SOIA 4PMAA 1MY8A 1N4OA 3ISGA 4CJNA 4JF5A 4KG5A 4BJPA 4JF4A 2Y2MA 4OLDA 1XA1A 5L2FA 3NDGA 4EBPA 1E25A 5A90A 5E2GA 2ZQAA 5FQQA 4LV3A 5CRFA 1HVBA 3PAEA 1NJ4A 1K4EA 1NRFA 4E3MA 3VP4A 4JBFA 4LV0A 4OVDA 3C5AA 3V3SA 4EBLA 3Q82A 1K25A 1FCMA 1PW8A 1PZPA 1AXBA 4JPMA 1YLZA 3MBZA 4E3KA 2HDSA 4U0XA 1TDLA 1KGGA 2H5SA 3HVFA 1HTZA 5F1FA 4JKTA 3Q7VA 1JVJA 4BQMA 2X02A 4OQGA 5GLBA 1YM1A 3N8RA 3A3FA 3IXDA 2Y2OA 2ZLYA 3BFGA 3GR2A 2DCFA 4OOYA 4GDBA 3UPNA 4X55A 5CEBA 3E2LA 5GHYA 2XDMA 4GD6A 1BLPA 2WK0A 3GTCA 2OLVA 3CG5A 4S2PA 5CGSA 1WYCA 1K55C 5AQBA 3BFEA 3IWIA 4PM6A 5EOOA 3O3VA 5CTNA 4KQQA 4PPRA 1EI5A 4GDNA 2ZC6B 4S2OA 5M19A 1IKIA 5TFQA 1K6SA 3A3IA 3ZG9B 3BM6A 3VP1A 4F94A 3IF6C 1O7EA 3HUNA 5CHUA 5CTMA 3GSGA 4ZJ2A 3GV9A 3AGDA 2FFYA 2H10A 2ZC4B 4KZ8A 3UNWA 1YLWA 2WGWA 1PI4A 1NY0A 2C6WB 3OC2A 4KQOA 3CJMA 3A3EA 3P98A 3BEBA 2WZZA 4R3JA 5GLAA 2P9VA 3FKWA 4GZBA 5HAIA 1YT4A 4K0XA 3Q81A 3ZGAB 1FSYA 2ZQDA 3HREA 2QPNA 3HLWA 2WKIA 2OLUA 3D4FA 3DW0A 5E2EA 1KGEA 5DTTA 3FV7A 3OPRA 4UA9A 1QMFA 4OOLA 1KVLA 1NYMA 3M2KA 1ESUA 1H8ZA 4LENA 3G32A 1SDEA 5JYPA 1KE0A 4K0WA 1C3BA 3ZCZA 2BG1A 5HW3A 1BUEA 4UHUA 3V50A 1N9BA 1ERQA 4GB7A 1KE3A 4FH4A 3WS1A 3VFFA 4WEJA 2EFXA 2XH9A 4X69A 1FCNA 1Q2QA 3VSKA 3ITAA 2ZQ9A 1BZAA 1PWDA 4R0QA 1H8YA 4DF6A 1M40A 3PTEA 2PU2A 1SCWA 2XR0A 5GHXA 4OONA 4S2LA 4E6XA 2HP6A 3TG9A 2G2UA 4OPYA 2JCHA 5EE8A 2Z2LB 1JTGA 3FYZA 5HFOA 3IQAA 3UDFA 4FSFA 5J8XA 4R3BA 2ZC7A 4ZDXA 4DKIA 5HARA 1W5DA 2WZXA 3ZG7B 4CPKA 1GCEA 4Y0OA 4NETA 2JC7A 1YLPA 5BOHA 5HAPA 5G18A 5GLDA 4S2KA 5A92A 3RJUA 1BTLA 4HBTA 3ZG0A 4N92A 4OPQA 4QB8A 2QZ6A 4MNRA 2Y2LA 4DE3A 1JTDA 3W4PA 2ZQ7A 1I5QA 3IF6B 3NIAA 1Q2PA 5DF9A 4KG6A 1TDGA 3EQVA 1LI9A 3VP0A 2EXAA 2V1ZA 3IXBA 4OQ0A 3ZDJA 2EX9A 2X01A 3GQZA 1GHMA 3IXHA 4DXBA 1RGZA 3WS4A 1SHVA 1M6KA 2Y2NA 1E3UA 3SS5A 3C4PA 4DXCA 1FR1A 4K91A 4OPZA 3BECA 3V3RA 4XXRA 3LO7A 4YFMA 1DJAA 1E3UD 4FH2A 4N9LA 4Y0TA 2ZQ8A 1GA9A 1K54A 1L2SA 3PBSA 3PBRA 1JWVA 5FI2A 5JYOA 3ZVWA 3FWLA 2CC1A 4MBFA 2HP5A 5KMWA 2J9PA 3VP3A 4L0LA 4OOMA 3CZDA 1ES4A 3B3XA 3OPHA 3PBNA 4LCLA 4S2JA 4E3NA 4U3TA 1GHPA 4JXVA 2Y2PA 5EVLA 1ONGA 5CGWA 2OSUA 4P0MA 4WMCA 5TR7A 3VMAA 3UO9A 1WYBA 3JYIA 2EX8A 4KZBA 2A3UA 3PBTA 4KG2A 3G30A 1NYYA 4Z9QA 4EBNA 4WMCD 5DTSA 4R4RA 3LEZA 4NK3A 1IEMA 4KENB 3UE3A 3RXXA 4PM9A 1LL5A 1HD8A 1WE4A 2I72A 3WRTA 1ES5A 5KSHA 2H0TA 5CHJA 1LL9A 1W8QA 4LCMA 4IBRA 4XUZA 3AGEA 5EPHA 2XFSA 5EECA 3SH7A 4DE0A 4IVIA 4WELA 1KE4A 1XKZA 1PYYA 4GKUA 1DY6A 1CEFA 3WWXA 3BLSA 3ITBA 3BFFA 1BLCA 1NZOA 4S2MA 5FI6A 1CEGA 4WZ5A 4Y0UA 3G31A 4MEZA 5GLCA 3GVBA 3AGFA 2WADA 5FQKA 2DNSA 1CI8A 3IWOA 1BT5A 5AQ7A 2G2WA 4WEKA 3VOYA 1O07A 3HLDA 4E3LA 5EVIA 1XP4A 1BLHA 5TGFA 2Y2JA 2WGIA 5FQJA 4P6BA 4B88A 2EFUA 5F82A 1IELA 3LCEA 3VFHA 4BLMA 5EVID 2J7VA 2ZM2A 2IWCA 4HESA 1DJCA 4JXWA 2ZQCA 4JXSA 1SKFA 3ZVTA 1MWUA 3S1YA 3V5MA 4KZ4A 2WAEA 3HLEA 2WAFA 4B4XA 5A91A 3ZHHA 1GHIA 2Y91A 5GL9A 5CXWA 2IWBA 3E2KA 2B5RA 4QJGA 5U47A 1CK3A 3IH9A 5FSRA 1KDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V39 A;  4P85 A;  2X71 A;  1NXY A;  3OZH A;  4EQI A;  2RL3 A;  4JXG A;  1MWR A;  3ZG8 B;  4KZ6 A;  4R4S A;  4U0T A;  1YMS A;  2P9V B;  1KGF A;  3NY4 A;  4JLF A;  1FOF A;  3QNC A;  1RGY A;  2PU4 A;  4EV4 A;  1DJB A;  5KZH A;  4KZ5 A;  2H0Y A;  2HP9 A;  1ERO A;  3IT9 A;  3O88 A;  2Y59 A;  1W79 A;  2HDU A;  1K54 C;  3IWQ A;  1K38 A;  3QHY A;  4GOG A;  1YMX A;  2BLS A;  1MBL A;  3Q07 A;  2PBY A;  1PWG A;  5CHM A;  3IHB A;  3MXS A;  3UDI A;  5EUA A;  2P74 A;  4N1H A;  3M2J A;  4RVA A;  4D2O A;  3HBR A;  3OCL A;  4DE2 A;  4A5R A;  3ZNY A;  4ID4 A;  1I2W A;  2Q9N A;  2J9O A;  1NZU A;  2Y2K A;  3W8K A;  4BEN A;  1KDW A;  3BRM A;  3UN7 A;  3LY4 A;  3MZD A;  2XD5 A;  5FA7 A;  2HDQ A;  4RYE A;  3RXW A;  3VOZ A;  3S4X A;  3BYD A;  4RX3 A;  1GA0 A;  2JBF A;  3SS4 A;  2HPB A;  4YIN A;  4LV1 A;  4O7D A;  4X56 A;  4H8R A;  2WYX A;  3UY6 A;  4C6Y A;  1TVF A;  5GHZ A;  1K6R A;  1XPB A;  4PM5 A;  1EWZ A;  3FZC A;  2WUQ A;  3QNB A;  4RA7 A;  4BD0 A;  3P09 A;  3CMZ A;  4IVK A;  4KZ3 A;  4E3O A;  1G6A A;  3UDX A;  1MPL A;  4E6W A;  4ZTK A;  1OME A;  4OLG A;  3A3D A;  1K57 A;  1IYQ A;  1PZO A;  5A93 A;  3SH8 A;  4MBH A;  4S2N A;  1IYS A;  3UE1 A;  5DVA A;  1YLJ A;  1CI9 A;  4X68 A;  1I2S A;  1KVM A;  3BLM A;  2XK1 A;  1FCO A;  2QMI A;  2RCX A;  5D3O A;  2FFF B;  5M1A A;  4Q8I A;  3NC8 A;  3NI9 A;  5FQI A;  2ZD8 A;  2ZM8 A;  5CER A;  5I94 A;  3C4O A;  4JF6 A;  2XEP A;  3C7V A;  4PM8 A;  4ZJ3 A;  3WRZ A;  1LHY A;  5HAQ A;  1ZKJ A;  3W4Q A;  4X53 A;  4BL2 A;  1VQQ A;  5EVI C;  3HLC A;  5FAQ A;  2Q9M A;  4ZBE A;  3ZNT A;  3G2Y A;  4B4Z A;  4OQI A;  4PM7 A;  4ZJ1 A;  3O87 A;  2R9W A;  4XUX A;  4EUZ A;  1JWP A;  5CEC A;  3MFD A;  1MKI A;  2E8I A;  4OQH A;  2Y2Q A;  2Y4A A;  5FAO A;  2ZC3 B;  2Y2I A;  5M18 A;  3MZF A;  4HBU A;  1ONH A;  5AQ9 A;  5CGX A;  1PIO A;  4OPR A;  2ZC5 B;  1J9M A;  1L0D A;  3S22 A;  3LY3 A;  3N8L A;  5FQM A;  2Z2M B;  5IHV A;  2C5W B;  3HUO A;  1L0F A;  1ES3 A;  4RX2 A;  4DRT A;  3TOI A;  4KZA A;  2XF3 A;  1PWC A;  3OPL A;  3WS0 A;  1TEM A;  5KSC A;  1QME A;  1BSG A;  3NDE A;  2A49 A;  3N8S A;  1S6R A;  5E2H A;  3IXG A;  4M3K A;  2DRW A;  3IF5 A;  1K56 A;  3MZE A;  1ES2 A;  1W7F A;  3SH9 A;  4QU3 A;  3NCK A;  3Q1F A;  5FAP A;  2XLN A;  4WYY A;  3UE0 A;  3HLG A;  4GD8 A;  1IYP A;  1K56 D;  3OPP A;  5F83 A;  3Q7V B;  2WKE A;  3VP2 A;  3UPO A;  3HLF A;  4UA6 A;  1HZO A;  4FD8 A;  5HL1 A;  3EQU A;  1RCJ A;  3UPP A;  5AQA A;  5DF7 A;  4OKP A;  4QY6 A;  4C75 A;  2EXB A;  3FKV A;  1RP5 A;  1XXM A;  1JWZ A;  1K4F A;  1Y54 A;  5DF8 A;  5FI7 A;  3HUM A;  3DTM A;  4GN2 A;  3MXR A;  2EX2 A;  2Y55 A;  1L0E A;  3DWZ A;  4KQR A;  2GDN A;  3BFD A;  3ZFZ A;  2ZJ9 A;  1FQG A;  3IHA A;  2V20 A;  2ZMA A;  4ZAM A;  5FAS A;  3PBO A;  3TSG A;  1U60 A;  4DDY A;  5FDH A;  2ZM0 A;  1ALQ A;  3A3J A;  1XGI A;  3Q7Z A;  5HX9 A;  3WS5 A;  1L0G A;  2XFT A;  4N9K A;  3GRJ A;  1E4D A;  1ERM A;  1ZC2 A;  2WGW B;  2XD1 A;  4BD1 A;  1XX2 A;  2VGK A;  4E3I A;  4WZ4 A;  5EVI B;  1LI0 A;  3M6B A;  4BL3 A;  2IWD A;  4MBK A;  1H5X A;  1MWS A;  1YLY A;  1ESI A;  1K55 A;  2Y2H A;  3I7J A;  3VSL A;  1MWT A;  3WS2 A;  1IKG A;  5EOE A;  1K57 C;  4MLL A;  1ZG6 A;  3N4I A;  3HLB A;  1VM1 A;  1IYO A;  1FSW A;  3IF6 A;  1PI5 A;  2WGV A;  3BFC A;  4X6T A;  4S2N C;  4P87 A;  5E2F A;  4DDS A;  4C3Q A;  4WM9 A;  4UAA A;  4S2I A;  1G68 A;  4IBX A;  4QY5 A;  3IH8 A;  3MKF A;  3MKE A;  2V2F F;  2HDR A;  2J8Y A;  4QHC A;  2VGJ A;  3PAG A;  1BUL A;  3DWK A;  5FQ9 A;  3G2Z A;  1YLT A;  2EX6 A;  3OCN A;  1PW1 A;  4LV2 A;  3NBL A;  1ZG4 A;  4N1X A;  4E3J A;  3W4O A;  2UWX A;  4KZ9 A;  3N7W A;  2XQZ A;  3SS3 A;  3G4P A;  4WBG A;  5DTK A;  4EWF A;  5FAT A;  3N6I A;  4QD4 A;  1S0W A;  4KZ7 A;  4IED A;  3O86 A;  4OP8 A;  3PBQ A;  1XGJ A;  4GNU A;  2WKH A;  4R23 A;  4FCF A;  4HEF A;  1YQS A;  4R1G A;  1FR6 A;  1Z6F A;  2R9X A;  5E43 A;  4OH0 A;  1XA7 A;  1MXO A;  3C7U A;  3M6H A;  3G35 A;  4UA7 A;  1BLS A;  1LLB A;  2OV5 A;  1SDN A;  2Y2G A;  3GMW A;  3HL9 A;  4Y7P A;  2XGN A;  5F1G A;  4WZ5 C;  3ZG5 A;  4DE1 A;  4OP5 A;  1W8Y A;  2JE5 A;  5CED A;  3G34 A;  3SOI A;  4PMA A;  1MY8 A;  1N4O A;  3ISG A;  4CJN A;  4JF5 A;  4KG5 A;  4BJP A;  4JF4 A;  2Y2M A;  4OLD A;  1XA1 A;  5L2F A;  3NDG A;  4EBP A;  1E25 A;  5A90 A;  5E2G A;  2ZQA A;  5FQQ A;  4LV3 A;  5CRF A;  1HVB A;  3PAE A;  1NJ4 A;  1K4E A;  1NRF A;  4E3M A;  3VP4 A;  4JBF A;  4LV0 A;  4OVD A;  3C5A A;  3V3S A;  4EBL A;  3Q82 A;  1K25 A;  1FCM A;  1PW8 A;  1PZP A;  1AXB A;  4JPM A;  1YLZ A;  3MBZ A;  4E3K A;  2HDS A;  4U0X A;  1TDL A;  1KGG A;  2H5S A;  3HVF A;  1HTZ A;  5F1F A;  4JKT A;  3Q7V A;  1JVJ A;  4BQM A;  2X02 A;  4OQG A;  5GLB A;  1YM1 A;  3N8R A;  3A3F A;  3IXD A;  2Y2O A;  2ZLY A;  3BFG A;  3GR2 A;  2DCF A;  4OOY A;  4GDB A;  3UPN A;  4X55 A;  5CEB A;  3E2L A;  5GHY A;  2XDM A;  4GD6 A;  1BLP A;  2WK0 A;  3GTC A;  2OLV A;  3CG5 A;  4S2P A;  5CGS A;  1WYC A;  1K55 C;  5AQB A;  3BFE A;  3IWI A;  4PM6 A;  5EOO A;  3O3V A;  5CTN A;  4KQQ A;  4PPR A;  1EI5 A;  4GDN A;  2ZC6 B;  4S2O A;  5M19 A;  1IKI A;  5TFQ A;  1K6S A;  3A3I A;  3ZG9 B;  3BM6 A;  3VP1 A;  4F94 A;  3IF6 C;  1O7E A;  3HUN A;  5CHU A;  5CTM A;  3GSG A;  4ZJ2 A;  3GV9 A;  3AGD A;  2FFY A;  2H10 A;  2ZC4 B;  4KZ8 A;  3UNW A;  1YLW A;  2WGW A;  1PI4 A;  1NY0 A;  2C6W B;  3OC2 A;  4KQO A;  3CJM A;  3A3E A;  3P98 A;  3BEB A;  2WZZ A;  4R3J A;  5GLA A;  2P9V A;  3FKW A;  4GZB A;  5HAI A;  1YT4 A;  4K0X A;  3Q81 A;  3ZGA B;  1FSY A;  2ZQD A;  3HRE A;  2QPN A;  3HLW A;  2WKI A;  2OLU A;  3D4F A;  3DW0 A;  5E2E A;  1KGE A;  5DTT A;  3FV7 A;  3OPR A;  4UA9 A;  1QMF A;  4OOL A;  1KVL A;  1NYM A;  3M2K A;  1ESU A;  1H8Z A;  4LEN A;  3G32 A;  1SDE A;  5JYP A;  1KE0 A;  4K0W A;  1C3B A;  3ZCZ A;  2BG1 A;  5HW3 A;  1BUE A;  4UHU A;  3V50 A;  1N9B A;  1ERQ A;  4GB7 A;  1KE3 A;  4FH4 A;  3WS1 A;  3VFF A;  4WEJ A;  2EFX A;  2XH9 A;  4X69 A;  1FCN A;  1Q2Q A;  3VSK A;  3ITA A;  2ZQ9 A;  1BZA A;  1PWD A;  4R0Q A;  1H8Y A;  4DF6 A;  1M40 A;  3PTE A;  2PU2 A;  1SCW A;  2XR0 A;  5GHX A;  4OON A;  4S2L A;  4E6X A;  2HP6 A;  3TG9 A;  2G2U A;  4OPY A;  2JCH A;  5EE8 A;  2Z2L B;  1JTG A;  3FYZ A;  5HFO A;  3IQA A;  3UDF A;  4FSF A;  5J8X A;  4R3B A;  2ZC7 A;  4ZDX A;  4DKI A;  5HAR A;  1W5D A;  2WZX A;  3ZG7 B;  4CPK A;  1GCE A;  4Y0O A;  4NET A;  2JC7 A;  1YLP A;  5BOH A;  5HAP A;  5G18 A;  5GLD A;  4S2K A;  5A92 A;  3RJU A;  1BTL A;  4HBT A;  3ZG0 A;  4N92 A;  4OPQ A;  4QB8 A;  2QZ6 A;  4MNR A;  2Y2L A;  4DE3 A;  1JTD A;  3W4P A;  2ZQ7 A;  1I5Q A;  3IF6 B;  3NIA A;  1Q2P A;  5DF9 A;  4KG6 A;  1TDG A;  3EQV A;  1LI9 A;  3VP0 A;  2EXA A;  2V1Z A;  3IXB A;  4OQ0 A;  3ZDJ A;  2EX9 A;  2X01 A;  3GQZ A;  1GHM A;  3IXH A;  4DXB A;  1RGZ A;  3WS4 A;  1SHV A;  1M6K A;  2Y2N A;  1E3U A;  3SS5 A;  3C4P A;  4DXC A;  1FR1 A;  4K91 A;  4OPZ A;  3BEC A;  3V3R A;  4XXR A;  3LO7 A;  4YFM A;  1DJA A;  1E3U D;  4FH2 A;  4N9L A;  4Y0T A;  2ZQ8 A;  1GA9 A;  1K54 A;  1L2S A;  3PBS A;  3PBR A;  1JWV A;  5FI2 A;  5JYO A;  3ZVW A;  3FWL A;  2CC1 A;  4MBF A;  2HP5 A;  5KMW A;  2J9P A;  3VP3 A;  4L0L A;  4OOM A;  3CZD A;  1ES4 A;  3B3X A;  3OPH A;  3PBN A;  4LCL A;  4S2J A;  4E3N A;  4U3T A;  1GHP A;  4JXV A;  2Y2P A;  5EVL A;  1ONG A;  5CGW A;  2OSU A;  4P0M A;  4WMC A;  5TR7 A;  3VMA A;  3UO9 A;  1WYB A;  3JYI A;  2EX8 A;  4KZB A;  2A3U A;  3PBT A;  4KG2 A;  3G30 A;  1NYY A;  4Z9Q A;  4EBN A;  4WMC D;  5DTS A;  4R4R A;  3LEZ A;  4NK3 A;  1IEM A;  4KEN B;  3UE3 A;  3RXX A;  4PM9 A;  1LL5 A;  1HD8 A;  1WE4 A;  2I72 A;  3WRT A;  1ES5 A;  5KSH A;  2H0T A;  5CHJ A;  1LL9 A;  1W8Q A;  4LCM A;  4IBR A;  4XUZ A;  3AGE A;  5EPH A;  2XFS A;  5EEC A;  3SH7 A;  4DE0 A;  4IVI A;  4WEL A;  1KE4 A;  1XKZ A;  1PYY A;  4GKU A;  1DY6 A;  1CEF A;  3WWX A;  3BLS A;  3ITB A;  3BFF A;  1BLC A;  1NZO A;  4S2M A;  5FI6 A;  1CEG A;  4WZ5 A;  4Y0U A;  3G31 A;  4MEZ A;  5GLC A;  3GVB A;  3AGF A;  2WAD A;  5FQK A;  2DNS A;  1CI8 A;  3IWO A;  1BT5 A;  5AQ7 A;  2G2W A;  4WEK A;  3VOY A;  1O07 A;  3HLD A;  4E3L A;  5EVI A;  1XP4 A;  1BLH A;  5TGF A;  2Y2J A;  2WGI A;  5FQJ A;  4P6B A;  4B88 A;  2EFU A;  5F82 A;  1IEL A;  3LCE A;  3VFH A;  4BLM A;  5EVI D;  2J7V A;  2ZM2 A;  2IWC A;  4HES A;  1DJC A;  4JXW A;  2ZQC A;  4JXS A;  1SKF A;  3ZVT A;  1MWU A;  3S1Y A;  3V5M A;  4KZ4 A;  2WAE A;  3HLE A;  2WAF A;  4B4X A;  5A91 A;  3ZHH A;  1GHI A;  2Y91 A;  5GL9 A;  5CXW A;  2IWB A;  3E2K A;  2B5R A;  4QJG A;  5U47 A;  1CK3 A;  3IH9 A;  5FSR A;  1KDS A; 
#chains in the Genus database with same CATH topology
 3V39 A;  4P85 A;  2HJ9 C;  3CIT A;  4G3V A;  2W3D A;  3BJN A;  4I3I A;  4U0T A;  4HP9 A;  4HIA A;  4R38 A;  4P6Z M;  2HP9 A;  3IT9 A;  4I5S A;  1ACF A;  1W79 A;  3IWQ A;  4PKY G;  5HSQ A;  3UDI A;  4HY8 A;  4GS9 A;  2P74 A;  3OCL A;  4ID4 A;  2WKP A;  1OPX A;  3BRM A;  1T1C A;  2XD5 A;  4RYE A;  3BYD A;  3MQO A;  3E4P A;  3TJZ C;  4CLC D;  2BTF P;  4C6Y A;  2WYX A;  4WUJ A;  3P09 A;  3IS2 B;  5TBM A;  1MPL A;  4E6W A;  1S67 L;  1SZV A;  1OME A;  3A3D A;  1PZO A;  3KYE A;  3UE1 A;  4K08 A;  1KVM A;  3L9K A;  4Q8I A;  2FFF B;  5FQI A;  4H6J A;  5CER A;  4NEE D;  3C4O A;  4PM8 A;  4L9E A;  3W4Q A;  4X53 A;  4MDZ A;  3HLC A;  2Q9M A;  4ZBE A;  4OQI A;  3O87 A;  5CEC A;  3MFD A;  3UB8 A;  2OOL A;  2Y2I A;  5M18 A;  1S4R A;  2HZ5 A;  1J9M A;  3LY3 A;  3N8L A;  5IHV A;  1ES3 A;  4RX2 A;  1GSV A;  5FDS A;  1TEM A;  1QME A;  2FZ0 A;  4Q0H A;  2J80 A;  1S6R A;  2PT7 A;  3IXG A;  2DRW A;  1K56 A;  1ES2 A;  3NCK A;  4WYY A;  4YNR A;  1IYP A;  3OPP A;  3VP2 A;  3F1O A;  3HLF A;  3EQU A;  1GSW A;  1OJG A;  3U2A A;  2XRO A;  3UPP A;  2DMW A;  5DF7 A;  4C75 A;  1N9L A;  2QHK A;  1XXM A;  1JWZ A;  3BQ8 A;  3C2W A;  3DTM A;  3IBJ A;  4Y2F A;  2GDN A;  3ZFZ A;  1NLY A;  4ZAM A;  3IBR A;  5FDH A;  2ZM0 A;  5DJT A;  3A3J A;  3D72 A;  3WS5 A;  4BD1 A;  2VGK A;  3FG8 A;  4WZ4 A;  4MBK A;  1ESI A;  3I7J A;  5EM1 A;  1MWT A;  3WS2 A;  5J7E A;  1ZG6 A;  3N4I A;  1VM1 A;  5F69 A;  2Y79 A;  3R4K A;  4IUK A;  2Z6C A;  4P87 A;  5E2F A;  4WM9 A;  2M7V A;  4QY5 A;  3IH8 A;  3IS2 A;  2HDR A;  5IS1 A;  3G2Z A;  1YLT A;  4LV2 A;  1ZG4 A;  4N1X A;  4BBT A;  3SS3 A;  3KSH A;  5DTK A;  3NOU C;  4OP8 A;  1WA9 A;  2WKH A;  1LL8 A;  4FOF A;  4JGP A;  1FR6 A;  1V9Y A;  4OH0 A;  4RQ9 A;  2OAP 1;  4UA7 A;  1BLS A;  3HL9 A;  4Y7P A;  5G4Z A;  2JE5 A;  3H82 A;  4BJP A;  2Y2M A;  4EBP A;  1E25 A;  3KSF A;  5E2G A;  3IX8 A;  3PAE A;  2L0W A;  3T4O A;  2XRN A;  1K4E A;  1NRF A;  4E3M A;  2PD7 A;  3V3S A;  4EBL A;  4LRX C;  2EA9 A;  1AXB A;  4JPM A;  1YLZ A;  2HDS A;  2Z6D A;  4U0X A;  1ZHH B;  2X02 A;  2A2L A;  2HJE A;  4F3L B;  3BFG A;  3GR2 A;  2DCF A;  1CJF A;  2JN7 A;  2OWJ A;  3BQA A;  5CGS A;  3GTC A;  1G6O A;  4IUH A;  1WYC A;  1LT0 A;  3BFE A;  4PM6 A;  3LIE A;  4PPR A;  2A24 A;  4S2O A;  4NXG A;  5CTM A;  3AGD A;  2H10 A;  2HF6 A;  2ZC4 B;  3CLO A;  1H0M A;  3A0V A;  4KQO A;  2C6W B;  1XFQ A;  3DBA A;  5TJJ A;  3P98 A;  3BEB A;  3H9W A;  5HAI A;  2P9V A;  1Y28 A;  2B18 A;  1KGE A;  5DTT A;  1KVL A;  2QJ5 A;  5JYP A;  3ZCZ A;  2BG1 A;  1BUE A;  1KE3 A;  4WEJ A;  2V9A A;  2XH9 A;  1Q2Q A;  1HLU P;  3VSK A;  2W27 A;  4GHI A;  2OWH A;  1H8Y A;  4DF6 A;  1M40 A;  2XR0 A;  4S2L A;  3TG9 A;  2G2U A;  4KUO A;  1KOU A;  4HJ3 A;  3UDF A;  2ZC7 A;  3MR0 A;  5HAR A;  4Y0O A;  4XT2 B;  4GJ4 A;  3KO6 A;  4OPQ A;  4DE3 A;  2PD8 A;  5HWT A;  3IF6 B;  5J3W A;  1Q2P A;  4KG6 A;  2QKP A;  1A0K A;  4DXB A;  1RGZ A;  4AFI A;  1SHV A;  1M6K A;  4PAU A;  4UQI S;  4Y13 A;  4O8G A;  3DTI A;  4XXR A;  3LO7 A;  1E3U D;  4FH2 A;  1JWV A;  3VP3 A;  4R6L A;  5DJU A;  1ES4 A;  4U3T A;  4GW9 A;  2Y2P A;  3V67 A;  5CGW A;  2OSU A;  4WMC A;  3VMA A;  3EEA A;  3PBT A;  5AJG A;  2J3T D;  4MCW A;  5DTS A;  4NK3 A;  3DAV A;  1AWI A;  1LL5 A;  3MJQ A;  1WE4 A;  2I72 A;  3F1N B;  5G4Y A;  4G3K A;  2H0T A;  3ZQ5 A;  5CHJ A;  1LL9 A;  1W8Q A;  5MC7 A;  4IBR A;  4ZRR A;  2W0N A;  1XKZ A;  1PYY A;  1DY6 A;  3BLS A;  2O99 A;  3E98 A;  5AVE A;  3G31 A;  3NUL A;  4MEZ A;  2WAD A;  2DNS A;  3VOY A;  5L07 A;  1O07 A;  3HLD A;  1BLH A;  5TGF A;  2Y2J A;  5FQJ A;  1XJ3 A;  2XA7 M;  3LCE A;  5EVI D;  2VGL S;  1G5U A;  2ZQC A;  3V5M A;  4KZ4 A;  2WAE A;  3HLE A;  2WAF A;  2CMN A;  1VET B;  2ACG A;  1CK3 A;  3IH9 A;  2QJ7 A;  4YWZ A;  2R78 A;  2X71 A;  1XJ2 A;  4EEU A;  1NXY A;  3OZH A;  2RL3 A;  1FIK A;  3CAX A;  4KZ6 A;  1TS6 A;  3NY4 A;  4JLF A;  2H0Y A;  5HZH A;  1K38 A;  1PWG A;  5CHM A;  3MXS A;  1STZ A;  4N1H A;  4D2O A;  3HBR A;  4DE2 A;  4A5R A;  1I2W A;  2Q9N A;  1NZU A;  4BEN A;  4KQD A;  5FA7 A;  2HDQ A;  3VOZ A;  3S4X A;  4WN5 A;  3BY8 A;  1MZU A;  1GA0 A;  2JBF A;  2HPB A;  4LV1 A;  3F1P A;  4IVK A;  1D1J A;  3UDX A;  4YOF A;  1IYQ A;  3SH8 A;  2W3G A;  1IYS A;  3LR5 A;  4X68 A;  4BD0 A;  2XK1 A;  3NOT C;  5D3O A;  1FIL A;  2RCX A;  3NI9 A;  2ZM8 A;  5I94 A;  2XEP A;  1XJ6 A;  3C7V A;  3C30 A;  1VQQ A;  3HCY A;  1YSP A;  2JKT I;  3ZNT A;  3G2Y A;  4B4Z A;  2O9A A;  4ZJ1 A;  2R9W A;  4XUX A;  2H28 A;  4HH2 A;  1MKI A;  2Y2Q A;  2Y4A A;  3MZF A;  4ARZ A;  4HOI A;  5AQ9 A;  5CGX A;  4HNB A;  4DRT A;  3NDE A;  2PYR A;  4X1L A;  1P9R A;  1W7F A;  1S1Y A;  3Q1F A;  3A0R A;  4HHD A;  3T1S A;  3OLO A;  3UPO A;  4Y5F A;  3LUQ A;  5HL1 A;  2W3E A;  4OKP A;  1VET A;  3FKV A;  1RP5 A;  3LIF A;  3GDI A;  3BFD A;  4HQA A;  1FQG A;  3IHA A;  2V20 A;  5FAS A;  3PBO A;  1XGI A;  3Q7Z A;  3T4Q A;  2XFT A;  3QP6 A;  4KUK A;  2WGW B;  5EVI B;  2IWD A;  1IKG A;  2P08 A;  1H8M A;  1IYO A;  3LGO A;  3LR3 A;  4R3A A;  2WGV A;  5F68 A;  1IOU A;  4S2I A;  3E0Y A;  3MKF A;  3MKE A;  4QHC A;  2VGJ A;  3RFB A;  1BUL A;  3CWF A;  2VV8 A;  3BW6 A;  3N7W A;  1UWN X;  2XQZ A;  1OTI A;  4WBG A;  4LRZ E;  3EGD C;  3N6I A;  1SKO A;  3QP4 A;  4R23 A;  4FCF A;  1YQS A;  5E43 A;  1XA7 A;  1MXO A;  2OV5 A;  3G35 A;  1PRQ A;  1LLB A;  1SDN A;  5F1G A;  2K31 A;  4WZ5 C;  2PR5 A;  3G34 A;  3PYP A;  3UB9 A;  1MY8 A;  1N4O A;  2XSS A;  1XA1 A;  5L2F A;  4CLC E;  3LEQ A;  2ZQA A;  3K3D A;  5FQQ A;  5CRF A;  2EWV A;  1F9I A;  1K25 A;  1PW8 A;  3BY9 A;  1PZP A;  2ZBB A;  3QP1 A;  5F1F A;  3BWL A;  3HJK A;  4BQM A;  3C8C A;  1YM1 A;  3A3F A;  3UMD A;  5I5L A;  3E2L A;  5GHY A;  2OAQ 1;  2WK0 A;  2OLV A;  2JKF A;  3IWI A;  4KQQ A;  5M19 A;  5TFQ A;  1K6S A;  3ZG9 B;  4F94 A;  3CI6 A;  3EOI A;  1O7E A;  3GV9 A;  2KOI A;  4KZ8 A;  2FFY A;  1YLW A;  2WGW A;  1PI4 A;  1NY0 A;  4GZB A;  3FKW A;  1YT4 A;  4K0X A;  3Q81 A;  3D4F A;  3DW0 A;  5E2E A;  3FV7 A;  3OPR A;  4UA9 A;  4CQH A;  3M2K A;  3JPU A;  5IU1 A;  1C3B A;  1DRM A;  4UHU A;  3T4L A;  1ERQ A;  4GB7 A;  2P04 A;  1PNE A;  5L8M A;  3E4Q A;  2ZQ9 A;  2PU2 A;  5FL3 A;  2Z2L B;  5HFO A;  4FSF A;  3VV4 A;  5J8X A;  2WKR A;  4DKI A;  3LR0 A;  4NET A;  2JC7 A;  5HAP A;  4S2K A;  2PHY A;  5A92 A;  3ZG0 A;  4N92 A;  4QB8 A;  1OTE A;  2Y2L A;  3W4P A;  3G6O A;  3SZT A;  1TDG A;  2V1Z A;  3IXH A;  5HPF A;  4CLC B;  2Y2N A;  3C4P A;  4DXC A;  1YKD A;  1DJA A;  3P01 A;  4N9L A;  2ZQ8 A;  3PBR A;  1K54 A;  1L2S A;  3PBS A;  4BMW A;  5FI2 A;  1GSX A;  4MBF A;  4NXB A;  4OOM A;  3CZD A;  2VV7 A;  3VOL A;  4FTX A;  2D02 A;  1ONG A;  4KZB A;  4EBN A;  4R4R A;  3LEZ A;  1OT6 A;  1HD8 A;  3WRT A;  4M4X A;  3RTY A;  4NG2 A;  2EWW A;  4LCM A;  5EPH A;  4WEL A;  2G7U A;  3WWX A;  3ITB A;  1NZO A;  4LGW A;  3PR6 A;  2I9V A;  3AGF A;  1CI8 A;  1BT5 A;  5AQ7 A;  1ZTU A;  4IHQ A;  4P6B A;  1IEL A;  3VFH A;  3TE8 A;  2J7V A;  2K7S A;  4HES A;  4JXS A;  1MWU A;  3S1Y A;  3QP5 A;  4ETX A;  4L9G A;  3IX3 A;  2INW A;  1GHI A;  2Y91 A;  5GL9 A;  4ME4 A;  1K0K A;  2B5R A;  5U47 A;  4Y17 A;  3LIA A;  1OTB A;  4HJ4 A;  3B47 A;  3T12 B;  4EQI A;  4JXG A;  1MWR A;  3ZG8 B;  5HL6 A;  4R4S A;  1W63 M;  1KGF A;  1FOF A;  3QNC A;  1TD5 A;  2M7U A;  1RGY A;  1T19 A;  2PU4 A;  4X1M A;  2O0Y A;  2W1T B;  4EV4 A;  5KZH A;  1ERO A;  3O88 A;  3S7O A;  2Y59 A;  2HDU A;  1K54 C;  4GOG A;  1LSV A;  1MBL A;  4DMZ A;  3IHB A;  5CX7 A;  3W2Z A;  2J9O A;  2W1R A;  2Y2K A;  3W8K A;  3MXQ A;  1KDW A;  3MZD A;  2PAV P;  4RX3 A;  4YIN A;  1TVF A;  2V0U A;  1K6R A;  5GHZ A;  4PM5 A;  1EWZ A;  2WUQ A;  3QNB A;  2V8F A;  3JVV A;  5HDC A;  3C38 A;  4KZ3 A;  3T4T A;  1H3Q A;  3B33 A;  4ZTK A;  2FH5 A;  1K57 A;  3L7H A;  5A93 A;  2W3F A;  2KX6 A;  2WKQ A;  4MBH A;  1YLJ A;  1I2S A;  3BLM A;  3NC8 A;  5LBR A;  4JF6 A;  4F3L A;  4WL9 A;  4ZJ3 A;  1LHY A;  1ZKJ A;  1NLZ A;  3JVU A;  4PM7 A;  4EUZ A;  1JWP A;  2E8I A;  4OQH A;  5FAO A;  2ZC3 B;  3TRC A;  3K3C A;  4HBU A;  1ONH A;  4FUW A;  1VB6 A;  1PIO A;  5HD3 A;  2ZC5 B;  1L0D A;  3S22 A;  3LIB A;  5DFY A;  3HUO A;  1OTA A;  3TOI A;  4KZA A;  1D06 A;  5DFX A;  3N8S A;  4P6Z S;  3IF5 A;  3MZE A;  5FAP A;  3UE0 A;  3KSG A;  3HLG A;  3OBF A;  3FPV A;  4GD8 A;  3VE3 A;  1K56 D;  3Q7V B;  1HZO A;  1RCJ A;  2AVX A;  2P7J A;  4Q0I A;  5AQA A;  4QY6 A;  2EXB A;  3NEC A;  4BWI A;  1Y54 A;  1K4F A;  5DF8 A;  5FI7 A;  3HUM A;  4GN2 A;  2Y55 A;  3DWZ A;  2ZJ9 A;  3TSG A;  3FPW A;  1U60 A;  5HX9 A;  4E04 A;  4N9K A;  3GRJ A;  1E4D A;  1ERM A;  2XD1 A;  2VX8 A;  2VJW A;  4XT2 A;  1LI0 A;  4QWO A;  1H5X A;  1K55 A;  3VSL A;  1F5M A;  5K5B A;  4NXF A;  1K57 C;  2KLI A;  5DKK A;  3HLB A;  4PKY A;  2VKS A;  3D3O A;  1FSW A;  3LID A;  3IF6 A;  1T18 A;  2ZL1 B;  3E4O A;  4X6T A;  2PRF A;  4DDS A;  4C3Q A;  3CUE A;  1PFL A;  4UAA A;  2ZOH A;  1G68 A;  4IBX A;  5FQ9 A;  2V2F F;  3DWK A;  2EX6 A;  5HDS A;  3OCN A;  1PW1 A;  2YKF A;  2UWX A;  3GEC A;  4KZ9 A;  1YSQ A;  3KSI A;  2JKR M;  1BYW A;  4EWF A;  2B02 A;  1TF1 A;  3R7W B;  4QD4 A;  1S0W A;  4IED A;  3O86 A;  4GLQ A;  1XGJ A;  4GNU A;  4EES A;  4HEF A;  4GS9 B;  4MN6 A;  4R1G A;  4EER A;  3C7U A;  2Y2G A;  3GMW A;  3ZG5 A;  3F1N A;  3ZYT A;  1T1A A;  5CED A;  3SOI A;  2D01 A;  1W63 Q;  3ISG A;  4CJN A;  4KG5 A;  4OLD A;  5FEG A;  5A90 A;  1MKM A;  4DJ3 A;  4LV3 A;  5F5Y A;  1HVB A;  5TBM B;  3VP4 A;  4LV0 A;  2GZA A;  2M1C A;  3Q82 A;  3NJA A;  1NRJ A;  4NKP A;  5IT5 A;  2GJ3 A;  5FEF A;  2H5S A;  1HTZ A;  4GCZ A;  3Q7V A;  4H6J B;  4OQG A;  5GLB A;  3IXD A;  4IJG A;  2Y2O A;  4OOY A;  3UPN A;  4GDB A;  4X55 A;  3T4S A;  5CEB A;  2VEA A;  3EWK A;  4S2P A;  5AQB A;  1K55 C;  4HJ6 A;  1S1Z A;  2IA2 A;  3O3V A;  4GDN A;  4UQI M;  4ETZ A;  4D60 A;  3A3I A;  2W3H A;  3IF6 C;  2YKH A;  3HUN A;  5CHU A;  5HWW A;  3GSG A;  3CUE C;  4ZJ2 A;  3UNW A;  3OC2 A;  3CJM A;  3A3E A;  5GLA A;  5A8B A;  4NXE A;  4MN7 A;  3CHW P;  2BAS A;  1FSY A;  2ZQD A;  1Y4O A;  3HRE A;  3DTK A;  3MMH A;  4JGO A;  2ZL1 A;  4HI4 A;  1NYM A;  1ESU A;  2HGV A;  3F1O B;  1DP9 A;  1H8Z A;  3KYQ A;  4LEN A;  3MS6 A;  1KE0 A;  3TW8 A;  1J3W A;  4FH4 A;  3WS1 A;  2EFX A;  4WLA A;  1BZA A;  3MSH A;  1OJ5 A;  4OON A;  3R7W A;  2K2N A;  4OPY A;  2JCH A;  3IQA A;  1V9Z A;  2NUP C;  4R3B A;  4ZDX A;  1W5D A;  2WZX A;  4CPK A;  1GCE A;  4O01 A;  3SW1 A;  1YLP A;  1L3L A;  1BTL A;  4HBT A;  1P9W A;  4MN5 A;  4LPZ A;  2VGL M;  5HDD A;  3ULF A;  2ZQ7 A;  2GX5 A;  1OT9 A;  3NIA A;  5DF9 A;  4G3W A;  3EQV A;  2EX9 A;  2X01 A;  1YAX A;  3WS4 A;  1E3U A;  1FR1 A;  4K91 A;  3V3R A;  4YFM A;  4Y15 A;  3MQ0 A;  2HP5 A;  1ODV A;  4I38 A;  3B3X A;  4E3N A;  4S2J A;  4LCL A;  1GHP A;  5EVL A;  4P0M A;  3UO9 A;  1WYB A;  3JYI A;  2EX8 A;  4EET B;  4KG2 A;  3G30 A;  1NYY A;  4WMC D;  4KEN B;  3RXX A;  1D7E A;  5EM0 A;  5KSH A;  3H82 B;  3LYX A;  3AGE A;  2XFS A;  3SH7 A;  1S4S A;  4IVI A;  3U4L P;  1KE4 A;  4GKU A;  3P7N A;  3BFF A;  4B93 A;  1BLC A;  2JHE A;  4I3A A;  5FI6 A;  2LB5 A;  4WF0 A;  1Z09 A;  5FQK A;  1UWP X;  2G2W A;  4WEK A;  5EVI A;  2PBD P;  2EFU A;  3FC7 A;  3D9Y A;  2ZM2 A;  1XJ4 A;  5KIZ A;  3ZVT A;  4X25 A;  4B4X A;  3ZHH A;  2A24 B;  5CXW A;  2IWB A;  5L10 A;  5C5K A;  4LRY C;  1VEU B;  1KDS A;  2UV0 E;  1T1B A;  1YMS A;  1F2K A;  2P9V B;  3CPT B;  1DJB A;  4KZ5 A;  3QHY A;  1YMX A;  2BLS A;  3Q07 A;  2PBY A;  3UB6 A;  4DN0 A;  4HP4 A;  5EUA A;  1DP6 A;  3T1X A;  2ZMV A;  3M2J A;  4RVA A;  1DP8 A;  3ZNY A;  4EXO A;  3UN7 A;  3LY4 A;  5L09 A;  3RXW A;  2J3T C;  1CF0 A;  2Y8H A;  3SS4 A;  2KDK A;  2Q0O A;  4GHI B;  4O7D A;  4X56 A;  4H8R A;  3UY6 A;  1XPB A;  1TS7 A;  3FZC A;  4RA7 A;  3CMZ A;  1UGU A;  5J4E A;  4E3O A;  1G6A A;  4EQ1 A;  4OLG A;  1NWZ A;  4S2N A;  5DVA A;  1CI9 A;  5HAQ A;  1LSX A;  1FCO A;  2QMI A;  5M1A A;  2VV6 A;  4LFU A;  2O9B A;  4JGQ A;  2ZD8 A;  2XA7 S;  3WRZ A;  4LLO B;  4BL2 A;  3QP8 A;  2ZMF A;  5EVI C;  5FAQ A;  4I39 A;  3NHQ A;  3QP2 A;  3T1R A;  3DTE A;  3PXP A;  3RH8 B;  3ICY A;  2PYP A;  4OPR A;  1P0Z A;  5FQM A;  2Z2M B;  2C5W B;  1G28 A;  1L0F A;  2HV1 A;  2XF3 A;  1PWC A;  3OPL A;  3WS0 A;  5KSC A;  1BSG A;  4I3J A;  2J3W A;  2A49 A;  1YPR A;  5E2H A;  4M3K A;  3SH9 A;  4QU3 A;  3S7P A;  2XLN A;  5F6A A;  5F83 A;  2WKE A;  1MC0 A;  4UA6 A;  2E8J A;  4FD8 A;  4L9F A;  1VEU A;  1CQA A;  3MXR A;  2EX2 A;  4KQR A;  1IFQ A;  1L0E A;  2LB9 A;  2ZMA A;  4B9O A;  4DDY A;  3CPT A;  1ALQ A;  1L0G A;  1ZC2 A;  1XX2 A;  3LIC A;  4E3I A;  5DKL A;  3M6B A;  4BL3 A;  1MWS A;  1YLY A;  2Y2H A;  4BBU A;  1X0O A;  5EOE A;  4MLL A;  1PI5 A;  3BFC A;  4S2N C;  4Y3I A;  3PHY A;  3T1Q B;  4MMN A;  3UME A;  2MJ6 A;  4CLC A;  2J8Y A;  3PAG A;  3NBL A;  4E3J A;  1JNU A;  3O5Y A;  3W4O A;  3G4P A;  2VA0 A;  4EUV A;  5FAT A;  2VZW A;  1LSW A;  4KZ7 A;  3PBQ A;  4QPR A;  3B42 A;  1Z6F A;  2R9X A;  4Q0J A;  5EVE A;  3M6H A;  2XGN A;  4DE1 A;  4OP5 A;  1W8Y A;  1EW0 A;  3LI9 A;  4PMA A;  4JF5 A;  4JF4 A;  3HJI A;  3OOV A;  3NDG A;  5EFW A;  3F1P B;  5HWV A;  1NJ4 A;  3UB7 A;  4JBF A;  4ESP A;  4OVD A;  3C5A A;  1FCM A;  3K2N A;  3MBZ A;  4E3K A;  1TDL A;  1KGG A;  3HVF A;  5AVF A;  1XFN A;  4JKT A;  1JVJ A;  3N8R A;  2ZLY A;  2O9C A;  3T4K A;  2V8C A;  3IX4 A;  3S7N A;  1S66 L;  2XDM A;  4GD6 A;  3S7Q A;  1BLP A;  3CG5 A;  5EOO A;  5CTN A;  1EI5 A;  2VK3 A;  2ZC6 B;  1IKI A;  3BM6 A;  3VP1 A;  4ARZ B;  2L1M A;  2PDR A;  3UB5 P;  3H7W B;  3EGX C;  4CLC C;  2WZZ A;  4R3J A;  3ZGA B;  2V0W A;  2W1T A;  2QPN A;  3HLW A;  2WKI A;  2OLU A;  1QMF A;  4OOL A;  2L4R A;  3UE6 A;  4Z1W A;  3G32 A;  1SDE A;  4K0W A;  5HW3 A;  3V50 A;  1N9B A;  3VFF A;  1TS0 A;  4X69 A;  1FCN A;  3ITA A;  1PWD A;  4R0Q A;  5HPI A;  3PTE A;  1SCW A;  1N9O A;  5GHX A;  1TS8 A;  4E6X A;  2HP6 A;  2JKR I;  1OTD A;  3KYZ A;  5EE8 A;  3T4J A;  1JTG A;  3FYZ A;  5EV0 A;  3ZG7 B;  5BOH A;  2QWS A;  5G18 A;  5GLD A;  3RJU A;  2ZOI A;  2QZ6 A;  4MNR A;  1JTD A;  1N9N A;  1I5Q A;  5HD5 A;  3LI8 A;  1LI9 A;  3VP0 A;  2EXA A;  3IXB A;  4OQ0 A;  4PHT A;  3ZDJ A;  3KX0 X;  2VLG A;  3GQZ A;  1GHM A;  1P97 A;  3SS5 A;  4OPZ A;  3BEC A;  3MF0 A;  2QYB A;  2NUT C;  4Y0T A;  1GA9 A;  4BBV A;  4O0P A;  5JYO A;  3ZVW A;  3FWL A;  2CC1 A;  3A0S A;  5KMW A;  2J9P A;  4L0L A;  1SKO B;  3OPH A;  3PBN A;  2B95 A;  4JXV A;  1VHM A;  4EW7 A;  2V1A A;  3NOP C;  5TR7 A;  2A3U A;  4HH3 A;  4Z9Q A;  4EU0 A;  1IEM A;  3UE3 A;  4PM9 A;  1ES5 A;  3MFX A;  2JKT M;  3MQQ A;  4XUZ A;  3LFV A;  5EEC A;  4DE0 A;  4II7 A;  3H7W A;  1CEF A;  2GNX A;  4JGR A;  3T50 A;  2JKG A;  4S2M A;  2V1B A;  1CEG A;  4WZ5 A;  4Y0U A;  4R70 A;  5GLC A;  3GVB A;  4DJ2 A;  3IWO A;  4E3L A;  1XP4 A;  3VE4 A;  2WGI A;  4B88 A;  5F82 A;  1F98 A;  4BLM A;  2IWC A;  1DJC A;  4JXW A;  1SKF A;  4EEP A;  4UEY A;  5A91 A;  3EEH A;  2PR6 A;  3E2K A;  4QJG A;  3LR4 A;  5FSR A; 
#chains in the Genus database with same CATH homology
 3V39 A;  4P85 A;  2X71 A;  1NXY A;  3OZH A;  4EQI A;  2RL3 A;  4JXG A;  1MWR A;  3ZG8 B;  4KZ6 A;  4R4S A;  4U0T A;  1YMS A;  2P9V B;  1KGF A;  3NY4 A;  4JLF A;  1FOF A;  3QNC A;  1RGY A;  2PU4 A;  4EV4 A;  1DJB A;  5KZH A;  4KZ5 A;  2H0Y A;  2HP9 A;  1ERO A;  3IT9 A;  3O88 A;  2Y59 A;  1W79 A;  2HDU A;  1K54 C;  3IWQ A;  1K38 A;  3QHY A;  4GOG A;  1YMX A;  2BLS A;  1MBL A;  3Q07 A;  2PBY A;  1PWG A;  5CHM A;  3IHB A;  3MXS A;  3UDI A;  5EUA A;  2P74 A;  4N1H A;  3M2J A;  4RVA A;  4D2O A;  3HBR A;  3OCL A;  4DE2 A;  4A5R A;  3ZNY A;  4ID4 A;  1I2W A;  2Q9N A;  2J9O A;  1NZU A;  2Y2K A;  3W8K A;  4BEN A;  1KDW A;  3BRM A;  3UN7 A;  3LY4 A;  3MZD A;  2XD5 A;  5FA7 A;  2HDQ A;  4RYE A;  3RXW A;  3VOZ A;  3S4X A;  3BYD A;  4RX3 A;  1GA0 A;  2JBF A;  3SS4 A;  2HPB A;  4YIN A;  4LV1 A;  4O7D A;  4X56 A;  4H8R A;  2WYX A;  3UY6 A;  4C6Y A;  1TVF A;  5GHZ A;  1K6R A;  1XPB A;  4PM5 A;  1EWZ A;  3FZC A;  2WUQ A;  3QNB A;  4RA7 A;  4BD0 A;  3P09 A;  3CMZ A;  4IVK A;  4KZ3 A;  4E3O A;  1G6A A;  3UDX A;  1MPL A;  4E6W A;  4ZTK A;  1OME A;  4OLG A;  3A3D A;  1K57 A;  1IYQ A;  1PZO A;  5A93 A;  3SH8 A;  4MBH A;  4S2N A;  1IYS A;  3UE1 A;  5DVA A;  1YLJ A;  1CI9 A;  4X68 A;  1I2S A;  1KVM A;  3BLM A;  2XK1 A;  1FCO A;  2QMI A;  2RCX A;  5D3O A;  2FFF B;  5M1A A;  4Q8I A;  3NC8 A;  3NI9 A;  5FQI A;  2ZD8 A;  2ZM8 A;  5CER A;  5I94 A;  3C4O A;  4JF6 A;  2XEP A;  3C7V A;  4PM8 A;  4ZJ3 A;  3WRZ A;  1LHY A;  5HAQ A;  1ZKJ A;  3W4Q A;  4X53 A;  4BL2 A;  1VQQ A;  5EVI C;  3HLC A;  5FAQ A;  2Q9M A;  4ZBE A;  3ZNT A;  3G2Y A;  4B4Z A;  4OQI A;  4PM7 A;  4ZJ1 A;  3O87 A;  2R9W A;  4XUX A;  4EUZ A;  1JWP A;  5CEC A;  3MFD A;  1MKI A;  2E8I A;  4OQH A;  2Y2Q A;  2Y4A A;  5FAO A;  2ZC3 B;  2Y2I A;  5M18 A;  3MZF A;  4HBU A;  1ONH A;  5AQ9 A;  5CGX A;  1PIO A;  4OPR A;  2ZC5 B;  1J9M A;  1L0D A;  3S22 A;  3LY3 A;  3N8L A;  5FQM A;  2Z2M B;  5IHV A;  2C5W B;  3HUO A;  1L0F A;  1ES3 A;  4RX2 A;  4DRT A;  3TOI A;  4KZA A;  2XF3 A;  1PWC A;  3OPL A;  3WS0 A;  1TEM A;  5KSC A;  1QME A;  1BSG A;  3NDE A;  2A49 A;  3N8S A;  1S6R A;  5E2H A;  3IXG A;  4M3K A;  2DRW A;  3IF5 A;  1K56 A;  3MZE A;  1ES2 A;  1W7F A;  3SH9 A;  4QU3 A;  3NCK A;  3Q1F A;  5FAP A;  2XLN A;  4WYY A;  3UE0 A;  3HLG A;  4GD8 A;  1IYP A;  1K56 D;  3OPP A;  5F83 A;  3Q7V B;  2WKE A;  3VP2 A;  3UPO A;  3HLF A;  4UA6 A;  1HZO A;  4FD8 A;  5HL1 A;  3EQU A;  1RCJ A;  3UPP A;  5AQA A;  5DF7 A;  4OKP A;  4QY6 A;  4C75 A;  2EXB A;  3FKV A;  1RP5 A;  1XXM A;  1JWZ A;  1K4F A;  1Y54 A;  5DF8 A;  5FI7 A;  3HUM A;  3DTM A;  4GN2 A;  3MXR A;  2EX2 A;  2Y55 A;  1L0E A;  3DWZ A;  4KQR A;  2GDN A;  3BFD A;  3ZFZ A;  2ZJ9 A;  1FQG A;  3IHA A;  2V20 A;  2ZMA A;  4ZAM A;  5FAS A;  3PBO A;  3TSG A;  1U60 A;  4DDY A;  5FDH A;  2ZM0 A;  1ALQ A;  3A3J A;  1XGI A;  3Q7Z A;  5HX9 A;  3WS5 A;  1L0G A;  2XFT A;  4N9K A;  3GRJ A;  1E4D A;  1ERM A;  1ZC2 A;  2WGW B;  2XD1 A;  4BD1 A;  1XX2 A;  2VGK A;  4E3I A;  4WZ4 A;  5EVI B;  1LI0 A;  3M6B A;  4BL3 A;  2IWD A;  4MBK A;  1H5X A;  1MWS A;  1YLY A;  1ESI A;  1K55 A;  2Y2H A;  3I7J A;  3VSL A;  1MWT A;  3WS2 A;  1IKG A;  5EOE A;  1K57 C;  4MLL A;  1ZG6 A;  3N4I A;  3HLB A;  1VM1 A;  1IYO A;  1FSW A;  3IF6 A;  1PI5 A;  2WGV A;  3BFC A;  4X6T A;  4S2N C;  4P87 A;  5E2F A;  4DDS A;  4C3Q A;  4WM9 A;  4UAA A;  4S2I A;  1G68 A;  4IBX A;  4QY5 A;  3IH8 A;  3MKF A;  3MKE A;  2V2F F;  2HDR A;  2J8Y A;  4QHC A;  2VGJ A;  3PAG A;  1BUL A;  3DWK A;  5FQ9 A;  3G2Z A;  1YLT A;  2EX6 A;  3OCN A;  1PW1 A;  4LV2 A;  3NBL A;  1ZG4 A;  4N1X A;  4E3J A;  3W4O A;  2UWX A;  4KZ9 A;  3N7W A;  2XQZ A;  3SS3 A;  3G4P A;  4WBG A;  5DTK A;  4EWF A;  5FAT A;  3N6I A;  4QD4 A;  1S0W A;  4KZ7 A;  4IED A;  3O86 A;  4OP8 A;  3PBQ A;  1XGJ A;  4GNU A;  2WKH A;  4R23 A;  4FCF A;  4HEF A;  1YQS A;  4R1G A;  1FR6 A;  1Z6F A;  2R9X A;  5E43 A;  4OH0 A;  1XA7 A;  1MXO A;  3C7U A;  3M6H A;  3G35 A;  4UA7 A;  1BLS A;  1LLB A;  2OV5 A;  1SDN A;  2Y2G A;  3GMW A;  3HL9 A;  4Y7P A;  2XGN A;  5F1G A;  4WZ5 C;  3ZG5 A;  4DE1 A;  4OP5 A;  1W8Y A;  2JE5 A;  5CED A;  3G34 A;  3SOI A;  4PMA A;  1MY8 A;  1N4O A;  3ISG A;  4CJN A;  4JF5 A;  4KG5 A;  4BJP A;  4JF4 A;  2Y2M A;  4OLD A;  1XA1 A;  5L2F A;  3NDG A;  4EBP A;  1E25 A;  5A90 A;  5E2G A;  2ZQA A;  5FQQ A;  4LV3 A;  5CRF A;  1HVB A;  3PAE A;  1NJ4 A;  1K4E A;  1NRF A;  4E3M A;  3VP4 A;  4JBF A;  4LV0 A;  4OVD A;  3C5A A;  3V3S A;  4EBL A;  3Q82 A;  1K25 A;  1FCM A;  1PW8 A;  1PZP A;  1AXB A;  4JPM A;  1YLZ A;  3MBZ A;  4E3K A;  2HDS A;  4U0X A;  1TDL A;  1KGG A;  2H5S A;  3HVF A;  1HTZ A;  5F1F A;  4JKT A;  3Q7V A;  1JVJ A;  4BQM A;  2X02 A;  4OQG A;  5GLB A;  1YM1 A;  3N8R A;  3A3F A;  3IXD A;  2Y2O A;  2ZLY A;  3BFG A;  3GR2 A;  2DCF A;  4OOY A;  4GDB A;  3UPN A;  4X55 A;  5CEB A;  3E2L A;  5GHY A;  2XDM A;  4GD6 A;  1BLP A;  2WK0 A;  3GTC A;  2OLV A;  3CG5 A;  4S2P A;  5CGS A;  1WYC A;  1K55 C;  5AQB A;  3BFE A;  3IWI A;  4PM6 A;  5EOO A;  3O3V A;  5CTN A;  4KQQ A;  4PPR A;  1EI5 A;  4GDN A;  2ZC6 B;  4S2O A;  5M19 A;  1IKI A;  5TFQ A;  1K6S A;  3A3I A;  3ZG9 B;  3BM6 A;  3VP1 A;  4F94 A;  3IF6 C;  1O7E A;  3HUN A;  5CHU A;  5CTM A;  3GSG A;  4ZJ2 A;  3GV9 A;  3AGD A;  2FFY A;  2H10 A;  2ZC4 B;  4KZ8 A;  3UNW A;  1YLW A;  2WGW A;  1PI4 A;  1NY0 A;  2C6W B;  3OC2 A;  4KQO A;  3CJM A;  3A3E A;  3P98 A;  3BEB A;  2WZZ A;  4R3J A;  5GLA A;  2P9V A;  3FKW A;  4GZB A;  5HAI A;  1YT4 A;  4K0X A;  3Q81 A;  3ZGA B;  1FSY A;  2ZQD A;  3HRE A;  2QPN A;  3HLW A;  2WKI A;  2OLU A;  3D4F A;  3DW0 A;  5E2E A;  1KGE A;  5DTT A;  3FV7 A;  3OPR A;  4UA9 A;  1QMF A;  4OOL A;  1KVL A;  1NYM A;  3M2K A;  1ESU A;  1H8Z A;  4LEN A;  3G32 A;  1SDE A;  5JYP A;  1KE0 A;  4K0W A;  1C3B A;  3ZCZ A;  2BG1 A;  5HW3 A;  1BUE A;  4UHU A;  3V50 A;  1N9B A;  1ERQ A;  4GB7 A;  1KE3 A;  4FH4 A;  3WS1 A;  3VFF A;  4WEJ A;  2EFX A;  2XH9 A;  4X69 A;  1FCN A;  1Q2Q A;  3VSK A;  3ITA A;  2ZQ9 A;  1BZA A;  1PWD A;  4R0Q A;  1H8Y A;  4DF6 A;  1M40 A;  3PTE A;  2PU2 A;  1SCW A;  2XR0 A;  5GHX A;  4OON A;  4S2L A;  4E6X A;  2HP6 A;  3TG9 A;  2G2U A;  4OPY A;  2JCH A;  5EE8 A;  2Z2L B;  1JTG A;  3FYZ A;  5HFO A;  3IQA A;  3UDF A;  4FSF A;  5J8X A;  4R3B A;  2ZC7 A;  4ZDX A;  4DKI A;  5HAR A;  1W5D A;  2WZX A;  3ZG7 B;  4CPK A;  1GCE A;  4Y0O A;  4NET A;  2JC7 A;  1YLP A;  5BOH A;  5HAP A;  5G18 A;  5GLD A;  4S2K A;  5A92 A;  3RJU A;  1BTL A;  4HBT A;  3ZG0 A;  4N92 A;  4OPQ A;  4QB8 A;  2QZ6 A;  4MNR A;  2Y2L A;  4DE3 A;  1JTD A;  3W4P A;  2ZQ7 A;  1I5Q A;  3IF6 B;  3NIA A;  1Q2P A;  5DF9 A;  4KG6 A;  1TDG A;  3EQV A;  1LI9 A;  3VP0 A;  2EXA A;  2V1Z A;  3IXB A;  4OQ0 A;  3ZDJ A;  2EX9 A;  2X01 A;  3GQZ A;  1GHM A;  3IXH A;  4DXB A;  1RGZ A;  3WS4 A;  1SHV A;  1M6K A;  2Y2N A;  1E3U A;  3SS5 A;  3C4P A;  4DXC A;  1FR1 A;  4K91 A;  4OPZ A;  3BEC A;  3V3R A;  4XXR A;  3LO7 A;  4YFM A;  1DJA A;  1E3U D;  4FH2 A;  4N9L A;  4Y0T A;  2ZQ8 A;  1GA9 A;  1K54 A;  1L2S A;  3PBS A;  3PBR A;  1JWV A;  5FI2 A;  5JYO A;  3ZVW A;  3FWL A;  2CC1 A;  4MBF A;  2HP5 A;  5KMW A;  2J9P A;  3VP3 A;  4L0L A;  4OOM A;  3CZD A;  1ES4 A;  3B3X A;  3OPH A;  3PBN A;  4LCL A;  4S2J A;  4E3N A;  4U3T A;  1GHP A;  4JXV A;  2Y2P A;  5EVL A;  1ONG A;  5CGW A;  2OSU A;  4P0M A;  4WMC A;  5TR7 A;  3VMA A;  3UO9 A;  1WYB A;  3JYI A;  2EX8 A;  4KZB A;  2A3U A;  3PBT A;  4KG2 A;  3G30 A;  1NYY A;  4Z9Q A;  4EBN A;  4WMC D;  5DTS A;  4R4R A;  3LEZ A;  4NK3 A;  1IEM A;  4KEN B;  3UE3 A;  3RXX A;  4PM9 A;  1LL5 A;  1HD8 A;  1WE4 A;  2I72 A;  3WRT A;  1ES5 A;  5KSH A;  2H0T A;  5CHJ A;  1LL9 A;  1W8Q A;  4LCM A;  4IBR A;  4XUZ A;  3AGE A;  5EPH A;  2XFS A;  5EEC A;  3SH7 A;  4DE0 A;  4IVI A;  4WEL A;  1KE4 A;  1XKZ A;  1PYY A;  4GKU A;  1DY6 A;  1CEF A;  3WWX A;  3BLS A;  3ITB A;  3BFF A;  1BLC A;  1NZO A;  4S2M A;  5FI6 A;  1CEG A;  4WZ5 A;  4Y0U A;  3G31 A;  4MEZ A;  5GLC A;  3GVB A;  3AGF A;  2WAD A;  5FQK A;  2DNS A;  1CI8 A;  3IWO A;  1BT5 A;  5AQ7 A;  2G2W A;  4WEK A;  3VOY A;  1O07 A;  3HLD A;  4E3L A;  5EVI A;  1XP4 A;  1BLH A;  5TGF A;  2Y2J A;  2WGI A;  5FQJ A;  4P6B A;  4B88 A;  2EFU A;  5F82 A;  1IEL A;  3LCE A;  3VFH A;  4BLM A;  5EVI D;  2J7V A;  2ZM2 A;  2IWC A;  4HES A;  1DJC A;  4JXW A;  2ZQC A;  4JXS A;  1SKF A;  3ZVT A;  1MWU A;  3S1Y A;  3V5M A;  4KZ4 A;  2WAE A;  3HLE A;  2WAF A;  4B4X A;  5A91 A;  3ZHH A;  1GHI A;  2Y91 A;  5GL9 A;  5CXW A;  2IWB A;  3E2K A;  2B5R A;  4QJG A;  5U47 A;  1CK3 A;  3IH9 A;  5FSR A;  1KDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...