1MZUA

Crystal structure of the photoactive yellow protein domain from the sensor histidine kinase ppr from rhodospirillum centenum
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
107
Chain Sequence
IDTAEFDALPVGAIQVDGSGVIHRYNRTESRLSGRIPERVIGRNFFTEVAPCTNIPAFSGRFMDGVTSGTLDARFDFVFDFQMAPVRVQIRMQNAGVPDRYWIFVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PPR
publication title Crystal Structure of a Photoactive Yellow Protein from a Sensor Histidine Kinase: Conformational Variability and Signal Transduction
pubmed doi rcsb
source organism Rhodospirillum centenum
total genus 27
structure length 107
sequence length 110
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1mzuA00
3FC7A 1T1BA 2WKPA 1N9NA 1VB6A 2PYRA 2Z6DA 4WF0A 4R3AA 4LRYC 1OTAA 3MFXA 1OT9A 3F1PB 3F1NA 2L1MA 1X0OA 3BY8A 3NOPC 2YKFA 2ZBBA 1G28A 4I38A 4KUKA 2WKRA 4PKYG 4I5SA 5G4ZA 2Z6CA 1OTIA 2HV1A 4HP9A 3H82A 4GW9A 2M1CA 1N9OA 5DKLA 1OJGA 3LI8A 3MQOA 3IS2B 3CAXA 3K3CA 4JGPA 1DP6A 1TS7A 3BY9A 4R70A 3OLOA 3VE3A 3F1NB 1S67L 4R38A 2JHEA 3PYPA 1Y28A 2VV7A 5KIZA 3A0RA 1NWZA 2CMNA 1LSWA 1WA9A 3F1OA 4NXFA 4EXOA 2QJ7A 3NOTC 3VE4A 5F6AA 4GS9A 3H7WA 4HJ4A 1OTBA 3E4OA 1F98A 4KQDA 3H82B 5A8BA 4DJ3A 1S66L 5IS1A 4WLAA 4RQ9A 2D01A 3UMDA 3MQQA 4MN6A 4HI4A 1P97A 1LL8A 5HD5A 3HJIA 4BBUA 4EEPA 4LRZE 1UGUA 4I3AA 4L9GA 2ZOIA 4GHIA 3E4QA 1GSXA 4L9EA 4EETB 3LICA 2V1BA 1XJ4A 4HJ3A 1DP9A 1T19A 3NJAA 4HH2A 4KUOA 3F1OB 2VEAA 3UB6A 4NXBA 1OTDA 2PHYA 3EWKA 4WL9A 2GJ3A 1GSWA 2EA9A 1GSVA 5HSQA 4GS9B 3VOLA 3H7WB 1V9YA 2OOLA 5F68A 4BBVA 1LSXA 4F3LA 5HWVA 4GCZA 4XT2A 5TBMB 1JNUA 3NHQA 3UB7A 4HIAA 5HDDA 4EESA 4JGOA 2OWJA 2L0WA 4NXEA 1MZUA 4GHIB 4R6LA 4YWZA 5EFWA 3MR0A 2BASA 5F69A 1P0ZA 3B33A 4HOIA 5I5LA 4HQAA 3RH8B 1S4RA 2OWHA 2QJ5A 3C2WA 5J3WA 3KX0X 3LUQA 1V9ZA 4EW7A 2V9AA 4H6JA 4K08A 1OT6A 2YKHA 2KDKA 1T18A 3C8CA 4F3LB 1D7EA 1OTEA 5AVFA 4XT2B 4WN5A 1T1AA 5G4YA 3GDIA 2QHKA 4EEUA 1BYWA 2VV8A 3F1PA 2K7SA 4I39A 3H9WA 2WKQA 5AVEA 1D06A 2W27A 3LIBA 4B9OA 2PYPA 3T50A 3EEHA 4HNBA 3UB8A 2D02A 1XJ6A 4E04A 4LLOB 4DJ2A 1LSVA 2QWSA 4H6JB 1XJ2A 2J80A 3ICYA 3D72A 1UWNX 2QKPA 1TS8A 2V0UA 5DJUA 4EERA 1EW0A 4PKYA 5IU1A 3SW1A 3LIFA 3MXQA 2PR6A 2ZOHA 3PHYA 5HD3A 3UE6A 3G6OA 4HY8A 3A0VA 3LI9A 1OJ5A 4I3JA 5HWTA 2P7JA 2I9VA 2PD8A 4NXGA 1S1ZA 1XFNA 3LIAA 1N9LA 2W0NA 2H28A 3K3DA 1F9IA 2PD7A 1DRMA 1T1CA 4WUJA 5HZHA 1S1YA 4LRXC 3FG8A 3CLOA 3BWLA 4MN5A 4JGRA 1ODVA 2A24A 3CWFA 3IBRA 1LT0A 4M4XA 1UWPX 4HH3A 1XFQA 2PDRA 4BBTA 5F5YA 3UB9A 2V0WA 3LIDA 3LIEA 2L4RA 2JN7A 4HJ6A 3A0SA 5J4EA 2R78A 5J7EA 1DP8A 1TS6A 2VLGA 4L9FA 3ZQ5A 3LYXA 2KX6A 5HDCA 3MJQA 5HWWA 2V1AA 3E4PA 2PR5A 3NOUC 2INWA 4LPZA 1KOUA 4JGQA 3GECA 3P7NA 3HJKA 3UMEA 2A24B 4HP4A 5TBMA 3ULFA 5DKKA 4EQ1A 2B02A 1TS0A 5DJTA 1XJ3A 2VV6A 4HHDA 3RTYA 5HDSA 3IS2A 4I3IA 1S4SA
chains in the Genus database with same CATH superfamily
3FC7A 1T1BA 1ALQA 2NUPC 5CGSA 1N9BA 3MFXA 3R7WA 3MKEA 3F1NA 3ISGA 3HVFA 1YT4A 3BY8A 4YOFA 4MEZA 2ZLYA 5M19A 1H8YA 1NXYA 1G28A 4I38A 3UDFA 5CEDA 4I5SA 4UQIM 3S22A 2Q9NA 2Z6CA 1AXBA 5HX9A 2HV1A 4HP9A 5FL3A 2H0TA 1XGIA 2VJWA 1K55C 4E3OA 2GDNA 3BFEA 1EROA 4GOGA 2ZQDA 3CAXA 4NG2A 1H5XA 1BTLA 4GZBA 3T4OA 4X1LA 1YPRA 1GCEA 3LR4A 1DP6A 2WYXA 4R70A 3MS6A 1VEUB 3FZCA 4KG5A 1J9MA 2WGWB 2W3GA 3VE3A 4RVAA 3MZEA 2HP9A 3MKFA 4N9KA 3MXSA 2VV7A 3V39A 5A92A 1YMXA 5CHUA 3PBOA 3SS4A 1LSWA 2PU4A 1PW8A 4S2PA 4KQQA 3VE4A 3BJNA 5F6AA 1LLBA 4EUZA 4IBXA 3OPLA 3DWZA 3B42A 4MMNA 2BG1A 4DJ3A 2FH5A 2EX2A 4RQ9A 3GSGA 3SZTA 3G32A 3MQQA 1Y4OA 2GZAA 1LL8A 5HD5A 2XQZA 1UGUA 3RXWA 3UPOA 3PAEA 2ZOIA 5DTSA 4GD6A 3C4OA 3BYDA 1YAXA 1Z6FA 2Q0OA 2W3FA 2PT7A 3ZVWA 1YLJA 5L8MA 2AVXA 2G2WA 4HJ3A 4HESA 1XA1A 4HH2A 2WAFA 3PBQA 4E3IA 5FEFA 2JE5A 3HLBA 3EWKA 4RX3A 2B5RA 3HLCA 4EBLA 3IBJA 4GS9B 1M40A 3FKWA 4Z9QA 5EUAA 3MF0A 2Y2PA 2OOLA 5F68A 1NYYA 4Y0TA 1LL5A 4S2OA 4S2JA 4DRTA 4Y7PA 1K55A 3T4SA 3BFCA 4GDNA 4CPKA 3NHQA 3RJUA 4B93A 3UB7A 2QYBA 4LENA 1E3UA 4EESA 3IF6C 4JGOA 2JKTI 4NXEA 4S2NC 4GHIB 3C4PA 2ZM0A 1YLYA 2OSUA 5GLAA 1BLPA 4CLCD 1BT5A 4KZ6A 2DRWA 5E43A 3FPVA 2OWHA 5C5KA 2JBFA 4ESPA 3BFFA 5LBRA 3QHYA 1HVBA 2ZQ7A 3VP4A 2OLVA 4HBTA 1Q2QA 1V9ZA 3G2YA 3A3DA 4EW7A 5EPHA 3TRCA 4S2IA 1SKFA 1VQQA 3UB5P 1OTEA 4OONA 4S2KA 2HDQA 2VX8A 4XT2B 2EX8A 3TJZC 1VM1A 3C38A 1T1AA 5G4YA 5FAOA 4OPQA 3E2KA 3S7NA 2K7SA 4I39A 4WBGA 1IYSA 4F94A 5FAQA 2W27A 5FEGA 3W4OA 2HF6A 1H0MA 3WS2A 1YMSA 2XLNA 4OH0A 3PXPA 2O9AA 1Q2PA 1VETA 1ONGA 4FUWA 2EX6A 2J8YA 3QP2A 3PAGA 3CG5A 5GL9A 4DJ2A 1LSVA 1DY6A 3A3IA 3OC2A 3ICYA 4Y15A 3WS5A 5HAIA 1TS8A 1ES3A 2JCHA 2E8IA 1U60A 3CITA 2VGKA 4II7A 3KSGA 2JKFA 3CUEC 4PKYA 2Y2LA 3SW1A 1GHIA 3MXQA 2PR6A 5FDHA 2ZOHA 5TFQA 3UE6A 4HY8A 5JYOA 4UQIS 3IXGA 3A3EA 3IF6A 2PRFA 2ZM8A 3N8LA 5CGXA 4S2NA 1SHVA 3MZFA 1S1ZA 2W0NA 1SKOB 2H28A 2E8JA 2V2FF 2ZC5B 2XROA 3OOVA 3PBRA 3VFHA 2PD7A 1ESIA 1WYCA 2VK3A 3CLOA 3NDGA 3FWLA 2Y2QA 1ODVA 1KVMA 3IXBA 5J8XA 3IBRA 5GHXA 3GQZA 4FSFA 5EVEA 5L09A 2Y2JA 4WZ5A 1XFQA 3TG9A 1N4OA 3CJMA 2ZC7A 3ZDJA 5F5YA 3SH9A 2L4RA 3MQ0A 4E3JA 4O8GA 5J4EA 3RXXA 3Q82A 2EWWA 1DP8A 4BWIA 5JYPA 5EV0A 3T1RA 1MC0A 3A3JA 4L9FA 1S0WA 1MKIA 3DTKA 2KX6A 5D3OA 3LCEA 1DJCA 2PAVP 2V8FA 2WKHA 3WS4A 3MMHA 1ZC2A 2INWA 1ERMA 1L2SA 3LY3A 4WZ4A 3UO9A 4KENB 1BLCA 4QB8A 4E3LA 4DF6A 5FQ9A 4BJPA 2UV0E 4HP4A 4H8RA 4E3NA 3L9KA 3KYQA 2Q9MA 1KE4A 1MWRA 3CUEA 1NZOA 2VGJA 3GV9A 2H5SA 2Z2MB 2JC7A 4HHDA 3K2NA 3RTYA 2X02A 3IS2A 2HJEA 4P6ZM 4OPZA 1YM1A 2IWBA 2BLSA 2WKPA 4EV4A 4R3JA 4R4SA 1O7EA 3QP6A 4WF0A 4R3AA 2JKTM 1OTAA 1NYMA 1MXOA 4PM6A 1ZG4A 1IKGA 4ZJ2A 4Z1WA 3HUMA 4O7DA 2EXBA 1RCJA 1H8MA 2WKRA 4PKYG 2C5WB 3QP8A 1OTIA 2OAQ1 3PR6A 2PBDP 4X53A 2WUQA 3UNWA 5AQAA 2XDMA 3OZHA 4GW9A 1LL9A 1OJGA 3LI8A 5EM1A 1M6KA 3K3CA 1RGZA 3VOZA 3UDXA 1H8ZA 3BY9A 2WZXA 5DFYA 3LEQA 3GVBA 1TF1A 4B88A 3R7WB 3F1NB 1FSYA 3DBAA 1S67L 2EFXA 4R38A 2JHEA 1K56A 4KZ9A 1Y28A 4QY6A 2V20A 4GJ4A 3A0RA 3JPUA 3HLDA 2CMNA 1WA9A 1FILA 3P98A 4KQOA 1K6SA 3BFGA 3NOTC 4WM9A 4CLCB 3BQAA 2M7UA 4LFUA 1F98A 3DTEA 4KQDA 5AQBA 4MN7A 3T1SA 1S6RA 1S66L 2B95A 4WLAA 5EVLA 3IX3A 3AGEA 5EE8A 3UMDA 3N6IA 4MN6A 3HJIA 4LRZE 4PPRA 3PBSA 4I3AA 4FH2A 3BW6A 1IKIA 1GSXA 1PYYA 4E3MA 3IHBA 1TEMA 5CHMA 2RCXA 2V8CA 1I5QA 3OBFA 1DP9A 1T19A 3N8SA 1PI5A 5M1AA 3V5MA 5KSCA 1CI9A 3PBTA 3ZG9B 2VEAA 3ITAA 4NXBA 4N9LA 3NULA 3TSGA 4DE0A 2GJ3A 2EA9A 4NETA 2O99A 5FI7A 5HSQA 5L2FA 3VOLA 4UA7A 4IUHA 3UN7A 5U47A 1MWSA 3ZG7B 4Y0OA 4FH4A 1P9RA 2ZMVA 1P9WA 3HLGA 4F3LA 4GCZA 5CGWA 2EX9A 2KLIA 2JKRI 5F1GA 1ZTUA 4C3QA 4HIAA 5FDSA 1W63M 4B4XA 4OQIA 3HUOA 2L0WA 2W3HA 1ESUA 1MZUA 4R6LA 3UY6A 2X01A 3D3OA 4KZ7A 3SH8A 4WEJA 3R4KA 4EU0A 2RL3A 2XFTA 1TDLA 4HOIA 5FQIA 4CQHA 3JVVA 3RH8B 4BD0A 4BL2A 4WMCD 1KDWA 2XR0A 5CRFA 5FSRA 4DXCA 3KX0X 1MWTA 2XH9A 1CK3A 4H6JA 2LB9A 3C8CA 4HBUA 5EVIC 4IEDA 4WN5A 2XEPA 3U2AA 1K56D 3IX4A 3VSLA 3ZGAB 3HBRA 3MZDA 4OOYA 2ZM2A 4P6BA 4C6YA 4S2LA 1AWIA 1Y54A 4UA9A 4ZTKA 3KSHA 1FQGA 3LIBA 3IT9A 4ZRRA 5FQQA 3T1QB 3T50A 1G68A 2DMWA 1BSGA 2Y59A 3EEHA 3LGOA 2XF3A 3KYZA 3G2ZA 4LLOB 2QWSA 5CX7A 5FAPA 1ONHA 2K31A 2V0UA 1QMEA 4IJGA 2HP6A 3C30A 4A5RA 3NDEA 3N8RA 5HD3A 3NY4A 3O5YA 1FR1A 3GTCA 1PIOA 3S4XA 2IWCA 1OJ5A 4PHTA 4ZAMA 2K2NA 3Q1FA 1PZOA 5FQMA 2PD8A 4GLQA 3UE3A 3KO6A 3FYZA 4MDZA 5GLDA 3SH7A 1PRQA 5GHYA 4EQIA 4LV1A 5DFXA 3N4IA 1VETB 4G3VA 4DN0A 1JWVA 3BWLA 4MN5A 4Y2FA 1JTDA 2HDUA 2VGLS 4PM9A 4X56A 1D1JA 3CWFA 3MXRA 3HL9A 4M4XA 3C7VA 1TD5A 4M3KA 5GHZA 5EVIA 5IT5A 4BBTA 5L07A 2V0WA 3IF6B 4WZ5C 4XUXA 4HJ6A 1W7FA 4OQ0A 2ZC3B 4OOMA 3EQVA 4O01A 2OV5A 3BECA 3ZQ5A 3LYXA 1H3QA 2J3TC 3MJQA 1RP5A 1JVJA 2XA7M 4JXGA 2J9PA 1XP4A 3E4PA 1YLTA 3DAVA 4N1HA 4R23A 1I2WA 3T4LA 3ZG0A 4MNRA 2HGVA 4ZDXA 2ZQAA 3ULFA 3VFFA 1JWPA 2Y79A 4QD4A 1CEGA 5FQKA 1SDEA 4U0TA 4JF5A 4E6XA 5DF8A 4E3KA 1QMFA 3C5AA 2EWVA 4UHUA 3EEAA 3IHAA 3GMWA 3N7WA 2JKRM 4E6WA 3VMAA 1N9NA 4O0PA 2O9BA 2PYRA 2Z6DA 2PU2A 4Q0JA 4LRYC 3F1PB 4RYEA 1FCOA 5HPIA 3T4TA 4K0XA 3EOIA 3NOPC 3S1YA 2H10A 4GDBA 1CQAA 2WK0A 4LV0A 4X6TA 4KQRA 1LI9A 4KUKA 3Q7VA 1WE4A 5G4ZA 2QZ6A 2OLUA 4DE2A 3L7HA 4R3BA 4OOLA 1NY0A 3CHWP 2LB5A 1GA9A 2VZWA 5F82A 3H82A 2ZL1B 3UDIA 3W8KA 1K0KA 3ZNYA 2VA0A 3ZCZA 5DKLA 1E3UD 4CLCE 5I94A 3V50A 3DTMA 1WYBA 1F5MA 3VOYA 4KZAA 3MQOA 3IS2B 5G18A 3C7UA 4PM8A 4JGPA 2ZD8A 3QP5A 3OLOA 2DNSA 5CTMA 4DE3A 1FCMA 3JVUA 4OKPA 3ZG5A 2A3UA 3W2ZA 4ZJ3A 3PYPA 2B18A 1NWZA 4FD8A 3T12B 3F1OA 2HDRA 3VP1A 3FKVA 5EVID 4EXOA 4BLMA 4Y5FA 3ZVTA 2QJ7A 4WEKA 3H7WA 4HJ4A 1IYQA 3E4OA 2WAEA 4ARZA 5A8BA 3HLWA 5IS1A 1YKDA 2ZC6B 4NEED 1PNEA 1K57C 1XXMA 3DTIA 4HI4A 1P97A 4EUVA 4BBUA 4U0XA 3WWXA 3JYIA 3S7OA 3I7JA 4DE1A 3O88A 3E4QA 1JWZA 3BLSA 4EETB 3GRJA 3LICA 3HUNA 2V1BA 1XJ4A 2P04A 1KGEA 3HLFA 3NJAA 3W4PA 3CPTB 1PWGA 3UB6A 5CHJA 1DJBA 5A93A 3HLEA 1OTDA 3WS1A 5GLCA 2ZC4B 3V3RA 1PI4A 4BENA 1DJAA 1HLUP 2Y2HA 1BLHA 1GA0A 3NI9A 1L0GA 1PWCA 1L0DA 1XPBA 5TBMB 1JNUA 3M2JA 1XA7A 3M6HA 5HDDA 1IFQA 1F2KA 5F83A 1Z09A 5EFWA 3G30A 2BASA 2HJ9C 5HW3A 3BFDA 4FTXA 4GB7A 3TE8A 2W1TA 1PW1A 2J7VA 3E98A 4NKPA 5I5LA 4EWFA 1STZA 4JLFA 1NJ4A 3VSKA 4BMWA 5CECA 4BD1A 3LR0A 3LR5A 4ID4A 3SOIA 4X68A 3C2WA 5J3WA 1ES5A 3LY4A 4R0QA 2HZ5A 5CXWA 3NIAA 3P09A 2V9AA 4K08A 2YKHA 3QNBA 1ERQA 2P9VA 1T18A 3O86A 4F3LB 1D7EA 1I2SA 5AVFA 2MJ6A 4JF6A 1K57A 4X55A 5EM0A 4RX2A 1K4EA 2J3TD 2QHKA 4EEUA 1OPXA 1LHYA 2Y2OA 2VV8A 5AJGA 2O9CA 3AGDA 5FQJA 4ZBEA 3T4KA 5AVEA 4P0MA 5BOHA 4QU3A 1KVLA 2Z2LB 3NC8A 2EXAA 2D02A 3CMZA 5HFOA 3IWIA 2WKEA 1G6OA 3ITBA 5DVAA 4H6JB 1XJ2A 2J80A 3D72A 1UWNX 4Y3IA 4LCLA 4YNRA 5DJUA 5E2FA 5CERA 1EW0A 3T4QA 1E4DA 5IU1A 4DKIA 2HDSA 3G6OA 4DDYA 3LI9A 3ZNTA 3KSIA 5HWTA 1K54C 3QNCA 1ACFA 2G2UA 1PWDA 1YLWA 2QMIA 1N9LA 2WGIA 5FA7A 2FFYA 2G7UA 2Y91A 3K3DA 4LCMA 4U3TA 4OPYA 2UWXA 1MWUA 4CLCA 4XXRA 2XSSA 1S1YA 1KE0A 4WYYA 5AQ9A 4LRXC 3MBZA 1NRFA 5HL1A 3P01A 4JXVA 2V1ZA 2FZ0A 2KOIA 2A24A 4Y0UA 1FIKA 1W5DA 3MSHA 5TGFA 1FSWA 3PTEA 1ZG6A 4HH3A 2WADA 2R9XA 1CI8A 5KMWA 3BQ8A 2J3WA 2PDRA 4PM7A 3UE0A 4KG2A 3E0YA 2R78A 2ACGA 5J7EA 4PAUA 2W1RA 1TS6A 4QY5A 2VLGA 3Q7ZA 2P74A 4S2MA 5HDCA 4YINA 5HWWA 2P08A 3M2KA 1CJFA 1NZUA 2DCFA 2Y55A 3ZG8B 1NLZA 3U4LP 1KOUA 5HAPA 1FCNA 3O3VA 3GECA 3HJKA 4P6ZS 3WRZA 3KSFA 4C75A 5DKKA 4EQ1A 3IWQA 5DJTA 3FV7A 1XJ3A 5EVIB 2VV6A 5K5BA 2PBYA 4I3IA 5TJJA 3VP3A 1GHPA 3IXDA 1W63Q 1K54A 4OLGA 2BTFP 3IQAA 4R4RA 1PZPA 1VB6A 4P87A 1VEUA 1L3LA 3Q81A 2WGWA 3D4FA 2A49A 1OT9A 3HCYA 3LFVA 2L1MA 1X0OA 3MFDA 3CZDA 2YKFA 3ZHHA 3IWOA 4GNUA 4OVDA 3V67A 2IA2A 3WRTA 4Y13A 2JKGA 3B3XA 1W79A 2ZBBA 4YFMA 1A0KA 1IEMA 4CJNA 1ES2A 1OMEA 4MBHA 2HPBA 1XX2A 3G31A 3CI6A 4RA7A 3G35A 2M1CA 5KSHA 1N9OA 4EBPA 4QWOA 5FI2A 1K38A 3S7PA 1HTZA 5TR7A 1GHMA 5DTTA 2Y8HA 1TS7A 4OP5A 1K6RA 2XK1A 4ETXA 4JKTA 4ETZA 4PMAA 3AGFA 4K0WA 1MKMA 5KIZA 1FOFA 3NCKA 3IH8A 5CEBA 2W3DA 4OLDA 4KZ3A 4OP8A 4NXFA 1YSQA 1KE3A 3Q7VB 3EGDC 4UEYA 2Y2NA 4GS9A 3DW0A 4Q0IA 2Y2MA 3ZFZA 3S7QA 1OTBA 1MPLA 5M18A 3TOIA 3H82B 2Y2GA 5DF9A 5FI6A 4BL3A 2GX5A 4MLLA 4LGWA 2EFUA 2D01A 1L0EA 3T1XA 4EEPA 4OQGA 4L9GA 3QP1A 4GHIA 3GR2A 5IHVA 4L9EA 3UE1A 4N92A 1ZHHB 1K25A 4OQHA 4KUOA 3F1OB 4MCWA 3A3FA 2PHYA 4WL9A 1YLZA 1GSWA 4Q8IA 2XRNA 3OCLA 1GSVA 4JXWA 4AFIA 3H7WB 1V9YA 1CEFA 1PFLA 5DTKA 5HAQA 2Y2IA 4IVKA 3IH9A 4KZ8A 4ARZB 4BBVA 4JBFA 2IWDA 3NBLA 1LSXA 5HWVA 4KZ4A 1TDGA 4XT2A 1SZVA 1W8YA 3DWKA 4MBKA 2ZJ9A 4GKUA 2WZZA 4IHQA 2M7VA 4Q0HA 5FATA 3G4PA 2OWJA 3B47A 4YWZA 2ZQ9A 5EOEA 3MR0A 5F69A 4GD8A 1P0ZA 3OCNA 3B33A 3EQUA 4X69A 4IVIA 4HQAA 4PM5A 2ZMAA 1YLPA 3D9YA 1S4RA 3LO7A 2ZQCA 4D60A 4WELA 2XGNA 1JTGA 1MBLA 4QHCA 2QJ5A 3OPPA 5GLBA 2QPNA 3LUQA 4G3WA 5KZHA 4JF4A 1OT6A 2KDKA 3BLMA 4R1GA 4FCFA 3W4QA 1ZKJA 1L0FA 4HEFA 2C6WB 4KZ5A 5A90A 3GDIA 2WKIA 4OPRA 2I72A 4KG6A 3BM6A 2XD5A 4ME4A 1BYWA 4JXSA 3KYEA 3F1PA 5FASA 3H9WA 3RFBA 3SS3A 3HREA 5E2GA 1O07A 2WKQA 3T4JA 1D06A 2W1TB 4UA6A 4XUZA 2ZMFA 1SKOA 4B9OA 2PYPA 3Q07A 4GN2A 4P85A 3E2LA 2ZQ8A 4HNBA 1IYPA 3UB8A 3OPHA 5F1FA 5HL6A 3PBNA 1XJ6A 2ZL1A 5MC7A 3UPPA 2XD1A 4E04A 1SDNA 1HD8A 1YSPA 1LI0A 5AQ7A 2NUTC 2QKPA 2P9VB 5EOOA 4QPRA 5L10A 1IOUA 1KGFA 1NRJA 4EERA 3V3SA 2CC1A 4BQMA 1CF0A 3LIFA 4IBRA 2GNXA 2R9WA 4X25A 3PHYA 4MBFA 1J3WA 3VP2A 5DF7A 3A0VA 1HZOA 3G34A 1SCWA 1C3BA 2H0YA 1K4FA 4I3JA 2P7JA 2I9VA 3VV4A 4DMZA 1BULA 1W8QA 2J9OA 4NXGA 1XFNA 1BUEA 3LIAA 4N1XA 1YQSA 1IELA 5CTNA 3M6BA 2VKSA 1MY8A 1F9IA 3EGXC 3BRMA 1DRMA 1T1CA 4WUJA 5HZHA 1BZAA 3IF5A 5EECA 1E25A 3FG8A 4LV3A 4CLCC 1KGGA 3BEBA 4JGRA 1IYOA 4WMCA 2OAP1 3QP4A 4DDSA 3FPWA 1LT0A 1ES4A 4K91A 1UWPX 3VP0A 2O0YA 2Y4AA 1TVFA 4Y17A 4IUKA 3UB9A 3LIDA 3LIEA 3UPNA 3ZYTA 3OPRA 2XA7S 2JN7A 2VGLM 2FFFB 3A0SA 2A2LA 4LV2A 4JPMA 1XGJA 1G6AA 1EI5A 2Y2KA 4B4ZA 1VHMA 5HPFA 1G5UA 3CPTA 3LEZA 3IX8A 4UAAA 1BLSA 3SS5A 5A91A 1NLYA 2WGVA 2V1AA 1XKZA 1RGYA 3WS0A 2PR5A 3IXHA 3NOUC 4KZBA 4L0LA 5E2HA 1FR6A 2W3EA 4NK3A 4LPZA 3NECA 4FOFA 4G3KA 4JGQA 3P7NA 5E2EA 5HARA 2X71A 3UMEA 4QJGA 1KDSA 2A24B 5TBMA 4EBNA 2XFSA 3LR3A 1EWZA 4DXBA 2B02A 4X1MA 1TS0A 3TW8A 3O87A 4ZJ1A 2HP5A 5HDSA 1S4SA 4D2OA
chains in the Genus database with same CATH topology
2HJEA 4P6ZM 3FC7A 2JKRM 1T1BA 1W63Q 2WKPA 1N9NA 2NUPC 4O0PA 1VB6A 2O9BA 2PYRA 2Z6DA 4WF0A 4Q0JA 4R3AA 2JKTM 4LRYC 1OTAA 3MFXA 1OT9A 3R7WA 3HCYA 3F1PB 3F1NA 3LFVA 2L1MA 1X0OA 5HPIA 3T4TA 3EOIA 3BY8A 3NOPC 4YOFA 2YKFA 3V67A 2IA2A 4Z1WA 2ZBBA 1G28A 4I38A 4KUKA 1H8MA 2WKRA 4PKYG 4I5SA 5G4ZA 4UQIM 2Z6CA 1OTIA 2OAQ1 4OOLA 3PR6A 3CI6A 2LB5A 2HV1A 2VZWA 4HP9A 3H82A 5FL3A 4GW9A 2M1CA 5KSHA 1N9OA 2VA0A 2VJWA 5DKLA 4CLCE 1OJGA 3LI8A 1F5MA 3S7PA 3MQOA 3IS2B 3CAXA 3K3CA 2Y8HA 3T4OA 3LR4A 4JGPA 1DP6A 1TS7A 3BY9A 4R70A 3OLOA 5DFYA 4ETXA 3JVUA 2W3GA 3VE3A 1TF1A 4ETZA 3R7WB 3F1NB 3DBAA 1S67L 4R38A 3W2ZA 2JHEA 3PYPA 1MKMA 1Y28A 2VV7A 5KIZA 4GJ4A 3A0RA 2B18A 1NWZA 2CMNA 3PBOA 2W3DA 1LSWA 1WA9A 3F1OA 4KQOA 4NXFA 4EXOA 1YSQA 4Y5FA 2QJ7A 4WEKA 3NOTC 3VE4A 3EGDC 3BJNA 5F6AA 4CLCB 4UEYA 4GS9A 3BQAA 2M7UA 4Q0IA 3H7WA 4HJ4A 3S7QA 1OTBA 3E4OA 3B42A 4MMNA 1F98A 4KQDA 3H82B 4MN7A 5DF9A 4ARZA 5A8BA 2GX5A 4DJ3A 1S66L 2FH5A 5IS1A 1YKDA 4WLAA 4NEED 4RQ9A 2D01A 3UMDA 3MQQA 4MN6A 4HI4A 2GZAA 1P97A 1LL8A 5HD5A 3HJIA 4EUVA 4BBUA 4EEPA 3S7OA 4LRZE 3PBSA 1UGUA 4I3AA 3BW6A 4L9GA 2ZOIA 4GHIA 3E4QA 1GSXA 4L9EA 1YAXA 2W3FA 4EETB 2PT7A 3LICA 2V1BA 5L8MA 1XJ4A 2P04A 3OBFA 4HJ3A 1ZHHB 1DP9A 1T19A 3NJAA 4HH2A 3PBTA 4KUOA 3F1OB 3PBQA 2VEAA 4MCWA 3UB6A 4NXBA 1OTDA 2PHYA 3EWKA 4WL9A 2GJ3A 1GSWA 2EA9A 2XRNA 3IBJA 2O99A 3OCLA 1GSVA 5HSQA 4GS9B 4AFIA 3VOLA 3H7WB 1V9YA 4IUHA 3MF0A 1P9RA 4ARZB 2OOLA 5F68A 4BBVA 2ZMVA 1P9WA 1LSXA 4F3LA 5HWVA 4GCZA 2KLIA 4XT2A 2JKRI 5TBMB 1JNUA 3T4SA 1ZTUA 3NHQA 4B93A 4IHQA 4HIAA 3UB7A 2QYBA 2M7VA 4Q0HA 5HDDA 1IFQA 1W63M 4JGOA 4EESA 2OWJA 2JKTI 3B47A 2L0WA 4NXEA 2W3HA 1MZUA 4GHIB 4R6LA 4YWZA 5EFWA 3D3OA 4WEJA 3R4KA 4EU0A 4CLCD 3MR0A 2BASA 5F69A 2HJ9C 1P0ZA 3OCNA 3TE8A 2W1TA 3B33A 3EQUA 3E98A 4NKPA 4HOIA 5I5LA 4HQAA 4CQHA 1STZA 3JVVA 3RH8B 1S4RA 4BMWA 3FPVA 2OWHA 5C5KA 4WELA 3LR0A 5LBRA 3LR5A 2QJ5A 3C2WA 5J3WA 3KX0X 3LUQA 4G3WA 1V9ZA 4EW7A 2V9AA 4H6JA 4K08A 1OT6A 3TRCA 2YKHA 2LB9A 2KDKA 1T18A 3C8CA 4F3LB 1D7EA 1OTEA 5AVFA 2VX8A 4XT2B 2MJ6A 4WN5A 3U2AA 3TJZC 3C38A 1T1AA 2J3TD 3GDIA 5G4YA 2QHKA 4EEUA 1OPXA 4ME4A 3S7NA 1BYWA 2VV8A 3F1PA 2K7SA 4I39A 3H9WA 5AJGA 3RFBA 2O9CA 3T4KA 2WKQA 5AVEA 3T4JA 1D06A 2W1TB 2W27A 3KSHA 3LIBA 2ZMFA 4ZRRA 2HF6A 4B9OA 2PYPA 3T50A 2DMWA 3EEHA 2O9AA 3PXPA 4HNBA 3UB8A 5HL6A 2D02A 3KYZA 1XJ6A 3PBNA 5MC7A 1G6OA 4E04A 4LLOB 4DJ2A 1LSVA 2QWSA 1YSPA 4H6JB 5CX7A 1XJ2A 2J80A 3ICYA 3OC2A 2NUTC 1UWNX 2QKPA 3D72A 4Y3IA 1TS8A 2K31A 2V0UA 4YNRA 4QPRA 5DJUA 1IOUA 4IJGA 3CITA 1NRJA 4EERA 4II7A 3KSGA 3CUEC 1EW0A 3T4QA 3C30A 4PKYA 5IU1A 3SW1A 3LIFA 2GNXA 3MXQA 2PR6A 2ZOHA 3PHYA 5HD3A 3UE6A 3G6OA 4HY8A 3O5YA 3A0VA 3LI9A 4UQIS 3KSIA 1OJ5A 4I3JA 4PHTA 5HWTA 2K2NA 2P7JA 2I9VA 3VV4A 4DMZA 2PD8A 4GLQA 3UE3A 3KO6A 4NXGA 1S1ZA 1XFNA 3LIAA 1N9LA 4MDZA 2W0NA 2G7UA 2H28A 3K3DA 2XROA 2VKSA 3OOVA 1F9IA 3PBRA 5DFXA 4CLCA 3EGXC 2PD7A 2XSSA 1DRMA 1T1CA 4WUJA 4G3VA 1S1YA 5HZHA 4DN0A 4LRXC 3FG8A 3P01A 3CLOA 3BWLA 4MN5A 4CLCC 4Y2FA 4JGRA 2FZ0A 1ODVA 2KOIA 2A24A 2VGLS 2OAP1 3CWFA 3IBRA 3FPWA 1LT0A 4M4XA 1UWPX 1TD5A 4FSFA 4HH3A 2O0YA 1XFQA 5IT5A 3BQ8A 2J3WA 2PDRA 4BBTA 5F5YA 4IUKA 3UB9A 2V0WA 3LIDA 3LIEA 2L4RA 3MQ0A 4O8GA 3ZYTA 2XA7S 2JN7A 2VGLM 4HJ6A 3A0SA 5J4EA 2A2LA 3E0YA 2R78A 5J7EA 4PAUA 4OOMA 2EWWA 1DP8A 1VHMA 2W1RA 4BWIA 5HPFA 3EQVA 4O01A 1TS6A 1MC0A 2VLGA 4L9FA 3ZQ5A 3LYXA 1H3QA 2KX6A 1NLYA 5HDCA 2J3TC 3MJQA 5HWWA 2P08A 2V1AA 2XA7M 3E4PA 2PR5A 3MMHA 3NOUC 2INWA 4L0LA 2W3EA 1NLZA 4LPZA 1KOUA 4FOFA 4G3KA 4JGQA 3T4LA 3GECA 3P7NA 3HJKA 2HGVA 4P6ZS 3UMEA 4BJPA 2A24B 4HP4A 5TBMA 3KSFA 3ULFA 3LR3A 5DKKA 4EQ1A 2Y79A 3KYQA 2B02A 1TS0A 5DJTA 3TW8A 3CUEA 1XJ3A 2VV6A 5K5BA 2EWVA 4HHDA 3K2NA 3RTYA 5HDSA 3IS2A 3EEAA 4I3IA 5TJJA 1S4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FC7 A;  1T1B A;  2WKP A;  1N9N A;  1VB6 A;  2PYR A;  2Z6D A;  4WF0 A;  4R3A A;  4LRY C;  1OTA A;  3MFX A;  1OT9 A;  3F1P B;  3F1N A;  2L1M A;  1X0O A;  3BY8 A;  3NOP C;  2YKF A;  2ZBB A;  1G28 A;  4I38 A;  4KUK A;  2WKR A;  4PKY G;  4I5S A;  5G4Z A;  2Z6C A;  1OTI A;  2HV1 A;  4HP9 A;  3H82 A;  4GW9 A;  2M1C A;  1N9O A;  5DKL A;  1OJG A;  3LI8 A;  3MQO A;  3IS2 B;  3CAX A;  3K3C A;  4JGP A;  1DP6 A;  1TS7 A;  3BY9 A;  4R70 A;  3OLO A;  3VE3 A;  3F1N B;  1S67 L;  4R38 A;  2JHE A;  3PYP A;  1Y28 A;  2VV7 A;  5KIZ A;  3A0R A;  1NWZ A;  2CMN A;  1LSW A;  1WA9 A;  3F1O A;  4NXF A;  4EXO A;  2QJ7 A;  3NOT C;  3VE4 A;  5F6A A;  4GS9 A;  3H7W A;  4HJ4 A;  1OTB A;  3E4O A;  1F98 A;  4KQD A;  3H82 B;  5A8B A;  4DJ3 A;  1S66 L;  5IS1 A;  4WLA A;  4RQ9 A;  2D01 A;  3UMD A;  3MQQ A;  4MN6 A;  4HI4 A;  1P97 A;  1LL8 A;  5HD5 A;  3HJI A;  4BBU A;  4EEP A;  4LRZ E;  1UGU A;  4I3A A;  4L9G A;  2ZOI A;  4GHI A;  3E4Q A;  1GSX A;  4L9E A;  4EET B;  3LIC A;  2V1B A;  1XJ4 A;  4HJ3 A;  1DP9 A;  1T19 A;  3NJA A;  4HH2 A;  4KUO A;  3F1O B;  2VEA A;  3UB6 A;  4NXB A;  1OTD A;  2PHY A;  3EWK A;  4WL9 A;  2GJ3 A;  1GSW A;  2EA9 A;  1GSV A;  5HSQ A;  4GS9 B;  3VOL A;  3H7W B;  1V9Y A;  2OOL A;  5F68 A;  4BBV A;  1LSX A;  4F3L A;  5HWV A;  4GCZ A;  4XT2 A;  5TBM B;  1JNU A;  3NHQ A;  3UB7 A;  4HIA A;  5HDD A;  4EES A;  4JGO A;  2OWJ A;  2L0W A;  4NXE A;  1MZU A;  4GHI B;  4R6L A;  4YWZ A;  5EFW A;  3MR0 A;  2BAS A;  5F69 A;  1P0Z A;  3B33 A;  4HOI A;  5I5L A;  4HQA A;  3RH8 B;  1S4R A;  2OWH A;  2QJ5 A;  3C2W A;  5J3W A;  3KX0 X;  3LUQ A;  1V9Z A;  4EW7 A;  2V9A A;  4H6J A;  4K08 A;  1OT6 A;  2YKH A;  2KDK A;  1T18 A;  3C8C A;  4F3L B;  1D7E A;  1OTE A;  5AVF A;  4XT2 B;  4WN5 A;  1T1A A;  5G4Y A;  3GDI A;  2QHK A;  4EEU A;  1BYW A;  2VV8 A;  3F1P A;  2K7S A;  4I39 A;  3H9W A;  2WKQ A;  5AVE A;  1D06 A;  2W27 A;  3LIB A;  4B9O A;  2PYP A;  3T50 A;  3EEH A;  4HNB A;  3UB8 A;  2D02 A;  1XJ6 A;  4E04 A;  4LLO B;  4DJ2 A;  1LSV A;  2QWS A;  4H6J B;  1XJ2 A;  2J80 A;  3ICY A;  3D72 A;  1UWN X;  2QKP A;  1TS8 A;  2V0U A;  5DJU A;  4EER A;  1EW0 A;  4PKY A;  5IU1 A;  3SW1 A;  3LIF A;  3MXQ A;  2PR6 A;  2ZOH A;  3PHY A;  5HD3 A;  3UE6 A;  3G6O A;  4HY8 A;  3A0V A;  3LI9 A;  1OJ5 A;  4I3J A;  5HWT A;  2P7J A;  2I9V A;  2PD8 A;  4NXG A;  1S1Z A;  1XFN A;  3LIA A;  1N9L A;  2W0N A;  2H28 A;  3K3D A;  1F9I A;  2PD7 A;  1DRM A;  1T1C A;  4WUJ A;  5HZH A;  1S1Y A;  4LRX C;  3FG8 A;  3CLO A;  3BWL A;  4MN5 A;  4JGR A;  1ODV A;  2A24 A;  3CWF A;  3IBR A;  1LT0 A;  4M4X A;  1UWP X;  4HH3 A;  1XFQ A;  2PDR A;  4BBT A;  5F5Y A;  3UB9 A;  2V0W A;  3LID A;  3LIE A;  2L4R A;  2JN7 A;  4HJ6 A;  3A0S A;  5J4E A;  2R78 A;  5J7E A;  1DP8 A;  1TS6 A;  2VLG A;  4L9F A;  3ZQ5 A;  3LYX A;  2KX6 A;  5HDC A;  3MJQ A;  5HWW A;  2V1A A;  3E4P A;  2PR5 A;  3NOU C;  2INW A;  4LPZ A;  1KOU A;  4JGQ A;  3GEC A;  3P7N A;  3HJK A;  3UME A;  2A24 B;  4HP4 A;  5TBM A;  3ULF A;  5DKK A;  4EQ1 A;  2B02 A;  1TS0 A;  5DJT A;  1XJ3 A;  2VV6 A;  4HHD A;  3RTY A;  5HDS A;  3IS2 A;  4I3I A;  1S4S A; 
#chains in the Genus database with same CATH topology
 3FC7 A;  1T1B A;  1ALQ A;  2NUP C;  5CGS A;  1N9B A;  3MFX A;  3R7W A;  3MKE A;  3F1N A;  3ISG A;  3HVF A;  1YT4 A;  3BY8 A;  4YOF A;  4MEZ A;  2ZLY A;  5M19 A;  1H8Y A;  1NXY A;  1G28 A;  4I38 A;  3UDF A;  5CED A;  4I5S A;  4UQI M;  3S22 A;  2Q9N A;  2Z6C A;  1AXB A;  5HX9 A;  2HV1 A;  4HP9 A;  5FL3 A;  2H0T A;  1XGI A;  2VJW A;  1K55 C;  4E3O A;  2GDN A;  3BFE A;  1ERO A;  4GOG A;  2ZQD A;  3CAX A;  4NG2 A;  1H5X A;  1BTL A;  4GZB A;  3T4O A;  4X1L A;  1YPR A;  1GCE A;  3LR4 A;  1DP6 A;  2WYX A;  4R70 A;  3MS6 A;  1VEU B;  3FZC A;  4KG5 A;  1J9M A;  2WGW B;  2W3G A;  3VE3 A;  4RVA A;  3MZE A;  2HP9 A;  3MKF A;  4N9K A;  3MXS A;  2VV7 A;  3V39 A;  5A92 A;  1YMX A;  5CHU A;  3PBO A;  3SS4 A;  1LSW A;  2PU4 A;  1PW8 A;  4S2P A;  4KQQ A;  3VE4 A;  3BJN A;  5F6A A;  1LLB A;  4EUZ A;  4IBX A;  3OPL A;  3DWZ A;  3B42 A;  4MMN A;  2BG1 A;  4DJ3 A;  2FH5 A;  2EX2 A;  4RQ9 A;  3GSG A;  3SZT A;  3G32 A;  3MQQ A;  1Y4O A;  2GZA A;  1LL8 A;  5HD5 A;  2XQZ A;  1UGU A;  3RXW A;  3UPO A;  3PAE A;  2ZOI A;  5DTS A;  4GD6 A;  3C4O A;  3BYD A;  1YAX A;  1Z6F A;  2Q0O A;  2W3F A;  2PT7 A;  3ZVW A;  1YLJ A;  5L8M A;  2AVX A;  2G2W A;  4HJ3 A;  4HES A;  1XA1 A;  4HH2 A;  2WAF A;  3PBQ A;  4E3I A;  5FEF A;  2JE5 A;  3HLB A;  3EWK A;  4RX3 A;  2B5R A;  3HLC A;  4EBL A;  3IBJ A;  4GS9 B;  1M40 A;  3FKW A;  4Z9Q A;  5EUA A;  3MF0 A;  2Y2P A;  2OOL A;  5F68 A;  1NYY A;  4Y0T A;  1LL5 A;  4S2O A;  4S2J A;  4DRT A;  4Y7P A;  1K55 A;  3T4S A;  3BFC A;  4GDN A;  4CPK A;  3NHQ A;  3RJU A;  4B93 A;  3UB7 A;  2QYB A;  4LEN A;  1E3U A;  4EES A;  3IF6 C;  4JGO A;  2JKT I;  4NXE A;  4S2N C;  4GHI B;  3C4P A;  2ZM0 A;  1YLY A;  2OSU A;  5GLA A;  1BLP A;  4CLC D;  1BT5 A;  4KZ6 A;  2DRW A;  5E43 A;  3FPV A;  2OWH A;  5C5K A;  2JBF A;  4ESP A;  3BFF A;  5LBR A;  3QHY A;  1HVB A;  2ZQ7 A;  3VP4 A;  2OLV A;  4HBT A;  1Q2Q A;  1V9Z A;  3G2Y A;  3A3D A;  4EW7 A;  5EPH A;  3TRC A;  4S2I A;  1SKF A;  1VQQ A;  3UB5 P;  1OTE A;  4OON A;  4S2K A;  2HDQ A;  2VX8 A;  4XT2 B;  2EX8 A;  3TJZ C;  1VM1 A;  3C38 A;  1T1A A;  5G4Y A;  5FAO A;  4OPQ A;  3E2K A;  3S7N A;  2K7S A;  4I39 A;  4WBG A;  1IYS A;  4F94 A;  5FAQ A;  2W27 A;  5FEG A;  3W4O A;  2HF6 A;  1H0M A;  3WS2 A;  1YMS A;  2XLN A;  4OH0 A;  3PXP A;  2O9A A;  1Q2P A;  1VET A;  1ONG A;  4FUW A;  2EX6 A;  2J8Y A;  3QP2 A;  3PAG A;  3CG5 A;  5GL9 A;  4DJ2 A;  1LSV A;  1DY6 A;  3A3I A;  3OC2 A;  3ICY A;  4Y15 A;  3WS5 A;  5HAI A;  1TS8 A;  1ES3 A;  2JCH A;  2E8I A;  1U60 A;  3CIT A;  2VGK A;  4II7 A;  3KSG A;  2JKF A;  3CUE C;  4PKY A;  2Y2L A;  3SW1 A;  1GHI A;  3MXQ A;  2PR6 A;  5FDH A;  2ZOH A;  5TFQ A;  3UE6 A;  4HY8 A;  5JYO A;  4UQI S;  3IXG A;  3A3E A;  3IF6 A;  2PRF A;  2ZM8 A;  3N8L A;  5CGX A;  4S2N A;  1SHV A;  3MZF A;  1S1Z A;  2W0N A;  1SKO B;  2H28 A;  2E8J A;  2V2F F;  2ZC5 B;  2XRO A;  3OOV A;  3PBR A;  3VFH A;  2PD7 A;  1ESI A;  1WYC A;  2VK3 A;  3CLO A;  3NDG A;  3FWL A;  2Y2Q A;  1ODV A;  1KVM A;  3IXB A;  5J8X A;  3IBR A;  5GHX A;  3GQZ A;  4FSF A;  5EVE A;  5L09 A;  2Y2J A;  4WZ5 A;  1XFQ A;  3TG9 A;  1N4O A;  3CJM A;  2ZC7 A;  3ZDJ A;  5F5Y A;  3SH9 A;  2L4R A;  3MQ0 A;  4E3J A;  4O8G A;  5J4E A;  3RXX A;  3Q82 A;  2EWW A;  1DP8 A;  4BWI A;  5JYP A;  5EV0 A;  3T1R A;  1MC0 A;  3A3J A;  4L9F A;  1S0W A;  1MKI A;  3DTK A;  2KX6 A;  5D3O A;  3LCE A;  1DJC A;  2PAV P;  2V8F A;  2WKH A;  3WS4 A;  3MMH A;  1ZC2 A;  2INW A;  1ERM A;  1L2S A;  3LY3 A;  4WZ4 A;  3UO9 A;  4KEN B;  1BLC A;  4QB8 A;  4E3L A;  4DF6 A;  5FQ9 A;  4BJP A;  2UV0 E;  4HP4 A;  4H8R A;  4E3N A;  3L9K A;  3KYQ A;  2Q9M A;  1KE4 A;  1MWR A;  3CUE A;  1NZO A;  2VGJ A;  3GV9 A;  2H5S A;  2Z2M B;  2JC7 A;  4HHD A;  3K2N A;  3RTY A;  2X02 A;  3IS2 A;  2HJE A;  4P6Z M;  4OPZ A;  1YM1 A;  2IWB A;  2BLS A;  2WKP A;  4EV4 A;  4R3J A;  4R4S A;  1O7E A;  3QP6 A;  4WF0 A;  4R3A A;  2JKT M;  1OTA A;  1NYM A;  1MXO A;  4PM6 A;  1ZG4 A;  1IKG A;  4ZJ2 A;  4Z1W A;  3HUM A;  4O7D A;  2EXB A;  1RCJ A;  1H8M A;  2WKR A;  4PKY G;  2C5W B;  3QP8 A;  1OTI A;  2OAQ 1;  3PR6 A;  2PBD P;  4X53 A;  2WUQ A;  3UNW A;  5AQA A;  2XDM A;  3OZH A;  4GW9 A;  1LL9 A;  1OJG A;  3LI8 A;  5EM1 A;  1M6K A;  3K3C A;  1RGZ A;  3VOZ A;  3UDX A;  1H8Z A;  3BY9 A;  2WZX A;  5DFY A;  3LEQ A;  3GVB A;  1TF1 A;  4B88 A;  3R7W B;  3F1N B;  1FSY A;  3DBA A;  1S67 L;  2EFX A;  4R38 A;  2JHE A;  1K56 A;  4KZ9 A;  1Y28 A;  4QY6 A;  2V20 A;  4GJ4 A;  3A0R A;  3JPU A;  3HLD A;  2CMN A;  1WA9 A;  1FIL A;  3P98 A;  4KQO A;  1K6S A;  3BFG A;  3NOT C;  4WM9 A;  4CLC B;  3BQA A;  2M7U A;  4LFU A;  1F98 A;  3DTE A;  4KQD A;  5AQB A;  4MN7 A;  3T1S A;  1S6R A;  1S66 L;  2B95 A;  4WLA A;  5EVL A;  3IX3 A;  3AGE A;  5EE8 A;  3UMD A;  3N6I A;  4MN6 A;  3HJI A;  4LRZ E;  4PPR A;  3PBS A;  4I3A A;  4FH2 A;  3BW6 A;  1IKI A;  1GSX A;  1PYY A;  4E3M A;  3IHB A;  1TEM A;  5CHM A;  2RCX A;  2V8C A;  1I5Q A;  3OBF A;  1DP9 A;  1T19 A;  3N8S A;  1PI5 A;  5M1A A;  3V5M A;  5KSC A;  1CI9 A;  3PBT A;  3ZG9 B;  2VEA A;  3ITA A;  4NXB A;  4N9L A;  3NUL A;  3TSG A;  4DE0 A;  2GJ3 A;  2EA9 A;  4NET A;  2O99 A;  5FI7 A;  5HSQ A;  5L2F A;  3VOL A;  4UA7 A;  4IUH A;  3UN7 A;  5U47 A;  1MWS A;  3ZG7 B;  4Y0O A;  4FH4 A;  1P9R A;  2ZMV A;  1P9W A;  3HLG A;  4F3L A;  4GCZ A;  5CGW A;  2EX9 A;  2KLI A;  2JKR I;  5F1G A;  1ZTU A;  4C3Q A;  4HIA A;  5FDS A;  1W63 M;  4B4X A;  4OQI A;  3HUO A;  2L0W A;  2W3H A;  1ESU A;  1MZU A;  4R6L A;  3UY6 A;  2X01 A;  3D3O A;  4KZ7 A;  3SH8 A;  4WEJ A;  3R4K A;  4EU0 A;  2RL3 A;  2XFT A;  1TDL A;  4HOI A;  5FQI A;  4CQH A;  3JVV A;  3RH8 B;  4BD0 A;  4BL2 A;  4WMC D;  1KDW A;  2XR0 A;  5CRF A;  5FSR A;  4DXC A;  3KX0 X;  1MWT A;  2XH9 A;  1CK3 A;  4H6J A;  2LB9 A;  3C8C A;  4HBU A;  5EVI C;  4IED A;  4WN5 A;  2XEP A;  3U2A A;  1K56 D;  3IX4 A;  3VSL A;  3ZGA B;  3HBR A;  3MZD A;  4OOY A;  2ZM2 A;  4P6B A;  4C6Y A;  4S2L A;  1AWI A;  1Y54 A;  4UA9 A;  4ZTK A;  3KSH A;  1FQG A;  3LIB A;  3IT9 A;  4ZRR A;  5FQQ A;  3T1Q B;  3T50 A;  1G68 A;  2DMW A;  1BSG A;  2Y59 A;  3EEH A;  3LGO A;  2XF3 A;  3KYZ A;  3G2Z A;  4LLO B;  2QWS A;  5CX7 A;  5FAP A;  1ONH A;  2K31 A;  2V0U A;  1QME A;  4IJG A;  2HP6 A;  3C30 A;  4A5R A;  3NDE A;  3N8R A;  5HD3 A;  3NY4 A;  3O5Y A;  1FR1 A;  3GTC A;  1PIO A;  3S4X A;  2IWC A;  1OJ5 A;  4PHT A;  4ZAM A;  2K2N A;  3Q1F A;  1PZO A;  5FQM A;  2PD8 A;  4GLQ A;  3UE3 A;  3KO6 A;  3FYZ A;  4MDZ A;  5GLD A;  3SH7 A;  1PRQ A;  5GHY A;  4EQI A;  4LV1 A;  5DFX A;  3N4I A;  1VET B;  4G3V A;  4DN0 A;  1JWV A;  3BWL A;  4MN5 A;  4Y2F A;  1JTD A;  2HDU A;  2VGL S;  4PM9 A;  4X56 A;  1D1J A;  3CWF A;  3MXR A;  3HL9 A;  4M4X A;  3C7V A;  1TD5 A;  4M3K A;  5GHZ A;  5EVI A;  5IT5 A;  4BBT A;  5L07 A;  2V0W A;  3IF6 B;  4WZ5 C;  4XUX A;  4HJ6 A;  1W7F A;  4OQ0 A;  2ZC3 B;  4OOM A;  3EQV A;  4O01 A;  2OV5 A;  3BEC A;  3ZQ5 A;  3LYX A;  1H3Q A;  2J3T C;  3MJQ A;  1RP5 A;  1JVJ A;  2XA7 M;  4JXG A;  2J9P A;  1XP4 A;  3E4P A;  1YLT A;  3DAV A;  4N1H A;  4R23 A;  1I2W A;  3T4L A;  3ZG0 A;  4MNR A;  2HGV A;  4ZDX A;  2ZQA A;  3ULF A;  3VFF A;  1JWP A;  2Y79 A;  4QD4 A;  1CEG A;  5FQK A;  1SDE A;  4U0T A;  4JF5 A;  4E6X A;  5DF8 A;  4E3K A;  1QMF A;  3C5A A;  2EWV A;  4UHU A;  3EEA A;  3IHA A;  3GMW A;  3N7W A;  2JKR M;  4E6W A;  3VMA A;  1N9N A;  4O0P A;  2O9B A;  2PYR A;  2Z6D A;  2PU2 A;  4Q0J A;  4LRY C;  3F1P B;  4RYE A;  1FCO A;  5HPI A;  3T4T A;  4K0X A;  3EOI A;  3NOP C;  3S1Y A;  2H10 A;  4GDB A;  1CQA A;  2WK0 A;  4LV0 A;  4X6T A;  4KQR A;  1LI9 A;  4KUK A;  3Q7V A;  1WE4 A;  5G4Z A;  2QZ6 A;  2OLU A;  4DE2 A;  3L7H A;  4R3B A;  4OOL A;  1NY0 A;  3CHW P;  2LB5 A;  1GA9 A;  2VZW A;  5F82 A;  3H82 A;  2ZL1 B;  3UDI A;  3W8K A;  1K0K A;  3ZNY A;  2VA0 A;  3ZCZ A;  5DKL A;  1E3U D;  4CLC E;  5I94 A;  3V50 A;  3DTM A;  1WYB A;  1F5M A;  3VOY A;  4KZA A;  3MQO A;  3IS2 B;  5G18 A;  3C7U A;  4PM8 A;  4JGP A;  2ZD8 A;  3QP5 A;  3OLO A;  2DNS A;  5CTM A;  4DE3 A;  1FCM A;  3JVU A;  4OKP A;  3ZG5 A;  2A3U A;  3W2Z A;  4ZJ3 A;  3PYP A;  2B18 A;  1NWZ A;  4FD8 A;  3T12 B;  3F1O A;  2HDR A;  3VP1 A;  3FKV A;  5EVI D;  4EXO A;  4BLM A;  4Y5F A;  3ZVT A;  2QJ7 A;  4WEK A;  3H7W A;  4HJ4 A;  1IYQ A;  3E4O A;  2WAE A;  4ARZ A;  5A8B A;  3HLW A;  5IS1 A;  1YKD A;  2ZC6 B;  4NEE D;  1PNE A;  1K57 C;  1XXM A;  3DTI A;  4HI4 A;  1P97 A;  4EUV A;  4BBU A;  4U0X A;  3WWX A;  3JYI A;  3S7O A;  3I7J A;  4DE1 A;  3O88 A;  3E4Q A;  1JWZ A;  3BLS A;  4EET B;  3GRJ A;  3LIC A;  3HUN A;  2V1B A;  1XJ4 A;  2P04 A;  1KGE A;  3HLF A;  3NJA A;  3W4P A;  3CPT B;  1PWG A;  3UB6 A;  5CHJ A;  1DJB A;  5A93 A;  3HLE A;  1OTD A;  3WS1 A;  5GLC A;  2ZC4 B;  3V3R A;  1PI4 A;  4BEN A;  1DJA A;  1HLU P;  2Y2H A;  1BLH A;  1GA0 A;  3NI9 A;  1L0G A;  1PWC A;  1L0D A;  1XPB A;  5TBM B;  1JNU A;  3M2J A;  1XA7 A;  3M6H A;  5HDD A;  1IFQ A;  1F2K A;  5F83 A;  1Z09 A;  5EFW A;  3G30 A;  2BAS A;  2HJ9 C;  5HW3 A;  3BFD A;  4FTX A;  4GB7 A;  3TE8 A;  2W1T A;  1PW1 A;  2J7V A;  3E98 A;  4NKP A;  5I5L A;  4EWF A;  1STZ A;  4JLF A;  1NJ4 A;  3VSK A;  4BMW A;  5CEC A;  4BD1 A;  3LR0 A;  3LR5 A;  4ID4 A;  3SOI A;  4X68 A;  3C2W A;  5J3W A;  1ES5 A;  3LY4 A;  4R0Q A;  2HZ5 A;  5CXW A;  3NIA A;  3P09 A;  2V9A A;  4K08 A;  2YKH A;  3QNB A;  1ERQ A;  2P9V A;  1T18 A;  3O86 A;  4F3L B;  1D7E A;  1I2S A;  5AVF A;  2MJ6 A;  4JF6 A;  1K57 A;  4X55 A;  5EM0 A;  4RX2 A;  1K4E A;  2J3T D;  2QHK A;  4EEU A;  1OPX A;  1LHY A;  2Y2O A;  2VV8 A;  5AJG A;  2O9C A;  3AGD A;  5FQJ A;  4ZBE A;  3T4K A;  5AVE A;  4P0M A;  5BOH A;  4QU3 A;  1KVL A;  2Z2L B;  3NC8 A;  2EXA A;  2D02 A;  3CMZ A;  5HFO A;  3IWI A;  2WKE A;  1G6O A;  3ITB A;  5DVA A;  4H6J B;  1XJ2 A;  2J80 A;  3D72 A;  1UWN X;  4Y3I A;  4LCL A;  4YNR A;  5DJU A;  5E2F A;  5CER A;  1EW0 A;  3T4Q A;  1E4D A;  5IU1 A;  4DKI A;  2HDS A;  3G6O A;  4DDY A;  3LI9 A;  3ZNT A;  3KSI A;  5HWT A;  1K54 C;  3QNC A;  1ACF A;  2G2U A;  1PWD A;  1YLW A;  2QMI A;  1N9L A;  2WGI A;  5FA7 A;  2FFY A;  2G7U A;  2Y91 A;  3K3D A;  4LCM A;  4U3T A;  4OPY A;  2UWX A;  1MWU A;  4CLC A;  4XXR A;  2XSS A;  1S1Y A;  1KE0 A;  4WYY A;  5AQ9 A;  4LRX C;  3MBZ A;  1NRF A;  5HL1 A;  3P01 A;  4JXV A;  2V1Z A;  2FZ0 A;  2KOI A;  2A24 A;  4Y0U A;  1FIK A;  1W5D A;  3MSH A;  5TGF A;  1FSW A;  3PTE A;  1ZG6 A;  4HH3 A;  2WAD A;  2R9X A;  1CI8 A;  5KMW A;  3BQ8 A;  2J3W A;  2PDR A;  4PM7 A;  3UE0 A;  4KG2 A;  3E0Y A;  2R78 A;  2ACG A;  5J7E A;  4PAU A;  2W1R A;  1TS6 A;  4QY5 A;  2VLG A;  3Q7Z A;  2P74 A;  4S2M A;  5HDC A;  4YIN A;  5HWW A;  2P08 A;  3M2K A;  1CJF A;  1NZU A;  2DCF A;  2Y55 A;  3ZG8 B;  1NLZ A;  3U4L P;  1KOU A;  5HAP A;  1FCN A;  3O3V A;  3GEC A;  3HJK A;  4P6Z S;  3WRZ A;  3KSF A;  4C75 A;  5DKK A;  4EQ1 A;  3IWQ A;  5DJT A;  3FV7 A;  1XJ3 A;  5EVI B;  2VV6 A;  5K5B A;  2PBY A;  4I3I A;  5TJJ A;  3VP3 A;  1GHP A;  3IXD A;  1W63 Q;  1K54 A;  4OLG A;  2BTF P;  3IQA A;  4R4R A;  1PZP A;  1VB6 A;  4P87 A;  1VEU A;  1L3L A;  3Q81 A;  2WGW A;  3D4F A;  2A49 A;  1OT9 A;  3HCY A;  3LFV A;  2L1M A;  1X0O A;  3MFD A;  3CZD A;  2YKF A;  3ZHH A;  3IWO A;  4GNU A;  4OVD A;  3V67 A;  2IA2 A;  3WRT A;  4Y13 A;  2JKG A;  3B3X A;  1W79 A;  2ZBB A;  4YFM A;  1A0K A;  1IEM A;  4CJN A;  1ES2 A;  1OME A;  4MBH A;  2HPB A;  1XX2 A;  3G31 A;  3CI6 A;  4RA7 A;  3G35 A;  2M1C A;  5KSH A;  1N9O A;  4EBP A;  4QWO A;  5FI2 A;  1K38 A;  3S7P A;  1HTZ A;  5TR7 A;  1GHM A;  5DTT A;  2Y8H A;  1TS7 A;  4OP5 A;  1K6R A;  2XK1 A;  4ETX A;  4JKT A;  4ETZ A;  4PMA A;  3AGF A;  4K0W A;  1MKM A;  5KIZ A;  1FOF A;  3NCK A;  3IH8 A;  5CEB A;  2W3D A;  4OLD A;  4KZ3 A;  4OP8 A;  4NXF A;  1YSQ A;  1KE3 A;  3Q7V B;  3EGD C;  4UEY A;  2Y2N A;  4GS9 A;  3DW0 A;  4Q0I A;  2Y2M A;  3ZFZ A;  3S7Q A;  1OTB A;  1MPL A;  5M18 A;  3TOI A;  3H82 B;  2Y2G A;  5DF9 A;  5FI6 A;  4BL3 A;  2GX5 A;  4MLL A;  4LGW A;  2EFU A;  2D01 A;  1L0E A;  3T1X A;  4EEP A;  4OQG A;  4L9G A;  3QP1 A;  4GHI A;  3GR2 A;  5IHV A;  4L9E A;  3UE1 A;  4N92 A;  1ZHH B;  1K25 A;  4OQH A;  4KUO A;  3F1O B;  4MCW A;  3A3F A;  2PHY A;  4WL9 A;  1YLZ A;  1GSW A;  4Q8I A;  2XRN A;  3OCL A;  1GSV A;  4JXW A;  4AFI A;  3H7W B;  1V9Y A;  1CEF A;  1PFL A;  5DTK A;  5HAQ A;  2Y2I A;  4IVK A;  3IH9 A;  4KZ8 A;  4ARZ B;  4BBV A;  4JBF A;  2IWD A;  3NBL A;  1LSX A;  5HWV A;  4KZ4 A;  1TDG A;  4XT2 A;  1SZV A;  1W8Y A;  3DWK A;  4MBK A;  2ZJ9 A;  4GKU A;  2WZZ A;  4IHQ A;  2M7V A;  4Q0H A;  5FAT A;  3G4P A;  2OWJ A;  3B47 A;  4YWZ A;  2ZQ9 A;  5EOE A;  3MR0 A;  5F69 A;  4GD8 A;  1P0Z A;  3OCN A;  3B33 A;  3EQU A;  4X69 A;  4IVI A;  4HQA A;  4PM5 A;  2ZMA A;  1YLP A;  3D9Y A;  1S4R A;  3LO7 A;  2ZQC A;  4D60 A;  4WEL A;  2XGN A;  1JTG A;  1MBL A;  4QHC A;  2QJ5 A;  3OPP A;  5GLB A;  2QPN A;  3LUQ A;  4G3W A;  5KZH A;  4JF4 A;  1OT6 A;  2KDK A;  3BLM A;  4R1G A;  4FCF A;  3W4Q A;  1ZKJ A;  1L0F A;  4HEF A;  2C6W B;  4KZ5 A;  5A90 A;  3GDI A;  2WKI A;  4OPR A;  2I72 A;  4KG6 A;  3BM6 A;  2XD5 A;  4ME4 A;  1BYW A;  4JXS A;  3KYE A;  3F1P A;  5FAS A;  3H9W A;  3RFB A;  3SS3 A;  3HRE A;  5E2G A;  1O07 A;  2WKQ A;  3T4J A;  1D06 A;  2W1T B;  4UA6 A;  4XUZ A;  2ZMF A;  1SKO A;  4B9O A;  2PYP A;  3Q07 A;  4GN2 A;  4P85 A;  3E2L A;  2ZQ8 A;  4HNB A;  1IYP A;  3UB8 A;  3OPH A;  5F1F A;  5HL6 A;  3PBN A;  1XJ6 A;  2ZL1 A;  5MC7 A;  3UPP A;  2XD1 A;  4E04 A;  1SDN A;  1HD8 A;  1YSP A;  1LI0 A;  5AQ7 A;  2NUT C;  2QKP A;  2P9V B;  5EOO A;  4QPR A;  5L10 A;  1IOU A;  1KGF A;  1NRJ A;  4EER A;  3V3S A;  2CC1 A;  4BQM A;  1CF0 A;  3LIF A;  4IBR A;  2GNX A;  2R9W A;  4X25 A;  3PHY A;  4MBF A;  1J3W A;  3VP2 A;  5DF7 A;  3A0V A;  1HZO A;  3G34 A;  1SCW A;  1C3B A;  2H0Y A;  1K4F A;  4I3J A;  2P7J A;  2I9V A;  3VV4 A;  4DMZ A;  1BUL A;  1W8Q A;  2J9O A;  4NXG A;  1XFN A;  1BUE A;  3LIA A;  4N1X A;  1YQS A;  1IEL A;  5CTN A;  3M6B A;  2VKS A;  1MY8 A;  1F9I A;  3EGX C;  3BRM A;  1DRM A;  1T1C A;  4WUJ A;  5HZH A;  1BZA A;  3IF5 A;  5EEC A;  1E25 A;  3FG8 A;  4LV3 A;  4CLC C;  1KGG A;  3BEB A;  4JGR A;  1IYO A;  4WMC A;  2OAP 1;  3QP4 A;  4DDS A;  3FPW A;  1LT0 A;  1ES4 A;  4K91 A;  1UWP X;  3VP0 A;  2O0Y A;  2Y4A A;  1TVF A;  4Y17 A;  4IUK A;  3UB9 A;  3LID A;  3LIE A;  3UPN A;  3ZYT A;  3OPR A;  2XA7 S;  2JN7 A;  2VGL M;  2FFF B;  3A0S A;  2A2L A;  4LV2 A;  4JPM A;  1XGJ A;  1G6A A;  1EI5 A;  2Y2K A;  4B4Z A;  1VHM A;  5HPF A;  1G5U A;  3CPT A;  3LEZ A;  3IX8 A;  4UAA A;  1BLS A;  3SS5 A;  5A91 A;  1NLY A;  2WGV A;  2V1A A;  1XKZ A;  1RGY A;  3WS0 A;  2PR5 A;  3IXH A;  3NOU C;  4KZB A;  4L0L A;  5E2H A;  1FR6 A;  2W3E A;  4NK3 A;  4LPZ A;  3NEC A;  4FOF A;  4G3K A;  4JGQ A;  3P7N A;  5E2E A;  5HAR A;  2X71 A;  3UME A;  4QJG A;  1KDS A;  2A24 B;  5TBM A;  4EBN A;  2XFS A;  3LR3 A;  1EWZ A;  4DXB A;  2B02 A;  4X1M A;  1TS0 A;  3TW8 A;  3O87 A;  4ZJ1 A;  2HP5 A;  5HDS A;  1S4S A;  4D2O A; 
#chains in the Genus database with same CATH homology
 2HJE A;  4P6Z M;  3FC7 A;  2JKR M;  1T1B A;  1W63 Q;  2WKP A;  1N9N A;  2NUP C;  4O0P A;  1VB6 A;  2O9B A;  2PYR A;  2Z6D A;  4WF0 A;  4Q0J A;  4R3A A;  2JKT M;  4LRY C;  1OTA A;  3MFX A;  1OT9 A;  3R7W A;  3HCY A;  3F1P B;  3F1N A;  3LFV A;  2L1M A;  1X0O A;  5HPI A;  3T4T A;  3EOI A;  3BY8 A;  3NOP C;  4YOF A;  2YKF A;  3V67 A;  2IA2 A;  4Z1W A;  2ZBB A;  1G28 A;  4I38 A;  4KUK A;  1H8M A;  2WKR A;  4PKY G;  4I5S A;  5G4Z A;  4UQI M;  2Z6C A;  1OTI A;  2OAQ 1;  4OOL A;  3PR6 A;  3CI6 A;  2LB5 A;  2HV1 A;  2VZW A;  4HP9 A;  3H82 A;  5FL3 A;  4GW9 A;  2M1C A;  5KSH A;  1N9O A;  2VA0 A;  2VJW A;  5DKL A;  4CLC E;  1OJG A;  3LI8 A;  1F5M A;  3S7P A;  3MQO A;  3IS2 B;  3CAX A;  3K3C A;  2Y8H A;  3T4O A;  3LR4 A;  4JGP A;  1DP6 A;  1TS7 A;  3BY9 A;  4R70 A;  3OLO A;  5DFY A;  4ETX A;  3JVU A;  2W3G A;  3VE3 A;  1TF1 A;  4ETZ A;  3R7W B;  3F1N B;  3DBA A;  1S67 L;  4R38 A;  3W2Z A;  2JHE A;  3PYP A;  1MKM A;  1Y28 A;  2VV7 A;  5KIZ A;  4GJ4 A;  3A0R A;  2B18 A;  1NWZ A;  2CMN A;  3PBO A;  2W3D A;  1LSW A;  1WA9 A;  3F1O A;  4KQO A;  4NXF A;  4EXO A;  1YSQ A;  4Y5F A;  2QJ7 A;  4WEK A;  3NOT C;  3VE4 A;  3EGD C;  3BJN A;  5F6A A;  4CLC B;  4UEY A;  4GS9 A;  3BQA A;  2M7U A;  4Q0I A;  3H7W A;  4HJ4 A;  3S7Q A;  1OTB A;  3E4O A;  3B42 A;  4MMN A;  1F98 A;  4KQD A;  3H82 B;  4MN7 A;  5DF9 A;  4ARZ A;  5A8B A;  2GX5 A;  4DJ3 A;  1S66 L;  2FH5 A;  5IS1 A;  1YKD A;  4WLA A;  4NEE D;  4RQ9 A;  2D01 A;  3UMD A;  3MQQ A;  4MN6 A;  4HI4 A;  2GZA A;  1P97 A;  1LL8 A;  5HD5 A;  3HJI A;  4EUV A;  4BBU A;  4EEP A;  3S7O A;  4LRZ E;  3PBS A;  1UGU A;  4I3A A;  3BW6 A;  4L9G A;  2ZOI A;  4GHI A;  3E4Q A;  1GSX A;  4L9E A;  1YAX A;  2W3F A;  4EET B;  2PT7 A;  3LIC A;  2V1B A;  5L8M A;  1XJ4 A;  2P04 A;  3OBF A;  4HJ3 A;  1ZHH B;  1DP9 A;  1T19 A;  3NJA A;  4HH2 A;  3PBT A;  4KUO A;  3F1O B;  3PBQ A;  2VEA A;  4MCW A;  3UB6 A;  4NXB A;  1OTD A;  2PHY A;  3EWK A;  4WL9 A;  2GJ3 A;  1GSW A;  2EA9 A;  2XRN A;  3IBJ A;  2O99 A;  3OCL A;  1GSV A;  5HSQ A;  4GS9 B;  4AFI A;  3VOL A;  3H7W B;  1V9Y A;  4IUH A;  3MF0 A;  1P9R A;  4ARZ B;  2OOL A;  5F68 A;  4BBV A;  2ZMV A;  1P9W A;  1LSX A;  4F3L A;  5HWV A;  4GCZ A;  2KLI A;  4XT2 A;  2JKR I;  5TBM B;  1JNU A;  3T4S A;  1ZTU A;  3NHQ A;  4B93 A;  4IHQ A;  4HIA A;  3UB7 A;  2QYB A;  2M7V A;  4Q0H A;  5HDD A;  1IFQ A;  1W63 M;  4JGO A;  4EES A;  2OWJ A;  2JKT I;  3B47 A;  2L0W A;  4NXE A;  2W3H A;  1MZU A;  4GHI B;  4R6L A;  4YWZ A;  5EFW A;  3D3O A;  4WEJ A;  3R4K A;  4EU0 A;  4CLC D;  3MR0 A;  2BAS A;  5F69 A;  2HJ9 C;  1P0Z A;  3OCN A;  3TE8 A;  2W1T A;  3B33 A;  3EQU A;  3E98 A;  4NKP A;  4HOI A;  5I5L A;  4HQA A;  4CQH A;  1STZ A;  3JVV A;  3RH8 B;  1S4R A;  4BMW A;  3FPV A;  2OWH A;  5C5K A;  4WEL A;  3LR0 A;  5LBR A;  3LR5 A;  2QJ5 A;  3C2W A;  5J3W A;  3KX0 X;  3LUQ A;  4G3W A;  1V9Z A;  4EW7 A;  2V9A A;  4H6J A;  4K08 A;  1OT6 A;  3TRC A;  2YKH A;  2LB9 A;  2KDK A;  1T18 A;  3C8C A;  4F3L B;  1D7E A;  1OTE A;  5AVF A;  2VX8 A;  4XT2 B;  2MJ6 A;  4WN5 A;  3U2A A;  3TJZ C;  3C38 A;  1T1A A;  2J3T D;  3GDI A;  5G4Y A;  2QHK A;  4EEU A;  1OPX A;  4ME4 A;  3S7N A;  1BYW A;  2VV8 A;  3F1P A;  2K7S A;  4I39 A;  3H9W A;  5AJG A;  3RFB A;  2O9C A;  3T4K A;  2WKQ A;  5AVE A;  3T4J A;  1D06 A;  2W1T B;  2W27 A;  3KSH A;  3LIB A;  2ZMF A;  4ZRR A;  2HF6 A;  4B9O A;  2PYP A;  3T50 A;  2DMW A;  3EEH A;  2O9A A;  3PXP A;  4HNB A;  3UB8 A;  5HL6 A;  2D02 A;  3KYZ A;  1XJ6 A;  3PBN A;  5MC7 A;  1G6O A;  4E04 A;  4LLO B;  4DJ2 A;  1LSV A;  2QWS A;  1YSP A;  4H6J B;  5CX7 A;  1XJ2 A;  2J80 A;  3ICY A;  3OC2 A;  2NUT C;  1UWN X;  2QKP A;  3D72 A;  4Y3I A;  1TS8 A;  2K31 A;  2V0U A;  4YNR A;  4QPR A;  5DJU A;  1IOU A;  4IJG A;  3CIT A;  1NRJ A;  4EER A;  4II7 A;  3KSG A;  3CUE C;  1EW0 A;  3T4Q A;  3C30 A;  4PKY A;  5IU1 A;  3SW1 A;  3LIF A;  2GNX A;  3MXQ A;  2PR6 A;  2ZOH A;  3PHY A;  5HD3 A;  3UE6 A;  3G6O A;  4HY8 A;  3O5Y A;  3A0V A;  3LI9 A;  4UQI S;  3KSI A;  1OJ5 A;  4I3J A;  4PHT A;  5HWT A;  2K2N A;  2P7J A;  2I9V A;  3VV4 A;  4DMZ A;  2PD8 A;  4GLQ A;  3UE3 A;  3KO6 A;  4NXG A;  1S1Z A;  1XFN A;  3LIA A;  1N9L A;  4MDZ A;  2W0N A;  2G7U A;  2H28 A;  3K3D A;  2XRO A;  2VKS A;  3OOV A;  1F9I A;  3PBR A;  5DFX A;  4CLC A;  3EGX C;  2PD7 A;  2XSS A;  1DRM A;  1T1C A;  4WUJ A;  4G3V A;  1S1Y A;  5HZH A;  4DN0 A;  4LRX C;  3FG8 A;  3P01 A;  3CLO A;  3BWL A;  4MN5 A;  4CLC C;  4Y2F A;  4JGR A;  2FZ0 A;  1ODV A;  2KOI A;  2A24 A;  2VGL S;  2OAP 1;  3CWF A;  3IBR A;  3FPW A;  1LT0 A;  4M4X A;  1UWP X;  1TD5 A;  4FSF A;  4HH3 A;  2O0Y A;  1XFQ A;  5IT5 A;  3BQ8 A;  2J3W A;  2PDR A;  4BBT A;  5F5Y A;  4IUK A;  3UB9 A;  2V0W A;  3LID A;  3LIE A;  2L4R A;  3MQ0 A;  4O8G A;  3ZYT A;  2XA7 S;  2JN7 A;  2VGL M;  4HJ6 A;  3A0S A;  5J4E A;  2A2L A;  3E0Y A;  2R78 A;  5J7E A;  4PAU A;  4OOM A;  2EWW A;  1DP8 A;  1VHM A;  2W1R A;  4BWI A;  5HPF A;  3EQV A;  4O01 A;  1TS6 A;  1MC0 A;  2VLG A;  4L9F A;  3ZQ5 A;  3LYX A;  1H3Q A;  2KX6 A;  1NLY A;  5HDC A;  2J3T C;  3MJQ A;  5HWW A;  2P08 A;  2V1A A;  2XA7 M;  3E4P A;  2PR5 A;  3MMH A;  3NOU C;  2INW A;  4L0L A;  2W3E A;  1NLZ A;  4LPZ A;  1KOU A;  4FOF A;  4G3K A;  4JGQ A;  3T4L A;  3GEC A;  3P7N A;  3HJK A;  2HGV A;  4P6Z S;  3UME A;  4BJP A;  2A24 B;  4HP4 A;  5TBM A;  3KSF A;  3ULF A;  3LR3 A;  5DKK A;  4EQ1 A;  2Y79 A;  3KYQ A;  2B02 A;  1TS0 A;  5DJT A;  3TW8 A;  3CUE A;  1XJ3 A;  2VV6 A;  5K5B A;  2EWV A;  4HHD A;  3K2N A;  3RTY A;  5HDS A;  3IS2 A;  3EEA A;  4I3I A;  5TJJ A;  1S4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...