1XKZA

Crystal structure of the acylated beta-lactam sensor domain of blar1 from s. aureus
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
245
structure length
244
Chain Sequence
NYKKPLHNDYQILDKSKIFGSNSGSFVMYSMKKDKYYIYNEKESRKRYSPNSTYKIYLAMFGLDRHIINDENSRMSWNHKHYPFDAWNKEQDLNTAMQNSVNWYFERISDQIPKNYTATQLKQLNYGNKNLGSYKSYWMEDSLKISNLEQVIVFKNMMEQNHFSKKAKNQLSSSLLIKKNEKYELYGKTGTGIVNGKYNNGWFVGYVITNHDKYYFATHLSDGKPSGKNAELISEKILKEMGVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title X-ray crystal structure of the acylated beta-lactam sensor domain of BlaR1 from Staphylococcus aureus and the mechanism of receptor activation for signal transduction
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Signaling protein
molecule keywords Regulatory protein blaR1
total genus 81
structure length 244
sequence length 245
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1xkzA00
3BYDA 4JXWA 4DE1A 1ZC2A 3NY4A 5FQQA 4E3NA 3QNBA 5GLAA 3N7WA 3ITAA 1FOFA 2XD1A 1K56D 2WAEA 1K54A 3BFFA 1YT4A 1ES3A 2Y91A 2VGJA 4R0QA 4IEDA 4JLFA 1BLHA 1IKGA 2ZLYA 5IHVA 2Y4AA 2BG1A 2RL3A 4OPQA 4P85A 5U47A 4UA6A 3MXSA 2DNSA 1WYCA 4LV0A 1PI4A 3HLCA 3WS5A 1NXYA 4H8RA 5DTSA 3SS4A 3M6HA 4KZ8A 4GN2A 1YLYA 3IF6C 4K0XA 4KZ5A 4R1GA 2ZC4B 5FQMA 5CEDA 3B3XA 3O86A 1IYQA 4OKPA 3IWIA 2A3UA 4X68A 4XUZA 5KSCA 2IWDA 2V1ZA 2WGWA 4MBKA 3P98A 1WE4A 3BEBA 5GLDA 1ESIA 3FYZA 3G2YA 3C4PA 5F1GA 2JE5A 3VFHA 1L0GA 1FCNA 3IHAA 1PZPA 5FI2A 2DCFA 4DDYA 4S2IA 4LCMA 3G4PA 4HBUA 3HLFA 4EV4A 3G31A 3MZEA 1FR1A 2Y2PA 1Q2PA 3BRMA 4OOYA 1RGZA 3JYIA 4S2LA 5E2HA 4XUXA 4KG2A 1CK3A 3BLSA 1O7EA 5M18A 1MKIA 1NZOA 4S2JA 4E3JA 1L0EA 3N8LA 4UAAA 5FATA 1KDWA 2XLNA 3CJMA 4GD8A 4S2PA 2OV5A 5CHUA 3O87A 4JKTA 2Y2OA 5AQAA 4DE2A 1K57A 2OSUA 1MWRA 4LV1A 4R4RA 2ZJ9A 2J8YA 1J9MA 1KE4A 2OLUA 5DTKA 4RA7A 5FQ9A 1CI8A 5FDHA 1PI5A 4IVKA 3IXGA 4OVDA 4B4ZA 3OC2A 3ZG0A 2ZM8A 1MWUA 3GSGA 4WEJA 1GA9A 1W8YA 1RGYA 2Y2KA 1YLWA 1PWDA 2WZXA 3HLWA 3LO7A 5AQ9A 3M2KA 3Q1FA 5EVIA 3ZDJA 1CEGA 3SS3A 1XKZA 5FQIA 5HAQA 2H0TA 2HP9A 1FSYA 2XH9A 3N8RA 3MFDA 3RXWA 1OMEA 1HD8A 4WZ5C 2P74A 2ZQAA 3AGEA 2HDRA 2Y2GA 3EQVA 3BLMA 3MZDA 3GTCA 4GKUA 4KZAA 1JWVA 5GL9A 3UY6A 1K6RA 1YLZA 3PBNA 4DRTA 1ZKJA 3NDGA 5CGWA 4EBPA 1K55C 3AGDA 5CECA 1KGGA 3G34A 4RVAA 5HX9A 2ZC6B 4OLDA 3UO9A 3ZG7B 5HL1A 2IWCA 1IYOA 5HARA 3ZG9B 2B5RA 3M2JA 2JCHA 3FZCA 4ZJ1A 1G6AA 3SS5A 1MWSA 1PWGA 3CG5A 1L2SA 4DDSA 4EUZA 4QJGA 3LY4A 1N4OA 1K25A 1YMSA 3O3VA 1NJ4A 5TR7A 4N9KA 3A3IA 5HW3A 2R9WA 3CMZA 4MLLA 3W4PA 3IXDA 3OPPA 3PBRA 4X6TA 1ZG6A 3DWZA 1NYYA 3W4QA 4HEFA 2J7VA 1KVMA 3Q7VA 1PIOA 3WRTA 5CTMA 3SH7A 3HLEA 3WS1A 1MXOA 5CERA 2ZM2A 1K38A 1MBLA 3VP0A 5E2FA 1YLPA 5FAOA 4GNUA 2WYXA 1ALQA 3MKEA 2Y55A 3VP4A 3ITBA 1DY6A 1ES5A 5CRFA 5CXWA 1XPBA 1FCOA 1ESUA 4ZJ2A 1ES4A 3M6BA 2VGKA 2E8IA 2J9PA 3UDXA 1PWCA 5DF9A 1XA1A 1W5DA 4B88A 2ZC3B 5FI6A 3NCKA 1PZOA 1LLBA 2WADA 3UN7A 5A91A 3UNWA 4MBFA 1H8ZA 1GCEA 3BFDA 3PAEA 5FASA 4GB7A 1HTZA 5M1AA 2EXAA 2R9XA 4FCFA 3N6IA 1W8QA 1Y54A 1ERQA 2BLSA 4KZBA 1IKIA 3A3FA 4WYYA 5HAIA 1EWZA 4Y0UA 1L0FA 3ZNYA 5AQBA 3W8KA 3HLDA 4BENA 4S2OA 4GD6A 4OPZA 4S2NC 1K55A 1RP5A 3G30A 4P87A 2J9OA 4R4SA 4FH4A 4BQMA 2JC7A 3A3EA 1XA7A 1NY0A 2X71A 1DJBA 4C3QA 1BLCA 4RX2A 4RX3A 4Y0TA 5EVLA 3ZG8B 2HP6A 4WELA 1JTGA 4OQHA 4C6YA 4U0XA 1XX2A 1BSGA 1HZOA 2Y2HA 5HFOA 1K6SA 2H10A 4E6XA 1I2SA 1CEFA 4FD8A 1RCJA 3VMAA 5A90A 5JYPA 2ZC5B 5GHZA 4QY6A 4OQGA 3SH9A 2Z2LB 4CJNA 4OPRA 1QMEA 2P9VA 3SOIA 1SKFA 4EQIA 1ERMA 2C6WB 2RCXA 4OH0A 3D4FA 3QNCA 1C3BA 4UHUA 2WAFA 3V3RA 5JYOA 3BECA 3BM6A 4QHCA 5A92A 4OPYA 5F83A 1YM1A 1XGJA 5GHXA 1H5XA 1TEMA 1BUEA 1K57C 1EI5A 3EQUA 2OLVA 3WWXA 3BFCA 3GR2A 4M3KA 3VP2A 5F82A 4R23A 5CGXA 4OONA 1CI9A 4U3TA 4NETA 4WZ5A 4ZDXA 4JXSA 4GDNA 2Y59A 1MY8A 4IVIA 4BL3A 5EVIC 2ZQ9A 1I5QA 4X55A 5F1FA 4KZ7A 1QMFA 4E3MA 2FFFB 2WZZA 5FQJA 1M6KA 1K4FA 3BFGA 2V2FF 1XXMA 4YFMA 1IELA 3RXXA 4E3LA 2PBYA 4KENB 4X69A 2IWBA 2V20A 3HUMA 2ZD8A 4F94A 1LHYA 1ONHA 4PM7A 3MXRA 5EPHA 5FSRA 4DXCA 3IQAA 4KQRA 4LENA 1W7FA 3NC8A 3ZG5A 5A93A 4Y7PA 4ZBEA 3Q82A 1GHIA 2XF3A 1BT5A 1KGEA 3UPPA 3HLBA 3WS2A 5HAPA 1YMXA 3P09A 4P0MA 3NIAA 4DE3A 2JBFA 4WZ4A 5EECA 4OOMA 3UDIA 2EXBA 1K56A 3PBOA 3V50A 3WS0A 1M40A 1ES2A 3A3JA 3C4OA 2ZMAA 3RJUA 5BOHA 4OOLA 2XD5A 3DWKA 4K91A 2CC1A 5KSHA 2H0YA 3O88A 3MBZA 4KZ9A 1EROA 1FR6A 4OQ0A 4O7DA 2WKHA 4UA7A 4MBHA 4IBRA 4HBTA 3PBTA 1IYSA 4N92A 3OCNA 4PM6A 2HDSA 4GZBA 5DF7A 4ZAMA 4KZ6A 3ISGA 1E3UD 2H5SA 4DKIA 5CEBA 1YQSA 3IF6A 1PW1A 2XK1A 3NI9A 3ZCZA 2QMIA 4WMCD 4KZ4A 3IWQA 5FQKA 3WRZA 5EUAA 3A3DA 3Q7ZA 2EX9A 1IEMA 2EX2A 1GA0A 3FKVA 4X53A 4BD0A 3E2KA 1AXBA 3IXBA 1U60A 2WKEA 4EBNA 2ZM0A 3UE0A 2X01A 3HBRA 5FAPA 5J8XA 5L2FA 5FI7A 1H8YA 3Q7VB 5EE8A 4JXGA 4KQQA 3WS4A 4PMAA 5EOEA 3ZVTA 5I94A 1E3UA 3E2LA 3PBQA 1LI9A 1KVLA 2Q9MA 1DJAA 1TVFA 4OP8A 4N9LA 3BFEA 4K0WA 1BLSA 5D3OA 4MEZA 3ZVWA 5KMWA 2EFXA 2ZQ7A 3DW0A 3ZNTA 3VSLA 3VP3A 4RYEA 4KG6A 2ZQDA 3VOZA 1NYMA 3CZDA 1L0DA 3IF6B 2Q9NA 1LL5A 1SCWA 1NRFA 3OZHA 2Y2QA 1KE0A 4BD1A 5KZHA 1SDEA 3HL9A 1N9BA 3GMWA 2P9VB 3LEZA 3MKFA 4R3JA 3TOIA 3VP1A 3Q07A 3W4OA 4Y0OA 1PW8A 4PPRA 4B4XA 3FKWA 4GDBA 4FH2A 3S1YA 4DE0A 1E25A 3N8SA 1JVJA 1FSWA 1WYBA 3IWOA 3G32A 5TFQA 4A5RA 4XXRA 5FAQA 4JXVA 4E3KA 4N1XA 3TG9A 5AQ7A 3IXHA 5G18A 2HPBA 3MZFA 4Q8IA 1TDLA 1JWZA 4N1HA 3UPOA 1G68A 5GHYA 1LL9A 1KDSA 4BL2A 5DVAA 3QHYA 4OP5A 4QD4A 1LI0A 2Y2IA 5E2GA 1TDGA 4BLMA 4QY5A 4C75A 3VOYA 2XGNA 3V3SA 2Y2JA 2QZ6A 3OPLA 2DRWA 3C7UA 4DF6A 3ZGAB 2FFYA 3HVFA 1BLPA 2UWXA 2WK0A 4MNRA 3FV7A 3HUOA 1KGFA 1XGIA 3GRJA 1MWTA 3V39A 1YLTA 5FA7A 4IBXA 2EFUA 4FSFA 2Y2LA 5CTNA 2G2UA 3VFFA 3C5AA 1PYYA 1KE3A 1MPLA 3UE1A 1JWPA 2WGVA 3UDFA 1YLJA 2EX6A 2Y2NA 2HDUA 2XDMA 1BTLA 1HVBA 5CHJA 1Z6FA 1IYPA 3G35A 4LV3A 3OPRA 1ONGA 4QB8A 4X56A 4ZTKA 3I7JA 2X02A 3PAGA 1W79A 2HDQA 5EVID 5M19A 5E43A 4LV2A 4JF4A 3IH9A 3N4IA 3GQZA 4UA9A 4LCLA 2A49A 4E3IA 4WMCA 2WUQA 1ZG4A 4JBFA 4ID4A 3TSGA 1O07A 5DTTA 1S6RA 4PM5A 5TGFA 3LY3A 2HP5A 3HLGA 3Q81A 1DJCA 4R3BA 4Z9QA 3VSKA 5EOOA 4EBLA 5E2EA 2WGIA 3ZHHA 4PM9A 3GVBA 4OLGA 2ZQCA 2GDNA 1JTDA 4OQIA 2XEPA 4E6WA 2ZQ8A 3IH8A 2ZC7A 4JF5A 3SH8A 2Z2MB 2PU4A 3NBLA 4KG5A 3NDEA 4GOGA 2XFSA 2QPNA 1K4EA 4WEKA 1GHPA 5CGSA 4S2MA 2XR0A 1FCMA 1Q2QA 4KQOA 1FQGA 2C5WB 4L0LA 4E3OA 1BULA 3OPHA 2WGWB 3AGFA 3G2ZA 3UPNA 2I72A 3IF5A 4CPKA 4ZJ3A 2G2WA 2WKIA 4S2KA 1GHMA 1I2WA 1BZAA 3V5MA 5CHMA 3HREA 1VM1A 4EWFA 1E4DA 2EX8A 3IHBA 4NK3A 4PM8A 3C7VA 4BJPA 4S2NA 1S0WA 4QU3A 4U0TA 3FWLA 3OCLA 3S22A 4D2OA 4DXBA 2Y2MA 3IT9A 2PU2A 3DTMA 5DF8A 5GLBA 3ZFZA 4WBGA 5GLCA 3UE3A 3HUNA 3S4XA 3PTEA 4JPMA 4HESA 4KZ3A 1NZUA 5EVIB 1SHVA 3LCEA 1K54C 4WM9A 1SDNA 4P6BA 4JF6A 3PBSA 4YINA 1VQQA 2XFTA 1XP4A 2XQZA 3GV9A
chains in the Genus database with same CATH superfamily
3BYDA 3CPTB 4JXWA 2PYPA 4E3NA 3QNBA 1S67L 1FOFA 1K56D 1OTAA 3BFFA 4BMWA 2VGJA 4IEDA 4JLFA 1IKGA 3D9YA 4NKPA 3C8CA 4X1LA 2W3EA 1NXYA 4GN2A 1D1JA 4KZ5A 3CWFA 3O86A 2IWDA 4MBKA 3JVVA 3FYZA 3IHAA 5EM1A 3T4OA 4DDYA 4LCMA 2JKGA 3G31A 2GX5A 3BRMA 5E2HA 5AVFA 4KG2A 4PKYA 1O7EA 1NZOA 4S2JA 4EXOA 5FATA 2XLNA 4FTXA 4GHIA 4JKTA 5AQAA 4DE2A 5FEFA 2E8JA 1G5UA 4RA7A 4HJ3A 5FDHA 3BY8A 3MS6A 3UB5P 1MWUA 2Y2KA 5L8MA 2HF6A 2EWWA 3R7WA 2HP9A 1FSYA 4HHDA 3MFDA 3UB7A 1HD8A 1CQAA 3H82B 3MXQA 2Y2GA 4KZAA 3GTCA 1JWVA 3IS2A 2V1BA 3UY6A 5HPFA 1YLZA 3LIFA 2A2LA 3LFVA 4R3AA 1ZKJA 1SZVA 1G28A 3AGDA 1KGGA 3ICYA 3ZG7B 1IYOA 5MC7A 2B5RA 4ZJ1A 4Y17A 1L2SA 3O3VA 5HW3A 2V9AA 3IXDA 2AVXA 4X6TA 3DWZA 1KVMA 3IBRA 2BTFP 3SH7A 3U4LP 4PAUA 1MXOA 3WS1A 2P04A 2ZM2A 3IS2B 1L3LA 3H7WB 3MQ0A 1G6OA 3HCYA 1TS0A 2J9PA 3MQQA 5DFXA 5FI6A 3NCKA 1V9ZA 1GCEA 2PYRA 1NRJA 2BASA 5M1AA 1S4RA 4GW9A 4K08A 1W8QA 2BLSA 1VETB 3A3FA 3PXPA 3EOIA 3IX4A 4Y0UA 3HLDA 4HH2A 5HL6A 3TRCA 4GD6A 1K55A 2J9OA 4FH4A 3A3EA 1DJBA 3CHWP 4RX3A 4LRXC 4U0XA 1XX2A 1BSGA 4B9OA 2H10A 3NHQA 1I2SA 1CEFA 1XFQA 1RCJA 2JHEA 2PT7A 3PHYA 5GHZA 3CUEC 3SH9A 1TD5A 4CJNA 2P9VA 3SOIA 2D01A 4IHQA 4F3LA 1C3BA 4UHUA 2O9AA 5DJTA 3UMEA 4HQAA 1TEMA 3WWXA 4R23A 4OONA 4WZ5A 4NETA 2Y59A 4MCWA 1MY8A 4JGPA 5F1FA 1PNEA 2FFFB 1WA9A 4E3LA 1IELA 3RXXA 2IWBA 4BWIA 2ZD8A 1ONHA 3BW6A 4KQRA 5A93A 1N9NA 3Q82A 1GHIA 3HLBA 1YMXA 3NIAA 4WZ4A 4MN6A 2PRFA 2ZMAA 3RJUA 3DWKA 2CC1A 1T19A 3IX8A 2XSSA 1TS8A 4KZ9A 4IUKA 3LIAA 3CAXA 2WKHA 4MBHA 2Z6DA 4GZBA 4KZ6A 2ZMFA 3ISGA 2OWJA 5CEBA 3IF6A 2XK1A 3L9KA 3ZCZA 4WMCD 3IWQA 4EERA 5EUAA 4BD0A 3Q7ZA 1GA0A 3FKVA 3TJZC 5J7EA 1AXBA 3IXBA 1U60A 2W1TA 3EEHA 2WKEA 4EBNA 2ZM0A 3UE0A 1VHMA 1NLYA 3LGOA 3E2LA 4OP8A 1KVLA 4N9LA 3BFEA 4K0WA 1BLSA 4MEZA 2JKTM 2HJEA 3PR6A 3VP3A 4RYEA 2ZQDA 3VOZA 3CZDA 1L0DA 3IF6B 1LL5A 4L9EA 2Y2QA 1KE0A 4R3JA 4DE0A 4FH2A 4ARZB 5TFQA 4A5RA 2QWSA 2PR5A 5FAQA 4JXVA 4E3KA 3TG9A 3R7WB 4WL9A 2INWA 3MZFA 3E98A 3EEAA 5EFWA 4OP5A 4QD4A 5E2GA 4BLMA 4HP9A 2XGNA 3V3SA 5L10A 4DF6A 5FEGA 2O9BA 5EV0A 2WK0A 4MNRA 3GRJA 3V39A 2EFUA 4FSFA 3VFFA 3UE1A 1MPLA 1JWPA 2Y2NA 2EA9A 3PYPA 1Z6FA 1IYPA 4LV3A 3I7JA 5M19A 1GSXA 4JF4A 2XA7S 3D3OA 5G4ZA 2A49A 1LSWA 1S6RA 5TGFA 3LY3A 2HP5A 3HLGA 1DJCA 3FC7A 1S1YA 3W2ZA 2ZQ8A 3IH8A 4CLCA 1YSQA 3KYQA 4KQOA 2C5WB 4L0LA 4E3OA 1FILA 3UPNA 4ZJ3A 5HWVA 2WKIA 1GHMA 1I2WA 5CHMA 3QP4A 3IHBA 4PM8A 2ZOIA 5HWTA 3C7VA 4PHTA 1MC0A 3MFXA 3FWLA 3OCLA 2ZOHA 2Y2MA 3CPTA 5GLBA 3ZFZA 3UE3A 3HUNA 4HI4A 3T4TA 3O5YA 2L4RA 1SDNA 4LLOB 3PBSA 2XRNA 1VQQA 5TJJA 5FQQA 5GLAA 2GZAA 1SKOB 1K54A 3T4LA 1ES3A 3E4PA 2Y91A 5TBMA 2W1RA 2PR6A 4R0QA 5IS1A 4O0PA 5HPIA 5U47A 4UA6A 4Q0HA 5C5KA 1WYCA 1DP9A 1PI4A 2WKPA 2Y79A 4KZ8A 4QWOA 3IF6C 4K0XA 5FQMA 4EW7A 3P01A 3IWIA 4X68A 2V1ZA 4E04A 2W3HA 4D60A 4YWZA 2Z6CA 3G2YA 3T1RA 3C4PA 2JE5A 3T4JA 3VFHA 1FCNA 5FI2A 1P97A 2WKRA 1H8MA 4OOYA 3JYIA 3DAVA 3BLSA 1L0EA 3DBAA 1KDWA 4S2PA 3T1SA 3F1PA 3O87A 2Y2OA 1K57A 2OSUA 4LV1A 1ACFA 3OLOA 4O8GA 1UGUA 2OLUA 1OTBA 4DN0A 3ZQ5A 1A0KA 3IXGA 3C30A 1GA9A 3UB6A 1RGYA 3UE6A 3HLWA 3LO7A 3KSIA 3ZDJA 1XKZA 1H0MA 4WZ5C 2HDRA 3R4KA 4KUKA 3MZDA 3LR5A 3E4OA 1S66L 3D72A 4DRTA 3UB8A 2KX6A 2DMWA 3S7NA 3G34A 4RVAA 5HX9A 4GCZA 3MQOA 4OLDA 3UO9A 3M2JA 4L9GA 1PWGA 3CG5A 4GS9A 1N4OA 1YMSA 3V67A 5AJGA 4N9KA 3A3IA 5IT5A 2R9WA 5I5LA 1NYYA 1XJ6A 4EEPA 3WRTA 3FPWA 3GECA 1MBLA 5FAOA 3CLOA 2WYXA 1ALQA 5CRFA 4ZJ2A 1ES4A 2VGKA 2E8IA 1PWCA 1AWIA 4B88A 2ZC3B 1PZOA 1N9OA 5HDCA 5A91A 3UN7A 4GB7A 1HTZA 2EXAA 2R9XA 4WYYA 1XJ2A 3NECA 3ZNYA 4BENA 5KIZA 4OPZA 4R4SA 3KO6A 3A0RA 2JC7A 1T1CA 4II7A 1XA7A 2X71A 4C3QA 4RX2A 3ZG8B 2HP6A 4WELA 1HZOA 2Y2HA 2ZL1B 3VE4A 1K6SA 1D7EA 4HP4A 5A90A 2VK3A 1LSXA 5JYPA 3C38A 4LRYC 4HJ6A 3S7QA 3BWLA 2RCXA 1MKMA 3D4FA 3QNCA 5A92A 4QHCA 1XGJA 1PRQA 1H5XA 1BUEA 2L0WA 4M3KA 3GR2A 4Q0JA 5CGXA 4I3IA 4IVIA 4BL3A 2ZQ9A 1I5QA 5DJUA 1UWNX 2WZZA 1M6KA 1K4FA 3F1NA 2QJ5A 2V2FF 4YFMA 3LIEA 4KENB 2JKTI 4F94A 3LICA 2PD8A 2J3TD 2G7UA 2V0UA 4DXCA 4Y7PA 4EU0A 2PHYA 1KGEA 2XF3A 4P0MA 5CX7A 5EECA 1Y4OA 1K56A 1XFNA 4DJ3A 3C4OA 1ES2A 3A3JA 3K3CA 2J3WA 2KOIA 1X0OA 1EROA 1FR6A 4UA7A 4IBRA 4HBTA 3PBTA 1YAXA 1TF1A 4DKIA 5FQKA 3WRZA 3F1NB 3A3DA 2EX2A 1OTDA 3RTYA 3HBRA 5FAPA 2QYBA 5FI7A 4I3AA 3Q7VB 5I94A 2ACGA 2GJ3A 3PBQA 2K31A 2EFXA 3QP2A 5FDSA 3ZNTA 3VSLA 1YSPA 1NLZA 2Q9NA 3TE8A 5KZHA 2P9VB 3W4OA 4Y0OA 3KSFA 3S1YA 1E25A 3IWOA 2HPBA 3UPOA 3T1XA 5DVAA 1T1AA 3ZYTA 4QY5A 4ESPA 3VOYA 3H7WA 2Y2JA 2OWHA 2UWXA 3HUOA 5FA7A 2KLIA 3C5AA 1PYYA 5F5YA 2NUTC 2EX6A 4KUOA 5CHJA 3G35A 5J4EA 4QB8A 2X02A 1W79A 5EVID 4L9FA 4HJ4A 4UA9A 4LCLA 2WUQA 4R3BA 4Z9QA 5E2EA 4OLGA 2ZQCA 2GDNA 1JTDA 4OQIA 4YOFA 3SH8A 2Z2MB 1XJ3A 4GOGA 2XFSA 1K4EA 5CGSA 2XR0A 2IA2A 4ME4A 4WLAA 4Y13A 3IBJA 1BULA 3AGFA 2QHKA 4CPKA 4GHIB 2G2WA 4S2KA 3HREA 4NK3A 4S2NA 4DXBA 3IT9A 4WBGA 3QP6A 1VEUB 4JPMA 5EVIB 3BQAA 1DP8A 5A8BA 1DP6A 4YINA 2XFTA 5HDDA 2B95A 3NY4A 1T1BA 2GNXA 4AFIA 2VGLS 2VA0A 3N7WA 2XD1A 1IFQA 5LBRA 1YT4A 3SZTA 1BLHA 2ZLYA 3RFBA 2Y4AA 2RL3A 2DNSA 3DTIA 3HLCA 3WS5A 1D06A 4H8RA 3M6HA 3BJNA 3GDIA 3IX3A 2ZC4B 3DTKA 3B3XA 2O9CA 3T50A 4OKPA 2A3UA 3NOUC 2WGWA 3P98A 1GSWA 1ESIA 3MMHA 2M7VA 5F1GA 2XA7M 4Y5FA 1L0GA 2DCFA 2VV8A 3UB9A 4S2IA 3G4PA 1ODVA 4HBUA 4EV4A 1Q2PA 1RGZA 4S2LA 1CK3A 5M18A 3N8LA 4UAAA 3CJMA 3EGXC 1MWRA 4R4RA 2ZJ9A 2PD7A 3LIBA 4R38A 4WN5A 2O99A 1CI8A 1PI5A 1CJFA 4IVKA 5AVEA 4OVDA 4B4ZA 2ZM8A 3GSGA 2WZXA 5EVIA 3M2KA 2ZMVA 3SS3A 5FQIA 1VEUA 2V0WA 2P74A 2ZQAA 3BLMA 1K6RA 4BBTA 4ETXA 3PBNA 3S7PA 3NDGA 5CGWA 4P6ZM 5CECA 5HL1A 2IWCA 5HARA 3ZG9B 3SS5A 3KX0X 2JCHA 4DDSA 1G6AA 2M7UA 2VKSA 4QJGA 3LY4A 1K25A 2W1TB 5TR7A 3OPPA 3PBRA 1ZG6A 4G3VA 4HEFA 1PIOA 3LYXA 4QPRA 5CTMA 5G4YA 5CERA 1K38A 3VP0A 1YLPA 3VP4A 4NEED 1XPBA 1ESUA 3M6BA 1XA1A 1W5DA 3VV4A 1YPRA 2WADA 1H8ZA 3BFDA 5FASA 1JNUA 3ULFA 4FCFA 3N6IA 5HSQA 1ERQA 2CMNA 4KZBA 1IKIA 5HAIA 4NXEA 1EWZA 1OT6A 4GLQA 3RH8B 3W8KA 2ZL1A 3TW8A 3FPVA 4S2OA 1LSVA 1RP5A 3G30A 4P87A 3HJIA 1NY0A 4LPZA 1BLCA 5DKLA 4H6JA 5EVLA 2VLGA 4FD8A 3VMAA 4B93A 5F69A 4OQGA 4OPRA 1QMEA 4EQIA 1KOUA 2V1AA 2W3DA 4HH3A 4OH0A 2XROA 2WAFA 4O01A 3BECA 2OOLA 2I9VA 2H28A 5GHXA 1K57C 1EI5A 2OLVA 3BFCA 3P7NA 3NOTC 5DKKA 1FIKA 3UMDA 4ZDXA 4MMNA 4WF0A 4X25A 2NUPC 3LI8A 4KZ7A 1QMFA 3A0VA 4E3MA 5FQJA 1OTEA 3BFGA 2Q0OA 1XXMA 2JKRI 2QKPA 2V20A 3HUMA 1OPXA 1LHYA 3MJQA 4PM7A 3MXRA 2VEAA 3NC8A 4ZBEA 4MN5A 1S1ZA 3UPPA 1BT5A 3WS2A 5HAPA 3P09A 3CI6A 4DE3A 3UDIA 4OOMA 3PBOA 3OOVA 4G3KA 3WS0A 1YKDA 3VOLA 4OOLA 2XD5A 5KSHA 1XJ4A 2H0YA 4IJGA 4OQ0A 4O7DA 3NOPC 3OCNA 4FUWA 2HDSA 4ZAMA 1E3UD 2H5SA 2PBDP 2EX9A 1IEMA 5HZHA 4LRZE 4YNRA 4NXGA 5J8XA 1IOUA 5L2FA 1H8YA 3LI9A 2A24A 3WS4A 4PMAA 1E3UA 2Q9MA 1DJAA 1TVFA 4IUHA 3ZVWA 1J3WA 2ZQ7A 3DW0A 3KYZA 3K3DA 4KG6A 1NYMA 1SCWA 1NRFA 3OZHA 4GJ4A 3HL9A 2WKQA 3LEZA 4MDZA 3Q07A 1MZUA 1VB6A 1PW8A 4PPRA 5HWWA 3FKWA 1VETA 1WYBA 1NWZA 4GS9B 4CLCC 4N1XA 5AQ7A 3IXHA 5DFYA 4Y15A 4Q8IA 1TDLA 1JWZA 3B47A 4MN7A 1LL9A 1KDSA 4BL2A 3QHYA 1LI0A 4HY8A 4C75A 4M4XA 3OPLA 2DRWA 2FZ0A 3C7UA 3QP8A 3ZGAB 3HVFA 2W0NA 3FV7A 1XGIA 1MWTA 1YLTA 4DMZA 3S7OA 4UQIM 1OT9A 2G2UA 1KE3A 2WGVA 2UV0E 2XDMA 2JN7A 1F2KA 1ONGA 1N9LA 4ZTKA 4LV2A 2QJ7A 5IU1A 4G3WA 3IH9A 3N4IA 3GQZA 2HJ9C 4JBFA 4ID4A 3TSGA 1O07A 5DTTA 4PM5A 3LUQA 4EBLA 3Q81A 3VSKA 4PM9A 4CLCE 3GVBA 3KSGA 2XEPA 2ZC7A 4JF5A 3NBLA 3NDEA 4S2MA 1FCMA 1Q2QA 2M1CA 3OPHA 3U2AA 2I72A 3IF5A 1ZTUA 3KSHA 4JGOA 1S0WA 2VGLM 4U0TA 1BYWA 3OBFA 3S22A 2PU2A 5DF8A 2J3TC 3JPUA 3PTEA 4HESA 4ARZA 3T12B 1SHVA 4Y3IA 2B02A 1SKOA 4CLCD 1K54C 1W63Q 4JF6A 2EXBA 3C2WA 2XQZA 3GV9A 4DE1A 1ZC2A 3ITAA 1OJ5A 3KYEA 2WAEA 3B42A 2PAVP 5IHVA 2BG1A 2HV1A 2VX8A 4OPQA 4P85A 3MXSA 4LV0A 5F6AA 2LB5A 5DTSA 1H3QA 3SS4A 1YLYA 4R1GA 3MR0A 4LFUA 5CEDA 4NG2A 1IYQA 4XUZA 5KSCA 4I5SA 1WE4A 4BBUA 3BEBA 2LB9A 5GLDA 3EWKA 2EWVA 3K2NA 2YKHA 1PZPA 3NULA 4FOFA 4Y2FA 3HLFA 3MZEA 1FR1A 2Y2PA 4XUXA 2VZWA 1S4SA 1MKIA 4E3JA 4GD8A 2OV5A 1LL8A 5CHUA 1PFLA 2J8YA 5HDSA 4XT2B 1J9MA 1KE4A 2V8CA 4NXBA 2MJ6A 5DTKA 5J3WA 5FQ9A 4LGWA 3OC2A 3ZG0A 4WEJA 5FL3A 1W8YA 1YLWA 1PWDA 3CUEA 3E4QA 3LR3A 5AQ9A 3Q1FA 1CEGA 5HAQA 3SW1A 2H0TA 3N8RA 2XH9A 1F5MA 3T4KA 5EVEA 3EGDC 3RXWA 2HGVA 1OMEA 3AGEA 3EQVA 4GKUA 5GL9A 4XT2A 3A0SA 3NJAA 4EBPA 1K55C 1F9IA 2ZC6B 2VV6A 2VV7A 3FZCA 4EUZA 1MWSA 4CLCB 4BBVA 4X1MA 5EM0A 1NJ4A 3CMZA 4MLLA 3W4PA 3W4QA 2J7VA 3Q7VA 1OTIA 3HLEA 3T1QB 2P7JA 2KDKA 5E2FA 4GNUA 3MKEA 2Y55A 3ITBA 1DY6A 1ES5A 5CXWA 1FCOA 3UDXA 5DF9A 4PKYG 2OAQ1 1LLBA 3UNWA 4MBFA 4CQHA 3PAEA 1T18A 1Y54A 1W63M 4ZRRA 1L0FA 2JKRM 5AQBA 1STZA 3BQ8A 4S2NC 4BQMA 4EEUA 3F1PB 4Y0TA 3QP1A 1JTGA 4OQHA 4C6YA 5F68A 5HFOA 1UWPX 4E6XA 3QP5A 4EQ1A 3LR4A 4EETB 2ZC5B 4QY6A 2Z2LB 3E0YA 1P9RA 1SKFA 4HIAA 1ERMA 3MSHA 2C6WB 5JYOA 3V3RA 3BM6A 4OPYA 5F83A 3T4SA 1YM1A 3EQUA 4NXFA 3VP2A 5F82A 2W27A 1CI9A 4U3TA 4HOIA 3H82A 3FG8A 2W3GA 4JXSA 4GDNA 1V9YA 4F3LB 5EVIC 4X55A 3F1OB 2A24B 4P6ZS 4JGRA 1CF0A 2PBYA 4X69A 1OJGA 5EPHA 5FSRA 5HD3A 3IQAA 4LENA 1W7FA 3ZG5A 3BY9A 1Z09A 2JBFA 4EESA 5L09A 3V50A 4I39A 1M40A 2JKFA 4UQIS 2L1MA 5BOHA 4K91A 3O88A 3MBZA 4DJ2A 2J80A 3LIDA 1IYSA 4N92A 4PM6A 5DF7A 4JGQA 4ETZA 1YQSA 3HJKA 1PW1A 3NI9A 2QMIA 4KZ4A 4X53A 3E2KA 3MF0A 1DRMA 1P0ZA 2X01A 1ZHHB 5EE8A 4JXGA 3JVUA 4KQQA 5EOEA 3ZVTA 5TBMB 1LI9A 3DTEA 4KQDA 2V8FA 5D3OA 5KMWA 2D02A 4BD1A 2O0YA 1SDEA 1N9BA 3B33A 3GMWA 4WUJA 3MKFA 3VP1A 3TOIA 4B4XA 4GDBA 3N8SA 2R78A 1JVJA 1FSWA 1LT0A 3G32A 4XXRA 1F98A 2ZBBA 5G18A 4H6JB 4N1HA 1G68A 5GHYA 2OAP1 2Y2IA 1TDGA 4Q0IA 4I38A 1K0KA 2HZ5A 2QZ6A 2FFYA 1BLPA 1KGFA 5HD5A 1Y28A 4IBXA 4R6LA 2Y2LA 5CTNA 3VE3A 1P9WA 3UDFA 1YLJA 3CITA 2HDUA 5L07A 1BTLA 1HVBA 1GSVA 3OPRA 4X56A 2P08A 3PAGA 2HDQA 3L7HA 5E43A 4RQ9A 1TS7A 2VJWA 3T4QA 4E3IA 4WMCA 1ZG4A 4HNBA 5EOOA 2WGIA 1EW0A 2FH5A 2K2NA 3F1OA 4I3JA 1HLUP 3ZHHA 2B18A 3LEQA 5K5BA 4E6WA 4R70A 2PU4A 4KG5A 2QPNA 4WEKA 1GHPA 1TS6A 1FQGA 2WGWB 3G2ZA 2Y8HA 2PDRA 1BZAA 3V5MA 1VM1A 4EWFA 1E4DA 2EX8A 4UEYA 4BJPA 2K7SA 3G6OA 4QU3A 4D2OA 3H9WA 3DTMA 5GLCA 3S4XA 4EUVA 4KZ3A 1NZUA 3LCEA 4WM9A 2W3FA 4P6BA 2YKFA 3LR0A 4Z1WA 1XP4A
chains in the Genus database with same CATH topology
3BYDA 4JXWA 4DE1A 1ZC2A 3NY4A 5FQQA 4E3NA 3QNBA 5GLAA 3N7WA 3ITAA 1FOFA 2XD1A 1K56D 2WAEA 1K54A 3BFFA 1YT4A 1ES3A 2Y91A 2VGJA 4R0QA 4IEDA 4JLFA 1BLHA 1IKGA 2ZLYA 5IHVA 2Y4AA 2BG1A 2RL3A 4OPQA 4P85A 5U47A 4UA6A 3MXSA 2DNSA 1WYCA 4LV0A 1PI4A 3HLCA 3WS5A 1NXYA 4H8RA 5DTSA 3SS4A 3M6HA 4KZ8A 4GN2A 1YLYA 3IF6C 4K0XA 4KZ5A 4R1GA 2ZC4B 5FQMA 5CEDA 3B3XA 3O86A 1IYQA 4OKPA 3IWIA 2A3UA 4X68A 4XUZA 5KSCA 2IWDA 2V1ZA 2WGWA 4MBKA 3P98A 1WE4A 3BEBA 5GLDA 1ESIA 3FYZA 3G2YA 3C4PA 5F1GA 2JE5A 3VFHA 1L0GA 1FCNA 3IHAA 1PZPA 5FI2A 2DCFA 4DDYA 4S2IA 4LCMA 3G4PA 4HBUA 3HLFA 4EV4A 3G31A 3MZEA 1FR1A 2Y2PA 1Q2PA 3BRMA 4OOYA 1RGZA 3JYIA 4S2LA 5E2HA 4XUXA 4KG2A 1CK3A 3BLSA 1O7EA 5M18A 1MKIA 1NZOA 4S2JA 4E3JA 1L0EA 3N8LA 4UAAA 5FATA 1KDWA 2XLNA 3CJMA 4GD8A 4S2PA 2OV5A 5CHUA 3O87A 4JKTA 2Y2OA 5AQAA 4DE2A 1K57A 2OSUA 1MWRA 4LV1A 4R4RA 2ZJ9A 2J8YA 1J9MA 1KE4A 2OLUA 5DTKA 4RA7A 5FQ9A 1CI8A 5FDHA 1PI5A 4IVKA 3IXGA 4OVDA 4B4ZA 3OC2A 3ZG0A 2ZM8A 1MWUA 3GSGA 4WEJA 1GA9A 1W8YA 1RGYA 2Y2KA 1YLWA 1PWDA 2WZXA 3HLWA 3LO7A 5AQ9A 3M2KA 3Q1FA 5EVIA 3ZDJA 1CEGA 3SS3A 1XKZA 5FQIA 5HAQA 2H0TA 2HP9A 1FSYA 2XH9A 3N8RA 3MFDA 3RXWA 1OMEA 1HD8A 4WZ5C 2P74A 2ZQAA 3AGEA 2HDRA 2Y2GA 3EQVA 3BLMA 3MZDA 3GTCA 4GKUA 4KZAA 1JWVA 5GL9A 3UY6A 1K6RA 1YLZA 3PBNA 4DRTA 1ZKJA 3NDGA 5CGWA 4EBPA 1K55C 3AGDA 5CECA 1KGGA 3G34A 4RVAA 5HX9A 2ZC6B 4OLDA 3UO9A 3ZG7B 5HL1A 2IWCA 1IYOA 5HARA 3ZG9B 2B5RA 3M2JA 2JCHA 3FZCA 4ZJ1A 1G6AA 3SS5A 1MWSA 1PWGA 3CG5A 1L2SA 4DDSA 4EUZA 4QJGA 3LY4A 1N4OA 1K25A 1YMSA 3O3VA 1NJ4A 5TR7A 4N9KA 3A3IA 5HW3A 2R9WA 3CMZA 4MLLA 3W4PA 3IXDA 3OPPA 3PBRA 4X6TA 1ZG6A 3DWZA 1NYYA 3W4QA 4HEFA 2J7VA 1KVMA 3Q7VA 1PIOA 3WRTA 5CTMA 3SH7A 3HLEA 3WS1A 1MXOA 5CERA 2ZM2A 1K38A 1MBLA 3VP0A 5E2FA 1YLPA 5FAOA 4GNUA 2WYXA 1ALQA 3MKEA 2Y55A 3VP4A 3ITBA 1DY6A 1ES5A 5CRFA 5CXWA 1XPBA 1FCOA 1ESUA 4ZJ2A 1ES4A 3M6BA 2VGKA 2E8IA 2J9PA 3UDXA 1PWCA 5DF9A 1XA1A 1W5DA 4B88A 2ZC3B 5FI6A 3NCKA 1PZOA 1LLBA 2WADA 3UN7A 5A91A 3UNWA 4MBFA 1H8ZA 1GCEA 3BFDA 3PAEA 5FASA 4GB7A 1HTZA 5M1AA 2EXAA 2R9XA 4FCFA 3N6IA 1W8QA 1Y54A 1ERQA 2BLSA 4KZBA 1IKIA 3A3FA 4WYYA 5HAIA 1EWZA 4Y0UA 1L0FA 3ZNYA 5AQBA 3W8KA 3HLDA 4BENA 4S2OA 4GD6A 4OPZA 4S2NC 1K55A 1RP5A 3G30A 4P87A 2J9OA 4R4SA 4FH4A 4BQMA 2JC7A 3A3EA 1XA7A 1NY0A 2X71A 1DJBA 4C3QA 1BLCA 4RX2A 4RX3A 4Y0TA 5EVLA 3ZG8B 2HP6A 4WELA 1JTGA 4OQHA 4C6YA 4U0XA 1XX2A 1BSGA 1HZOA 2Y2HA 5HFOA 1K6SA 2H10A 4E6XA 1I2SA 1CEFA 4FD8A 1RCJA 3VMAA 5A90A 5JYPA 2ZC5B 5GHZA 4QY6A 4OQGA 3SH9A 2Z2LB 4CJNA 4OPRA 1QMEA 2P9VA 3SOIA 1SKFA 4EQIA 1ERMA 2C6WB 2RCXA 4OH0A 3D4FA 3QNCA 1C3BA 4UHUA 2WAFA 3V3RA 5JYOA 3BECA 3BM6A 4QHCA 5A92A 4OPYA 5F83A 1YM1A 1XGJA 5GHXA 1H5XA 1TEMA 1BUEA 1K57C 1EI5A 3EQUA 2OLVA 3WWXA 3BFCA 3GR2A 4M3KA 3VP2A 5F82A 4R23A 5CGXA 4OONA 1CI9A 4U3TA 4NETA 4WZ5A 4ZDXA 4JXSA 4GDNA 2Y59A 1MY8A 4IVIA 4BL3A 5EVIC 2ZQ9A 1I5QA 4X55A 5F1FA 4KZ7A 1QMFA 4E3MA 2FFFB 2WZZA 5FQJA 1M6KA 1K4FA 3BFGA 2V2FF 1XXMA 4YFMA 1IELA 3RXXA 4E3LA 2PBYA 4KENB 4X69A 2IWBA 2V20A 3HUMA 2ZD8A 4F94A 1LHYA 1ONHA 4PM7A 3MXRA 5EPHA 5FSRA 4DXCA 3IQAA 4KQRA 4LENA 1W7FA 3NC8A 3ZG5A 5A93A 4Y7PA 4ZBEA 3Q82A 1GHIA 2XF3A 1BT5A 1KGEA 3UPPA 3HLBA 3WS2A 5HAPA 1YMXA 3P09A 4P0MA 3NIAA 4DE3A 2JBFA 4WZ4A 5EECA 4OOMA 3UDIA 2EXBA 1K56A 3PBOA 3V50A 3WS0A 1M40A 1ES2A 3A3JA 3C4OA 2ZMAA 3RJUA 5BOHA 4OOLA 2XD5A 3DWKA 4K91A 2CC1A 5KSHA 2H0YA 3O88A 3MBZA 4KZ9A 1EROA 1FR6A 4OQ0A 4O7DA 2WKHA 4UA7A 4MBHA 4IBRA 4HBTA 3PBTA 1IYSA 4N92A 3OCNA 4PM6A 2HDSA 4GZBA 5DF7A 4ZAMA 4KZ6A 3ISGA 1E3UD 2H5SA 4DKIA 5CEBA 1YQSA 3IF6A 1PW1A 2XK1A 3NI9A 3ZCZA 2QMIA 4WMCD 4KZ4A 3IWQA 5FQKA 3WRZA 5EUAA 3A3DA 3Q7ZA 2EX9A 1IEMA 2EX2A 1GA0A 3FKVA 4X53A 4BD0A 3E2KA 1AXBA 3IXBA 1U60A 2WKEA 4EBNA 2ZM0A 3UE0A 2X01A 3HBRA 5FAPA 5J8XA 5L2FA 5FI7A 1H8YA 3Q7VB 5EE8A 4JXGA 4KQQA 3WS4A 4PMAA 5EOEA 3ZVTA 5I94A 1E3UA 3E2LA 3PBQA 1LI9A 1KVLA 2Q9MA 1DJAA 1TVFA 4OP8A 4N9LA 3BFEA 4K0WA 1BLSA 5D3OA 4MEZA 3ZVWA 5KMWA 2EFXA 2ZQ7A 3DW0A 3ZNTA 3VSLA 3VP3A 4RYEA 4KG6A 2ZQDA 3VOZA 1NYMA 3CZDA 1L0DA 3IF6B 2Q9NA 1LL5A 1SCWA 1NRFA 3OZHA 2Y2QA 1KE0A 4BD1A 5KZHA 1SDEA 3HL9A 1N9BA 3GMWA 2P9VB 3LEZA 3MKFA 4R3JA 3TOIA 3VP1A 3Q07A 3W4OA 4Y0OA 1PW8A 4PPRA 4B4XA 3FKWA 4GDBA 4FH2A 3S1YA 4DE0A 1E25A 3N8SA 1JVJA 1FSWA 1WYBA 3IWOA 3G32A 5TFQA 4A5RA 4XXRA 5FAQA 4JXVA 4E3KA 4N1XA 3TG9A 5AQ7A 3IXHA 5G18A 2HPBA 3MZFA 4Q8IA 1TDLA 1JWZA 4N1HA 3UPOA 1G68A 5GHYA 1LL9A 1KDSA 4BL2A 5DVAA 3QHYA 4OP5A 4QD4A 1LI0A 2Y2IA 5E2GA 1TDGA 4BLMA 4QY5A 4C75A 3VOYA 2XGNA 3V3SA 2Y2JA 2QZ6A 3OPLA 2DRWA 3C7UA 4DF6A 3ZGAB 2FFYA 3HVFA 1BLPA 2UWXA 2WK0A 4MNRA 3FV7A 3HUOA 1KGFA 1XGIA 3GRJA 1MWTA 3V39A 1YLTA 5FA7A 4IBXA 2EFUA 4FSFA 2Y2LA 5CTNA 2G2UA 3VFFA 3C5AA 1PYYA 1KE3A 1MPLA 3UE1A 1JWPA 2WGVA 3UDFA 1YLJA 2EX6A 2Y2NA 2HDUA 2XDMA 1BTLA 1HVBA 5CHJA 1Z6FA 1IYPA 3G35A 4LV3A 3OPRA 1ONGA 4QB8A 4X56A 4ZTKA 3I7JA 2X02A 3PAGA 1W79A 2HDQA 5EVID 5M19A 5E43A 4LV2A 4JF4A 3IH9A 3N4IA 3GQZA 4UA9A 4LCLA 2A49A 4E3IA 4WMCA 2WUQA 1ZG4A 4JBFA 4ID4A 3TSGA 1O07A 5DTTA 1S6RA 4PM5A 5TGFA 3LY3A 2HP5A 3HLGA 3Q81A 1DJCA 4R3BA 4Z9QA 3VSKA 5EOOA 4EBLA 5E2EA 2WGIA 3ZHHA 4PM9A 3GVBA 4OLGA 2ZQCA 2GDNA 1JTDA 4OQIA 2XEPA 4E6WA 2ZQ8A 3IH8A 2ZC7A 4JF5A 3SH8A 2Z2MB 2PU4A 3NBLA 4KG5A 3NDEA 4GOGA 2XFSA 2QPNA 1K4EA 4WEKA 1GHPA 5CGSA 4S2MA 2XR0A 1FCMA 1Q2QA 4KQOA 1FQGA 2C5WB 4L0LA 4E3OA 1BULA 3OPHA 2WGWB 3AGFA 3G2ZA 3UPNA 2I72A 3IF5A 4CPKA 4ZJ3A 2G2WA 2WKIA 4S2KA 1GHMA 1I2WA 1BZAA 3V5MA 5CHMA 3HREA 1VM1A 4EWFA 1E4DA 2EX8A 3IHBA 4NK3A 4PM8A 3C7VA 4BJPA 4S2NA 1S0WA 4QU3A 4U0TA 3FWLA 3OCLA 3S22A 4D2OA 4DXBA 2Y2MA 3IT9A 2PU2A 3DTMA 5DF8A 5GLBA 3ZFZA 4WBGA 5GLCA 3UE3A 3HUNA 3S4XA 3PTEA 4JPMA 4HESA 4KZ3A 1NZUA 5EVIB 1SHVA 3LCEA 1K54C 4WM9A 1SDNA 4P6BA 4JF6A 3PBSA 4YINA 1VQQA 2XFTA 1XP4A 2XQZA 3GV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BYD A;  4JXW A;  4DE1 A;  1ZC2 A;  3NY4 A;  5FQQ A;  4E3N A;  3QNB A;  5GLA A;  3N7W A;  3ITA A;  1FOF A;  2XD1 A;  1K56 D;  2WAE A;  1K54 A;  3BFF A;  1YT4 A;  1ES3 A;  2Y91 A;  2VGJ A;  4R0Q A;  4IED A;  4JLF A;  1BLH A;  1IKG A;  2ZLY A;  5IHV A;  2Y4A A;  2BG1 A;  2RL3 A;  4OPQ A;  4P85 A;  5U47 A;  4UA6 A;  3MXS A;  2DNS A;  1WYC A;  4LV0 A;  1PI4 A;  3HLC A;  3WS5 A;  1NXY A;  4H8R A;  5DTS A;  3SS4 A;  3M6H A;  4KZ8 A;  4GN2 A;  1YLY A;  3IF6 C;  4K0X A;  4KZ5 A;  4R1G A;  2ZC4 B;  5FQM A;  5CED A;  3B3X A;  3O86 A;  1IYQ A;  4OKP A;  3IWI A;  2A3U A;  4X68 A;  4XUZ A;  5KSC A;  2IWD A;  2V1Z A;  2WGW A;  4MBK A;  3P98 A;  1WE4 A;  3BEB A;  5GLD A;  1ESI A;  3FYZ A;  3G2Y A;  3C4P A;  5F1G A;  2JE5 A;  3VFH A;  1L0G A;  1FCN A;  3IHA A;  1PZP A;  5FI2 A;  2DCF A;  4DDY A;  4S2I A;  4LCM A;  3G4P A;  4HBU A;  3HLF A;  4EV4 A;  3G31 A;  3MZE A;  1FR1 A;  2Y2P A;  1Q2P A;  3BRM A;  4OOY A;  1RGZ A;  3JYI A;  4S2L A;  5E2H A;  4XUX A;  4KG2 A;  1CK3 A;  3BLS A;  1O7E A;  5M18 A;  1MKI A;  1NZO A;  4S2J A;  4E3J A;  1L0E A;  3N8L A;  4UAA A;  5FAT A;  1KDW A;  2XLN A;  3CJM A;  4GD8 A;  4S2P A;  2OV5 A;  5CHU A;  3O87 A;  4JKT A;  2Y2O A;  5AQA A;  4DE2 A;  1K57 A;  2OSU A;  1MWR A;  4LV1 A;  4R4R A;  2ZJ9 A;  2J8Y A;  1J9M A;  1KE4 A;  2OLU A;  5DTK A;  4RA7 A;  5FQ9 A;  1CI8 A;  5FDH A;  1PI5 A;  4IVK A;  3IXG A;  4OVD A;  4B4Z A;  3OC2 A;  3ZG0 A;  2ZM8 A;  1MWU A;  3GSG A;  4WEJ A;  1GA9 A;  1W8Y A;  1RGY A;  2Y2K A;  1YLW A;  1PWD A;  2WZX A;  3HLW A;  3LO7 A;  5AQ9 A;  3M2K A;  3Q1F A;  5EVI A;  3ZDJ A;  1CEG A;  3SS3 A;  1XKZ A;  5FQI A;  5HAQ A;  2H0T A;  2HP9 A;  1FSY A;  2XH9 A;  3N8R A;  3MFD A;  3RXW A;  1OME A;  1HD8 A;  4WZ5 C;  2P74 A;  2ZQA A;  3AGE A;  2HDR A;  2Y2G A;  3EQV A;  3BLM A;  3MZD A;  3GTC A;  4GKU A;  4KZA A;  1JWV A;  5GL9 A;  3UY6 A;  1K6R A;  1YLZ A;  3PBN A;  4DRT A;  1ZKJ A;  3NDG A;  5CGW A;  4EBP A;  1K55 C;  3AGD A;  5CEC A;  1KGG A;  3G34 A;  4RVA A;  5HX9 A;  2ZC6 B;  4OLD A;  3UO9 A;  3ZG7 B;  5HL1 A;  2IWC A;  1IYO A;  5HAR A;  3ZG9 B;  2B5R A;  3M2J A;  2JCH A;  3FZC A;  4ZJ1 A;  1G6A A;  3SS5 A;  1MWS A;  1PWG A;  3CG5 A;  1L2S A;  4DDS A;  4EUZ A;  4QJG A;  3LY4 A;  1N4O A;  1K25 A;  1YMS A;  3O3V A;  1NJ4 A;  5TR7 A;  4N9K A;  3A3I A;  5HW3 A;  2R9W A;  3CMZ A;  4MLL A;  3W4P A;  3IXD A;  3OPP A;  3PBR A;  4X6T A;  1ZG6 A;  3DWZ A;  1NYY A;  3W4Q A;  4HEF A;  2J7V A;  1KVM A;  3Q7V A;  1PIO A;  3WRT A;  5CTM A;  3SH7 A;  3HLE A;  3WS1 A;  1MXO A;  5CER A;  2ZM2 A;  1K38 A;  1MBL A;  3VP0 A;  5E2F A;  1YLP A;  5FAO A;  4GNU A;  2WYX A;  1ALQ A;  3MKE A;  2Y55 A;  3VP4 A;  3ITB A;  1DY6 A;  1ES5 A;  5CRF A;  5CXW A;  1XPB A;  1FCO A;  1ESU A;  4ZJ2 A;  1ES4 A;  3M6B A;  2VGK A;  2E8I A;  2J9P A;  3UDX A;  1PWC A;  5DF9 A;  1XA1 A;  1W5D A;  4B88 A;  2ZC3 B;  5FI6 A;  3NCK A;  1PZO A;  1LLB A;  2WAD A;  3UN7 A;  5A91 A;  3UNW A;  4MBF A;  1H8Z A;  1GCE A;  3BFD A;  3PAE A;  5FAS A;  4GB7 A;  1HTZ A;  5M1A A;  2EXA A;  2R9X A;  4FCF A;  3N6I A;  1W8Q A;  1Y54 A;  1ERQ A;  2BLS A;  4KZB A;  1IKI A;  3A3F A;  4WYY A;  5HAI A;  1EWZ A;  4Y0U A;  1L0F A;  3ZNY A;  5AQB A;  3W8K A;  3HLD A;  4BEN A;  4S2O A;  4GD6 A;  4OPZ A;  4S2N C;  1K55 A;  1RP5 A;  3G30 A;  4P87 A;  2J9O A;  4R4S A;  4FH4 A;  4BQM A;  2JC7 A;  3A3E A;  1XA7 A;  1NY0 A;  2X71 A;  1DJB A;  4C3Q A;  1BLC A;  4RX2 A;  4RX3 A;  4Y0T A;  5EVL A;  3ZG8 B;  2HP6 A;  4WEL A;  1JTG A;  4OQH A;  4C6Y A;  4U0X A;  1XX2 A;  1BSG A;  1HZO A;  2Y2H A;  5HFO A;  1K6S A;  2H10 A;  4E6X A;  1I2S A;  1CEF A;  4FD8 A;  1RCJ A;  3VMA A;  5A90 A;  5JYP A;  2ZC5 B;  5GHZ A;  4QY6 A;  4OQG A;  3SH9 A;  2Z2L B;  4CJN A;  4OPR A;  1QME A;  2P9V A;  3SOI A;  1SKF A;  4EQI A;  1ERM A;  2C6W B;  2RCX A;  4OH0 A;  3D4F A;  3QNC A;  1C3B A;  4UHU A;  2WAF A;  3V3R A;  5JYO A;  3BEC A;  3BM6 A;  4QHC A;  5A92 A;  4OPY A;  5F83 A;  1YM1 A;  1XGJ A;  5GHX A;  1H5X A;  1TEM A;  1BUE A;  1K57 C;  1EI5 A;  3EQU A;  2OLV A;  3WWX A;  3BFC A;  3GR2 A;  4M3K A;  3VP2 A;  5F82 A;  4R23 A;  5CGX A;  4OON A;  1CI9 A;  4U3T A;  4NET A;  4WZ5 A;  4ZDX A;  4JXS A;  4GDN A;  2Y59 A;  1MY8 A;  4IVI A;  4BL3 A;  5EVI C;  2ZQ9 A;  1I5Q A;  4X55 A;  5F1F A;  4KZ7 A;  1QMF A;  4E3M A;  2FFF B;  2WZZ A;  5FQJ A;  1M6K A;  1K4F A;  3BFG A;  2V2F F;  1XXM A;  4YFM A;  1IEL A;  3RXX A;  4E3L A;  2PBY A;  4KEN B;  4X69 A;  2IWB A;  2V20 A;  3HUM A;  2ZD8 A;  4F94 A;  1LHY A;  1ONH A;  4PM7 A;  3MXR A;  5EPH A;  5FSR A;  4DXC A;  3IQA A;  4KQR A;  4LEN A;  1W7F A;  3NC8 A;  3ZG5 A;  5A93 A;  4Y7P A;  4ZBE A;  3Q82 A;  1GHI A;  2XF3 A;  1BT5 A;  1KGE A;  3UPP A;  3HLB A;  3WS2 A;  5HAP A;  1YMX A;  3P09 A;  4P0M A;  3NIA A;  4DE3 A;  2JBF A;  4WZ4 A;  5EEC A;  4OOM A;  3UDI A;  2EXB A;  1K56 A;  3PBO A;  3V50 A;  3WS0 A;  1M40 A;  1ES2 A;  3A3J A;  3C4O A;  2ZMA A;  3RJU A;  5BOH A;  4OOL A;  2XD5 A;  3DWK A;  4K91 A;  2CC1 A;  5KSH A;  2H0Y A;  3O88 A;  3MBZ A;  4KZ9 A;  1ERO A;  1FR6 A;  4OQ0 A;  4O7D A;  2WKH A;  4UA7 A;  4MBH A;  4IBR A;  4HBT A;  3PBT A;  1IYS A;  4N92 A;  3OCN A;  4PM6 A;  2HDS A;  4GZB A;  5DF7 A;  4ZAM A;  4KZ6 A;  3ISG A;  1E3U D;  2H5S A;  4DKI A;  5CEB A;  1YQS A;  3IF6 A;  1PW1 A;  2XK1 A;  3NI9 A;  3ZCZ A;  2QMI A;  4WMC D;  4KZ4 A;  3IWQ A;  5FQK A;  3WRZ A;  5EUA A;  3A3D A;  3Q7Z A;  2EX9 A;  1IEM A;  2EX2 A;  1GA0 A;  3FKV A;  4X53 A;  4BD0 A;  3E2K A;  1AXB A;  3IXB A;  1U60 A;  2WKE A;  4EBN A;  2ZM0 A;  3UE0 A;  2X01 A;  3HBR A;  5FAP A;  5J8X A;  5L2F A;  5FI7 A;  1H8Y A;  3Q7V B;  5EE8 A;  4JXG A;  4KQQ A;  3WS4 A;  4PMA A;  5EOE A;  3ZVT A;  5I94 A;  1E3U A;  3E2L A;  3PBQ A;  1LI9 A;  1KVL A;  2Q9M A;  1DJA A;  1TVF A;  4OP8 A;  4N9L A;  3BFE A;  4K0W A;  1BLS A;  5D3O A;  4MEZ A;  3ZVW A;  5KMW A;  2EFX A;  2ZQ7 A;  3DW0 A;  3ZNT A;  3VSL A;  3VP3 A;  4RYE A;  4KG6 A;  2ZQD A;  3VOZ A;  1NYM A;  3CZD A;  1L0D A;  3IF6 B;  2Q9N A;  1LL5 A;  1SCW A;  1NRF A;  3OZH A;  2Y2Q A;  1KE0 A;  4BD1 A;  5KZH A;  1SDE A;  3HL9 A;  1N9B A;  3GMW A;  2P9V B;  3LEZ A;  3MKF A;  4R3J A;  3TOI A;  3VP1 A;  3Q07 A;  3W4O A;  4Y0O A;  1PW8 A;  4PPR A;  4B4X A;  3FKW A;  4GDB A;  4FH2 A;  3S1Y A;  4DE0 A;  1E25 A;  3N8S A;  1JVJ A;  1FSW A;  1WYB A;  3IWO A;  3G32 A;  5TFQ A;  4A5R A;  4XXR A;  5FAQ A;  4JXV A;  4E3K A;  4N1X A;  3TG9 A;  5AQ7 A;  3IXH A;  5G18 A;  2HPB A;  3MZF A;  4Q8I A;  1TDL A;  1JWZ A;  4N1H A;  3UPO A;  1G68 A;  5GHY A;  1LL9 A;  1KDS A;  4BL2 A;  5DVA A;  3QHY A;  4OP5 A;  4QD4 A;  1LI0 A;  2Y2I A;  5E2G A;  1TDG A;  4BLM A;  4QY5 A;  4C75 A;  3VOY A;  2XGN A;  3V3S A;  2Y2J A;  2QZ6 A;  3OPL A;  2DRW A;  3C7U A;  4DF6 A;  3ZGA B;  2FFY A;  3HVF A;  1BLP A;  2UWX A;  2WK0 A;  4MNR A;  3FV7 A;  3HUO A;  1KGF A;  1XGI A;  3GRJ A;  1MWT A;  3V39 A;  1YLT A;  5FA7 A;  4IBX A;  2EFU A;  4FSF A;  2Y2L A;  5CTN A;  2G2U A;  3VFF A;  3C5A A;  1PYY A;  1KE3 A;  1MPL A;  3UE1 A;  1JWP A;  2WGV A;  3UDF A;  1YLJ A;  2EX6 A;  2Y2N A;  2HDU A;  2XDM A;  1BTL A;  1HVB A;  5CHJ A;  1Z6F A;  1IYP A;  3G35 A;  4LV3 A;  3OPR A;  1ONG A;  4QB8 A;  4X56 A;  4ZTK A;  3I7J A;  2X02 A;  3PAG A;  1W79 A;  2HDQ A;  5EVI D;  5M19 A;  5E43 A;  4LV2 A;  4JF4 A;  3IH9 A;  3N4I A;  3GQZ A;  4UA9 A;  4LCL A;  2A49 A;  4E3I A;  4WMC A;  2WUQ A;  1ZG4 A;  4JBF A;  4ID4 A;  3TSG A;  1O07 A;  5DTT A;  1S6R A;  4PM5 A;  5TGF A;  3LY3 A;  2HP5 A;  3HLG A;  3Q81 A;  1DJC A;  4R3B A;  4Z9Q A;  3VSK A;  5EOO A;  4EBL A;  5E2E A;  2WGI A;  3ZHH A;  4PM9 A;  3GVB A;  4OLG A;  2ZQC A;  2GDN A;  1JTD A;  4OQI A;  2XEP A;  4E6W A;  2ZQ8 A;  3IH8 A;  2ZC7 A;  4JF5 A;  3SH8 A;  2Z2M B;  2PU4 A;  3NBL A;  4KG5 A;  3NDE A;  4GOG A;  2XFS A;  2QPN A;  1K4E A;  4WEK A;  1GHP A;  5CGS A;  4S2M A;  2XR0 A;  1FCM A;  1Q2Q A;  4KQO A;  1FQG A;  2C5W B;  4L0L A;  4E3O A;  1BUL A;  3OPH A;  2WGW B;  3AGF A;  3G2Z A;  3UPN A;  2I72 A;  3IF5 A;  4CPK A;  4ZJ3 A;  2G2W A;  2WKI A;  4S2K A;  1GHM A;  1I2W A;  1BZA A;  3V5M A;  5CHM A;  3HRE A;  1VM1 A;  4EWF A;  1E4D A;  2EX8 A;  3IHB A;  4NK3 A;  4PM8 A;  3C7V A;  4BJP A;  4S2N A;  1S0W A;  4QU3 A;  4U0T A;  3FWL A;  3OCL A;  3S22 A;  4D2O A;  4DXB A;  2Y2M A;  3IT9 A;  2PU2 A;  3DTM A;  5DF8 A;  5GLB A;  3ZFZ A;  4WBG A;  5GLC A;  3UE3 A;  3HUN A;  3S4X A;  3PTE A;  4JPM A;  4HES A;  4KZ3 A;  1NZU A;  5EVI B;  1SHV A;  3LCE A;  1K54 C;  4WM9 A;  1SDN A;  4P6B A;  4JF6 A;  3PBS A;  4YIN A;  1VQQ A;  2XFT A;  1XP4 A;  2XQZ A;  3GV9 A; 
#chains in the Genus database with same CATH topology
 3BYD A;  3CPT B;  4JXW A;  2PYP A;  4E3N A;  3QNB A;  1S67 L;  1FOF A;  1K56 D;  1OTA A;  3BFF A;  4BMW A;  2VGJ A;  4IED A;  4JLF A;  1IKG A;  3D9Y A;  4NKP A;  3C8C A;  4X1L A;  2W3E A;  1NXY A;  4GN2 A;  1D1J A;  4KZ5 A;  3CWF A;  3O86 A;  2IWD A;  4MBK A;  3JVV A;  3FYZ A;  3IHA A;  5EM1 A;  3T4O A;  4DDY A;  4LCM A;  2JKG A;  3G31 A;  2GX5 A;  3BRM A;  5E2H A;  5AVF A;  4KG2 A;  4PKY A;  1O7E A;  1NZO A;  4S2J A;  4EXO A;  5FAT A;  2XLN A;  4FTX A;  4GHI A;  4JKT A;  5AQA A;  4DE2 A;  5FEF A;  2E8J A;  1G5U A;  4RA7 A;  4HJ3 A;  5FDH A;  3BY8 A;  3MS6 A;  3UB5 P;  1MWU A;  2Y2K A;  5L8M A;  2HF6 A;  2EWW A;  3R7W A;  2HP9 A;  1FSY A;  4HHD A;  3MFD A;  3UB7 A;  1HD8 A;  1CQA A;  3H82 B;  3MXQ A;  2Y2G A;  4KZA A;  3GTC A;  1JWV A;  3IS2 A;  2V1B A;  3UY6 A;  5HPF A;  1YLZ A;  3LIF A;  2A2L A;  3LFV A;  4R3A A;  1ZKJ A;  1SZV A;  1G28 A;  3AGD A;  1KGG A;  3ICY A;  3ZG7 B;  1IYO A;  5MC7 A;  2B5R A;  4ZJ1 A;  4Y17 A;  1L2S A;  3O3V A;  5HW3 A;  2V9A A;  3IXD A;  2AVX A;  4X6T A;  3DWZ A;  1KVM A;  3IBR A;  2BTF P;  3SH7 A;  3U4L P;  4PAU A;  1MXO A;  3WS1 A;  2P04 A;  2ZM2 A;  3IS2 B;  1L3L A;  3H7W B;  3MQ0 A;  1G6O A;  3HCY A;  1TS0 A;  2J9P A;  3MQQ A;  5DFX A;  5FI6 A;  3NCK A;  1V9Z A;  1GCE A;  2PYR A;  1NRJ A;  2BAS A;  5M1A A;  1S4R A;  4GW9 A;  4K08 A;  1W8Q A;  2BLS A;  1VET B;  3A3F A;  3PXP A;  3EOI A;  3IX4 A;  4Y0U A;  3HLD A;  4HH2 A;  5HL6 A;  3TRC A;  4GD6 A;  1K55 A;  2J9O A;  4FH4 A;  3A3E A;  1DJB A;  3CHW P;  4RX3 A;  4LRX C;  4U0X A;  1XX2 A;  1BSG A;  4B9O A;  2H10 A;  3NHQ A;  1I2S A;  1CEF A;  1XFQ A;  1RCJ A;  2JHE A;  2PT7 A;  3PHY A;  5GHZ A;  3CUE C;  3SH9 A;  1TD5 A;  4CJN A;  2P9V A;  3SOI A;  2D01 A;  4IHQ A;  4F3L A;  1C3B A;  4UHU A;  2O9A A;  5DJT A;  3UME A;  4HQA A;  1TEM A;  3WWX A;  4R23 A;  4OON A;  4WZ5 A;  4NET A;  2Y59 A;  4MCW A;  1MY8 A;  4JGP A;  5F1F A;  1PNE A;  2FFF B;  1WA9 A;  4E3L A;  1IEL A;  3RXX A;  2IWB A;  4BWI A;  2ZD8 A;  1ONH A;  3BW6 A;  4KQR A;  5A93 A;  1N9N A;  3Q82 A;  1GHI A;  3HLB A;  1YMX A;  3NIA A;  4WZ4 A;  4MN6 A;  2PRF A;  2ZMA A;  3RJU A;  3DWK A;  2CC1 A;  1T19 A;  3IX8 A;  2XSS A;  1TS8 A;  4KZ9 A;  4IUK A;  3LIA A;  3CAX A;  2WKH A;  4MBH A;  2Z6D A;  4GZB A;  4KZ6 A;  2ZMF A;  3ISG A;  2OWJ A;  5CEB A;  3IF6 A;  2XK1 A;  3L9K A;  3ZCZ A;  4WMC D;  3IWQ A;  4EER A;  5EUA A;  4BD0 A;  3Q7Z A;  1GA0 A;  3FKV A;  3TJZ C;  5J7E A;  1AXB A;  3IXB A;  1U60 A;  2W1T A;  3EEH A;  2WKE A;  4EBN A;  2ZM0 A;  3UE0 A;  1VHM A;  1NLY A;  3LGO A;  3E2L A;  4OP8 A;  1KVL A;  4N9L A;  3BFE A;  4K0W A;  1BLS A;  4MEZ A;  2JKT M;  2HJE A;  3PR6 A;  3VP3 A;  4RYE A;  2ZQD A;  3VOZ A;  3CZD A;  1L0D A;  3IF6 B;  1LL5 A;  4L9E A;  2Y2Q A;  1KE0 A;  4R3J A;  4DE0 A;  4FH2 A;  4ARZ B;  5TFQ A;  4A5R A;  2QWS A;  2PR5 A;  5FAQ A;  4JXV A;  4E3K A;  3TG9 A;  3R7W B;  4WL9 A;  2INW A;  3MZF A;  3E98 A;  3EEA A;  5EFW A;  4OP5 A;  4QD4 A;  5E2G A;  4BLM A;  4HP9 A;  2XGN A;  3V3S A;  5L10 A;  4DF6 A;  5FEG A;  2O9B A;  5EV0 A;  2WK0 A;  4MNR A;  3GRJ A;  3V39 A;  2EFU A;  4FSF A;  3VFF A;  3UE1 A;  1MPL A;  1JWP A;  2Y2N A;  2EA9 A;  3PYP A;  1Z6F A;  1IYP A;  4LV3 A;  3I7J A;  5M19 A;  1GSX A;  4JF4 A;  2XA7 S;  3D3O A;  5G4Z A;  2A49 A;  1LSW A;  1S6R A;  5TGF A;  3LY3 A;  2HP5 A;  3HLG A;  1DJC A;  3FC7 A;  1S1Y A;  3W2Z A;  2ZQ8 A;  3IH8 A;  4CLC A;  1YSQ A;  3KYQ A;  4KQO A;  2C5W B;  4L0L A;  4E3O A;  1FIL A;  3UPN A;  4ZJ3 A;  5HWV A;  2WKI A;  1GHM A;  1I2W A;  5CHM A;  3QP4 A;  3IHB A;  4PM8 A;  2ZOI A;  5HWT A;  3C7V A;  4PHT A;  1MC0 A;  3MFX A;  3FWL A;  3OCL A;  2ZOH A;  2Y2M A;  3CPT A;  5GLB A;  3ZFZ A;  3UE3 A;  3HUN A;  4HI4 A;  3T4T A;  3O5Y A;  2L4R A;  1SDN A;  4LLO B;  3PBS A;  2XRN A;  1VQQ A;  5TJJ A;  5FQQ A;  5GLA A;  2GZA A;  1SKO B;  1K54 A;  3T4L A;  1ES3 A;  3E4P A;  2Y91 A;  5TBM A;  2W1R A;  2PR6 A;  4R0Q A;  5IS1 A;  4O0P A;  5HPI A;  5U47 A;  4UA6 A;  4Q0H A;  5C5K A;  1WYC A;  1DP9 A;  1PI4 A;  2WKP A;  2Y79 A;  4KZ8 A;  4QWO A;  3IF6 C;  4K0X A;  5FQM A;  4EW7 A;  3P01 A;  3IWI A;  4X68 A;  2V1Z A;  4E04 A;  2W3H A;  4D60 A;  4YWZ A;  2Z6C A;  3G2Y A;  3T1R A;  3C4P A;  2JE5 A;  3T4J A;  3VFH A;  1FCN A;  5FI2 A;  1P97 A;  2WKR A;  1H8M A;  4OOY A;  3JYI A;  3DAV A;  3BLS A;  1L0E A;  3DBA A;  1KDW A;  4S2P A;  3T1S A;  3F1P A;  3O87 A;  2Y2O A;  1K57 A;  2OSU A;  4LV1 A;  1ACF A;  3OLO A;  4O8G A;  1UGU A;  2OLU A;  1OTB A;  4DN0 A;  3ZQ5 A;  1A0K A;  3IXG A;  3C30 A;  1GA9 A;  3UB6 A;  1RGY A;  3UE6 A;  3HLW A;  3LO7 A;  3KSI A;  3ZDJ A;  1XKZ A;  1H0M A;  4WZ5 C;  2HDR A;  3R4K A;  4KUK A;  3MZD A;  3LR5 A;  3E4O A;  1S66 L;  3D72 A;  4DRT A;  3UB8 A;  2KX6 A;  2DMW A;  3S7N A;  3G34 A;  4RVA A;  5HX9 A;  4GCZ A;  3MQO A;  4OLD A;  3UO9 A;  3M2J A;  4L9G A;  1PWG A;  3CG5 A;  4GS9 A;  1N4O A;  1YMS A;  3V67 A;  5AJG A;  4N9K A;  3A3I A;  5IT5 A;  2R9W A;  5I5L A;  1NYY A;  1XJ6 A;  4EEP A;  3WRT A;  3FPW A;  3GEC A;  1MBL A;  5FAO A;  3CLO A;  2WYX A;  1ALQ A;  5CRF A;  4ZJ2 A;  1ES4 A;  2VGK A;  2E8I A;  1PWC A;  1AWI A;  4B88 A;  2ZC3 B;  1PZO A;  1N9O A;  5HDC A;  5A91 A;  3UN7 A;  4GB7 A;  1HTZ A;  2EXA A;  2R9X A;  4WYY A;  1XJ2 A;  3NEC A;  3ZNY A;  4BEN A;  5KIZ A;  4OPZ A;  4R4S A;  3KO6 A;  3A0R A;  2JC7 A;  1T1C A;  4II7 A;  1XA7 A;  2X71 A;  4C3Q A;  4RX2 A;  3ZG8 B;  2HP6 A;  4WEL A;  1HZO A;  2Y2H A;  2ZL1 B;  3VE4 A;  1K6S A;  1D7E A;  4HP4 A;  5A90 A;  2VK3 A;  1LSX A;  5JYP A;  3C38 A;  4LRY C;  4HJ6 A;  3S7Q A;  3BWL A;  2RCX A;  1MKM A;  3D4F A;  3QNC A;  5A92 A;  4QHC A;  1XGJ A;  1PRQ A;  1H5X A;  1BUE A;  2L0W A;  4M3K A;  3GR2 A;  4Q0J A;  5CGX A;  4I3I A;  4IVI A;  4BL3 A;  2ZQ9 A;  1I5Q A;  5DJU A;  1UWN X;  2WZZ A;  1M6K A;  1K4F A;  3F1N A;  2QJ5 A;  2V2F F;  4YFM A;  3LIE A;  4KEN B;  2JKT I;  4F94 A;  3LIC A;  2PD8 A;  2J3T D;  2G7U A;  2V0U A;  4DXC A;  4Y7P A;  4EU0 A;  2PHY A;  1KGE A;  2XF3 A;  4P0M A;  5CX7 A;  5EEC A;  1Y4O A;  1K56 A;  1XFN A;  4DJ3 A;  3C4O A;  1ES2 A;  3A3J A;  3K3C A;  2J3W A;  2KOI A;  1X0O A;  1ERO A;  1FR6 A;  4UA7 A;  4IBR A;  4HBT A;  3PBT A;  1YAX A;  1TF1 A;  4DKI A;  5FQK A;  3WRZ A;  3F1N B;  3A3D A;  2EX2 A;  1OTD A;  3RTY A;  3HBR A;  5FAP A;  2QYB A;  5FI7 A;  4I3A A;  3Q7V B;  5I94 A;  2ACG A;  2GJ3 A;  3PBQ A;  2K31 A;  2EFX A;  3QP2 A;  5FDS A;  3ZNT A;  3VSL A;  1YSP A;  1NLZ A;  2Q9N A;  3TE8 A;  5KZH A;  2P9V B;  3W4O A;  4Y0O A;  3KSF A;  3S1Y A;  1E25 A;  3IWO A;  2HPB A;  3UPO A;  3T1X A;  5DVA A;  1T1A A;  3ZYT A;  4QY5 A;  4ESP A;  3VOY A;  3H7W A;  2Y2J A;  2OWH A;  2UWX A;  3HUO A;  5FA7 A;  2KLI A;  3C5A A;  1PYY A;  5F5Y A;  2NUT C;  2EX6 A;  4KUO A;  5CHJ A;  3G35 A;  5J4E A;  4QB8 A;  2X02 A;  1W79 A;  5EVI D;  4L9F A;  4HJ4 A;  4UA9 A;  4LCL A;  2WUQ A;  4R3B A;  4Z9Q A;  5E2E A;  4OLG A;  2ZQC A;  2GDN A;  1JTD A;  4OQI A;  4YOF A;  3SH8 A;  2Z2M B;  1XJ3 A;  4GOG A;  2XFS A;  1K4E A;  5CGS A;  2XR0 A;  2IA2 A;  4ME4 A;  4WLA A;  4Y13 A;  3IBJ A;  1BUL A;  3AGF A;  2QHK A;  4CPK A;  4GHI B;  2G2W A;  4S2K A;  3HRE A;  4NK3 A;  4S2N A;  4DXB A;  3IT9 A;  4WBG A;  3QP6 A;  1VEU B;  4JPM A;  5EVI B;  3BQA A;  1DP8 A;  5A8B A;  1DP6 A;  4YIN A;  2XFT A;  5HDD A;  2B95 A;  3NY4 A;  1T1B A;  2GNX A;  4AFI A;  2VGL S;  2VA0 A;  3N7W A;  2XD1 A;  1IFQ A;  5LBR A;  1YT4 A;  3SZT A;  1BLH A;  2ZLY A;  3RFB A;  2Y4A A;  2RL3 A;  2DNS A;  3DTI A;  3HLC A;  3WS5 A;  1D06 A;  4H8R A;  3M6H A;  3BJN A;  3GDI A;  3IX3 A;  2ZC4 B;  3DTK A;  3B3X A;  2O9C A;  3T50 A;  4OKP A;  2A3U A;  3NOU C;  2WGW A;  3P98 A;  1GSW A;  1ESI A;  3MMH A;  2M7V A;  5F1G A;  2XA7 M;  4Y5F A;  1L0G A;  2DCF A;  2VV8 A;  3UB9 A;  4S2I A;  3G4P A;  1ODV A;  4HBU A;  4EV4 A;  1Q2P A;  1RGZ A;  4S2L A;  1CK3 A;  5M18 A;  3N8L A;  4UAA A;  3CJM A;  3EGX C;  1MWR A;  4R4R A;  2ZJ9 A;  2PD7 A;  3LIB A;  4R38 A;  4WN5 A;  2O99 A;  1CI8 A;  1PI5 A;  1CJF A;  4IVK A;  5AVE A;  4OVD A;  4B4Z A;  2ZM8 A;  3GSG A;  2WZX A;  5EVI A;  3M2K A;  2ZMV A;  3SS3 A;  5FQI A;  1VEU A;  2V0W A;  2P74 A;  2ZQA A;  3BLM A;  1K6R A;  4BBT A;  4ETX A;  3PBN A;  3S7P A;  3NDG A;  5CGW A;  4P6Z M;  5CEC A;  5HL1 A;  2IWC A;  5HAR A;  3ZG9 B;  3SS5 A;  3KX0 X;  2JCH A;  4DDS A;  1G6A A;  2M7U A;  2VKS A;  4QJG A;  3LY4 A;  1K25 A;  2W1T B;  5TR7 A;  3OPP A;  3PBR A;  1ZG6 A;  4G3V A;  4HEF A;  1PIO A;  3LYX A;  4QPR A;  5CTM A;  5G4Y A;  5CER A;  1K38 A;  3VP0 A;  1YLP A;  3VP4 A;  4NEE D;  1XPB A;  1ESU A;  3M6B A;  1XA1 A;  1W5D A;  3VV4 A;  1YPR A;  2WAD A;  1H8Z A;  3BFD A;  5FAS A;  1JNU A;  3ULF A;  4FCF A;  3N6I A;  5HSQ A;  1ERQ A;  2CMN A;  4KZB A;  1IKI A;  5HAI A;  4NXE A;  1EWZ A;  1OT6 A;  4GLQ A;  3RH8 B;  3W8K A;  2ZL1 A;  3TW8 A;  3FPV A;  4S2O A;  1LSV A;  1RP5 A;  3G30 A;  4P87 A;  3HJI A;  1NY0 A;  4LPZ A;  1BLC A;  5DKL A;  4H6J A;  5EVL A;  2VLG A;  4FD8 A;  3VMA A;  4B93 A;  5F69 A;  4OQG A;  4OPR A;  1QME A;  4EQI A;  1KOU A;  2V1A A;  2W3D A;  4HH3 A;  4OH0 A;  2XRO A;  2WAF A;  4O01 A;  3BEC A;  2OOL A;  2I9V A;  2H28 A;  5GHX A;  1K57 C;  1EI5 A;  2OLV A;  3BFC A;  3P7N A;  3NOT C;  5DKK A;  1FIK A;  3UMD A;  4ZDX A;  4MMN A;  4WF0 A;  4X25 A;  2NUP C;  3LI8 A;  4KZ7 A;  1QMF A;  3A0V A;  4E3M A;  5FQJ A;  1OTE A;  3BFG A;  2Q0O A;  1XXM A;  2JKR I;  2QKP A;  2V20 A;  3HUM A;  1OPX A;  1LHY A;  3MJQ A;  4PM7 A;  3MXR A;  2VEA A;  3NC8 A;  4ZBE A;  4MN5 A;  1S1Z A;  3UPP A;  1BT5 A;  3WS2 A;  5HAP A;  3P09 A;  3CI6 A;  4DE3 A;  3UDI A;  4OOM A;  3PBO A;  3OOV A;  4G3K A;  3WS0 A;  1YKD A;  3VOL A;  4OOL A;  2XD5 A;  5KSH A;  1XJ4 A;  2H0Y A;  4IJG A;  4OQ0 A;  4O7D A;  3NOP C;  3OCN A;  4FUW A;  2HDS A;  4ZAM A;  1E3U D;  2H5S A;  2PBD P;  2EX9 A;  1IEM A;  5HZH A;  4LRZ E;  4YNR A;  4NXG A;  5J8X A;  1IOU A;  5L2F A;  1H8Y A;  3LI9 A;  2A24 A;  3WS4 A;  4PMA A;  1E3U A;  2Q9M A;  1DJA A;  1TVF A;  4IUH A;  3ZVW A;  1J3W A;  2ZQ7 A;  3DW0 A;  3KYZ A;  3K3D A;  4KG6 A;  1NYM A;  1SCW A;  1NRF A;  3OZH A;  4GJ4 A;  3HL9 A;  2WKQ A;  3LEZ A;  4MDZ A;  3Q07 A;  1MZU A;  1VB6 A;  1PW8 A;  4PPR A;  5HWW A;  3FKW A;  1VET A;  1WYB A;  1NWZ A;  4GS9 B;  4CLC C;  4N1X A;  5AQ7 A;  3IXH A;  5DFY A;  4Y15 A;  4Q8I A;  1TDL A;  1JWZ A;  3B47 A;  4MN7 A;  1LL9 A;  1KDS A;  4BL2 A;  3QHY A;  1LI0 A;  4HY8 A;  4C75 A;  4M4X A;  3OPL A;  2DRW A;  2FZ0 A;  3C7U A;  3QP8 A;  3ZGA B;  3HVF A;  2W0N A;  3FV7 A;  1XGI A;  1MWT A;  1YLT A;  4DMZ A;  3S7O A;  4UQI M;  1OT9 A;  2G2U A;  1KE3 A;  2WGV A;  2UV0 E;  2XDM A;  2JN7 A;  1F2K A;  1ONG A;  1N9L A;  4ZTK A;  4LV2 A;  2QJ7 A;  5IU1 A;  4G3W A;  3IH9 A;  3N4I A;  3GQZ A;  2HJ9 C;  4JBF A;  4ID4 A;  3TSG A;  1O07 A;  5DTT A;  4PM5 A;  3LUQ A;  4EBL A;  3Q81 A;  3VSK A;  4PM9 A;  4CLC E;  3GVB A;  3KSG A;  2XEP A;  2ZC7 A;  4JF5 A;  3NBL A;  3NDE A;  4S2M A;  1FCM A;  1Q2Q A;  2M1C A;  3OPH A;  3U2A A;  2I72 A;  3IF5 A;  1ZTU A;  3KSH A;  4JGO A;  1S0W A;  2VGL M;  4U0T A;  1BYW A;  3OBF A;  3S22 A;  2PU2 A;  5DF8 A;  2J3T C;  3JPU A;  3PTE A;  4HES A;  4ARZ A;  3T12 B;  1SHV A;  4Y3I A;  2B02 A;  1SKO A;  4CLC D;  1K54 C;  1W63 Q;  4JF6 A;  2EXB A;  3C2W A;  2XQZ A;  3GV9 A;  4DE1 A;  1ZC2 A;  3ITA A;  1OJ5 A;  3KYE A;  2WAE A;  3B42 A;  2PAV P;  5IHV A;  2BG1 A;  2HV1 A;  2VX8 A;  4OPQ A;  4P85 A;  3MXS A;  4LV0 A;  5F6A A;  2LB5 A;  5DTS A;  1H3Q A;  3SS4 A;  1YLY A;  4R1G A;  3MR0 A;  4LFU A;  5CED A;  4NG2 A;  1IYQ A;  4XUZ A;  5KSC A;  4I5S A;  1WE4 A;  4BBU A;  3BEB A;  2LB9 A;  5GLD A;  3EWK A;  2EWV A;  3K2N A;  2YKH A;  1PZP A;  3NUL A;  4FOF A;  4Y2F A;  3HLF A;  3MZE A;  1FR1 A;  2Y2P A;  4XUX A;  2VZW A;  1S4S A;  1MKI A;  4E3J A;  4GD8 A;  2OV5 A;  1LL8 A;  5CHU A;  1PFL A;  2J8Y A;  5HDS A;  4XT2 B;  1J9M A;  1KE4 A;  2V8C A;  4NXB A;  2MJ6 A;  5DTK A;  5J3W A;  5FQ9 A;  4LGW A;  3OC2 A;  3ZG0 A;  4WEJ A;  5FL3 A;  1W8Y A;  1YLW A;  1PWD A;  3CUE A;  3E4Q A;  3LR3 A;  5AQ9 A;  3Q1F A;  1CEG A;  5HAQ A;  3SW1 A;  2H0T A;  3N8R A;  2XH9 A;  1F5M A;  3T4K A;  5EVE A;  3EGD C;  3RXW A;  2HGV A;  1OME A;  3AGE A;  3EQV A;  4GKU A;  5GL9 A;  4XT2 A;  3A0S A;  3NJA A;  4EBP A;  1K55 C;  1F9I A;  2ZC6 B;  2VV6 A;  2VV7 A;  3FZC A;  4EUZ A;  1MWS A;  4CLC B;  4BBV A;  4X1M A;  5EM0 A;  1NJ4 A;  3CMZ A;  4MLL A;  3W4P A;  3W4Q A;  2J7V A;  3Q7V A;  1OTI A;  3HLE A;  3T1Q B;  2P7J A;  2KDK A;  5E2F A;  4GNU A;  3MKE A;  2Y55 A;  3ITB A;  1DY6 A;  1ES5 A;  5CXW A;  1FCO A;  3UDX A;  5DF9 A;  4PKY G;  2OAQ 1;  1LLB A;  3UNW A;  4MBF A;  4CQH A;  3PAE A;  1T18 A;  1Y54 A;  1W63 M;  4ZRR A;  1L0F A;  2JKR M;  5AQB A;  1STZ A;  3BQ8 A;  4S2N C;  4BQM A;  4EEU A;  3F1P B;  4Y0T A;  3QP1 A;  1JTG A;  4OQH A;  4C6Y A;  5F68 A;  5HFO A;  1UWP X;  4E6X A;  3QP5 A;  4EQ1 A;  3LR4 A;  4EET B;  2ZC5 B;  4QY6 A;  2Z2L B;  3E0Y A;  1P9R A;  1SKF A;  4HIA A;  1ERM A;  3MSH A;  2C6W B;  5JYO A;  3V3R A;  3BM6 A;  4OPY A;  5F83 A;  3T4S A;  1YM1 A;  3EQU A;  4NXF A;  3VP2 A;  5F82 A;  2W27 A;  1CI9 A;  4U3T A;  4HOI A;  3H82 A;  3FG8 A;  2W3G A;  4JXS A;  4GDN A;  1V9Y A;  4F3L B;  5EVI C;  4X55 A;  3F1O B;  2A24 B;  4P6Z S;  4JGR A;  1CF0 A;  2PBY A;  4X69 A;  1OJG A;  5EPH A;  5FSR A;  5HD3 A;  3IQA A;  4LEN A;  1W7F A;  3ZG5 A;  3BY9 A;  1Z09 A;  2JBF A;  4EES A;  5L09 A;  3V50 A;  4I39 A;  1M40 A;  2JKF A;  4UQI S;  2L1M A;  5BOH A;  4K91 A;  3O88 A;  3MBZ A;  4DJ2 A;  2J80 A;  3LID A;  1IYS A;  4N92 A;  4PM6 A;  5DF7 A;  4JGQ A;  4ETZ A;  1YQS A;  3HJK A;  1PW1 A;  3NI9 A;  2QMI A;  4KZ4 A;  4X53 A;  3E2K A;  3MF0 A;  1DRM A;  1P0Z A;  2X01 A;  1ZHH B;  5EE8 A;  4JXG A;  3JVU A;  4KQQ A;  5EOE A;  3ZVT A;  5TBM B;  1LI9 A;  3DTE A;  4KQD A;  2V8F A;  5D3O A;  5KMW A;  2D02 A;  4BD1 A;  2O0Y A;  1SDE A;  1N9B A;  3B33 A;  3GMW A;  4WUJ A;  3MKF A;  3VP1 A;  3TOI A;  4B4X A;  4GDB A;  3N8S A;  2R78 A;  1JVJ A;  1FSW A;  1LT0 A;  3G32 A;  4XXR A;  1F98 A;  2ZBB A;  5G18 A;  4H6J B;  4N1H A;  1G68 A;  5GHY A;  2OAP 1;  2Y2I A;  1TDG A;  4Q0I A;  4I38 A;  1K0K A;  2HZ5 A;  2QZ6 A;  2FFY A;  1BLP A;  1KGF A;  5HD5 A;  1Y28 A;  4IBX A;  4R6L A;  2Y2L A;  5CTN A;  3VE3 A;  1P9W A;  3UDF A;  1YLJ A;  3CIT A;  2HDU A;  5L07 A;  1BTL A;  1HVB A;  1GSV A;  3OPR A;  4X56 A;  2P08 A;  3PAG A;  2HDQ A;  3L7H A;  5E43 A;  4RQ9 A;  1TS7 A;  2VJW A;  3T4Q A;  4E3I A;  4WMC A;  1ZG4 A;  4HNB A;  5EOO A;  2WGI A;  1EW0 A;  2FH5 A;  2K2N A;  3F1O A;  4I3J A;  1HLU P;  3ZHH A;  2B18 A;  3LEQ A;  5K5B A;  4E6W A;  4R70 A;  2PU4 A;  4KG5 A;  2QPN A;  4WEK A;  1GHP A;  1TS6 A;  1FQG A;  2WGW B;  3G2Z A;  2Y8H A;  2PDR A;  1BZA A;  3V5M A;  1VM1 A;  4EWF A;  1E4D A;  2EX8 A;  4UEY A;  4BJP A;  2K7S A;  3G6O A;  4QU3 A;  4D2O A;  3H9W A;  3DTM A;  5GLC A;  3S4X A;  4EUV A;  4KZ3 A;  1NZU A;  3LCE A;  4WM9 A;  2W3F A;  4P6B A;  2YKF A;  3LR0 A;  4Z1W A;  1XP4 A; 
#chains in the Genus database with same CATH homology
 3BYD A;  4JXW A;  4DE1 A;  1ZC2 A;  3NY4 A;  5FQQ A;  4E3N A;  3QNB A;  5GLA A;  3N7W A;  3ITA A;  1FOF A;  2XD1 A;  1K56 D;  2WAE A;  1K54 A;  3BFF A;  1YT4 A;  1ES3 A;  2Y91 A;  2VGJ A;  4R0Q A;  4IED A;  4JLF A;  1BLH A;  1IKG A;  2ZLY A;  5IHV A;  2Y4A A;  2BG1 A;  2RL3 A;  4OPQ A;  4P85 A;  5U47 A;  4UA6 A;  3MXS A;  2DNS A;  1WYC A;  4LV0 A;  1PI4 A;  3HLC A;  3WS5 A;  1NXY A;  4H8R A;  5DTS A;  3SS4 A;  3M6H A;  4KZ8 A;  4GN2 A;  1YLY A;  3IF6 C;  4K0X A;  4KZ5 A;  4R1G A;  2ZC4 B;  5FQM A;  5CED A;  3B3X A;  3O86 A;  1IYQ A;  4OKP A;  3IWI A;  2A3U A;  4X68 A;  4XUZ A;  5KSC A;  2IWD A;  2V1Z A;  2WGW A;  4MBK A;  3P98 A;  1WE4 A;  3BEB A;  5GLD A;  1ESI A;  3FYZ A;  3G2Y A;  3C4P A;  5F1G A;  2JE5 A;  3VFH A;  1L0G A;  1FCN A;  3IHA A;  1PZP A;  5FI2 A;  2DCF A;  4DDY A;  4S2I A;  4LCM A;  3G4P A;  4HBU A;  3HLF A;  4EV4 A;  3G31 A;  3MZE A;  1FR1 A;  2Y2P A;  1Q2P A;  3BRM A;  4OOY A;  1RGZ A;  3JYI A;  4S2L A;  5E2H A;  4XUX A;  4KG2 A;  1CK3 A;  3BLS A;  1O7E A;  5M18 A;  1MKI A;  1NZO A;  4S2J A;  4E3J A;  1L0E A;  3N8L A;  4UAA A;  5FAT A;  1KDW A;  2XLN A;  3CJM A;  4GD8 A;  4S2P A;  2OV5 A;  5CHU A;  3O87 A;  4JKT A;  2Y2O A;  5AQA A;  4DE2 A;  1K57 A;  2OSU A;  1MWR A;  4LV1 A;  4R4R A;  2ZJ9 A;  2J8Y A;  1J9M A;  1KE4 A;  2OLU A;  5DTK A;  4RA7 A;  5FQ9 A;  1CI8 A;  5FDH A;  1PI5 A;  4IVK A;  3IXG A;  4OVD A;  4B4Z A;  3OC2 A;  3ZG0 A;  2ZM8 A;  1MWU A;  3GSG A;  4WEJ A;  1GA9 A;  1W8Y A;  1RGY A;  2Y2K A;  1YLW A;  1PWD A;  2WZX A;  3HLW A;  3LO7 A;  5AQ9 A;  3M2K A;  3Q1F A;  5EVI A;  3ZDJ A;  1CEG A;  3SS3 A;  1XKZ A;  5FQI A;  5HAQ A;  2H0T A;  2HP9 A;  1FSY A;  2XH9 A;  3N8R A;  3MFD A;  3RXW A;  1OME A;  1HD8 A;  4WZ5 C;  2P74 A;  2ZQA A;  3AGE A;  2HDR A;  2Y2G A;  3EQV A;  3BLM A;  3MZD A;  3GTC A;  4GKU A;  4KZA A;  1JWV A;  5GL9 A;  3UY6 A;  1K6R A;  1YLZ A;  3PBN A;  4DRT A;  1ZKJ A;  3NDG A;  5CGW A;  4EBP A;  1K55 C;  3AGD A;  5CEC A;  1KGG A;  3G34 A;  4RVA A;  5HX9 A;  2ZC6 B;  4OLD A;  3UO9 A;  3ZG7 B;  5HL1 A;  2IWC A;  1IYO A;  5HAR A;  3ZG9 B;  2B5R A;  3M2J A;  2JCH A;  3FZC A;  4ZJ1 A;  1G6A A;  3SS5 A;  1MWS A;  1PWG A;  3CG5 A;  1L2S A;  4DDS A;  4EUZ A;  4QJG A;  3LY4 A;  1N4O A;  1K25 A;  1YMS A;  3O3V A;  1NJ4 A;  5TR7 A;  4N9K A;  3A3I A;  5HW3 A;  2R9W A;  3CMZ A;  4MLL A;  3W4P A;  3IXD A;  3OPP A;  3PBR A;  4X6T A;  1ZG6 A;  3DWZ A;  1NYY A;  3W4Q A;  4HEF A;  2J7V A;  1KVM A;  3Q7V A;  1PIO A;  3WRT A;  5CTM A;  3SH7 A;  3HLE A;  3WS1 A;  1MXO A;  5CER A;  2ZM2 A;  1K38 A;  1MBL A;  3VP0 A;  5E2F A;  1YLP A;  5FAO A;  4GNU A;  2WYX A;  1ALQ A;  3MKE A;  2Y55 A;  3VP4 A;  3ITB A;  1DY6 A;  1ES5 A;  5CRF A;  5CXW A;  1XPB A;  1FCO A;  1ESU A;  4ZJ2 A;  1ES4 A;  3M6B A;  2VGK A;  2E8I A;  2J9P A;  3UDX A;  1PWC A;  5DF9 A;  1XA1 A;  1W5D A;  4B88 A;  2ZC3 B;  5FI6 A;  3NCK A;  1PZO A;  1LLB A;  2WAD A;  3UN7 A;  5A91 A;  3UNW A;  4MBF A;  1H8Z A;  1GCE A;  3BFD A;  3PAE A;  5FAS A;  4GB7 A;  1HTZ A;  5M1A A;  2EXA A;  2R9X A;  4FCF A;  3N6I A;  1W8Q A;  1Y54 A;  1ERQ A;  2BLS A;  4KZB A;  1IKI A;  3A3F A;  4WYY A;  5HAI A;  1EWZ A;  4Y0U A;  1L0F A;  3ZNY A;  5AQB A;  3W8K A;  3HLD A;  4BEN A;  4S2O A;  4GD6 A;  4OPZ A;  4S2N C;  1K55 A;  1RP5 A;  3G30 A;  4P87 A;  2J9O A;  4R4S A;  4FH4 A;  4BQM A;  2JC7 A;  3A3E A;  1XA7 A;  1NY0 A;  2X71 A;  1DJB A;  4C3Q A;  1BLC A;  4RX2 A;  4RX3 A;  4Y0T A;  5EVL A;  3ZG8 B;  2HP6 A;  4WEL A;  1JTG A;  4OQH A;  4C6Y A;  4U0X A;  1XX2 A;  1BSG A;  1HZO A;  2Y2H A;  5HFO A;  1K6S A;  2H10 A;  4E6X A;  1I2S A;  1CEF A;  4FD8 A;  1RCJ A;  3VMA A;  5A90 A;  5JYP A;  2ZC5 B;  5GHZ A;  4QY6 A;  4OQG A;  3SH9 A;  2Z2L B;  4CJN A;  4OPR A;  1QME A;  2P9V A;  3SOI A;  1SKF A;  4EQI A;  1ERM A;  2C6W B;  2RCX A;  4OH0 A;  3D4F A;  3QNC A;  1C3B A;  4UHU A;  2WAF A;  3V3R A;  5JYO A;  3BEC A;  3BM6 A;  4QHC A;  5A92 A;  4OPY A;  5F83 A;  1YM1 A;  1XGJ A;  5GHX A;  1H5X A;  1TEM A;  1BUE A;  1K57 C;  1EI5 A;  3EQU A;  2OLV A;  3WWX A;  3BFC A;  3GR2 A;  4M3K A;  3VP2 A;  5F82 A;  4R23 A;  5CGX A;  4OON A;  1CI9 A;  4U3T A;  4NET A;  4WZ5 A;  4ZDX A;  4JXS A;  4GDN A;  2Y59 A;  1MY8 A;  4IVI A;  4BL3 A;  5EVI C;  2ZQ9 A;  1I5Q A;  4X55 A;  5F1F A;  4KZ7 A;  1QMF A;  4E3M A;  2FFF B;  2WZZ A;  5FQJ A;  1M6K A;  1K4F A;  3BFG A;  2V2F F;  1XXM A;  4YFM A;  1IEL A;  3RXX A;  4E3L A;  2PBY A;  4KEN B;  4X69 A;  2IWB A;  2V20 A;  3HUM A;  2ZD8 A;  4F94 A;  1LHY A;  1ONH A;  4PM7 A;  3MXR A;  5EPH A;  5FSR A;  4DXC A;  3IQA A;  4KQR A;  4LEN A;  1W7F A;  3NC8 A;  3ZG5 A;  5A93 A;  4Y7P A;  4ZBE A;  3Q82 A;  1GHI A;  2XF3 A;  1BT5 A;  1KGE A;  3UPP A;  3HLB A;  3WS2 A;  5HAP A;  1YMX A;  3P09 A;  4P0M A;  3NIA A;  4DE3 A;  2JBF A;  4WZ4 A;  5EEC A;  4OOM A;  3UDI A;  2EXB A;  1K56 A;  3PBO A;  3V50 A;  3WS0 A;  1M40 A;  1ES2 A;  3A3J A;  3C4O A;  2ZMA A;  3RJU A;  5BOH A;  4OOL A;  2XD5 A;  3DWK A;  4K91 A;  2CC1 A;  5KSH A;  2H0Y A;  3O88 A;  3MBZ A;  4KZ9 A;  1ERO A;  1FR6 A;  4OQ0 A;  4O7D A;  2WKH A;  4UA7 A;  4MBH A;  4IBR A;  4HBT A;  3PBT A;  1IYS A;  4N92 A;  3OCN A;  4PM6 A;  2HDS A;  4GZB A;  5DF7 A;  4ZAM A;  4KZ6 A;  3ISG A;  1E3U D;  2H5S A;  4DKI A;  5CEB A;  1YQS A;  3IF6 A;  1PW1 A;  2XK1 A;  3NI9 A;  3ZCZ A;  2QMI A;  4WMC D;  4KZ4 A;  3IWQ A;  5FQK A;  3WRZ A;  5EUA A;  3A3D A;  3Q7Z A;  2EX9 A;  1IEM A;  2EX2 A;  1GA0 A;  3FKV A;  4X53 A;  4BD0 A;  3E2K A;  1AXB A;  3IXB A;  1U60 A;  2WKE A;  4EBN A;  2ZM0 A;  3UE0 A;  2X01 A;  3HBR A;  5FAP A;  5J8X A;  5L2F A;  5FI7 A;  1H8Y A;  3Q7V B;  5EE8 A;  4JXG A;  4KQQ A;  3WS4 A;  4PMA A;  5EOE A;  3ZVT A;  5I94 A;  1E3U A;  3E2L A;  3PBQ A;  1LI9 A;  1KVL A;  2Q9M A;  1DJA A;  1TVF A;  4OP8 A;  4N9L A;  3BFE A;  4K0W A;  1BLS A;  5D3O A;  4MEZ A;  3ZVW A;  5KMW A;  2EFX A;  2ZQ7 A;  3DW0 A;  3ZNT A;  3VSL A;  3VP3 A;  4RYE A;  4KG6 A;  2ZQD A;  3VOZ A;  1NYM A;  3CZD A;  1L0D A;  3IF6 B;  2Q9N A;  1LL5 A;  1SCW A;  1NRF A;  3OZH A;  2Y2Q A;  1KE0 A;  4BD1 A;  5KZH A;  1SDE A;  3HL9 A;  1N9B A;  3GMW A;  2P9V B;  3LEZ A;  3MKF A;  4R3J A;  3TOI A;  3VP1 A;  3Q07 A;  3W4O A;  4Y0O A;  1PW8 A;  4PPR A;  4B4X A;  3FKW A;  4GDB A;  4FH2 A;  3S1Y A;  4DE0 A;  1E25 A;  3N8S A;  1JVJ A;  1FSW A;  1WYB A;  3IWO A;  3G32 A;  5TFQ A;  4A5R A;  4XXR A;  5FAQ A;  4JXV A;  4E3K A;  4N1X A;  3TG9 A;  5AQ7 A;  3IXH A;  5G18 A;  2HPB A;  3MZF A;  4Q8I A;  1TDL A;  1JWZ A;  4N1H A;  3UPO A;  1G68 A;  5GHY A;  1LL9 A;  1KDS A;  4BL2 A;  5DVA A;  3QHY A;  4OP5 A;  4QD4 A;  1LI0 A;  2Y2I A;  5E2G A;  1TDG A;  4BLM A;  4QY5 A;  4C75 A;  3VOY A;  2XGN A;  3V3S A;  2Y2J A;  2QZ6 A;  3OPL A;  2DRW A;  3C7U A;  4DF6 A;  3ZGA B;  2FFY A;  3HVF A;  1BLP A;  2UWX A;  2WK0 A;  4MNR A;  3FV7 A;  3HUO A;  1KGF A;  1XGI A;  3GRJ A;  1MWT A;  3V39 A;  1YLT A;  5FA7 A;  4IBX A;  2EFU A;  4FSF A;  2Y2L A;  5CTN A;  2G2U A;  3VFF A;  3C5A A;  1PYY A;  1KE3 A;  1MPL A;  3UE1 A;  1JWP A;  2WGV A;  3UDF A;  1YLJ A;  2EX6 A;  2Y2N A;  2HDU A;  2XDM A;  1BTL A;  1HVB A;  5CHJ A;  1Z6F A;  1IYP A;  3G35 A;  4LV3 A;  3OPR A;  1ONG A;  4QB8 A;  4X56 A;  4ZTK A;  3I7J A;  2X02 A;  3PAG A;  1W79 A;  2HDQ A;  5EVI D;  5M19 A;  5E43 A;  4LV2 A;  4JF4 A;  3IH9 A;  3N4I A;  3GQZ A;  4UA9 A;  4LCL A;  2A49 A;  4E3I A;  4WMC A;  2WUQ A;  1ZG4 A;  4JBF A;  4ID4 A;  3TSG A;  1O07 A;  5DTT A;  1S6R A;  4PM5 A;  5TGF A;  3LY3 A;  2HP5 A;  3HLG A;  3Q81 A;  1DJC A;  4R3B A;  4Z9Q A;  3VSK A;  5EOO A;  4EBL A;  5E2E A;  2WGI A;  3ZHH A;  4PM9 A;  3GVB A;  4OLG A;  2ZQC A;  2GDN A;  1JTD A;  4OQI A;  2XEP A;  4E6W A;  2ZQ8 A;  3IH8 A;  2ZC7 A;  4JF5 A;  3SH8 A;  2Z2M B;  2PU4 A;  3NBL A;  4KG5 A;  3NDE A;  4GOG A;  2XFS A;  2QPN A;  1K4E A;  4WEK A;  1GHP A;  5CGS A;  4S2M A;  2XR0 A;  1FCM A;  1Q2Q A;  4KQO A;  1FQG A;  2C5W B;  4L0L A;  4E3O A;  1BUL A;  3OPH A;  2WGW B;  3AGF A;  3G2Z A;  3UPN A;  2I72 A;  3IF5 A;  4CPK A;  4ZJ3 A;  2G2W A;  2WKI A;  4S2K A;  1GHM A;  1I2W A;  1BZA A;  3V5M A;  5CHM A;  3HRE A;  1VM1 A;  4EWF A;  1E4D A;  2EX8 A;  3IHB A;  4NK3 A;  4PM8 A;  3C7V A;  4BJP A;  4S2N A;  1S0W A;  4QU3 A;  4U0T A;  3FWL A;  3OCL A;  3S22 A;  4D2O A;  4DXB A;  2Y2M A;  3IT9 A;  2PU2 A;  3DTM A;  5DF8 A;  5GLB A;  3ZFZ A;  4WBG A;  5GLC A;  3UE3 A;  3HUN A;  3S4X A;  3PTE A;  4JPM A;  4HES A;  4KZ3 A;  1NZU A;  5EVI B;  1SHV A;  3LCE A;  1K54 C;  4WM9 A;  1SDN A;  4P6B A;  4JF6 A;  3PBS A;  4YIN A;  1VQQ A;  2XFT A;  1XP4 A;  2XQZ A;  3GV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...