1MZUA

Crystal structure of the photoactive yellow protein domain from the sensor histidine kinase ppr from rhodospirillum centenum
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
110
structure length
107
Chain Sequence
IDTAEFDALPVGAIQVDGSGVIHRYNRTESRLSGRIPERVIGRNFFTEVAPCTNIPAFSGRFMDGVTSGTLDARFDFVFDFQMAPVRVQIRMQNAGVPDRYWIFVRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PPR
publication title Crystal Structure of a Photoactive Yellow Protein from a Sensor Histidine Kinase: Conformational Variability and Signal Transduction
pubmed doi rcsb
source organism Rhodospirillum centenum
molecule tags Signaling protein
total genus 27
structure length 107
sequence length 110
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1mzuA00
1TS7A 1TS0A 1V9YA 4KQDA 1OJGA 1DP9A 2L0WA 4R6LA 4I3IA 1X0OA 3T50A 3MJQA 3IBRA 1TS6A 3G6OA 1ODVA 5TBMB 1T1BA 4GS9B 4JGRA 5F6AA 4HJ4A 1T19A 5DKKA 2KX6A 4HH3A 4BBVA 3PYPA 5KIZA 3LIFA 3EWKA 4F3LB 2VLGA 3E4PA 3F1NB 2PHYA 1OTEA 2PYPA 4LRXC 1D7EA 1DP6A 1F9IA 2WKPA 2V9AA 3BY9A 4HQAA 3NOUC 3HJKA 1G28A 3LUQA 3K3CA 2V0WA 4BBUA 1OT9A 1OTAA 5F68A 5HZHA 3EEHA 2HV1A 3LIDA 2OWHA 4I3AA 3UE6A 5G4ZA 5F69A 5HWVA 4HH2A 4KUOA 5HWTA 4E04A 2QJ7A 1KOUA 2ZOIA 4EERA 4PKYA 2WKRA 4GHIA 1UWPX 4I5SA 3BWLA 5DKLA 2OOLA 3A0VA 3IS2B 4NXBA 4PKYG 4XT2A 2P7JA 1OT6A 1UWNX 3RH8B 4L9FA 4WLAA 3GDIA 2ZOHA 2KDKA 4HIAA 3MFXA 1GSVA 3B33A 1T1AA 3H9WA 3BY8A 3CWFA 1OTBA 3F1OB 2VV8A 4L9EA 1XJ3A 3MXQA 1VB6A 2YKHA 4R70A 1GSXA 3FG8A 4MN6A 2JHEA 3C8CA 3VE3A 5J7EA 3LICA 3CLOA 3K3DA 2B02A 1NWZA 3UB7A 3UB8A 2QHKA 4R3AA 4EXOA 4DJ2A 5IU1A 3SW1A 1JNUA 3KX0X 4EW7A 4HOIA 3P7NA 4EETB 2K7SA 4GS9A 2PR5A 3H82B 4H6JB 4EEUA 5F5YA 2J80A 3CAXA 1S1YA 4M4XA 5I5LA 3LI9A 1F98A 3A0RA 1OTDA 3LI8A 1TS8A 3GECA 4EEPA 1V9ZA 4KUKA 4JGQA 2W0NA 4LPZA 1XFQA 1LT0A 1P0ZA 2PDRA 3H7WB 3F1PB 1LSVA 3F1NA 4I38A 2PD7A 4LRZE 1LL8A 2M1CA 1XFNA 2VEAA 2A24B 3LIEA 2EA9A 4HP4A 4I39A 3LIAA 4I3JA 1DRMA 4NXEA 5DJTA 3VE4A 4HI4A 1S1ZA 1WA9A 4WUJA 1T1CA 2CMNA 2V1AA 5A8BA 1XJ2A 2R78A 1S4SA 4NXFA 3UB6A 3OLOA 3ULFA 5J3WA 5HWWA 1XJ4A 2YKFA 4WF0A 1N9OA 1S67L 1EW0A 2ZBBA 2W27A 5IS1A 1XJ6A 5AVEA 5EFWA 3LYXA 3HJIA 3PHYA 4R38A 2L4RA 4JGPA 4NXGA 1S66L 1MZUA 2V1BA 3UMEA 4DJ3A 4B9OA 3IS2A 2BASA 1D06A 2PYRA 2VV7A 3E4OA 1Y28A 2L1MA 4GW9A 3VOLA 3A0SA 1BYWA 4LRYC 2D02A 2QJ5A 1UGUA 2WKQA 1P97A 3MR0A 5TBMA 3F1OA 4GCZA 4YWZA 4MN5A 5HD3A 2PR6A 1LSXA 4RQ9A 5G4YA 3LIBA 4L9GA 3C2WA 3MQOA 2QKPA 2INWA 4HNBA 1N9NA 4F3LA 3NHQA 4EESA 1GSWA 3E4QA 2QWSA 4WN5A 5DJUA 4HJ6A 2I9VA 4HY8A 5AVFA 4LLOB 3H82A 4HP9A 4H6JA 2Z6CA 5J4EA 3RTYA 1OJ5A 2Z6DA 4HJ3A 2H28A 2D01A 1N9LA 3NOTC 2PD8A 4HHDA 5HDSA 3UMDA 5HDCA 4GHIB 1T18A 4JGOA 2GJ3A 2V0UA 3H7WA 2VV6A 3F1PA 4WL9A 1OTIA 4XT2B 3ZQ5A 3NJAA 3NOPC 1LSWA 2JN7A 5HDDA 2OWJA 5HSQA 3UB9A 4BBTA 2A24A 3MQQA 3D72A 3FC7A 5HD5A 1DP8A 1S4RA 3ICYA 4EQ1A 4K08A
chains in the Genus database with same CATH superfamily
2JKTM 1V9YA 1TS0A 1Y54A 1OPXA 4IUKA 1KGEA 4KQDA 3HREA 5F1GA 1OJGA 5A90A 5L2FA 4Y3IA 2EXBA 2WKIA 3U4LP 5FEFA 2HDRA 3RXWA 2HGVA 1YLPA 2BTFP 3KSGA 2H0TA 3AGFA 4KZ4A 2Y91A 1ODVA 5TBMB 3IXHA 2VA0A 1T1BA 5E2FA 5DF8A 5FSRA 4HJ4A 4E3MA 4P6ZM 4FUWA 5DKKA 2KX6A 4HH3A 2G2UA 3CUEC 1FSYA 3PBOA 5KIZA 3SH9A 4OPYA 1OMEA 1H0MA 3NECA 2EX8A 4ARZA 2K31A 3E4PA 3KYEA 5CTNA 2HP9A 4WZ5C 5FI6A 1PYYA 3KO6A 5EVID 4MLLA 1D7EA 1DP6A 3IX8A 3VV4A 2WAFA 1IYQA 1E25A 1BUEA 5FQMA 1PZOA 2G2WA 4BBUA 5LBRA 1OT9A 5CEBA 1J9MA 4C75A 5FAOA 1EI5A 5HZHA 2Y2KA 1E4DA 4R0QA 3EEHA 3E2LA 3LIDA 3ZNTA 4E6WA 4I3AA 5G4ZA 3O86A 5HWVA 2WGVA 4G3WA 4PAUA 1ERMA 4OLGA 3GTCA 4KG2A 5FQKA 2XQZA 4NEED 3SH7A 4IBRA 4EERA 2Q0OA 2BG1A 2WKRA 1PNEA 1DJCA 1H5XA 1UWPX 2JKRM 4I5SA 5HL6A 4JBFA 3IX4A 5DKLA 4K0XA 3V67A 2WADA 3OCLA 2ZL1A 2WK0A 2P7JA 5FDHA 3T4SA 4WLAA 1Z09A 3GSGA 4Y5FA 4ZRRA 4LV2A 5AJGA 4HIAA 3NCKA 1EWZA 1YAXA 4OQGA 3BY8A 1PFLA 2X71A 4KZ7A 3JVUA 4L9EA 1NLYA 1K0KA 1GSXA 3DTMA 2UV0E 3FG8A 4MN6A 3IF6A 4KZ3A 5DTTA 4KZBA 5GLBA 1BLPA 3O87A 4JLFA 2Y79A 4II7A 3VSLA 5CHJA 1TF1A 1MKMA 2J8YA 4DRTA 4HOIA 3PXPA 2HJEA 3ZYTA 2LB9A 4EEUA 2H10A 3OPPA 3EEAA 3VP0A 1KGFA 4M4XA 2JKGA 1XKZA 4ID4A 4Y17A 5DTSA 3P98A 4GN2A 4KUKA 2W0NA 4LPZA 2XA7S 4DE1A 3H7WB 3CITA 3F1PB 1LSVA 4FOFA 4PM7A 5DFYA 4I38A 4K91A 3NULA 3TW8A 3UPOA 3FPWA 1PWGA 3QP1A 4YINA 4OPRA 2LB5A 5GLDA 2A24B 4I39A 2O0YA 3LIAA 1FIKA 4I3JA 3KSHA 1DRMA 2DRWA 3LY4A 5L8MA 5CX7A 5EECA 3VE4A 4HI4A 4B4ZA 2JC7A 4S2NA 4O01A 2CMNA 4O0PA 5A8BA 1SKFA 5FQJA 2Y2PA 4WZ4A 4NXFA 3T12B 3KYQA 3ULFA 5F82A 3ZGAB 4BD0A 1MXOA 4WF0A 4BLMA 1EW0A 4KZAA 1IYPA 1PRQA 2Y8HA 3C30A 3UO9A 1ACFA 3S7QA 4QB8A 2PU2A 3UMEA 5KMWA 3D3OA 1XX2A 4GLQA 4BWIA 3E4OA 1W7FA 5FL3A 1BULA 4R3JA 2VX8A 2D02A 4GD8A 2QJ5A 3MKFA 3B3XA 5FEGA 2WKQA 4L0LA 1YLJA 1ES2A 5HW3A 4JF5A 4GCZA 4WMCA 1K55C 3BJNA 2O9CA 2O9AA 2PR6A 5TJJA 1GA9A 3FKWA 4RQ9A 5AQAA 4ZDXA 4Q0JA 3C2WA 4DXCA 4E6XA 3PTEA 4UA7A 3SS3A 4HNBA 1KE4A 4IHQA 4Y2FA 2X02A 3A3JA 2A2LA 3NHQA 4EESA 1PW1A 2ZQ8A 1IKGA 2QWSA 2I9VA 4OH0A 3RXXA 3VOZA 3ZG9B 2Z6CA 4OP8A 4NK3A 2HJ9C 1I2WA 3G2ZA 2XSSA 1DJBA 3IXDA 4HJ3A 5CHUA 4OOLA 3EQUA 2J9OA 1VEUB 4QU3A 5CRFA 1K54C 3GR2A 4GHIB 1T18A 4JGOA 1ZG6A 3H7WA 4PM6A 3F1PA 3W4QA 3CJMA 4LGWA 1W63M 3T1XA 4XT2B 5DVAA 4X53A 5EVLA 5HDDA 1HTZA 1NRJA 1HLUP 4BBTA 1DY6A 4EWFA 2A24A 3C5AA 4PM9A 1F2KA 2XD5A 2PBDP 4LFUA 4RA7A 3RFBA 5FASA 3FYZA 1XA1A 1BSGA 4PM5A 3NDGA 2O99A 1CEFA 1ONHA 3IHAA 1TS7A 1SHVA 3M6HA 4JXSA 5GL9A 1XP4A 1DP9A 2VK3A 4R6LA 1X0OA 2EX9A 3QP5A 4RX2A 1TS6A 2VGLS 5EM1A 1FQGA 2W3GA 2XR0A 4UEYA 2HDQA 3ITAA 1ZKJA 4MBKA 1KDWA 4GS9B 4JGRA 3UE3A 5F6AA 4EU0A 3QNBA 4OPQA 3IWOA 2PBYA 1T19A 2B18A 2HDUA 4CPKA 1IYSA 4QPRA 1ZTUA 3IQAA 3N6IA 4BBVA 5BOHA 3I7JA 2Y2HA 1LHYA 3EWKA 4F3LB 1NZOA 2P08A 4P6ZS 1ESUA 2JCHA 3S7PA 4EUZA 1KE0A 2W3DA 2EWWA 3CUEA 2WKPA 4P6BA 4ZJ2A 3FKVA 4HQAA 3T4KA 2C6WB 1YM1A 1NLZA 1WYBA 1FCNA 4WZ5A 5EE8A 1GHIA 1L3LA 3JVVA 3VFHA 2DMWA 1OTAA 3LR3A 3ZG7B 5EVEA 3VP4A 3LEQA 4C3QA 2OWHA 4R4RA 3UE6A 3IWQA 5CHMA 4D2OA 4ETZA 1MWRA 3B42A 3EOIA 4PPRA 4UA6A 3LY3A 1STZA 2E8IA 5DF9A 4PKYA 1TDLA 3V5MA 4GHIA 4PMAA 4NG2A 2RL3A 3MQ0A 2XF3A 2WGWB 1PWCA 3BLMA 5D3OA 3ISGA 3TSGA 3A0VA 3IS2B 5CGXA 3WS1A 3GRJA 4XT2A 4YOFA 1KE3A 4EBPA 1OT6A 3DAVA 3LFVA 4E3LA 2VGLM 1MC0A 4L9FA 4CLCB 4OLDA 4QY6A 3GDIA 3MZFA 2M7UA 3GV9A 2HDSA 1GSVA 3B33A 1T1AA 4NKPA 2MJ6A 4E3KA 3A3EA 1WYCA 1KGGA 3CWFA 5GHXA 2NUPC 2WKEA 2WYXA 4GJ4A 4ZJ3A 3BM6A 3G32A 3TE8A 1XJ3A 4P0MA 1C3BA 1HVBA 2YKHA 2A3UA 5IT5A 2FH5A 1MWUA 4MN7A 4OOMA 1NWZA 1XPBA 5L09A 3A3IA 1G5UA 3HUOA 3G2YA 3C4OA 4MEZA 1YLTA 2IA2A 4R3AA 4EXOA 3IF5A 2Y59A 4K0WA 2Z2LB 3ZVWA 2G7UA 3T4LA 1JNUA 2XRNA 3UNWA 4EW7A 1L0EA 5G18A 4QWOA 4GS9A 2PR5A 4RVAA 3C38A 3G31A 4H6JB 2O9BA 4JKTA 3CAXA 2WZZA 1LLBA 1S1YA 5M18A 3HLDA 3PBQA 3A0RA 3CZDA 4S2PA 3LI8A 3PBSA 4JGQA 1PI5A 3VFFA 2ZC5B 3R7WA 2PDRA 3Q7ZA 3CHWP 1RGYA 3VMAA 3EGXC 3PR6A 5JYOA 2HF6A 2PT7A 1W8QA 4AFIA 2PD7A 1NY0A 5EVIB 3OPHA 3N7WA 4N9KA 1XFNA 2GNXA 3NDEA 1TVFA 5GHZA 2ZC3B 1M40A 4XUZA 3OCNA 3WS0A 1F5MA 4FD8A 3N4IA 4WUJA 5TGFA 2PRFA 4ZJ1A 5CERA 1JWZA 4KG6A 4U0XA 4G3KA 4M3KA 2Z2MB 1H8YA 2R9WA 3DTIA 5I94A 1SKOB 2H5SA 2I72A 5L07A 1XJ4A 4R3BA 1JVJA 4Y13A 1O7EA 1N9OA 1S67L 2ZBBA 1BLCA 4EBNA 3FZCA 1XJ6A 5FAQA 3C7UA 3LYXA 2IWDA 2GZAA 3PHYA 3OBFA 4B93A 3BRMA 4JGPA 4OOYA 4U0TA 3HLBA 3W2ZA 1S66L 4DJ3A 4CLCE 3IS2A 3MKEA 2BASA 1D06A 4GZBA 1Y28A 2L1MA 1MBLA 5EUAA 1XA7A 2KOIA 5HPIA 1BYWA 4LRYC 4Y7PA 4JXGA 1YSPA 1UGUA 3C7VA 3EGDC 3JYIA 1P97A 3MR0A 3ZCZA 5AQBA 4X68A 5TBMA 1W8YA 4UA9A 4DDYA 2VGKA 5HD3A 2OV5A 3LCEA 3W4PA 1K56A 4XUXA 3LIBA 3G30A 4CQHA 5TR7A 2INWA 4Q0HA 1JTGA 3BQAA 4X69A 2Y2LA 3DW0A 1N9NA 1K55A 4LV0A 4IVIA 2EFXA 4HY8A 1IELA 3PBTA 4X1MA 4H6JA 1L0GA 3RTYA 3OZHA 3WRZA 2B95A 2W3HA 4Y15A 4MNRA 4A5RA 5FDSA 4BL3A 5U47A 1FR1A 2VV6A 1L0DA 2QMIA 4Z9QA 1TDGA 4R4SA 4YFMA 3IX3A 2IWCA 1FOFA 3NOPC 5AQ9A 2P9VB 1LSWA 5EVIA 1GA0A 1K54A 4UAAA 4FH2A 3MSHA 1FCOA 3WWXA 3NC8A 3QP8A 2Q9NA 3MQQA 3D72A 3S4XA 3FC7A 5HD5A 4CLCC 5DTKA 4EQ1A 3E0YA 2B5RA 1ERQA 1ZG4A 4JF6A 4MMNA 1YSQA 2L0WA 4KQOA 4I3IA 1JTDA 3N8SA 4S2LA 2Y2JA 4G3VA 1CF0A 3T50A 5L10A 2KLIA 4QHCA 3G6OA 3E98A 5DFXA 2ACGA 2J3WA 1K4FA 3Q81A 5CEDA 4O8GA 3AGDA 3UDFA 4DE2A 3UPNA 3NIAA 3IHBA 3OC2A 5EV0A 2CC1A 4KQQA 2J3TD 3PYPA 3NBLA 4EQIA 3LIFA 4ETXA 2BLSA 2VLGA 5F83A 1XGIA 1I5QA 4RX3A 1XGJA 3UE1A 3F1NB 2PHYA 1OTEA 4LRXC 1F9IA 1PZPA 1LL9A 3T1QB 3BY9A 3T4TA 4HEFA 3Q07A 3ZG0A 3DTEA 3HJKA 3U2AA 1ES4A 1U60A 3LGOA 1Z6FA 4DXBA 1RGZA 4OQHA 2WKHA 2FZ0A 3G34A 3M2KA 1VHMA 5EVIC 5FATA 3SOIA 3ITBA 2HV1A 1SCWA 5FA7A 1N9BA 3BECA 3WS4A 2Y2QA 1YLZA 4UHUA 1YQSA 4ESPA 1Y4OA 3LEZA 4GB7A 4KG5A 3R4KA 1VQQA 4HESA 4HH2A 3V50A 3HUMA 5A92A 5HWTA 1E3UA 3B47A 1KOUA 1LL5A 2ZOIA 1CI9A 4DN0A 3BYDA 5M19A 5FQ9A 2Y2OA 2QZ6A 2WAEA 2EX6A 4GOGA 3OPLA 5HL1A 1PIOA 4DKIA 2OOLA 5HAPA 4NXBA 4PKYG 1AXBA 1UWNX 2GDNA 3RH8B 2V1ZA 4JXWA 1YMXA 2ZOHA 3SS4A 2VGJA 3MFXA 3FWLA 3IXGA 3VP2A 2W1TB 3O3VA 3UY6A 3H9WA 1K4EA 4S2MA 2OLVA 1IFQA 2JE5A 4R1GA 4MBFA 5K5BA 5E2HA 4S2IA 3MMHA 3MXQA 1VB6A 4FSFA 1BZAA 4WYYA 5HFOA 3C8CA 5J7EA 3K3DA 3FPVA 3RJUA 2XD1A 4DF6A 3PAEA 4ARZB 3QHYA 3UB7A 3QP2A 2IWBA 3CPTB 2QHKA 4DJ2A 5IU1A 4OONA 3PBRA 1H8MA 3KX0X 4MCWA 2ZQ9A 4WEKA 4EETB 3HLWA 2OSUA 1MWTA 4KZ6A 1P9RA 3H82B 2ZMVA 5F5YA 2J80A 2R9XA 1VETB 1TEMA 1W63Q 5I5LA 2Y2NA 3LR5A 3VP3A 1OTDA 1LI9A 3GECA 3DWKA 1XFQA 1FCMA 2DCFA 1H3QA 3F1NA 4E3NA 3HLGA 1HD8A 4WBGA 4LRZE 3DBAA 3A3FA 3S7OA 2ZMFA 4JF4A 1NJ4A 2VEAA 4S2JA 4EUVA 4Z1WA 2QPNA 3P09A 1K57C 4OKPA 3LIEA 4HP4A 2FFFB 4DE0A 2DNSA 2Y2GA 4NXEA 2M7VA 1VEUA 2EXAA 2V2FF 2ZC6B 5DJTA 3T1RA 1N4OA 2RCXA 4OVDA 1S1ZA 1QMEA 1WA9A 1ES5A 1GHMA 3LR0A 3BFCA 1S0WA 1CJFA 4N1HA 5A93A 4N92A 1XJ2A 2ZQ7A 2R78A 1S4SA 3ZDJA 2WGIA 3VP1A 5AQ7A 3KSIA 1P9WA 2YKFA 4Q0IA 2UWXA 4WEJA 4KZ5A 1KDSA 2W27A 1NZUA 5AVEA 1BTLA 1K38A 1MY8A 1K6SA 1K56D 3HJIA 4R38A 2L4RA 2OAP1 2ZMAA 2OLUA 4R23A 4JPMA 4OPZA 4HBTA 3IF6B 3TG9A 2VZWA 2PYRA 3BW6A 2VV7A 1G6OA 4GW9A 1RP5A 3ZNYA 4QJGA 2Y4AA 3IBJA 2W1RA 4KENB 2HPBA 1W5DA 4X1LA 2FFYA 5FI2A 2W1TA 2J7VA 4ME4A 5CGWA 1IOUA 4LENA 1NYMA 4U3TA 4IEDA 1ONGA 2WZXA 2ZQAA 4DDSA 1SDNA 2Q9MA 4YWZA 5HX9A 3HBRA 2W3EA 3QP4A 3L9KA 4E3OA 1G68A 1LSXA 5G4YA 2XFTA 2VJWA 1MWSA 2HP5A 4S2OA 2XLNA 1ES3A 1W79A 4YNRA 3UPPA 3CPTA 4F3LA 3TJZC 1PI4A 3CI6A 1GSWA 3E4QA 5HPFA 1ZC2A 2A49A 4WN5A 3GVBA 2J3TC 5AVFA 4FTXA 4LLOB 3H82A 4HP9A 3IT9A 5J4EA 4LV1A 1BT5A 1VETA 5IHVA 2D01A 3NOTC 5CGSA 2X01A 5M1AA 4Y0TA 3Q1FA 4GD6A 5A91A 4BMWA 1YMSA 2GJ3A 3CG5A 3V3SA 2XFSA 4B4XA 4BJPA 4F94A 4WL9A 2ZC7A 1WE4A 1OTIA 1BLHA 3O88A 3GMWA 3HLFA 3M6BA 3PBNA 4D60A 3ZQ5A 3NJAA 2NUTC 4UQIS 2JN7A 2OWJA 5HSQA 4IUHA 4GDNA 3NI9A 3MXSA 3HCYA 1IYOA 4RYEA 4WM9A 3HUNA 1K6RA 1YT4A 2V20A 4WMCD 2H0YA 1IEMA 1CI8A 3WS5A 3G4PA 1FSWA 2WGWA 4P87A 5FQQA 4JXVA 3SZTA 2PAVP 1L2SA 5E2GA 4ZBEA 2PU4A 3V3RA 1TD5A 4CLCA 2XDMA 3S22A 5HAIA 3MJQA 2ZM2A 4O7DA 3IBRA 3E2KA 5MC7A 2Y2MA 3BFGA 4B88A 2ZD8A 3IWIA 3WS2A 3C4PA 1MKIA 1QMFA 3ZG5A 4LCLA 3UDIA 4HBUA 2ZC4B 5KSCA 3JPUA 4E3IA 2P74A 3QNCA 2GX5A 3BFEA 3M2JA 2PYPA 1E3UD 3A3DA 1NXYA 2V9AA 2J9PA 4X25A 3NOUC 3G35A 1NRFA 4CJNA 1CK3A 4N1XA 1G28A 3LUQA 3W8KA 4P85A 4ZAMA 3K3CA 3ZG8B 2V0WA 5GHYA 1KVMA 4UQIM 3TRCA 3HVFA 5F68A 2C5WB 3GQZA 4MBHA 3VSKA 2AVXA 3QP6A 5F69A 2JBFA 5CXWA 1SZVA 5J8XA 3T4JA 3V39A 4H8RA 4QY5A 4KUOA 2HZ5A 3PAGA 1ALQA 4E04A 2QJ7A 3S1YA 4EBLA 1CEGA 3BWLA 1XXMA 5DF7A 5FQIA 3ZHHA 3MZDA 1NYYA 1A0KA 3IXBA 1GCEA 2JKTI 2KDKA 1SKOA 4E3JA 3IF6C 5GLCA 4X56A 5E2EA 5EPHA 3KYZA 2OAQ1 2XH9A 2ZQDA 1OTBA 4LV3A 4C6YA 4Y0OA 3F1OB 1J3WA 2VV8A 2W3FA 2ZM8A 3Q82A 4FH4A 1H8ZA 1S6RA 4EV4A 3OPRA 5EOOA 4R70A 5E43A 1EROA 2EX2A 2JHEA 2ZM0A 3VE3A 5CECA 3LICA 3CLOA 3MBZA 2B02A 5KZHA 4GDBA 3D9YA 3UB8A 3S7NA 3N8RA 3TOIA 2V8FA 3SW1A 3IH8A 4Q8IA 3P7NA 1KVLA 1YKDA 2K7SA 1PW8A 2XA7M 3ZFZA 2Y2IA 1ZHHB 2XK1A 3LI9A 1F98A 4KZ9A 1TS8A 4EEPA 1V9ZA 3SH8A 1ESIA 2EFUA 1LT0A 1P0ZA 3DTKA 1MPLA 5FI7A 3P01A 1VM1A 4IVKA 5EM0A 2HP6A 3UB5P 4OQ0A 1LL8A 1I2SA 2M1CA 3AGEA 3Q7VB 2XGNA 4LCMA 3UDXA 4S2NC 5HAQA 1Q2PA 3OOVA 3BEBA 3W4OA 2EA9A 3BQ8A 5GLAA 5KSHA 5FAPA 3L7HA 4OQIA 3MF0A 1JWPA 4NETA 3T4OA 4S2KA 1T1CA 3MZEA 4IBXA 4KQRA 2JKRI 1IKIA 1K57A 1GHPA 5EOEA 2V1AA 3BFDA 4PHTA 3SS5A 2P9VA 4IJGA 3UB6A 3OLOA 3BLSA 5J3WA 5HWWA 1FILA 2K2NA 1YLWA 5IS1A 3FV7A 5EFWA 3CMZA 2E8JA 3IH9A 2JKFA 4NXGA 4OP5A 2XROA 3HL9A 3MFDA 1MZUA 3ZVTA 2V1BA 4B9OA 4BD1A 3HLEA 5TFQA 4N9LA 1HZOA 1BLSA 3EQVA 1AWIA 3VOLA 3A0SA 3UE0A 4Y0UA 4WELA 3MXRA 2P04A 5C5KA 4DE3A 1G6AA 1CQAA 4GKUA 3F1OA 4FCFA 1D1JA 4MN5A 3LO7A 1YLYA 4L9GA 3T4QA 3MQOA 2QKPA 3R7WB 3WRTA 4X55A 3KSFA 2ZJ9A 1DJAA 4ZTKA 3LR4A 2Y55A 1Q2QA 5DJUA 4HJ6A 1YPRA 5CTMA 5F1FA 4BQMA 3K2NA 3MS6A 1FR6A 1JWVA 2V8CA 1O07A 1OJ5A 2Z6DA 2H28A 1LI0A 3HLCA 1N9LA 2PD8A 1M6KA 1PWDA 4HHDA 5HDSA 3UMDA 5HDCA 3N8LA 4X6TA 2V0UA 2EWVA 3BFFA 4XXRA 5JYPA 4KZ8A 4CLCD 1L0FA 2ZL1B 4QD4A 4PM8A 2QYBA 2XEPA 2ZQCA 3UN7A 4DMZA 3O5YA 3Q7VA 3UB9A 4BENA 1SDEA 3T1SA 1K25A 3DWZA 3D4FA 1RCJA 3VOYA 5HARA 2ZLYA 3NY4A 1DP8A 1S4RA 3ICYA 2VKSA 2WUQA 4MDZA 4GNUA 4K08A 4BL2A
chains in the Genus database with same CATH topology
2JKTM 1TS7A 1TS0A 1V9YA 1OPXA 4IUKA 4MMNA 4KQDA 1YSQA 1OJGA 1DP9A 4Y3IA 2L0WA 4KQOA 4R6LA 4I3IA 1TD5A 1X0OA 4CLCA 2HGVA 4G3VA 3T50A 3MJQA 3IBRA 1TS6A 5MC7A 3KSGA 2VGLS 2KLIA 2W3GA 3G6OA 3E98A 1ODVA 5TBMB 2VA0A 4UEYA 1T1BA 5DFXA 4GS9B 4JGRA 3UE3A 5F6AA 2J3WA 4EU0A 4HJ4A 4O8GA 1T19A 2B18A 4P6ZM 5DKKA 2KX6A 4HH3A 3OC2A 3CUEC 4QPRA 1ZTUA 4BBVA 2J3TD 3PYPA 3PBOA 5KIZA 3LIFA 4ETXA 3EWKA 4F3LB 2VLGA 4ARZA 2P08A 2K31A 3E4PA 4P6ZS 2GX5A 3S7PA 3KO6A 3F1NB 2W3DA 2PHYA 1OTEA 2EWWA 2PYPA 4LRXC 3CUEA 1D7EA 1DP6A 1F9IA 2WKPA 3VV4A 2V9AA 3BY9A 4HQAA 3T4KA 3T4TA 1NLZA 3NOUC 3HJKA 3U2AA 1G28A 3LUQA 2FZ0A 3JVVA 3K3CA 2V0WA 1VHMA 4BBUA 5LBRA 1OT9A 2DMWA 1OTAA 3LR3A 4UQIM 3TRCA 5F68A 5HZHA 3EEHA 2HV1A 3LIDA 2OWHA 4I3AA 3UE6A 5G4ZA 5F69A 5HWVA 4ETZA 3R4KA 4G3WA 3B42A 3T4JA 3EOIA 4HH2A 4PAUA 4KUOA 5HWTA 4E04A 4NEED 1STZA 2QJ7A 3B47A 1KOUA 2ZOIA 4EERA 5DF9A 4PKYA 4DN0A 2WKRA 4GHIA 1UWPX 2JKRM 4I5SA 3BWLA 3MQ0A 5HL6A 5DKLA 2OOLA 3V67A 3A0VA 3IS2B 4NXBA 4PKYG 4XT2A 3OCLA 4YOFA 2P7JA 1OT6A 3LFVA 1UWNX 3RH8B 2VGLM 1MC0A 4L9FA 4CLCB 3T4SA 4WLAA 3GDIA 4Y5FA 4ZRRA 2JKTI 2ZOHA 2KDKA 5AJGA 2M7UA 4HIAA 3MFXA 1GSVA 2W1TB 3B33A 1T1AA 1YAXA 3H9WA 4NKPA 2MJ6A 3BY8A 3KYZA 1IFQA 3CWFA 2NUPC 2OAQ1 4GJ4A 1OTBA 3F1OB 5K5BA 3TE8A 2VV8A 2W3FA 3MMHA 4L9EA 1XJ3A 3JVUA 1NLYA 3MXQA 1VB6A 4FSFA 2YKHA 5IT5A 4R70A 1GSXA 2FH5A 3FG8A 4MN6A 2JHEA 3C8CA 3VE3A 4MN7A 5J7EA 4OOMA 3LICA 3CLOA 3K3DA 3FPVA 2B02A 1NWZA 4ARZB 3UB7A 3UB8A 3S7NA 2Y79A 2IA2A 2QHKA 4R3AA 4EXOA 4II7A 4DJ2A 5IU1A 3PBRA 2G7UA 1TF1A 3SW1A 1MKMA 3T4LA 1JNUA 1H8MA 2XRNA 3KX0X 4MCWA 4WEKA 4HOIA 3P7NA 4EW7A 4EETB 1YKDA 3PXPA 2K7SA 2HJEA 4GS9A 1P9RA 3ZYTA 2PR5A 3H82B 3C38A 2ZMVA 2XA7M 4H6JB 2LB9A 4EEUA 5F5YA 2J80A 2O9BA 3CAXA 1W63Q 3EEAA 1S1YA 4M4XA 5I5LA 1ZHHB 3PBQA 3LI9A 1F98A 3A0RA 3LR5A 1OTDA 3LI8A 1TS8A 3GECA 4EEPA 1V9ZA 3PBSA 4JGQA 4KUKA 2W0NA 4LPZA 2XA7S 1XFQA 3R7WA 1LT0A 1P0ZA 2PDRA 3H7WB 3CITA 3F1PB 1LSVA 4FOFA 5DFYA 3P01A 1H3QA 3F1NA 3EGXC 4I38A 3PR6A 2HF6A 2PT7A 4AFIA 2PD7A 3DBAA 4LRZE 3S7OA 3TW8A 2ZMFA 1LL8A 2M1CA 3FPWA 1XFNA 2VEAA 4EUVA 2GNXA 4Z1WA 2LB5A 3OOVA 2A24B 3LIEA 2EA9A 3BQ8A 4HP4A 4I39A 2O0YA 3LIAA 5KSHA 4I3JA 3KSHA 1DRMA 4NXEA 5L8MA 2M7VA 5CX7A 5DJTA 3MF0A 3VE4A 3OCNA 4HI4A 1F5MA 1S1ZA 3T4OA 1WA9A 4WUJA 1T1CA 3LR0A 2JKRI 4O01A 2CMNA 2V1AA 4O0PA 5A8BA 4PHTA 4G3KA 1XJ2A 2R78A 1S4SA 4NXFA 3KYQA 4IJGA 3UB6A 3OLOA 3ULFA 3KSIA 5J3WA 5HWWA 1XJ4A 1P9WA 2YKFA 4WF0A 2K2NA 1N9OA 1S67L 1EW0A 2ZBBA 4Q0IA 4WEJA 2W27A 5IS1A 2Y8HA 1XJ6A 5AVEA 3C30A 5EFWA 3LYXA 2GZAA 3HJIA 3PHYA 3OBFA 4R38A 2L4RA 2OAP1 4JGPA 4NXGA 3S7QA 4B93A 2XROA 3W2ZA 1S66L 1MZUA 2V1BA 3UMEA 4DJ3A 4CLCE 4B9OA 3D3OA 3IS2A 2BASA 1D06A 2VZWA 2PYRA 3BW6A 2VV7A 1G6OA 4GLQA 3E4OA 4BWIA 1Y28A 2L1MA 4GW9A 3EQVA 3IBJA 2KOIA 5FL3A 2W1RA 5HPIA 3VOLA 3A0SA 1BYWA 4LRYC 2VX8A 4WELA 1YSPA 2D02A 2P04A 2QJ5A 5C5KA 2W1TA 4ME4A 1UGUA 2WKQA 3EGDC 1IOUA 4L0LA 1P97A 3MR0A 5TBMA 3F1OA 4GCZA 4YWZA 4MN5A 3BJNA 2O9CA 2O9AA 2W3EA 5HD3A 2PR6A 5TJJA 1LSXA 4RQ9A 5G4YA 3LIBA 4L9GA 3T4QA 2VJWA 4Q0JA 3C2WA 3MQOA 2QKPA 4CQHA 2INWA 3R7WB 4Q0HA 4HNBA 4YNRA 4IHQA 3BQAA 3KSFA 4Y2FA 1N9NA 2A2LA 3NHQA 3TJZC 4F3LA 3LR4A 3CI6A 4EESA 1GSWA 3E4QA 5HPFA 2QWSA 4WN5A 5DJUA 4HJ6A 2I9VA 4HY8A 2J3TC 5AVFA 4LLOB 3PBTA 3H82A 4HP9A 4H6JA 2Z6CA 3K2NA 5J4EA 2HJ9C 3RTYA 2XSSA 1OJ5A 2Z6DA 4HJ3A 2W3HA 2H28A 2D01A 1N9LA 3NOTC 2PD8A 4HHDA 4OOLA 3EQUA 5HDSA 3UMDA 5HDCA 4GHIB 1T18A 4JGOA 4BMWA 2GJ3A 2V0UA 2EWVA 3H7WA 4BJPA 2VV6A 3F1PA 4WL9A 1OTIA 1W63M 3PBNA 4XT2B 4CLCD 3ZQ5A 3NJAA 3NOPC 2NUTC 4UQIS 1LSWA 2JN7A 2QYBA 5HDDA 2OWJA 5HSQA 4DMZA 1NRJA 3O5YA 3UB9A 4IUHA 4BBTA 2A24A 3HCYA 3MQQA 3D72A 3RFBA 3FC7A 5HD5A 4CLCC 1DP8A 1S4RA 3ICYA 2VKSA 4EQ1A 3E0YA 4MDZA 2O99A 4K08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TS7 A;  1TS0 A;  1V9Y A;  4KQD A;  1OJG A;  1DP9 A;  2L0W A;  4R6L A;  4I3I A;  1X0O A;  3T50 A;  3MJQ A;  3IBR A;  1TS6 A;  3G6O A;  1ODV A;  5TBM B;  1T1B A;  4GS9 B;  4JGR A;  5F6A A;  4HJ4 A;  1T19 A;  5DKK A;  2KX6 A;  4HH3 A;  4BBV A;  3PYP A;  5KIZ A;  3LIF A;  3EWK A;  4F3L B;  2VLG A;  3E4P A;  3F1N B;  2PHY A;  1OTE A;  2PYP A;  4LRX C;  1D7E A;  1DP6 A;  1F9I A;  2WKP A;  2V9A A;  3BY9 A;  4HQA A;  3NOU C;  3HJK A;  1G28 A;  3LUQ A;  3K3C A;  2V0W A;  4BBU A;  1OT9 A;  1OTA A;  5F68 A;  5HZH A;  3EEH A;  2HV1 A;  3LID A;  2OWH A;  4I3A A;  3UE6 A;  5G4Z A;  5F69 A;  5HWV A;  4HH2 A;  4KUO A;  5HWT A;  4E04 A;  2QJ7 A;  1KOU A;  2ZOI A;  4EER A;  4PKY A;  2WKR A;  4GHI A;  1UWP X;  4I5S A;  3BWL A;  5DKL A;  2OOL A;  3A0V A;  3IS2 B;  4NXB A;  4PKY G;  4XT2 A;  2P7J A;  1OT6 A;  1UWN X;  3RH8 B;  4L9F A;  4WLA A;  3GDI A;  2ZOH A;  2KDK A;  4HIA A;  3MFX A;  1GSV A;  3B33 A;  1T1A A;  3H9W A;  3BY8 A;  3CWF A;  1OTB A;  3F1O B;  2VV8 A;  4L9E A;  1XJ3 A;  3MXQ A;  1VB6 A;  2YKH A;  4R70 A;  1GSX A;  3FG8 A;  4MN6 A;  2JHE A;  3C8C A;  3VE3 A;  5J7E A;  3LIC A;  3CLO A;  3K3D A;  2B02 A;  1NWZ A;  3UB7 A;  3UB8 A;  2QHK A;  4R3A A;  4EXO A;  4DJ2 A;  5IU1 A;  3SW1 A;  1JNU A;  3KX0 X;  4EW7 A;  4HOI A;  3P7N A;  4EET B;  2K7S A;  4GS9 A;  2PR5 A;  3H82 B;  4H6J B;  4EEU A;  5F5Y A;  2J80 A;  3CAX A;  1S1Y A;  4M4X A;  5I5L A;  3LI9 A;  1F98 A;  3A0R A;  1OTD A;  3LI8 A;  1TS8 A;  3GEC A;  4EEP A;  1V9Z A;  4KUK A;  4JGQ A;  2W0N A;  4LPZ A;  1XFQ A;  1LT0 A;  1P0Z A;  2PDR A;  3H7W B;  3F1P B;  1LSV A;  3F1N A;  4I38 A;  2PD7 A;  4LRZ E;  1LL8 A;  2M1C A;  1XFN A;  2VEA A;  2A24 B;  3LIE A;  2EA9 A;  4HP4 A;  4I39 A;  3LIA A;  4I3J A;  1DRM A;  4NXE A;  5DJT A;  3VE4 A;  4HI4 A;  1S1Z A;  1WA9 A;  4WUJ A;  1T1C A;  2CMN A;  2V1A A;  5A8B A;  1XJ2 A;  2R78 A;  1S4S A;  4NXF A;  3UB6 A;  3OLO A;  3ULF A;  5J3W A;  5HWW A;  1XJ4 A;  2YKF A;  4WF0 A;  1N9O A;  1S67 L;  1EW0 A;  2ZBB A;  2W27 A;  5IS1 A;  1XJ6 A;  5AVE A;  5EFW A;  3LYX A;  3HJI A;  3PHY A;  4R38 A;  2L4R A;  4JGP A;  4NXG A;  1S66 L;  1MZU A;  2V1B A;  3UME A;  4DJ3 A;  4B9O A;  3IS2 A;  2BAS A;  1D06 A;  2PYR A;  2VV7 A;  3E4O A;  1Y28 A;  2L1M A;  4GW9 A;  3VOL A;  3A0S A;  1BYW A;  4LRY C;  2D02 A;  2QJ5 A;  1UGU A;  2WKQ A;  1P97 A;  3MR0 A;  5TBM A;  3F1O A;  4GCZ A;  4YWZ A;  4MN5 A;  5HD3 A;  2PR6 A;  1LSX A;  4RQ9 A;  5G4Y A;  3LIB A;  4L9G A;  3C2W A;  3MQO A;  2QKP A;  2INW A;  4HNB A;  1N9N A;  4F3L A;  3NHQ A;  4EES A;  1GSW A;  3E4Q A;  2QWS A;  4WN5 A;  5DJU A;  4HJ6 A;  2I9V A;  4HY8 A;  5AVF A;  4LLO B;  3H82 A;  4HP9 A;  4H6J A;  2Z6C A;  5J4E A;  3RTY A;  1OJ5 A;  2Z6D A;  4HJ3 A;  2H28 A;  2D01 A;  1N9L A;  3NOT C;  2PD8 A;  4HHD A;  5HDS A;  3UMD A;  5HDC A;  4GHI B;  1T18 A;  4JGO A;  2GJ3 A;  2V0U A;  3H7W A;  2VV6 A;  3F1P A;  4WL9 A;  1OTI A;  4XT2 B;  3ZQ5 A;  3NJA A;  3NOP C;  1LSW A;  2JN7 A;  5HDD A;  2OWJ A;  5HSQ A;  3UB9 A;  4BBT A;  2A24 A;  3MQQ A;  3D72 A;  3FC7 A;  5HD5 A;  1DP8 A;  1S4R A;  3ICY A;  4EQ1 A;  4K08 A; 
#chains in the Genus database with same CATH topology
 2JKT M;  1V9Y A;  1TS0 A;  1Y54 A;  1OPX A;  4IUK A;  1KGE A;  4KQD A;  3HRE A;  5F1G A;  1OJG A;  5A90 A;  5L2F A;  4Y3I A;  2EXB A;  2WKI A;  3U4L P;  5FEF A;  2HDR A;  3RXW A;  2HGV A;  1YLP A;  2BTF P;  3KSG A;  2H0T A;  3AGF A;  4KZ4 A;  2Y91 A;  1ODV A;  5TBM B;  3IXH A;  2VA0 A;  1T1B A;  5E2F A;  5DF8 A;  5FSR A;  4HJ4 A;  4E3M A;  4P6Z M;  4FUW A;  5DKK A;  2KX6 A;  4HH3 A;  2G2U A;  3CUE C;  1FSY A;  3PBO A;  5KIZ A;  3SH9 A;  4OPY A;  1OME A;  1H0M A;  3NEC A;  2EX8 A;  4ARZ A;  2K31 A;  3E4P A;  3KYE A;  5CTN A;  2HP9 A;  4WZ5 C;  5FI6 A;  1PYY A;  3KO6 A;  5EVI D;  4MLL A;  1D7E A;  1DP6 A;  3IX8 A;  3VV4 A;  2WAF A;  1IYQ A;  1E25 A;  1BUE A;  5FQM A;  1PZO A;  2G2W A;  4BBU A;  5LBR A;  1OT9 A;  5CEB A;  1J9M A;  4C75 A;  5FAO A;  1EI5 A;  5HZH A;  2Y2K A;  1E4D A;  4R0Q A;  3EEH A;  3E2L A;  3LID A;  3ZNT A;  4E6W A;  4I3A A;  5G4Z A;  3O86 A;  5HWV A;  2WGV A;  4G3W A;  4PAU A;  1ERM A;  4OLG A;  3GTC A;  4KG2 A;  5FQK A;  2XQZ A;  4NEE D;  3SH7 A;  4IBR A;  4EER A;  2Q0O A;  2BG1 A;  2WKR A;  1PNE A;  1DJC A;  1H5X A;  1UWP X;  2JKR M;  4I5S A;  5HL6 A;  4JBF A;  3IX4 A;  5DKL A;  4K0X A;  3V67 A;  2WAD A;  3OCL A;  2ZL1 A;  2WK0 A;  2P7J A;  5FDH A;  3T4S A;  4WLA A;  1Z09 A;  3GSG A;  4Y5F A;  4ZRR A;  4LV2 A;  5AJG A;  4HIA A;  3NCK A;  1EWZ A;  1YAX A;  4OQG A;  3BY8 A;  1PFL A;  2X71 A;  4KZ7 A;  3JVU A;  4L9E A;  1NLY A;  1K0K A;  1GSX A;  3DTM A;  2UV0 E;  3FG8 A;  4MN6 A;  3IF6 A;  4KZ3 A;  5DTT A;  4KZB A;  5GLB A;  1BLP A;  3O87 A;  4JLF A;  2Y79 A;  4II7 A;  3VSL A;  5CHJ A;  1TF1 A;  1MKM A;  2J8Y A;  4DRT A;  4HOI A;  3PXP A;  2HJE A;  3ZYT A;  2LB9 A;  4EEU A;  2H10 A;  3OPP A;  3EEA A;  3VP0 A;  1KGF A;  4M4X A;  2JKG A;  1XKZ A;  4ID4 A;  4Y17 A;  5DTS A;  3P98 A;  4GN2 A;  4KUK A;  2W0N A;  4LPZ A;  2XA7 S;  4DE1 A;  3H7W B;  3CIT A;  3F1P B;  1LSV A;  4FOF A;  4PM7 A;  5DFY A;  4I38 A;  4K91 A;  3NUL A;  3TW8 A;  3UPO A;  3FPW A;  1PWG A;  3QP1 A;  4YIN A;  4OPR A;  2LB5 A;  5GLD A;  2A24 B;  4I39 A;  2O0Y A;  3LIA A;  1FIK A;  4I3J A;  3KSH A;  1DRM A;  2DRW A;  3LY4 A;  5L8M A;  5CX7 A;  5EEC A;  3VE4 A;  4HI4 A;  4B4Z A;  2JC7 A;  4S2N A;  4O01 A;  2CMN A;  4O0P A;  5A8B A;  1SKF A;  5FQJ A;  2Y2P A;  4WZ4 A;  4NXF A;  3T12 B;  3KYQ A;  3ULF A;  5F82 A;  3ZGA B;  4BD0 A;  1MXO A;  4WF0 A;  4BLM A;  1EW0 A;  4KZA A;  1IYP A;  1PRQ A;  2Y8H A;  3C30 A;  3UO9 A;  1ACF A;  3S7Q A;  4QB8 A;  2PU2 A;  3UME A;  5KMW A;  3D3O A;  1XX2 A;  4GLQ A;  4BWI A;  3E4O A;  1W7F A;  5FL3 A;  1BUL A;  4R3J A;  2VX8 A;  2D02 A;  4GD8 A;  2QJ5 A;  3MKF A;  3B3X A;  5FEG A;  2WKQ A;  4L0L A;  1YLJ A;  1ES2 A;  5HW3 A;  4JF5 A;  4GCZ A;  4WMC A;  1K55 C;  3BJN A;  2O9C A;  2O9A A;  2PR6 A;  5TJJ A;  1GA9 A;  3FKW A;  4RQ9 A;  5AQA A;  4ZDX A;  4Q0J A;  3C2W A;  4DXC A;  4E6X A;  3PTE A;  4UA7 A;  3SS3 A;  4HNB A;  1KE4 A;  4IHQ A;  4Y2F A;  2X02 A;  3A3J A;  2A2L A;  3NHQ A;  4EES A;  1PW1 A;  2ZQ8 A;  1IKG A;  2QWS A;  2I9V A;  4OH0 A;  3RXX A;  3VOZ A;  3ZG9 B;  2Z6C A;  4OP8 A;  4NK3 A;  2HJ9 C;  1I2W A;  3G2Z A;  2XSS A;  1DJB A;  3IXD A;  4HJ3 A;  5CHU A;  4OOL A;  3EQU A;  2J9O A;  1VEU B;  4QU3 A;  5CRF A;  1K54 C;  3GR2 A;  4GHI B;  1T18 A;  4JGO A;  1ZG6 A;  3H7W A;  4PM6 A;  3F1P A;  3W4Q A;  3CJM A;  4LGW A;  1W63 M;  3T1X A;  4XT2 B;  5DVA A;  4X53 A;  5EVL A;  5HDD A;  1HTZ A;  1NRJ A;  1HLU P;  4BBT A;  1DY6 A;  4EWF A;  2A24 A;  3C5A A;  4PM9 A;  1F2K A;  2XD5 A;  2PBD P;  4LFU A;  4RA7 A;  3RFB A;  5FAS A;  3FYZ A;  1XA1 A;  1BSG A;  4PM5 A;  3NDG A;  2O99 A;  1CEF A;  1ONH A;  3IHA A;  1TS7 A;  1SHV A;  3M6H A;  4JXS A;  5GL9 A;  1XP4 A;  1DP9 A;  2VK3 A;  4R6L A;  1X0O A;  2EX9 A;  3QP5 A;  4RX2 A;  1TS6 A;  2VGL S;  5EM1 A;  1FQG A;  2W3G A;  2XR0 A;  4UEY A;  2HDQ A;  3ITA A;  1ZKJ A;  4MBK A;  1KDW A;  4GS9 B;  4JGR A;  3UE3 A;  5F6A A;  4EU0 A;  3QNB A;  4OPQ A;  3IWO A;  2PBY A;  1T19 A;  2B18 A;  2HDU A;  4CPK A;  1IYS A;  4QPR A;  1ZTU A;  3IQA A;  3N6I A;  4BBV A;  5BOH A;  3I7J A;  2Y2H A;  1LHY A;  3EWK A;  4F3L B;  1NZO A;  2P08 A;  4P6Z S;  1ESU A;  2JCH A;  3S7P A;  4EUZ A;  1KE0 A;  2W3D A;  2EWW A;  3CUE A;  2WKP A;  4P6B A;  4ZJ2 A;  3FKV A;  4HQA A;  3T4K A;  2C6W B;  1YM1 A;  1NLZ A;  1WYB A;  1FCN A;  4WZ5 A;  5EE8 A;  1GHI A;  1L3L A;  3JVV A;  3VFH A;  2DMW A;  1OTA A;  3LR3 A;  3ZG7 B;  5EVE A;  3VP4 A;  3LEQ A;  4C3Q A;  2OWH A;  4R4R A;  3UE6 A;  3IWQ A;  5CHM A;  4D2O A;  4ETZ A;  1MWR A;  3B42 A;  3EOI A;  4PPR A;  4UA6 A;  3LY3 A;  1STZ A;  2E8I A;  5DF9 A;  4PKY A;  1TDL A;  3V5M A;  4GHI A;  4PMA A;  4NG2 A;  2RL3 A;  3MQ0 A;  2XF3 A;  2WGW B;  1PWC A;  3BLM A;  5D3O A;  3ISG A;  3TSG A;  3A0V A;  3IS2 B;  5CGX A;  3WS1 A;  3GRJ A;  4XT2 A;  4YOF A;  1KE3 A;  4EBP A;  1OT6 A;  3DAV A;  3LFV A;  4E3L A;  2VGL M;  1MC0 A;  4L9F A;  4CLC B;  4OLD A;  4QY6 A;  3GDI A;  3MZF A;  2M7U A;  3GV9 A;  2HDS A;  1GSV A;  3B33 A;  1T1A A;  4NKP A;  2MJ6 A;  4E3K A;  3A3E A;  1WYC A;  1KGG A;  3CWF A;  5GHX A;  2NUP C;  2WKE A;  2WYX A;  4GJ4 A;  4ZJ3 A;  3BM6 A;  3G32 A;  3TE8 A;  1XJ3 A;  4P0M A;  1C3B A;  1HVB A;  2YKH A;  2A3U A;  5IT5 A;  2FH5 A;  1MWU A;  4MN7 A;  4OOM A;  1NWZ A;  1XPB A;  5L09 A;  3A3I A;  1G5U A;  3HUO A;  3G2Y A;  3C4O A;  4MEZ A;  1YLT A;  2IA2 A;  4R3A A;  4EXO A;  3IF5 A;  2Y59 A;  4K0W A;  2Z2L B;  3ZVW A;  2G7U A;  3T4L A;  1JNU A;  2XRN A;  3UNW A;  4EW7 A;  1L0E A;  5G18 A;  4QWO A;  4GS9 A;  2PR5 A;  4RVA A;  3C38 A;  3G31 A;  4H6J B;  2O9B A;  4JKT A;  3CAX A;  2WZZ A;  1LLB A;  1S1Y A;  5M18 A;  3HLD A;  3PBQ A;  3A0R A;  3CZD A;  4S2P A;  3LI8 A;  3PBS A;  4JGQ A;  1PI5 A;  3VFF A;  2ZC5 B;  3R7W A;  2PDR A;  3Q7Z A;  3CHW P;  1RGY A;  3VMA A;  3EGX C;  3PR6 A;  5JYO A;  2HF6 A;  2PT7 A;  1W8Q A;  4AFI A;  2PD7 A;  1NY0 A;  5EVI B;  3OPH A;  3N7W A;  4N9K A;  1XFN A;  2GNX A;  3NDE A;  1TVF A;  5GHZ A;  2ZC3 B;  1M40 A;  4XUZ A;  3OCN A;  3WS0 A;  1F5M A;  4FD8 A;  3N4I A;  4WUJ A;  5TGF A;  2PRF A;  4ZJ1 A;  5CER A;  1JWZ A;  4KG6 A;  4U0X A;  4G3K A;  4M3K A;  2Z2M B;  1H8Y A;  2R9W A;  3DTI A;  5I94 A;  1SKO B;  2H5S A;  2I72 A;  5L07 A;  1XJ4 A;  4R3B A;  1JVJ A;  4Y13 A;  1O7E A;  1N9O A;  1S67 L;  2ZBB A;  1BLC A;  4EBN A;  3FZC A;  1XJ6 A;  5FAQ A;  3C7U A;  3LYX A;  2IWD A;  2GZA A;  3PHY A;  3OBF A;  4B93 A;  3BRM A;  4JGP A;  4OOY A;  4U0T A;  3HLB A;  3W2Z A;  1S66 L;  4DJ3 A;  4CLC E;  3IS2 A;  3MKE A;  2BAS A;  1D06 A;  4GZB A;  1Y28 A;  2L1M A;  1MBL A;  5EUA A;  1XA7 A;  2KOI A;  5HPI A;  1BYW A;  4LRY C;  4Y7P A;  4JXG A;  1YSP A;  1UGU A;  3C7V A;  3EGD C;  3JYI A;  1P97 A;  3MR0 A;  3ZCZ A;  5AQB A;  4X68 A;  5TBM A;  1W8Y A;  4UA9 A;  4DDY A;  2VGK A;  5HD3 A;  2OV5 A;  3LCE A;  3W4P A;  1K56 A;  4XUX A;  3LIB A;  3G30 A;  4CQH A;  5TR7 A;  2INW A;  4Q0H A;  1JTG A;  3BQA A;  4X69 A;  2Y2L A;  3DW0 A;  1N9N A;  1K55 A;  4LV0 A;  4IVI A;  2EFX A;  4HY8 A;  1IEL A;  3PBT A;  4X1M A;  4H6J A;  1L0G A;  3RTY A;  3OZH A;  3WRZ A;  2B95 A;  2W3H A;  4Y15 A;  4MNR A;  4A5R A;  5FDS A;  4BL3 A;  5U47 A;  1FR1 A;  2VV6 A;  1L0D A;  2QMI A;  4Z9Q A;  1TDG A;  4R4S A;  4YFM A;  3IX3 A;  2IWC A;  1FOF A;  3NOP C;  5AQ9 A;  2P9V B;  1LSW A;  5EVI A;  1GA0 A;  1K54 A;  4UAA A;  4FH2 A;  3MSH A;  1FCO A;  3WWX A;  3NC8 A;  3QP8 A;  2Q9N A;  3MQQ A;  3D72 A;  3S4X A;  3FC7 A;  5HD5 A;  4CLC C;  5DTK A;  4EQ1 A;  3E0Y A;  2B5R A;  1ERQ A;  1ZG4 A;  4JF6 A;  4MMN A;  1YSQ A;  2L0W A;  4KQO A;  4I3I A;  1JTD A;  3N8S A;  4S2L A;  2Y2J A;  4G3V A;  1CF0 A;  3T50 A;  5L10 A;  2KLI A;  4QHC A;  3G6O A;  3E98 A;  5DFX A;  2ACG A;  2J3W A;  1K4F A;  3Q81 A;  5CED A;  4O8G A;  3AGD A;  3UDF A;  4DE2 A;  3UPN A;  3NIA A;  3IHB A;  3OC2 A;  5EV0 A;  2CC1 A;  4KQQ A;  2J3T D;  3PYP A;  3NBL A;  4EQI A;  3LIF A;  4ETX A;  2BLS A;  2VLG A;  5F83 A;  1XGI A;  1I5Q A;  4RX3 A;  1XGJ A;  3UE1 A;  3F1N B;  2PHY A;  1OTE A;  4LRX C;  1F9I A;  1PZP A;  1LL9 A;  3T1Q B;  3BY9 A;  3T4T A;  4HEF A;  3Q07 A;  3ZG0 A;  3DTE A;  3HJK A;  3U2A A;  1ES4 A;  1U60 A;  3LGO A;  1Z6F A;  4DXB A;  1RGZ A;  4OQH A;  2WKH A;  2FZ0 A;  3G34 A;  3M2K A;  1VHM A;  5EVI C;  5FAT A;  3SOI A;  3ITB A;  2HV1 A;  1SCW A;  5FA7 A;  1N9B A;  3BEC A;  3WS4 A;  2Y2Q A;  1YLZ A;  4UHU A;  1YQS A;  4ESP A;  1Y4O A;  3LEZ A;  4GB7 A;  4KG5 A;  3R4K A;  1VQQ A;  4HES A;  4HH2 A;  3V50 A;  3HUM A;  5A92 A;  5HWT A;  1E3U A;  3B47 A;  1KOU A;  1LL5 A;  2ZOI A;  1CI9 A;  4DN0 A;  3BYD A;  5M19 A;  5FQ9 A;  2Y2O A;  2QZ6 A;  2WAE A;  2EX6 A;  4GOG A;  3OPL A;  5HL1 A;  1PIO A;  4DKI A;  2OOL A;  5HAP A;  4NXB A;  4PKY G;  1AXB A;  1UWN X;  2GDN A;  3RH8 B;  2V1Z A;  4JXW A;  1YMX A;  2ZOH A;  3SS4 A;  2VGJ A;  3MFX A;  3FWL A;  3IXG A;  3VP2 A;  2W1T B;  3O3V A;  3UY6 A;  3H9W A;  1K4E A;  4S2M A;  2OLV A;  1IFQ A;  2JE5 A;  4R1G A;  4MBF A;  5K5B A;  5E2H A;  4S2I A;  3MMH A;  3MXQ A;  1VB6 A;  4FSF A;  1BZA A;  4WYY A;  5HFO A;  3C8C A;  5J7E A;  3K3D A;  3FPV A;  3RJU A;  2XD1 A;  4DF6 A;  3PAE A;  4ARZ B;  3QHY A;  3UB7 A;  3QP2 A;  2IWB A;  3CPT B;  2QHK A;  4DJ2 A;  5IU1 A;  4OON A;  3PBR A;  1H8M A;  3KX0 X;  4MCW A;  2ZQ9 A;  4WEK A;  4EET B;  3HLW A;  2OSU A;  1MWT A;  4KZ6 A;  1P9R A;  3H82 B;  2ZMV A;  5F5Y A;  2J80 A;  2R9X A;  1VET B;  1TEM A;  1W63 Q;  5I5L A;  2Y2N A;  3LR5 A;  3VP3 A;  1OTD A;  1LI9 A;  3GEC A;  3DWK A;  1XFQ A;  1FCM A;  2DCF A;  1H3Q A;  3F1N A;  4E3N A;  3HLG A;  1HD8 A;  4WBG A;  4LRZ E;  3DBA A;  3A3F A;  3S7O A;  2ZMF A;  4JF4 A;  1NJ4 A;  2VEA A;  4S2J A;  4EUV A;  4Z1W A;  2QPN A;  3P09 A;  1K57 C;  4OKP A;  3LIE A;  4HP4 A;  2FFF B;  4DE0 A;  2DNS A;  2Y2G A;  4NXE A;  2M7V A;  1VEU A;  2EXA A;  2V2F F;  2ZC6 B;  5DJT A;  3T1R A;  1N4O A;  2RCX A;  4OVD A;  1S1Z A;  1QME A;  1WA9 A;  1ES5 A;  1GHM A;  3LR0 A;  3BFC A;  1S0W A;  1CJF A;  4N1H A;  5A93 A;  4N92 A;  1XJ2 A;  2ZQ7 A;  2R78 A;  1S4S A;  3ZDJ A;  2WGI A;  3VP1 A;  5AQ7 A;  3KSI A;  1P9W A;  2YKF A;  4Q0I A;  2UWX A;  4WEJ A;  4KZ5 A;  1KDS A;  2W27 A;  1NZU A;  5AVE A;  1BTL A;  1K38 A;  1MY8 A;  1K6S A;  1K56 D;  3HJI A;  4R38 A;  2L4R A;  2OAP 1;  2ZMA A;  2OLU A;  4R23 A;  4JPM A;  4OPZ A;  4HBT A;  3IF6 B;  3TG9 A;  2VZW A;  2PYR A;  3BW6 A;  2VV7 A;  1G6O A;  4GW9 A;  1RP5 A;  3ZNY A;  4QJG A;  2Y4A A;  3IBJ A;  2W1R A;  4KEN B;  2HPB A;  1W5D A;  4X1L A;  2FFY A;  5FI2 A;  2W1T A;  2J7V A;  4ME4 A;  5CGW A;  1IOU A;  4LEN A;  1NYM A;  4U3T A;  4IED A;  1ONG A;  2WZX A;  2ZQA A;  4DDS A;  1SDN A;  2Q9M A;  4YWZ A;  5HX9 A;  3HBR A;  2W3E A;  3QP4 A;  3L9K A;  4E3O A;  1G68 A;  1LSX A;  5G4Y A;  2XFT A;  2VJW A;  1MWS A;  2HP5 A;  4S2O A;  2XLN A;  1ES3 A;  1W79 A;  4YNR A;  3UPP A;  3CPT A;  4F3L A;  3TJZ C;  1PI4 A;  3CI6 A;  1GSW A;  3E4Q A;  5HPF A;  1ZC2 A;  2A49 A;  4WN5 A;  3GVB A;  2J3T C;  5AVF A;  4FTX A;  4LLO B;  3H82 A;  4HP9 A;  3IT9 A;  5J4E A;  4LV1 A;  1BT5 A;  1VET A;  5IHV A;  2D01 A;  3NOT C;  5CGS A;  2X01 A;  5M1A A;  4Y0T A;  3Q1F A;  4GD6 A;  5A91 A;  4BMW A;  1YMS A;  2GJ3 A;  3CG5 A;  3V3S A;  2XFS A;  4B4X A;  4BJP A;  4F94 A;  4WL9 A;  2ZC7 A;  1WE4 A;  1OTI A;  1BLH A;  3O88 A;  3GMW A;  3HLF A;  3M6B A;  3PBN A;  4D60 A;  3ZQ5 A;  3NJA A;  2NUT C;  4UQI S;  2JN7 A;  2OWJ A;  5HSQ A;  4IUH A;  4GDN A;  3NI9 A;  3MXS A;  3HCY A;  1IYO A;  4RYE A;  4WM9 A;  3HUN A;  1K6R A;  1YT4 A;  2V20 A;  4WMC D;  2H0Y A;  1IEM A;  1CI8 A;  3WS5 A;  3G4P A;  1FSW A;  2WGW A;  4P87 A;  5FQQ A;  4JXV A;  3SZT A;  2PAV P;  1L2S A;  5E2G A;  4ZBE A;  2PU4 A;  3V3R A;  1TD5 A;  4CLC A;  2XDM A;  3S22 A;  5HAI A;  3MJQ A;  2ZM2 A;  4O7D A;  3IBR A;  3E2K A;  5MC7 A;  2Y2M A;  3BFG A;  4B88 A;  2ZD8 A;  3IWI A;  3WS2 A;  3C4P A;  1MKI A;  1QMF A;  3ZG5 A;  4LCL A;  3UDI A;  4HBU A;  2ZC4 B;  5KSC A;  3JPU A;  4E3I A;  2P74 A;  3QNC A;  2GX5 A;  3BFE A;  3M2J A;  2PYP A;  1E3U D;  3A3D A;  1NXY A;  2V9A A;  2J9P A;  4X25 A;  3NOU C;  3G35 A;  1NRF A;  4CJN A;  1CK3 A;  4N1X A;  1G28 A;  3LUQ A;  3W8K A;  4P85 A;  4ZAM A;  3K3C A;  3ZG8 B;  2V0W A;  5GHY A;  1KVM A;  4UQI M;  3TRC A;  3HVF A;  5F68 A;  2C5W B;  3GQZ A;  4MBH A;  3VSK A;  2AVX A;  3QP6 A;  5F69 A;  2JBF A;  5CXW A;  1SZV A;  5J8X A;  3T4J A;  3V39 A;  4H8R A;  4QY5 A;  4KUO A;  2HZ5 A;  3PAG A;  1ALQ A;  4E04 A;  2QJ7 A;  3S1Y A;  4EBL A;  1CEG A;  3BWL A;  1XXM A;  5DF7 A;  5FQI A;  3ZHH A;  3MZD A;  1NYY A;  1A0K A;  3IXB A;  1GCE A;  2JKT I;  2KDK A;  1SKO A;  4E3J A;  3IF6 C;  5GLC A;  4X56 A;  5E2E A;  5EPH A;  3KYZ A;  2OAQ 1;  2XH9 A;  2ZQD A;  1OTB A;  4LV3 A;  4C6Y A;  4Y0O A;  3F1O B;  1J3W A;  2VV8 A;  2W3F A;  2ZM8 A;  3Q82 A;  4FH4 A;  1H8Z A;  1S6R A;  4EV4 A;  3OPR A;  5EOO A;  4R70 A;  5E43 A;  1ERO A;  2EX2 A;  2JHE A;  2ZM0 A;  3VE3 A;  5CEC A;  3LIC A;  3CLO A;  3MBZ A;  2B02 A;  5KZH A;  4GDB A;  3D9Y A;  3UB8 A;  3S7N A;  3N8R A;  3TOI A;  2V8F A;  3SW1 A;  3IH8 A;  4Q8I A;  3P7N A;  1KVL A;  1YKD A;  2K7S A;  1PW8 A;  2XA7 M;  3ZFZ A;  2Y2I A;  1ZHH B;  2XK1 A;  3LI9 A;  1F98 A;  4KZ9 A;  1TS8 A;  4EEP A;  1V9Z A;  3SH8 A;  1ESI A;  2EFU A;  1LT0 A;  1P0Z A;  3DTK A;  1MPL A;  5FI7 A;  3P01 A;  1VM1 A;  4IVK A;  5EM0 A;  2HP6 A;  3UB5 P;  4OQ0 A;  1LL8 A;  1I2S A;  2M1C A;  3AGE A;  3Q7V B;  2XGN A;  4LCM A;  3UDX A;  4S2N C;  5HAQ A;  1Q2P A;  3OOV A;  3BEB A;  3W4O A;  2EA9 A;  3BQ8 A;  5GLA A;  5KSH A;  5FAP A;  3L7H A;  4OQI A;  3MF0 A;  1JWP A;  4NET A;  3T4O A;  4S2K A;  1T1C A;  3MZE A;  4IBX A;  4KQR A;  2JKR I;  1IKI A;  1K57 A;  1GHP A;  5EOE A;  2V1A A;  3BFD A;  4PHT A;  3SS5 A;  2P9V A;  4IJG A;  3UB6 A;  3OLO A;  3BLS A;  5J3W A;  5HWW A;  1FIL A;  2K2N A;  1YLW A;  5IS1 A;  3FV7 A;  5EFW A;  3CMZ A;  2E8J A;  3IH9 A;  2JKF A;  4NXG A;  4OP5 A;  2XRO A;  3HL9 A;  3MFD A;  1MZU A;  3ZVT A;  2V1B A;  4B9O A;  4BD1 A;  3HLE A;  5TFQ A;  4N9L A;  1HZO A;  1BLS A;  3EQV A;  1AWI A;  3VOL A;  3A0S A;  3UE0 A;  4Y0U A;  4WEL A;  3MXR A;  2P04 A;  5C5K A;  4DE3 A;  1G6A A;  1CQA A;  4GKU A;  3F1O A;  4FCF A;  1D1J A;  4MN5 A;  3LO7 A;  1YLY A;  4L9G A;  3T4Q A;  3MQO A;  2QKP A;  3R7W B;  3WRT A;  4X55 A;  3KSF A;  2ZJ9 A;  1DJA A;  4ZTK A;  3LR4 A;  2Y55 A;  1Q2Q A;  5DJU A;  4HJ6 A;  1YPR A;  5CTM A;  5F1F A;  4BQM A;  3K2N A;  3MS6 A;  1FR6 A;  1JWV A;  2V8C A;  1O07 A;  1OJ5 A;  2Z6D A;  2H28 A;  1LI0 A;  3HLC A;  1N9L A;  2PD8 A;  1M6K A;  1PWD A;  4HHD A;  5HDS A;  3UMD A;  5HDC A;  3N8L A;  4X6T A;  2V0U A;  2EWV A;  3BFF A;  4XXR A;  5JYP A;  4KZ8 A;  4CLC D;  1L0F A;  2ZL1 B;  4QD4 A;  4PM8 A;  2QYB A;  2XEP A;  2ZQC A;  3UN7 A;  4DMZ A;  3O5Y A;  3Q7V A;  3UB9 A;  4BEN A;  1SDE A;  3T1S A;  1K25 A;  3DWZ A;  3D4F A;  1RCJ A;  3VOY A;  5HAR A;  2ZLY A;  3NY4 A;  1DP8 A;  1S4R A;  3ICY A;  2VKS A;  2WUQ A;  4MDZ A;  4GNU A;  4K08 A;  4BL2 A; 
#chains in the Genus database with same CATH homology
 2JKT M;  1TS7 A;  1TS0 A;  1V9Y A;  1OPX A;  4IUK A;  4MMN A;  4KQD A;  1YSQ A;  1OJG A;  1DP9 A;  4Y3I A;  2L0W A;  4KQO A;  4R6L A;  4I3I A;  1TD5 A;  1X0O A;  4CLC A;  2HGV A;  4G3V A;  3T50 A;  3MJQ A;  3IBR A;  1TS6 A;  5MC7 A;  3KSG A;  2VGL S;  2KLI A;  2W3G A;  3G6O A;  3E98 A;  1ODV A;  5TBM B;  2VA0 A;  4UEY A;  1T1B A;  5DFX A;  4GS9 B;  4JGR A;  3UE3 A;  5F6A A;  2J3W A;  4EU0 A;  4HJ4 A;  4O8G A;  1T19 A;  2B18 A;  4P6Z M;  5DKK A;  2KX6 A;  4HH3 A;  3OC2 A;  3CUE C;  4QPR A;  1ZTU A;  4BBV A;  2J3T D;  3PYP A;  3PBO A;  5KIZ A;  3LIF A;  4ETX A;  3EWK A;  4F3L B;  2VLG A;  4ARZ A;  2P08 A;  2K31 A;  3E4P A;  4P6Z S;  2GX5 A;  3S7P A;  3KO6 A;  3F1N B;  2W3D A;  2PHY A;  1OTE A;  2EWW A;  2PYP A;  4LRX C;  3CUE A;  1D7E A;  1DP6 A;  1F9I A;  2WKP A;  3VV4 A;  2V9A A;  3BY9 A;  4HQA A;  3T4K A;  3T4T A;  1NLZ A;  3NOU C;  3HJK A;  3U2A A;  1G28 A;  3LUQ A;  2FZ0 A;  3JVV A;  3K3C A;  2V0W A;  1VHM A;  4BBU A;  5LBR A;  1OT9 A;  2DMW A;  1OTA A;  3LR3 A;  4UQI M;  3TRC A;  5F68 A;  5HZH A;  3EEH A;  2HV1 A;  3LID A;  2OWH A;  4I3A A;  3UE6 A;  5G4Z A;  5F69 A;  5HWV A;  4ETZ A;  3R4K A;  4G3W A;  3B42 A;  3T4J A;  3EOI A;  4HH2 A;  4PAU A;  4KUO A;  5HWT A;  4E04 A;  4NEE D;  1STZ A;  2QJ7 A;  3B47 A;  1KOU A;  2ZOI A;  4EER A;  5DF9 A;  4PKY A;  4DN0 A;  2WKR A;  4GHI A;  1UWP X;  2JKR M;  4I5S A;  3BWL A;  3MQ0 A;  5HL6 A;  5DKL A;  2OOL A;  3V67 A;  3A0V A;  3IS2 B;  4NXB A;  4PKY G;  4XT2 A;  3OCL A;  4YOF A;  2P7J A;  1OT6 A;  3LFV A;  1UWN X;  3RH8 B;  2VGL M;  1MC0 A;  4L9F A;  4CLC B;  3T4S A;  4WLA A;  3GDI A;  4Y5F A;  4ZRR A;  2JKT I;  2ZOH A;  2KDK A;  5AJG A;  2M7U A;  4HIA A;  3MFX A;  1GSV A;  2W1T B;  3B33 A;  1T1A A;  1YAX A;  3H9W A;  4NKP A;  2MJ6 A;  3BY8 A;  3KYZ A;  1IFQ A;  3CWF A;  2NUP C;  2OAQ 1;  4GJ4 A;  1OTB A;  3F1O B;  5K5B A;  3TE8 A;  2VV8 A;  2W3F A;  3MMH A;  4L9E A;  1XJ3 A;  3JVU A;  1NLY A;  3MXQ A;  1VB6 A;  4FSF A;  2YKH A;  5IT5 A;  4R70 A;  1GSX A;  2FH5 A;  3FG8 A;  4MN6 A;  2JHE A;  3C8C A;  3VE3 A;  4MN7 A;  5J7E A;  4OOM A;  3LIC A;  3CLO A;  3K3D A;  3FPV A;  2B02 A;  1NWZ A;  4ARZ B;  3UB7 A;  3UB8 A;  3S7N A;  2Y79 A;  2IA2 A;  2QHK A;  4R3A A;  4EXO A;  4II7 A;  4DJ2 A;  5IU1 A;  3PBR A;  2G7U A;  1TF1 A;  3SW1 A;  1MKM A;  3T4L A;  1JNU A;  1H8M A;  2XRN A;  3KX0 X;  4MCW A;  4WEK A;  4HOI A;  3P7N A;  4EW7 A;  4EET B;  1YKD A;  3PXP A;  2K7S A;  2HJE A;  4GS9 A;  1P9R A;  3ZYT A;  2PR5 A;  3H82 B;  3C38 A;  2ZMV A;  2XA7 M;  4H6J B;  2LB9 A;  4EEU A;  5F5Y A;  2J80 A;  2O9B A;  3CAX A;  1W63 Q;  3EEA A;  1S1Y A;  4M4X A;  5I5L A;  1ZHH B;  3PBQ A;  3LI9 A;  1F98 A;  3A0R A;  3LR5 A;  1OTD A;  3LI8 A;  1TS8 A;  3GEC A;  4EEP A;  1V9Z A;  3PBS A;  4JGQ A;  4KUK A;  2W0N A;  4LPZ A;  2XA7 S;  1XFQ A;  3R7W A;  1LT0 A;  1P0Z A;  2PDR A;  3H7W B;  3CIT A;  3F1P B;  1LSV A;  4FOF A;  5DFY A;  3P01 A;  1H3Q A;  3F1N A;  3EGX C;  4I38 A;  3PR6 A;  2HF6 A;  2PT7 A;  4AFI A;  2PD7 A;  3DBA A;  4LRZ E;  3S7O A;  3TW8 A;  2ZMF A;  1LL8 A;  2M1C A;  3FPW A;  1XFN A;  2VEA A;  4EUV A;  2GNX A;  4Z1W A;  2LB5 A;  3OOV A;  2A24 B;  3LIE A;  2EA9 A;  3BQ8 A;  4HP4 A;  4I39 A;  2O0Y A;  3LIA A;  5KSH A;  4I3J A;  3KSH A;  1DRM A;  4NXE A;  5L8M A;  2M7V A;  5CX7 A;  5DJT A;  3MF0 A;  3VE4 A;  3OCN A;  4HI4 A;  1F5M A;  1S1Z A;  3T4O A;  1WA9 A;  4WUJ A;  1T1C A;  3LR0 A;  2JKR I;  4O01 A;  2CMN A;  2V1A A;  4O0P A;  5A8B A;  4PHT A;  4G3K A;  1XJ2 A;  2R78 A;  1S4S A;  4NXF A;  3KYQ A;  4IJG A;  3UB6 A;  3OLO A;  3ULF A;  3KSI A;  5J3W A;  5HWW A;  1XJ4 A;  1P9W A;  2YKF A;  4WF0 A;  2K2N A;  1N9O A;  1S67 L;  1EW0 A;  2ZBB A;  4Q0I A;  4WEJ A;  2W27 A;  5IS1 A;  2Y8H A;  1XJ6 A;  5AVE A;  3C30 A;  5EFW A;  3LYX A;  2GZA A;  3HJI A;  3PHY A;  3OBF A;  4R38 A;  2L4R A;  2OAP 1;  4JGP A;  4NXG A;  3S7Q A;  4B93 A;  2XRO A;  3W2Z A;  1S66 L;  1MZU A;  2V1B A;  3UME A;  4DJ3 A;  4CLC E;  4B9O A;  3D3O A;  3IS2 A;  2BAS A;  1D06 A;  2VZW A;  2PYR A;  3BW6 A;  2VV7 A;  1G6O A;  4GLQ A;  3E4O A;  4BWI A;  1Y28 A;  2L1M A;  4GW9 A;  3EQV A;  3IBJ A;  2KOI A;  5FL3 A;  2W1R A;  5HPI A;  3VOL A;  3A0S A;  1BYW A;  4LRY C;  2VX8 A;  4WEL A;  1YSP A;  2D02 A;  2P04 A;  2QJ5 A;  5C5K A;  2W1T A;  4ME4 A;  1UGU A;  2WKQ A;  3EGD C;  1IOU A;  4L0L A;  1P97 A;  3MR0 A;  5TBM A;  3F1O A;  4GCZ A;  4YWZ A;  4MN5 A;  3BJN A;  2O9C A;  2O9A A;  2W3E A;  5HD3 A;  2PR6 A;  5TJJ A;  1LSX A;  4RQ9 A;  5G4Y A;  3LIB A;  4L9G A;  3T4Q A;  2VJW A;  4Q0J A;  3C2W A;  3MQO A;  2QKP A;  4CQH A;  2INW A;  3R7W B;  4Q0H A;  4HNB A;  4YNR A;  4IHQ A;  3BQA A;  3KSF A;  4Y2F A;  1N9N A;  2A2L A;  3NHQ A;  3TJZ C;  4F3L A;  3LR4 A;  3CI6 A;  4EES A;  1GSW A;  3E4Q A;  5HPF A;  2QWS A;  4WN5 A;  5DJU A;  4HJ6 A;  2I9V A;  4HY8 A;  2J3T C;  5AVF A;  4LLO B;  3PBT A;  3H82 A;  4HP9 A;  4H6J A;  2Z6C A;  3K2N A;  5J4E A;  2HJ9 C;  3RTY A;  2XSS A;  1OJ5 A;  2Z6D A;  4HJ3 A;  2W3H A;  2H28 A;  2D01 A;  1N9L A;  3NOT C;  2PD8 A;  4HHD A;  4OOL A;  3EQU A;  5HDS A;  3UMD A;  5HDC A;  4GHI B;  1T18 A;  4JGO A;  4BMW A;  2GJ3 A;  2V0U A;  2EWV A;  3H7W A;  4BJP A;  2VV6 A;  3F1P A;  4WL9 A;  1OTI A;  1W63 M;  3PBN A;  4XT2 B;  4CLC D;  3ZQ5 A;  3NJA A;  3NOP C;  2NUT C;  4UQI S;  1LSW A;  2JN7 A;  2QYB A;  5HDD A;  2OWJ A;  5HSQ A;  4DMZ A;  1NRJ A;  3O5Y A;  3UB9 A;  4IUH A;  4BBT A;  2A24 A;  3HCY A;  3MQQ A;  3D72 A;  3RFB A;  3FC7 A;  5HD5 A;  4CLC C;  1DP8 A;  1S4R A;  3ICY A;  2VKS A;  4EQ1 A;  3E0Y A;  4MDZ A;  2O99 A;  4K08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...