1XKZA

Crystal structure of the acylated beta-lactam sensor domain of blar1 from s. aureus
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
245
structure length
244
Chain Sequence
NYKKPLHNDYQILDKSKIFGSNSGSFVMYSMKKDKYYIYNEKESRKRYSPNSTYKIYLAMFGLDRHIINDENSRMSWNHKHYPFDAWNKEQDLNTAMQNSVNWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWMEDSLKISNLEQVIVFKNMMEQNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIVNGKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulatory protein blaR1
publication title X-ray crystal structure of the acylated beta-lactam sensor domain of BlaR1 from Staphylococcus aureus and the mechanism of receptor activation for signal transduction
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Signaling protein
total genus 81
structure length 244
sequence length 245
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1xkzA00
4KZ8A 5FQJA 4Z9QA 5GHZA 1IKGA 1TVFA 5D3OA 1LL9A 2ZMAA 3N8LA 1IELA 2ZQ8A 2ZQ9A 1ALQA 3HLGA 1LHYA 3UDFA 4FCFA 3RXWA 4OLGA 2XQZA 5CHUA 4NETA 1PI4A 1MBLA 5GHYA 4Y0TA 1YLZA 3N8SA 5G18A 5DVAA 2ZQCA 2EX6A 4WBGA 2XLNA 3CZDA 1LI0A 4S2NA 4XXRA 5CTNA 1XGJA 1YMXA 3G34A 5GL9A 1WYBA 5F82A 1I5QA 5TGFA 4IBRA 1KE0A 4JXGA 1DJCA 4O7DA 4PM7A 3SS4A 4KG5A 3W8KA 3VP2A 2FFFB 1LLBA 4OOLA 1FCMA 3FWLA 3ZVTA 5EOOA 1MKIA 1M6KA 4S2JA 4S2PA 4WEJA 3SOIA 2WGIA 5FQKA 4L0LA 4PM9A 1MPLA 2H0YA 2WK0A 1XA7A 3AGFA 5F1FA 4MNRA 1JWVA 3UE0A 1MWRA 1EROA 2XK1A 3SS3A 4A5RA 1ES2A 4PM6A 3FV7A 2ZC7A 5EVID 1ERQA 5FA7A 1YLTA 4BLMA 1RP5A 4C75A 1CI9A 3N8RA 1NY0A 4P0MA 3ZG5A 3GRJA 3IF6C 5FQ9A 3ZNYA 1W8QA 1TDLA 2XD1A 1YLWA 1GA9A 3OPPA 2Y2QA 5HFOA 4KZ5A 3NY4A 4IVIA 4OOMA 5DF8A 3Q7VB 4LV0A 2OV5A 4E3LA 5EVIA 2JE5A 4HBUA 4Y0UA 1YLJA 4JF5A 2ZQ7A 1IYOA 1JWPA 4MBKA 3IH9A 2R9WA 2WKIA 3N4IA 4LCMA 5AQBA 3O87A 4GZBA 4ZBEA 4ZDXA 1HZOA 2CC1A 3OCNA 2E8IA 1SDEA 3UDXA 1ES5A 2J8YA 3HLCA 4KZ3A 4U0XA 4X53A 4WYYA 2XGNA 1KDWA 5DF7A 4B4ZA 4NK3A 4GKUA 1PWDA 4E3JA 1OMEA 4ZAMA 4E3KA 1TEMA 3M6BA 1PI5A 3DWZA 1SDNA 3G35A 1W8YA 3MXSA 1PW1A 3BFDA 1YM1A 3GTCA 3LEZA 5FI2A 3ZG9B 4R3JA 2Y91A 1DJAA 3QHYA 2DCFA 3NCKA 3PBRA 3RXXA 3IXHA 2EX9A 1KVLA 1N9BA 2Y2IA 4DKIA 4DDYA 3S1YA 3ZNTA 1PIOA 4BQMA 1ONHA 4QHCA 1QMEA 3EQVA 4X68A 1BT5A 3VMAA 1CI8A 2RL3A 1EI5A 3VP1A 3HLDA 3M2JA 3UPPA 3VFHA 5DTKA 5I94A 4FSFA 3PBNA 2WGWA 4KG2A 3CG5A 5CRFA 3N6IA 4GOGA 3MZFA 2J9OA 3BEBA 3HUMA 4YINA 4KENB 1H8ZA 4M3KA 2XFTA 5CHMA 2HDRA 1ZC2A 2WKEA 2RCXA 2V2FF 4UA9A 3Q1FA 3UE1A 2WUQA 3MXRA 3PAEA 5HAQA 1ES4A 1FQGA 3JYIA 1YLPA 3RJUA 4LENA 4ZTKA 2Y2KA 5J8XA 1W79A 2PU2A 3C7UA 4KQQA 4B4XA 3HLEA 3SS5A 5A93A 4R4SA 3WS4A 3NBLA 2WYXA 3ISGA 1XP4A 1K6SA 3V3SA 5GLAA 3M2KA 3NDEA 1KGFA 2XH9A 5FI7A 1XKZA 3HUOA 5FAOA 1L0DA 3ZFZA 4EBNA 2P9VB 3MZDA 1NYMA 4GD6A 1JTGA 1BULA 4JBFA 5AQ7A 5IHVA 2OLUA 4P85A 1H8YA 4KZ6A 4OQHA 2Q9NA 2Y2MA 3BLSA 3VP4A 3A3EA 3WRZA 4BL2A 3G4PA 1JVJA 1PZPA 4S2LA 2P74A 1PWCA 1U60A 3HVFA 3WS0A 1SHVA 5EE8A 4UHUA 1K38A 5EVIC 1VM1A 4JKTA 4QB8A 5GLDA 2PU4A 3NDGA 1LI9A 2ZC4B 4MBHA 2JC7A 5E2HA 1NXYA 4S2KA 1YMSA 3MFDA 1BTLA 1SKFA 5E2GA 3V5MA 2H5SA 1EWZA 1MY8A 2XR0A 2EFUA 1ERMA 4OOYA 1MWSA 5E2FA 3AGDA 2HPBA 1PWGA 2ZM2A 3M6HA 4GNUA 3PBOA 4BL3A 4OQ0A 1CEFA 1GCEA 3IWIA 3O3VA 1W5DA 4KQOA 3MBZA 3PAGA 4KZBA 2WADA 5HAPA 1ES3A 1HVBA 3A3DA 3DWKA 3V39A 4S2MA 3C7VA 3ZG8B 3PTEA 3E2LA 3IT9A 5CECA 4IVKA 2JBFA 4OP8A 4ZJ2A 1MWTA 2ZC6B 4B88A 3GQZA 4E6WA 5M19A 4PMAA 2IWDA 1MWUA 1KVMA 5AQ9A 4X56A 3P09A 4OH0A 4QD4A 4CJNA 5EOEA 4BD0A 3FKVA 1CK3A 3HLWA 5TR7A 3CJMA 1I2SA 1FR6A 1IEMA 4DE0A 4EBLA 4S2OA 3C5AA 1K4EA 1S6RA 1XX2A 1K57C 3A3JA 3IF5A 3OC2A 2EXAA 5HX9A 3UE3A 3UPNA 2WZXA 1KGGA 1XA1A 4FH2A 1YQSA 1Q2PA 2GDNA 3HBRA 4JF4A 2Y2PA 3WS1A 4RX3A 2V1ZA 2VGKA 3LY3A 3Q7VA 5E43A 4C6YA 2WAEA 4H8RA 5KSHA 1SCWA 4X6TA 4E3MA 1ESUA 2V20A 2Y2HA 3WS5A 2HP6A 3G2YA 5EVLA 3VSKA 1GA0A 2WZZA 3HLFA 2G2WA 1K55C 3IXBA 5CGWA 5CXWA 3O88A 1KE3A 1NRFA 4WZ5A 1WE4A 3UDIA 1FSWA 4F94A 3Q7ZA 4KZ9A 3BM6A 1M40A 1BZAA 4EBPA 5A92A 3VP3A 3D4FA 1S0WA 3LCEA 4BD1A 1YLYA 3OCLA 3A3FA 2OLVA 3SH9A 3C4OA 4E3OA 1PW8A 1KDSA 4N1XA 4GB7A 5A91A 1BLSA 1PZOA 3HLBA 4KZ7A 3Q81A 4HESA 3OZHA 1FCNA 5F1GA 3WRTA 5A90A 4MEZA 1L2SA 1XXMA 4CPKA 3IF6B 3PBTA 4N1HA 4Y7PA 1TDGA 4LV3A 4Q8IA 1O7EA 4ZJ3A 2Y59A 3IHBA 2Y2NA 4QY6A 1K57A 4UA7A 2ZM8A 3PBSA 3TOIA 3VSLA 1ESIA 4OPZA 4Y0OA 4EV4A 4ID4A 2WGVA 4OVDA 1GHIA 5FDHA 3IWQA 4OLDA 2WKHA 4OPYA 3GVBA 5FASA 3C4PA 4N9KA 3UY6A 4DF6A 1RCJA 2XFSA 3ZGAB 1C3BA 1BLPA 3S22A 1PYYA 3B3XA 3OPHA 3AGEA 3V50A 3ZCZA 4EQIA 5CHJA 3ZVWA 4DE2A 3UPOA 3VFFA 3W4OA 3MZEA 4OPRA 4R0QA 4JF6A 4LV2A 3HREA 2J7VA 3UNWA 4DE3A 1LL5A 3Q82A 4XUXA 5FQIA 3QNBA 3S4XA 4PM5A 4EUZA 1L0FA 3OPRA 5EUAA 1I2WA 4GDNA 5L2FA 5JYPA 3BFGA 3DW0A 2EX8A 5FAPA 3G2ZA 4E3NA 2QMIA 2HP5A 5HARA 5CGSA 4XUZA 2P9VA 2VGJA 2XF3A 2EX2A 5HAIA 1AXBA 3ZG0A 4RX2A 2X02A 4E6XA 5FAQA 4HEFA 3ZDJA 3DTMA 4WM9A 4ZJ1A 4RA7A 5CERA 4BJPA 3GSGA 3NC8A 3VP0A 1NYYA 2J9PA 4C3QA 4DRTA 2ZJ9A 5GLCA 4EWFA 5CEDA 1E3UD 2QPNA 4JXSA 4RYEA 4WELA 2X71A 3MKFA 3WS2A 4GN2A 1KE4A 4LCLA 1GHMA 4GDBA 1K54C 5CGXA 2WAFA 2IWBA 2A49A 2B5RA 3CMZA 2ZQDA 4KZ4A 2HDQA 3IQAA 1E3UA 2ZM0A 5FQMA 4OQIA 3UO9A 2R9XA 2ZLYA 4R1GA 3BRMA 4WZ5C 5JYOA 4DE1A 1K56D 1IYSA 3TSGA 5M1AA 5FQQA 1WYCA 5KMWA 4D2OA 4PPRA 1G68A 1FR1A 1XGIA 2EFXA 3BECA 1MXOA 2C5WB 1W7FA 3QNCA 5FI6A 1ONGA 3O86A 4QY5A 4MBFA 1K56A 1K25A 3LO7A 2Y2OA 3GV9A 1ZG4A 3G31A 3HUNA 4N9LA 3BFCA 3GR2A 3I7JA 5E2EA 3ZHHA 5FATA 2ZQAA 4FH4A 4BENA 4K91A 3E2KA 2H0TA 1BLHA 1L0EA 2DRWA 3ITBA 2Y55A 5KSCA 3WWXA 4MLLA 1O07A 4QU3A 4X69A 4DXCA 2UWXA 1L0GA 5EVIB 1K4FA 4IBXA 1K55A 4R23A 3SH7A 2Y2JA 5FSRA 5BOHA 4OP5A 2G2UA 2XD5A 5M18A 5GLBA 1FOFA 1NZUA 2H10A 3HL9A 4KQRA 4OONA 4YFMA 3LY4A 4UA6A 1KGEA 1K54A 4OKPA 4X55A 2X01A 3A3IA 3UN7A 1XPBA 1IKIA 3MKEA 3V3RA 2BG1A 4HBTA 5CEBA 4GD8A 4K0WA 3BLMA 4IEDA 3N7WA 4U0TA 5AQAA 3ZG7B 2HDUA 2ZC5B 4WMCD 1JWZA 4LV1A 4U3TA 2XDMA 5KZHA 1HTZA 5EPHA 4DXBA 3IWOA 4N92A 5U47A 1FCOA 5DTSA 1CEGA 4KG6A 3W4PA 2FFYA 2HDSA 2ZC3B 1Y54A 1VQQA 3FYZA 4WMCA 4FD8A 2Z2LB 4WZ4A 4JXWA 5EECA 1GHPA 3EQUA 1DJBA 4OPQA 3OPLA 4P87A 1Z6FA 2QZ6A 2I72A 3P98A 3IHAA 1IYQA 4E3IA 3BYDA 2WGWB 1BLCA 4KZAA 2EXBA 2XEPA 2HP9A 5TFQA 2OSUA 1ZKJA 2JCHA 3TG9A 1QMFA 3IXGA 4QJGA 2DNSA 3GMWA 2A3UA 1E4DA 3IF6A 1RGYA 1HD8A 2PBYA 1JTDA 3BFEA 3VOZA 1YT4A 4OQGA 5DF9A 1FSYA 1BSGA 1NZOA 4S2IA 4K0XA 1BUEA 2C6WB 3VOYA 4S2NC 1N4OA 3IXDA 1H5XA 2Z2MB 3FKWA 4WEKA 2Y4AA 1ZG6A 1DY6A 3ITAA 5F83A 3PBQA 1E25A 4UAAA 5CTMA 4R3BA 1K6RA 4R4RA 3Q07A 4DDSA 2BLSA 3NIAA 4RVAA 1RGZA 3W4QA 5HL1A 4P6BA 2ZD8A 2Q9MA 2Y2GA 5HW3A 1J9MA 4JXVA 5GHXA 3SH8A 3FZCA 1IYPA 3BFFA 1NJ4A 3G32A 3G30A 3NI9A 4JPMA 5DTTA 2IWCA 4JLFA 2Y2LA 1G6AA 3IH8A 1Q2QA 4PM8A
chains in the Genus database with same CATH superfamily
4Z9QA 1IKGA 2ZQ8A 3HLGA 3UDFA 4NG2A 4OLGA 5CHUA 4NETA 1DP6A 5GHYA 1UGUA 2LB9A 2ZQCA 2EX6A 4WBGA 4CLCB 5F82A 1DJCA 1ODVA 4KG5A 1J3WA 3TW8A 3W8KA 2Y79A 1LLBA 5EOOA 1OJGA 2L0WA 4PM9A 4HY8A 1MPLA 3AGFA 4MNRA 3UE0A 1ES2A 3FV7A 5EM0A 3ZG5A 3IF6C 3OOVA 1YLWA 1GA9A 2Y2QA 3FG8A 5HFOA 2VV8A 2OOLA 4IVIA 2OV5A 2PD8A 4HBUA 4JF5A 1IYOA 4MBKA 2R9WA 3N4IA 4ZBEA 1HZOA 3H82B 3HLCA 3JVVA 4X53A 1IFQA 4NK3A 1PWDA 4ZAMA 3M6BA 3NOTC 3G35A 5HWVA 1W8YA 5HPFA 5FI2A 3IX3A 4GS9B 2INWA 3PBRA 3EOIA 3E4PA 2EX9A 4DDYA 3ZNTA 1ONHA 2RL3A 5F6AA 5I94A 4KG2A 3N6IA 4GOGA 2J9OA 3D9YA 1XJ4A 3Q1FA 5HAQA 1ES4A 3JYIA 4ZTKA 2Y2KA 4B4XA 4JGQA 5A93A 2JHEA 2JKFA 2WYXA 3ISGA 3M2KA 4YWZA 3UB8A 3MZDA 1NYMA 4GD6A 1TS7A 4KZ6A 3CPTB 2QYBA 5EFWA 3G4PA 1PZPA 2P74A 1U60A 1MZUA 2PT7A 2OAP1 1Y28A 4UHUA 1K38A 3A0RA 2ZC4B 4S2KA 3RFBA 1YMSA 2M7UA 5E2GA 2NUPC 4FTXA 1T18A 1MWSA 4L9GA 4CLCE 1PWGA 1IOUA 1CEFA 2UV0E 3T4LA 3S7QA 4KZBA 3KYQA 1HVBA 3HJIA 1S4RA 3T1XA 2M7VA 3IT9A 2JBFA 5HL6A 4ZJ2A 4HI4A 4B88A 2IWDA 4DN0A 5EVEA 5EOEA 5A8BA 2ZMFA 4EUVA 1CK3A 4EBLA 5TBMA 5IU1A 1LT0A 1KGGA 1YQSA 1Q2PA 2EWWA 3HBRA 4F3LA 5E43A 4E3MA 2HP6A 2PYRA 4ETZA 3G2YA 2WZZA 2O99A 3O88A 1SKOA 3H7WA 3F1OA 1FSWA 1VETB 3LI9A 2IA2A 2QHKA 3BM6A 3CHWP 4KZ9A 4MMNA 5A92A 1BZAA 3VP3A 4BMWA 3HJKA 1CJFA 3HLBA 1GSXA 4KZ7A 3MQQA 1PNEA 4EXOA 1O7EA 4HQAA 3P7NA 5HSQA 1OTBA 2ZM8A 2W3EA 3S7OA 1XJ6A 2EWVA 2WGVA 4OLDA 3GVBA 5FASA 5LBRA 2XFSA 3V67A 3ZGAB 3S22A 1PYYA 4LRZE 2HJ9C 4DE2A 3LIBA 3IX4A 1ZHHB 4R0QA 3BY9A 5FQIA 5EUAA 3IBRA 2J3TC 1OPXA 2XF3A 3ZG0A 5FAQA 3QP8A 3NOPC 3CAXA 3DTMA 4HEFA 4WM9A 4BJPA 4C3QA 2JKTM 1T19A 4JXSA 3MKFA 4GN2A 1KE4A 4GDBA 3FC7A 2LB5A 3K3CA 2WAFA 3FPWA 2IWBA 4KZ4A 1W63Q 4Y2FA 5DFYA 2HDQA 1F98A 3KSFA 3IQAA 5FQMA 2ZLYA 2PD7A 2EA9A 3MS6A 4DE1A 1IYSA 5KMWA 1G68A 1FR1A 2J3TD 2C5WB 4KQDA 1VEUA 5FI6A 2CMNA 4QY5A 4MBFA 1K56A 3ZHHA 2ZQAA 2PR5A 5DJUA 4K91A 2Y55A 2V1AA 1L0GA 5EVIB 3T1SA 1K55A 3CUEA 5FSRA 2G2UA 1FOFA 1NZUA 2DMWA 5AVFA 1DP9A 1KGEA 1K54A 4X55A 2X01A 3B33A 1H0MA 4JGPA 1ZTUA 4K0WA 5CEBA 3BLMA 4U0TA 2XRNA 1NLZA 2BTFP 4LV1A 4U3TA 2XDMA 1YPRA 5EPHA 3EEHA 1FCOA 2VEAA 2KLIA 3L9KA 3MQ0A 4WMCA 5HDCA 3EGDC 1GHPA 3EQUA 1DJBA 4ESPA 3OPLA 2I72A 3P98A 2OWJA 4UQIS 1PFLA 2OSUA 5IT5A 2DNSA 1FILA 1HD8A 2PBYA 2V8FA 3BFEA 3G6OA 4S2IA 1WA9A 3CLOA 2C6WB 4WEKA 4S2NC 2B18A 3FKWA 2ZOHA 1ZG6A 1DY6A 1OJ5A 3B47A 4XT2B 3IX8A 2ACGA 2BLSA 3NIAA 5HWTA 4R38A 2ZL1B 4JGOA 4ARZB 5GHXA 3SH8A 3VV4A 4Y17A 3G32A 4JPMA 3G30A 5DTTA 4EQ1A 1S1YA 1G6AA 4GHIA 1K55C 3CUEC 1Q2QA 5GHZA 1TVFA 1LL9A 2ZQ9A 3RXWA 1MBLA 5DVAA 2QJ5A 3CZDA 1LI0A 1S66L 3G34A 1I5QA 5TGFA 4PM7A 4JXGA 3FWLA 1W63M 1M6KA 4S2JA 4S2PA 4WEJA 2WGIA 4LPZA 4O8GA 5FQKA 2FZ0A 3S7NA 3MSHA 1XA7A 1JWVA 1MWRA 2XK1A 3SS3A 4A5RA 4PM6A 5EVID 4BLMA 4C75A 2AVXA 3N8RA 1NY0A 3QP6A 4P0MA 5FQ9A 1W8QA 1TDLA 4KZ5A 3Q7VB 2YKHA 4Y0UA 1YLJA 3IH9A 4LCMA 4LRYC 3LIAA 3F1PA 1SDEA 1ES5A 2J8YA 3F1NA 1TS0A 4KZ3A 4GKUA 2HF6A 1OMEA 4E3JA 4WL9A 4E3KA 5J7EA 1PI5A 4DJ3A 3MXSA 1YM1A 5HD5A 3LEZA 3UE6A 4R3JA 3QHYA 3NCKA 4MN5A 3T4TA 1PIOA 4QHCA 3VP1A 3M2JA 5DTKA 2WGWA 3PYPA 3CG5A 4H6JB 4KENB 2HDRA 2WKEA 2RCXA 2V2FF 1FIKA 3UE1A 3MXRA 3RJUA 1OTEA 5J8XA 2PU2A 3HLEA 3SS5A 3LR0A 3A0SA 1K6SA 1KGFA 2M1CA 3KX0X 5FI7A 1XKZA 3SW1A 1L0DA 4ME4A 3ZFZA 4EBNA 3LIFA 4Q0IA 1KOUA 3EWKA 1JTGA 1P9RA 2JKRI 5AQ7A 1H8YA 3VP4A 2Q9NA 2Y2MA 3BLSA 3WRZA 3A3EA 4HJ3A 2OAQ1 1D1JA 5EE8A 2A24A 3UB5P 3NDGA 4Q0HA 1XJ3A 1T1CA 3MFDA 1BTLA 1D06A 2J80A 1EWZA 2XR0A 1ERMA 5E2FA 3AGDA 2HPBA 1LSXA 2PRFA 4EU0A 3M6HA 3PBOA 4BL3A 1LL8A 1GCEA 2R78A 4I38A 3PAGA 4M4XA 4LFUA 3DWKA 3V39A 3KSHA 3ZG8B 3PR6A 4BWIA 3T4QA 1MWUA 3P09A 1N9OA 4O0PA 3HLWA 5TR7A 3NECA 1IEMA 1K4EA 3LR3A 3IF5A 3KYZA 4HP9A 3UE3A 2GDNA 3WS1A 4JF4A 2Y2PA 3LY3A 2GNXA 3DTKA 1SCWA 4X6TA 1ESUA 3WS5A 5KIZA 3HLFA 3IXBA 4B93A 1KE3A 1WE4A 3UDIA 1BYWA 1OTIA 3Q7ZA 2D01A 5HZHA 3OCLA 3SH9A 4E3OA 1PW8A 1PZOA 5K5BA 4GS9A 4IJGA 3EEAA 3WRTA 1FCNA 1L2SA 1XXMA 1X0OA 4N1HA 4LV3A 4Q8IA 4ZJ3A 2Y59A 3T4JA 1YSPA 2BASA 2XA7S 4OVDA 1GHIA 3IWQA 4OPYA 4DF6A 3C2WA 1RCJA 1C3BA 3V50A 3B3XA 3OPHA 3AGEA 4EQIA 4CLCC 3O5YA 1UWNX 4QWOA 3W4OA 3LGOA 1MKMA 1P9WA 3HREA 4DE3A 1LL5A 3S4XA 4EUZA 1OT9A 3LICA 5L2FA 1GSVA 2EX8A 2HJEA 4E3NA 2QMIA 5CGSA 2O9AA 5HAIA 5L07A 3C38A 4RA7A 3CPTA 1TD5A 3IS2B 3NC8A 1NYYA 1G28A 5CEDA 3DTEA 1E3UD 2QPNA 2X71A 4CLCD 4LCLA 5CGXA 2A49A 2ZM0A 2V8CA 5DKKA 3TSGA 5FQQA 1D7EA 1K25A 3G31A 3HUNA 3BFCA 4GCZA 1SZVA 2ZOIA 4EW7A 4BENA 2WKQA 3E2KA 2H0TA 2DRWA 5KSCA 3DAVA 2I9VA 1O07A 4WUJA 4DXCA 1K4FA 4IBXA 4R23A 2QJ7A 2XD5A 4NEED 3HL9A 3LY4A 3T50A 1S4SA 3UN7A 1IKIA 3MKEA 4GD8A 4IEDA 2P7JA 2HDUA 2ZC5B 4L9EA 3BY8A 3P01A 3OBFA 5DKLA 5KZHA 3JVUA 4N92A 1SKOB 5U47A 5DTSA 3W4PA 4DXBA 4KG6A 2ZC3B 3MMHA 5TJJA 4FD8A 1VETA 3KSIA 3LR5A 4I3AA 3T1RA 3IHAA 1IYQA 2EXBA 1ACFA 2HP9A 2KOIA 1ZKJA 2OWHA 2MJ6A 4BBVA 2A3UA 5FEGA 3VOZA 1TF1A 5DF9A 1BSGA 3TE8A 3VOYA 1N4OA 1H5XA 4WLAA 3TRCA 3D3OA 2VK3A 1IYPA 5I5LA 2IWCA 4PM8A 5D3OA 1HLUP 2ZMAA 2KDKA 1ALQA 1LHYA 1STZA 4FCFA 3BQAA 4Y15A 2XLNA 4S2NA 4XXRA 1XGJA 1YMXA 5GL9A 3UMDA 3LIEA 1KE0A 3SS4A 1OTDA 2FFFB 1FCMA 4E04A 3ZVTA 1MKIA 3SOIA 5J4EA 3K2NA 4EEUA 3NULA 2WK0A 2Q0OA 4D60A 5F1FA 3MXQA 5FA7A 1YLTA 1RP5A 3A0VA 4HJ4A 3GRJA 3LI8A 2XD1A 2VZWA 2WKPA 2GJ3A 4P6ZM 4OOMA 5CX7A 1EW0A 4LV0A 4E3LA 5EVIA 2JE5A 2Z6DA 2ZQ7A 2KX6A 1JWPA 3PHYA 4ZDXA 3O87A 4GZBA 2L4RA 2E8IA 3UDXA 5DF7A 4B4ZA 2W27A 4HH3A 1SDNA 1PW1A 3ZG9B 2Y91A 1DJAA 2VGLM 4IUKA 3RXXA 3IXHA 1KVLA 1N9BA 4BQMA 3EQVA 1BT5A 1CI8A 4R70A 3LIDA 2B95A 3UPPA 3VFHA 2K31A 4FSFA 3PBNA 3MZFA 3BEBA 3T12B 1N9LA 3VOLA 4I39A 2XFTA 3DTIA 1FQGA 4UEYA 4LENA 4R4SA 3NBLA 1XP4A 3V3SA 4FUWA 5GLAA 3NDEA 2XH9A 4XT2A 2P9VB 3PXPA 2ZL1A 4JBFA 5IHVA 4OQHA 4ARZA 4Y5FA 1SHVA 2V0UA 5EVIC 1VM1A 4JKTA 4QB8A 2PU4A 1LI9A 2W1TB 5FDSA 3LUQA 3UB9A 3V5MA 2H5SA 1MY8A 3H9WA 2E8JA 4GNUA 3O3VA 3KSGA 4KQOA 2WADA 2V9AA 1G5UA 4G3VA 4JGRA 1ES3A 4S2MA 4EESA 1NWZA 3E2LA 5MC7A 1MWTA 2ZC6B 4E6WA 4PMAA 1KVMA 1S67L 4X56A 3HCYA 4QD4A 4X1MA 4WF0A 4WN5A 1I2SA 1FR6A 4IHQA 1XFNA 3C5AA 1K57C 3T1QB 3UPNA 2WZXA 4FH2A 2O9BA 5AJGA 2B02A 4RX3A 2V1ZA 2VGKA 3Q7VA 1MC0A 1LSVA 2WAEA 3U2AA 4HNBA 2V20A 2Y2HA 5EVLA 5HDSA 3VSKA 2G2WA 5CGWA 4WZ5A 4F94A 4EBPA 3D4FA 4BD1A 4I3JA 3A3FA 3C4OA 4GB7A 5EM1A 3Q81A 5F1GA 4CPKA 1V9ZA 3NOUC 3IF6B 3PBTA 4Y7PA 1TDGA 3BW6A 2Y2NA 3PBSA 2HGVA 1ESIA 4Y0OA 4EV4A 5FDHA 2WKHA 3C4PA 3UY6A 4H6JA 1BLPA 2PR6A 3ZCZA 3R7WB 2H28A 3VFFA 3TJZC 3MZEA 4LV2A 2W3GA 4PKYG 3UNWA 3LFVA 3Q82A 1L0FA 3JPUA 1I2WA 4GDNA 5JYPA 3L7HA 5C5KA 2HP5A 4XUZA 1YKDA 1AXBA 3ULFA 4HHDA 4E6XA 5L10A 5CERA 3OLOA 4ZJ1A 3GSGA 3VP0A 4DRTA 2ZJ9A 4EWFA 4RYEA 4NXFA 2Z6CA 2B5RA 3CMZA 2ZQDA 4PAUA 1E3UA 4I3IA 3UO9A 2R9XA 4CLCA 3C8CA 3BRMA 4WZ5C 1WYCA 4D2OA 4PPRA 3BECA 1W7FA 3QNCA 3B42A 2Y2OA 1ZG4A 2Y8HA 5F5YA 3I7JA 2VV6A 5E2EA 5FATA 3C30A 1L0EA 1NRJA 4MLLA 5M18A 5GLBA 1OTAA 2PAVP 4PHTA 4DMZA 4Y13A 2VV7A 1XPBA 3H82A 3V3RA 2PHYA 3ZG7B 4LLOB 5G4YA 4GLQA 3E98A 1HTZA 2JN7A 1CEGA 2HDSA 1OT6A 1VQQA 1Y54A 3FYZA 5EECA 4OPQA 4NKPA 4I5SA 4GJ4A 3GDIA 2QWSA 1BLCA 4KZAA 2XEPA 5F68A 5TFQA 2JCHA 4KUKA 3T4SA 1QMFA 3IXGA 3GMWA 1E4DA 3MQOA 3RTYA 3KO6A 4OQGA 1FSYA 1NZOA 4K0XA 1BUEA 2A2LA 4YNRA 5F83A 4EERA 3PBQA 1E25A 4KUOA 4UAAA 2GZAA 5CTMA 1K6RA 4R4RA 3Q07A 4DDSA 4RVAA 4P6BA 2J3WA 3FPVA 2Y2GA 5HW3A 1J9MA 4JXVA 3BFFA 1NJ4A 3NI9A 1GHMA 2BG1A 3IH8A 1L3LA 4KZ8A 5FQJA 3NHQA 3N8LA 1IELA 3IS2A 3K3DA 2XQZA 2W3FA 1PI4A 2HV1A 4Y0TA 1YLZA 3N8SA 5G18A 3MJQA 5CTNA 3UMEA 2PBDP 1P97A 1WYBA 4ZRRA 4IBRA 4O7DA 5HD3A 2O0YA 3ICYA 3VP2A 4OOLA 3MR0A 5L09A 1N9NA 4MN6A 4L0LA 2H0YA 4UQIM 1EROA 2HZ5A 2ZC7A 5TBMB 1ERQA 3UB7A 1CI9A 3ZNYA 3OPPA 3NY4A 3ZYTA 4F3LB 5DF8A 2GX5A 5FL3A 3UB6A 4O01A 1YSQA 2WKIA 5AQBA 2CC1A 3OCNA 3H7WB 3F1OB 4U0XA 1GSWA 3SZTA 4WYYA 2XGNA 1KDWA 4Z1WA 1TEMA 3DWZA 3GTCA 3BFDA 2DCFA 2JKGA 5J3WA 2Y2IA 4BBUA 4DKIA 3S1YA 1QMEA 4R6LA 4X68A 3VMAA 2QKPA 1EI5A 3HLDA 2G7UA 1XFQA 3MF0A 5CRFA 3HUMA 4YINA 2FH5A 1H8ZA 4M3KA 5G4ZA 5CHMA 1ZC2A 4UA9A 4X1LA 2WUQA 3PAEA 3QP5A 4EEPA 1YLPA 1UWPX 2ZBBA 1W79A 3C7UA 3S7PA 4KQQA 5HWWA 3MFXA 3WS4A 5AVEA 3CITA 3DBAA 3LEQA 4LRXC 1H8MA 3HUOA 5FAOA 3VE3A 1Y4OA 4HP4A 4HOIA 1BULA 2W3HA 2OLUA 4YOFA 4P85A 1TS6A 4BL2A 1JVJA 4S2LA 3GECA 5DFXA 1PWCA 3HVFA 3WS0A 1G6OA 4HH2A 3E4QA 3QP2A 2NUTC 5GLDA 4HIAA 3LYXA 4MBHA 5E2HA 3BQ8A 2JC7A 2JKTI 4PKYA 1NXYA 1XJ2A 1SKFA 2PYPA 1NLYA 2EFUA 5HPIA 4OOYA 3W2ZA 2VJWA 2ZM2A 1VEUB 4OQ0A 2VKSA 3IWIA 4RQ9A 1W5DA 3MBZA 5HAPA 3QP1A 5DJTA 3A3DA 4IUHA 3C7VA 3PTEA 1CF0A 5CECA 4IVKA 4OP8A 4BBTA 3GQZA 3VE4A 5M19A 5AQ9A 1T1AA 4OH0A 4CJNA 4BD0A 3FKVA 3CJMA 4DE0A 1H3QA 4S2OA 1XX2A 1S6RA 3A3JA 3OC2A 3T4KA 2EXAA 5HX9A 1XA1A 4DJ2A 1VB6A 4C6YA 4H8RA 5KSHA 4MDZA 1VHMA 3EGXC 1GA0A 5CXWA 1NRFA 3NJAA 4FOFA 1M40A 3LCEA 1S0WA 1YLYA 2OLVA 2WKRA 1KDSA 4N1XA 5A91A 1K0KA 1BLSA 4CQHA 4B9OA 3T4OA 4HESA 3OZHA 5A90A 4MEZA 3IHBA 4QY6A 1K57A 4UA7A 3TOIA 3VSLA 5EV0A 2P04A 4OPZA 4ID4A 5L8MA 4N9KA 2W0NA 5CHJA 3ZVWA 3UPOA 3IBJA 4OPRA 1F9IA 4JF6A 1DP8A 3QP4A 2J7VA 4XUXA 4PM5A 3QNBA 3OPRA 2XSSA 4GHIB 3BFGA 3DW0A 5FAPA 3G2ZA 5HARA 2P9VA 2VGJA 2EX2A 4RX2A 5F69A 2X02A 1LSWA 3ZDJA 5HDDA 2J9PA 2PDRA 3BJNA 5GLCA 1P0ZA 1S1ZA 4AFIA 4WELA 3WS2A 3KYEA 1JNUA 1K54C 2P08A 2W1TA 4OQIA 4R1GA 5JYOA 2ZMVA 1K56D 4HJ6A 5M1AA 4L9FA 1XGIA 2EFXA 2XROA 1MXOA 4NXBA 1ONGA 3D72A 3O86A 3ZQ5A 3LO7A 3GV9A 4N9LA 4GW9A 3GR2A 4QPRA 4MCWA 4FH4A 3CI6A 2YKFA 1T1BA 1BLHA 3ITBA 4ETXA 2O9CA 4G3WA 3WWXA 1F5MA 2VLGA 4QU3A 4X69A 2UWXA 3RH8B 1TS8A 3SH7A 2Y2JA 4EETB 5BOHA 4OP5A 2XA7M 3BWLA 1A0KA 2H10A 3F1PB 4KQRA 4OONA 3U4LP 4YFMA 4UA6A 2K7SA 3CWFA 4OKPA 3R4KA 3A3IA 3F1NB 3E0YA 4HBTA 3N7WA 5AQAA 4WMCD 1JWZA 4MN7A 2L1MA 5FEFA 1Z09A 4R3AA 3IWOA 2W3DA 2FFYA 3E4OA 2Z2LB 4WZ4A 4JXWA 5IS1A 4P87A 1Z6FA 2QZ6A 4E3IA 3BYDA 2WGWB 1PRQA 2K2NA 4II7A 4Y3IA 2VA0A 3TG9A 1CQAA 4QJGA 1DRMA 2V1BA 3LR4A 3IF6A 2V0WA 1RGYA 4P6ZS 4G3KA 1JTDA 1F2KA 1YT4A 1V9YA 3IXDA 2D02A 2Z2MB 2Y4AA 4X25A 3ITAA 4NXEA 4R3BA 3R7WA 2VX8A 1YAXA 1RGZA 4Q0JA 3W4QA 2JKRM 5HL1A 2ZD8A 2Q9MA 2W1RA 1AWIA 3FZCA 4NXGA 4LGWA 2VGLS 4JLFA 2Y2LA 2A24B 4K08A
chains in the Genus database with same CATH topology
4KZ8A 5FQJA 4Z9QA 5GHZA 1IKGA 1TVFA 5D3OA 1LL9A 2ZMAA 3N8LA 1IELA 2ZQ8A 2ZQ9A 1ALQA 3HLGA 1LHYA 3UDFA 4FCFA 3RXWA 4OLGA 2XQZA 5CHUA 4NETA 1PI4A 1MBLA 5GHYA 4Y0TA 1YLZA 3N8SA 5G18A 5DVAA 2ZQCA 2EX6A 4WBGA 2XLNA 3CZDA 1LI0A 4S2NA 4XXRA 5CTNA 1XGJA 1YMXA 3G34A 5GL9A 1WYBA 5F82A 1I5QA 5TGFA 4IBRA 1KE0A 4JXGA 1DJCA 4O7DA 4PM7A 3SS4A 4KG5A 3W8KA 3VP2A 2FFFB 1LLBA 4OOLA 1FCMA 3FWLA 3ZVTA 5EOOA 1MKIA 1M6KA 4S2JA 4S2PA 4WEJA 3SOIA 2WGIA 5FQKA 4L0LA 4PM9A 1MPLA 2H0YA 2WK0A 1XA7A 3AGFA 5F1FA 4MNRA 1JWVA 3UE0A 1MWRA 1EROA 2XK1A 3SS3A 4A5RA 1ES2A 4PM6A 3FV7A 2ZC7A 5EVID 1ERQA 5FA7A 1YLTA 4BLMA 1RP5A 4C75A 1CI9A 3N8RA 1NY0A 4P0MA 3ZG5A 3GRJA 3IF6C 5FQ9A 3ZNYA 1W8QA 1TDLA 2XD1A 1YLWA 1GA9A 3OPPA 2Y2QA 5HFOA 4KZ5A 3NY4A 4IVIA 4OOMA 5DF8A 3Q7VB 4LV0A 2OV5A 4E3LA 5EVIA 2JE5A 4HBUA 4Y0UA 1YLJA 4JF5A 2ZQ7A 1IYOA 1JWPA 4MBKA 3IH9A 2R9WA 2WKIA 3N4IA 4LCMA 5AQBA 3O87A 4GZBA 4ZBEA 4ZDXA 1HZOA 2CC1A 3OCNA 2E8IA 1SDEA 3UDXA 1ES5A 2J8YA 3HLCA 4KZ3A 4U0XA 4X53A 4WYYA 2XGNA 1KDWA 5DF7A 4B4ZA 4NK3A 4GKUA 1PWDA 4E3JA 1OMEA 4ZAMA 4E3KA 1TEMA 3M6BA 1PI5A 3DWZA 1SDNA 3G35A 1W8YA 3MXSA 1PW1A 3BFDA 1YM1A 3GTCA 3LEZA 5FI2A 3ZG9B 4R3JA 2Y91A 1DJAA 3QHYA 2DCFA 3NCKA 3PBRA 3RXXA 3IXHA 2EX9A 1KVLA 1N9BA 2Y2IA 4DKIA 4DDYA 3S1YA 3ZNTA 1PIOA 4BQMA 1ONHA 4QHCA 1QMEA 3EQVA 4X68A 1BT5A 3VMAA 1CI8A 2RL3A 1EI5A 3VP1A 3HLDA 3M2JA 3UPPA 3VFHA 5DTKA 5I94A 4FSFA 3PBNA 2WGWA 4KG2A 3CG5A 5CRFA 3N6IA 4GOGA 3MZFA 2J9OA 3BEBA 3HUMA 4YINA 4KENB 1H8ZA 4M3KA 2XFTA 5CHMA 2HDRA 1ZC2A 2WKEA 2RCXA 2V2FF 4UA9A 3Q1FA 3UE1A 2WUQA 3MXRA 3PAEA 5HAQA 1ES4A 1FQGA 3JYIA 1YLPA 3RJUA 4LENA 4ZTKA 2Y2KA 5J8XA 1W79A 2PU2A 3C7UA 4KQQA 4B4XA 3HLEA 3SS5A 5A93A 4R4SA 3WS4A 3NBLA 2WYXA 3ISGA 1XP4A 1K6SA 3V3SA 5GLAA 3M2KA 3NDEA 1KGFA 2XH9A 5FI7A 1XKZA 3HUOA 5FAOA 1L0DA 3ZFZA 4EBNA 2P9VB 3MZDA 1NYMA 4GD6A 1JTGA 1BULA 4JBFA 5AQ7A 5IHVA 2OLUA 4P85A 1H8YA 4KZ6A 4OQHA 2Q9NA 2Y2MA 3BLSA 3VP4A 3A3EA 3WRZA 4BL2A 3G4PA 1JVJA 1PZPA 4S2LA 2P74A 1PWCA 1U60A 3HVFA 3WS0A 1SHVA 5EE8A 4UHUA 1K38A 5EVIC 1VM1A 4JKTA 4QB8A 5GLDA 2PU4A 3NDGA 1LI9A 2ZC4B 4MBHA 2JC7A 5E2HA 1NXYA 4S2KA 1YMSA 3MFDA 1BTLA 1SKFA 5E2GA 3V5MA 2H5SA 1EWZA 1MY8A 2XR0A 2EFUA 1ERMA 4OOYA 1MWSA 5E2FA 3AGDA 2HPBA 1PWGA 2ZM2A 3M6HA 4GNUA 3PBOA 4BL3A 4OQ0A 1CEFA 1GCEA 3IWIA 3O3VA 1W5DA 4KQOA 3MBZA 3PAGA 4KZBA 2WADA 5HAPA 1ES3A 1HVBA 3A3DA 3DWKA 3V39A 4S2MA 3C7VA 3ZG8B 3PTEA 3E2LA 3IT9A 5CECA 4IVKA 2JBFA 4OP8A 4ZJ2A 1MWTA 2ZC6B 4B88A 3GQZA 4E6WA 5M19A 4PMAA 2IWDA 1MWUA 1KVMA 5AQ9A 4X56A 3P09A 4OH0A 4QD4A 4CJNA 5EOEA 4BD0A 3FKVA 1CK3A 3HLWA 5TR7A 3CJMA 1I2SA 1FR6A 1IEMA 4DE0A 4EBLA 4S2OA 3C5AA 1K4EA 1S6RA 1XX2A 1K57C 3A3JA 3IF5A 3OC2A 2EXAA 5HX9A 3UE3A 3UPNA 2WZXA 1KGGA 1XA1A 4FH2A 1YQSA 1Q2PA 2GDNA 3HBRA 4JF4A 2Y2PA 3WS1A 4RX3A 2V1ZA 2VGKA 3LY3A 3Q7VA 5E43A 4C6YA 2WAEA 4H8RA 5KSHA 1SCWA 4X6TA 4E3MA 1ESUA 2V20A 2Y2HA 3WS5A 2HP6A 3G2YA 5EVLA 3VSKA 1GA0A 2WZZA 3HLFA 2G2WA 1K55C 3IXBA 5CGWA 5CXWA 3O88A 1KE3A 1NRFA 4WZ5A 1WE4A 3UDIA 1FSWA 4F94A 3Q7ZA 4KZ9A 3BM6A 1M40A 1BZAA 4EBPA 5A92A 3VP3A 3D4FA 1S0WA 3LCEA 4BD1A 1YLYA 3OCLA 3A3FA 2OLVA 3SH9A 3C4OA 4E3OA 1PW8A 1KDSA 4N1XA 4GB7A 5A91A 1BLSA 1PZOA 3HLBA 4KZ7A 3Q81A 4HESA 3OZHA 1FCNA 5F1GA 3WRTA 5A90A 4MEZA 1L2SA 1XXMA 4CPKA 3IF6B 3PBTA 4N1HA 4Y7PA 1TDGA 4LV3A 4Q8IA 1O7EA 4ZJ3A 2Y59A 3IHBA 2Y2NA 4QY6A 1K57A 4UA7A 2ZM8A 3PBSA 3TOIA 3VSLA 1ESIA 4OPZA 4Y0OA 4EV4A 4ID4A 2WGVA 4OVDA 1GHIA 5FDHA 3IWQA 4OLDA 2WKHA 4OPYA 3GVBA 5FASA 3C4PA 4N9KA 3UY6A 4DF6A 1RCJA 2XFSA 3ZGAB 1C3BA 1BLPA 3S22A 1PYYA 3B3XA 3OPHA 3AGEA 3V50A 3ZCZA 4EQIA 5CHJA 3ZVWA 4DE2A 3UPOA 3VFFA 3W4OA 3MZEA 4OPRA 4R0QA 4JF6A 4LV2A 3HREA 2J7VA 3UNWA 4DE3A 1LL5A 3Q82A 4XUXA 5FQIA 3QNBA 3S4XA 4PM5A 4EUZA 1L0FA 3OPRA 5EUAA 1I2WA 4GDNA 5L2FA 5JYPA 3BFGA 3DW0A 2EX8A 5FAPA 3G2ZA 4E3NA 2QMIA 2HP5A 5HARA 5CGSA 4XUZA 2P9VA 2VGJA 2XF3A 2EX2A 5HAIA 1AXBA 3ZG0A 4RX2A 2X02A 4E6XA 5FAQA 4HEFA 3ZDJA 3DTMA 4WM9A 4ZJ1A 4RA7A 5CERA 4BJPA 3GSGA 3NC8A 3VP0A 1NYYA 2J9PA 4C3QA 4DRTA 2ZJ9A 5GLCA 4EWFA 5CEDA 1E3UD 2QPNA 4JXSA 4RYEA 4WELA 2X71A 3MKFA 3WS2A 4GN2A 1KE4A 4LCLA 1GHMA 4GDBA 1K54C 5CGXA 2WAFA 2IWBA 2A49A 2B5RA 3CMZA 2ZQDA 4KZ4A 2HDQA 3IQAA 1E3UA 2ZM0A 5FQMA 4OQIA 3UO9A 2R9XA 2ZLYA 4R1GA 3BRMA 4WZ5C 5JYOA 4DE1A 1K56D 1IYSA 3TSGA 5M1AA 5FQQA 1WYCA 5KMWA 4D2OA 4PPRA 1G68A 1FR1A 1XGIA 2EFXA 3BECA 1MXOA 2C5WB 1W7FA 3QNCA 5FI6A 1ONGA 3O86A 4QY5A 4MBFA 1K56A 1K25A 3LO7A 2Y2OA 3GV9A 1ZG4A 3G31A 3HUNA 4N9LA 3BFCA 3GR2A 3I7JA 5E2EA 3ZHHA 5FATA 2ZQAA 4FH4A 4BENA 4K91A 3E2KA 2H0TA 1BLHA 1L0EA 2DRWA 3ITBA 2Y55A 5KSCA 3WWXA 4MLLA 1O07A 4QU3A 4X69A 4DXCA 2UWXA 1L0GA 5EVIB 1K4FA 4IBXA 1K55A 4R23A 3SH7A 2Y2JA 5FSRA 5BOHA 4OP5A 2G2UA 2XD5A 5M18A 5GLBA 1FOFA 1NZUA 2H10A 3HL9A 4KQRA 4OONA 4YFMA 3LY4A 4UA6A 1KGEA 1K54A 4OKPA 4X55A 2X01A 3A3IA 3UN7A 1XPBA 1IKIA 3MKEA 3V3RA 2BG1A 4HBTA 5CEBA 4GD8A 4K0WA 3BLMA 4IEDA 3N7WA 4U0TA 5AQAA 3ZG7B 2HDUA 2ZC5B 4WMCD 1JWZA 4LV1A 4U3TA 2XDMA 5KZHA 1HTZA 5EPHA 4DXBA 3IWOA 4N92A 5U47A 1FCOA 5DTSA 1CEGA 4KG6A 3W4PA 2FFYA 2HDSA 2ZC3B 1Y54A 1VQQA 3FYZA 4WMCA 4FD8A 2Z2LB 4WZ4A 4JXWA 5EECA 1GHPA 3EQUA 1DJBA 4OPQA 3OPLA 4P87A 1Z6FA 2QZ6A 2I72A 3P98A 3IHAA 1IYQA 4E3IA 3BYDA 2WGWB 1BLCA 4KZAA 2EXBA 2XEPA 2HP9A 5TFQA 2OSUA 1ZKJA 2JCHA 3TG9A 1QMFA 3IXGA 4QJGA 2DNSA 3GMWA 2A3UA 1E4DA 3IF6A 1RGYA 1HD8A 2PBYA 1JTDA 3BFEA 3VOZA 1YT4A 4OQGA 5DF9A 1FSYA 1BSGA 1NZOA 4S2IA 4K0XA 1BUEA 2C6WB 3VOYA 4S2NC 1N4OA 3IXDA 1H5XA 2Z2MB 3FKWA 4WEKA 2Y4AA 1ZG6A 1DY6A 3ITAA 5F83A 3PBQA 1E25A 4UAAA 5CTMA 4R3BA 1K6RA 4R4RA 3Q07A 4DDSA 2BLSA 3NIAA 4RVAA 1RGZA 3W4QA 5HL1A 4P6BA 2ZD8A 2Q9MA 2Y2GA 5HW3A 1J9MA 4JXVA 5GHXA 3SH8A 3FZCA 1IYPA 3BFFA 1NJ4A 3G32A 3G30A 3NI9A 4JPMA 5DTTA 2IWCA 4JLFA 2Y2LA 1G6AA 3IH8A 1Q2QA 4PM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZ8 A;  5FQJ A;  4Z9Q A;  5GHZ A;  1IKG A;  1TVF A;  5D3O A;  1LL9 A;  2ZMA A;  3N8L A;  1IEL A;  2ZQ8 A;  2ZQ9 A;  1ALQ A;  3HLG A;  1LHY A;  3UDF A;  4FCF A;  3RXW A;  4OLG A;  2XQZ A;  5CHU A;  4NET A;  1PI4 A;  1MBL A;  5GHY A;  4Y0T A;  1YLZ A;  3N8S A;  5G18 A;  5DVA A;  2ZQC A;  2EX6 A;  4WBG A;  2XLN A;  3CZD A;  1LI0 A;  4S2N A;  4XXR A;  5CTN A;  1XGJ A;  1YMX A;  3G34 A;  5GL9 A;  1WYB A;  5F82 A;  1I5Q A;  5TGF A;  4IBR A;  1KE0 A;  4JXG A;  1DJC A;  4O7D A;  4PM7 A;  3SS4 A;  4KG5 A;  3W8K A;  3VP2 A;  2FFF B;  1LLB A;  4OOL A;  1FCM A;  3FWL A;  3ZVT A;  5EOO A;  1MKI A;  1M6K A;  4S2J A;  4S2P A;  4WEJ A;  3SOI A;  2WGI A;  5FQK A;  4L0L A;  4PM9 A;  1MPL A;  2H0Y A;  2WK0 A;  1XA7 A;  3AGF A;  5F1F A;  4MNR A;  1JWV A;  3UE0 A;  1MWR A;  1ERO A;  2XK1 A;  3SS3 A;  4A5R A;  1ES2 A;  4PM6 A;  3FV7 A;  2ZC7 A;  5EVI D;  1ERQ A;  5FA7 A;  1YLT A;  4BLM A;  1RP5 A;  4C75 A;  1CI9 A;  3N8R A;  1NY0 A;  4P0M A;  3ZG5 A;  3GRJ A;  3IF6 C;  5FQ9 A;  3ZNY A;  1W8Q A;  1TDL A;  2XD1 A;  1YLW A;  1GA9 A;  3OPP A;  2Y2Q A;  5HFO A;  4KZ5 A;  3NY4 A;  4IVI A;  4OOM A;  5DF8 A;  3Q7V B;  4LV0 A;  2OV5 A;  4E3L A;  5EVI A;  2JE5 A;  4HBU A;  4Y0U A;  1YLJ A;  4JF5 A;  2ZQ7 A;  1IYO A;  1JWP A;  4MBK A;  3IH9 A;  2R9W A;  2WKI A;  3N4I A;  4LCM A;  5AQB A;  3O87 A;  4GZB A;  4ZBE A;  4ZDX A;  1HZO A;  2CC1 A;  3OCN A;  2E8I A;  1SDE A;  3UDX A;  1ES5 A;  2J8Y A;  3HLC A;  4KZ3 A;  4U0X A;  4X53 A;  4WYY A;  2XGN A;  1KDW A;  5DF7 A;  4B4Z A;  4NK3 A;  4GKU A;  1PWD A;  4E3J A;  1OME A;  4ZAM A;  4E3K A;  1TEM A;  3M6B A;  1PI5 A;  3DWZ A;  1SDN A;  3G35 A;  1W8Y A;  3MXS A;  1PW1 A;  3BFD A;  1YM1 A;  3GTC A;  3LEZ A;  5FI2 A;  3ZG9 B;  4R3J A;  2Y91 A;  1DJA A;  3QHY A;  2DCF A;  3NCK A;  3PBR A;  3RXX A;  3IXH A;  2EX9 A;  1KVL A;  1N9B A;  2Y2I A;  4DKI A;  4DDY A;  3S1Y A;  3ZNT A;  1PIO A;  4BQM A;  1ONH A;  4QHC A;  1QME A;  3EQV A;  4X68 A;  1BT5 A;  3VMA A;  1CI8 A;  2RL3 A;  1EI5 A;  3VP1 A;  3HLD A;  3M2J A;  3UPP A;  3VFH A;  5DTK A;  5I94 A;  4FSF A;  3PBN A;  2WGW A;  4KG2 A;  3CG5 A;  5CRF A;  3N6I A;  4GOG A;  3MZF A;  2J9O A;  3BEB A;  3HUM A;  4YIN A;  4KEN B;  1H8Z A;  4M3K A;  2XFT A;  5CHM A;  2HDR A;  1ZC2 A;  2WKE A;  2RCX A;  2V2F F;  4UA9 A;  3Q1F A;  3UE1 A;  2WUQ A;  3MXR A;  3PAE A;  5HAQ A;  1ES4 A;  1FQG A;  3JYI A;  1YLP A;  3RJU A;  4LEN A;  4ZTK A;  2Y2K A;  5J8X A;  1W79 A;  2PU2 A;  3C7U A;  4KQQ A;  4B4X A;  3HLE A;  3SS5 A;  5A93 A;  4R4S A;  3WS4 A;  3NBL A;  2WYX A;  3ISG A;  1XP4 A;  1K6S A;  3V3S A;  5GLA A;  3M2K A;  3NDE A;  1KGF A;  2XH9 A;  5FI7 A;  1XKZ A;  3HUO A;  5FAO A;  1L0D A;  3ZFZ A;  4EBN A;  2P9V B;  3MZD A;  1NYM A;  4GD6 A;  1JTG A;  1BUL A;  4JBF A;  5AQ7 A;  5IHV A;  2OLU A;  4P85 A;  1H8Y A;  4KZ6 A;  4OQH A;  2Q9N A;  2Y2M A;  3BLS A;  3VP4 A;  3A3E A;  3WRZ A;  4BL2 A;  3G4P A;  1JVJ A;  1PZP A;  4S2L A;  2P74 A;  1PWC A;  1U60 A;  3HVF A;  3WS0 A;  1SHV A;  5EE8 A;  4UHU A;  1K38 A;  5EVI C;  1VM1 A;  4JKT A;  4QB8 A;  5GLD A;  2PU4 A;  3NDG A;  1LI9 A;  2ZC4 B;  4MBH A;  2JC7 A;  5E2H A;  1NXY A;  4S2K A;  1YMS A;  3MFD A;  1BTL A;  1SKF A;  5E2G A;  3V5M A;  2H5S A;  1EWZ A;  1MY8 A;  2XR0 A;  2EFU A;  1ERM A;  4OOY A;  1MWS A;  5E2F A;  3AGD A;  2HPB A;  1PWG A;  2ZM2 A;  3M6H A;  4GNU A;  3PBO A;  4BL3 A;  4OQ0 A;  1CEF A;  1GCE A;  3IWI A;  3O3V A;  1W5D A;  4KQO A;  3MBZ A;  3PAG A;  4KZB A;  2WAD A;  5HAP A;  1ES3 A;  1HVB A;  3A3D A;  3DWK A;  3V39 A;  4S2M A;  3C7V A;  3ZG8 B;  3PTE A;  3E2L A;  3IT9 A;  5CEC A;  4IVK A;  2JBF A;  4OP8 A;  4ZJ2 A;  1MWT A;  2ZC6 B;  4B88 A;  3GQZ A;  4E6W A;  5M19 A;  4PMA A;  2IWD A;  1MWU A;  1KVM A;  5AQ9 A;  4X56 A;  3P09 A;  4OH0 A;  4QD4 A;  4CJN A;  5EOE A;  4BD0 A;  3FKV A;  1CK3 A;  3HLW A;  5TR7 A;  3CJM A;  1I2S A;  1FR6 A;  1IEM A;  4DE0 A;  4EBL A;  4S2O A;  3C5A A;  1K4E A;  1S6R A;  1XX2 A;  1K57 C;  3A3J A;  3IF5 A;  3OC2 A;  2EXA A;  5HX9 A;  3UE3 A;  3UPN A;  2WZX A;  1KGG A;  1XA1 A;  4FH2 A;  1YQS A;  1Q2P A;  2GDN A;  3HBR A;  4JF4 A;  2Y2P A;  3WS1 A;  4RX3 A;  2V1Z A;  2VGK A;  3LY3 A;  3Q7V A;  5E43 A;  4C6Y A;  2WAE A;  4H8R A;  5KSH A;  1SCW A;  4X6T A;  4E3M A;  1ESU A;  2V20 A;  2Y2H A;  3WS5 A;  2HP6 A;  3G2Y A;  5EVL A;  3VSK A;  1GA0 A;  2WZZ A;  3HLF A;  2G2W A;  1K55 C;  3IXB A;  5CGW A;  5CXW A;  3O88 A;  1KE3 A;  1NRF A;  4WZ5 A;  1WE4 A;  3UDI A;  1FSW A;  4F94 A;  3Q7Z A;  4KZ9 A;  3BM6 A;  1M40 A;  1BZA A;  4EBP A;  5A92 A;  3VP3 A;  3D4F A;  1S0W A;  3LCE A;  4BD1 A;  1YLY A;  3OCL A;  3A3F A;  2OLV A;  3SH9 A;  3C4O A;  4E3O A;  1PW8 A;  1KDS A;  4N1X A;  4GB7 A;  5A91 A;  1BLS A;  1PZO A;  3HLB A;  4KZ7 A;  3Q81 A;  4HES A;  3OZH A;  1FCN A;  5F1G A;  3WRT A;  5A90 A;  4MEZ A;  1L2S A;  1XXM A;  4CPK A;  3IF6 B;  3PBT A;  4N1H A;  4Y7P A;  1TDG A;  4LV3 A;  4Q8I A;  1O7E A;  4ZJ3 A;  2Y59 A;  3IHB A;  2Y2N A;  4QY6 A;  1K57 A;  4UA7 A;  2ZM8 A;  3PBS A;  3TOI A;  3VSL A;  1ESI A;  4OPZ A;  4Y0O A;  4EV4 A;  4ID4 A;  2WGV A;  4OVD A;  1GHI A;  5FDH A;  3IWQ A;  4OLD A;  2WKH A;  4OPY A;  3GVB A;  5FAS A;  3C4P A;  4N9K A;  3UY6 A;  4DF6 A;  1RCJ A;  2XFS A;  3ZGA B;  1C3B A;  1BLP A;  3S22 A;  1PYY A;  3B3X A;  3OPH A;  3AGE A;  3V50 A;  3ZCZ A;  4EQI A;  5CHJ A;  3ZVW A;  4DE2 A;  3UPO A;  3VFF A;  3W4O A;  3MZE A;  4OPR A;  4R0Q A;  4JF6 A;  4LV2 A;  3HRE A;  2J7V A;  3UNW A;  4DE3 A;  1LL5 A;  3Q82 A;  4XUX A;  5FQI A;  3QNB A;  3S4X A;  4PM5 A;  4EUZ A;  1L0F A;  3OPR A;  5EUA A;  1I2W A;  4GDN A;  5L2F A;  5JYP A;  3BFG A;  3DW0 A;  2EX8 A;  5FAP A;  3G2Z A;  4E3N A;  2QMI A;  2HP5 A;  5HAR A;  5CGS A;  4XUZ A;  2P9V A;  2VGJ A;  2XF3 A;  2EX2 A;  5HAI A;  1AXB A;  3ZG0 A;  4RX2 A;  2X02 A;  4E6X A;  5FAQ A;  4HEF A;  3ZDJ A;  3DTM A;  4WM9 A;  4ZJ1 A;  4RA7 A;  5CER A;  4BJP A;  3GSG A;  3NC8 A;  3VP0 A;  1NYY A;  2J9P A;  4C3Q A;  4DRT A;  2ZJ9 A;  5GLC A;  4EWF A;  5CED A;  1E3U D;  2QPN A;  4JXS A;  4RYE A;  4WEL A;  2X71 A;  3MKF A;  3WS2 A;  4GN2 A;  1KE4 A;  4LCL A;  1GHM A;  4GDB A;  1K54 C;  5CGX A;  2WAF A;  2IWB A;  2A49 A;  2B5R A;  3CMZ A;  2ZQD A;  4KZ4 A;  2HDQ A;  3IQA A;  1E3U A;  2ZM0 A;  5FQM A;  4OQI A;  3UO9 A;  2R9X A;  2ZLY A;  4R1G A;  3BRM A;  4WZ5 C;  5JYO A;  4DE1 A;  1K56 D;  1IYS A;  3TSG A;  5M1A A;  5FQQ A;  1WYC A;  5KMW A;  4D2O A;  4PPR A;  1G68 A;  1FR1 A;  1XGI A;  2EFX A;  3BEC A;  1MXO A;  2C5W B;  1W7F A;  3QNC A;  5FI6 A;  1ONG A;  3O86 A;  4QY5 A;  4MBF A;  1K56 A;  1K25 A;  3LO7 A;  2Y2O A;  3GV9 A;  1ZG4 A;  3G31 A;  3HUN A;  4N9L A;  3BFC A;  3GR2 A;  3I7J A;  5E2E A;  3ZHH A;  5FAT A;  2ZQA A;  4FH4 A;  4BEN A;  4K91 A;  3E2K A;  2H0T A;  1BLH A;  1L0E A;  2DRW A;  3ITB A;  2Y55 A;  5KSC A;  3WWX A;  4MLL A;  1O07 A;  4QU3 A;  4X69 A;  4DXC A;  2UWX A;  1L0G A;  5EVI B;  1K4F A;  4IBX A;  1K55 A;  4R23 A;  3SH7 A;  2Y2J A;  5FSR A;  5BOH A;  4OP5 A;  2G2U A;  2XD5 A;  5M18 A;  5GLB A;  1FOF A;  1NZU A;  2H10 A;  3HL9 A;  4KQR A;  4OON A;  4YFM A;  3LY4 A;  4UA6 A;  1KGE A;  1K54 A;  4OKP A;  4X55 A;  2X01 A;  3A3I A;  3UN7 A;  1XPB A;  1IKI A;  3MKE A;  3V3R A;  2BG1 A;  4HBT A;  5CEB A;  4GD8 A;  4K0W A;  3BLM A;  4IED A;  3N7W A;  4U0T A;  5AQA A;  3ZG7 B;  2HDU A;  2ZC5 B;  4WMC D;  1JWZ A;  4LV1 A;  4U3T A;  2XDM A;  5KZH A;  1HTZ A;  5EPH A;  4DXB A;  3IWO A;  4N92 A;  5U47 A;  1FCO A;  5DTS A;  1CEG A;  4KG6 A;  3W4P A;  2FFY A;  2HDS A;  2ZC3 B;  1Y54 A;  1VQQ A;  3FYZ A;  4WMC A;  4FD8 A;  2Z2L B;  4WZ4 A;  4JXW A;  5EEC A;  1GHP A;  3EQU A;  1DJB A;  4OPQ A;  3OPL A;  4P87 A;  1Z6F A;  2QZ6 A;  2I72 A;  3P98 A;  3IHA A;  1IYQ A;  4E3I A;  3BYD A;  2WGW B;  1BLC A;  4KZA A;  2EXB A;  2XEP A;  2HP9 A;  5TFQ A;  2OSU A;  1ZKJ A;  2JCH A;  3TG9 A;  1QMF A;  3IXG A;  4QJG A;  2DNS A;  3GMW A;  2A3U A;  1E4D A;  3IF6 A;  1RGY A;  1HD8 A;  2PBY A;  1JTD A;  3BFE A;  3VOZ A;  1YT4 A;  4OQG A;  5DF9 A;  1FSY A;  1BSG A;  1NZO A;  4S2I A;  4K0X A;  1BUE A;  2C6W B;  3VOY A;  4S2N C;  1N4O A;  3IXD A;  1H5X A;  2Z2M B;  3FKW A;  4WEK A;  2Y4A A;  1ZG6 A;  1DY6 A;  3ITA A;  5F83 A;  3PBQ A;  1E25 A;  4UAA A;  5CTM A;  4R3B A;  1K6R A;  4R4R A;  3Q07 A;  4DDS A;  2BLS A;  3NIA A;  4RVA A;  1RGZ A;  3W4Q A;  5HL1 A;  4P6B A;  2ZD8 A;  2Q9M A;  2Y2G A;  5HW3 A;  1J9M A;  4JXV A;  5GHX A;  3SH8 A;  3FZC A;  1IYP A;  3BFF A;  1NJ4 A;  3G32 A;  3G30 A;  3NI9 A;  4JPM A;  5DTT A;  2IWC A;  4JLF A;  2Y2L A;  1G6A A;  3IH8 A;  1Q2Q A;  4PM8 A; 
#chains in the Genus database with same CATH topology
 4Z9Q A;  1IKG A;  2ZQ8 A;  3HLG A;  3UDF A;  4NG2 A;  4OLG A;  5CHU A;  4NET A;  1DP6 A;  5GHY A;  1UGU A;  2LB9 A;  2ZQC A;  2EX6 A;  4WBG A;  4CLC B;  5F82 A;  1DJC A;  1ODV A;  4KG5 A;  1J3W A;  3TW8 A;  3W8K A;  2Y79 A;  1LLB A;  5EOO A;  1OJG A;  2L0W A;  4PM9 A;  4HY8 A;  1MPL A;  3AGF A;  4MNR A;  3UE0 A;  1ES2 A;  3FV7 A;  5EM0 A;  3ZG5 A;  3IF6 C;  3OOV A;  1YLW A;  1GA9 A;  2Y2Q A;  3FG8 A;  5HFO A;  2VV8 A;  2OOL A;  4IVI A;  2OV5 A;  2PD8 A;  4HBU A;  4JF5 A;  1IYO A;  4MBK A;  2R9W A;  3N4I A;  4ZBE A;  1HZO A;  3H82 B;  3HLC A;  3JVV A;  4X53 A;  1IFQ A;  4NK3 A;  1PWD A;  4ZAM A;  3M6B A;  3NOT C;  3G35 A;  5HWV A;  1W8Y A;  5HPF A;  5FI2 A;  3IX3 A;  4GS9 B;  2INW A;  3PBR A;  3EOI A;  3E4P A;  2EX9 A;  4DDY A;  3ZNT A;  1ONH A;  2RL3 A;  5F6A A;  5I94 A;  4KG2 A;  3N6I A;  4GOG A;  2J9O A;  3D9Y A;  1XJ4 A;  3Q1F A;  5HAQ A;  1ES4 A;  3JYI A;  4ZTK A;  2Y2K A;  4B4X A;  4JGQ A;  5A93 A;  2JHE A;  2JKF A;  2WYX A;  3ISG A;  3M2K A;  4YWZ A;  3UB8 A;  3MZD A;  1NYM A;  4GD6 A;  1TS7 A;  4KZ6 A;  3CPT B;  2QYB A;  5EFW A;  3G4P A;  1PZP A;  2P74 A;  1U60 A;  1MZU A;  2PT7 A;  2OAP 1;  1Y28 A;  4UHU A;  1K38 A;  3A0R A;  2ZC4 B;  4S2K A;  3RFB A;  1YMS A;  2M7U A;  5E2G A;  2NUP C;  4FTX A;  1T18 A;  1MWS A;  4L9G A;  4CLC E;  1PWG A;  1IOU A;  1CEF A;  2UV0 E;  3T4L A;  3S7Q A;  4KZB A;  3KYQ A;  1HVB A;  3HJI A;  1S4R A;  3T1X A;  2M7V A;  3IT9 A;  2JBF A;  5HL6 A;  4ZJ2 A;  4HI4 A;  4B88 A;  2IWD A;  4DN0 A;  5EVE A;  5EOE A;  5A8B A;  2ZMF A;  4EUV A;  1CK3 A;  4EBL A;  5TBM A;  5IU1 A;  1LT0 A;  1KGG A;  1YQS A;  1Q2P A;  2EWW A;  3HBR A;  4F3L A;  5E43 A;  4E3M A;  2HP6 A;  2PYR A;  4ETZ A;  3G2Y A;  2WZZ A;  2O99 A;  3O88 A;  1SKO A;  3H7W A;  3F1O A;  1FSW A;  1VET B;  3LI9 A;  2IA2 A;  2QHK A;  3BM6 A;  3CHW P;  4KZ9 A;  4MMN A;  5A92 A;  1BZA A;  3VP3 A;  4BMW A;  3HJK A;  1CJF A;  3HLB A;  1GSX A;  4KZ7 A;  3MQQ A;  1PNE A;  4EXO A;  1O7E A;  4HQA A;  3P7N A;  5HSQ A;  1OTB A;  2ZM8 A;  2W3E A;  3S7O A;  1XJ6 A;  2EWV A;  2WGV A;  4OLD A;  3GVB A;  5FAS A;  5LBR A;  2XFS A;  3V67 A;  3ZGA B;  3S22 A;  1PYY A;  4LRZ E;  2HJ9 C;  4DE2 A;  3LIB A;  3IX4 A;  1ZHH B;  4R0Q A;  3BY9 A;  5FQI A;  5EUA A;  3IBR A;  2J3T C;  1OPX A;  2XF3 A;  3ZG0 A;  5FAQ A;  3QP8 A;  3NOP C;  3CAX A;  3DTM A;  4HEF A;  4WM9 A;  4BJP A;  4C3Q A;  2JKT M;  1T19 A;  4JXS A;  3MKF A;  4GN2 A;  1KE4 A;  4GDB A;  3FC7 A;  2LB5 A;  3K3C A;  2WAF A;  3FPW A;  2IWB A;  4KZ4 A;  1W63 Q;  4Y2F A;  5DFY A;  2HDQ A;  1F98 A;  3KSF A;  3IQA A;  5FQM A;  2ZLY A;  2PD7 A;  2EA9 A;  3MS6 A;  4DE1 A;  1IYS A;  5KMW A;  1G68 A;  1FR1 A;  2J3T D;  2C5W B;  4KQD A;  1VEU A;  5FI6 A;  2CMN A;  4QY5 A;  4MBF A;  1K56 A;  3ZHH A;  2ZQA A;  2PR5 A;  5DJU A;  4K91 A;  2Y55 A;  2V1A A;  1L0G A;  5EVI B;  3T1S A;  1K55 A;  3CUE A;  5FSR A;  2G2U A;  1FOF A;  1NZU A;  2DMW A;  5AVF A;  1DP9 A;  1KGE A;  1K54 A;  4X55 A;  2X01 A;  3B33 A;  1H0M A;  4JGP A;  1ZTU A;  4K0W A;  5CEB A;  3BLM A;  4U0T A;  2XRN A;  1NLZ A;  2BTF P;  4LV1 A;  4U3T A;  2XDM A;  1YPR A;  5EPH A;  3EEH A;  1FCO A;  2VEA A;  2KLI A;  3L9K A;  3MQ0 A;  4WMC A;  5HDC A;  3EGD C;  1GHP A;  3EQU A;  1DJB A;  4ESP A;  3OPL A;  2I72 A;  3P98 A;  2OWJ A;  4UQI S;  1PFL A;  2OSU A;  5IT5 A;  2DNS A;  1FIL A;  1HD8 A;  2PBY A;  2V8F A;  3BFE A;  3G6O A;  4S2I A;  1WA9 A;  3CLO A;  2C6W B;  4WEK A;  4S2N C;  2B18 A;  3FKW A;  2ZOH A;  1ZG6 A;  1DY6 A;  1OJ5 A;  3B47 A;  4XT2 B;  3IX8 A;  2ACG A;  2BLS A;  3NIA A;  5HWT A;  4R38 A;  2ZL1 B;  4JGO A;  4ARZ B;  5GHX A;  3SH8 A;  3VV4 A;  4Y17 A;  3G32 A;  4JPM A;  3G30 A;  5DTT A;  4EQ1 A;  1S1Y A;  1G6A A;  4GHI A;  1K55 C;  3CUE C;  1Q2Q A;  5GHZ A;  1TVF A;  1LL9 A;  2ZQ9 A;  3RXW A;  1MBL A;  5DVA A;  2QJ5 A;  3CZD A;  1LI0 A;  1S66 L;  3G34 A;  1I5Q A;  5TGF A;  4PM7 A;  4JXG A;  3FWL A;  1W63 M;  1M6K A;  4S2J A;  4S2P A;  4WEJ A;  2WGI A;  4LPZ A;  4O8G A;  5FQK A;  2FZ0 A;  3S7N A;  3MSH A;  1XA7 A;  1JWV A;  1MWR A;  2XK1 A;  3SS3 A;  4A5R A;  4PM6 A;  5EVI D;  4BLM A;  4C75 A;  2AVX A;  3N8R A;  1NY0 A;  3QP6 A;  4P0M A;  5FQ9 A;  1W8Q A;  1TDL A;  4KZ5 A;  3Q7V B;  2YKH A;  4Y0U A;  1YLJ A;  3IH9 A;  4LCM A;  4LRY C;  3LIA A;  3F1P A;  1SDE A;  1ES5 A;  2J8Y A;  3F1N A;  1TS0 A;  4KZ3 A;  4GKU A;  2HF6 A;  1OME A;  4E3J A;  4WL9 A;  4E3K A;  5J7E A;  1PI5 A;  4DJ3 A;  3MXS A;  1YM1 A;  5HD5 A;  3LEZ A;  3UE6 A;  4R3J A;  3QHY A;  3NCK A;  4MN5 A;  3T4T A;  1PIO A;  4QHC A;  3VP1 A;  3M2J A;  5DTK A;  2WGW A;  3PYP A;  3CG5 A;  4H6J B;  4KEN B;  2HDR A;  2WKE A;  2RCX A;  2V2F F;  1FIK A;  3UE1 A;  3MXR A;  3RJU A;  1OTE A;  5J8X A;  2PU2 A;  3HLE A;  3SS5 A;  3LR0 A;  3A0S A;  1K6S A;  1KGF A;  2M1C A;  3KX0 X;  5FI7 A;  1XKZ A;  3SW1 A;  1L0D A;  4ME4 A;  3ZFZ A;  4EBN A;  3LIF A;  4Q0I A;  1KOU A;  3EWK A;  1JTG A;  1P9R A;  2JKR I;  5AQ7 A;  1H8Y A;  3VP4 A;  2Q9N A;  2Y2M A;  3BLS A;  3WRZ A;  3A3E A;  4HJ3 A;  2OAQ 1;  1D1J A;  5EE8 A;  2A24 A;  3UB5 P;  3NDG A;  4Q0H A;  1XJ3 A;  1T1C A;  3MFD A;  1BTL A;  1D06 A;  2J80 A;  1EWZ A;  2XR0 A;  1ERM A;  5E2F A;  3AGD A;  2HPB A;  1LSX A;  2PRF A;  4EU0 A;  3M6H A;  3PBO A;  4BL3 A;  1LL8 A;  1GCE A;  2R78 A;  4I38 A;  3PAG A;  4M4X A;  4LFU A;  3DWK A;  3V39 A;  3KSH A;  3ZG8 B;  3PR6 A;  4BWI A;  3T4Q A;  1MWU A;  3P09 A;  1N9O A;  4O0P A;  3HLW A;  5TR7 A;  3NEC A;  1IEM A;  1K4E A;  3LR3 A;  3IF5 A;  3KYZ A;  4HP9 A;  3UE3 A;  2GDN A;  3WS1 A;  4JF4 A;  2Y2P A;  3LY3 A;  2GNX A;  3DTK A;  1SCW A;  4X6T A;  1ESU A;  3WS5 A;  5KIZ A;  3HLF A;  3IXB A;  4B93 A;  1KE3 A;  1WE4 A;  3UDI A;  1BYW A;  1OTI A;  3Q7Z A;  2D01 A;  5HZH A;  3OCL A;  3SH9 A;  4E3O A;  1PW8 A;  1PZO A;  5K5B A;  4GS9 A;  4IJG A;  3EEA A;  3WRT A;  1FCN A;  1L2S A;  1XXM A;  1X0O A;  4N1H A;  4LV3 A;  4Q8I A;  4ZJ3 A;  2Y59 A;  3T4J A;  1YSP A;  2BAS A;  2XA7 S;  4OVD A;  1GHI A;  3IWQ A;  4OPY A;  4DF6 A;  3C2W A;  1RCJ A;  1C3B A;  3V50 A;  3B3X A;  3OPH A;  3AGE A;  4EQI A;  4CLC C;  3O5Y A;  1UWN X;  4QWO A;  3W4O A;  3LGO A;  1MKM A;  1P9W A;  3HRE A;  4DE3 A;  1LL5 A;  3S4X A;  4EUZ A;  1OT9 A;  3LIC A;  5L2F A;  1GSV A;  2EX8 A;  2HJE A;  4E3N A;  2QMI A;  5CGS A;  2O9A A;  5HAI A;  5L07 A;  3C38 A;  4RA7 A;  3CPT A;  1TD5 A;  3IS2 B;  3NC8 A;  1NYY A;  1G28 A;  5CED A;  3DTE A;  1E3U D;  2QPN A;  2X71 A;  4CLC D;  4LCL A;  5CGX A;  2A49 A;  2ZM0 A;  2V8C A;  5DKK A;  3TSG A;  5FQQ A;  1D7E A;  1K25 A;  3G31 A;  3HUN A;  3BFC A;  4GCZ A;  1SZV A;  2ZOI A;  4EW7 A;  4BEN A;  2WKQ A;  3E2K A;  2H0T A;  2DRW A;  5KSC A;  3DAV A;  2I9V A;  1O07 A;  4WUJ A;  4DXC A;  1K4F A;  4IBX A;  4R23 A;  2QJ7 A;  2XD5 A;  4NEE D;  3HL9 A;  3LY4 A;  3T50 A;  1S4S A;  3UN7 A;  1IKI A;  3MKE A;  4GD8 A;  4IED A;  2P7J A;  2HDU A;  2ZC5 B;  4L9E A;  3BY8 A;  3P01 A;  3OBF A;  5DKL A;  5KZH A;  3JVU A;  4N92 A;  1SKO B;  5U47 A;  5DTS A;  3W4P A;  4DXB A;  4KG6 A;  2ZC3 B;  3MMH A;  5TJJ A;  4FD8 A;  1VET A;  3KSI A;  3LR5 A;  4I3A A;  3T1R A;  3IHA A;  1IYQ A;  2EXB A;  1ACF A;  2HP9 A;  2KOI A;  1ZKJ A;  2OWH A;  2MJ6 A;  4BBV A;  2A3U A;  5FEG A;  3VOZ A;  1TF1 A;  5DF9 A;  1BSG A;  3TE8 A;  3VOY A;  1N4O A;  1H5X A;  4WLA A;  3TRC A;  3D3O A;  2VK3 A;  1IYP A;  5I5L A;  2IWC A;  4PM8 A;  5D3O A;  1HLU P;  2ZMA A;  2KDK A;  1ALQ A;  1LHY A;  1STZ A;  4FCF A;  3BQA A;  4Y15 A;  2XLN A;  4S2N A;  4XXR A;  1XGJ A;  1YMX A;  5GL9 A;  3UMD A;  3LIE A;  1KE0 A;  3SS4 A;  1OTD A;  2FFF B;  1FCM A;  4E04 A;  3ZVT A;  1MKI A;  3SOI A;  5J4E A;  3K2N A;  4EEU A;  3NUL A;  2WK0 A;  2Q0O A;  4D60 A;  5F1F A;  3MXQ A;  5FA7 A;  1YLT A;  1RP5 A;  3A0V A;  4HJ4 A;  3GRJ A;  3LI8 A;  2XD1 A;  2VZW A;  2WKP A;  2GJ3 A;  4P6Z M;  4OOM A;  5CX7 A;  1EW0 A;  4LV0 A;  4E3L A;  5EVI A;  2JE5 A;  2Z6D A;  2ZQ7 A;  2KX6 A;  1JWP A;  3PHY A;  4ZDX A;  3O87 A;  4GZB A;  2L4R A;  2E8I A;  3UDX A;  5DF7 A;  4B4Z A;  2W27 A;  4HH3 A;  1SDN A;  1PW1 A;  3ZG9 B;  2Y91 A;  1DJA A;  2VGL M;  4IUK A;  3RXX A;  3IXH A;  1KVL A;  1N9B A;  4BQM A;  3EQV A;  1BT5 A;  1CI8 A;  4R70 A;  3LID A;  2B95 A;  3UPP A;  3VFH A;  2K31 A;  4FSF A;  3PBN A;  3MZF A;  3BEB A;  3T12 B;  1N9L A;  3VOL A;  4I39 A;  2XFT A;  3DTI A;  1FQG A;  4UEY A;  4LEN A;  4R4S A;  3NBL A;  1XP4 A;  3V3S A;  4FUW A;  5GLA A;  3NDE A;  2XH9 A;  4XT2 A;  2P9V B;  3PXP A;  2ZL1 A;  4JBF A;  5IHV A;  4OQH A;  4ARZ A;  4Y5F A;  1SHV A;  2V0U A;  5EVI C;  1VM1 A;  4JKT A;  4QB8 A;  2PU4 A;  1LI9 A;  2W1T B;  5FDS A;  3LUQ A;  3UB9 A;  3V5M A;  2H5S A;  1MY8 A;  3H9W A;  2E8J A;  4GNU A;  3O3V A;  3KSG A;  4KQO A;  2WAD A;  2V9A A;  1G5U A;  4G3V A;  4JGR A;  1ES3 A;  4S2M A;  4EES A;  1NWZ A;  3E2L A;  5MC7 A;  1MWT A;  2ZC6 B;  4E6W A;  4PMA A;  1KVM A;  1S67 L;  4X56 A;  3HCY A;  4QD4 A;  4X1M A;  4WF0 A;  4WN5 A;  1I2S A;  1FR6 A;  4IHQ A;  1XFN A;  3C5A A;  1K57 C;  3T1Q B;  3UPN A;  2WZX A;  4FH2 A;  2O9B A;  5AJG A;  2B02 A;  4RX3 A;  2V1Z A;  2VGK A;  3Q7V A;  1MC0 A;  1LSV A;  2WAE A;  3U2A A;  4HNB A;  2V20 A;  2Y2H A;  5EVL A;  5HDS A;  3VSK A;  2G2W A;  5CGW A;  4WZ5 A;  4F94 A;  4EBP A;  3D4F A;  4BD1 A;  4I3J A;  3A3F A;  3C4O A;  4GB7 A;  5EM1 A;  3Q81 A;  5F1G A;  4CPK A;  1V9Z A;  3NOU C;  3IF6 B;  3PBT A;  4Y7P A;  1TDG A;  3BW6 A;  2Y2N A;  3PBS A;  2HGV A;  1ESI A;  4Y0O A;  4EV4 A;  5FDH A;  2WKH A;  3C4P A;  3UY6 A;  4H6J A;  1BLP A;  2PR6 A;  3ZCZ A;  3R7W B;  2H28 A;  3VFF A;  3TJZ C;  3MZE A;  4LV2 A;  2W3G A;  4PKY G;  3UNW A;  3LFV A;  3Q82 A;  1L0F A;  3JPU A;  1I2W A;  4GDN A;  5JYP A;  3L7H A;  5C5K A;  2HP5 A;  4XUZ A;  1YKD A;  1AXB A;  3ULF A;  4HHD A;  4E6X A;  5L10 A;  5CER A;  3OLO A;  4ZJ1 A;  3GSG A;  3VP0 A;  4DRT A;  2ZJ9 A;  4EWF A;  4RYE A;  4NXF A;  2Z6C A;  2B5R A;  3CMZ A;  2ZQD A;  4PAU A;  1E3U A;  4I3I A;  3UO9 A;  2R9X A;  4CLC A;  3C8C A;  3BRM A;  4WZ5 C;  1WYC A;  4D2O A;  4PPR A;  3BEC A;  1W7F A;  3QNC A;  3B42 A;  2Y2O A;  1ZG4 A;  2Y8H A;  5F5Y A;  3I7J A;  2VV6 A;  5E2E A;  5FAT A;  3C30 A;  1L0E A;  1NRJ A;  4MLL A;  5M18 A;  5GLB A;  1OTA A;  2PAV P;  4PHT A;  4DMZ A;  4Y13 A;  2VV7 A;  1XPB A;  3H82 A;  3V3R A;  2PHY A;  3ZG7 B;  4LLO B;  5G4Y A;  4GLQ A;  3E98 A;  1HTZ A;  2JN7 A;  1CEG A;  2HDS A;  1OT6 A;  1VQQ A;  1Y54 A;  3FYZ A;  5EEC A;  4OPQ A;  4NKP A;  4I5S A;  4GJ4 A;  3GDI A;  2QWS A;  1BLC A;  4KZA A;  2XEP A;  5F68 A;  5TFQ A;  2JCH A;  4KUK A;  3T4S A;  1QMF A;  3IXG A;  3GMW A;  1E4D A;  3MQO A;  3RTY A;  3KO6 A;  4OQG A;  1FSY A;  1NZO A;  4K0X A;  1BUE A;  2A2L A;  4YNR A;  5F83 A;  4EER A;  3PBQ A;  1E25 A;  4KUO A;  4UAA A;  2GZA A;  5CTM A;  1K6R A;  4R4R A;  3Q07 A;  4DDS A;  4RVA A;  4P6B A;  2J3W A;  3FPV A;  2Y2G A;  5HW3 A;  1J9M A;  4JXV A;  3BFF A;  1NJ4 A;  3NI9 A;  1GHM A;  2BG1 A;  3IH8 A;  1L3L A;  4KZ8 A;  5FQJ A;  3NHQ A;  3N8L A;  1IEL A;  3IS2 A;  3K3D A;  2XQZ A;  2W3F A;  1PI4 A;  2HV1 A;  4Y0T A;  1YLZ A;  3N8S A;  5G18 A;  3MJQ A;  5CTN A;  3UME A;  2PBD P;  1P97 A;  1WYB A;  4ZRR A;  4IBR A;  4O7D A;  5HD3 A;  2O0Y A;  3ICY A;  3VP2 A;  4OOL A;  3MR0 A;  5L09 A;  1N9N A;  4MN6 A;  4L0L A;  2H0Y A;  4UQI M;  1ERO A;  2HZ5 A;  2ZC7 A;  5TBM B;  1ERQ A;  3UB7 A;  1CI9 A;  3ZNY A;  3OPP A;  3NY4 A;  3ZYT A;  4F3L B;  5DF8 A;  2GX5 A;  5FL3 A;  3UB6 A;  4O01 A;  1YSQ A;  2WKI A;  5AQB A;  2CC1 A;  3OCN A;  3H7W B;  3F1O B;  4U0X A;  1GSW A;  3SZT A;  4WYY A;  2XGN A;  1KDW A;  4Z1W A;  1TEM A;  3DWZ A;  3GTC A;  3BFD A;  2DCF A;  2JKG A;  5J3W A;  2Y2I A;  4BBU A;  4DKI A;  3S1Y A;  1QME A;  4R6L A;  4X68 A;  3VMA A;  2QKP A;  1EI5 A;  3HLD A;  2G7U A;  1XFQ A;  3MF0 A;  5CRF A;  3HUM A;  4YIN A;  2FH5 A;  1H8Z A;  4M3K A;  5G4Z A;  5CHM A;  1ZC2 A;  4UA9 A;  4X1L A;  2WUQ A;  3PAE A;  3QP5 A;  4EEP A;  1YLP A;  1UWP X;  2ZBB A;  1W79 A;  3C7U A;  3S7P A;  4KQQ A;  5HWW A;  3MFX A;  3WS4 A;  5AVE A;  3CIT A;  3DBA A;  3LEQ A;  4LRX C;  1H8M A;  3HUO A;  5FAO A;  3VE3 A;  1Y4O A;  4HP4 A;  4HOI A;  1BUL A;  2W3H A;  2OLU A;  4YOF A;  4P85 A;  1TS6 A;  4BL2 A;  1JVJ A;  4S2L A;  3GEC A;  5DFX A;  1PWC A;  3HVF A;  3WS0 A;  1G6O A;  4HH2 A;  3E4Q A;  3QP2 A;  2NUT C;  5GLD A;  4HIA A;  3LYX A;  4MBH A;  5E2H A;  3BQ8 A;  2JC7 A;  2JKT I;  4PKY A;  1NXY A;  1XJ2 A;  1SKF A;  2PYP A;  1NLY A;  2EFU A;  5HPI A;  4OOY A;  3W2Z A;  2VJW A;  2ZM2 A;  1VEU B;  4OQ0 A;  2VKS A;  3IWI A;  4RQ9 A;  1W5D A;  3MBZ A;  5HAP A;  3QP1 A;  5DJT A;  3A3D A;  4IUH A;  3C7V A;  3PTE A;  1CF0 A;  5CEC A;  4IVK A;  4OP8 A;  4BBT A;  3GQZ A;  3VE4 A;  5M19 A;  5AQ9 A;  1T1A A;  4OH0 A;  4CJN A;  4BD0 A;  3FKV A;  3CJM A;  4DE0 A;  1H3Q A;  4S2O A;  1XX2 A;  1S6R A;  3A3J A;  3OC2 A;  3T4K A;  2EXA A;  5HX9 A;  1XA1 A;  4DJ2 A;  1VB6 A;  4C6Y A;  4H8R A;  5KSH A;  4MDZ A;  1VHM A;  3EGX C;  1GA0 A;  5CXW A;  1NRF A;  3NJA A;  4FOF A;  1M40 A;  3LCE A;  1S0W A;  1YLY A;  2OLV A;  2WKR A;  1KDS A;  4N1X A;  5A91 A;  1K0K A;  1BLS A;  4CQH A;  4B9O A;  3T4O A;  4HES A;  3OZH A;  5A90 A;  4MEZ A;  3IHB A;  4QY6 A;  1K57 A;  4UA7 A;  3TOI A;  3VSL A;  5EV0 A;  2P04 A;  4OPZ A;  4ID4 A;  5L8M A;  4N9K A;  2W0N A;  5CHJ A;  3ZVW A;  3UPO A;  3IBJ A;  4OPR A;  1F9I A;  4JF6 A;  1DP8 A;  3QP4 A;  2J7V A;  4XUX A;  4PM5 A;  3QNB A;  3OPR A;  2XSS A;  4GHI B;  3BFG A;  3DW0 A;  5FAP A;  3G2Z A;  5HAR A;  2P9V A;  2VGJ A;  2EX2 A;  4RX2 A;  5F69 A;  2X02 A;  1LSW A;  3ZDJ A;  5HDD A;  2J9P A;  2PDR A;  3BJN A;  5GLC A;  1P0Z A;  1S1Z A;  4AFI A;  4WEL A;  3WS2 A;  3KYE A;  1JNU A;  1K54 C;  2P08 A;  2W1T A;  4OQI A;  4R1G A;  5JYO A;  2ZMV A;  1K56 D;  4HJ6 A;  5M1A A;  4L9F A;  1XGI A;  2EFX A;  2XRO A;  1MXO A;  4NXB A;  1ONG A;  3D72 A;  3O86 A;  3ZQ5 A;  3LO7 A;  3GV9 A;  4N9L A;  4GW9 A;  3GR2 A;  4QPR A;  4MCW A;  4FH4 A;  3CI6 A;  2YKF A;  1T1B A;  1BLH A;  3ITB A;  4ETX A;  2O9C A;  4G3W A;  3WWX A;  1F5M A;  2VLG A;  4QU3 A;  4X69 A;  2UWX A;  3RH8 B;  1TS8 A;  3SH7 A;  2Y2J A;  4EET B;  5BOH A;  4OP5 A;  2XA7 M;  3BWL A;  1A0K A;  2H10 A;  3F1P B;  4KQR A;  4OON A;  3U4L P;  4YFM A;  4UA6 A;  2K7S A;  3CWF A;  4OKP A;  3R4K A;  3A3I A;  3F1N B;  3E0Y A;  4HBT A;  3N7W A;  5AQA A;  4WMC D;  1JWZ A;  4MN7 A;  2L1M A;  5FEF A;  1Z09 A;  4R3A A;  3IWO A;  2W3D A;  2FFY A;  3E4O A;  2Z2L B;  4WZ4 A;  4JXW A;  5IS1 A;  4P87 A;  1Z6F A;  2QZ6 A;  4E3I A;  3BYD A;  2WGW B;  1PRQ A;  2K2N A;  4II7 A;  4Y3I A;  2VA0 A;  3TG9 A;  1CQA A;  4QJG A;  1DRM A;  2V1B A;  3LR4 A;  3IF6 A;  2V0W A;  1RGY A;  4P6Z S;  4G3K A;  1JTD A;  1F2K A;  1YT4 A;  1V9Y A;  3IXD A;  2D02 A;  2Z2M B;  2Y4A A;  4X25 A;  3ITA A;  4NXE A;  4R3B A;  3R7W A;  2VX8 A;  1YAX A;  1RGZ A;  4Q0J A;  3W4Q A;  2JKR M;  5HL1 A;  2ZD8 A;  2Q9M A;  2W1R A;  1AWI A;  3FZC A;  4NXG A;  4LGW A;  2VGL S;  4JLF A;  2Y2L A;  2A24 B;  4K08 A; 
#chains in the Genus database with same CATH homology
 4KZ8 A;  5FQJ A;  4Z9Q A;  5GHZ A;  1IKG A;  1TVF A;  5D3O A;  1LL9 A;  2ZMA A;  3N8L A;  1IEL A;  2ZQ8 A;  2ZQ9 A;  1ALQ A;  3HLG A;  1LHY A;  3UDF A;  4FCF A;  3RXW A;  4OLG A;  2XQZ A;  5CHU A;  4NET A;  1PI4 A;  1MBL A;  5GHY A;  4Y0T A;  1YLZ A;  3N8S A;  5G18 A;  5DVA A;  2ZQC A;  2EX6 A;  4WBG A;  2XLN A;  3CZD A;  1LI0 A;  4S2N A;  4XXR A;  5CTN A;  1XGJ A;  1YMX A;  3G34 A;  5GL9 A;  1WYB A;  5F82 A;  1I5Q A;  5TGF A;  4IBR A;  1KE0 A;  4JXG A;  1DJC A;  4O7D A;  4PM7 A;  3SS4 A;  4KG5 A;  3W8K A;  3VP2 A;  2FFF B;  1LLB A;  4OOL A;  1FCM A;  3FWL A;  3ZVT A;  5EOO A;  1MKI A;  1M6K A;  4S2J A;  4S2P A;  4WEJ A;  3SOI A;  2WGI A;  5FQK A;  4L0L A;  4PM9 A;  1MPL A;  2H0Y A;  2WK0 A;  1XA7 A;  3AGF A;  5F1F A;  4MNR A;  1JWV A;  3UE0 A;  1MWR A;  1ERO A;  2XK1 A;  3SS3 A;  4A5R A;  1ES2 A;  4PM6 A;  3FV7 A;  2ZC7 A;  5EVI D;  1ERQ A;  5FA7 A;  1YLT A;  4BLM A;  1RP5 A;  4C75 A;  1CI9 A;  3N8R A;  1NY0 A;  4P0M A;  3ZG5 A;  3GRJ A;  3IF6 C;  5FQ9 A;  3ZNY A;  1W8Q A;  1TDL A;  2XD1 A;  1YLW A;  1GA9 A;  3OPP A;  2Y2Q A;  5HFO A;  4KZ5 A;  3NY4 A;  4IVI A;  4OOM A;  5DF8 A;  3Q7V B;  4LV0 A;  2OV5 A;  4E3L A;  5EVI A;  2JE5 A;  4HBU A;  4Y0U A;  1YLJ A;  4JF5 A;  2ZQ7 A;  1IYO A;  1JWP A;  4MBK A;  3IH9 A;  2R9W A;  2WKI A;  3N4I A;  4LCM A;  5AQB A;  3O87 A;  4GZB A;  4ZBE A;  4ZDX A;  1HZO A;  2CC1 A;  3OCN A;  2E8I A;  1SDE A;  3UDX A;  1ES5 A;  2J8Y A;  3HLC A;  4KZ3 A;  4U0X A;  4X53 A;  4WYY A;  2XGN A;  1KDW A;  5DF7 A;  4B4Z A;  4NK3 A;  4GKU A;  1PWD A;  4E3J A;  1OME A;  4ZAM A;  4E3K A;  1TEM A;  3M6B A;  1PI5 A;  3DWZ A;  1SDN A;  3G35 A;  1W8Y A;  3MXS A;  1PW1 A;  3BFD A;  1YM1 A;  3GTC A;  3LEZ A;  5FI2 A;  3ZG9 B;  4R3J A;  2Y91 A;  1DJA A;  3QHY A;  2DCF A;  3NCK A;  3PBR A;  3RXX A;  3IXH A;  2EX9 A;  1KVL A;  1N9B A;  2Y2I A;  4DKI A;  4DDY A;  3S1Y A;  3ZNT A;  1PIO A;  4BQM A;  1ONH A;  4QHC A;  1QME A;  3EQV A;  4X68 A;  1BT5 A;  3VMA A;  1CI8 A;  2RL3 A;  1EI5 A;  3VP1 A;  3HLD A;  3M2J A;  3UPP A;  3VFH A;  5DTK A;  5I94 A;  4FSF A;  3PBN A;  2WGW A;  4KG2 A;  3CG5 A;  5CRF A;  3N6I A;  4GOG A;  3MZF A;  2J9O A;  3BEB A;  3HUM A;  4YIN A;  4KEN B;  1H8Z A;  4M3K A;  2XFT A;  5CHM A;  2HDR A;  1ZC2 A;  2WKE A;  2RCX A;  2V2F F;  4UA9 A;  3Q1F A;  3UE1 A;  2WUQ A;  3MXR A;  3PAE A;  5HAQ A;  1ES4 A;  1FQG A;  3JYI A;  1YLP A;  3RJU A;  4LEN A;  4ZTK A;  2Y2K A;  5J8X A;  1W79 A;  2PU2 A;  3C7U A;  4KQQ A;  4B4X A;  3HLE A;  3SS5 A;  5A93 A;  4R4S A;  3WS4 A;  3NBL A;  2WYX A;  3ISG A;  1XP4 A;  1K6S A;  3V3S A;  5GLA A;  3M2K A;  3NDE A;  1KGF A;  2XH9 A;  5FI7 A;  1XKZ A;  3HUO A;  5FAO A;  1L0D A;  3ZFZ A;  4EBN A;  2P9V B;  3MZD A;  1NYM A;  4GD6 A;  1JTG A;  1BUL A;  4JBF A;  5AQ7 A;  5IHV A;  2OLU A;  4P85 A;  1H8Y A;  4KZ6 A;  4OQH A;  2Q9N A;  2Y2M A;  3BLS A;  3VP4 A;  3A3E A;  3WRZ A;  4BL2 A;  3G4P A;  1JVJ A;  1PZP A;  4S2L A;  2P74 A;  1PWC A;  1U60 A;  3HVF A;  3WS0 A;  1SHV A;  5EE8 A;  4UHU A;  1K38 A;  5EVI C;  1VM1 A;  4JKT A;  4QB8 A;  5GLD A;  2PU4 A;  3NDG A;  1LI9 A;  2ZC4 B;  4MBH A;  2JC7 A;  5E2H A;  1NXY A;  4S2K A;  1YMS A;  3MFD A;  1BTL A;  1SKF A;  5E2G A;  3V5M A;  2H5S A;  1EWZ A;  1MY8 A;  2XR0 A;  2EFU A;  1ERM A;  4OOY A;  1MWS A;  5E2F A;  3AGD A;  2HPB A;  1PWG A;  2ZM2 A;  3M6H A;  4GNU A;  3PBO A;  4BL3 A;  4OQ0 A;  1CEF A;  1GCE A;  3IWI A;  3O3V A;  1W5D A;  4KQO A;  3MBZ A;  3PAG A;  4KZB A;  2WAD A;  5HAP A;  1ES3 A;  1HVB A;  3A3D A;  3DWK A;  3V39 A;  4S2M A;  3C7V A;  3ZG8 B;  3PTE A;  3E2L A;  3IT9 A;  5CEC A;  4IVK A;  2JBF A;  4OP8 A;  4ZJ2 A;  1MWT A;  2ZC6 B;  4B88 A;  3GQZ A;  4E6W A;  5M19 A;  4PMA A;  2IWD A;  1MWU A;  1KVM A;  5AQ9 A;  4X56 A;  3P09 A;  4OH0 A;  4QD4 A;  4CJN A;  5EOE A;  4BD0 A;  3FKV A;  1CK3 A;  3HLW A;  5TR7 A;  3CJM A;  1I2S A;  1FR6 A;  1IEM A;  4DE0 A;  4EBL A;  4S2O A;  3C5A A;  1K4E A;  1S6R A;  1XX2 A;  1K57 C;  3A3J A;  3IF5 A;  3OC2 A;  2EXA A;  5HX9 A;  3UE3 A;  3UPN A;  2WZX A;  1KGG A;  1XA1 A;  4FH2 A;  1YQS A;  1Q2P A;  2GDN A;  3HBR A;  4JF4 A;  2Y2P A;  3WS1 A;  4RX3 A;  2V1Z A;  2VGK A;  3LY3 A;  3Q7V A;  5E43 A;  4C6Y A;  2WAE A;  4H8R A;  5KSH A;  1SCW A;  4X6T A;  4E3M A;  1ESU A;  2V20 A;  2Y2H A;  3WS5 A;  2HP6 A;  3G2Y A;  5EVL A;  3VSK A;  1GA0 A;  2WZZ A;  3HLF A;  2G2W A;  1K55 C;  3IXB A;  5CGW A;  5CXW A;  3O88 A;  1KE3 A;  1NRF A;  4WZ5 A;  1WE4 A;  3UDI A;  1FSW A;  4F94 A;  3Q7Z A;  4KZ9 A;  3BM6 A;  1M40 A;  1BZA A;  4EBP A;  5A92 A;  3VP3 A;  3D4F A;  1S0W A;  3LCE A;  4BD1 A;  1YLY A;  3OCL A;  3A3F A;  2OLV A;  3SH9 A;  3C4O A;  4E3O A;  1PW8 A;  1KDS A;  4N1X A;  4GB7 A;  5A91 A;  1BLS A;  1PZO A;  3HLB A;  4KZ7 A;  3Q81 A;  4HES A;  3OZH A;  1FCN A;  5F1G A;  3WRT A;  5A90 A;  4MEZ A;  1L2S A;  1XXM A;  4CPK A;  3IF6 B;  3PBT A;  4N1H A;  4Y7P A;  1TDG A;  4LV3 A;  4Q8I A;  1O7E A;  4ZJ3 A;  2Y59 A;  3IHB A;  2Y2N A;  4QY6 A;  1K57 A;  4UA7 A;  2ZM8 A;  3PBS A;  3TOI A;  3VSL A;  1ESI A;  4OPZ A;  4Y0O A;  4EV4 A;  4ID4 A;  2WGV A;  4OVD A;  1GHI A;  5FDH A;  3IWQ A;  4OLD A;  2WKH A;  4OPY A;  3GVB A;  5FAS A;  3C4P A;  4N9K A;  3UY6 A;  4DF6 A;  1RCJ A;  2XFS A;  3ZGA B;  1C3B A;  1BLP A;  3S22 A;  1PYY A;  3B3X A;  3OPH A;  3AGE A;  3V50 A;  3ZCZ A;  4EQI A;  5CHJ A;  3ZVW A;  4DE2 A;  3UPO A;  3VFF A;  3W4O A;  3MZE A;  4OPR A;  4R0Q A;  4JF6 A;  4LV2 A;  3HRE A;  2J7V A;  3UNW A;  4DE3 A;  1LL5 A;  3Q82 A;  4XUX A;  5FQI A;  3QNB A;  3S4X A;  4PM5 A;  4EUZ A;  1L0F A;  3OPR A;  5EUA A;  1I2W A;  4GDN A;  5L2F A;  5JYP A;  3BFG A;  3DW0 A;  2EX8 A;  5FAP A;  3G2Z A;  4E3N A;  2QMI A;  2HP5 A;  5HAR A;  5CGS A;  4XUZ A;  2P9V A;  2VGJ A;  2XF3 A;  2EX2 A;  5HAI A;  1AXB A;  3ZG0 A;  4RX2 A;  2X02 A;  4E6X A;  5FAQ A;  4HEF A;  3ZDJ A;  3DTM A;  4WM9 A;  4ZJ1 A;  4RA7 A;  5CER A;  4BJP A;  3GSG A;  3NC8 A;  3VP0 A;  1NYY A;  2J9P A;  4C3Q A;  4DRT A;  2ZJ9 A;  5GLC A;  4EWF A;  5CED A;  1E3U D;  2QPN A;  4JXS A;  4RYE A;  4WEL A;  2X71 A;  3MKF A;  3WS2 A;  4GN2 A;  1KE4 A;  4LCL A;  1GHM A;  4GDB A;  1K54 C;  5CGX A;  2WAF A;  2IWB A;  2A49 A;  2B5R A;  3CMZ A;  2ZQD A;  4KZ4 A;  2HDQ A;  3IQA A;  1E3U A;  2ZM0 A;  5FQM A;  4OQI A;  3UO9 A;  2R9X A;  2ZLY A;  4R1G A;  3BRM A;  4WZ5 C;  5JYO A;  4DE1 A;  1K56 D;  1IYS A;  3TSG A;  5M1A A;  5FQQ A;  1WYC A;  5KMW A;  4D2O A;  4PPR A;  1G68 A;  1FR1 A;  1XGI A;  2EFX A;  3BEC A;  1MXO A;  2C5W B;  1W7F A;  3QNC A;  5FI6 A;  1ONG A;  3O86 A;  4QY5 A;  4MBF A;  1K56 A;  1K25 A;  3LO7 A;  2Y2O A;  3GV9 A;  1ZG4 A;  3G31 A;  3HUN A;  4N9L A;  3BFC A;  3GR2 A;  3I7J A;  5E2E A;  3ZHH A;  5FAT A;  2ZQA A;  4FH4 A;  4BEN A;  4K91 A;  3E2K A;  2H0T A;  1BLH A;  1L0E A;  2DRW A;  3ITB A;  2Y55 A;  5KSC A;  3WWX A;  4MLL A;  1O07 A;  4QU3 A;  4X69 A;  4DXC A;  2UWX A;  1L0G A;  5EVI B;  1K4F A;  4IBX A;  1K55 A;  4R23 A;  3SH7 A;  2Y2J A;  5FSR A;  5BOH A;  4OP5 A;  2G2U A;  2XD5 A;  5M18 A;  5GLB A;  1FOF A;  1NZU A;  2H10 A;  3HL9 A;  4KQR A;  4OON A;  4YFM A;  3LY4 A;  4UA6 A;  1KGE A;  1K54 A;  4OKP A;  4X55 A;  2X01 A;  3A3I A;  3UN7 A;  1XPB A;  1IKI A;  3MKE A;  3V3R A;  2BG1 A;  4HBT A;  5CEB A;  4GD8 A;  4K0W A;  3BLM A;  4IED A;  3N7W A;  4U0T A;  5AQA A;  3ZG7 B;  2HDU A;  2ZC5 B;  4WMC D;  1JWZ A;  4LV1 A;  4U3T A;  2XDM A;  5KZH A;  1HTZ A;  5EPH A;  4DXB A;  3IWO A;  4N92 A;  5U47 A;  1FCO A;  5DTS A;  1CEG A;  4KG6 A;  3W4P A;  2FFY A;  2HDS A;  2ZC3 B;  1Y54 A;  1VQQ A;  3FYZ A;  4WMC A;  4FD8 A;  2Z2L B;  4WZ4 A;  4JXW A;  5EEC A;  1GHP A;  3EQU A;  1DJB A;  4OPQ A;  3OPL A;  4P87 A;  1Z6F A;  2QZ6 A;  2I72 A;  3P98 A;  3IHA A;  1IYQ A;  4E3I A;  3BYD A;  2WGW B;  1BLC A;  4KZA A;  2EXB A;  2XEP A;  2HP9 A;  5TFQ A;  2OSU A;  1ZKJ A;  2JCH A;  3TG9 A;  1QMF A;  3IXG A;  4QJG A;  2DNS A;  3GMW A;  2A3U A;  1E4D A;  3IF6 A;  1RGY A;  1HD8 A;  2PBY A;  1JTD A;  3BFE A;  3VOZ A;  1YT4 A;  4OQG A;  5DF9 A;  1FSY A;  1BSG A;  1NZO A;  4S2I A;  4K0X A;  1BUE A;  2C6W B;  3VOY A;  4S2N C;  1N4O A;  3IXD A;  1H5X A;  2Z2M B;  3FKW A;  4WEK A;  2Y4A A;  1ZG6 A;  1DY6 A;  3ITA A;  5F83 A;  3PBQ A;  1E25 A;  4UAA A;  5CTM A;  4R3B A;  1K6R A;  4R4R A;  3Q07 A;  4DDS A;  2BLS A;  3NIA A;  4RVA A;  1RGZ A;  3W4Q A;  5HL1 A;  4P6B A;  2ZD8 A;  2Q9M A;  2Y2G A;  5HW3 A;  1J9M A;  4JXV A;  5GHX A;  3SH8 A;  3FZC A;  1IYP A;  3BFF A;  1NJ4 A;  3G32 A;  3G30 A;  3NI9 A;  4JPM A;  5DTT A;  2IWC A;  4JLF A;  2Y2L A;  1G6A A;  3IH8 A;  1Q2Q A;  4PM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...