1LI9A

Crystal structure of tem-34 beta-lactamase at 1.5 angstrom
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
b'HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMVSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class A beta-Lactamase- TEM-34
molecule tags Hydrolase
source organism Escherichia coli
publication title The structural bases of antibiotic resistance in the clinically derived mutant beta-lactamases TEM-30, TEM-32, and TEM-34.
pubmed doi rcsb
total genus 95
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1li9A00
1PW8A 1ZG6A 4S2KA 1PIOA 4QB8A 5FAPA 3VP4A 5A90A 3W4QA 3W4PA 4B4XA 1YQSA 2QPNA 1GCEA 4M3KA 4E3JA 2I72A 4PM7A 2DRWA 3WS2A 5M19A 3ZCZA 1LL9A 3HUOA 5BOHA 4S2NA 2XH9A 1SDNA 2WKHA 2BLSA 3N8SA 1YMSA 3PBOA 1KE0A 1FQGA 4P87A 1PWDA 5E2HA 1MWRA 1K55A 1NYYA 1Y54A 3IH9A 4PMAA 5FI2A 3N7WA 3UY6A 3C7UA 4GD6A 2WAEA 3S4XA 4NETA 2A49A 2J9PA 4MBHA 4S2MA 4U0TA 4QD4A 4LV0A 3MZEA 1XP4A 1ES2A 1E3UA 1MWUA 3BFEA 3M2KA 2XLNA 3VP3A 3ZVWA 4E3LA 5DF8A 2ZMAA 1K57C 1KGGA 4BL2A 3C4PA 3IXGA 4QU3A 2V20A 2XR0A 3D4FA 4K0WA 3AGEA 1IYSA 3SS5A 2Y59A 4IBXA 1TVFA 3VFHA 3HLCA 3FWLA 4E3NA 1LLBA 3ITAA 3M6BA 5FASA 4OQ0A 2P9VB 3ISGA 5FI6A 3RJUA 1W8YA 3GV9A 1I5QA 1MXOA 2Y2NA 3GQZA 3UN7A 1XPBA 4XXRA 3SH8A 1MKIA 5DF7A 4WM9A 1BSGA 1RGYA 2XD5A 2ZM8A 4KZ9A 5HARA 1KE3A 5JYPA 3UE3A 3E2KA 5EVIB 3UPOA 5HX9A 5U47A 3O88A 1W5DA 1W79A 2RCXA 2Y2PA 4X53A 2VGKA 4UA9A 2ZM0A 5M1AA 4KZ3A 3OC2A 2WUQA 3VOYA 4C75A 4WZ5C 4E6WA 3FYZA 3IHAA 5CXWA 1H8YA 3AGDA 2OSUA 3HREA 5TR7A 5AQBA 3M6HA 1ERQA 2ZC7A 4OKPA 4BD1A 1XA1A 4FSFA 4QY6A 1K55C 3ZVTA 4DXCA 1BZAA 5FAOA 1MPLA 5HFOA 3QNBA 4WMCA 2WZZA 2EX6A 4A5RA 4LV1A 1PYYA 2WGWA 2VGJA 4ZJ2A 4YINA 2EXBA 2X01A 1J9MA 1Q2PA 1BT5A 2XQZA 4N1XA 1PZOA 5FQQA 3ZG0A 4EBLA 1H8ZA 3BEBA 3G2ZA 4UAAA 4KZBA 1KVMA 2Z2MB 5IHVA 4HBUA 1JWPA 2XD1A 4KZ6A 4EWFA 5CRFA 1S0WA 4GZBA 3HUNA 4MBKA 4R3JA 4MLLA 3P09A 2ZQAA 1ESIA 1M6KA 2FFYA 5HL1A 5CHMA 1LI9A 2IWCA 1CK3A 1LHYA 3A3EA 3G32A 3O3VA 2CC1A 3Q7ZA 4LCMA 4OPYA 4GN2A 5FATA 1S6RA 2Q9NA 1MBLA 3SS4A 1I2WA 3MBZA 4DXBA 3BRMA 1ZG4A 1WYCA 2IWDA 1AXBA 4ZAMA 2OV5A 3A3FA 4X69A 1FR1A 5EVIC 1TEMA 3WWXA 2ZC3B 1YLJA 4JF4A 4X55A 3OPLA 5CGXA 4EV4A 4EBPA 2J8YA 2ZQDA 4HESA 5DF9A 3O87A 1C3BA 4KZAA 4Y0UA 1CI9A 4WZ5A 1YM1A 3NDEA 3C4OA 4JXSA 4IVIA 1BLSA 4E3KA 4O7DA 4ZJ1A 1BLPA 1ESUA 3ZFZA 4OPZA 3PAGA 3BFGA 4DE0A 2WYXA 3P98A 5L2FA 3BFDA 4PM5A 4JKTA 1XXMA 3BLMA 1XKZA 2BG1A 1MY8A 2DNSA 4OOMA 3LY3A 3BLSA 3FKWA 2EX8A 5HW3A 1IELA 3DTMA 3SH9A 2V1ZA 1JWZA 3VMAA 1NXYA 3FV7A 3Q7VB 3VP2A 2EX9A 1DJAA 4GB7A 4RVAA 5KSHA 3HLGA 1ZC2A 5F1FA 1ES3A 4D2OA 1YT4A 4HEFA 1K25A 2WGVA 1G68A 2WKEA 5CHUA 5CHJA 3IWQA 1FCMA 2H10A 4PM6A 4DE1A 4N9LA 4OLGA 4Y7PA 1EROA 4RX3A 2B5RA 3CJMA 2XEPA 2Y2OA 3IH8A 4KENB 4N1HA 3WS1A 5CGSA 3NCKA 4FCFA 3A3DA 1CEFA 5HAQA 1IYOA 1FSWA 1PZPA 3BFCA 2Y2JA 4LV3A 3LCEA 3GR2A 4R4RA 1I2SA 4WBGA 5KMWA 4OOLA 4S2NC 3IF6B 3OPRA 5F1GA 4ZBEA 3MKEA 5FQ9A 3ZG8B 2XF3A 1PW1A 5GHYA 4DE3A 4RYEA 3VFFA 1ALQA 3LY4A 4GDNA 4KZ5A 3HL9A 1YMXA 3Q82A 3SH7A 3W4OA 5A92A 3C7VA 2XFTA 4JXGA 4WEKA 3TOIA 3UNWA 5FAQA 4L0LA 1JTGA 4KG2A 3MXRA 1FCNA 3ZG7B 1IYQA 4JXVA 3WRTA 3WS5A 5CEBA 3B3XA 5FQJA 4HBTA 1K54C 3IF5A 1KGFA 4Y0TA 2Y2GA 2WADA 4E3OA 2R9WA 1TDGA 2XGNA 3NC8A 4U3TA 2QMIA 3Q07A 4U0XA 4EUZA 4C6YA 2C5WB 4R0QA 3EQVA 4WEJA 1ONHA 3QNCA 3IXBA 4P6BA 5A93A 1QMFA 4LCLA 2H0YA 3PBTA 4IVKA 2A3UA 3NDGA 4JF5A 5F83A 1W8QA 1XX2A 1CI8A 3DWZA 3RXXA 3ZNYA 2FFFB 2OLVA 1O7EA 2Y2IA 3QHYA 4B88A 1N9BA 1SDEA 4K91A 3DWKA 2EFXA 1YLPA 1GA9A 1O07A 3TSGA 4JPMA 5EVIA 2R9XA 3ZNTA 3LEZA 3SS3A 4YFMA 1IEMA 2JBFA 5J8XA 2HDUA 4WZ4A 1KE4A 4BQMA 1L0GA 2G2WA 3G34A 4P85A 2ZQCA 4ZTKA 5FDHA 5FI7A 2IWBA 1BUEA 4R4SA 2PU4A 2Y91A 1YLYA 1KVLA 2G2UA 4KZ7A 3S22A 3UPNA 3DW0A 3MZDA 2Y2KA 3HLEA 1BLHA 5I94A 1GA0A 2JE5A 2HP5A 2WGIA 4IEDA 3PBSA 1K56A 4LV2A 5DTKA 2H0TA 5GLCA 4F94A 5CTMA 4E6XA 1ERMA 4Y0OA 1RP5A 3OCLA 4R3BA 1Q2QA 1VM1A 2HP6A 3HLFA 3HVFA 1M40A 3ITBA 5FA7A 1KGEA 5CECA 2HDQA 4XUZA 3A3JA 2XDMA 3BECA 4IBRA 5DTTA 4KG5A 3ZGAB 5GHXA 3IXHA 2XFSA 3UPPA 3VP0A 4KQQA 3WS4A 1LI0A 3OPHA 4GKUA 4R23A 4BL3A 1NZUA 2ZJ9A 5E2GA 1L0DA 1WYBA 1HVBA 2J7VA 4QJGA 1QMEA 3E2LA 4ID4A 3MXSA 1IKGA 1IKIA 5FSRA 2HP9A 2WKIA 1MWTA 1GHPA 4GD8A 4X68A 1HD8A 4DRTA 1DJCA 1ONGA 4GNUA 1BTLA 4ZJ3A 1G6AA 1SKFA 3V39A 1K6RA 4X56A 3BFFA 2Q9MA 1NJ4A 4B4ZA 4MBFA 4OLDA 1PI4A 5AQ7A 5HAPA 2Y55A 5E2EA 4S2LA 1K56D 1WE4A 4NK3A 1YLZA 1ZKJA 1PWCA 4DDYA 1FOFA 1K38A 3PBRA 4WMCD 4OQHA 1ES5A 3V5MA 4CJNA 2UWXA 1FSYA 1CEGA 2EFUA 4OP5A 3V3SA 1H5XA 3VOZA 3HLDA 4C3QA 3VSLA 2ZC6B 1VQQA 5G18A 2X02A 2Y2QA 4PPRA 1K54A 1FCOA 5AQ9A 5EUAA 1JTDA 2EXAA 2HPBA 4E3MA 1DJBA 3UDXA 2RL3A 3V50A 4KZ4A 4UHUA 2E8IA 5DVAA 2P9VA 3N8LA 1MWSA 3SOIA 1PI5A 3A3IA 3FKVA 4K0XA 5E2FA 1Z6FA 4BLMA 3UE1A 2Y2HA 4OPQA 3OPPA 4XUXA 4KQRA 4RX2A 2ZC4B 3OZHA 2ZQ9A 1RGZA 3M2JA 1JWVA 3V3RA 2PBYA 3Q1FA 4S2PA 1XGJA 2PU2A 3MFDA 3ZG5A 1FR6A 5D3OA 1NZOA 3O86A 5EE8A 3G31A 2V2FF 2ZLYA 1ES4A 1GHIA 2H5SA 3RXWA 3PAEA 3MKFA 4OONA 5KSCA 5AQAA 4DKIA 1OMEA 1NYMA 4KZ8A 4ZDXA 1L0EA 5GLAA 3HUMA 1E3UD 3N4IA 1EI5A 2HDSA 3JYIA 1K4FA 4RA7A 4GDBA 5DTSA 4OPRA 3UDIA 2ZD8A 1E25A 3NI9A 3HLBA 4EBNA 1BULA 2JCHA 4DDSA 1PWGA 2DCFA 5KZHA 3I7JA 1RCJA 2OLUA 2GDNA 5F82A 3OCNA 1EWZA 1K57A 3UE0A 3GRJA 3EQUA 2X71A 5TFQA 5JYOA 5TGFA 2ZQ8A 3IWIA 4GOGA 3CMZA 3PTEA 2QZ6A 3AGFA 4EQIA 3G30A 3GSGA 4N92A 4KQOA 1K4EA 2Y4AA 3BM6A 5FQIA 4X6TA 1NY0A 5CGWA 1YLTA 4JBFA 3CG5A 4KG6A 3MZFA 4DF6A 3FZCA 4PM8A 3Q81A 1SCWA 4LENA 4Z9QA 3PBQA 3VSKA 1NRFA 4DE2A 3BYDA 1U60A 2ZM2A 3VP1A 3GTCA 4FH4A 5EVID 3IT9A 2Y2MA 2ZC5B 4OOYA 3IF6C 1IYPA 3C5AA 4S2OA 3NIAA 4WELA 4Q8IA 1W7FA 1GHMA 5FQMA 3G4PA 5CEDA 5GLDA 3ZG9B 1BLCA 3LO7A 3IQAA 1E4DA 4QHCA 4UA7A 4H8RA 5EVLA 4FD8A 3N8RA 3S1YA 4FH2A 4PM9A 2J9OA 1YLWA 2Z2LB 1JVJA 2XK1A 4BENA 4CPKA 1XGIA 4OQIA 2P74A 2JC7A 4OQGA 5CERA 2HDRA 5HAIA 3IWOA 4OP8A 1HTZA 3N6IA 2Y2LA 3PBNA 4MNRA 4N9KA 2WGWB 3ZHHA 4S2IA 4UA6A 1K6SA 1DY6A 2ZQ7A 3TG9A 1XA7A 2WZXA 3CZDA 4MEZA 4OH0A 1KDSA 3UDFA 4P0MA 3GVBA 4QY5A 1L2SA 3GMWA 4OVDA 5A91A 3WS0A 5GHZA 5EOEA 5EECA 3HLWA 1LL5A 3Q7VA 3W8KA 4JXWA 4BJPA 5GL9A 3HBRA 1KDWA 5EOOA 3UO9A 4JF6A 3ZDJA 5CTNA 4BD0A 3WRZA 3NBLA 5GLBA 1HZOA 2WAFA 4S2JA 3IXDA 4E3IA 1SHVA 1N4OA 3G2YA 4WYYA 4JLFA 2C6WB 2EX2A 3IHBA 3NY4A 1TDLA 2WK0A 5E43A 4R1GA 5FQKA 5EPHA 5M18A 1L0FA 3G35A 3IF6A
chains in the Genus database with same CATH superfamily
1PW8A 2V8CA 4QB8A 5FAPA 5A90A 3W4PA 4B4XA 4M3KA 2Z6DA 4PM7A 2ZMVA 5M19A 1HLUP 5BOHA 3HUOA 1FILA 2Y79A 2WKHA 3LFVA 3H7WA 3N7WA 3UY6A 1LSWA 4NXGA 1ES2A 1MWUA 3BFEA 3M2KA 2XLNA 1Z09A 4BL2A 3C4PA 3IXGA 4QU3A 5EVEA 3SS5A 1G6OA 2Y59A 3HLCA 3FWLA 3EEHA 4P6ZS 1LLBA 2VGLS 1L3LA 1MXOA 4XXRA 4K08A 3SH8A 1STZA 2A24B 3T50A 1BSGA 1KE3A 3VOLA 3E2KA 5HX9A 5U47A 4HNBA 4HH2A 1W5DA 1W79A 2RCXA 2Y2PA 4X53A 3KYQA 2VGKA 4UA9A 2ZM0A 3A0RA 4KZ3A 5EM1A 4C75A 1S66L 5AQBA 3W2ZA 2VLGA 3BY8A 1K55C 2VA0A 4DXCA 4HHDA 4Z1WA 4WMCA 1OTBA 2EX6A 2VGJA 1Q2PA 1BT5A 2XQZA 4GHIA 4DJ2A 4HJ6A 1JWPA 4MBKA 1OJGA 3Q7ZA 4OPYA 4GN2A 1YAXA 2P08A 4L9EA 2JKRM 2IWDA 2QHKA 5EVIC 2ZC3B 1NLZA 5L8MA 4HQAA 2BASA 1BYWA 1CI9A 3CLOA 1DP8A 3R7WA 1BLPA 1ESUA 1T19A 4OPZA 4DE0A 3BFGA 3P98A 3BFDA 3CWFA 1XKZA 2BG1A 5HPIA 3LY3A 1IELA 1JWZA 3NECA 4L9FA 5CHUA 3IBRA 5CHJA 3IWQA 4Y7PA 2W1TA 2XEPA 3KSGA 3IX4A 5TBMA 3TRCA 3NCKA 5HAQA 1I2SA 4WBGA 5KMWA 4OOLA 4S2NC 2W0NA 3OPRA 1YKDA 2XF3A 3UB7A 3VFFA 3W4OA 2L0WA 4WEKA 2JKRI 3MXRA 3ZG7B 4JXVA 1OTIA 1PNEA 4E3OA 4HIAA 2R9WA 2XGNA 4DMZA 4EEUA 4EUZA 4C6YA 2C5WB 3EQVA 4FUWA 3QNCA 2H0YA 3PBTA 1OTDA 3BWLA 1H8MA 3O5YA 3ZNYA 3QP8A 3H82B 4CLCB 1GA9A 1O07A 3TSGA 4JPMA 4YFMA 1IEMA 2A2LA 4WZ4A 4BQMA 3T4SA 2R78A 1KVLA 4KZ7A 3C38A 3MZDA 2Y2KA 5I94A 3T1RA 2JE5A 4LGWA 1K56A 4GCZA 5CTMA 2KOIA 1Q2QA 3HVFA 2HDQA 4IBRA 1N9LA 2XDMA 3IS2B 3WS4A 5HWVA 3QP1A 4GKUA 1NZUA 5E2GA 1WYBA 1HVBA 4GJ4A 2PR5A 3MXSA 1IKGA 3S7OA 2HP9A 4GD8A 1HD8A 1ONGA 4GNUA 3T4KA 3V39A 4X56A 3BQAA 4MBFA 3VE4A 5E2EA 4NK3A 1PWCA 4DDYA 1FOFA 1K38A 1ES5A 2P04A 1CQAA 1CEGA 3V3SA 3VOZA 3HLDA 2O9CA 2ZC6B 1VQQA 5AVFA 5KIZA 2Y2QA 4PPRA 1FCOA 5AQ9A 3V50A 1DRMA 2J3TD 4G3WA 3A3IA 4K0XA 2L4RA 5E2FA 4XUXA 4EUVA 3D72A 2EWWA 2ZC4B 2P7JA 2V0UA 1FIKA 3ZQ5A 2PU2A 1A0KA 3ZG5A 3A0SA 1NZOA 2VV8A 2V2FF 4YNRA 1IFQA 3RXWA 3PAEA 4ETXA 3MKFA 5KSCA 1YPRA 4KZ8A 3NOUC 2HDSA 1D7EA 4II7A 5F68A 3NI9A 3HLBA 1YSPA 2DCFA 2OLUA 3UE0A 5TFQA 3EQUA 3MJQA 1G28A 3AGFA 4I3AA 3BM6A 1NY0A 3MFXA 2B02A 3TJZC 1YLTA 4JGOA 4KG6A 3FZCA 5TBMB 1T18A 1SCWA 4Z9QA 1UWNX 2VZWA 3R4KA 2ZC5B 4Q0IA 3T1QB 1W7FA 1GHMA 2JKTM 2ZMFA 3LO7A 2W3HA 3NJAA 3S1YA 3LUQA 4FTXA 2VV7A 1YLWA 3JVVA 3C8CA 4BMWA 2JC7A 3U2AA 2VKSA 3N6IA 4MNRA 4N9KA 4PKYG 2WGWB 3ZHHA 4UA6A 2ZQ7A 1XA7A 2WZXA 4MEZA 3LICA 3RTYA 4I3IA 3GMWA 3WS0A 5DJTA 4R6LA 1LL8A 2NUPC 2W3GA 3W8KA 4JXWA 4BJPA 5GL9A 3ICYA 3F1OB 2K7SA 1SHVA 1N4OA 3G2YA 2EX2A 5E43A 2WK0A 1S1ZA 3G35A 3UB6A 2Q0OA 4WF0A 3W4QA 2QPNA 4E3JA 5F69A 2DRWA 3QP6A 3ZCZA 5IU1A 4S2NA 2GZAA 1YMSA 3HCYA 3F1NB 1FQGA 4P87A 4LFUA 5E2HA 5AVEA 1K55A 3P01A 1NYYA 4WUJA 5FI2A 3C7UA 4GD6A 2WAEA 3T4TA 3PYPA 2XA7M 3ZVWA 2XR0A 4K0WA 3AGEA 4OQ0A 1OTAA 2PYPA 5FI6A 3IS2A 3RJUA 1W8YA 3GV9A 1I5QA 3GQZA 3UN7A 2H28A 1XPBA 2GJ3A 4WM9A 2XD5A 1RGYA 2ZM8A 5HARA 3UE3A 1VHMA 4KUOA 3UPOA 2WKPA 4CLCD 2WUQA 1VEUB 3CAXA 3CI6A 3JPUA 4E6WA 1D06A 3FYZA 5CXWA 2PT7A 4LRZE 4NXEA 2ZC7A 3BY9A 3ZVTA 1BZAA 3E0YA 1MPLA 1D1JA 1S4SA 1EW0A 2EXBA 2X01A 1J9MA 2LB5A 3T4QA 4EBLA 3BEBA 4UAAA 3BJNA 3MF0A 4EWFA 4R3JA 2UV0E 4P6ZM 4E04A 1M6KA 2FFYA 5HL1A 1CK3A 3A3EA 5FATA 3BRMA 1WYCA 1AXBA 3A3FA 2ZL1A 2HV1A 3KYZA 4MMNA 1YLJA 4JF4A 4H6JB 5CGXA 4EBPA 2J8YA 1OT6A 3T4OA 4EETB 4Q0JA 2KLIA 4HP9A 2AVXA 4JXSA 3S7NA 4O7DA 4ZJ1A 3ZFZA 2WYXA 2M7VA 4O0PA 4PM5A 3S7PA 2DNSA 3BLSA 3FKWA 2EX8A 3SH9A 1XJ4A 2EX9A 1DJAA 3V67A 4GS9B 5HWWA 4BBTA 1ZC2A 5F1FA 3EOIA 3UB8A 1YT4A 4HEFA 1K25A 2HGVA 1G68A 1FCMA 1F98A 2H10A 4PM6A 4DE1A 4N9LA 3K3DA 2B5RA 2Y2OA 3H82A 4D60A 4QPRA 2M7UA 1CEFA 2Y2JA 4NXFA 3LCEA 3GR2A 5IS1A 3IF6B 1PW1A 4DE3A 3LY4A 4GDNA 3F1NA 3HL9A 2WKRA 2J3TC 3Q82A 3SH7A 3C7VA 4JXGA 3TOIA 1ZTUA 3UNWA 1JTGA 4XT2B 3WRTA 2YKFA 5FEGA 3WS5A 5CEBA 5FL3A 1K54C 3LI9A 2Y2GA 1P0ZA 2QMIA 1WA9A 4U0XA 2O9BA 4B93A 4R0QA 4O01A 3IXBA 5A93A 4LCLA 3EEAA 2PBDP 4CLCC 4MN5A 5F83A 1W8QA 3RXXA 2Y2IA 1O7EA 1SDEA 3D9YA 4K91A 3T1SA 1IOUA 4Y2FA 5EVIA 1F9IA 1W63Q 3CITA 2HDUA 2O99A 3TE8A 4ZTKA 5FDHA 2PU4A 4F3LB 2Y91A 3KSIA 3S22A 1N9NA 3LIBA 1NWZA 1GA0A 5A8BA 2HP5A 2WGIA 3LR4A 1K0KA 4ARZA 4R3BA 2HP6A 3HLFA 5FA7A 2W3FA 5CECA 3A0VA 3ZGAB 5GHXA 4L9GA 2KDKA 3CUEA 2J7VA 2D01A 1QMEA 2EA9A 1DJCA 2JN7A 1K6RA 4ESPA 3B33A 1NJ4A 4B4ZA 4OLDA 1PI4A 5HAPA 2ZBBA 2B18A 1ZKJA 4HJ4A 4WMCD 1FSYA 2EFUA 5G4ZA 5G18A 2X02A 1DJBA 3UDXA 3F1PB 4KZ4A 5DVAA 2E8IA 1MWSA 3SOIA 3TW8A 3FKVA 4BLMA 3UE1A 2Y2HA 4OPQA 3CUEC 3OPPA 4RQ9A 4KQRA 1T1BA 2EWVA 2HF6A 3CPTB 3P7NA 4ETZA 1RGZA 3M2JA 4I5SA 1V9ZA 4Q0HA 2PBYA 4S2PA 3V3RA 2XA7S 5C5KA 1XGJA 1FR6A 5D3OA 4EESA 3O86A 1H3QA 2O9AA 4EU0A 1GHIA 4MCWA 2O0YA 4ZDXA 1L0EA 2KX6A 3HUMA 3N4IA 1G5UA 4RA7A 1K4FA 4GDBA 5DTSA 2ZD8A 3MQ0A 4DDSA 3MSHA 2B95A 3I7JA 1RCJA 5J4EA 1EWZA 5JYOA 2PHYA 4LPZA 3GECA 3CMZA 5FDSA 1TD5A 4EQIA 3MXQA 2HJ9C 3DTKA 4Y5FA 5FQIA 4Y17A 4EXOA 3CG5A 3MZFA 2W3DA 3VSKA 1XJ3A 3LIEA 3VE3A 3VP1A 3GTCA 5EVID 3NIAA 5FQMA 1F2KA 3ZG9B 1BLCA 1E4DA 4QHCA 1JNUA 4UA7A 3NHQA 3N8RA 4PM9A 2J9OA 2XK1A 1VEUA 1MZUA 3IWOA 4OP8A 2Y2LA 3PBNA 4M4XA 2K31A 1MKMA 5EOEA 5EECA 3HLWA 1LL5A 2DMWA 4Y3IA 2V8FA 1SZVA 1KDWA 5EOOA 2I9VA 3F1PA 1DP9A 1HZOA 4GW9A 4E3IA 3NY4A 5FQKA 5M18A 1L0FA 4S2KA 2V1BA 3VP4A 3UMDA 2I72A 1LL9A 1P97A 1LSXA 2PAVP 1SDNA 2BLSA 3N8SA 1YSQA 3PBOA 2QYBA 3SZTA 3IH9A 4NETA 2J9PA 4MBHA 4S2MA 4U0TA 4LV0A 3MZEA 4XT2A 3H7WB 1E3UA 3VP3A 1V9YA 4I38A 2V1AA 3D4FA 1IYSA 3VFHA 3UB5P 3ITAA 5HSQA 2P9VB 3ISGA 4R38A 2FH5A 5AJGA 2Y2NA 1MKIA 4AFIA 4KZ9A 5JYPA 1PRQA 3LIAA 4BBUA 3OC2A 3VOYA 4WZ5C 5CX7A 4ME4A 3HREA 5TR7A 3RFBA 4FSFA 1VETB 4QY6A 3ULFA 4I3JA 4HP4A 2VK3A 4A5RA 1PYYA 3FPWA 4ZJ2A 2VJWA 4N1XA 1PZOA 3G2ZA 4KZBA 2Z2MB 4HBUA 1S0WA 2VGLM 4HOIA 4MLLA 3P09A 4FOFA 1ESIA 2QWSA 5CHMA 1LI9A 3G32A 4D2OA 3SS4A 4R3AA 4LRXC 4MN6A 2VEAA 2Q9NA 1MBLA 1I2WA 2W1TB 4HJ3A 4DXBA 1ZG4A 3MMHA 4ZAMA 1TS7A 4X69A 1FR1A 4G3VA 4HESA 1OJ5A 3VV4A 3O87A 3L9KA 1C3BA 3LR5A 4KZAA 4Y0UA 3DTEA 4Y13A 4WZ5A 3BW6A 1BLSA 2PDRA 3BLMA 1MY8A 2W27A 4OOMA 1PFLA 5HW3A 3VMAA 5KSHA 3HLGA 2QJ7A 2Y8HA 2WKEA 2XRNA 1DP6A 4RX3A 2LB9A 3CJMA 4KENB 4N1HA 3T12B 2OOLA 5CGSA 4FCFA 3PHYA 3A3DA 2PR6A 1FSWA 2OAQ1 4X1MA 2XROA 3B42A 5I5LA 1VB6A 5F1GA 1ALQA 2PRFA 4IUKA 2JHEA 4L0LA 4IUHA 4KG2A 1FCNA 3B47A 4CQHA 3IF5A 4Y0TA 1UGUA 2WADA 3C2WA 3Q07A 5FEFA 4WEJA 4IVKA 2A3UA 3NDGA 3ZYTA 4JF5A 1XX2A 1CI8A 3DWZA 2FFFB 4B88A 3QHYA 1N9BA 2EFXA 1YLPA 2V9AA 2R9XA 4NEED 2JBFA 4IJGA 2G2WA 3G34A 4P85A 5FI7A 2IWBA 3LR0A 3DW0A 4EERA 1BLHA 4IEDA 3PBSA 5GLCA 2GNXA 4F94A 1TS6A 3CHWP 4E6XA 1ERMA 4Y0OA 1RP5A 1VM1A 3DBAA 1KGEA 3A3JA 5DTTA 1GSXA 3MQOA 3IXHA 1P9RA 2XFSA 3UPPA 2PYRA 1NRJA 1XFNA 4R23A 1L0DA 3E2LA 3EGXC 1XJ2A 3FC7A 2WKIA 1GHPA 4X68A 3T4JA 2Q9MA 3G6OA 3R7WB 2Y55A 5EM0A 4LLOB 4S2LA 1WE4A 1YLZA 5K5BA 1GSWA 1LT0A 3V5MA 2FZ0A 2GX5A 1H5XA 4BBVA 3VSLA 4I39A 2L1MA 3E98A 3IX3A 3UE6A 1K54A 1JTDA 4E3MA 2RL3A 4UHUA 3N8LA 1PI5A 1Z6FA 5HL6A 2ZQ9A 1JWVA 3CPTA 3KYEA 3MFDA 5EE8A 3G31A 3LR3A 5MC7A 1ES4A 2K2NA 2H5SA 2VX8A 4DKIA 1Y4OA 1NYMA 4F3LA 5GLAA 3QP4A 3IBJA 5L09A 5G4YA 3KO6A 3UDIA 4EBNA 1BULA 2JCHA 1PWGA 5F82A 2GDNA 4X25A 3OCNA 1K57A 1T1CA 2JKTI 3GRJA 2X71A 3IWIA 3NOTC 2QZ6A 3G30A 4LRYC 1P9WA 2Y4AA 4X6TA 5CGWA 2ACGA 3D3OA 3E4PA 5HD5A 4EW7A 4HY8A 2QKPA 4PM8A 3Q81A 3PBQA 1NRFA 3BYDA 1U60A 3IT9A 1IYPA 3C5AA 1OT9A 5HDSA 2D02A 3G4PA 5CEDA 5GLDA 3T1XA 3HJKA 3MQQA 5DJUA 4H8RA 1H0MA 4H6JA 4NG2A 1VETA 2J80A 1JVJA 4CPKA 5CERA 1HTZA 1ODVA 4S2IA 1K6SA 3TG9A 3U4LP 5DFXA 4OH0A 1KDSA 3UDFA 4P0MA 3GVBA 4QY5A 1L2SA 4OVDA 5A91A 5GHZA 2W3EA 3Q7VA 1CF0A 3HBRA 3UO9A 3ZDJA 5CTNA 5HWTA 3WRZA 2WAFA 2YKHA 3IXDA 2XSSA 4DJ3A 4JLFA 1TDLA 3KSHA 5L07A 5EPHA 3GSGA 1ZG6A 2M1CA 3FG8A 4WL9A 1PIOA 1YQSA 1GCEA 3LGOA 3WS2A 2XH9A 2OAP1 1XFQA 5TJJA 1KE0A 1PWDA 3MS6A 1MWRA 1GSVA 1Y54A 4PMAA 3S4XA 2A49A 4QD4A 1XP4A 1ACFA 4E3LA 3NULA 5DF8A 2ZMAA 3PXPA 1K57C 1KGGA 2V20A 4DN0A 5HZHA 4IBXA 1TVFA 4E3NA 3M6BA 3BQ8A 2PD8A 5FASA 5DF7A 1CJFA 5EVIB 2A24A 3O88A 1TS8A 5M1AA 4YOFA 3IHAA 1H8YA 3AGDA 2OSUA 3M6HA 2INWA 1ERQA 2OWJA 4OKPA 4BD1A 1XA1A 1SKOB 5F5YA 4UEYA 5DKLA 2Z6CA 4UQIS 5FAOA 5HFOA 3LI8A 3QNBA 4ARZB 2WZZA 4LV1A 2WGWA 4HI4A 4YINA 3DTIA 5FQQA 3ZG0A 1H8ZA 1KVMA 4EEPA 5IHVA 2XD1A 4KZ6A 5CRFA 4GZBA 3HUNA 3HJIA 5HD3A 2ZQAA 2IWCA 5EFWA 1LHYA 3O3VA 4LCMA 2CC1A 1S6RA 3MBZA 2BTFP 4KQDA 1W63M 2OV5A 1NLYA 5DFYA 3GDIA 1TEMA 3WWXA 4QWOA 4UQIM 4X55A 3OPLA 4EV4A 2ZQDA 5DF9A 2ZOHA 1S4RA 1YM1A 3NDEA 3C4OA 4IVIA 4E3KA 1OPXA 3PAGA 5L2FA 1AWIA 2PD7A 4JKTA 1XXMA 4WN5A 3T4LA 1SKOA 2E8JA 3DTMA 4IHQA 2V1ZA 1NXYA 3FV7A 3Q7VB 3VP2A 4GB7A 4RVAA 4NXBA 1ES3A 1Y28A 2J3WA 2WGVA 3LIDA 4OLGA 3E4QA 1EROA 3IH8A 2VV6A 3WS1A 5DKKA 1IYOA 1PZPA 3BFCA 4LV3A 1S1YA 4R4RA 4JGRA 4ZBEA 3MKEA 5FQ9A 3ZG8B 5GHYA 2JKFA 3IX8A 3K2NA 4RYEA 4KZ5A 1YMXA 3PR6A 5A92A 3EWKA 2XFTA 3LEQA 5FAQA 3QP2A 1IYQA 2MJ6A 3B3XA 4MDZA 5FQJA 4HBTA 3KX0X 1KGFA 1J3WA 3OOVA 1T1AA 1TDGA 3NC8A 4U3TA 4GS9A 1ONHA 4P6BA 1QMFA 3F1OA 2OLVA 4NKPA 5HPFA 3DWKA 2HZ5A 4PKYA 3ZNTA 3LEZA 3SS3A 3JVUA 5J8XA 1KE4A 1F5MA 1L0GA 2ZQCA 1N9OA 4O8GA 1BUEA 4R4SA 4B9OA 1TF1A 1YLYA 4EQ1A 2G2UA 3UPNA 1X0OA 3HLEA 1LSVA 3RH8B 4LV2A 5DTKA 2H0TA 3LYXA 3OCLA 2HJEA 3ITBA 1M40A 4XUZA 3BECA 4KG5A 3VP0A 4KQQA 1LI0A 3OPHA 5F6AA 4BL3A 2ZJ9A 4CLCA 5J7EA 4QJGA 3UB9A 2V0WA 4ID4A 4MN7A 1IKIA 5FSRA 1MWTA 4YWZA 4DRTA 1BTLA 3OBFA 4ZJ3A 1G6AA 1XJ6A 1SKFA 2JKGA 3BFFA 3H9WA 2ZL1B 5AQ7A 1UWPX 4PHTA 1K56D 3KSFA 1OTEA 3PBRA 4BWIA 4OQHA 4CJNA 2UWXA 2G7UA 5J3WA 4OP5A 4C3QA 4KUKA 5EV0A 5LBRA 3LIFA 2CMNA 5EUAA 2EXAA 2HPBA 2P9VA 2W1RA 5HDCA 4RX2A 3MR0A 3OZHA 5HDDA 3FPVA 4Y15A 2ZLYA 5L10A 1KOUA 4OONA 5AQAA 1OMEA 1E3UD 1EI5A 3JYIA 4OPRA 3QP5A 1E25A 1ZHHB 4G3KA 5KZHA 4X1LA 4GLQA 5TGFA 2ZQ8A 4GOGA 3PTEA 4N92A 4KQOA 3S7QA 1K4EA 4PAUA 3NOPC 3DAVA 1S67L 4JBFA 4DF6A 4LENA 3E4OA 4DE2A 2ZM2A 4FH4A 2Y2MA 4R70A 4OOYA 3IF6C 3SW1A 4S2OA 4WELA 4CLCE 4Q8IA 3IQAA 2ZOIA 1MC0A 3L7HA 5EVLA 4FD8A 4FH2A 3OLOA 2WKQA 5IT5A 2QJ5A 2Z2LB 4BENA 1TS0A 1XGIA 4OQIA 2P74A 4OQGA 2HDRA 5HAIA 3C30A 1DY6A 3CZDA 2IA2A 3UMEA 3EGDC 4ZRRA 2NUTC 2OWHA 4WLAA 4JF6A 4GHIB 4BD0A 3NBLA 4HH3A 5GLBA 4JGQA 3K3CA 4S2JA 4JGPA 4WYYA 2C6WB 3IHBA 4R1GA 3Q1FA 3IF6A
chains in the Genus database with same CATH topology
1PW8A 1ZG6A 4S2KA 1PIOA 4QB8A 5FAPA 3VP4A 5A90A 3W4QA 3W4PA 4B4XA 1YQSA 2QPNA 1GCEA 4M3KA 4E3JA 2I72A 4PM7A 2DRWA 3WS2A 5M19A 3ZCZA 1LL9A 3HUOA 5BOHA 4S2NA 2XH9A 1SDNA 2WKHA 2BLSA 3N8SA 1YMSA 3PBOA 1KE0A 1FQGA 4P87A 1PWDA 5E2HA 1MWRA 1K55A 1NYYA 1Y54A 3IH9A 4PMAA 5FI2A 3N7WA 3UY6A 3C7UA 4GD6A 2WAEA 3S4XA 4NETA 2A49A 2J9PA 4MBHA 4S2MA 4U0TA 4QD4A 4LV0A 3MZEA 1XP4A 1ES2A 1E3UA 1MWUA 3BFEA 3M2KA 2XLNA 3VP3A 3ZVWA 4E3LA 5DF8A 2ZMAA 1K57C 1KGGA 4BL2A 3C4PA 3IXGA 4QU3A 2V20A 2XR0A 3D4FA 4K0WA 3AGEA 1IYSA 3SS5A 2Y59A 4IBXA 1TVFA 3VFHA 3HLCA 3FWLA 4E3NA 1LLBA 3ITAA 3M6BA 5FASA 4OQ0A 2P9VB 3ISGA 5FI6A 3RJUA 1W8YA 3GV9A 1I5QA 1MXOA 2Y2NA 3GQZA 3UN7A 1XPBA 4XXRA 3SH8A 1MKIA 5DF7A 4WM9A 1BSGA 1RGYA 2XD5A 2ZM8A 4KZ9A 5HARA 1KE3A 5JYPA 3UE3A 3E2KA 5EVIB 3UPOA 5HX9A 5U47A 3O88A 1W5DA 1W79A 2RCXA 2Y2PA 4X53A 2VGKA 4UA9A 2ZM0A 5M1AA 4KZ3A 3OC2A 2WUQA 3VOYA 4C75A 4WZ5C 4E6WA 3FYZA 3IHAA 5CXWA 1H8YA 3AGDA 2OSUA 3HREA 5TR7A 5AQBA 3M6HA 1ERQA 2ZC7A 4OKPA 4BD1A 1XA1A 4FSFA 4QY6A 1K55C 3ZVTA 4DXCA 1BZAA 5FAOA 1MPLA 5HFOA 3QNBA 4WMCA 2WZZA 2EX6A 4A5RA 4LV1A 1PYYA 2WGWA 2VGJA 4ZJ2A 4YINA 2EXBA 2X01A 1J9MA 1Q2PA 1BT5A 2XQZA 4N1XA 1PZOA 5FQQA 3ZG0A 4EBLA 1H8ZA 3BEBA 3G2ZA 4UAAA 4KZBA 1KVMA 2Z2MB 5IHVA 4HBUA 1JWPA 2XD1A 4KZ6A 4EWFA 5CRFA 1S0WA 4GZBA 3HUNA 4MBKA 4R3JA 4MLLA 3P09A 2ZQAA 1ESIA 1M6KA 2FFYA 5HL1A 5CHMA 1LI9A 2IWCA 1CK3A 1LHYA 3A3EA 3G32A 3O3VA 2CC1A 3Q7ZA 4LCMA 4OPYA 4GN2A 5FATA 1S6RA 2Q9NA 1MBLA 3SS4A 1I2WA 3MBZA 4DXBA 3BRMA 1ZG4A 1WYCA 2IWDA 1AXBA 4ZAMA 2OV5A 3A3FA 4X69A 1FR1A 5EVIC 1TEMA 3WWXA 2ZC3B 1YLJA 4JF4A 4X55A 3OPLA 5CGXA 4EV4A 4EBPA 2J8YA 2ZQDA 4HESA 5DF9A 3O87A 1C3BA 4KZAA 4Y0UA 1CI9A 4WZ5A 1YM1A 3NDEA 3C4OA 4JXSA 4IVIA 1BLSA 4E3KA 4O7DA 4ZJ1A 1BLPA 1ESUA 3ZFZA 4OPZA 3PAGA 3BFGA 4DE0A 2WYXA 3P98A 5L2FA 3BFDA 4PM5A 4JKTA 1XXMA 3BLMA 1XKZA 2BG1A 1MY8A 2DNSA 4OOMA 3LY3A 3BLSA 3FKWA 2EX8A 5HW3A 1IELA 3DTMA 3SH9A 2V1ZA 1JWZA 3VMAA 1NXYA 3FV7A 3Q7VB 3VP2A 2EX9A 1DJAA 4GB7A 4RVAA 5KSHA 3HLGA 1ZC2A 5F1FA 1ES3A 4D2OA 1YT4A 4HEFA 1K25A 2WGVA 1G68A 2WKEA 5CHUA 5CHJA 3IWQA 1FCMA 2H10A 4PM6A 4DE1A 4N9LA 4OLGA 4Y7PA 1EROA 4RX3A 2B5RA 3CJMA 2XEPA 2Y2OA 3IH8A 4KENB 4N1HA 3WS1A 5CGSA 3NCKA 4FCFA 3A3DA 1CEFA 5HAQA 1IYOA 1FSWA 1PZPA 3BFCA 2Y2JA 4LV3A 3LCEA 3GR2A 4R4RA 1I2SA 4WBGA 5KMWA 4OOLA 4S2NC 3IF6B 3OPRA 5F1GA 4ZBEA 3MKEA 5FQ9A 3ZG8B 2XF3A 1PW1A 5GHYA 4DE3A 4RYEA 3VFFA 1ALQA 3LY4A 4GDNA 4KZ5A 3HL9A 1YMXA 3Q82A 3SH7A 3W4OA 5A92A 3C7VA 2XFTA 4JXGA 4WEKA 3TOIA 3UNWA 5FAQA 4L0LA 1JTGA 4KG2A 3MXRA 1FCNA 3ZG7B 1IYQA 4JXVA 3WRTA 3WS5A 5CEBA 3B3XA 5FQJA 4HBTA 1K54C 3IF5A 1KGFA 4Y0TA 2Y2GA 2WADA 4E3OA 2R9WA 1TDGA 2XGNA 3NC8A 4U3TA 2QMIA 3Q07A 4U0XA 4EUZA 4C6YA 2C5WB 4R0QA 3EQVA 4WEJA 1ONHA 3QNCA 3IXBA 4P6BA 5A93A 1QMFA 4LCLA 2H0YA 3PBTA 4IVKA 2A3UA 3NDGA 4JF5A 5F83A 1W8QA 1XX2A 1CI8A 3DWZA 3RXXA 3ZNYA 2FFFB 2OLVA 1O7EA 2Y2IA 3QHYA 4B88A 1N9BA 1SDEA 4K91A 3DWKA 2EFXA 1YLPA 1GA9A 1O07A 3TSGA 4JPMA 5EVIA 2R9XA 3ZNTA 3LEZA 3SS3A 4YFMA 1IEMA 2JBFA 5J8XA 2HDUA 4WZ4A 1KE4A 4BQMA 1L0GA 2G2WA 3G34A 4P85A 2ZQCA 4ZTKA 5FDHA 5FI7A 2IWBA 1BUEA 4R4SA 2PU4A 2Y91A 1YLYA 1KVLA 2G2UA 4KZ7A 3S22A 3UPNA 3DW0A 3MZDA 2Y2KA 3HLEA 1BLHA 5I94A 1GA0A 2JE5A 2HP5A 2WGIA 4IEDA 3PBSA 1K56A 4LV2A 5DTKA 2H0TA 5GLCA 4F94A 5CTMA 4E6XA 1ERMA 4Y0OA 1RP5A 3OCLA 4R3BA 1Q2QA 1VM1A 2HP6A 3HLFA 3HVFA 1M40A 3ITBA 5FA7A 1KGEA 5CECA 2HDQA 4XUZA 3A3JA 2XDMA 3BECA 4IBRA 5DTTA 4KG5A 3ZGAB 5GHXA 3IXHA 2XFSA 3UPPA 3VP0A 4KQQA 3WS4A 1LI0A 3OPHA 4GKUA 4R23A 4BL3A 1NZUA 2ZJ9A 5E2GA 1L0DA 1WYBA 1HVBA 2J7VA 4QJGA 1QMEA 3E2LA 4ID4A 3MXSA 1IKGA 1IKIA 5FSRA 2HP9A 2WKIA 1MWTA 1GHPA 4GD8A 4X68A 1HD8A 4DRTA 1DJCA 1ONGA 4GNUA 1BTLA 4ZJ3A 1G6AA 1SKFA 3V39A 1K6RA 4X56A 3BFFA 2Q9MA 1NJ4A 4B4ZA 4MBFA 4OLDA 1PI4A 5AQ7A 5HAPA 2Y55A 5E2EA 4S2LA 1K56D 1WE4A 4NK3A 1YLZA 1ZKJA 1PWCA 4DDYA 1FOFA 1K38A 3PBRA 4WMCD 4OQHA 1ES5A 3V5MA 4CJNA 2UWXA 1FSYA 1CEGA 2EFUA 4OP5A 3V3SA 1H5XA 3VOZA 3HLDA 4C3QA 3VSLA 2ZC6B 1VQQA 5G18A 2X02A 2Y2QA 4PPRA 1K54A 1FCOA 5AQ9A 5EUAA 1JTDA 2EXAA 2HPBA 4E3MA 1DJBA 3UDXA 2RL3A 3V50A 4KZ4A 4UHUA 2E8IA 5DVAA 2P9VA 3N8LA 1MWSA 3SOIA 1PI5A 3A3IA 3FKVA 4K0XA 5E2FA 1Z6FA 4BLMA 3UE1A 2Y2HA 4OPQA 3OPPA 4XUXA 4KQRA 4RX2A 2ZC4B 3OZHA 2ZQ9A 1RGZA 3M2JA 1JWVA 3V3RA 2PBYA 3Q1FA 4S2PA 1XGJA 2PU2A 3MFDA 3ZG5A 1FR6A 5D3OA 1NZOA 3O86A 5EE8A 3G31A 2V2FF 2ZLYA 1ES4A 1GHIA 2H5SA 3RXWA 3PAEA 3MKFA 4OONA 5KSCA 5AQAA 4DKIA 1OMEA 1NYMA 4KZ8A 4ZDXA 1L0EA 5GLAA 3HUMA 1E3UD 3N4IA 1EI5A 2HDSA 3JYIA 1K4FA 4RA7A 4GDBA 5DTSA 4OPRA 3UDIA 2ZD8A 1E25A 3NI9A 3HLBA 4EBNA 1BULA 2JCHA 4DDSA 1PWGA 2DCFA 5KZHA 3I7JA 1RCJA 2OLUA 2GDNA 5F82A 3OCNA 1EWZA 1K57A 3UE0A 3GRJA 3EQUA 2X71A 5TFQA 5JYOA 5TGFA 2ZQ8A 3IWIA 4GOGA 3CMZA 3PTEA 2QZ6A 3AGFA 4EQIA 3G30A 3GSGA 4N92A 4KQOA 1K4EA 2Y4AA 3BM6A 5FQIA 4X6TA 1NY0A 5CGWA 1YLTA 4JBFA 3CG5A 4KG6A 3MZFA 4DF6A 3FZCA 4PM8A 3Q81A 1SCWA 4LENA 4Z9QA 3PBQA 3VSKA 1NRFA 4DE2A 3BYDA 1U60A 2ZM2A 3VP1A 3GTCA 4FH4A 5EVID 3IT9A 2Y2MA 2ZC5B 4OOYA 3IF6C 1IYPA 3C5AA 4S2OA 3NIAA 4WELA 4Q8IA 1W7FA 1GHMA 5FQMA 3G4PA 5CEDA 5GLDA 3ZG9B 1BLCA 3LO7A 3IQAA 1E4DA 4QHCA 4UA7A 4H8RA 5EVLA 4FD8A 3N8RA 3S1YA 4FH2A 4PM9A 2J9OA 1YLWA 2Z2LB 1JVJA 2XK1A 4BENA 4CPKA 1XGIA 4OQIA 2P74A 2JC7A 4OQGA 5CERA 2HDRA 5HAIA 3IWOA 4OP8A 1HTZA 3N6IA 2Y2LA 3PBNA 4MNRA 4N9KA 2WGWB 3ZHHA 4S2IA 4UA6A 1K6SA 1DY6A 2ZQ7A 3TG9A 1XA7A 2WZXA 3CZDA 4MEZA 4OH0A 1KDSA 3UDFA 4P0MA 3GVBA 4QY5A 1L2SA 3GMWA 4OVDA 5A91A 3WS0A 5GHZA 5EOEA 5EECA 3HLWA 1LL5A 3Q7VA 3W8KA 4JXWA 4BJPA 5GL9A 3HBRA 1KDWA 5EOOA 3UO9A 4JF6A 3ZDJA 5CTNA 4BD0A 3WRZA 3NBLA 5GLBA 1HZOA 2WAFA 4S2JA 3IXDA 4E3IA 1SHVA 1N4OA 3G2YA 4WYYA 4JLFA 2C6WB 2EX2A 3IHBA 3NY4A 1TDLA 2WK0A 5E43A 4R1GA 5FQKA 5EPHA 5M18A 1L0FA 3G35A 3IF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PW8 A;  1ZG6 A;  4S2K A;  1PIO A;  4QB8 A;  5FAP A;  3VP4 A;  5A90 A;  3W4Q A;  3W4P A;  4B4X A;  1YQS A;  2QPN A;  1GCE A;  4M3K A;  4E3J A;  2I72 A;  4PM7 A;  2DRW A;  3WS2 A;  5M19 A;  3ZCZ A;  1LL9 A;  3HUO A;  5BOH A;  4S2N A;  2XH9 A;  1SDN A;  2WKH A;  2BLS A;  3N8S A;  1YMS A;  3PBO A;  1KE0 A;  1FQG A;  4P87 A;  1PWD A;  5E2H A;  1MWR A;  1K55 A;  1NYY A;  1Y54 A;  3IH9 A;  4PMA A;  5FI2 A;  3N7W A;  3UY6 A;  3C7U A;  4GD6 A;  2WAE A;  3S4X A;  4NET A;  2A49 A;  2J9P A;  4MBH A;  4S2M A;  4U0T A;  4QD4 A;  4LV0 A;  3MZE A;  1XP4 A;  1ES2 A;  1E3U A;  1MWU A;  3BFE A;  3M2K A;  2XLN A;  3VP3 A;  3ZVW A;  4E3L A;  5DF8 A;  2ZMA A;  1K57 C;  1KGG A;  4BL2 A;  3C4P A;  3IXG A;  4QU3 A;  2V20 A;  2XR0 A;  3D4F A;  4K0W A;  3AGE A;  1IYS A;  3SS5 A;  2Y59 A;  4IBX A;  1TVF A;  3VFH A;  3HLC A;  3FWL A;  4E3N A;  1LLB A;  3ITA A;  3M6B A;  5FAS A;  4OQ0 A;  2P9V B;  3ISG A;  5FI6 A;  3RJU A;  1W8Y A;  3GV9 A;  1I5Q A;  1MXO A;  2Y2N A;  3GQZ A;  3UN7 A;  1XPB A;  4XXR A;  3SH8 A;  1MKI A;  5DF7 A;  4WM9 A;  1BSG A;  1RGY A;  2XD5 A;  2ZM8 A;  4KZ9 A;  5HAR A;  1KE3 A;  5JYP A;  3UE3 A;  3E2K A;  5EVI B;  3UPO A;  5HX9 A;  5U47 A;  3O88 A;  1W5D A;  1W79 A;  2RCX A;  2Y2P A;  4X53 A;  2VGK A;  4UA9 A;  2ZM0 A;  5M1A A;  4KZ3 A;  3OC2 A;  2WUQ A;  3VOY A;  4C75 A;  4WZ5 C;  4E6W A;  3FYZ A;  3IHA A;  5CXW A;  1H8Y A;  3AGD A;  2OSU A;  3HRE A;  5TR7 A;  5AQB A;  3M6H A;  1ERQ A;  2ZC7 A;  4OKP A;  4BD1 A;  1XA1 A;  4FSF A;  4QY6 A;  1K55 C;  3ZVT A;  4DXC A;  1BZA A;  5FAO A;  1MPL A;  5HFO A;  3QNB A;  4WMC A;  2WZZ A;  2EX6 A;  4A5R A;  4LV1 A;  1PYY A;  2WGW A;  2VGJ A;  4ZJ2 A;  4YIN A;  2EXB A;  2X01 A;  1J9M A;  1Q2P A;  1BT5 A;  2XQZ A;  4N1X A;  1PZO A;  5FQQ A;  3ZG0 A;  4EBL A;  1H8Z A;  3BEB A;  3G2Z A;  4UAA A;  4KZB A;  1KVM A;  2Z2M B;  5IHV A;  4HBU A;  1JWP A;  2XD1 A;  4KZ6 A;  4EWF A;  5CRF A;  1S0W A;  4GZB A;  3HUN A;  4MBK A;  4R3J A;  4MLL A;  3P09 A;  2ZQA A;  1ESI A;  1M6K A;  2FFY A;  5HL1 A;  5CHM A;  1LI9 A;  2IWC A;  1CK3 A;  1LHY A;  3A3E A;  3G32 A;  3O3V A;  2CC1 A;  3Q7Z A;  4LCM A;  4OPY A;  4GN2 A;  5FAT A;  1S6R A;  2Q9N A;  1MBL A;  3SS4 A;  1I2W A;  3MBZ A;  4DXB A;  3BRM A;  1ZG4 A;  1WYC A;  2IWD A;  1AXB A;  4ZAM A;  2OV5 A;  3A3F A;  4X69 A;  1FR1 A;  5EVI C;  1TEM A;  3WWX A;  2ZC3 B;  1YLJ A;  4JF4 A;  4X55 A;  3OPL A;  5CGX A;  4EV4 A;  4EBP A;  2J8Y A;  2ZQD A;  4HES A;  5DF9 A;  3O87 A;  1C3B A;  4KZA A;  4Y0U A;  1CI9 A;  4WZ5 A;  1YM1 A;  3NDE A;  3C4O A;  4JXS A;  4IVI A;  1BLS A;  4E3K A;  4O7D A;  4ZJ1 A;  1BLP A;  1ESU A;  3ZFZ A;  4OPZ A;  3PAG A;  3BFG A;  4DE0 A;  2WYX A;  3P98 A;  5L2F A;  3BFD A;  4PM5 A;  4JKT A;  1XXM A;  3BLM A;  1XKZ A;  2BG1 A;  1MY8 A;  2DNS A;  4OOM A;  3LY3 A;  3BLS A;  3FKW A;  2EX8 A;  5HW3 A;  1IEL A;  3DTM A;  3SH9 A;  2V1Z A;  1JWZ A;  3VMA A;  1NXY A;  3FV7 A;  3Q7V B;  3VP2 A;  2EX9 A;  1DJA A;  4GB7 A;  4RVA A;  5KSH A;  3HLG A;  1ZC2 A;  5F1F A;  1ES3 A;  4D2O A;  1YT4 A;  4HEF A;  1K25 A;  2WGV A;  1G68 A;  2WKE A;  5CHU A;  5CHJ A;  3IWQ A;  1FCM A;  2H10 A;  4PM6 A;  4DE1 A;  4N9L A;  4OLG A;  4Y7P A;  1ERO A;  4RX3 A;  2B5R A;  3CJM A;  2XEP A;  2Y2O A;  3IH8 A;  4KEN B;  4N1H A;  3WS1 A;  5CGS A;  3NCK A;  4FCF A;  3A3D A;  1CEF A;  5HAQ A;  1IYO A;  1FSW A;  1PZP A;  3BFC A;  2Y2J A;  4LV3 A;  3LCE A;  3GR2 A;  4R4R A;  1I2S A;  4WBG A;  5KMW A;  4OOL A;  4S2N C;  3IF6 B;  3OPR A;  5F1G A;  4ZBE A;  3MKE A;  5FQ9 A;  3ZG8 B;  2XF3 A;  1PW1 A;  5GHY A;  4DE3 A;  4RYE A;  3VFF A;  1ALQ A;  3LY4 A;  4GDN A;  4KZ5 A;  3HL9 A;  1YMX A;  3Q82 A;  3SH7 A;  3W4O A;  5A92 A;  3C7V A;  2XFT A;  4JXG A;  4WEK A;  3TOI A;  3UNW A;  5FAQ A;  4L0L A;  1JTG A;  4KG2 A;  3MXR A;  1FCN A;  3ZG7 B;  1IYQ A;  4JXV A;  3WRT A;  3WS5 A;  5CEB A;  3B3X A;  5FQJ A;  4HBT A;  1K54 C;  3IF5 A;  1KGF A;  4Y0T A;  2Y2G A;  2WAD A;  4E3O A;  2R9W A;  1TDG A;  2XGN A;  3NC8 A;  4U3T A;  2QMI A;  3Q07 A;  4U0X A;  4EUZ A;  4C6Y A;  2C5W B;  4R0Q A;  3EQV A;  4WEJ A;  1ONH A;  3QNC A;  3IXB A;  4P6B A;  5A93 A;  1QMF A;  4LCL A;  2H0Y A;  3PBT A;  4IVK A;  2A3U A;  3NDG A;  4JF5 A;  5F83 A;  1W8Q A;  1XX2 A;  1CI8 A;  3DWZ A;  3RXX A;  3ZNY A;  2FFF B;  2OLV A;  1O7E A;  2Y2I A;  3QHY A;  4B88 A;  1N9B A;  1SDE A;  4K91 A;  3DWK A;  2EFX A;  1YLP A;  1GA9 A;  1O07 A;  3TSG A;  4JPM A;  5EVI A;  2R9X A;  3ZNT A;  3LEZ A;  3SS3 A;  4YFM A;  1IEM A;  2JBF A;  5J8X A;  2HDU A;  4WZ4 A;  1KE4 A;  4BQM A;  1L0G A;  2G2W A;  3G34 A;  4P85 A;  2ZQC A;  4ZTK A;  5FDH A;  5FI7 A;  2IWB A;  1BUE A;  4R4S A;  2PU4 A;  2Y91 A;  1YLY A;  1KVL A;  2G2U A;  4KZ7 A;  3S22 A;  3UPN A;  3DW0 A;  3MZD A;  2Y2K A;  3HLE A;  1BLH A;  5I94 A;  1GA0 A;  2JE5 A;  2HP5 A;  2WGI A;  4IED A;  3PBS A;  1K56 A;  4LV2 A;  5DTK A;  2H0T A;  5GLC A;  4F94 A;  5CTM A;  4E6X A;  1ERM A;  4Y0O A;  1RP5 A;  3OCL A;  4R3B A;  1Q2Q A;  1VM1 A;  2HP6 A;  3HLF A;  3HVF A;  1M40 A;  3ITB A;  5FA7 A;  1KGE A;  5CEC A;  2HDQ A;  4XUZ A;  3A3J A;  2XDM A;  3BEC A;  4IBR A;  5DTT A;  4KG5 A;  3ZGA B;  5GHX A;  3IXH A;  2XFS A;  3UPP A;  3VP0 A;  4KQQ A;  3WS4 A;  1LI0 A;  3OPH A;  4GKU A;  4R23 A;  4BL3 A;  1NZU A;  2ZJ9 A;  5E2G A;  1L0D A;  1WYB A;  1HVB A;  2J7V A;  4QJG A;  1QME A;  3E2L A;  4ID4 A;  3MXS A;  1IKG A;  1IKI A;  5FSR A;  2HP9 A;  2WKI A;  1MWT A;  1GHP A;  4GD8 A;  4X68 A;  1HD8 A;  4DRT A;  1DJC A;  1ONG A;  4GNU A;  1BTL A;  4ZJ3 A;  1G6A A;  1SKF A;  3V39 A;  1K6R A;  4X56 A;  3BFF A;  2Q9M A;  1NJ4 A;  4B4Z A;  4MBF A;  4OLD A;  1PI4 A;  5AQ7 A;  5HAP A;  2Y55 A;  5E2E A;  4S2L A;  1K56 D;  1WE4 A;  4NK3 A;  1YLZ A;  1ZKJ A;  1PWC A;  4DDY A;  1FOF A;  1K38 A;  3PBR A;  4WMC D;  4OQH A;  1ES5 A;  3V5M A;  4CJN A;  2UWX A;  1FSY A;  1CEG A;  2EFU A;  4OP5 A;  3V3S A;  1H5X A;  3VOZ A;  3HLD A;  4C3Q A;  3VSL A;  2ZC6 B;  1VQQ A;  5G18 A;  2X02 A;  2Y2Q A;  4PPR A;  1K54 A;  1FCO A;  5AQ9 A;  5EUA A;  1JTD A;  2EXA A;  2HPB A;  4E3M A;  1DJB A;  3UDX A;  2RL3 A;  3V50 A;  4KZ4 A;  4UHU A;  2E8I A;  5DVA A;  2P9V A;  3N8L A;  1MWS A;  3SOI A;  1PI5 A;  3A3I A;  3FKV A;  4K0X A;  5E2F A;  1Z6F A;  4BLM A;  3UE1 A;  2Y2H A;  4OPQ A;  3OPP A;  4XUX A;  4KQR A;  4RX2 A;  2ZC4 B;  3OZH A;  2ZQ9 A;  1RGZ A;  3M2J A;  1JWV A;  3V3R A;  2PBY A;  3Q1F A;  4S2P A;  1XGJ A;  2PU2 A;  3MFD A;  3ZG5 A;  1FR6 A;  5D3O A;  1NZO A;  3O86 A;  5EE8 A;  3G31 A;  2V2F F;  2ZLY A;  1ES4 A;  1GHI A;  2H5S A;  3RXW A;  3PAE A;  3MKF A;  4OON A;  5KSC A;  5AQA A;  4DKI A;  1OME A;  1NYM A;  4KZ8 A;  4ZDX A;  1L0E A;  5GLA A;  3HUM A;  1E3U D;  3N4I A;  1EI5 A;  2HDS A;  3JYI A;  1K4F A;  4RA7 A;  4GDB A;  5DTS A;  4OPR A;  3UDI A;  2ZD8 A;  1E25 A;  3NI9 A;  3HLB A;  4EBN A;  1BUL A;  2JCH A;  4DDS A;  1PWG A;  2DCF A;  5KZH A;  3I7J A;  1RCJ A;  2OLU A;  2GDN A;  5F82 A;  3OCN A;  1EWZ A;  1K57 A;  3UE0 A;  3GRJ A;  3EQU A;  2X71 A;  5TFQ A;  5JYO A;  5TGF A;  2ZQ8 A;  3IWI A;  4GOG A;  3CMZ A;  3PTE A;  2QZ6 A;  3AGF A;  4EQI A;  3G30 A;  3GSG A;  4N92 A;  4KQO A;  1K4E A;  2Y4A A;  3BM6 A;  5FQI A;  4X6T A;  1NY0 A;  5CGW A;  1YLT A;  4JBF A;  3CG5 A;  4KG6 A;  3MZF A;  4DF6 A;  3FZC A;  4PM8 A;  3Q81 A;  1SCW A;  4LEN A;  4Z9Q A;  3PBQ A;  3VSK A;  1NRF A;  4DE2 A;  3BYD A;  1U60 A;  2ZM2 A;  3VP1 A;  3GTC A;  4FH4 A;  5EVI D;  3IT9 A;  2Y2M A;  2ZC5 B;  4OOY A;  3IF6 C;  1IYP A;  3C5A A;  4S2O A;  3NIA A;  4WEL A;  4Q8I A;  1W7F A;  1GHM A;  5FQM A;  3G4P A;  5CED A;  5GLD A;  3ZG9 B;  1BLC A;  3LO7 A;  3IQA A;  1E4D A;  4QHC A;  4UA7 A;  4H8R A;  5EVL A;  4FD8 A;  3N8R A;  3S1Y A;  4FH2 A;  4PM9 A;  2J9O A;  1YLW A;  2Z2L B;  1JVJ A;  2XK1 A;  4BEN A;  4CPK A;  1XGI A;  4OQI A;  2P74 A;  2JC7 A;  4OQG A;  5CER A;  2HDR A;  5HAI A;  3IWO A;  4OP8 A;  1HTZ A;  3N6I A;  2Y2L A;  3PBN A;  4MNR A;  4N9K A;  2WGW B;  3ZHH A;  4S2I A;  4UA6 A;  1K6S A;  1DY6 A;  2ZQ7 A;  3TG9 A;  1XA7 A;  2WZX A;  3CZD A;  4MEZ A;  4OH0 A;  1KDS A;  3UDF A;  4P0M A;  3GVB A;  4QY5 A;  1L2S A;  3GMW A;  4OVD A;  5A91 A;  3WS0 A;  5GHZ A;  5EOE A;  5EEC A;  3HLW A;  1LL5 A;  3Q7V A;  3W8K A;  4JXW A;  4BJP A;  5GL9 A;  3HBR A;  1KDW A;  5EOO A;  3UO9 A;  4JF6 A;  3ZDJ A;  5CTN A;  4BD0 A;  3WRZ A;  3NBL A;  5GLB A;  1HZO A;  2WAF A;  4S2J A;  3IXD A;  4E3I A;  1SHV A;  1N4O A;  3G2Y A;  4WYY A;  4JLF A;  2C6W B;  2EX2 A;  3IHB A;  3NY4 A;  1TDL A;  2WK0 A;  5E43 A;  4R1G A;  5FQK A;  5EPH A;  5M18 A;  1L0F A;  3G35 A;  3IF6 A; 
#chains in the Genus database with same CATH topology
 1PW8 A;  2V8C A;  4QB8 A;  5FAP A;  5A90 A;  3W4P A;  4B4X A;  4M3K A;  2Z6D A;  4PM7 A;  2ZMV A;  5M19 A;  1HLU P;  5BOH A;  3HUO A;  1FIL A;  2Y79 A;  2WKH A;  3LFV A;  3H7W A;  3N7W A;  3UY6 A;  1LSW A;  4NXG A;  1ES2 A;  1MWU A;  3BFE A;  3M2K A;  2XLN A;  1Z09 A;  4BL2 A;  3C4P A;  3IXG A;  4QU3 A;  5EVE A;  3SS5 A;  1G6O A;  2Y59 A;  3HLC A;  3FWL A;  3EEH A;  4P6Z S;  1LLB A;  2VGL S;  1L3L A;  1MXO A;  4XXR A;  4K08 A;  3SH8 A;  1STZ A;  2A24 B;  3T50 A;  1BSG A;  1KE3 A;  3VOL A;  3E2K A;  5HX9 A;  5U47 A;  4HNB A;  4HH2 A;  1W5D A;  1W79 A;  2RCX A;  2Y2P A;  4X53 A;  3KYQ A;  2VGK A;  4UA9 A;  2ZM0 A;  3A0R A;  4KZ3 A;  5EM1 A;  4C75 A;  1S66 L;  5AQB A;  3W2Z A;  2VLG A;  3BY8 A;  1K55 C;  2VA0 A;  4DXC A;  4HHD A;  4Z1W A;  4WMC A;  1OTB A;  2EX6 A;  2VGJ A;  1Q2P A;  1BT5 A;  2XQZ A;  4GHI A;  4DJ2 A;  4HJ6 A;  1JWP A;  4MBK A;  1OJG A;  3Q7Z A;  4OPY A;  4GN2 A;  1YAX A;  2P08 A;  4L9E A;  2JKR M;  2IWD A;  2QHK A;  5EVI C;  2ZC3 B;  1NLZ A;  5L8M A;  4HQA A;  2BAS A;  1BYW A;  1CI9 A;  3CLO A;  1DP8 A;  3R7W A;  1BLP A;  1ESU A;  1T19 A;  4OPZ A;  4DE0 A;  3BFG A;  3P98 A;  3BFD A;  3CWF A;  1XKZ A;  2BG1 A;  5HPI A;  3LY3 A;  1IEL A;  1JWZ A;  3NEC A;  4L9F A;  5CHU A;  3IBR A;  5CHJ A;  3IWQ A;  4Y7P A;  2W1T A;  2XEP A;  3KSG A;  3IX4 A;  5TBM A;  3TRC A;  3NCK A;  5HAQ A;  1I2S A;  4WBG A;  5KMW A;  4OOL A;  4S2N C;  2W0N A;  3OPR A;  1YKD A;  2XF3 A;  3UB7 A;  3VFF A;  3W4O A;  2L0W A;  4WEK A;  2JKR I;  3MXR A;  3ZG7 B;  4JXV A;  1OTI A;  1PNE A;  4E3O A;  4HIA A;  2R9W A;  2XGN A;  4DMZ A;  4EEU A;  4EUZ A;  4C6Y A;  2C5W B;  3EQV A;  4FUW A;  3QNC A;  2H0Y A;  3PBT A;  1OTD A;  3BWL A;  1H8M A;  3O5Y A;  3ZNY A;  3QP8 A;  3H82 B;  4CLC B;  1GA9 A;  1O07 A;  3TSG A;  4JPM A;  4YFM A;  1IEM A;  2A2L A;  4WZ4 A;  4BQM A;  3T4S A;  2R78 A;  1KVL A;  4KZ7 A;  3C38 A;  3MZD A;  2Y2K A;  5I94 A;  3T1R A;  2JE5 A;  4LGW A;  1K56 A;  4GCZ A;  5CTM A;  2KOI A;  1Q2Q A;  3HVF A;  2HDQ A;  4IBR A;  1N9L A;  2XDM A;  3IS2 B;  3WS4 A;  5HWV A;  3QP1 A;  4GKU A;  1NZU A;  5E2G A;  1WYB A;  1HVB A;  4GJ4 A;  2PR5 A;  3MXS A;  1IKG A;  3S7O A;  2HP9 A;  4GD8 A;  1HD8 A;  1ONG A;  4GNU A;  3T4K A;  3V39 A;  4X56 A;  3BQA A;  4MBF A;  3VE4 A;  5E2E A;  4NK3 A;  1PWC A;  4DDY A;  1FOF A;  1K38 A;  1ES5 A;  2P04 A;  1CQA A;  1CEG A;  3V3S A;  3VOZ A;  3HLD A;  2O9C A;  2ZC6 B;  1VQQ A;  5AVF A;  5KIZ A;  2Y2Q A;  4PPR A;  1FCO A;  5AQ9 A;  3V50 A;  1DRM A;  2J3T D;  4G3W A;  3A3I A;  4K0X A;  2L4R A;  5E2F A;  4XUX A;  4EUV A;  3D72 A;  2EWW A;  2ZC4 B;  2P7J A;  2V0U A;  1FIK A;  3ZQ5 A;  2PU2 A;  1A0K A;  3ZG5 A;  3A0S A;  1NZO A;  2VV8 A;  2V2F F;  4YNR A;  1IFQ A;  3RXW A;  3PAE A;  4ETX A;  3MKF A;  5KSC A;  1YPR A;  4KZ8 A;  3NOU C;  2HDS A;  1D7E A;  4II7 A;  5F68 A;  3NI9 A;  3HLB A;  1YSP A;  2DCF A;  2OLU A;  3UE0 A;  5TFQ A;  3EQU A;  3MJQ A;  1G28 A;  3AGF A;  4I3A A;  3BM6 A;  1NY0 A;  3MFX A;  2B02 A;  3TJZ C;  1YLT A;  4JGO A;  4KG6 A;  3FZC A;  5TBM B;  1T18 A;  1SCW A;  4Z9Q A;  1UWN X;  2VZW A;  3R4K A;  2ZC5 B;  4Q0I A;  3T1Q B;  1W7F A;  1GHM A;  2JKT M;  2ZMF A;  3LO7 A;  2W3H A;  3NJA A;  3S1Y A;  3LUQ A;  4FTX A;  2VV7 A;  1YLW A;  3JVV A;  3C8C A;  4BMW A;  2JC7 A;  3U2A A;  2VKS A;  3N6I A;  4MNR A;  4N9K A;  4PKY G;  2WGW B;  3ZHH A;  4UA6 A;  2ZQ7 A;  1XA7 A;  2WZX A;  4MEZ A;  3LIC A;  3RTY A;  4I3I A;  3GMW A;  3WS0 A;  5DJT A;  4R6L A;  1LL8 A;  2NUP C;  2W3G A;  3W8K A;  4JXW A;  4BJP A;  5GL9 A;  3ICY A;  3F1O B;  2K7S A;  1SHV A;  1N4O A;  3G2Y A;  2EX2 A;  5E43 A;  2WK0 A;  1S1Z A;  3G35 A;  3UB6 A;  2Q0O A;  4WF0 A;  3W4Q A;  2QPN A;  4E3J A;  5F69 A;  2DRW A;  3QP6 A;  3ZCZ A;  5IU1 A;  4S2N A;  2GZA A;  1YMS A;  3HCY A;  3F1N B;  1FQG A;  4P87 A;  4LFU A;  5E2H A;  5AVE A;  1K55 A;  3P01 A;  1NYY A;  4WUJ A;  5FI2 A;  3C7U A;  4GD6 A;  2WAE A;  3T4T A;  3PYP A;  2XA7 M;  3ZVW A;  2XR0 A;  4K0W A;  3AGE A;  4OQ0 A;  1OTA A;  2PYP A;  5FI6 A;  3IS2 A;  3RJU A;  1W8Y A;  3GV9 A;  1I5Q A;  3GQZ A;  3UN7 A;  2H28 A;  1XPB A;  2GJ3 A;  4WM9 A;  2XD5 A;  1RGY A;  2ZM8 A;  5HAR A;  3UE3 A;  1VHM A;  4KUO A;  3UPO A;  2WKP A;  4CLC D;  2WUQ A;  1VEU B;  3CAX A;  3CI6 A;  3JPU A;  4E6W A;  1D06 A;  3FYZ A;  5CXW A;  2PT7 A;  4LRZ E;  4NXE A;  2ZC7 A;  3BY9 A;  3ZVT A;  1BZA A;  3E0Y A;  1MPL A;  1D1J A;  1S4S A;  1EW0 A;  2EXB A;  2X01 A;  1J9M A;  2LB5 A;  3T4Q A;  4EBL A;  3BEB A;  4UAA A;  3BJN A;  3MF0 A;  4EWF A;  4R3J A;  2UV0 E;  4P6Z M;  4E04 A;  1M6K A;  2FFY A;  5HL1 A;  1CK3 A;  3A3E A;  5FAT A;  3BRM A;  1WYC A;  1AXB A;  3A3F A;  2ZL1 A;  2HV1 A;  3KYZ A;  4MMN A;  1YLJ A;  4JF4 A;  4H6J B;  5CGX A;  4EBP A;  2J8Y A;  1OT6 A;  3T4O A;  4EET B;  4Q0J A;  2KLI A;  4HP9 A;  2AVX A;  4JXS A;  3S7N A;  4O7D A;  4ZJ1 A;  3ZFZ A;  2WYX A;  2M7V A;  4O0P A;  4PM5 A;  3S7P A;  2DNS A;  3BLS A;  3FKW A;  2EX8 A;  3SH9 A;  1XJ4 A;  2EX9 A;  1DJA A;  3V67 A;  4GS9 B;  5HWW A;  4BBT A;  1ZC2 A;  5F1F A;  3EOI A;  3UB8 A;  1YT4 A;  4HEF A;  1K25 A;  2HGV A;  1G68 A;  1FCM A;  1F98 A;  2H10 A;  4PM6 A;  4DE1 A;  4N9L A;  3K3D A;  2B5R A;  2Y2O A;  3H82 A;  4D60 A;  4QPR A;  2M7U A;  1CEF A;  2Y2J A;  4NXF A;  3LCE A;  3GR2 A;  5IS1 A;  3IF6 B;  1PW1 A;  4DE3 A;  3LY4 A;  4GDN A;  3F1N A;  3HL9 A;  2WKR A;  2J3T C;  3Q82 A;  3SH7 A;  3C7V A;  4JXG A;  3TOI A;  1ZTU A;  3UNW A;  1JTG A;  4XT2 B;  3WRT A;  2YKF A;  5FEG A;  3WS5 A;  5CEB A;  5FL3 A;  1K54 C;  3LI9 A;  2Y2G A;  1P0Z A;  2QMI A;  1WA9 A;  4U0X A;  2O9B A;  4B93 A;  4R0Q A;  4O01 A;  3IXB A;  5A93 A;  4LCL A;  3EEA A;  2PBD P;  4CLC C;  4MN5 A;  5F83 A;  1W8Q A;  3RXX A;  2Y2I A;  1O7E A;  1SDE A;  3D9Y A;  4K91 A;  3T1S A;  1IOU A;  4Y2F A;  5EVI A;  1F9I A;  1W63 Q;  3CIT A;  2HDU A;  2O99 A;  3TE8 A;  4ZTK A;  5FDH A;  2PU4 A;  4F3L B;  2Y91 A;  3KSI A;  3S22 A;  1N9N A;  3LIB A;  1NWZ A;  1GA0 A;  5A8B A;  2HP5 A;  2WGI A;  3LR4 A;  1K0K A;  4ARZ A;  4R3B A;  2HP6 A;  3HLF A;  5FA7 A;  2W3F A;  5CEC A;  3A0V A;  3ZGA B;  5GHX A;  4L9G A;  2KDK A;  3CUE A;  2J7V A;  2D01 A;  1QME A;  2EA9 A;  1DJC A;  2JN7 A;  1K6R A;  4ESP A;  3B33 A;  1NJ4 A;  4B4Z A;  4OLD A;  1PI4 A;  5HAP A;  2ZBB A;  2B18 A;  1ZKJ A;  4HJ4 A;  4WMC D;  1FSY A;  2EFU A;  5G4Z A;  5G18 A;  2X02 A;  1DJB A;  3UDX A;  3F1P B;  4KZ4 A;  5DVA A;  2E8I A;  1MWS A;  3SOI A;  3TW8 A;  3FKV A;  4BLM A;  3UE1 A;  2Y2H A;  4OPQ A;  3CUE C;  3OPP A;  4RQ9 A;  4KQR A;  1T1B A;  2EWV A;  2HF6 A;  3CPT B;  3P7N A;  4ETZ A;  1RGZ A;  3M2J A;  4I5S A;  1V9Z A;  4Q0H A;  2PBY A;  4S2P A;  3V3R A;  2XA7 S;  5C5K A;  1XGJ A;  1FR6 A;  5D3O A;  4EES A;  3O86 A;  1H3Q A;  2O9A A;  4EU0 A;  1GHI A;  4MCW A;  2O0Y A;  4ZDX A;  1L0E A;  2KX6 A;  3HUM A;  3N4I A;  1G5U A;  4RA7 A;  1K4F A;  4GDB A;  5DTS A;  2ZD8 A;  3MQ0 A;  4DDS A;  3MSH A;  2B95 A;  3I7J A;  1RCJ A;  5J4E A;  1EWZ A;  5JYO A;  2PHY A;  4LPZ A;  3GEC A;  3CMZ A;  5FDS A;  1TD5 A;  4EQI A;  3MXQ A;  2HJ9 C;  3DTK A;  4Y5F A;  5FQI A;  4Y17 A;  4EXO A;  3CG5 A;  3MZF A;  2W3D A;  3VSK A;  1XJ3 A;  3LIE A;  3VE3 A;  3VP1 A;  3GTC A;  5EVI D;  3NIA A;  5FQM A;  1F2K A;  3ZG9 B;  1BLC A;  1E4D A;  4QHC A;  1JNU A;  4UA7 A;  3NHQ A;  3N8R A;  4PM9 A;  2J9O A;  2XK1 A;  1VEU A;  1MZU A;  3IWO A;  4OP8 A;  2Y2L A;  3PBN A;  4M4X A;  2K31 A;  1MKM A;  5EOE A;  5EEC A;  3HLW A;  1LL5 A;  2DMW A;  4Y3I A;  2V8F A;  1SZV A;  1KDW A;  5EOO A;  2I9V A;  3F1P A;  1DP9 A;  1HZO A;  4GW9 A;  4E3I A;  3NY4 A;  5FQK A;  5M18 A;  1L0F A;  4S2K A;  2V1B A;  3VP4 A;  3UMD A;  2I72 A;  1LL9 A;  1P97 A;  1LSX A;  2PAV P;  1SDN A;  2BLS A;  3N8S A;  1YSQ A;  3PBO A;  2QYB A;  3SZT A;  3IH9 A;  4NET A;  2J9P A;  4MBH A;  4S2M A;  4U0T A;  4LV0 A;  3MZE A;  4XT2 A;  3H7W B;  1E3U A;  3VP3 A;  1V9Y A;  4I38 A;  2V1A A;  3D4F A;  1IYS A;  3VFH A;  3UB5 P;  3ITA A;  5HSQ A;  2P9V B;  3ISG A;  4R38 A;  2FH5 A;  5AJG A;  2Y2N A;  1MKI A;  4AFI A;  4KZ9 A;  5JYP A;  1PRQ A;  3LIA A;  4BBU A;  3OC2 A;  3VOY A;  4WZ5 C;  5CX7 A;  4ME4 A;  3HRE A;  5TR7 A;  3RFB A;  4FSF A;  1VET B;  4QY6 A;  3ULF A;  4I3J A;  4HP4 A;  2VK3 A;  4A5R A;  1PYY A;  3FPW A;  4ZJ2 A;  2VJW A;  4N1X A;  1PZO A;  3G2Z A;  4KZB A;  2Z2M B;  4HBU A;  1S0W A;  2VGL M;  4HOI A;  4MLL A;  3P09 A;  4FOF A;  1ESI A;  2QWS A;  5CHM A;  1LI9 A;  3G32 A;  4D2O A;  3SS4 A;  4R3A A;  4LRX C;  4MN6 A;  2VEA A;  2Q9N A;  1MBL A;  1I2W A;  2W1T B;  4HJ3 A;  4DXB A;  1ZG4 A;  3MMH A;  4ZAM A;  1TS7 A;  4X69 A;  1FR1 A;  4G3V A;  4HES A;  1OJ5 A;  3VV4 A;  3O87 A;  3L9K A;  1C3B A;  3LR5 A;  4KZA A;  4Y0U A;  3DTE A;  4Y13 A;  4WZ5 A;  3BW6 A;  1BLS A;  2PDR A;  3BLM A;  1MY8 A;  2W27 A;  4OOM A;  1PFL A;  5HW3 A;  3VMA A;  5KSH A;  3HLG A;  2QJ7 A;  2Y8H A;  2WKE A;  2XRN A;  1DP6 A;  4RX3 A;  2LB9 A;  3CJM A;  4KEN B;  4N1H A;  3T12 B;  2OOL A;  5CGS A;  4FCF A;  3PHY A;  3A3D A;  2PR6 A;  1FSW A;  2OAQ 1;  4X1M A;  2XRO A;  3B42 A;  5I5L A;  1VB6 A;  5F1G A;  1ALQ A;  2PRF A;  4IUK A;  2JHE A;  4L0L A;  4IUH A;  4KG2 A;  1FCN A;  3B47 A;  4CQH A;  3IF5 A;  4Y0T A;  1UGU A;  2WAD A;  3C2W A;  3Q07 A;  5FEF A;  4WEJ A;  4IVK A;  2A3U A;  3NDG A;  3ZYT A;  4JF5 A;  1XX2 A;  1CI8 A;  3DWZ A;  2FFF B;  4B88 A;  3QHY A;  1N9B A;  2EFX A;  1YLP A;  2V9A A;  2R9X A;  4NEE D;  2JBF A;  4IJG A;  2G2W A;  3G34 A;  4P85 A;  5FI7 A;  2IWB A;  3LR0 A;  3DW0 A;  4EER A;  1BLH A;  4IED A;  3PBS A;  5GLC A;  2GNX A;  4F94 A;  1TS6 A;  3CHW P;  4E6X A;  1ERM A;  4Y0O A;  1RP5 A;  1VM1 A;  3DBA A;  1KGE A;  3A3J A;  5DTT A;  1GSX A;  3MQO A;  3IXH A;  1P9R A;  2XFS A;  3UPP A;  2PYR A;  1NRJ A;  1XFN A;  4R23 A;  1L0D A;  3E2L A;  3EGX C;  1XJ2 A;  3FC7 A;  2WKI A;  1GHP A;  4X68 A;  3T4J A;  2Q9M A;  3G6O A;  3R7W B;  2Y55 A;  5EM0 A;  4LLO B;  4S2L A;  1WE4 A;  1YLZ A;  5K5B A;  1GSW A;  1LT0 A;  3V5M A;  2FZ0 A;  2GX5 A;  1H5X A;  4BBV A;  3VSL A;  4I39 A;  2L1M A;  3E98 A;  3IX3 A;  3UE6 A;  1K54 A;  1JTD A;  4E3M A;  2RL3 A;  4UHU A;  3N8L A;  1PI5 A;  1Z6F A;  5HL6 A;  2ZQ9 A;  1JWV A;  3CPT A;  3KYE A;  3MFD A;  5EE8 A;  3G31 A;  3LR3 A;  5MC7 A;  1ES4 A;  2K2N A;  2H5S A;  2VX8 A;  4DKI A;  1Y4O A;  1NYM A;  4F3L A;  5GLA A;  3QP4 A;  3IBJ A;  5L09 A;  5G4Y A;  3KO6 A;  3UDI A;  4EBN A;  1BUL A;  2JCH A;  1PWG A;  5F82 A;  2GDN A;  4X25 A;  3OCN A;  1K57 A;  1T1C A;  2JKT I;  3GRJ A;  2X71 A;  3IWI A;  3NOT C;  2QZ6 A;  3G30 A;  4LRY C;  1P9W A;  2Y4A A;  4X6T A;  5CGW A;  2ACG A;  3D3O A;  3E4P A;  5HD5 A;  4EW7 A;  4HY8 A;  2QKP A;  4PM8 A;  3Q81 A;  3PBQ A;  1NRF A;  3BYD A;  1U60 A;  3IT9 A;  1IYP A;  3C5A A;  1OT9 A;  5HDS A;  2D02 A;  3G4P A;  5CED A;  5GLD A;  3T1X A;  3HJK A;  3MQQ A;  5DJU A;  4H8R A;  1H0M A;  4H6J A;  4NG2 A;  1VET A;  2J80 A;  1JVJ A;  4CPK A;  5CER A;  1HTZ A;  1ODV A;  4S2I A;  1K6S A;  3TG9 A;  3U4L P;  5DFX A;  4OH0 A;  1KDS A;  3UDF A;  4P0M A;  3GVB A;  4QY5 A;  1L2S A;  4OVD A;  5A91 A;  5GHZ A;  2W3E A;  3Q7V A;  1CF0 A;  3HBR A;  3UO9 A;  3ZDJ A;  5CTN A;  5HWT A;  3WRZ A;  2WAF A;  2YKH A;  3IXD A;  2XSS A;  4DJ3 A;  4JLF A;  1TDL A;  3KSH A;  5L07 A;  5EPH A;  3GSG A;  1ZG6 A;  2M1C A;  3FG8 A;  4WL9 A;  1PIO A;  1YQS A;  1GCE A;  3LGO A;  3WS2 A;  2XH9 A;  2OAP 1;  1XFQ A;  5TJJ A;  1KE0 A;  1PWD A;  3MS6 A;  1MWR A;  1GSV A;  1Y54 A;  4PMA A;  3S4X A;  2A49 A;  4QD4 A;  1XP4 A;  1ACF A;  4E3L A;  3NUL A;  5DF8 A;  2ZMA A;  3PXP A;  1K57 C;  1KGG A;  2V20 A;  4DN0 A;  5HZH A;  4IBX A;  1TVF A;  4E3N A;  3M6B A;  3BQ8 A;  2PD8 A;  5FAS A;  5DF7 A;  1CJF A;  5EVI B;  2A24 A;  3O88 A;  1TS8 A;  5M1A A;  4YOF A;  3IHA A;  1H8Y A;  3AGD A;  2OSU A;  3M6H A;  2INW A;  1ERQ A;  2OWJ A;  4OKP A;  4BD1 A;  1XA1 A;  1SKO B;  5F5Y A;  4UEY A;  5DKL A;  2Z6C A;  4UQI S;  5FAO A;  5HFO A;  3LI8 A;  3QNB A;  4ARZ B;  2WZZ A;  4LV1 A;  2WGW A;  4HI4 A;  4YIN A;  3DTI A;  5FQQ A;  3ZG0 A;  1H8Z A;  1KVM A;  4EEP A;  5IHV A;  2XD1 A;  4KZ6 A;  5CRF A;  4GZB A;  3HUN A;  3HJI A;  5HD3 A;  2ZQA A;  2IWC A;  5EFW A;  1LHY A;  3O3V A;  4LCM A;  2CC1 A;  1S6R A;  3MBZ A;  2BTF P;  4KQD A;  1W63 M;  2OV5 A;  1NLY A;  5DFY A;  3GDI A;  1TEM A;  3WWX A;  4QWO A;  4UQI M;  4X55 A;  3OPL A;  4EV4 A;  2ZQD A;  5DF9 A;  2ZOH A;  1S4R A;  1YM1 A;  3NDE A;  3C4O A;  4IVI A;  4E3K A;  1OPX A;  3PAG A;  5L2F A;  1AWI A;  2PD7 A;  4JKT A;  1XXM A;  4WN5 A;  3T4L A;  1SKO A;  2E8J A;  3DTM A;  4IHQ A;  2V1Z A;  1NXY A;  3FV7 A;  3Q7V B;  3VP2 A;  4GB7 A;  4RVA A;  4NXB A;  1ES3 A;  1Y28 A;  2J3W A;  2WGV A;  3LID A;  4OLG A;  3E4Q A;  1ERO A;  3IH8 A;  2VV6 A;  3WS1 A;  5DKK A;  1IYO A;  1PZP A;  3BFC A;  4LV3 A;  1S1Y A;  4R4R A;  4JGR A;  4ZBE A;  3MKE A;  5FQ9 A;  3ZG8 B;  5GHY A;  2JKF A;  3IX8 A;  3K2N A;  4RYE A;  4KZ5 A;  1YMX A;  3PR6 A;  5A92 A;  3EWK A;  2XFT A;  3LEQ A;  5FAQ A;  3QP2 A;  1IYQ A;  2MJ6 A;  3B3X A;  4MDZ A;  5FQJ A;  4HBT A;  3KX0 X;  1KGF A;  1J3W A;  3OOV A;  1T1A A;  1TDG A;  3NC8 A;  4U3T A;  4GS9 A;  1ONH A;  4P6B A;  1QMF A;  3F1O A;  2OLV A;  4NKP A;  5HPF A;  3DWK A;  2HZ5 A;  4PKY A;  3ZNT A;  3LEZ A;  3SS3 A;  3JVU A;  5J8X A;  1KE4 A;  1F5M A;  1L0G A;  2ZQC A;  1N9O A;  4O8G A;  1BUE A;  4R4S A;  4B9O A;  1TF1 A;  1YLY A;  4EQ1 A;  2G2U A;  3UPN A;  1X0O A;  3HLE A;  1LSV A;  3RH8 B;  4LV2 A;  5DTK A;  2H0T A;  3LYX A;  3OCL A;  2HJE A;  3ITB A;  1M40 A;  4XUZ A;  3BEC A;  4KG5 A;  3VP0 A;  4KQQ A;  1LI0 A;  3OPH A;  5F6A A;  4BL3 A;  2ZJ9 A;  4CLC A;  5J7E A;  4QJG A;  3UB9 A;  2V0W A;  4ID4 A;  4MN7 A;  1IKI A;  5FSR A;  1MWT A;  4YWZ A;  4DRT A;  1BTL A;  3OBF A;  4ZJ3 A;  1G6A A;  1XJ6 A;  1SKF A;  2JKG A;  3BFF A;  3H9W A;  2ZL1 B;  5AQ7 A;  1UWP X;  4PHT A;  1K56 D;  3KSF A;  1OTE A;  3PBR A;  4BWI A;  4OQH A;  4CJN A;  2UWX A;  2G7U A;  5J3W A;  4OP5 A;  4C3Q A;  4KUK A;  5EV0 A;  5LBR A;  3LIF A;  2CMN A;  5EUA A;  2EXA A;  2HPB A;  2P9V A;  2W1R A;  5HDC A;  4RX2 A;  3MR0 A;  3OZH A;  5HDD A;  3FPV A;  4Y15 A;  2ZLY A;  5L10 A;  1KOU A;  4OON A;  5AQA A;  1OME A;  1E3U D;  1EI5 A;  3JYI A;  4OPR A;  3QP5 A;  1E25 A;  1ZHH B;  4G3K A;  5KZH A;  4X1L A;  4GLQ A;  5TGF A;  2ZQ8 A;  4GOG A;  3PTE A;  4N92 A;  4KQO A;  3S7Q A;  1K4E A;  4PAU A;  3NOP C;  3DAV A;  1S67 L;  4JBF A;  4DF6 A;  4LEN A;  3E4O A;  4DE2 A;  2ZM2 A;  4FH4 A;  2Y2M A;  4R70 A;  4OOY A;  3IF6 C;  3SW1 A;  4S2O A;  4WEL A;  4CLC E;  4Q8I A;  3IQA A;  2ZOI A;  1MC0 A;  3L7H A;  5EVL A;  4FD8 A;  4FH2 A;  3OLO A;  2WKQ A;  5IT5 A;  2QJ5 A;  2Z2L B;  4BEN A;  1TS0 A;  1XGI A;  4OQI A;  2P74 A;  4OQG A;  2HDR A;  5HAI A;  3C30 A;  1DY6 A;  3CZD A;  2IA2 A;  3UME A;  3EGD C;  4ZRR A;  2NUT C;  2OWH A;  4WLA A;  4JF6 A;  4GHI B;  4BD0 A;  3NBL A;  4HH3 A;  5GLB A;  4JGQ A;  3K3C A;  4S2J A;  4JGP A;  4WYY A;  2C6W B;  3IHB A;  4R1G A;  3Q1F A;  3IF6 A; 
#chains in the Genus database with same CATH homology
 1PW8 A;  1ZG6 A;  4S2K A;  1PIO A;  4QB8 A;  5FAP A;  3VP4 A;  5A90 A;  3W4Q A;  3W4P A;  4B4X A;  1YQS A;  2QPN A;  1GCE A;  4M3K A;  4E3J A;  2I72 A;  4PM7 A;  2DRW A;  3WS2 A;  5M19 A;  3ZCZ A;  1LL9 A;  3HUO A;  5BOH A;  4S2N A;  2XH9 A;  1SDN A;  2WKH A;  2BLS A;  3N8S A;  1YMS A;  3PBO A;  1KE0 A;  1FQG A;  4P87 A;  1PWD A;  5E2H A;  1MWR A;  1K55 A;  1NYY A;  1Y54 A;  3IH9 A;  4PMA A;  5FI2 A;  3N7W A;  3UY6 A;  3C7U A;  4GD6 A;  2WAE A;  3S4X A;  4NET A;  2A49 A;  2J9P A;  4MBH A;  4S2M A;  4U0T A;  4QD4 A;  4LV0 A;  3MZE A;  1XP4 A;  1ES2 A;  1E3U A;  1MWU A;  3BFE A;  3M2K A;  2XLN A;  3VP3 A;  3ZVW A;  4E3L A;  5DF8 A;  2ZMA A;  1K57 C;  1KGG A;  4BL2 A;  3C4P A;  3IXG A;  4QU3 A;  2V20 A;  2XR0 A;  3D4F A;  4K0W A;  3AGE A;  1IYS A;  3SS5 A;  2Y59 A;  4IBX A;  1TVF A;  3VFH A;  3HLC A;  3FWL A;  4E3N A;  1LLB A;  3ITA A;  3M6B A;  5FAS A;  4OQ0 A;  2P9V B;  3ISG A;  5FI6 A;  3RJU A;  1W8Y A;  3GV9 A;  1I5Q A;  1MXO A;  2Y2N A;  3GQZ A;  3UN7 A;  1XPB A;  4XXR A;  3SH8 A;  1MKI A;  5DF7 A;  4WM9 A;  1BSG A;  1RGY A;  2XD5 A;  2ZM8 A;  4KZ9 A;  5HAR A;  1KE3 A;  5JYP A;  3UE3 A;  3E2K A;  5EVI B;  3UPO A;  5HX9 A;  5U47 A;  3O88 A;  1W5D A;  1W79 A;  2RCX A;  2Y2P A;  4X53 A;  2VGK A;  4UA9 A;  2ZM0 A;  5M1A A;  4KZ3 A;  3OC2 A;  2WUQ A;  3VOY A;  4C75 A;  4WZ5 C;  4E6W A;  3FYZ A;  3IHA A;  5CXW A;  1H8Y A;  3AGD A;  2OSU A;  3HRE A;  5TR7 A;  5AQB A;  3M6H A;  1ERQ A;  2ZC7 A;  4OKP A;  4BD1 A;  1XA1 A;  4FSF A;  4QY6 A;  1K55 C;  3ZVT A;  4DXC A;  1BZA A;  5FAO A;  1MPL A;  5HFO A;  3QNB A;  4WMC A;  2WZZ A;  2EX6 A;  4A5R A;  4LV1 A;  1PYY A;  2WGW A;  2VGJ A;  4ZJ2 A;  4YIN A;  2EXB A;  2X01 A;  1J9M A;  1Q2P A;  1BT5 A;  2XQZ A;  4N1X A;  1PZO A;  5FQQ A;  3ZG0 A;  4EBL A;  1H8Z A;  3BEB A;  3G2Z A;  4UAA A;  4KZB A;  1KVM A;  2Z2M B;  5IHV A;  4HBU A;  1JWP A;  2XD1 A;  4KZ6 A;  4EWF A;  5CRF A;  1S0W A;  4GZB A;  3HUN A;  4MBK A;  4R3J A;  4MLL A;  3P09 A;  2ZQA A;  1ESI A;  1M6K A;  2FFY A;  5HL1 A;  5CHM A;  1LI9 A;  2IWC A;  1CK3 A;  1LHY A;  3A3E A;  3G32 A;  3O3V A;  2CC1 A;  3Q7Z A;  4LCM A;  4OPY A;  4GN2 A;  5FAT A;  1S6R A;  2Q9N A;  1MBL A;  3SS4 A;  1I2W A;  3MBZ A;  4DXB A;  3BRM A;  1ZG4 A;  1WYC A;  2IWD A;  1AXB A;  4ZAM A;  2OV5 A;  3A3F A;  4X69 A;  1FR1 A;  5EVI C;  1TEM A;  3WWX A;  2ZC3 B;  1YLJ A;  4JF4 A;  4X55 A;  3OPL A;  5CGX A;  4EV4 A;  4EBP A;  2J8Y A;  2ZQD A;  4HES A;  5DF9 A;  3O87 A;  1C3B A;  4KZA A;  4Y0U A;  1CI9 A;  4WZ5 A;  1YM1 A;  3NDE A;  3C4O A;  4JXS A;  4IVI A;  1BLS A;  4E3K A;  4O7D A;  4ZJ1 A;  1BLP A;  1ESU A;  3ZFZ A;  4OPZ A;  3PAG A;  3BFG A;  4DE0 A;  2WYX A;  3P98 A;  5L2F A;  3BFD A;  4PM5 A;  4JKT A;  1XXM A;  3BLM A;  1XKZ A;  2BG1 A;  1MY8 A;  2DNS A;  4OOM A;  3LY3 A;  3BLS A;  3FKW A;  2EX8 A;  5HW3 A;  1IEL A;  3DTM A;  3SH9 A;  2V1Z A;  1JWZ A;  3VMA A;  1NXY A;  3FV7 A;  3Q7V B;  3VP2 A;  2EX9 A;  1DJA A;  4GB7 A;  4RVA A;  5KSH A;  3HLG A;  1ZC2 A;  5F1F A;  1ES3 A;  4D2O A;  1YT4 A;  4HEF A;  1K25 A;  2WGV A;  1G68 A;  2WKE A;  5CHU A;  5CHJ A;  3IWQ A;  1FCM A;  2H10 A;  4PM6 A;  4DE1 A;  4N9L A;  4OLG A;  4Y7P A;  1ERO A;  4RX3 A;  2B5R A;  3CJM A;  2XEP A;  2Y2O A;  3IH8 A;  4KEN B;  4N1H A;  3WS1 A;  5CGS A;  3NCK A;  4FCF A;  3A3D A;  1CEF A;  5HAQ A;  1IYO A;  1FSW A;  1PZP A;  3BFC A;  2Y2J A;  4LV3 A;  3LCE A;  3GR2 A;  4R4R A;  1I2S A;  4WBG A;  5KMW A;  4OOL A;  4S2N C;  3IF6 B;  3OPR A;  5F1G A;  4ZBE A;  3MKE A;  5FQ9 A;  3ZG8 B;  2XF3 A;  1PW1 A;  5GHY A;  4DE3 A;  4RYE A;  3VFF A;  1ALQ A;  3LY4 A;  4GDN A;  4KZ5 A;  3HL9 A;  1YMX A;  3Q82 A;  3SH7 A;  3W4O A;  5A92 A;  3C7V A;  2XFT A;  4JXG A;  4WEK A;  3TOI A;  3UNW A;  5FAQ A;  4L0L A;  1JTG A;  4KG2 A;  3MXR A;  1FCN A;  3ZG7 B;  1IYQ A;  4JXV A;  3WRT A;  3WS5 A;  5CEB A;  3B3X A;  5FQJ A;  4HBT A;  1K54 C;  3IF5 A;  1KGF A;  4Y0T A;  2Y2G A;  2WAD A;  4E3O A;  2R9W A;  1TDG A;  2XGN A;  3NC8 A;  4U3T A;  2QMI A;  3Q07 A;  4U0X A;  4EUZ A;  4C6Y A;  2C5W B;  4R0Q A;  3EQV A;  4WEJ A;  1ONH A;  3QNC A;  3IXB A;  4P6B A;  5A93 A;  1QMF A;  4LCL A;  2H0Y A;  3PBT A;  4IVK A;  2A3U A;  3NDG A;  4JF5 A;  5F83 A;  1W8Q A;  1XX2 A;  1CI8 A;  3DWZ A;  3RXX A;  3ZNY A;  2FFF B;  2OLV A;  1O7E A;  2Y2I A;  3QHY A;  4B88 A;  1N9B A;  1SDE A;  4K91 A;  3DWK A;  2EFX A;  1YLP A;  1GA9 A;  1O07 A;  3TSG A;  4JPM A;  5EVI A;  2R9X A;  3ZNT A;  3LEZ A;  3SS3 A;  4YFM A;  1IEM A;  2JBF A;  5J8X A;  2HDU A;  4WZ4 A;  1KE4 A;  4BQM A;  1L0G A;  2G2W A;  3G34 A;  4P85 A;  2ZQC A;  4ZTK A;  5FDH A;  5FI7 A;  2IWB A;  1BUE A;  4R4S A;  2PU4 A;  2Y91 A;  1YLY A;  1KVL A;  2G2U A;  4KZ7 A;  3S22 A;  3UPN A;  3DW0 A;  3MZD A;  2Y2K A;  3HLE A;  1BLH A;  5I94 A;  1GA0 A;  2JE5 A;  2HP5 A;  2WGI A;  4IED A;  3PBS A;  1K56 A;  4LV2 A;  5DTK A;  2H0T A;  5GLC A;  4F94 A;  5CTM A;  4E6X A;  1ERM A;  4Y0O A;  1RP5 A;  3OCL A;  4R3B A;  1Q2Q A;  1VM1 A;  2HP6 A;  3HLF A;  3HVF A;  1M40 A;  3ITB A;  5FA7 A;  1KGE A;  5CEC A;  2HDQ A;  4XUZ A;  3A3J A;  2XDM A;  3BEC A;  4IBR A;  5DTT A;  4KG5 A;  3ZGA B;  5GHX A;  3IXH A;  2XFS A;  3UPP A;  3VP0 A;  4KQQ A;  3WS4 A;  1LI0 A;  3OPH A;  4GKU A;  4R23 A;  4BL3 A;  1NZU A;  2ZJ9 A;  5E2G A;  1L0D A;  1WYB A;  1HVB A;  2J7V A;  4QJG A;  1QME A;  3E2L A;  4ID4 A;  3MXS A;  1IKG A;  1IKI A;  5FSR A;  2HP9 A;  2WKI A;  1MWT A;  1GHP A;  4GD8 A;  4X68 A;  1HD8 A;  4DRT A;  1DJC A;  1ONG A;  4GNU A;  1BTL A;  4ZJ3 A;  1G6A A;  1SKF A;  3V39 A;  1K6R A;  4X56 A;  3BFF A;  2Q9M A;  1NJ4 A;  4B4Z A;  4MBF A;  4OLD A;  1PI4 A;  5AQ7 A;  5HAP A;  2Y55 A;  5E2E A;  4S2L A;  1K56 D;  1WE4 A;  4NK3 A;  1YLZ A;  1ZKJ A;  1PWC A;  4DDY A;  1FOF A;  1K38 A;  3PBR A;  4WMC D;  4OQH A;  1ES5 A;  3V5M A;  4CJN A;  2UWX A;  1FSY A;  1CEG A;  2EFU A;  4OP5 A;  3V3S A;  1H5X A;  3VOZ A;  3HLD A;  4C3Q A;  3VSL A;  2ZC6 B;  1VQQ A;  5G18 A;  2X02 A;  2Y2Q A;  4PPR A;  1K54 A;  1FCO A;  5AQ9 A;  5EUA A;  1JTD A;  2EXA A;  2HPB A;  4E3M A;  1DJB A;  3UDX A;  2RL3 A;  3V50 A;  4KZ4 A;  4UHU A;  2E8I A;  5DVA A;  2P9V A;  3N8L A;  1MWS A;  3SOI A;  1PI5 A;  3A3I A;  3FKV A;  4K0X A;  5E2F A;  1Z6F A;  4BLM A;  3UE1 A;  2Y2H A;  4OPQ A;  3OPP A;  4XUX A;  4KQR A;  4RX2 A;  2ZC4 B;  3OZH A;  2ZQ9 A;  1RGZ A;  3M2J A;  1JWV A;  3V3R A;  2PBY A;  3Q1F A;  4S2P A;  1XGJ A;  2PU2 A;  3MFD A;  3ZG5 A;  1FR6 A;  5D3O A;  1NZO A;  3O86 A;  5EE8 A;  3G31 A;  2V2F F;  2ZLY A;  1ES4 A;  1GHI A;  2H5S A;  3RXW A;  3PAE A;  3MKF A;  4OON A;  5KSC A;  5AQA A;  4DKI A;  1OME A;  1NYM A;  4KZ8 A;  4ZDX A;  1L0E A;  5GLA A;  3HUM A;  1E3U D;  3N4I A;  1EI5 A;  2HDS A;  3JYI A;  1K4F A;  4RA7 A;  4GDB A;  5DTS A;  4OPR A;  3UDI A;  2ZD8 A;  1E25 A;  3NI9 A;  3HLB A;  4EBN A;  1BUL A;  2JCH A;  4DDS A;  1PWG A;  2DCF A;  5KZH A;  3I7J A;  1RCJ A;  2OLU A;  2GDN A;  5F82 A;  3OCN A;  1EWZ A;  1K57 A;  3UE0 A;  3GRJ A;  3EQU A;  2X71 A;  5TFQ A;  5JYO A;  5TGF A;  2ZQ8 A;  3IWI A;  4GOG A;  3CMZ A;  3PTE A;  2QZ6 A;  3AGF A;  4EQI A;  3G30 A;  3GSG A;  4N92 A;  4KQO A;  1K4E A;  2Y4A A;  3BM6 A;  5FQI A;  4X6T A;  1NY0 A;  5CGW A;  1YLT A;  4JBF A;  3CG5 A;  4KG6 A;  3MZF A;  4DF6 A;  3FZC A;  4PM8 A;  3Q81 A;  1SCW A;  4LEN A;  4Z9Q A;  3PBQ A;  3VSK A;  1NRF A;  4DE2 A;  3BYD A;  1U60 A;  2ZM2 A;  3VP1 A;  3GTC A;  4FH4 A;  5EVI D;  3IT9 A;  2Y2M A;  2ZC5 B;  4OOY A;  3IF6 C;  1IYP A;  3C5A A;  4S2O A;  3NIA A;  4WEL A;  4Q8I A;  1W7F A;  1GHM A;  5FQM A;  3G4P A;  5CED A;  5GLD A;  3ZG9 B;  1BLC A;  3LO7 A;  3IQA A;  1E4D A;  4QHC A;  4UA7 A;  4H8R A;  5EVL A;  4FD8 A;  3N8R A;  3S1Y A;  4FH2 A;  4PM9 A;  2J9O A;  1YLW A;  2Z2L B;  1JVJ A;  2XK1 A;  4BEN A;  4CPK A;  1XGI A;  4OQI A;  2P74 A;  2JC7 A;  4OQG A;  5CER A;  2HDR A;  5HAI A;  3IWO A;  4OP8 A;  1HTZ A;  3N6I A;  2Y2L A;  3PBN A;  4MNR A;  4N9K A;  2WGW B;  3ZHH A;  4S2I A;  4UA6 A;  1K6S A;  1DY6 A;  2ZQ7 A;  3TG9 A;  1XA7 A;  2WZX A;  3CZD A;  4MEZ A;  4OH0 A;  1KDS A;  3UDF A;  4P0M A;  3GVB A;  4QY5 A;  1L2S A;  3GMW A;  4OVD A;  5A91 A;  3WS0 A;  5GHZ A;  5EOE A;  5EEC A;  3HLW A;  1LL5 A;  3Q7V A;  3W8K A;  4JXW A;  4BJP A;  5GL9 A;  3HBR A;  1KDW A;  5EOO A;  3UO9 A;  4JF6 A;  3ZDJ A;  5CTN A;  4BD0 A;  3WRZ A;  3NBL A;  5GLB A;  1HZO A;  2WAF A;  4S2J A;  3IXD A;  4E3I A;  1SHV A;  1N4O A;  3G2Y A;  4WYY A;  4JLF A;  2C6W B;  2EX2 A;  3IHB A;  3NY4 A;  1TDL A;  2WK0 A;  5E43 A;  4R1G A;  5FQK A;  5EPH A;  5M18 A;  1L0F A;  3G35 A;  3IF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...