1MZUA

Crystal structure of the photoactive yellow protein domain from the sensor histidine kinase ppr from rhodospirillum centenum
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
107
Chain Sequence
IDTAEFDALPVGAIQVDGSGVIHRYNRTESRLSGRIPERVIGRNFFTEVAPCTNIPAFSGRFMDGVTSGTLDARFDFVFDFQMAPVRVQIRMQNAGVPDRYWIFVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PPR
publication title Crystal Structure of a Photoactive Yellow Protein from a Sensor Histidine Kinase: Conformational Variability and Signal Transduction
pubmed doi rcsb
source organism Rhodospirillum centenum
molecule tags Signaling protein
total genus 27
structure length 107
sequence length 110
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1mzuA00
1OTDA 2PYPA 4RQ9A 1XJ3A 3RTYA 4HJ6A 4I3AA 3LIFA 1MZUA 5HDSA 4HHDA 2V1BA 1OTBA 2A24B 5AVFA 2QHKA 2ZOHA 1T1CA 1OT9A 3UE6A 4HQAA 2PR6A 4EQ1A 4WN5A 3F1OB 2M1CA 5HDCA 1UGUA 5J3WA 4H6JA 1D06A 1UWNX 3KX0X 1T18A 5F5YA 2BASA 4PKYA 3NOTC 3EEHA 2PDRA 5F69A 1OTAA 3F1NA 2VLGA 2R78A 1LSXA 5G4YA 4LRXC 1DP9A 1EW0A 3UB6A 1NWZA 4NXEA 4B9OA 4M4XA 2OWJA 5KIZA 4R70A 2HV1A 3A0VA 4KUOA 5HSQA 4I3IA 3LI8A 1TS8A 1TS6A 2K7SA 1OJGA 4H6JB 2WKPA 2V0UA 4LLOB 5A8BA 2QWSA 2OOLA 1P97A 3G6OA 1LL8A 3F1OA 4LRZE 4JGQA 2B02A 1XJ6A 1GSWA 3ULFA 4EESA 1F98A 5I5LA 3RH8B 1LSVA 3H9WA 3VE3A 3FC7A 3GECA 1XFNA 1LSWA 2D02A 4MN5A 2OWHA 5IS1A 5HWVA 3LI9A 4DJ2A 5HWWA 3MJQA 3LIAA 3BY9A 1XJ2A 4EETB 4LRYC 4NXBA 3BWLA 1OJ5A 1S1YA 2VV7A 4WL9A 3UB8A 1OTIA 3H82A 1P0ZA 1TS7A 4I39A 5DKKA 3F1PB 2QJ5A 4JGPA 4I3JA 4NXGA 2PD8A 4HH2A 2V1AA 5F68A 3UMEA 3CAXA 4HNBA 4NXFA 5HWTA 3OLOA 5DJUA 4HI4A 1UWPX 4HH3A 4BBVA 1DRMA 1GSVA 5HDDA 2KX6A 3IS2B 2Z6DA 4EEUA 4YWZA 3H82B 4WUJA 3LIEA 4I38A 1D7EA 4F3LB 1V9YA 1ODVA 4I5SA 4GHIB 3CWFA 3BY8A 3A0SA 5DKLA 4L9EA 4R3AA 3NOUC 1F9IA 3NHQA 3F1PA 3E4OA 3ZQ5A 3C2WA 4EERA 3H7WB 4HP9A 1TS0A 2QJ7A 4EEPA 5G4ZA 4E04A 3LYXA 4HIAA 4K08A 2P7JA 3EWKA 3MXQA 3MQOA 1G28A 3SW1A 2W27A 3C8CA 3PYPA 5TBMB 4BBUA 2VEAA 1DP6A 3FG8A 1S1ZA 2YKHA 3HJKA 3IBRA 5HD5A 1N9OA 5DJTA 2JN7A 2JHEA 3IS2A 4GW9A 3P7NA 2INWA 2V0WA 3LUQA 1S4RA 3VOLA 5HZHA 4BBTA 4WF0A 2CMNA 1DP8A 4F3LA 2W0NA 4HJ3A 4XT2B 4EXOA 1BYWA 1T1AA 2J80A 4GHIA 1OTEA 2WKQA 4GS9A 2L0WA 4HJ4A 3D72A 4R6LA 2WKRA 2KDKA 5AVEA 1N9LA 1KOUA 4R38A 2EA9A 3PHYA 1X0OA 2PR5A 3H7WA 4MN6A 4HY8A 2H28A 1JNUA 4HOIA 4DJ3A 3UB9A 2VV6A 2YKFA 3VE4A 1T19A 3HJIA 4L9FA 3LIDA 3A0RA 3UB7A 2VV8A 1Y28A 1S67L 1LT0A 2L1MA 2ZBBA 5IU1A 5TBMA 3MQQA 2I9VA 1S66L 3B33A 1XJ4A 4L9GA 4PKYG 2L4RA 3LIBA 3LICA 1XFQA 5F6AA 3K3CA 4WLAA 4GS9B 4KQDA 5EFWA 3NOPC 4XT2A 1VB6A 3ICYA 3NJAA 4JGRA 3E4PA 3CLOA 4JGOA 4EW7A 3UMDA 1WA9A 4KUKA 2Z6CA 5HD3A 1T1BA 4HP4A 2A24A 2D01A 2PD7A 3MR0A 1OT6A 1S4SA 2GJ3A 2QKPA 1N9NA 2V9AA 3E4QA 5J4EA 3GDIA 2ZOIA 3K3DA 3F1NB 3MFXA 5J7EA 1V9ZA 2PYRA 2PHYA 1GSXA 3T50A 4GCZA 4LPZA
chains in the Genus database with same CATH superfamily
1OTDA 2PYPA 3PXPA 2NUPC 2XSSA 2XR0A 2W1RA 5EVEA 3HL9A 3O87A 3LEQA 2XK1A 3RTYA 3IQAA 3Q81A 5GLAA 3U2AA 4OH0A 2OV5A 2V1BA 1OTBA 2HP6A 4E3NA 2A24B 2ZMAA 5AVFA 1SDNA 3MZFA 4KZ8A 4LFUA 2ZOHA 1KDSA 2ZM0A 3V3RA 3HUMA 3BFEA 2PR6A 5FQQA 2Y2LA 1SDEA 3WWXA 5EE8A 4KZ9A 2Y79A 5J3WA 4Y3IA 4UAAA 4GNUA 1FCOA 4S2PA 1I5QA 2VGLS 1NY0A 1UWNX 4UQIM 3B42A 1BLCA 4OPRA 4ZAMA 5F5YA 2H5SA 2XD1A 2JKFA 2WKIA 3NOTC 2PDRA 3KSFA 1Q2PA 3G34A 1BLHA 2XGNA 3KYQA 4LRXC 3UPPA 3C7VA 1MKIA 4NXEA 3PR6A 4DXCA 1WYCA 4M4XA 2EWWA 2Q0OA 1YQSA 5HSQA 3S22A 2V0UA 2QWSA 3MF0A 3ISGA 3S4XA 3R7WB 2FFFB 3SS4A 1XJ6A 2AVXA 3EGDC 1VEUA 4ESPA 3ULFA 1MPLA 1HD8A 1LSVA 4EV4A 2HDSA 4WELA 4JF5A 1FR6A 3BECA 4Y17A 3BFFA 3G31A 2D02A 3DWKA 5AQ7A 3UPNA 4N9LA 4OVDA 1XGJA 3LR0A 5HWVA 3C4PA 1XJ2A 5HL1A 1S1YA 3IHAA 1QMEA 3D9YA 4E3IA 1GCEA 1I2SA 3H82A 2GDNA 1TS7A 3EGXC 3HLWA 4A5RA 4FUWA 5EVLA 4OLGA 4JGPA 4I3JA 4OPYA 3WRZA 4NXGA 5CTMA 2PD8A 3IX3A 3IXBA 3V50A 4IVKA 2J7VA 5DVAA 3IWIA 2W3FA 2PBDP 5CGSA 3MXRA 4P87A 4Q0JA 1CK3A 3TW8A 1UWPX 3M2KA 2DRWA 4HH3A 1YSQA 3EQVA 1DRMA 2JE5A 3OPPA 4KZAA 5FEFA 4KQQA 1GHMA 4X25A 4YWZA 1NYMA 3CUEC 1W5DA 5DTSA 3M6BA 3KO6A 2Y8HA 4F3LB 3BQ8A 3IXGA 4I5SA 3MZEA 3CWFA 3LFVA 2X02A 3ZNTA 3CPTB 3A0SA 3V3SA 4LV0A 3MFDA 2JC7A 4R3AA 3Q7VA 4FCFA 3DAVA 3LR4A 1LI9A 3PBNA 3QNBA 1K6RA 3ZQ5A 4EERA 2H0YA 4H8RA 4JF6A 4KQRA 4BMWA 3IBJA 4JBFA 3AGDA 3BM6A 3LY3A 5E43A 1I2WA 2ZQCA 1ACFA 3SH8A 2VGLM 3BYDA 4K08A 2P7JA 4LV1A 2WAFA 3P09A 3SW1A 1YMXA 3OCLA 2Y55A 3PYPA 2ZM8A 3CUEA 4E6WA 3W8KA 1SHVA 3OBFA 3IHBA 1BUEA 3FG8A 2YKHA 1YLWA 2HF6A 5HD5A 5DJTA 1L0FA 4GW9A 1O7EA 1H8YA 4C75A 3N6IA 3PBTA 3PTEA 1KGGA 2XDMA 3CJMA 4XXRA 1L0DA 4BWIA 3D4FA 1HTZA 3RFBA 5AQ9A 3TE8A 3PAGA 1T1AA 3QP1A 3NBLA 2L0WA 4HJ4A 2WKRA 4WEJA 4XUXA 3S7NA 4QHCA 5AVEA 5L2FA 2WGWB 3UN7A 1JWPA 5DF7A 4KZ7A 3VOZA 4GDBA 5CECA 3VP2A 4HY8A 4ID4A 5EV0A 3T4KA 3OCNA 2QYBA 1T19A 2BG1A 4L9FA 1IELA 2ZQ8A 4X6TA 3T1QB 3T4QA 4OPZA 1W8QA 2WADA 1MWSA 3DBAA 3EOIA 2O99A 4P0MA 2ZBBA 3JYIA 3MQQA 1ZTUA 1S66L 3B33A 4NETA 3T1SA 4L9GA 2M7UA 4K91A 4PKYG 3FPVA 5FAPA 3UE1A 4RX2A 3CMZA 4Q0IA 1NRFA 4OOMA 4KQDA 4S2MA 4OQ0A 3T4SA 4JGOA 4EW7A 3UMDA 1CQAA 5GLCA 2WGIA 5F82A 3HREA 1T1BA 2A24A 4KG2A 4YFMA 4Y5FA 2GZAA 4Z1WA 1N9NA 2EX8A 3BFGA 1E3UD 1XP4A 1MWUA 3T1XA 1HVBA 4E3OA 3ZHHA 3GDIA 4WM9A 2ZOIA 3MFXA 1WYBA 5GLBA 2PHYA 1EWZA 2JKTI 1KE3A 5CEDA 1F5MA 3N8LA 4HEFA 1PW8A 4Z9QA 5FDSA 1ZC2A 4I3AA 3HLDA 3LIFA 1MZUA 1L3LA 5KSHA 3GMWA 3Q7ZA 3ZG0A 5GHZA 5TR7A 5AJGA 2ZC3B 1KGEA 3UE6A 4HQAA 4EQ1A 1K57C 4WN5A 3F1OB 1IKIA 2M1CA 5GLDA 5HDCA 1F2KA 4PM5A 1W63Q 1SCWA 5EVIC 2WKEA 3MZDA 2G2WA 3RXWA 3VSKA 3EEAA 4PKYA 2DCFA 3EEHA 4ZDXA 2CC1A 3HLEA 3IF5A 3LCEA 4NG2A 4Q8IA 2XFTA 4WMCD 3QP4A 2Y91A 4X1MA 1EW0A 4D2OA 1ONHA 3HUOA 4WZ4A 3UB6A 1ZG6A 2O9BA 5U47A 2GX5A 5DFYA 2IWDA 5CTNA 4B9OA 1K57A 3LO7A 3I7JA 2HV1A 4OQHA 2A49A 5EVIA 4KUOA 5F1GA 1Y4OA 4R3JA 1FSYA 4I3IA 1TS6A 1FOFA 4GD8A 1M40A 2K7SA 4ZTKA 5A93A 4ZJ1A 4JLFA 1BLSA 1IFQA 3G6OA 3N7WA 2WZZA 4JGQA 4R23A 4XUZA 2ZMVA 2LB9A 1LI0A 3HCYA 2Q9MA 3EQUA 1L0GA 1CI8A 1G68A 2IA2A 1IYQA 1XFNA 3IT9A 3MQ0A 1IYOA 2HDQA 1ONGA 3ZGAB 4GD6A 3ITBA 5BOHA 1IYSA 2PRFA 3JVUA 2FZ0A 3ZCZA 4OPQA 3BY9A 1OPXA 4LRYC 4NXBA 3TRCA 3BWLA 4KZBA 1W7FA 4WYYA 2VV7A 3G32A 3IX4A 3UB8A 1FQGA 2KOIA 1K56A 2E8IA 1BLPA 3R4KA 4I39A 5IHVA 1YLYA 2HDRA 1M6KA 1YM1A 2QZ6A 4X55A 3CPTA 2V1AA 1NRJA 1MC0A 4HNBA 4QPRA 4ARZB 4C6YA 2PT7A 4GJ4A 3G4PA 3T4LA 1VETB 3FKWA 3QNCA 1BTLA 3P98A 2WGVA 5FSRA 4O8GA 3T4JA 1YPRA 5L09A 5M19A 2V20A 4ZJ2A 1PW1A 5DTTA 5MC7A 2ZC4B 5HDDA 3DTKA 5FA7A 3IF6B 3IS2B 2W3GA 3IH8A 2V2FF 5IT5A 4FD8A 1VM1A 3K2NA 4R3BA 4KZ6A 1ODVA 2OAQ1 4GHIB 2ZC5B 3C4OA 4QD4A 3B3XA 1ES5A 4DE0A 4JXWA 2R9XA 3W4OA 2B5RA 4EU0A 1K0KA 1SKOB 4HESA 2ZJ9A 1F9IA 4M3KA 3F1PA 3GR2A 1GA0A 3E4OA 4N9KA 4OOYA 3WS4A 4N1XA 3H7WB 1Z09A 1CEGA 4O01A 2M7VA 3VMAA 1LL5A 3MBZA 5G4ZA 1ES2A 3LYXA 5J8XA 2EWVA 4HIAA 3WS1A 3EWKA 1JVJA 1TD5A 3MXQA 5GL9A 3QHYA 3MQOA 2W27A 3C8CA 1SZVA 5FAOA 5TBMB 4GOGA 4BBUA 2C5WB 2VEAA 1BULA 4MLLA 4C3QA 1XKZA 2ACGA 3S7OA 3HJKA 4EUZA 4N1HA 3P01A 2JHEA 1FSWA 3BLMA 4II7A 4FH4A 3NECA 5GHYA 3JVVA 3W2ZA 3G30A 1Y54A 1S4RA 3GSGA 5M18A 3GVBA 4NKPA 2J8YA 2CMNA 3CG5A 1DJAA 4CJNA 2W0NA 1NZUA 4CLCC 4EXOA 2OLVA 3PAEA 2J80A 3KYEA 3O3VA 3FZCA 1ZHHB 3MKEA 3DW0A 2I72A 4UA9A 4ZJ3A 4R4SA 3UO9A 2ZM2A 1PRQA 3UDXA 1J9MA 3IX8A 4GDNA 1N9BA 3LY4A 4U0XA 2HPBA 1N4OA 2J3TD 2PR5A 3ZG5A 3QP6A 1D1JA 2XFSA 1JNUA 4DJ3A 2HGVA 3UB9A 2VV6A 3VE4A 5EVID 4NEED 4E3LA 3WS2A 3WS5A 1PI5A 4S2LA 2HJ9C 3W4QA 3A0RA 3ZG8B 5FQ9A 3WRTA 2O0YA 1Y28A 2VV8A 3MSHA 2ZL1A 3KSHA 2I9VA 4CLCA 3PBOA 2JKRI 5HAPA 1XJ4A 2DNSA 3HUNA 3BEBA 2L4RA 3LIBA 3IWQA 4NK3A 1PI4A 4MN7A 4JF4A 3K3CA 4IEDA 4WLAA 4GS9B 4DE1A 3BW6A 1K55C 1QMFA 2Y2JA 1JWVA 4XT2A 2ZMFA 1VB6A 4DDYA 3NJAA 1TEMA 1RGZA 3NI9A 5FI2A 3OPHA 4QY5A 3NIAA 2Z6CA 2D01A 3LR5A 1TF1A 3ZNYA 3MR0A 4IHQA 4RA7A 1OT6A 4BJPA 2X71A 1S4SA 1K56D 3RXXA 4LGWA 3QP5A 4IBRA 2V9AA 2XF3A 2JKTM 5FEGA 3E4QA 3S7QA 3LR3A 2HZ5A 2VGKA 2EX9A 1BT5A 2V1ZA 3K3DA 1AXBA 1NLZA 5AQBA 2FFYA 3T1RA 1STZA 1K55A 3VP3A 4N92A 4GCZA 2R9WA 2IWCA 5FI6A 5A92A 3A3FA 3GRJA 4OONA 1K38A 1Q2QA 5HDSA 4HHDA 3TG9A 4DN0A 2JCHA 4JXVA 2V8FA 4Y7PA 4K0WA 1YLZA 4PM7A 1K25A 2Y2MA 3DTEA 2EFUA 5TGFA 1FIKA 3T4TA 5L8MA 1RGYA 2H10A 3NULA 4B93A 4B88A 1VEUB 2EXBA 1A0KA 1D06A 1YKDA 2XH9A 2ZC7A 4F94A 3KX0X 5EECA 2IWBA 1T18A 2BASA 2HP9A 3N8SA 5HPFA 5F69A 3F1NA 1KGFA 2VLGA 2R78A 2RCXA 5G4YA 2KLIA 2XLNA 4IBXA 5EM1A 1VQQA 2PU4A 1FCMA 5CXWA 4KZ5A 3Q07A 3O5YA 1J3WA 2OWJA 4BL2A 3KYZA 5HARA 2BLSA 4OQIA 4S2IA 4S2KA 1IEMA 4OQGA 5HW3A 3T4OA 4DRTA 1IKGA 3LI8A 1XXMA 1H5XA 2JBFA 4YNRA 1LL9A 1HLUP 5TFQA 4H6JB 1H8MA 1CI9A 2WKPA 3C7UA 5DF9A 1MWRA 5EOEA 1P97A 3KSGA 4PHTA 2Y59A 4LRZE 1NXYA 2EX6A 2B02A 2XA7S 1GHIA 1HZOA 3SH7A 1CEFA 4X1LA 1ESUA 3RH8B 1MBLA 3FC7A 4FH2A 1VETA 5EOOA 1KVMA 2VJWA 4QWOA 1LSWA 4DMZA 3UY6A 4GLQA 3E98A 3B47A 4MN5A 3BLSA 3ZVWA 3LIAA 4BLMA 3VP0A 3IXDA 5TJJA 1OJ5A 5GHXA 1OTIA 1NZOA 1P0ZA 4Y2FA 3UNWA 2XD5A 5CX7A 3Q7VB 4KZ3A 5E2FA 4CLCD 1PFLA 2J3WA 4Y15A 4E3JA 3SS5A 4R0QA 1OMEA 3BQAA 3CHWP 1E4DA 4HH2A 4DDSA 5G18A 3CAXA 3A3IA 3OOVA 4NXFA 4IJGA 4R4RA 3C5AA 5HWTA 2ZC6B 4EBPA 5DJUA 3R7WA 3Q1FA 1W63M 4EUVA 3O86A 4AFIA 4HI4A 4BD0A 4EWFA 4ZRRA 5EPHA 3GTCA 2O9CA 1JTDA 4PM9A 1WE4A 5FAQA 4WEKA 1L0EA 5HX9A 2P08A 3LIEA 3MS6A 4I38A 1D7EA 2X01A 1E25A 1KE4A 1V9YA 4CQHA 3BY8A 3UDIA 3W4PA 5DTKA 3L7HA 3FV7A 5HAIA 2Y2PA 3NHQA 5EM0A 3E0YA 5M1AA 3OZHA 3HVFA 4X53A 1YLJA 1K54A 2Y2HA 4B4XA 2HP5A 1H3QA 2QJ7A 4WBGA 4EBLA 3UB5P 2P9VB 4EEPA 4OP5A 4CPKA 1GHPA 4IUHA 4OOLA 3PBRA 4QJGA 3FYZA 1BZAA 1G28A 4MBHA 5HAQA 4JXSA 2ZQ7A 3A3EA 1BSGA 3BFDA 2W3EA 2PAVP 1XPBA 1ALQA 1S1ZA 5E2GA 5CEBA 3PBQA 1N9OA 4DE3A 3NY4A 5F83A 3VOLA 3MXSA 1O07A 5FQJA 2XQZA 3UE0A 4F3LA 1G5UA 1XX2A 4HJ3A 2ZQ9A 1BYWA 4P6BA 4E3MA 1H0MA 4LV3A 5DFXA 2ZQDA 3FKVA 4GS9A 2W3HA 3D72A 4QB8A 4MDZA 2A3UA 1N9LA 4R38A 1DJBA 4PAUA 4QY6A 2Q9NA 2XROA 2EA9A 5FQMA 3SOIA 3VV4A 2XA7M 2Y2NA 1EI5A 2H28A 4EQIA 3OPRA 3HJIA 4Q0HA 2JKRM 1YLTA 3KSIA 5CGXA 4KG5A 5E2EA 3LIDA 5CHJA 4BD1A 2PBYA 3UB7A 2G7UA 1LT0A 3LGOA 2L1MA 3UDFA 3HLCA 3V5MA 1PWGA 3ZYTA 3A3JA 4RYEA 2E8JA 3E2KA 2Y2IA 5FASA 3A3DA 3LICA 3UPOA 5F6AA 4PM6A 3CITA 2XEPA 4O0PA 1DJCA 1W79A 4WZ5C 1MXOA 1ERMA 3ZDJA 1EROA 5FQKA 4UHUA 4IVIA 4DXBA 3VFFA 1WA9A 4KUKA 3IXHA 4JPMA 2PD7A 1TDLA 5FDHA 4O7DA 2WGWA 3OPLA 1W8YA 2W1TB 3L9KA 2GJ3A 2WAEA 2ZLYA 2FH5A 4Y0OA 4P6ZS 4KZ4A 2WUQA 1K4EA 5J4EA 1PWCA 4S2NC 3D3OA 4E6XA 4L0LA 3QP8A 4EBNA 4S2JA 5J7EA 4OKPA 1YLPA 2PYRA 2XRNA 1GSXA 3NDGA 4ETXA 4LPZA 3FWLA 5K5BA 4WZ5A 2K31A 4RQ9A 4D60A 4B4ZA 4GB7A 4JKTA 1XJ3A 1PWDA 4HJ6A 4ETZA 1PZOA 1FCNA 4FSFA 4X69A 5EVIB 2O9AA 2QHKA 5A91A 4BL3A 4LV2A 1T1CA 1OT9A 4QU3A 4U0TA 1E3UA 3HLBA 4PMAA 2OLUA 4LCLA 4S2NA 2Z2LB 1XA1A 1UGUA 5AQAA 1PNEA 1RCJA 4H6JA 4R1GA 1P9RA 4GZBA 1YMSA 1G6OA 4UA7A 2WKHA 2V8CA 2Y2QA 1OTAA 2W3DA 2Y2KA 4X56A 1LSXA 1IOUA 1YT4A 5KSCA 3ZVTA 1DP9A 5CHUA 1NWZA 1MKMA 2EFXA 1KDWA 4X68A 1IYPA 5KIZA 4R70A 3BJNA 3A0VA 4UEYA 5I94A 4MNRA 2DMWA 2P74A 1TS8A 3GV9A 1OJGA 2WK0A 5E2HA 3V67A 4LLOB 5A8BA 2OOLA 3T12B 1TVFA 2WYXA 1LL8A 5FQIA 3F1OA 5D3OA 2J9PA 1FR1A 1GSWA 4EESA 4WMCA 5FL3A 3TJZC 1F98A 5I5LA 3IH9A 3NCKA 3H9WA 1CJFA 2C6WB 3VE3A 4K0XA 3GECA 3NDEA 5JYOA 1PIOA 2B95A 2OWHA 5IS1A 3LI9A 5DF8A 3SS3A 1DY6A 4DJ2A 5HWWA 3MJQA 3N4IA 4EETB 2B18A 5CGWA 1K4FA 4WL9A 3CZDA 2Y2GA 2VK3A 2RL3A 3HBRA 3UE3A 5KMWA 5DKKA 1NLYA 2UV0E 1RP5A 3FPWA 2OSUA 3TOIA 3F1PB 5A90A 2QJ5A 3SZTA 2HJEA 4DE2A 3Q82A 4MBFA 5F68A 4UA6A 1L2SA 3UMEA 3C38A 1JTGA 3SH9A 1PYYA 4Y13A 1VHMA 3QP2A 5CRFA 4LCMA 3OLOA 5HL6A 1AWIA 4P6ZM 1TDGA 5L07A 3G35A 1GA9A 4YINA 3DWZA 1YSPA 2P9VA 4E3KA 3CI6A 4BBVA 1YAXA 3OC2A 2VGJA 1GSVA 4MEZA 4OLDA 4S2OA 1XGIA 1SKFA 2KX6A 2Z6DA 2H0TA 4EEUA 3M2JA 3LEZA 3H82B 4WUJA 2VKSA 1CF0A 5CERA 3U4LP 5HFOA 4HBUA 4BENA 2ZQAA 3M6HA 4MCWA 2UWXA 3IF6C 3G2YA 4PM8A 4YOFA 5DKLA 1ZG4A 4L9EA 3S7PA 3NOUC 1NYYA 3VP4A 2A2LA 3C30A 3C2WA 1LLBA 2OAP1 4HP9A 1TS0A 4E04A 1S6RA 4ARZA 4PPRA 3ZFZA 3GQZA 4RVAA 5EUAA 5F1FA 4UQIS 3HLFA 1H8ZA 2ZL1B 1MY8A 4Y0UA 3PBSA 4G3WA 4CLCB 1DP6A 1LHYA 3MMHA 1S0WA 1U60A 3IBRA 3VFHA 2JN7A 3IF6A 3IS2A 1FILA 4KQOA 3P7NA 2INWA 2HDUA 3RJUA 2V0WA 4GKUA 3VSLA 3LUQA 2JKGA 5HZHA 4BBTA 4WF0A 1DP8A 1JWZA 4ME4A 1K6SA 3DTIA 5CHMA 4XT2B 4DF6A 4GHIA 1OTEA 1C3BA 3O88A 2WKQA 5HPIA 3G2ZA 4R6LA 2KDKA 1SKOA 3VOYA 1KOUA 3BRMA 2QPNA 2LB5A 4FOFA 3N8RA 4DKIA 4CLCE 3PHYA 1X0OA 2QMIA 3IWOA 2J3TC 4LENA 4MBKA 3H7WA 3BFCA 4G3KA 4MN6A 1K54C 4OP8A 4HOIA 4IUKA 2YKFA 1P9WA 1Z6FA 2G2UA 2ZD8A 2W1TA 1XA7A 3AGEA 4HBTA 1PZPA 4P85A 1ZKJA 3NC8A 3V39A 1S67L 2PU2A 2GNXA 2VX8A 5IU1A 4JXGA 5TBMA 2VZWA 4U3TA 5LBRA 1ES3A 4Y0TA 2Y2OA 4ZBEA 1ESIA 4FTXA 4G3VA 1XFQA 2P04A 3E2LA 4KG6A 2K2NA 3TSGA 1NJ4A 2J9OA 2VA0A 2Y4AA 5EFWA 1KVLA 3NOPC 3AGFA 3ICYA 4JGRA 2NUTC 3E4PA 3CLOA 3HLGA 2Z2MB 1MWTA 3ZG9B 3MKFA 5HD3A 4HP4A 3WS0A 4RX3A 3JPUA 5C5KA 5FI7A 4KENB 2QKPA 5FATA 2BTFP 2MJ6A 2EX2A 2EXAA 3S1YA 3DTMA 4MMNA 4BQMA 2WZXA 5JYPA 4GN2A 3ITAA 3VP1A 3F1NB 1G6AA 1ES4A 1KE0A 1V9ZA 5L10A 5KZHA 3T50A 3ZG7B 1ERQA
chains in the Genus database with same CATH topology
1OTDA 5K5BA 2PYPA 3PXPA 2K31A 1F5MA 4RQ9A 2XSSA 2NUPC 2W1RA 1XJ3A 3RTYA 4HJ6A 4I3AA 4ETZA 3LIFA 3U2AA 1MZUA 5HDSA 4HHDA 2V1BA 4FSFA 1OTBA 4DN0A 5KSHA 2A24B 2O9AA 5AVFA 2QHKA 2ZOHA 5AJGA 1T1CA 1OT9A 3UE6A 4HQAA 2PR6A 4EQ1A 4WN5A 3T4TA 5L8MA 3F1OB 2M1CA 5HDCA 1UGUA 4B93A 1W63Q 2Y79A 5J3WA 4Y3IA 4H6JA 2VGLS 1D06A 1YKDA 1UWNX 4UQIM 3B42A 1P9RA 3KX0X 3EEAA 1T18A 5F5YA 2BASA 1G6OA 4PKYA 3NOTC 3EEHA 2PDRA 3KSFA 5HPFA 5F69A 1OTAA 3F1NA 2W3DA 2VLGA 2R78A 1LSXA 1IOUA 3KYQA 5G4YA 4LRXC 1DP9A 1EW0A 2KLIA 3UB6A 2O9BA 2GX5A 1NWZA 4NXEA 1MKMA 3PR6A 5DFYA 4B9OA 3O5YA 4M4XA 2OWJA 5KIZA 4R70A 3KYZA 2HV1A 3BJNA 3A0VA 2EWWA 4UEYA 4KUOA 2DMWA 5HSQA 3T4OA 4I3IA 3LI8A 1TS8A 1TS6A 2K7SA 4YNRA 1OJGA 4H6JB 1H8MA 3V67A 2WKPA 2V0UA 4LLOB 5DF9A 5A8BA 2QWSA 2OOLA 1IFQA 1P97A 3MF0A 3G6OA 3KSGA 4PHTA 1LL8A 3F1OA 4LRZE 3R7WB 4JGQA 2ZMVA 2B02A 2LB9A 1XJ6A 2XA7S 3EGDC 3HCYA 1GSWA 3EQUA 3ULFA 4EESA 5FL3A 3TJZC 1F98A 5I5LA 3RH8B 1LSVA 3H9WA 2IA2A 4WELA 3VE3A 3FC7A 3GECA 2VJWA 1XFNA 1LSWA 4DMZA 3MQ0A 4GLQA 3E98A 2D02A 3B47A 4MN5A 3JVUA 3LR0A 2OWHA 5IS1A 5HWVA 2FZ0A 3LI9A 4DJ2A 5HWWA 3MJQA 3LIAA 3BY9A 1XJ2A 4EETB 1OPXA 2B18A 4LRYC 4NXBA 3BWLA 3TRCA 5TJJA 1OJ5A 1S1YA 2VV7A 4WL9A 3UB8A 2KOIA 1OTIA 3H82A 1P0ZA 3UE3A 1TS7A 4Y2FA 3EGXC 3R4KA 5CX7A 4I39A 5DKKA 1NLYA 4CLCD 3FPWA 2J3WA 3F1PB 2QJ5A 4JGPA 4I3JA 2HJEA 3BQAA 4NXGA 2PD8A 4HH2A 2V1AA 5F68A 1NRJA 3UMEA 3C38A 3CAXA 1MC0A 4HNBA 4QPRA 3OOVA 4ARZB 2PT7A 4NXFA 2W3FA 4IJGA 4GJ4A 1VHMA 5HWTA 3T4LA 3OLOA 5HL6A 5DJUA 4P6ZM 3R7WA 1W63M 1YSPA 4O8GA 4Q0JA 3T4JA 3TW8A 4EUVA 4AFIA 4HI4A 1UWPX 4ZRRA 3CI6A 4HH3A 4BBVA 1YAXA 3OC2A 1YSQA 3EQVA 1DRMA 1GSVA 2O9CA 5MC7A 5HDDA 2KX6A 3IS2B 2W3GA 2Z6DA 4WEKA 5IT5A 4EEUA 4YWZA 2P08A 3H82B 4WUJA 3LIEA 3K2NA 2VKSA 3CUEC 4I38A 1D7EA 4F3LB 3KO6A 2Y8HA 3BQ8A 1V9YA 1ODVA 4I5SA 2OAQ1 4GHIB 3CWFA 3LFVA 4MCWA 4CQHA 3BY8A 3A0SA 4YOFA 4EU0A 5DKLA 4L9EA 4R3AA 3NOUC 1F9IA 3NHQA 3S7PA 3F1PA 3LR4A 2A2LA 3E0YA 3E4OA 3PBNA 3ZQ5A 3C30A 3C2WA 4EERA 2OAP1 3H7WB 4HP9A 4BMWA 1H3QA 3IBJA 1TS0A 4O01A 2M7VA 2QJ7A 4EEPA 5G4ZA 4E04A 4ARZA 3LYXA 4IUHA 2EWVA 2VGLM 4HIAA 4K08A 2P7JA 3EWKA 4OOLA 1TD5A 3MXQA 3PBRA 3MQOA 1G28A 3SW1A 2W27A 3OCLA 4UQIS 3C8CA 3PYPA 3CUEA 2W3EA 3PBSA 5TBMB 4BBUA 2VEAA 4G3WA 3OBFA 4CLCB 1DP6A 3FG8A 1S1ZA 2YKHA 3MMHA 3S7OA 3HJKA 2HF6A 3IBRA 5HD5A 3PBQA 3P01A 1N9OA 5DJTA 2JN7A 2JHEA 3IS2A 4GW9A 4KQOA 4II7A 3P7NA 2INWA 2V0WA 3LUQA 3JVVA 3W2ZA 1S4RA 3VOLA 5HZHA 3PBTA 4NKPA 4BBTA 4WF0A 2CMNA 1DP8A 4ME4A 4F3LA 2W0NA 4BWIA 4HJ3A 4XT2B 4CLCC 3RFBA 4EXOA 1BYWA 3TE8A 1T1AA 2J80A 4GHIA 1OTEA 5DFXA 2WKQA 5HPIA 4GS9A 1ZHHB 2W3HA 2L0WA 4HJ4A 3D72A 4R6LA 2WKRA 4WEJA 2KDKA 4MDZA 3S7NA 5AVEA 1N9LA 1KOUA 4R38A 4PAUA 2LB5A 2XROA 4FOFA 2EA9A 4CLCE 3PHYA 1X0OA 2J3TD 2PR5A 2J3TC 3H7WA 4G3KA 4MN6A 3VV4A 4HY8A 2XA7M 2H28A 3T4KA 1JNUA 4HOIA 2HGVA 4IUKA 4DJ3A 3UB9A 2VV6A 2YKFA 3VE4A 3OCNA 4NEED 2QYBA 1T19A 3HJIA 4Q0HA 1P9WA 2JKRM 3KSIA 4L9FA 2HJ9C 3T4QA 2W1TA 3LIDA 3EOIA 3DBAA 2O99A 3A0RA 3UB7A 2O0YA 1Y28A 1S67L 2G7UA 2VV8A 1LT0A 2GNXA 2VX8A 2L1MA 3KSHA 2ZBBA 5IU1A 5TBMA 2VZWA 5LBRA 3MQQA 2I9VA 3ZYTA 1ZTUA 1S66L 3B33A 4CLCA 3PBOA 2JKRI 1XJ4A 4L9GA 2M7UA 4G3VA 4PKYG 2L4RA 3LIBA 3FPVA 3LICA 1XFQA 5F6AA 2P04A 4Q0IA 4MN7A 3K3CA 4OOMA 3CITA 4WLAA 4GS9B 2K2NA 4O0PA 3BW6A 2VA0A 4KQDA 5EFWA 3NOPC 4XT2A 2ZMFA 1VB6A 3ICYA 3NJAA 4JGRA 3T4SA 2NUTC 3E4PA 3CLOA 4JGOA 4EW7A 3UMDA 1WA9A 4KUKA 2Z6CA 5HD3A 1T1BA 4HP4A 2A24A 2D01A 2PD7A 1TF1A 3LR5A 3MR0A 4IHQA 1OT6A 4Y5FA 4BJPA 1S4SA 2GZAA 5C5KA 2W1TB 2GJ3A 2QKPA 4Z1WA 1N9NA 2MJ6A 2V9AA 2FH5A 2JKTM 4P6ZS 3E4QA 3S7QA 3LR3A 5J4EA 3D3OA 3GDIA 4MMNA 4L0LA 2ZOIA 3K3DA 3F1NB 3MFXA 1NLZA 5J7EA 1V9ZA 2PYRA 2PHYA 2XRNA 2JKTI 1GSXA 1STZA 3T50A 4ETXA 4GCZA 4LPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTD A;  2PYP A;  4RQ9 A;  1XJ3 A;  3RTY A;  4HJ6 A;  4I3A A;  3LIF A;  1MZU A;  5HDS A;  4HHD A;  2V1B A;  1OTB A;  2A24 B;  5AVF A;  2QHK A;  2ZOH A;  1T1C A;  1OT9 A;  3UE6 A;  4HQA A;  2PR6 A;  4EQ1 A;  4WN5 A;  3F1O B;  2M1C A;  5HDC A;  1UGU A;  5J3W A;  4H6J A;  1D06 A;  1UWN X;  3KX0 X;  1T18 A;  5F5Y A;  2BAS A;  4PKY A;  3NOT C;  3EEH A;  2PDR A;  5F69 A;  1OTA A;  3F1N A;  2VLG A;  2R78 A;  1LSX A;  5G4Y A;  4LRX C;  1DP9 A;  1EW0 A;  3UB6 A;  1NWZ A;  4NXE A;  4B9O A;  4M4X A;  2OWJ A;  5KIZ A;  4R70 A;  2HV1 A;  3A0V A;  4KUO A;  5HSQ A;  4I3I A;  3LI8 A;  1TS8 A;  1TS6 A;  2K7S A;  1OJG A;  4H6J B;  2WKP A;  2V0U A;  4LLO B;  5A8B A;  2QWS A;  2OOL A;  1P97 A;  3G6O A;  1LL8 A;  3F1O A;  4LRZ E;  4JGQ A;  2B02 A;  1XJ6 A;  1GSW A;  3ULF A;  4EES A;  1F98 A;  5I5L A;  3RH8 B;  1LSV A;  3H9W A;  3VE3 A;  3FC7 A;  3GEC A;  1XFN A;  1LSW A;  2D02 A;  4MN5 A;  2OWH A;  5IS1 A;  5HWV A;  3LI9 A;  4DJ2 A;  5HWW A;  3MJQ A;  3LIA A;  3BY9 A;  1XJ2 A;  4EET B;  4LRY C;  4NXB A;  3BWL A;  1OJ5 A;  1S1Y A;  2VV7 A;  4WL9 A;  3UB8 A;  1OTI A;  3H82 A;  1P0Z A;  1TS7 A;  4I39 A;  5DKK A;  3F1P B;  2QJ5 A;  4JGP A;  4I3J A;  4NXG A;  2PD8 A;  4HH2 A;  2V1A A;  5F68 A;  3UME A;  3CAX A;  4HNB A;  4NXF A;  5HWT A;  3OLO A;  5DJU A;  4HI4 A;  1UWP X;  4HH3 A;  4BBV A;  1DRM A;  1GSV A;  5HDD A;  2KX6 A;  3IS2 B;  2Z6D A;  4EEU A;  4YWZ A;  3H82 B;  4WUJ A;  3LIE A;  4I38 A;  1D7E A;  4F3L B;  1V9Y A;  1ODV A;  4I5S A;  4GHI B;  3CWF A;  3BY8 A;  3A0S A;  5DKL A;  4L9E A;  4R3A A;  3NOU C;  1F9I A;  3NHQ A;  3F1P A;  3E4O A;  3ZQ5 A;  3C2W A;  4EER A;  3H7W B;  4HP9 A;  1TS0 A;  2QJ7 A;  4EEP A;  5G4Z A;  4E04 A;  3LYX A;  4HIA A;  4K08 A;  2P7J A;  3EWK A;  3MXQ A;  3MQO A;  1G28 A;  3SW1 A;  2W27 A;  3C8C A;  3PYP A;  5TBM B;  4BBU A;  2VEA A;  1DP6 A;  3FG8 A;  1S1Z A;  2YKH A;  3HJK A;  3IBR A;  5HD5 A;  1N9O A;  5DJT A;  2JN7 A;  2JHE A;  3IS2 A;  4GW9 A;  3P7N A;  2INW A;  2V0W A;  3LUQ A;  1S4R A;  3VOL A;  5HZH A;  4BBT A;  4WF0 A;  2CMN A;  1DP8 A;  4F3L A;  2W0N A;  4HJ3 A;  4XT2 B;  4EXO A;  1BYW A;  1T1A A;  2J80 A;  4GHI A;  1OTE A;  2WKQ A;  4GS9 A;  2L0W A;  4HJ4 A;  3D72 A;  4R6L A;  2WKR A;  2KDK A;  5AVE A;  1N9L A;  1KOU A;  4R38 A;  2EA9 A;  3PHY A;  1X0O A;  2PR5 A;  3H7W A;  4MN6 A;  4HY8 A;  2H28 A;  1JNU A;  4HOI A;  4DJ3 A;  3UB9 A;  2VV6 A;  2YKF A;  3VE4 A;  1T19 A;  3HJI A;  4L9F A;  3LID A;  3A0R A;  3UB7 A;  2VV8 A;  1Y28 A;  1S67 L;  1LT0 A;  2L1M A;  2ZBB A;  5IU1 A;  5TBM A;  3MQQ A;  2I9V A;  1S66 L;  3B33 A;  1XJ4 A;  4L9G A;  4PKY G;  2L4R A;  3LIB A;  3LIC A;  1XFQ A;  5F6A A;  3K3C A;  4WLA A;  4GS9 B;  4KQD A;  5EFW A;  3NOP C;  4XT2 A;  1VB6 A;  3ICY A;  3NJA A;  4JGR A;  3E4P A;  3CLO A;  4JGO A;  4EW7 A;  3UMD A;  1WA9 A;  4KUK A;  2Z6C A;  5HD3 A;  1T1B A;  4HP4 A;  2A24 A;  2D01 A;  2PD7 A;  3MR0 A;  1OT6 A;  1S4S A;  2GJ3 A;  2QKP A;  1N9N A;  2V9A A;  3E4Q A;  5J4E A;  3GDI A;  2ZOI A;  3K3D A;  3F1N B;  3MFX A;  5J7E A;  1V9Z A;  2PYR A;  2PHY A;  1GSX A;  3T50 A;  4GCZ A;  4LPZ A; 
#chains in the Genus database with same CATH topology
 1OTD A;  2PYP A;  3PXP A;  2NUP C;  2XSS A;  2XR0 A;  2W1R A;  5EVE A;  3HL9 A;  3O87 A;  3LEQ A;  2XK1 A;  3RTY A;  3IQA A;  3Q81 A;  5GLA A;  3U2A A;  4OH0 A;  2OV5 A;  2V1B A;  1OTB A;  2HP6 A;  4E3N A;  2A24 B;  2ZMA A;  5AVF A;  1SDN A;  3MZF A;  4KZ8 A;  4LFU A;  2ZOH A;  1KDS A;  2ZM0 A;  3V3R A;  3HUM A;  3BFE A;  2PR6 A;  5FQQ A;  2Y2L A;  1SDE A;  3WWX A;  5EE8 A;  4KZ9 A;  2Y79 A;  5J3W A;  4Y3I A;  4UAA A;  4GNU A;  1FCO A;  4S2P A;  1I5Q A;  2VGL S;  1NY0 A;  1UWN X;  4UQI M;  3B42 A;  1BLC A;  4OPR A;  4ZAM A;  5F5Y A;  2H5S A;  2XD1 A;  2JKF A;  2WKI A;  3NOT C;  2PDR A;  3KSF A;  1Q2P A;  3G34 A;  1BLH A;  2XGN A;  3KYQ A;  4LRX C;  3UPP A;  3C7V A;  1MKI A;  4NXE A;  3PR6 A;  4DXC A;  1WYC A;  4M4X A;  2EWW A;  2Q0O A;  1YQS A;  5HSQ A;  3S22 A;  2V0U A;  2QWS A;  3MF0 A;  3ISG A;  3S4X A;  3R7W B;  2FFF B;  3SS4 A;  1XJ6 A;  2AVX A;  3EGD C;  1VEU A;  4ESP A;  3ULF A;  1MPL A;  1HD8 A;  1LSV A;  4EV4 A;  2HDS A;  4WEL A;  4JF5 A;  1FR6 A;  3BEC A;  4Y17 A;  3BFF A;  3G31 A;  2D02 A;  3DWK A;  5AQ7 A;  3UPN A;  4N9L A;  4OVD A;  1XGJ A;  3LR0 A;  5HWV A;  3C4P A;  1XJ2 A;  5HL1 A;  1S1Y A;  3IHA A;  1QME A;  3D9Y A;  4E3I A;  1GCE A;  1I2S A;  3H82 A;  2GDN A;  1TS7 A;  3EGX C;  3HLW A;  4A5R A;  4FUW A;  5EVL A;  4OLG A;  4JGP A;  4I3J A;  4OPY A;  3WRZ A;  4NXG A;  5CTM A;  2PD8 A;  3IX3 A;  3IXB A;  3V50 A;  4IVK A;  2J7V A;  5DVA A;  3IWI A;  2W3F A;  2PBD P;  5CGS A;  3MXR A;  4P87 A;  4Q0J A;  1CK3 A;  3TW8 A;  1UWP X;  3M2K A;  2DRW A;  4HH3 A;  1YSQ A;  3EQV A;  1DRM A;  2JE5 A;  3OPP A;  4KZA A;  5FEF A;  4KQQ A;  1GHM A;  4X25 A;  4YWZ A;  1NYM A;  3CUE C;  1W5D A;  5DTS A;  3M6B A;  3KO6 A;  2Y8H A;  4F3L B;  3BQ8 A;  3IXG A;  4I5S A;  3MZE A;  3CWF A;  3LFV A;  2X02 A;  3ZNT A;  3CPT B;  3A0S A;  3V3S A;  4LV0 A;  3MFD A;  2JC7 A;  4R3A A;  3Q7V A;  4FCF A;  3DAV A;  3LR4 A;  1LI9 A;  3PBN A;  3QNB A;  1K6R A;  3ZQ5 A;  4EER A;  2H0Y A;  4H8R A;  4JF6 A;  4KQR A;  4BMW A;  3IBJ A;  4JBF A;  3AGD A;  3BM6 A;  3LY3 A;  5E43 A;  1I2W A;  2ZQC A;  1ACF A;  3SH8 A;  2VGL M;  3BYD A;  4K08 A;  2P7J A;  4LV1 A;  2WAF A;  3P09 A;  3SW1 A;  1YMX A;  3OCL A;  2Y55 A;  3PYP A;  2ZM8 A;  3CUE A;  4E6W A;  3W8K A;  1SHV A;  3OBF A;  3IHB A;  1BUE A;  3FG8 A;  2YKH A;  1YLW A;  2HF6 A;  5HD5 A;  5DJT A;  1L0F A;  4GW9 A;  1O7E A;  1H8Y A;  4C75 A;  3N6I A;  3PBT A;  3PTE A;  1KGG A;  2XDM A;  3CJM A;  4XXR A;  1L0D A;  4BWI A;  3D4F A;  1HTZ A;  3RFB A;  5AQ9 A;  3TE8 A;  3PAG A;  1T1A A;  3QP1 A;  3NBL A;  2L0W A;  4HJ4 A;  2WKR A;  4WEJ A;  4XUX A;  3S7N A;  4QHC A;  5AVE A;  5L2F A;  2WGW B;  3UN7 A;  1JWP A;  5DF7 A;  4KZ7 A;  3VOZ A;  4GDB A;  5CEC A;  3VP2 A;  4HY8 A;  4ID4 A;  5EV0 A;  3T4K A;  3OCN A;  2QYB A;  1T19 A;  2BG1 A;  4L9F A;  1IEL A;  2ZQ8 A;  4X6T A;  3T1Q B;  3T4Q A;  4OPZ A;  1W8Q A;  2WAD A;  1MWS A;  3DBA A;  3EOI A;  2O99 A;  4P0M A;  2ZBB A;  3JYI A;  3MQQ A;  1ZTU A;  1S66 L;  3B33 A;  4NET A;  3T1S A;  4L9G A;  2M7U A;  4K91 A;  4PKY G;  3FPV A;  5FAP A;  3UE1 A;  4RX2 A;  3CMZ A;  4Q0I A;  1NRF A;  4OOM A;  4KQD A;  4S2M A;  4OQ0 A;  3T4S A;  4JGO A;  4EW7 A;  3UMD A;  1CQA A;  5GLC A;  2WGI A;  5F82 A;  3HRE A;  1T1B A;  2A24 A;  4KG2 A;  4YFM A;  4Y5F A;  2GZA A;  4Z1W A;  1N9N A;  2EX8 A;  3BFG A;  1E3U D;  1XP4 A;  1MWU A;  3T1X A;  1HVB A;  4E3O A;  3ZHH A;  3GDI A;  4WM9 A;  2ZOI A;  3MFX A;  1WYB A;  5GLB A;  2PHY A;  1EWZ A;  2JKT I;  1KE3 A;  5CED A;  1F5M A;  3N8L A;  4HEF A;  1PW8 A;  4Z9Q A;  5FDS A;  1ZC2 A;  4I3A A;  3HLD A;  3LIF A;  1MZU A;  1L3L A;  5KSH A;  3GMW A;  3Q7Z A;  3ZG0 A;  5GHZ A;  5TR7 A;  5AJG A;  2ZC3 B;  1KGE A;  3UE6 A;  4HQA A;  4EQ1 A;  1K57 C;  4WN5 A;  3F1O B;  1IKI A;  2M1C A;  5GLD A;  5HDC A;  1F2K A;  4PM5 A;  1W63 Q;  1SCW A;  5EVI C;  2WKE A;  3MZD A;  2G2W A;  3RXW A;  3VSK A;  3EEA A;  4PKY A;  2DCF A;  3EEH A;  4ZDX A;  2CC1 A;  3HLE A;  3IF5 A;  3LCE A;  4NG2 A;  4Q8I A;  2XFT A;  4WMC D;  3QP4 A;  2Y91 A;  4X1M A;  1EW0 A;  4D2O A;  1ONH A;  3HUO A;  4WZ4 A;  3UB6 A;  1ZG6 A;  2O9B A;  5U47 A;  2GX5 A;  5DFY A;  2IWD A;  5CTN A;  4B9O A;  1K57 A;  3LO7 A;  3I7J A;  2HV1 A;  4OQH A;  2A49 A;  5EVI A;  4KUO A;  5F1G A;  1Y4O A;  4R3J A;  1FSY A;  4I3I A;  1TS6 A;  1FOF A;  4GD8 A;  1M40 A;  2K7S A;  4ZTK A;  5A93 A;  4ZJ1 A;  4JLF A;  1BLS A;  1IFQ A;  3G6O A;  3N7W A;  2WZZ A;  4JGQ A;  4R23 A;  4XUZ A;  2ZMV A;  2LB9 A;  1LI0 A;  3HCY A;  2Q9M A;  3EQU A;  1L0G A;  1CI8 A;  1G68 A;  2IA2 A;  1IYQ A;  1XFN A;  3IT9 A;  3MQ0 A;  1IYO A;  2HDQ A;  1ONG A;  3ZGA B;  4GD6 A;  3ITB A;  5BOH A;  1IYS A;  2PRF A;  3JVU A;  2FZ0 A;  3ZCZ A;  4OPQ A;  3BY9 A;  1OPX A;  4LRY C;  4NXB A;  3TRC A;  3BWL A;  4KZB A;  1W7F A;  4WYY A;  2VV7 A;  3G32 A;  3IX4 A;  3UB8 A;  1FQG A;  2KOI A;  1K56 A;  2E8I A;  1BLP A;  3R4K A;  4I39 A;  5IHV A;  1YLY A;  2HDR A;  1M6K A;  1YM1 A;  2QZ6 A;  4X55 A;  3CPT A;  2V1A A;  1NRJ A;  1MC0 A;  4HNB A;  4QPR A;  4ARZ B;  4C6Y A;  2PT7 A;  4GJ4 A;  3G4P A;  3T4L A;  1VET B;  3FKW A;  3QNC A;  1BTL A;  3P98 A;  2WGV A;  5FSR A;  4O8G A;  3T4J A;  1YPR A;  5L09 A;  5M19 A;  2V20 A;  4ZJ2 A;  1PW1 A;  5DTT A;  5MC7 A;  2ZC4 B;  5HDD A;  3DTK A;  5FA7 A;  3IF6 B;  3IS2 B;  2W3G A;  3IH8 A;  2V2F F;  5IT5 A;  4FD8 A;  1VM1 A;  3K2N A;  4R3B A;  4KZ6 A;  1ODV A;  2OAQ 1;  4GHI B;  2ZC5 B;  3C4O A;  4QD4 A;  3B3X A;  1ES5 A;  4DE0 A;  4JXW A;  2R9X A;  3W4O A;  2B5R A;  4EU0 A;  1K0K A;  1SKO B;  4HES A;  2ZJ9 A;  1F9I A;  4M3K A;  3F1P A;  3GR2 A;  1GA0 A;  3E4O A;  4N9K A;  4OOY A;  3WS4 A;  4N1X A;  3H7W B;  1Z09 A;  1CEG A;  4O01 A;  2M7V A;  3VMA A;  1LL5 A;  3MBZ A;  5G4Z A;  1ES2 A;  3LYX A;  5J8X A;  2EWV A;  4HIA A;  3WS1 A;  3EWK A;  1JVJ A;  1TD5 A;  3MXQ A;  5GL9 A;  3QHY A;  3MQO A;  2W27 A;  3C8C A;  1SZV A;  5FAO A;  5TBM B;  4GOG A;  4BBU A;  2C5W B;  2VEA A;  1BUL A;  4MLL A;  4C3Q A;  1XKZ A;  2ACG A;  3S7O A;  3HJK A;  4EUZ A;  4N1H A;  3P01 A;  2JHE A;  1FSW A;  3BLM A;  4II7 A;  4FH4 A;  3NEC A;  5GHY A;  3JVV A;  3W2Z A;  3G30 A;  1Y54 A;  1S4R A;  3GSG A;  5M18 A;  3GVB A;  4NKP A;  2J8Y A;  2CMN A;  3CG5 A;  1DJA A;  4CJN A;  2W0N A;  1NZU A;  4CLC C;  4EXO A;  2OLV A;  3PAE A;  2J80 A;  3KYE A;  3O3V A;  3FZC A;  1ZHH B;  3MKE A;  3DW0 A;  2I72 A;  4UA9 A;  4ZJ3 A;  4R4S A;  3UO9 A;  2ZM2 A;  1PRQ A;  3UDX A;  1J9M A;  3IX8 A;  4GDN A;  1N9B A;  3LY4 A;  4U0X A;  2HPB A;  1N4O A;  2J3T D;  2PR5 A;  3ZG5 A;  3QP6 A;  1D1J A;  2XFS A;  1JNU A;  4DJ3 A;  2HGV A;  3UB9 A;  2VV6 A;  3VE4 A;  5EVI D;  4NEE D;  4E3L A;  3WS2 A;  3WS5 A;  1PI5 A;  4S2L A;  2HJ9 C;  3W4Q A;  3A0R A;  3ZG8 B;  5FQ9 A;  3WRT A;  2O0Y A;  1Y28 A;  2VV8 A;  3MSH A;  2ZL1 A;  3KSH A;  2I9V A;  4CLC A;  3PBO A;  2JKR I;  5HAP A;  1XJ4 A;  2DNS A;  3HUN A;  3BEB A;  2L4R A;  3LIB A;  3IWQ A;  4NK3 A;  1PI4 A;  4MN7 A;  4JF4 A;  3K3C A;  4IED A;  4WLA A;  4GS9 B;  4DE1 A;  3BW6 A;  1K55 C;  1QMF A;  2Y2J A;  1JWV A;  4XT2 A;  2ZMF A;  1VB6 A;  4DDY A;  3NJA A;  1TEM A;  1RGZ A;  3NI9 A;  5FI2 A;  3OPH A;  4QY5 A;  3NIA A;  2Z6C A;  2D01 A;  3LR5 A;  1TF1 A;  3ZNY A;  3MR0 A;  4IHQ A;  4RA7 A;  1OT6 A;  4BJP A;  2X71 A;  1S4S A;  1K56 D;  3RXX A;  4LGW A;  3QP5 A;  4IBR A;  2V9A A;  2XF3 A;  2JKT M;  5FEG A;  3E4Q A;  3S7Q A;  3LR3 A;  2HZ5 A;  2VGK A;  2EX9 A;  1BT5 A;  2V1Z A;  3K3D A;  1AXB A;  1NLZ A;  5AQB A;  2FFY A;  3T1R A;  1STZ A;  1K55 A;  3VP3 A;  4N92 A;  4GCZ A;  2R9W A;  2IWC A;  5FI6 A;  5A92 A;  3A3F A;  3GRJ A;  4OON A;  1K38 A;  1Q2Q A;  5HDS A;  4HHD A;  3TG9 A;  4DN0 A;  2JCH A;  4JXV A;  2V8F A;  4Y7P A;  4K0W A;  1YLZ A;  4PM7 A;  1K25 A;  2Y2M A;  3DTE A;  2EFU A;  5TGF A;  1FIK A;  3T4T A;  5L8M A;  1RGY A;  2H10 A;  3NUL A;  4B93 A;  4B88 A;  1VEU B;  2EXB A;  1A0K A;  1D06 A;  1YKD A;  2XH9 A;  2ZC7 A;  4F94 A;  3KX0 X;  5EEC A;  2IWB A;  1T18 A;  2BAS A;  2HP9 A;  3N8S A;  5HPF A;  5F69 A;  3F1N A;  1KGF A;  2VLG A;  2R78 A;  2RCX A;  5G4Y A;  2KLI A;  2XLN A;  4IBX A;  5EM1 A;  1VQQ A;  2PU4 A;  1FCM A;  5CXW A;  4KZ5 A;  3Q07 A;  3O5Y A;  1J3W A;  2OWJ A;  4BL2 A;  3KYZ A;  5HAR A;  2BLS A;  4OQI A;  4S2I A;  4S2K A;  1IEM A;  4OQG A;  5HW3 A;  3T4O A;  4DRT A;  1IKG A;  3LI8 A;  1XXM A;  1H5X A;  2JBF A;  4YNR A;  1LL9 A;  1HLU P;  5TFQ A;  4H6J B;  1H8M A;  1CI9 A;  2WKP A;  3C7U A;  5DF9 A;  1MWR A;  5EOE A;  1P97 A;  3KSG A;  4PHT A;  2Y59 A;  4LRZ E;  1NXY A;  2EX6 A;  2B02 A;  2XA7 S;  1GHI A;  1HZO A;  3SH7 A;  1CEF A;  4X1L A;  1ESU A;  3RH8 B;  1MBL A;  3FC7 A;  4FH2 A;  1VET A;  5EOO A;  1KVM A;  2VJW A;  4QWO A;  1LSW A;  4DMZ A;  3UY6 A;  4GLQ A;  3E98 A;  3B47 A;  4MN5 A;  3BLS A;  3ZVW A;  3LIA A;  4BLM A;  3VP0 A;  3IXD A;  5TJJ A;  1OJ5 A;  5GHX A;  1OTI A;  1NZO A;  1P0Z A;  4Y2F A;  3UNW A;  2XD5 A;  5CX7 A;  3Q7V B;  4KZ3 A;  5E2F A;  4CLC D;  1PFL A;  2J3W A;  4Y15 A;  4E3J A;  3SS5 A;  4R0Q A;  1OME A;  3BQA A;  3CHW P;  1E4D A;  4HH2 A;  4DDS A;  5G18 A;  3CAX A;  3A3I A;  3OOV A;  4NXF A;  4IJG A;  4R4R A;  3C5A A;  5HWT A;  2ZC6 B;  4EBP A;  5DJU A;  3R7W A;  3Q1F A;  1W63 M;  4EUV A;  3O86 A;  4AFI A;  4HI4 A;  4BD0 A;  4EWF A;  4ZRR A;  5EPH A;  3GTC A;  2O9C A;  1JTD A;  4PM9 A;  1WE4 A;  5FAQ A;  4WEK A;  1L0E A;  5HX9 A;  2P08 A;  3LIE A;  3MS6 A;  4I38 A;  1D7E A;  2X01 A;  1E25 A;  1KE4 A;  1V9Y A;  4CQH A;  3BY8 A;  3UDI A;  3W4P A;  5DTK A;  3L7H A;  3FV7 A;  5HAI A;  2Y2P A;  3NHQ A;  5EM0 A;  3E0Y A;  5M1A A;  3OZH A;  3HVF A;  4X53 A;  1YLJ A;  1K54 A;  2Y2H A;  4B4X A;  2HP5 A;  1H3Q A;  2QJ7 A;  4WBG A;  4EBL A;  3UB5 P;  2P9V B;  4EEP A;  4OP5 A;  4CPK A;  1GHP A;  4IUH A;  4OOL A;  3PBR A;  4QJG A;  3FYZ A;  1BZA A;  1G28 A;  4MBH A;  5HAQ A;  4JXS A;  2ZQ7 A;  3A3E A;  1BSG A;  3BFD A;  2W3E A;  2PAV P;  1XPB A;  1ALQ A;  1S1Z A;  5E2G A;  5CEB A;  3PBQ A;  1N9O A;  4DE3 A;  3NY4 A;  5F83 A;  3VOL A;  3MXS A;  1O07 A;  5FQJ A;  2XQZ A;  3UE0 A;  4F3L A;  1G5U A;  1XX2 A;  4HJ3 A;  2ZQ9 A;  1BYW A;  4P6B A;  4E3M A;  1H0M A;  4LV3 A;  5DFX A;  2ZQD A;  3FKV A;  4GS9 A;  2W3H A;  3D72 A;  4QB8 A;  4MDZ A;  2A3U A;  1N9L A;  4R38 A;  1DJB A;  4PAU A;  4QY6 A;  2Q9N A;  2XRO A;  2EA9 A;  5FQM A;  3SOI A;  3VV4 A;  2XA7 M;  2Y2N A;  1EI5 A;  2H28 A;  4EQI A;  3OPR A;  3HJI A;  4Q0H A;  2JKR M;  1YLT A;  3KSI A;  5CGX A;  4KG5 A;  5E2E A;  3LID A;  5CHJ A;  4BD1 A;  2PBY A;  3UB7 A;  2G7U A;  1LT0 A;  3LGO A;  2L1M A;  3UDF A;  3HLC A;  3V5M A;  1PWG A;  3ZYT A;  3A3J A;  4RYE A;  2E8J A;  3E2K A;  2Y2I A;  5FAS A;  3A3D A;  3LIC A;  3UPO A;  5F6A A;  4PM6 A;  3CIT A;  2XEP A;  4O0P A;  1DJC A;  1W79 A;  4WZ5 C;  1MXO A;  1ERM A;  3ZDJ A;  1ERO A;  5FQK A;  4UHU A;  4IVI A;  4DXB A;  3VFF A;  1WA9 A;  4KUK A;  3IXH A;  4JPM A;  2PD7 A;  1TDL A;  5FDH A;  4O7D A;  2WGW A;  3OPL A;  1W8Y A;  2W1T B;  3L9K A;  2GJ3 A;  2WAE A;  2ZLY A;  2FH5 A;  4Y0O A;  4P6Z S;  4KZ4 A;  2WUQ A;  1K4E A;  5J4E A;  1PWC A;  4S2N C;  3D3O A;  4E6X A;  4L0L A;  3QP8 A;  4EBN A;  4S2J A;  5J7E A;  4OKP A;  1YLP A;  2PYR A;  2XRN A;  1GSX A;  3NDG A;  4ETX A;  4LPZ A;  3FWL A;  5K5B A;  4WZ5 A;  2K31 A;  4RQ9 A;  4D60 A;  4B4Z A;  4GB7 A;  4JKT A;  1XJ3 A;  1PWD A;  4HJ6 A;  4ETZ A;  1PZO A;  1FCN A;  4FSF A;  4X69 A;  5EVI B;  2O9A A;  2QHK A;  5A91 A;  4BL3 A;  4LV2 A;  1T1C A;  1OT9 A;  4QU3 A;  4U0T A;  1E3U A;  3HLB A;  4PMA A;  2OLU A;  4LCL A;  4S2N A;  2Z2L B;  1XA1 A;  1UGU A;  5AQA A;  1PNE A;  1RCJ A;  4H6J A;  4R1G A;  1P9R A;  4GZB A;  1YMS A;  1G6O A;  4UA7 A;  2WKH A;  2V8C A;  2Y2Q A;  1OTA A;  2W3D A;  2Y2K A;  4X56 A;  1LSX A;  1IOU A;  1YT4 A;  5KSC A;  3ZVT A;  1DP9 A;  5CHU A;  1NWZ A;  1MKM A;  2EFX A;  1KDW A;  4X68 A;  1IYP A;  5KIZ A;  4R70 A;  3BJN A;  3A0V A;  4UEY A;  5I94 A;  4MNR A;  2DMW A;  2P74 A;  1TS8 A;  3GV9 A;  1OJG A;  2WK0 A;  5E2H A;  3V67 A;  4LLO B;  5A8B A;  2OOL A;  3T12 B;  1TVF A;  2WYX A;  1LL8 A;  5FQI A;  3F1O A;  5D3O A;  2J9P A;  1FR1 A;  1GSW A;  4EES A;  4WMC A;  5FL3 A;  3TJZ C;  1F98 A;  5I5L A;  3IH9 A;  3NCK A;  3H9W A;  1CJF A;  2C6W B;  3VE3 A;  4K0X A;  3GEC A;  3NDE A;  5JYO A;  1PIO A;  2B95 A;  2OWH A;  5IS1 A;  3LI9 A;  5DF8 A;  3SS3 A;  1DY6 A;  4DJ2 A;  5HWW A;  3MJQ A;  3N4I A;  4EET B;  2B18 A;  5CGW A;  1K4F A;  4WL9 A;  3CZD A;  2Y2G A;  2VK3 A;  2RL3 A;  3HBR A;  3UE3 A;  5KMW A;  5DKK A;  1NLY A;  2UV0 E;  1RP5 A;  3FPW A;  2OSU A;  3TOI A;  3F1P B;  5A90 A;  2QJ5 A;  3SZT A;  2HJE A;  4DE2 A;  3Q82 A;  4MBF A;  5F68 A;  4UA6 A;  1L2S A;  3UME A;  3C38 A;  1JTG A;  3SH9 A;  1PYY A;  4Y13 A;  1VHM A;  3QP2 A;  5CRF A;  4LCM A;  3OLO A;  5HL6 A;  1AWI A;  4P6Z M;  1TDG A;  5L07 A;  3G35 A;  1GA9 A;  4YIN A;  3DWZ A;  1YSP A;  2P9V A;  4E3K A;  3CI6 A;  4BBV A;  1YAX A;  3OC2 A;  2VGJ A;  1GSV A;  4MEZ A;  4OLD A;  4S2O A;  1XGI A;  1SKF A;  2KX6 A;  2Z6D A;  2H0T A;  4EEU A;  3M2J A;  3LEZ A;  3H82 B;  4WUJ A;  2VKS A;  1CF0 A;  5CER A;  3U4L P;  5HFO A;  4HBU A;  4BEN A;  2ZQA A;  3M6H A;  4MCW A;  2UWX A;  3IF6 C;  3G2Y A;  4PM8 A;  4YOF A;  5DKL A;  1ZG4 A;  4L9E A;  3S7P A;  3NOU C;  1NYY A;  3VP4 A;  2A2L A;  3C30 A;  3C2W A;  1LLB A;  2OAP 1;  4HP9 A;  1TS0 A;  4E04 A;  1S6R A;  4ARZ A;  4PPR A;  3ZFZ A;  3GQZ A;  4RVA A;  5EUA A;  5F1F A;  4UQI S;  3HLF A;  1H8Z A;  2ZL1 B;  1MY8 A;  4Y0U A;  3PBS A;  4G3W A;  4CLC B;  1DP6 A;  1LHY A;  3MMH A;  1S0W A;  1U60 A;  3IBR A;  3VFH A;  2JN7 A;  3IF6 A;  3IS2 A;  1FIL A;  4KQO A;  3P7N A;  2INW A;  2HDU A;  3RJU A;  2V0W A;  4GKU A;  3VSL A;  3LUQ A;  2JKG A;  5HZH A;  4BBT A;  4WF0 A;  1DP8 A;  1JWZ A;  4ME4 A;  1K6S A;  3DTI A;  5CHM A;  4XT2 B;  4DF6 A;  4GHI A;  1OTE A;  1C3B A;  3O88 A;  2WKQ A;  5HPI A;  3G2Z A;  4R6L A;  2KDK A;  1SKO A;  3VOY A;  1KOU A;  3BRM A;  2QPN A;  2LB5 A;  4FOF A;  3N8R A;  4DKI A;  4CLC E;  3PHY A;  1X0O A;  2QMI A;  3IWO A;  2J3T C;  4LEN A;  4MBK A;  3H7W A;  3BFC A;  4G3K A;  4MN6 A;  1K54 C;  4OP8 A;  4HOI A;  4IUK A;  2YKF A;  1P9W A;  1Z6F A;  2G2U A;  2ZD8 A;  2W1T A;  1XA7 A;  3AGE A;  4HBT A;  1PZP A;  4P85 A;  1ZKJ A;  3NC8 A;  3V39 A;  1S67 L;  2PU2 A;  2GNX A;  2VX8 A;  5IU1 A;  4JXG A;  5TBM A;  2VZW A;  4U3T A;  5LBR A;  1ES3 A;  4Y0T A;  2Y2O A;  4ZBE A;  1ESI A;  4FTX A;  4G3V A;  1XFQ A;  2P04 A;  3E2L A;  4KG6 A;  2K2N A;  3TSG A;  1NJ4 A;  2J9O A;  2VA0 A;  2Y4A A;  5EFW A;  1KVL A;  3NOP C;  3AGF A;  3ICY A;  4JGR A;  2NUT C;  3E4P A;  3CLO A;  3HLG A;  2Z2M B;  1MWT A;  3ZG9 B;  3MKF A;  5HD3 A;  4HP4 A;  3WS0 A;  4RX3 A;  3JPU A;  5C5K A;  5FI7 A;  4KEN B;  2QKP A;  5FAT A;  2BTF P;  2MJ6 A;  2EX2 A;  2EXA A;  3S1Y A;  3DTM A;  4MMN A;  4BQM A;  2WZX A;  5JYP A;  4GN2 A;  3ITA A;  3VP1 A;  3F1N B;  1G6A A;  1ES4 A;  1KE0 A;  1V9Z A;  5L10 A;  5KZH A;  3T50 A;  3ZG7 B;  1ERQ A; 
#chains in the Genus database with same CATH homology
 1OTD A;  5K5B A;  2PYP A;  3PXP A;  2K31 A;  1F5M A;  4RQ9 A;  2XSS A;  2NUP C;  2W1R A;  1XJ3 A;  3RTY A;  4HJ6 A;  4I3A A;  4ETZ A;  3LIF A;  3U2A A;  1MZU A;  5HDS A;  4HHD A;  2V1B A;  4FSF A;  1OTB A;  4DN0 A;  5KSH A;  2A24 B;  2O9A A;  5AVF A;  2QHK A;  2ZOH A;  5AJG A;  1T1C A;  1OT9 A;  3UE6 A;  4HQA A;  2PR6 A;  4EQ1 A;  4WN5 A;  3T4T A;  5L8M A;  3F1O B;  2M1C A;  5HDC A;  1UGU A;  4B93 A;  1W63 Q;  2Y79 A;  5J3W A;  4Y3I A;  4H6J A;  2VGL S;  1D06 A;  1YKD A;  1UWN X;  4UQI M;  3B42 A;  1P9R A;  3KX0 X;  3EEA A;  1T18 A;  5F5Y A;  2BAS A;  1G6O A;  4PKY A;  3NOT C;  3EEH A;  2PDR A;  3KSF A;  5HPF A;  5F69 A;  1OTA A;  3F1N A;  2W3D A;  2VLG A;  2R78 A;  1LSX A;  1IOU A;  3KYQ A;  5G4Y A;  4LRX C;  1DP9 A;  1EW0 A;  2KLI A;  3UB6 A;  2O9B A;  2GX5 A;  1NWZ A;  4NXE A;  1MKM A;  3PR6 A;  5DFY A;  4B9O A;  3O5Y A;  4M4X A;  2OWJ A;  5KIZ A;  4R70 A;  3KYZ A;  2HV1 A;  3BJN A;  3A0V A;  2EWW A;  4UEY A;  4KUO A;  2DMW A;  5HSQ A;  3T4O A;  4I3I A;  3LI8 A;  1TS8 A;  1TS6 A;  2K7S A;  4YNR A;  1OJG A;  4H6J B;  1H8M A;  3V67 A;  2WKP A;  2V0U A;  4LLO B;  5DF9 A;  5A8B A;  2QWS A;  2OOL A;  1IFQ A;  1P97 A;  3MF0 A;  3G6O A;  3KSG A;  4PHT A;  1LL8 A;  3F1O A;  4LRZ E;  3R7W B;  4JGQ A;  2ZMV A;  2B02 A;  2LB9 A;  1XJ6 A;  2XA7 S;  3EGD C;  3HCY A;  1GSW A;  3EQU A;  3ULF A;  4EES A;  5FL3 A;  3TJZ C;  1F98 A;  5I5L A;  3RH8 B;  1LSV A;  3H9W A;  2IA2 A;  4WEL A;  3VE3 A;  3FC7 A;  3GEC A;  2VJW A;  1XFN A;  1LSW A;  4DMZ A;  3MQ0 A;  4GLQ A;  3E98 A;  2D02 A;  3B47 A;  4MN5 A;  3JVU A;  3LR0 A;  2OWH A;  5IS1 A;  5HWV A;  2FZ0 A;  3LI9 A;  4DJ2 A;  5HWW A;  3MJQ A;  3LIA A;  3BY9 A;  1XJ2 A;  4EET B;  1OPX A;  2B18 A;  4LRY C;  4NXB A;  3BWL A;  3TRC A;  5TJJ A;  1OJ5 A;  1S1Y A;  2VV7 A;  4WL9 A;  3UB8 A;  2KOI A;  1OTI A;  3H82 A;  1P0Z A;  3UE3 A;  1TS7 A;  4Y2F A;  3EGX C;  3R4K A;  5CX7 A;  4I39 A;  5DKK A;  1NLY A;  4CLC D;  3FPW A;  2J3W A;  3F1P B;  2QJ5 A;  4JGP A;  4I3J A;  2HJE A;  3BQA A;  4NXG A;  2PD8 A;  4HH2 A;  2V1A A;  5F68 A;  1NRJ A;  3UME A;  3C38 A;  3CAX A;  1MC0 A;  4HNB A;  4QPR A;  3OOV A;  4ARZ B;  2PT7 A;  4NXF A;  2W3F A;  4IJG A;  4GJ4 A;  1VHM A;  5HWT A;  3T4L A;  3OLO A;  5HL6 A;  5DJU A;  4P6Z M;  3R7W A;  1W63 M;  1YSP A;  4O8G A;  4Q0J A;  3T4J A;  3TW8 A;  4EUV A;  4AFI A;  4HI4 A;  1UWP X;  4ZRR A;  3CI6 A;  4HH3 A;  4BBV A;  1YAX A;  3OC2 A;  1YSQ A;  3EQV A;  1DRM A;  1GSV A;  2O9C A;  5MC7 A;  5HDD A;  2KX6 A;  3IS2 B;  2W3G A;  2Z6D A;  4WEK A;  5IT5 A;  4EEU A;  4YWZ A;  2P08 A;  3H82 B;  4WUJ A;  3LIE A;  3K2N A;  2VKS A;  3CUE C;  4I38 A;  1D7E A;  4F3L B;  3KO6 A;  2Y8H A;  3BQ8 A;  1V9Y A;  1ODV A;  4I5S A;  2OAQ 1;  4GHI B;  3CWF A;  3LFV A;  4MCW A;  4CQH A;  3BY8 A;  3A0S A;  4YOF A;  4EU0 A;  5DKL A;  4L9E A;  4R3A A;  3NOU C;  1F9I A;  3NHQ A;  3S7P A;  3F1P A;  3LR4 A;  2A2L A;  3E0Y A;  3E4O A;  3PBN A;  3ZQ5 A;  3C30 A;  3C2W A;  4EER A;  2OAP 1;  3H7W B;  4HP9 A;  4BMW A;  1H3Q A;  3IBJ A;  1TS0 A;  4O01 A;  2M7V A;  2QJ7 A;  4EEP A;  5G4Z A;  4E04 A;  4ARZ A;  3LYX A;  4IUH A;  2EWV A;  2VGL M;  4HIA A;  4K08 A;  2P7J A;  3EWK A;  4OOL A;  1TD5 A;  3MXQ A;  3PBR A;  3MQO A;  1G28 A;  3SW1 A;  2W27 A;  3OCL A;  4UQI S;  3C8C A;  3PYP A;  3CUE A;  2W3E A;  3PBS A;  5TBM B;  4BBU A;  2VEA A;  4G3W A;  3OBF A;  4CLC B;  1DP6 A;  3FG8 A;  1S1Z A;  2YKH A;  3MMH A;  3S7O A;  3HJK A;  2HF6 A;  3IBR A;  5HD5 A;  3PBQ A;  3P01 A;  1N9O A;  5DJT A;  2JN7 A;  2JHE A;  3IS2 A;  4GW9 A;  4KQO A;  4II7 A;  3P7N A;  2INW A;  2V0W A;  3LUQ A;  3JVV A;  3W2Z A;  1S4R A;  3VOL A;  5HZH A;  3PBT A;  4NKP A;  4BBT A;  4WF0 A;  2CMN A;  1DP8 A;  4ME4 A;  4F3L A;  2W0N A;  4BWI A;  4HJ3 A;  4XT2 B;  4CLC C;  3RFB A;  4EXO A;  1BYW A;  3TE8 A;  1T1A A;  2J80 A;  4GHI A;  1OTE A;  5DFX A;  2WKQ A;  5HPI A;  4GS9 A;  1ZHH B;  2W3H A;  2L0W A;  4HJ4 A;  3D72 A;  4R6L A;  2WKR A;  4WEJ A;  2KDK A;  4MDZ A;  3S7N A;  5AVE A;  1N9L A;  1KOU A;  4R38 A;  4PAU A;  2LB5 A;  2XRO A;  4FOF A;  2EA9 A;  4CLC E;  3PHY A;  1X0O A;  2J3T D;  2PR5 A;  2J3T C;  3H7W A;  4G3K A;  4MN6 A;  3VV4 A;  4HY8 A;  2XA7 M;  2H28 A;  3T4K A;  1JNU A;  4HOI A;  2HGV A;  4IUK A;  4DJ3 A;  3UB9 A;  2VV6 A;  2YKF A;  3VE4 A;  3OCN A;  4NEE D;  2QYB A;  1T19 A;  3HJI A;  4Q0H A;  1P9W A;  2JKR M;  3KSI A;  4L9F A;  2HJ9 C;  3T4Q A;  2W1T A;  3LID A;  3EOI A;  3DBA A;  2O99 A;  3A0R A;  3UB7 A;  2O0Y A;  1Y28 A;  1S67 L;  2G7U A;  2VV8 A;  1LT0 A;  2GNX A;  2VX8 A;  2L1M A;  3KSH A;  2ZBB A;  5IU1 A;  5TBM A;  2VZW A;  5LBR A;  3MQQ A;  2I9V A;  3ZYT A;  1ZTU A;  1S66 L;  3B33 A;  4CLC A;  3PBO A;  2JKR I;  1XJ4 A;  4L9G A;  2M7U A;  4G3V A;  4PKY G;  2L4R A;  3LIB A;  3FPV A;  3LIC A;  1XFQ A;  5F6A A;  2P04 A;  4Q0I A;  4MN7 A;  3K3C A;  4OOM A;  3CIT A;  4WLA A;  4GS9 B;  2K2N A;  4O0P A;  3BW6 A;  2VA0 A;  4KQD A;  5EFW A;  3NOP C;  4XT2 A;  2ZMF A;  1VB6 A;  3ICY A;  3NJA A;  4JGR A;  3T4S A;  2NUT C;  3E4P A;  3CLO A;  4JGO A;  4EW7 A;  3UMD A;  1WA9 A;  4KUK A;  2Z6C A;  5HD3 A;  1T1B A;  4HP4 A;  2A24 A;  2D01 A;  2PD7 A;  1TF1 A;  3LR5 A;  3MR0 A;  4IHQ A;  1OT6 A;  4Y5F A;  4BJP A;  1S4S A;  2GZA A;  5C5K A;  2W1T B;  2GJ3 A;  2QKP A;  4Z1W A;  1N9N A;  2MJ6 A;  2V9A A;  2FH5 A;  2JKT M;  4P6Z S;  3E4Q A;  3S7Q A;  3LR3 A;  5J4E A;  3D3O A;  3GDI A;  4MMN A;  4L0L A;  2ZOI A;  3K3D A;  3F1N B;  3MFX A;  1NLZ A;  5J7E A;  1V9Z A;  2PYR A;  2PHY A;  2XRN A;  2JKT I;  1GSX A;  1STZ A;  3T50 A;  4ETX A;  4GCZ A;  4LPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...