1MZUA

Crystal structure of the photoactive yellow protein domain from the sensor histidine kinase ppr from rhodospirillum centenum
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
107
Chain Sequence
b'IDTAEFDALPVGAIQVDGSGVIHRYNRTESRLSGRIPERVIGRNFFTEVAPCTNIPAFSGRFMDGVTSGTLDARFDFVFDFQMAPVRVQIRMQNAGVPDRYWIFVRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PPR
publication title Crystal Structure of a Photoactive Yellow Protein from a Sensor Histidine Kinase: Conformational Variability and Signal Transduction
pubmed doi rcsb
source organism Rhodospirillum centenum
molecule tags Signaling protein
total genus 27
structure length 107
sequence length 110
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1mzuA00
3H7WA 2ZOIA 4EEPA 1GSWA 2L4RA 4I3AA 1LSWA 4B9OA 4HP4A 2VV6A 5EFWA 4EQ1A 1XFNA 1UGUA 3UB9A 1OTDA 4M4XA 3NHQA 4E04A 2PDRA 5HZHA 3LIEA 1P97A 1ODVA 2QJ7A 4HJ3A 1S4SA 4I5SA 5F69A 4L9EA 4DJ2A 1UWPX 4GCZA 2OWHA 1G28A 5HDDA 4GW9A 2GJ3A 5DKKA 3MQOA 3CWFA 1LSVA 1DP6A 4L9GA 2VEAA 1VB6A 3F1PA 2K7SA 1F9IA 4KUOA 5F5YA 2D01A 2VV8A 3F1NB 2INWA 2VV7A 3LUQA 1V9ZA 2J80A 1P0ZA 5HWWA 1KOUA 2OWJA 4EETB 4H6JB 4YWZA 1T1CA 1XJ4A 1OJ5A 4EXOA 5G4ZA 4WL9A 3UB7A 1T18A 3H82A 1GSVA 4MN5A 3E4PA 1GSXA 1OTBA 4NXFA 4HH2A 5HDCA 3MJQA 1DP8A 3HJKA 3BWLA 3F1OA 2L1MA 1TS7A 4KUKA 4BBTA 1LT0A 4I39A 5DJUA 4I3JA 3LI9A 4PKYG 1MZUA 4NXEA 3G6OA 1DP9A 3CAXA 3SW1A 1N9LA 2WKQA 3K3DA 2V1AA 2D02A 2QKPA 2V9AA 1V9YA 3A0SA 3HJIA 3E4QA 3LICA 5AVEA 4F3LA 4WLAA 2ZBBA 3LIDA 4WF0A 1D06A 4JGRA 4HY8A 3UE6A 3VE3A 3KX0X 3LIAA 3ICYA 3RH8B 4GHIA 4I38A 4HQAA 1OT6A 4JGQA 3GDIA 1OT9A 5HDSA 3VE4A 3F1PB 1UWNX 5HD5A 3MQQA 1XJ2A 5DJTA 2ZOHA 3ZQ5A 1OJGA 4I3IA 4HIAA 3H82B 5HWVA 1S67L 1F98A 4HH3A 3NOPC 1TS8A 2CMNA 2V0WA 4PKYA 2PD7A 4GS9B 2OOLA 4R38A 5TBMA 4EW7A 4MN6A 1XJ6A 3NOTC 3C8CA 4LLOB 3EWKA 4NXBA 4XT2A 4DJ3A 5HD3A 2Z6DA 4RQ9A 4LPZA 1S66L 2WKPA 4HNBA 5HSQA 2QWSA 5HWTA 5J3WA 5J7EA 3FG8A 4KQDA 4L9FA 3H7WB 4R3AA 2A24A 1BYWA 5AVFA 3ULFA 3E4OA 2KX6A 2W27A 3MXQA 4LRXC 3D72A 3C2WA 5F6AA 4R6LA 3BY9A 2VLGA 2BASA 2PR6A 2QJ5A 5G4YA 1TS6A 3CLOA 2L0WA 3NJAA 2M1CA 3IS2A 3K3CA 3UMEA 3LIBA 2PD8A 1WA9A 5J4EA 4R70A 5I5LA 2V0UA 1OTAA 2PR5A 5IU1A 2PYPA 2R78A 1S1ZA 2Z6CA 1N9NA 2EA9A 2B02A 3LI8A 3LIFA 4LRYC 1T19A 2JHEA 2QHKA 3LYXA 5KIZA 4WN5A 4EEUA 4EERA 5TBMB 1X0OA 4K08A 3UB8A 2H28A 4XT2B 2HV1A 1DRMA 1S1YA 2I9VA 3OLOA 1XJ3A 2PYRA 3NOUC 3EEHA 3VOLA 2P7JA 3F1OB 4HOIA 3MFXA 2V1BA 3GECA 4WUJA 2A24B 4EESA 1XFQA 4NXGA 1N9OA 3T50A 1EW0A 4JGPA 3IBRA 1OTIA 1T1BA 3BY8A 3MR0A 4HHDA 5F68A 2YKHA 1OTEA 4F3LB 1TS0A 4HP9A 2JN7A 5IS1A 1D7EA 2W0NA 1NWZA 3PHYA 3A0RA 3P7NA 3IS2B 1LSXA 3RTYA 1T1AA 3UMDA 3H9WA 4HI4A 1LL8A 2WKRA 4JGOA 3FC7A 3F1NA 4GHIB 3B33A 4BBUA 4GS9A 3UB6A 1JNUA 4H6JA 4HJ6A 4BBVA 2YKFA 1S4RA 1Y28A 5DKLA 4HJ4A 2KDKA 5A8BA 3PYPA 3A0VA 2PHYA 4LRZE
chains in the Genus database with same CATH superfamily
1FSYA 3H7WA 5HARA 3G2YA 1D1JA 5FSRA 1GA0A 4B9OA 4HP4A 5GLDA 1J3WA 1XFNA 5CTNA 3A3IA 2IWCA 1BT5A 2Y59A 5A90A 3UB9A 2HP9A 3E2LA 4WBGA 2PU2A 4JLFA 5HZHA 3LIEA 3N4IA 4OLGA 1N9BA 4MBFA 5DTSA 1K54C 3HVFA 1ODVA 3T4TA 2Y2QA 4FD8A 3LEZA 5FQJA 1UWPX 1E3UD 1Z09A 4E6WA 2HDUA 3ISGA 3KYEA 3L9KA 4OPQA 4E3LA 2WZXA 3C7VA 3G34A 3WS2A 1EWZA 1IKIA 1TD5A 1RGYA 4ZAMA 3MQOA 3PR6A 1DP6A 3IX8A 3OPPA 1NYMA 2O0YA 1F9IA 4KUOA 2D01A 4EBPA 3R7WA 2W1TA 3F1NB 3KSIA 1BLCA 3PAEA 1IYQA 1XGJA 1ACFA 4RX3A 1BULA 3DTIA 4RX2A 4WL9A 5GHYA 1T18A 1RCJA 3GQZA 4MN5A 1G5UA 4EQIA 4KZ4A 3Q82A 1MWTA 2X71A 4LENA 3MJQA 1NZUA 3LY4A 3BWLA 3EOIA 5KSCA 4KUKA 3QNBA 2CC1A 1YMXA 1LT0A 1YQSA 5FQKA 5DJUA 4GB7A 1Y4OA 4PKYG 1MZUA 4NXEA 4BL3A 4Q8IA 3SW1A 3GV9A 4PMAA 2XA7S 4C6YA 1NXYA 4R4RA 5EVIB 2VGLM 3D4FA 3U2AA 3A0SA 1WE4A 4BD0A 1PWGA 4WLAA 4II7A 4C3QA 4EBNA 4IHQA 1H5XA 4PM9A 1D06A 1ZTUA 2ZC6B 1ES4A 4HY8A 1YM1A 1TF1A 2J9PA 3UE6A 4EU0A 3C30A 3LIAA 2EWWA 4I38A 4DDYA 4HQAA 5CTMA 1XXMA 4LV1A 4N9KA 3O3VA 3HUNA 1ES5A 5FDHA 1STZA 3F1PB 2J3WA 1CF0A 3BEBA 5F83A 3G32A 3IBJA 5HD5A 3JVUA 3BJNA 5GHXA 5I94A 1K56D 5DJTA 3ZG8B 1L0DA 4K0WA 5DTTA 4JXGA 3ZDJA 4KZ6A 5CECA 4RVAA 4GLQA 4FH4A 2FFYA 2ZC4B 3P01A 4LCMA 2WGVA 3H82B 5HWVA 1YLPA 1F98A 1Z6FA 4FCFA 4HESA 4OVDA 1ERMA 3HLDA 2HP6A 1ZG6A 2XSSA 1CQAA 4GS9B 4D60A 3VFFA 3HREA 5E2HA 1XJ6A 5E2EA 5CXWA 2ZQ9A 1K4FA 4OOMA 2J9OA 4OQIA 3P09A 4GN2A 3T12B 3PBQA 1TDLA 4JPMA 3NIAA 5FEFA 3IXBA 1SKOB 1JWPA 3ZFZA 1PYYA 3QP8A 3H7WB 3BLSA 3CMZA 1BYWA 5JYPA 2EFXA 4LCLA 3ULFA 4LV0A 3DTKA 3ZG5A 3OPRA 5E2FA 1O07A 3B3XA 5FQIA 2LB5A 2EX2A 3C2WA 5F6AA 5CGXA 3IX4A 4LGWA 1HTZA 3LR3A 4AFIA 2KOIA 1XGIA 3MKFA 3IS2A 3UMEA 3DAVA 4JF4A 3TJZC 1LHYA 5GL9A 2Y2LA 4IJGA 4X1MA 2R78A 1S1ZA 4Y3IA 2EA9A 2DMWA 4Y0TA 3LI8A 2W1TB 2PBYA 5KIZA 2JKTM 4EEUA 2BG1A 5M18A 4ETXA 3N6IA 3M2JA 1CEGA 4JF6A 4K0XA 3VSKA 3WS0A 4P85A 4EBLA 2Y91A 5A93A 1IYPA 1XP4A 4OQGA 2XLNA 3NOUC 2W3HA 5AQ7A 2V8FA 4HOIA 3VP1A 5A92A 3GECA 4WUJA 3BFDA 3S4XA 3CITA 4BQMA 1RP5A 4UA9A 3TG9A 1T1BA 2XDMA 3LR5A 2PU4A 4L0LA 4PAUA 4MNRA 3BY8A 4IUKA 5JYOA 4KQQA 5F68A 2K31A 3QHYA 5CGSA 1BLHA 3TE8A 1TS0A 1SDNA 3M6BA 5DTKA 3V50A 1VEUB 3MZEA 4HP9A 2JN7A 5IS1A 1G6OA 2WKHA 3ZVWA 4Y0UA 1GA9A 2GX5A 3D3OA 3PHYA 2ACGA 3WS4A 2JC7A 3T4QA 1LSXA 4CLCD 3CJMA 1T1AA 2P04A 1EI5A 5LBRA 4DE2A 4UHUA 3F1NA 2Y4AA 4HBUA 3T4JA 1SCWA 1CJFA 1JNUA 4BBVA 4IVIA 2WADA 5CHMA 2OV5A 1S4RA 5EVIC 3DWKA 1Y28A 4QB8A 2FZ0A 2XD1A 5DKLA 3IF6B 2JBFA 4JF5A 2VX8A 2WZZA 5CEDA 4FTXA 4UA6A 1KDWA 3DTEA 1KE3A 5HFOA 4I3AA 2VV6A 4UAAA 5HAPA 2ZM8A 4O01A 3RJUA 1UGUA 4M4XA 5EVIA 4BD1A 3PBRA 2J3TC 3FKVA 3UN7A 2Y2OA 4HJ3A 3JPUA 1C3BA 4KQOA 3UDXA 2E8JA 5HAQA 3PBTA 4U3TA 5F69A 4L9EA 3VP3A 1S0WA 5HPIA 4GCZA 5HDDA 4EV4A 4X55A 3UE0A 2G7UA 4RA7A 3CPTB 2A49A 4DXBA 3O86A 5DKKA 3CUEA 1K57C 3UY6A 3M6HA 3AGEA 2VEAA 3F1PA 4XXRA 4YOFA 2VV8A 5L07A 2INWA 4DE0A 1LLBA 3N7WA 3MSHA 3DTMA 5HWWA 1PWDA 3E98A 4H6JB 1W7FA 3IF5A 1T1CA 1YLTA 1OJ5A 4EXOA 2WAEA 1PI4A 2ZC7A 3SS5A 3H82A 3S22A 3SH9A 3JVVA 2M7VA 1K57A 3C4OA 4LFUA 3HJKA 2L1MA 1H0MA 4DKIA 4BBTA 1MKMA 4PHTA 4I39A 5HL1A 1NRFA 2HF6A 4I3JA 1FQGA 3E0YA 2FH5A 4FUWA 3G30A 3QP5A 4G3VA 4Y15A 5TGFA 1N9LA 3C38A 5K5BA 1O7EA 3K3DA 1VM1A 2JE5A 2D02A 2QKPA 2B18A 3HJIA 5AVEA 2Z2LB 2O99A 4IVKA 2A2LA 2ZBBA 3V3RA 2WKEA 3Q7ZA 3ZG0A 2JKGA 4D2OA 4GKUA 1PFLA 3ZYTA 1YPRA 4OOYA 5F1GA 1TDGA 4PM8A 2I72A 3NDGA 3VE3A 3W8KA 3ICYA 3S7NA 4GHIA 1BUEA 4UQIM 2ZMVA 4LV2A 3HL9A 1KVLA 1OT9A 3B42A 1QMFA 5HDSA 3VE4A 4IUHA 4S2NC 3HLCA 1JWVA 2NUPC 1XJ2A 3MBZA 1L2SA 2G2WA 3ZQ5A 1BLSA 4I3IA 4HIAA 1XPBA 2AVXA 1VETB 2WUQA 1S67L 3HUMA 4HH3A 3ZGAB 1K55A 4P6BA 4KG5A 4S2NA 4PKYA 4BLMA 1L0EA 5AQ9A 5DF9A 1YT4A 4LLOB 3FWLA 3L7HA 1TEMA 4NXBA 5EOEA 2HZ5A 5CERA 2QPNA 2Z6DA 3IH9A 5J3WA 3NECA 2ZJ9A 5J7EA 4KQDA 4KZAA 1MPLA 3C4PA 4Q0HA 4R3AA 5AVFA 5EM1A 3PXPA 2W3EA 3RFBA 4N9LA 1SHVA 1LI9A 5TR7A 4CPKA 4S2LA 1LL9A 4R6LA 2OAQ1 2VLGA 1VEUA 1FIKA 2H10A 1IELA 1I2SA 3IHBA 3BM6A 3CLOA 3NJAA 2EWVA 3IF6C 1U60A 2HPBA 5AJGA 5U47A 1ERQA 1KGGA 4IEDA 1MXOA 5J4EA 1YMSA 1FCOA 1E4DA 5FQQA 4ZDXA 5KSHA 1Y54A 1BLPA 2QMIA 2PR5A 3A3DA 1CI8A 3IQAA 3AGDA 5EE8A 3BRMA 5EM0A 4ZJ2A 3IXHA 5FL3A 4UEYA 2B02A 1HD8A 3UDIA 2OLVA 4LRYC 4JXWA 4O7DA 1T19A 5FQ9A 4EWFA 2JHEA 3LYXA 1IYSA 4WN5A 3E2KA 1JVJA 1K4EA 3IF6A 5TBMB 2X02A 2H28A 3FPWA 1OMEA 4XT2B 3W4QA 1S1YA 2O9BA 2I9VA 5M19A 3Q7VA 4CJNA 1XJ3A 2PYRA 4LV3A 4OPZA 3BQAA 2Y2NA 3VOLA 2Y2GA 1MBLA 2V1BA 2W3GA 3VOYA 3A3JA 2XROA 4XUXA 1SKFA 1N9OA 3GRJA 2Y79A 1EW0A 2PBDP 3MZDA 4JGPA 5AQAA 5L10A 1OTIA 2X01A 4QWOA 1YSPA 2G2UA 3ZVTA 4HHDA 2XQZA 2YKHA 3SH7A 2P08A 1E25A 3UB5P 2VK3A 3Q1FA 3S7OA 2W0NA 5FI2A 3CPTA 4NETA 4HEFA 1IOUA 1YSQA 1OPXA 3HLFA 4UQIS 3MQ0A 5KZHA 4DMZA 3A3EA 2XFTA 3NULA 4GDBA 3FC7A 1W63M 3I7JA 2C5WB 4IBXA 4GHIB 4KG2A 5DFYA 4GNUA 3B33A 3EGDC 5J8XA 4F94A 2H0YA 4H6JA 5EUAA 4OQHA 1I2WA 2GNXA 3W4PA 4HJ4A 4GOGA 5A8BA 3PYPA 5G18A 5CGWA 2V1ZA 1ES3A 2QYBA 3RXXA 2ZOIA 4Z1WA 2L4RA 3VV4A 4MDZA 4G3WA 4KENB 5CHJA 5EFWA 4EQ1A 2EXAA 2V8CA 3G4PA 2XF3A 1ZKJA 2ZLYA 1OTDA 2B5RA 3NHQA 2XD5A 1HLUP 3VP4A 4EUZA 1SDEA 3B47A 4E04A 1CI9A 3EGXC 2PDRA 2VKSA 4FH2A 2QJ7A 2ZQ7A 3HLEA 1F5MA 5M1AA 3IWIA 4JBFA 5F82A 4DE3A 1S4SA 4PPRA 4BJPA 5HPFA 3SS3A 2KLIA 3OZHA 1BSGA 3IWQA 4CLCE 3VFHA 3R4KA 3CWFA 2JKRI 4OPYA 3G2ZA 4L9GA 1VB6A 5F5YA 3WS1A 1ZC2A 3FV7A 1QMEA 4WZ4A 4E3IA 1CEFA 3ZG9B 1V9ZA 1KE4A 4DDSA 4ARZB 3VMAA 2HDSA 3V39A 2EX9A 4YWZA 3BFGA 4U0TA 5G4ZA 1VETA 4Z9QA 1GSVA 4WYYA 4R23A 3MF0A 1NLYA 1GSXA 2R9WA 1OTBA 4HH2A 5HDCA 1DP8A 3F1OA 3EEAA 1W63Q 3O87A 3PTEA 3LI9A 2EX6A 3G6OA 4E3KA 2HJ9C 1DJCA 5DVAA 3VSLA 4S2JA 2Y55A 4QHCA 2V9AA 1PZPA 2RCXA 4S2OA 2LB9A 3LICA 4F3LA 4B93A 4OH0A 3O5YA 3KSGA 3LIDA 4WF0A 3QP4A 3Q7VB 3S1YA 3TSGA 3DWZA 2WGWB 2Y2HA 4KZ5A 2W3DA 3KX0X 3CUEC 4Y0OA 2PAVP 1OT6A 2Q9MA 3DW0A 4JGQA 2NUTC 5FI7A 3GDIA 4UA7A 4ETZA 2DRWA 5EECA 5HX9A 1JWZA 4QPRA 3V5MA 1IYOA 3N8RA 4OQ0A 3UPOA 3HUOA 5FI6A 2A3UA 1G68A 4WMCA 4DE1A 2ZOHA 1K6SA 3T1RA 5FQMA 3NCKA 2UV0E 4S2KA 5L8MA 1WYCA 1W8QA 3BFCA 3KSFA 4MCWA 3KO6A 3IWOA 3NOPC 3QP1A 4WZ5C 2PD7A 2OSUA 5EVID 1XA7A 2OOLA 4R38A 3W4OA 2ZL1A 3CG5A 5TBMA 1ES2A 4MN6A 3C8CA 4GZBA 4XT2A 4X6TA 5DF8A 1S66L 4HNBA 4ESPA 3OOVA 2QWSA 1M40A 5HWTA 4P0MA 4FSFA 5MC7A 1DJAA 4KQRA 5TJJA 1LL5A 3WS5A 4WZ5A 3CZDA 4P87A 3N8LA 2J3TD 2OLUA 1L0GA 4DF6A 3DBAA 1W79A 4NG2A 4Y13A 2Y2PA 4NKPA 4X53A 2ZQDA 2V20A 3IHAA 4LRXC 5FASA 2Y8HA 4Q0JA 4BMWA 3W2ZA 3MMHA 3BY9A 3QP6A 3WRZA 1ESUA 1KE0A 4M3KA 2QJ5A 5G4YA 1FR1A 2WYXA 1NLZA 2BTFP 1TS6A 3LGOA 4PM6A 1YLYA 3K3CA 4E6XA 1ONHA 4A5RA 1E3UA 1WA9A 3LFVA 4R70A 3EQUA 2GZAA 2V0UA 3SZTA 3T4SA 1OTAA 5IU1A 4B4XA 2PYPA 1FOFA 1K55C 4CLCB 2Z6CA 1N9NA 1YAXA 2ZD8A 3Q07A 5IT5A 4IBRA 3T4KA 3NBLA 2WKIA 3A3FA 5CHUA 4G3KA 2VZWA 3VP0A 4ZBEA 1GHPA 1X0OA 4K08A 3UNWA 3GR2A 2C6WB 1BZAA 2ZQCA 2EFUA 3OBFA 2MJ6A 2HV1A 1MKIA 1DRMA 3WRTA 2V2FF 3Q81A 3UPNA 1PZOA 4JXSA 3OLOA 4OONA 3EEHA 3LY3A 1LI0A 2VJWA 4GJ4A 1NY0A 4R4SA 3BLMA 4X1LA 2ZQ8A 3F1OB 4WM9A 1JTGA 1F2KA 3G31A 1H3QA 2A24B 4EESA 5L09A 3N8SA 4NXGA 2Q9NA 1PWCA 3IBRA 5A91A 1XKZA 2WGIA 1K54A 3T1SA 3MXRA 3LCEA 4E3OA 2GDNA 4F3LB 5IHVA 3IT9A 1P9WA 4NEED 1IKGA 1RGZA 3LO7A 4JXVA 4N1XA 3V67A 4B4ZA 3UMDA 3H9WA 5FEGA 1GHIA 4HI4A 3S7PA 4JKTA 1SZVA 2WKRA 4JGOA 3VOZA 4KZBA 3ZHHA 2M7UA 1DY6A 1K38A 1G6AA 2OAP1 5GLBA 4BBUA 3LR0A 4ARZA 3ZNTA 4N92A 1I5QA 2YKFA 3ZG7B 3HLWA 4OKPA 3FYZA 5EVLA 4GD6A 5EVEA 1FSWA 3BW6A 4OP8A 1H8ZA 4FOFA 2ZQAA 2VA0A 1K56A 2JKRM 1IFQA 2KDKA 2Q0OA 5D3OA 4QJGA 3SH8A 4E3JA 2PHYA 2ZC3B 4LRZE 1XX2A 4ZRRA 1NYYA 3CI6A 4R3BA 2DCFA 4QY6A 3MKEA 5CEBA 1GHMA 4BENA 4EEPA 1GSWA 2B95A 1LSWA 4WEKA 4X69A 4MEZA 3BFEA 4U0XA 3LEQA 1PIOA 1PI5A 2ZL1B 4OPRA 4E3MA 1P97A 3OPHA 1M6KA 1ONGA 3HCYA 4DN0A 3FZCA 3ZNYA 1YLWA 4MLLA 4S2IA 2EXBA 1HVBA 2QZ6A 4I5SA 4DJ2A 1YLZA 3T4LA 4ID4A 3ZCZA 2OWHA 3U4LP 2WGWA 1G28A 4GW9A 2ZMAA 4R3JA 4PM7A 2P9VB 1KDSA 2GJ3A 4R0QA 1AWIA 4H8RA 1LSVA 1YLJA 4S2PA 1K6RA 4YINA 2K7SA 2Z2MB 5E43A 4PM5A 3MXSA 5FATA 3FPVA 1W5DA 4Y17A 4QD4A 2VV7A 4MBHA 3LUQA 2J80A 1P0ZA 3QP2A 1KOUA 2OWJA 4EETB 3NI9A 1XJ4A 1EROA 2IA2A 4QY5A 3T1QB 1KGFA 3UB7A 2O9AA 3TOIA 5BOHA 2E8IA 3E4PA 4MBKA 4NXFA 4ZTKA 3AGFA 1TS7A 2WAFA 1MC0A 3IH8A 5L2FA 3M2KA 3BFFA 3UO9A 4P6ZM 4O8GA 1FCNA 5F1FA 4OLDA 1DP9A 3CAXA 1FILA 2R9XA 4BWIA 1K0KA 2RL3A 2WKQA 2V1AA 5HL6A 1BTLA 3OCNA 1V9YA 3C7UA 2EX8A 3E4QA 1H8YA 4R1GA 1NRJA 3OC2A 4YNRA 1H8MA 3OCLA 2ZMFA 2JKFA 1MWRA 4JGRA 3NC8A 1YKDA 3TRCA 4E3NA 4DXCA 5CRFA 3RH8B 4CLCC 1MY8A 2XRNA 4KZ7A 1VHMA 1GCEA 3MS6A 2WK0A 2H0TA 2Y2KA 5GHZA 3UDFA 1L0FA 4KZ3A 1UWNX 4K91A 3R7WB 3V3SA 3MQQA 1ESIA 5FAOA 4BL2A 3OPLA 5FAQA 1OJGA 1PW8A 2HJEA 2HDRA 4X68A 4ME4A 3C5AA 5FA7A 4CLCA 2PRFA 5EPHA 1AXBA 3IX3A 2P74A 5DFXA 1TS8A 4MMNA 2CMNA 3PAGA 2Y2MA 2V0WA 4GDNA 2W1RA 1J9MA 4Y7PA 4EW7A 3NOTC 2ZC5B 2VGLS 3EWKA 1Q2PA 4DJ3A 2ZM2A 5HD3A 4RQ9A 3WWXA 1W8YA 5FAPA 4LPZA 2WKPA 2K2NA 5HSQA 2HP5A 3IXGA 2O9CA 4GD8A 5EV0A 1S6RA 4OOLA 3FG8A 4L9FA 3ITAA 5AQBA 4OP5A 2ZM0A 1WYBA 5DF7A 2A24A 4X56A 3KSHA 1KGEA 1DJBA 1JTDA 3K2NA 3E4OA 4Y2FA 2KX6A 4CQHA 1IEMA 4XUZA 3NY4A 2W27A 4ZJ1A 3MXQA 2XGNA 1P9RA 3D72A 1L3LA 4ZJ3A 2BASA 2Y2JA 3MFDA 4O0PA 2HGVA 2PR6A 3BYDA 4KZ9A 3UPPA 1TVFA 2VGJA 3P98A 2L0WA 3BQ8A 3T4OA 2UWXA 2M1CA 3RXWA 3LIBA 1N4OA 5HAIA 2PD8A 4S2MA 5E2GA 3HBRA 3TW8A 5I5LA 3SOIA 2J8YA 3QNCA 5FDSA 1MWSA 2W3FA 2XFSA 2XEPA 2J7VA 5C5KA 1FR6A 2VGKA 5HW3A 1ALQA 3VP2A 2IWBA 3LIFA 1XA1A 2QHKA 2JCHA 3O88A 5KMWA 4EERA 2DNSA 5CX7A 2XA7M 1KVMA 3UB8A 4EUVA 3HLBA 3HLGA 5EOOA 4WELA 5TFQA 3EQVA 4N1HA 3PBOA 4P6ZS 2P7JA 4NK3A 4WEJA 5GLAA 1FCMA 3LR4A 3BECA 3MFXA 4B88A 3IXDA 1XFQA 4X25A 3T50A 3SS4A 4HBTA 1VQQA 2XH9A 1K25A 1ZHHB 4WMCD 3MR0A 1CK3A 4Y5FA 4YFMA 3CHWP 4QU3A 3NDEA 1OTEA 2IWDA 1Q2QA 3GMWA 3FKWA 2P9VA 2XR0A 3UE1A 4Q0IA 1D7EA 3ITBA 2H5SA 4RYEA 1NWZA 3A0RA 3JYIA 2JKTI 5GLCA 3P7NA 3UE3A 1PRQA 3IS2B 3RTYA 1A0KA 3D9YA 3KYQA 1PW1A 3PBSA 3T1XA 3PBNA 4MN7A 1ZG4A 4DRTA 2BLSA 3GTCA 1LL8A 3GVBA 3S7QA 1NZOA 4GS9A 2FFFB 2HDQA 3G35A 1MWUA 3MZFA 1NJ4A 3UB6A 4HJ6A 4KZ8A 4KG6A 3GSGA 2Y2IA 2PT7A 1PNEA 3A0VA 3KYZA 1SKOA 1HZOA 2XK1A 4C75A
chains in the Genus database with same CATH topology
3H7WA 2QYBA 2ZOIA 4EEPA 1GSWA 4Z1WA 2L4RA 3VV4A 4MDZA 4G3WA 4I3AA 1LSWA 4B9OA 4HP4A 4WEKA 2VV6A 5EFWA 4EQ1A 1XFNA 4O01A 1UGUA 3UB9A 1OTDA 4M4XA 3NHQA 3PBRA 3B47A 2J3TC 4E04A 3EGXC 2PDRA 2VKSA 3LIEA 5HZHA 1P97A 1ODVA 2QJ7A 4HJ3A 3HCYA 4DN0A 4KQOA 1F5MA 3T4TA 3PBTA 1S4SA 4BJPA 5HPFA 4I5SA 5F69A 4L9EA 4DJ2A 1UWPX 3T4LA 5HPIA 4GCZA 2OWHA 2KLIA 1G28A 5HDDA 4GW9A 2G7UA 2GJ3A 4CLCE 1TD5A 3R4KA 5DKKA 3CUEA 3MQOA 3CWFA 2JKRI 1LSVA 3PR6A 1DP6A 4L9GA 2VEAA 1VB6A 2O0YA 3F1PA 2K7SA 1F9IA 4KUOA 4YOFA 5F5YA 2D01A 3R7WA 3FPVA 2W1TA 2VV8A 3F1NB 3KSIA 2INWA 2VV7A 3LUQA 1V9ZA 2J80A 1P0ZA 5HWWA 1KOUA 4ARZB 3E98A 2OWJA 4EETB 4H6JB 4YWZA 1T1CA 1XJ4A 1OJ5A 2IA2A 4EXOA 5G4ZA 4WL9A 3UB7A 1T18A 3H82A 1GSVA 2O9AA 4MN5A 3MF0A 1NLYA 3E4PA 1GSXA 3JVVA 1OTBA 4NXFA 4HH2A 2M7VA 5HDCA 3MJQA 1DP8A 3HJKA 3BWLA 3EOIA 2L1MA 1TS7A 3F1OA 4KUKA 4BBTA 1MC0A 1MKMA 3EEAA 1LT0A 4PHTA 1W63Q 4I39A 4P6ZM 5DJUA 2HF6A 4I3JA 3E0YA 2FH5A 4O8GA 3LI9A 4PKYG 1MZUA 4NXEA 3G6OA 1DP9A 4G3VA 2HJ9C 3CAXA 3SW1A 4BWIA 1N9LA 3C38A 5K5BA 2XA7S 2WKQA 3K3DA 2V1AA 2D02A 2QKPA 3OCNA 5HL6A 2V9AA 1V9YA 2VGLM 3U2AA 2B18A 3A0SA 3HJIA 3E4QA 2LB9A 3LICA 5AVEA 1NRJA 4F3LA 4B93A 2O99A 4WLAA 4II7A 2A2LA 2ZBBA 3OC2A 4YNRA 3O5YA 3KSGA 1H8MA 3LIDA 4WF0A 3OCLA 4IHQA 2ZMFA 1D06A 4JGRA 3ZYTA 1ZTUA 1YKDA 4HY8A 3TRCA 1TF1A 3UE6A 4EU0A 2W3DA 3C30A 3VE3A 3KX0X 3LIAA 3CUEC 3ICYA 2EWWA 3RH8B 3S7NA 4CLCC 4GHIA 4I38A 2XRNA 4HQAA 1OT6A 4JGQA 4UQIM 2ZMVA 2NUTC 3GDIA 1VHMA 4ETZA 1OT9A 3B42A 1STZA 5HDSA 4QPRA 3VE4A 4IUHA 3F1PB 2J3WA 2NUPC 1UWNX 3R7WB 3IBJA 5HD5A 3JVUA 3BJNA 3MQQA 1XJ2A 5DJTA 2ZOHA 4GLQA 5L8MA 3ZQ5A 1OJGA 4I3IA 2HJEA 3P01A 4HIAA 3H82B 4ME4A 4CLCA 5HWVA 3KSFA 1S67L 4MCWA 1F98A 4HH3A 3KO6A 5DFXA 3NOPC 1TS8A 4MMNA 2CMNA 2V0WA 4PKYA 2XSSA 2PD7A 2W1RA 4GS9B 2OOLA 4R38A 5TBMA 5DF9A 1XJ6A 4MN6A 3NOTC 4EW7A 3C8CA 4LLOB 4OOMA 2VGLS 3EWKA 4NXBA 4XT2A 4DJ3A 5HD3A 2Z6DA 4RQ9A 3PBQA 4LPZA 1S66L 2WKPA 2K2NA 4HNBA 5HSQA 3OOVA 2O9CA 2QWSA 5HWTA 5J3WA 4OOLA 4FSFA 3FG8A 4KQDA 4L9FA 5J7EA 5MC7A 5TJJA 4Q0HA 3H7WB 4R3AA 2A24A 1BYWA 5AVFA 3KSHA 3PXPA 3K2NA 2W3EA 3RFBA 3E4OA 3ULFA 2J3TD 4Y2FA 2KX6A 4CQHA 3DBAA 2W27A 4NKPA 2LB5A 3MXQA 4LRXC 1P9RA 3D72A 3C2WA 5F6AA 2Y8HA 4Q0JA 4BMWA 3W2ZA 3MMHA 4R6LA 3BY9A 2OAQ1 2VLGA 2BASA 3LR3A 4AFIA 4O0PA 2HGVA 2PR6A 2KOIA 2QJ5A 5G4YA 1NLZA 1TS6A 3CLOA 2L0WA 3BQ8A 3T4OA 3NJAA 2EWVA 2M1CA 3IS2A 3K3CA 5AJGA 3UMEA 3LIBA 3TJZC 2PD8A 1WA9A 5J4EA 3LFVA 3TW8A 4R70A 3EQUA 2GZAA 5I5LA 2V0UA 4IJGA 5KSHA 3T4SA 1OTAA 2PR5A 2W3FA 5IU1A 2PYPA 5C5KA 2R78A 1S1ZA 4CLCB 4Y3IA 2Z6CA 1N9NA 1YAXA 2EA9A 2DMWA 5FL3A 5IT5A 4UEYA 2B02A 3LI8A 3LIFA 4LRYC 1T19A 2W1TB 3T4KA 2JHEA 2QHKA 3LYXA 5KIZA 2JKTM 4G3KA 4WN5A 2VZWA 4EEUA 4EERA 5TBMB 5CX7A 1X0OA 4ETXA 4K08A 2XA7M 3UB8A 4EUVA 2H28A 3FPWA 4XT2B 3OBFA 2MJ6A 2HV1A 1DRMA 1S1YA 2O9BA 4WELA 2I9VA 3OLOA 1XJ3A 2PYRA 3EQVA 3NOUC 3EEHA 2W3HA 2VJWA 4GJ4A 3BQAA 3PBOA 3VOLA 4P6ZS 2P7JA 3F1OB 4WEJA 3LR4A 4HOIA 3MFXA 2V1BA 2W3GA 3GECA 4WUJA 1H3QA 2A24B 4EESA 1XFQA 4NXGA 2XROA 1N9OA 3T50A 2Y79A 1EW0A 4JGPA 3CITA 3IBRA 1OTIA 1T1BA 3LR5A 1YSPA 1ZHHB 4L0LA 4PAUA 3BY8A 3MR0A 4IUKA 4HHDA 5F68A 2YKHA 2K31A 4Y5FA 2P08A 1OTEA 4F3LB 3TE8A 1P9WA 1TS0A 3S7OA 4NEED 4HP9A 2JN7A 5IS1A 4Q0IA 1G6OA 1D7EA 3V67A 2W0NA 2GX5A 3D3OA 1NWZA 3PHYA 3A0RA 2JKTI 3P7NA 3UE3A 3IS2B 3T4QA 1LSXA 3RTYA 4CLCD 1IOUA 3KYQA 1T1AA 1YSQA 3UMDA 3H9WA 3PBSA 2P04A 1OPXA 3PBNA 4MN7A 4UQIS 3MQ0A 5LBRA 4HI4A 4DMZA 3S7PA 1LL8A 2WKRA 4JGOA 3FC7A 2M7UA 1W63M 5DFYA 3F1NA 4GHIB 3S7QA 2OAP1 3B33A 3T4JA 3EGDC 4BBUA 4GS9A 3UB6A 3LR0A 4ARZA 1JNUA 4H6JA 4HJ6A 4BBVA 2YKFA 1S4RA 2GNXA 2PT7A 1Y28A 3BW6A 2FZ0A 5DKLA 4FOFA 4HJ4A 2VA0A 2JKRM 1IFQA 2KDKA 3PYPA 5A8BA 3A0VA 3KYZA 2VX8A 2PHYA 4LRZE 4ZRRA 3CI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H7W A;  2ZOI A;  4EEP A;  1GSW A;  2L4R A;  4I3A A;  1LSW A;  4B9O A;  4HP4 A;  2VV6 A;  5EFW A;  4EQ1 A;  1XFN A;  1UGU A;  3UB9 A;  1OTD A;  4M4X A;  3NHQ A;  4E04 A;  2PDR A;  5HZH A;  3LIE A;  1P97 A;  1ODV A;  2QJ7 A;  4HJ3 A;  1S4S A;  4I5S A;  5F69 A;  4L9E A;  4DJ2 A;  1UWP X;  4GCZ A;  2OWH A;  1G28 A;  5HDD A;  4GW9 A;  2GJ3 A;  5DKK A;  3MQO A;  3CWF A;  1LSV A;  1DP6 A;  4L9G A;  2VEA A;  1VB6 A;  3F1P A;  2K7S A;  1F9I A;  4KUO A;  5F5Y A;  2D01 A;  2VV8 A;  3F1N B;  2INW A;  2VV7 A;  3LUQ A;  1V9Z A;  2J80 A;  1P0Z A;  5HWW A;  1KOU A;  2OWJ A;  4EET B;  4H6J B;  4YWZ A;  1T1C A;  1XJ4 A;  1OJ5 A;  4EXO A;  5G4Z A;  4WL9 A;  3UB7 A;  1T18 A;  3H82 A;  1GSV A;  4MN5 A;  3E4P A;  1GSX A;  1OTB A;  4NXF A;  4HH2 A;  5HDC A;  3MJQ A;  1DP8 A;  3HJK A;  3BWL A;  3F1O A;  2L1M A;  1TS7 A;  4KUK A;  4BBT A;  1LT0 A;  4I39 A;  5DJU A;  4I3J A;  3LI9 A;  4PKY G;  1MZU A;  4NXE A;  3G6O A;  1DP9 A;  3CAX A;  3SW1 A;  1N9L A;  2WKQ A;  3K3D A;  2V1A A;  2D02 A;  2QKP A;  2V9A A;  1V9Y A;  3A0S A;  3HJI A;  3E4Q A;  3LIC A;  5AVE A;  4F3L A;  4WLA A;  2ZBB A;  3LID A;  4WF0 A;  1D06 A;  4JGR A;  4HY8 A;  3UE6 A;  3VE3 A;  3KX0 X;  3LIA A;  3ICY A;  3RH8 B;  4GHI A;  4I38 A;  4HQA A;  1OT6 A;  4JGQ A;  3GDI A;  1OT9 A;  5HDS A;  3VE4 A;  3F1P B;  1UWN X;  5HD5 A;  3MQQ A;  1XJ2 A;  5DJT A;  2ZOH A;  3ZQ5 A;  1OJG A;  4I3I A;  4HIA A;  3H82 B;  5HWV A;  1S67 L;  1F98 A;  4HH3 A;  3NOP C;  1TS8 A;  2CMN A;  2V0W A;  4PKY A;  2PD7 A;  4GS9 B;  2OOL A;  4R38 A;  5TBM A;  4EW7 A;  4MN6 A;  1XJ6 A;  3NOT C;  3C8C A;  4LLO B;  3EWK A;  4NXB A;  4XT2 A;  4DJ3 A;  5HD3 A;  2Z6D A;  4RQ9 A;  4LPZ A;  1S66 L;  2WKP A;  4HNB A;  5HSQ A;  2QWS A;  5HWT A;  5J3W A;  5J7E A;  3FG8 A;  4KQD A;  4L9F A;  3H7W B;  4R3A A;  2A24 A;  1BYW A;  5AVF A;  3ULF A;  3E4O A;  2KX6 A;  2W27 A;  3MXQ A;  4LRX C;  3D72 A;  3C2W A;  5F6A A;  4R6L A;  3BY9 A;  2VLG A;  2BAS A;  2PR6 A;  2QJ5 A;  5G4Y A;  1TS6 A;  3CLO A;  2L0W A;  3NJA A;  2M1C A;  3IS2 A;  3K3C A;  3UME A;  3LIB A;  2PD8 A;  1WA9 A;  5J4E A;  4R70 A;  5I5L A;  2V0U A;  1OTA A;  2PR5 A;  5IU1 A;  2PYP A;  2R78 A;  1S1Z A;  2Z6C A;  1N9N A;  2EA9 A;  2B02 A;  3LI8 A;  3LIF A;  4LRY C;  1T19 A;  2JHE A;  2QHK A;  3LYX A;  5KIZ A;  4WN5 A;  4EEU A;  4EER A;  5TBM B;  1X0O A;  4K08 A;  3UB8 A;  2H28 A;  4XT2 B;  2HV1 A;  1DRM A;  1S1Y A;  2I9V A;  3OLO A;  1XJ3 A;  2PYR A;  3NOU C;  3EEH A;  3VOL A;  2P7J A;  3F1O B;  4HOI A;  3MFX A;  2V1B A;  3GEC A;  4WUJ A;  2A24 B;  4EES A;  1XFQ A;  4NXG A;  1N9O A;  3T50 A;  1EW0 A;  4JGP A;  3IBR A;  1OTI A;  1T1B A;  3BY8 A;  3MR0 A;  4HHD A;  5F68 A;  2YKH A;  1OTE A;  4F3L B;  1TS0 A;  4HP9 A;  2JN7 A;  5IS1 A;  1D7E A;  2W0N A;  1NWZ A;  3PHY A;  3A0R A;  3P7N A;  3IS2 B;  1LSX A;  3RTY A;  1T1A A;  3UMD A;  3H9W A;  4HI4 A;  1LL8 A;  2WKR A;  4JGO A;  3FC7 A;  3F1N A;  4GHI B;  3B33 A;  4BBU A;  4GS9 A;  3UB6 A;  1JNU A;  4H6J A;  4HJ6 A;  4BBV A;  2YKF A;  1S4R A;  1Y28 A;  5DKL A;  4HJ4 A;  2KDK A;  5A8B A;  3PYP A;  3A0V A;  2PHY A;  4LRZ E; 
#chains in the Genus database with same CATH topology
 1FSY A;  3H7W A;  5HAR A;  3G2Y A;  1D1J A;  5FSR A;  1GA0 A;  4B9O A;  4HP4 A;  5GLD A;  1J3W A;  1XFN A;  5CTN A;  3A3I A;  2IWC A;  1BT5 A;  2Y59 A;  5A90 A;  3UB9 A;  2HP9 A;  3E2L A;  4WBG A;  2PU2 A;  4JLF A;  5HZH A;  3LIE A;  3N4I A;  4OLG A;  1N9B A;  4MBF A;  5DTS A;  1K54 C;  3HVF A;  1ODV A;  3T4T A;  2Y2Q A;  4FD8 A;  3LEZ A;  5FQJ A;  1UWP X;  1E3U D;  1Z09 A;  4E6W A;  2HDU A;  3ISG A;  3KYE A;  3L9K A;  4OPQ A;  4E3L A;  2WZX A;  3C7V A;  3G34 A;  3WS2 A;  1EWZ A;  1IKI A;  1TD5 A;  1RGY A;  4ZAM A;  3MQO A;  3PR6 A;  1DP6 A;  3IX8 A;  3OPP A;  1NYM A;  2O0Y A;  1F9I A;  4KUO A;  2D01 A;  4EBP A;  3R7W A;  2W1T A;  3F1N B;  3KSI A;  1BLC A;  3PAE A;  1IYQ A;  1XGJ A;  1ACF A;  4RX3 A;  1BUL A;  3DTI A;  4RX2 A;  4WL9 A;  5GHY A;  1T18 A;  1RCJ A;  3GQZ A;  4MN5 A;  1G5U A;  4EQI A;  4KZ4 A;  3Q82 A;  1MWT A;  2X71 A;  4LEN A;  3MJQ A;  1NZU A;  3LY4 A;  3BWL A;  3EOI A;  5KSC A;  4KUK A;  3QNB A;  2CC1 A;  1YMX A;  1LT0 A;  1YQS A;  5FQK A;  5DJU A;  4GB7 A;  1Y4O A;  4PKY G;  1MZU A;  4NXE A;  4BL3 A;  4Q8I A;  3SW1 A;  3GV9 A;  4PMA A;  2XA7 S;  4C6Y A;  1NXY A;  4R4R A;  5EVI B;  2VGL M;  3D4F A;  3U2A A;  3A0S A;  1WE4 A;  4BD0 A;  1PWG A;  4WLA A;  4II7 A;  4C3Q A;  4EBN A;  4IHQ A;  1H5X A;  4PM9 A;  1D06 A;  1ZTU A;  2ZC6 B;  1ES4 A;  4HY8 A;  1YM1 A;  1TF1 A;  2J9P A;  3UE6 A;  4EU0 A;  3C30 A;  3LIA A;  2EWW A;  4I38 A;  4DDY A;  4HQA A;  5CTM A;  1XXM A;  4LV1 A;  4N9K A;  3O3V A;  3HUN A;  1ES5 A;  5FDH A;  1STZ A;  3F1P B;  2J3W A;  1CF0 A;  3BEB A;  5F83 A;  3G32 A;  3IBJ A;  5HD5 A;  3JVU A;  3BJN A;  5GHX A;  5I94 A;  1K56 D;  5DJT A;  3ZG8 B;  1L0D A;  4K0W A;  5DTT A;  4JXG A;  3ZDJ A;  4KZ6 A;  5CEC A;  4RVA A;  4GLQ A;  4FH4 A;  2FFY A;  2ZC4 B;  3P01 A;  4LCM A;  2WGV A;  3H82 B;  5HWV A;  1YLP A;  1F98 A;  1Z6F A;  4FCF A;  4HES A;  4OVD A;  1ERM A;  3HLD A;  2HP6 A;  1ZG6 A;  2XSS A;  1CQA A;  4GS9 B;  4D60 A;  3VFF A;  3HRE A;  5E2H A;  1XJ6 A;  5E2E A;  5CXW A;  2ZQ9 A;  1K4F A;  4OOM A;  2J9O A;  4OQI A;  3P09 A;  4GN2 A;  3T12 B;  3PBQ A;  1TDL A;  4JPM A;  3NIA A;  5FEF A;  3IXB A;  1SKO B;  1JWP A;  3ZFZ A;  1PYY A;  3QP8 A;  3H7W B;  3BLS A;  3CMZ A;  1BYW A;  5JYP A;  2EFX A;  4LCL A;  3ULF A;  4LV0 A;  3DTK A;  3ZG5 A;  3OPR A;  5E2F A;  1O07 A;  3B3X A;  5FQI A;  2LB5 A;  2EX2 A;  3C2W A;  5F6A A;  5CGX A;  3IX4 A;  4LGW A;  1HTZ A;  3LR3 A;  4AFI A;  2KOI A;  1XGI A;  3MKF A;  3IS2 A;  3UME A;  3DAV A;  4JF4 A;  3TJZ C;  1LHY A;  5GL9 A;  2Y2L A;  4IJG A;  4X1M A;  2R78 A;  1S1Z A;  4Y3I A;  2EA9 A;  2DMW A;  4Y0T A;  3LI8 A;  2W1T B;  2PBY A;  5KIZ A;  2JKT M;  4EEU A;  2BG1 A;  5M18 A;  4ETX A;  3N6I A;  3M2J A;  1CEG A;  4JF6 A;  4K0X A;  3VSK A;  3WS0 A;  4P85 A;  4EBL A;  2Y91 A;  5A93 A;  1IYP A;  1XP4 A;  4OQG A;  2XLN A;  3NOU C;  2W3H A;  5AQ7 A;  2V8F A;  4HOI A;  3VP1 A;  5A92 A;  3GEC A;  4WUJ A;  3BFD A;  3S4X A;  3CIT A;  4BQM A;  1RP5 A;  4UA9 A;  3TG9 A;  1T1B A;  2XDM A;  3LR5 A;  2PU4 A;  4L0L A;  4PAU A;  4MNR A;  3BY8 A;  4IUK A;  5JYO A;  4KQQ A;  5F68 A;  2K31 A;  3QHY A;  5CGS A;  1BLH A;  3TE8 A;  1TS0 A;  1SDN A;  3M6B A;  5DTK A;  3V50 A;  1VEU B;  3MZE A;  4HP9 A;  2JN7 A;  5IS1 A;  1G6O A;  2WKH A;  3ZVW A;  4Y0U A;  1GA9 A;  2GX5 A;  3D3O A;  3PHY A;  2ACG A;  3WS4 A;  2JC7 A;  3T4Q A;  1LSX A;  4CLC D;  3CJM A;  1T1A A;  2P04 A;  1EI5 A;  5LBR A;  4DE2 A;  4UHU A;  3F1N A;  2Y4A A;  4HBU A;  3T4J A;  1SCW A;  1CJF A;  1JNU A;  4BBV A;  4IVI A;  2WAD A;  5CHM A;  2OV5 A;  1S4R A;  5EVI C;  3DWK A;  1Y28 A;  4QB8 A;  2FZ0 A;  2XD1 A;  5DKL A;  3IF6 B;  2JBF A;  4JF5 A;  2VX8 A;  2WZZ A;  5CED A;  4FTX A;  4UA6 A;  1KDW A;  3DTE A;  1KE3 A;  5HFO A;  4I3A A;  2VV6 A;  4UAA A;  5HAP A;  2ZM8 A;  4O01 A;  3RJU A;  1UGU A;  4M4X A;  5EVI A;  4BD1 A;  3PBR A;  2J3T C;  3FKV A;  3UN7 A;  2Y2O A;  4HJ3 A;  3JPU A;  1C3B A;  4KQO A;  3UDX A;  2E8J A;  5HAQ A;  3PBT A;  4U3T A;  5F69 A;  4L9E A;  3VP3 A;  1S0W A;  5HPI A;  4GCZ A;  5HDD A;  4EV4 A;  4X55 A;  3UE0 A;  2G7U A;  4RA7 A;  3CPT B;  2A49 A;  4DXB A;  3O86 A;  5DKK A;  3CUE A;  1K57 C;  3UY6 A;  3M6H A;  3AGE A;  2VEA A;  3F1P A;  4XXR A;  4YOF A;  2VV8 A;  5L07 A;  2INW A;  4DE0 A;  1LLB A;  3N7W A;  3MSH A;  3DTM A;  5HWW A;  1PWD A;  3E98 A;  4H6J B;  1W7F A;  3IF5 A;  1T1C A;  1YLT A;  1OJ5 A;  4EXO A;  2WAE A;  1PI4 A;  2ZC7 A;  3SS5 A;  3H82 A;  3S22 A;  3SH9 A;  3JVV A;  2M7V A;  1K57 A;  3C4O A;  4LFU A;  3HJK A;  2L1M A;  1H0M A;  4DKI A;  4BBT A;  1MKM A;  4PHT A;  4I39 A;  5HL1 A;  1NRF A;  2HF6 A;  4I3J A;  1FQG A;  3E0Y A;  2FH5 A;  4FUW A;  3G30 A;  3QP5 A;  4G3V A;  4Y15 A;  5TGF A;  1N9L A;  3C38 A;  5K5B A;  1O7E A;  3K3D A;  1VM1 A;  2JE5 A;  2D02 A;  2QKP A;  2B18 A;  3HJI A;  5AVE A;  2Z2L B;  2O99 A;  4IVK A;  2A2L A;  2ZBB A;  3V3R A;  2WKE A;  3Q7Z A;  3ZG0 A;  2JKG A;  4D2O A;  4GKU A;  1PFL A;  3ZYT A;  1YPR A;  4OOY A;  5F1G A;  1TDG A;  4PM8 A;  2I72 A;  3NDG A;  3VE3 A;  3W8K A;  3ICY A;  3S7N A;  4GHI A;  1BUE A;  4UQI M;  2ZMV A;  4LV2 A;  3HL9 A;  1KVL A;  1OT9 A;  3B42 A;  1QMF A;  5HDS A;  3VE4 A;  4IUH A;  4S2N C;  3HLC A;  1JWV A;  2NUP C;  1XJ2 A;  3MBZ A;  1L2S A;  2G2W A;  3ZQ5 A;  1BLS A;  4I3I A;  4HIA A;  1XPB A;  2AVX A;  1VET B;  2WUQ A;  1S67 L;  3HUM A;  4HH3 A;  3ZGA B;  1K55 A;  4P6B A;  4KG5 A;  4S2N A;  4PKY A;  4BLM A;  1L0E A;  5AQ9 A;  5DF9 A;  1YT4 A;  4LLO B;  3FWL A;  3L7H A;  1TEM A;  4NXB A;  5EOE A;  2HZ5 A;  5CER A;  2QPN A;  2Z6D A;  3IH9 A;  5J3W A;  3NEC A;  2ZJ9 A;  5J7E A;  4KQD A;  4KZA A;  1MPL A;  3C4P A;  4Q0H A;  4R3A A;  5AVF A;  5EM1 A;  3PXP A;  2W3E A;  3RFB A;  4N9L A;  1SHV A;  1LI9 A;  5TR7 A;  4CPK A;  4S2L A;  1LL9 A;  4R6L A;  2OAQ 1;  2VLG A;  1VEU A;  1FIK A;  2H10 A;  1IEL A;  1I2S A;  3IHB A;  3BM6 A;  3CLO A;  3NJA A;  2EWV A;  3IF6 C;  1U60 A;  2HPB A;  5AJG A;  5U47 A;  1ERQ A;  1KGG A;  4IED A;  1MXO A;  5J4E A;  1YMS A;  1FCO A;  1E4D A;  5FQQ A;  4ZDX A;  5KSH A;  1Y54 A;  1BLP A;  2QMI A;  2PR5 A;  3A3D A;  1CI8 A;  3IQA A;  3AGD A;  5EE8 A;  3BRM A;  5EM0 A;  4ZJ2 A;  3IXH A;  5FL3 A;  4UEY A;  2B02 A;  1HD8 A;  3UDI A;  2OLV A;  4LRY C;  4JXW A;  4O7D A;  1T19 A;  5FQ9 A;  4EWF A;  2JHE A;  3LYX A;  1IYS A;  4WN5 A;  3E2K A;  1JVJ A;  1K4E A;  3IF6 A;  5TBM B;  2X02 A;  2H28 A;  3FPW A;  1OME A;  4XT2 B;  3W4Q A;  1S1Y A;  2O9B A;  2I9V A;  5M19 A;  3Q7V A;  4CJN A;  1XJ3 A;  2PYR A;  4LV3 A;  4OPZ A;  3BQA A;  2Y2N A;  3VOL A;  2Y2G A;  1MBL A;  2V1B A;  2W3G A;  3VOY A;  3A3J A;  2XRO A;  4XUX A;  1SKF A;  1N9O A;  3GRJ A;  2Y79 A;  1EW0 A;  2PBD P;  3MZD A;  4JGP A;  5AQA A;  5L10 A;  1OTI A;  2X01 A;  4QWO A;  1YSP A;  2G2U A;  3ZVT A;  4HHD A;  2XQZ A;  2YKH A;  3SH7 A;  2P08 A;  1E25 A;  3UB5 P;  2VK3 A;  3Q1F A;  3S7O A;  2W0N A;  5FI2 A;  3CPT A;  4NET A;  4HEF A;  1IOU A;  1YSQ A;  1OPX A;  3HLF A;  4UQI S;  3MQ0 A;  5KZH A;  4DMZ A;  3A3E A;  2XFT A;  3NUL A;  4GDB A;  3FC7 A;  1W63 M;  3I7J A;  2C5W B;  4IBX A;  4GHI B;  4KG2 A;  5DFY A;  4GNU A;  3B33 A;  3EGD C;  5J8X A;  4F94 A;  2H0Y A;  4H6J A;  5EUA A;  4OQH A;  1I2W A;  2GNX A;  3W4P A;  4HJ4 A;  4GOG A;  5A8B A;  3PYP A;  5G18 A;  5CGW A;  2V1Z A;  1ES3 A;  2QYB A;  3RXX A;  2ZOI A;  4Z1W A;  2L4R A;  3VV4 A;  4MDZ A;  4G3W A;  4KEN B;  5CHJ A;  5EFW A;  4EQ1 A;  2EXA A;  2V8C A;  3G4P A;  2XF3 A;  1ZKJ A;  2ZLY A;  1OTD A;  2B5R A;  3NHQ A;  2XD5 A;  1HLU P;  3VP4 A;  4EUZ A;  1SDE A;  3B47 A;  4E04 A;  1CI9 A;  3EGX C;  2PDR A;  2VKS A;  4FH2 A;  2QJ7 A;  2ZQ7 A;  3HLE A;  1F5M A;  5M1A A;  3IWI A;  4JBF A;  5F82 A;  4DE3 A;  1S4S A;  4PPR A;  4BJP A;  5HPF A;  3SS3 A;  2KLI A;  3OZH A;  1BSG A;  3IWQ A;  4CLC E;  3VFH A;  3R4K A;  3CWF A;  2JKR I;  4OPY A;  3G2Z A;  4L9G A;  1VB6 A;  5F5Y A;  3WS1 A;  1ZC2 A;  3FV7 A;  1QME A;  4WZ4 A;  4E3I A;  1CEF A;  3ZG9 B;  1V9Z A;  1KE4 A;  4DDS A;  4ARZ B;  3VMA A;  2HDS A;  3V39 A;  2EX9 A;  4YWZ A;  3BFG A;  4U0T A;  5G4Z A;  1VET A;  4Z9Q A;  1GSV A;  4WYY A;  4R23 A;  3MF0 A;  1NLY A;  1GSX A;  2R9W A;  1OTB A;  4HH2 A;  5HDC A;  1DP8 A;  3F1O A;  3EEA A;  1W63 Q;  3O87 A;  3PTE A;  3LI9 A;  2EX6 A;  3G6O A;  4E3K A;  2HJ9 C;  1DJC A;  5DVA A;  3VSL A;  4S2J A;  2Y55 A;  4QHC A;  2V9A A;  1PZP A;  2RCX A;  4S2O A;  2LB9 A;  3LIC A;  4F3L A;  4B93 A;  4OH0 A;  3O5Y A;  3KSG A;  3LID A;  4WF0 A;  3QP4 A;  3Q7V B;  3S1Y A;  3TSG A;  3DWZ A;  2WGW B;  2Y2H A;  4KZ5 A;  2W3D A;  3KX0 X;  3CUE C;  4Y0O A;  2PAV P;  1OT6 A;  2Q9M A;  3DW0 A;  4JGQ A;  2NUT C;  5FI7 A;  3GDI A;  4UA7 A;  4ETZ A;  2DRW A;  5EEC A;  5HX9 A;  1JWZ A;  4QPR A;  3V5M A;  1IYO A;  3N8R A;  4OQ0 A;  3UPO A;  3HUO A;  5FI6 A;  2A3U A;  1G68 A;  4WMC A;  4DE1 A;  2ZOH A;  1K6S A;  3T1R A;  5FQM A;  3NCK A;  2UV0 E;  4S2K A;  5L8M A;  1WYC A;  1W8Q A;  3BFC A;  3KSF A;  4MCW A;  3KO6 A;  3IWO A;  3NOP C;  3QP1 A;  4WZ5 C;  2PD7 A;  2OSU A;  5EVI D;  1XA7 A;  2OOL A;  4R38 A;  3W4O A;  2ZL1 A;  3CG5 A;  5TBM A;  1ES2 A;  4MN6 A;  3C8C A;  4GZB A;  4XT2 A;  4X6T A;  5DF8 A;  1S66 L;  4HNB A;  4ESP A;  3OOV A;  2QWS A;  1M40 A;  5HWT A;  4P0M A;  4FSF A;  5MC7 A;  1DJA A;  4KQR A;  5TJJ A;  1LL5 A;  3WS5 A;  4WZ5 A;  3CZD A;  4P87 A;  3N8L A;  2J3T D;  2OLU A;  1L0G A;  4DF6 A;  3DBA A;  1W79 A;  4NG2 A;  4Y13 A;  2Y2P A;  4NKP A;  4X53 A;  2ZQD A;  2V20 A;  3IHA A;  4LRX C;  5FAS A;  2Y8H A;  4Q0J A;  4BMW A;  3W2Z A;  3MMH A;  3BY9 A;  3QP6 A;  3WRZ A;  1ESU A;  1KE0 A;  4M3K A;  2QJ5 A;  5G4Y A;  1FR1 A;  2WYX A;  1NLZ A;  2BTF P;  1TS6 A;  3LGO A;  4PM6 A;  1YLY A;  3K3C A;  4E6X A;  1ONH A;  4A5R A;  1E3U A;  1WA9 A;  3LFV A;  4R70 A;  3EQU A;  2GZA A;  2V0U A;  3SZT A;  3T4S A;  1OTA A;  5IU1 A;  4B4X A;  2PYP A;  1FOF A;  1K55 C;  4CLC B;  2Z6C A;  1N9N A;  1YAX A;  2ZD8 A;  3Q07 A;  5IT5 A;  4IBR A;  3T4K A;  3NBL A;  2WKI A;  3A3F A;  5CHU A;  4G3K A;  2VZW A;  3VP0 A;  4ZBE A;  1GHP A;  1X0O A;  4K08 A;  3UNW A;  3GR2 A;  2C6W B;  1BZA A;  2ZQC A;  2EFU A;  3OBF A;  2MJ6 A;  2HV1 A;  1MKI A;  1DRM A;  3WRT A;  2V2F F;  3Q81 A;  3UPN A;  1PZO A;  4JXS A;  3OLO A;  4OON A;  3EEH A;  3LY3 A;  1LI0 A;  2VJW A;  4GJ4 A;  1NY0 A;  4R4S A;  3BLM A;  4X1L A;  2ZQ8 A;  3F1O B;  4WM9 A;  1JTG A;  1F2K A;  3G31 A;  1H3Q A;  2A24 B;  4EES A;  5L09 A;  3N8S A;  4NXG A;  2Q9N A;  1PWC A;  3IBR A;  5A91 A;  1XKZ A;  2WGI A;  1K54 A;  3T1S A;  3MXR A;  3LCE A;  4E3O A;  2GDN A;  4F3L B;  5IHV A;  3IT9 A;  1P9W A;  4NEE D;  1IKG A;  1RGZ A;  3LO7 A;  4JXV A;  4N1X A;  3V67 A;  4B4Z A;  3UMD A;  3H9W A;  5FEG A;  1GHI A;  4HI4 A;  3S7P A;  4JKT A;  1SZV A;  2WKR A;  4JGO A;  3VOZ A;  4KZB A;  3ZHH A;  2M7U A;  1DY6 A;  1K38 A;  1G6A A;  2OAP 1;  5GLB A;  4BBU A;  3LR0 A;  4ARZ A;  3ZNT A;  4N92 A;  1I5Q A;  2YKF A;  3ZG7 B;  3HLW A;  4OKP A;  3FYZ A;  5EVL A;  4GD6 A;  5EVE A;  1FSW A;  3BW6 A;  4OP8 A;  1H8Z A;  4FOF A;  2ZQA A;  2VA0 A;  1K56 A;  2JKR M;  1IFQ A;  2KDK A;  2Q0O A;  5D3O A;  4QJG A;  3SH8 A;  4E3J A;  2PHY A;  2ZC3 B;  4LRZ E;  1XX2 A;  4ZRR A;  1NYY A;  3CI6 A;  4R3B A;  2DCF A;  4QY6 A;  3MKE A;  5CEB A;  1GHM A;  4BEN A;  4EEP A;  1GSW A;  2B95 A;  1LSW A;  4WEK A;  4X69 A;  4MEZ A;  3BFE A;  4U0X A;  3LEQ A;  1PIO A;  1PI5 A;  2ZL1 B;  4OPR A;  4E3M A;  1P97 A;  3OPH A;  1M6K A;  1ONG A;  3HCY A;  4DN0 A;  3FZC A;  3ZNY A;  1YLW A;  4MLL A;  4S2I A;  2EXB A;  1HVB A;  2QZ6 A;  4I5S A;  4DJ2 A;  1YLZ A;  3T4L A;  4ID4 A;  3ZCZ A;  2OWH A;  3U4L P;  2WGW A;  1G28 A;  4GW9 A;  2ZMA A;  4R3J A;  4PM7 A;  2P9V B;  1KDS A;  2GJ3 A;  4R0Q A;  1AWI A;  4H8R A;  1LSV A;  1YLJ A;  4S2P A;  1K6R A;  4YIN A;  2K7S A;  2Z2M B;  5E43 A;  4PM5 A;  3MXS A;  5FAT A;  3FPV A;  1W5D A;  4Y17 A;  4QD4 A;  2VV7 A;  4MBH A;  3LUQ A;  2J80 A;  1P0Z A;  3QP2 A;  1KOU A;  2OWJ A;  4EET B;  3NI9 A;  1XJ4 A;  1ERO A;  2IA2 A;  4QY5 A;  3T1Q B;  1KGF A;  3UB7 A;  2O9A A;  3TOI A;  5BOH A;  2E8I A;  3E4P A;  4MBK A;  4NXF A;  4ZTK A;  3AGF A;  1TS7 A;  2WAF A;  1MC0 A;  3IH8 A;  5L2F A;  3M2K A;  3BFF A;  3UO9 A;  4P6Z M;  4O8G A;  1FCN A;  5F1F A;  4OLD A;  1DP9 A;  3CAX A;  1FIL A;  2R9X A;  4BWI A;  1K0K A;  2RL3 A;  2WKQ A;  2V1A A;  5HL6 A;  1BTL A;  3OCN A;  1V9Y A;  3C7U A;  2EX8 A;  3E4Q A;  1H8Y A;  4R1G A;  1NRJ A;  3OC2 A;  4YNR A;  1H8M A;  3OCL A;  2ZMF A;  2JKF A;  1MWR A;  4JGR A;  3NC8 A;  1YKD A;  3TRC A;  4E3N A;  4DXC A;  5CRF A;  3RH8 B;  4CLC C;  1MY8 A;  2XRN A;  4KZ7 A;  1VHM A;  1GCE A;  3MS6 A;  2WK0 A;  2H0T A;  2Y2K A;  5GHZ A;  3UDF A;  1L0F A;  4KZ3 A;  1UWN X;  4K91 A;  3R7W B;  3V3S A;  3MQQ A;  1ESI A;  5FAO A;  4BL2 A;  3OPL A;  5FAQ A;  1OJG A;  1PW8 A;  2HJE A;  2HDR A;  4X68 A;  4ME4 A;  3C5A A;  5FA7 A;  4CLC A;  2PRF A;  5EPH A;  1AXB A;  3IX3 A;  2P74 A;  5DFX A;  1TS8 A;  4MMN A;  2CMN A;  3PAG A;  2Y2M A;  2V0W A;  4GDN A;  2W1R A;  1J9M A;  4Y7P A;  4EW7 A;  3NOT C;  2ZC5 B;  2VGL S;  3EWK A;  1Q2P A;  4DJ3 A;  2ZM2 A;  5HD3 A;  4RQ9 A;  3WWX A;  1W8Y A;  5FAP A;  4LPZ A;  2WKP A;  2K2N A;  5HSQ A;  2HP5 A;  3IXG A;  2O9C A;  4GD8 A;  5EV0 A;  1S6R A;  4OOL A;  3FG8 A;  4L9F A;  3ITA A;  5AQB A;  4OP5 A;  2ZM0 A;  1WYB A;  5DF7 A;  2A24 A;  4X56 A;  3KSH A;  1KGE A;  1DJB A;  1JTD A;  3K2N A;  3E4O A;  4Y2F A;  2KX6 A;  4CQH A;  1IEM A;  4XUZ A;  3NY4 A;  2W27 A;  4ZJ1 A;  3MXQ A;  2XGN A;  1P9R A;  3D72 A;  1L3L A;  4ZJ3 A;  2BAS A;  2Y2J A;  3MFD A;  4O0P A;  2HGV A;  2PR6 A;  3BYD A;  4KZ9 A;  3UPP A;  1TVF A;  2VGJ A;  3P98 A;  2L0W A;  3BQ8 A;  3T4O A;  2UWX A;  2M1C A;  3RXW A;  3LIB A;  1N4O A;  5HAI A;  2PD8 A;  4S2M A;  5E2G A;  3HBR A;  3TW8 A;  5I5L A;  3SOI A;  2J8Y A;  3QNC A;  5FDS A;  1MWS A;  2W3F A;  2XFS A;  2XEP A;  2J7V A;  5C5K A;  1FR6 A;  2VGK A;  5HW3 A;  1ALQ A;  3VP2 A;  2IWB A;  3LIF A;  1XA1 A;  2QHK A;  2JCH A;  3O88 A;  5KMW A;  4EER A;  2DNS A;  5CX7 A;  2XA7 M;  1KVM A;  3UB8 A;  4EUV A;  3HLB A;  3HLG A;  5EOO A;  4WEL A;  5TFQ A;  3EQV A;  4N1H A;  3PBO A;  4P6Z S;  2P7J A;  4NK3 A;  4WEJ A;  5GLA A;  1FCM A;  3LR4 A;  3BEC A;  3MFX A;  4B88 A;  3IXD A;  1XFQ A;  4X25 A;  3T50 A;  3SS4 A;  4HBT A;  1VQQ A;  2XH9 A;  1K25 A;  1ZHH B;  4WMC D;  3MR0 A;  1CK3 A;  4Y5F A;  4YFM A;  3CHW P;  4QU3 A;  3NDE A;  1OTE A;  2IWD A;  1Q2Q A;  3GMW A;  3FKW A;  2P9V A;  2XR0 A;  3UE1 A;  4Q0I A;  1D7E A;  3ITB A;  2H5S A;  4RYE A;  1NWZ A;  3A0R A;  3JYI A;  2JKT I;  5GLC A;  3P7N A;  3UE3 A;  1PRQ A;  3IS2 B;  3RTY A;  1A0K A;  3D9Y A;  3KYQ A;  1PW1 A;  3PBS A;  3T1X A;  3PBN A;  4MN7 A;  1ZG4 A;  4DRT A;  2BLS A;  3GTC A;  1LL8 A;  3GVB A;  3S7Q A;  1NZO A;  4GS9 A;  2FFF B;  2HDQ A;  3G35 A;  1MWU A;  3MZF A;  1NJ4 A;  3UB6 A;  4HJ6 A;  4KZ8 A;  4KG6 A;  3GSG A;  2Y2I A;  2PT7 A;  1PNE A;  3A0V A;  3KYZ A;  1SKO A;  1HZO A;  2XK1 A;  4C75 A; 
#chains in the Genus database with same CATH homology
 3H7W A;  2QYB A;  2ZOI A;  4EEP A;  1GSW A;  4Z1W A;  2L4R A;  3VV4 A;  4MDZ A;  4G3W A;  4I3A A;  1LSW A;  4B9O A;  4HP4 A;  4WEK A;  2VV6 A;  5EFW A;  4EQ1 A;  1XFN A;  4O01 A;  1UGU A;  3UB9 A;  1OTD A;  4M4X A;  3NHQ A;  3PBR A;  3B47 A;  2J3T C;  4E04 A;  3EGX C;  2PDR A;  2VKS A;  3LIE A;  5HZH A;  1P97 A;  1ODV A;  2QJ7 A;  4HJ3 A;  3HCY A;  4DN0 A;  4KQO A;  1F5M A;  3T4T A;  3PBT A;  1S4S A;  4BJP A;  5HPF A;  4I5S A;  5F69 A;  4L9E A;  4DJ2 A;  1UWP X;  3T4L A;  5HPI A;  4GCZ A;  2OWH A;  2KLI A;  1G28 A;  5HDD A;  4GW9 A;  2G7U A;  2GJ3 A;  4CLC E;  1TD5 A;  3R4K A;  5DKK A;  3CUE A;  3MQO A;  3CWF A;  2JKR I;  1LSV A;  3PR6 A;  1DP6 A;  4L9G A;  2VEA A;  1VB6 A;  2O0Y A;  3F1P A;  2K7S A;  1F9I A;  4KUO A;  4YOF A;  5F5Y A;  2D01 A;  3R7W A;  3FPV A;  2W1T A;  2VV8 A;  3F1N B;  3KSI A;  2INW A;  2VV7 A;  3LUQ A;  1V9Z A;  2J80 A;  1P0Z A;  5HWW A;  1KOU A;  4ARZ B;  3E98 A;  2OWJ A;  4EET B;  4H6J B;  4YWZ A;  1T1C A;  1XJ4 A;  1OJ5 A;  2IA2 A;  4EXO A;  5G4Z A;  4WL9 A;  3UB7 A;  1T18 A;  3H82 A;  1GSV A;  2O9A A;  4MN5 A;  3MF0 A;  1NLY A;  3E4P A;  1GSX A;  3JVV A;  1OTB A;  4NXF A;  4HH2 A;  2M7V A;  5HDC A;  3MJQ A;  1DP8 A;  3HJK A;  3BWL A;  3EOI A;  2L1M A;  1TS7 A;  3F1O A;  4KUK A;  4BBT A;  1MC0 A;  1MKM A;  3EEA A;  1LT0 A;  4PHT A;  1W63 Q;  4I39 A;  4P6Z M;  5DJU A;  2HF6 A;  4I3J A;  3E0Y A;  2FH5 A;  4O8G A;  3LI9 A;  4PKY G;  1MZU A;  4NXE A;  3G6O A;  1DP9 A;  4G3V A;  2HJ9 C;  3CAX A;  3SW1 A;  4BWI A;  1N9L A;  3C38 A;  5K5B A;  2XA7 S;  2WKQ A;  3K3D A;  2V1A A;  2D02 A;  2QKP A;  3OCN A;  5HL6 A;  2V9A A;  1V9Y A;  2VGL M;  3U2A A;  2B18 A;  3A0S A;  3HJI A;  3E4Q A;  2LB9 A;  3LIC A;  5AVE A;  1NRJ A;  4F3L A;  4B93 A;  2O99 A;  4WLA A;  4II7 A;  2A2L A;  2ZBB A;  3OC2 A;  4YNR A;  3O5Y A;  3KSG A;  1H8M A;  3LID A;  4WF0 A;  3OCL A;  4IHQ A;  2ZMF A;  1D06 A;  4JGR A;  3ZYT A;  1ZTU A;  1YKD A;  4HY8 A;  3TRC A;  1TF1 A;  3UE6 A;  4EU0 A;  2W3D A;  3C30 A;  3VE3 A;  3KX0 X;  3LIA A;  3CUE C;  3ICY A;  2EWW A;  3RH8 B;  3S7N A;  4CLC C;  4GHI A;  4I38 A;  2XRN A;  4HQA A;  1OT6 A;  4JGQ A;  4UQI M;  2ZMV A;  2NUT C;  3GDI A;  1VHM A;  4ETZ A;  1OT9 A;  3B42 A;  1STZ A;  5HDS A;  4QPR A;  3VE4 A;  4IUH A;  3F1P B;  2J3W A;  2NUP C;  1UWN X;  3R7W B;  3IBJ A;  5HD5 A;  3JVU A;  3BJN A;  3MQQ A;  1XJ2 A;  5DJT A;  2ZOH A;  4GLQ A;  5L8M A;  3ZQ5 A;  1OJG A;  4I3I A;  2HJE A;  3P01 A;  4HIA A;  3H82 B;  4ME4 A;  4CLC A;  5HWV A;  3KSF A;  1S67 L;  4MCW A;  1F98 A;  4HH3 A;  3KO6 A;  5DFX A;  3NOP C;  1TS8 A;  4MMN A;  2CMN A;  2V0W A;  4PKY A;  2XSS A;  2PD7 A;  2W1R A;  4GS9 B;  2OOL A;  4R38 A;  5TBM A;  5DF9 A;  1XJ6 A;  4MN6 A;  3NOT C;  4EW7 A;  3C8C A;  4LLO B;  4OOM A;  2VGL S;  3EWK A;  4NXB A;  4XT2 A;  4DJ3 A;  5HD3 A;  2Z6D A;  4RQ9 A;  3PBQ A;  4LPZ A;  1S66 L;  2WKP A;  2K2N A;  4HNB A;  5HSQ A;  3OOV A;  2O9C A;  2QWS A;  5HWT A;  5J3W A;  4OOL A;  4FSF A;  3FG8 A;  4KQD A;  4L9F A;  5J7E A;  5MC7 A;  5TJJ A;  4Q0H A;  3H7W B;  4R3A A;  2A24 A;  1BYW A;  5AVF A;  3KSH A;  3PXP A;  3K2N A;  2W3E A;  3RFB A;  3E4O A;  3ULF A;  2J3T D;  4Y2F A;  2KX6 A;  4CQH A;  3DBA A;  2W27 A;  4NKP A;  2LB5 A;  3MXQ A;  4LRX C;  1P9R A;  3D72 A;  3C2W A;  5F6A A;  2Y8H A;  4Q0J A;  4BMW A;  3W2Z A;  3MMH A;  4R6L A;  3BY9 A;  2OAQ 1;  2VLG A;  2BAS A;  3LR3 A;  4AFI A;  4O0P A;  2HGV A;  2PR6 A;  2KOI A;  2QJ5 A;  5G4Y A;  1NLZ A;  1TS6 A;  3CLO A;  2L0W A;  3BQ8 A;  3T4O A;  3NJA A;  2EWV A;  2M1C A;  3IS2 A;  3K3C A;  5AJG A;  3UME A;  3LIB A;  3TJZ C;  2PD8 A;  1WA9 A;  5J4E A;  3LFV A;  3TW8 A;  4R70 A;  3EQU A;  2GZA A;  5I5L A;  2V0U A;  4IJG A;  5KSH A;  3T4S A;  1OTA A;  2PR5 A;  2W3F A;  5IU1 A;  2PYP A;  5C5K A;  2R78 A;  1S1Z A;  4CLC B;  4Y3I A;  2Z6C A;  1N9N A;  1YAX A;  2EA9 A;  2DMW A;  5FL3 A;  5IT5 A;  4UEY A;  2B02 A;  3LI8 A;  3LIF A;  4LRY C;  1T19 A;  2W1T B;  3T4K A;  2JHE A;  2QHK A;  3LYX A;  5KIZ A;  2JKT M;  4G3K A;  4WN5 A;  2VZW A;  4EEU A;  4EER A;  5TBM B;  5CX7 A;  1X0O A;  4ETX A;  4K08 A;  2XA7 M;  3UB8 A;  4EUV A;  2H28 A;  3FPW A;  4XT2 B;  3OBF A;  2MJ6 A;  2HV1 A;  1DRM A;  1S1Y A;  2O9B A;  4WEL A;  2I9V A;  3OLO A;  1XJ3 A;  2PYR A;  3EQV A;  3NOU C;  3EEH A;  2W3H A;  2VJW A;  4GJ4 A;  3BQA A;  3PBO A;  3VOL A;  4P6Z S;  2P7J A;  3F1O B;  4WEJ A;  3LR4 A;  4HOI A;  3MFX A;  2V1B A;  2W3G A;  3GEC A;  4WUJ A;  1H3Q A;  2A24 B;  4EES A;  1XFQ A;  4NXG A;  2XRO A;  1N9O A;  3T50 A;  2Y79 A;  1EW0 A;  4JGP A;  3CIT A;  3IBR A;  1OTI A;  1T1B A;  3LR5 A;  1YSP A;  1ZHH B;  4L0L A;  4PAU A;  3BY8 A;  3MR0 A;  4IUK A;  4HHD A;  5F68 A;  2YKH A;  2K31 A;  4Y5F A;  2P08 A;  1OTE A;  4F3L B;  3TE8 A;  1P9W A;  1TS0 A;  3S7O A;  4NEE D;  4HP9 A;  2JN7 A;  5IS1 A;  4Q0I A;  1G6O A;  1D7E A;  3V67 A;  2W0N A;  2GX5 A;  3D3O A;  1NWZ A;  3PHY A;  3A0R A;  2JKT I;  3P7N A;  3UE3 A;  3IS2 B;  3T4Q A;  1LSX A;  3RTY A;  4CLC D;  1IOU A;  3KYQ A;  1T1A A;  1YSQ A;  3UMD A;  3H9W A;  3PBS A;  2P04 A;  1OPX A;  3PBN A;  4MN7 A;  4UQI S;  3MQ0 A;  5LBR A;  4HI4 A;  4DMZ A;  3S7P A;  1LL8 A;  2WKR A;  4JGO A;  3FC7 A;  2M7U A;  1W63 M;  5DFY A;  3F1N A;  4GHI B;  3S7Q A;  2OAP 1;  3B33 A;  3T4J A;  3EGD C;  4BBU A;  4GS9 A;  3UB6 A;  3LR0 A;  4ARZ A;  1JNU A;  4H6J A;  4HJ6 A;  4BBV A;  2YKF A;  1S4R A;  2GNX A;  2PT7 A;  1Y28 A;  3BW6 A;  2FZ0 A;  5DKL A;  4FOF A;  4HJ4 A;  2VA0 A;  2JKR M;  1IFQ A;  2KDK A;  3PYP A;  5A8B A;  3A0V A;  3KYZ A;  2VX8 A;  2PHY A;  4LRZ E;  4ZRR A;  3CI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...