1LI9A

Crystal structure of tem-34 beta-lactamase at 1.5 angstrom
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMVSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class A beta-Lactamase- TEM-34
publication title The structural bases of antibiotic resistance in the clinically derived mutant beta-lactamases TEM-30, TEM-32, and TEM-34.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 95
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1li9A00
3I7JA 5GLCA 4MBFA 1NY0A 4WZ5C 3DWZA 4R0QA 2Y2NA 1BT5A 3SH8A 4B4ZA 1NYYA 1S6RA 1EWZA 1I2SA 1BLSA 1W7FA 2XDMA 5DTTA 4Z9QA 3VOYA 3TSGA 2XFSA 5CTNA 4S2NC 5GL9A 1MWUA 5EVIB 3WS1A 3BEBA 1YM1A 5DTSA 1TDLA 3RJUA 4E3JA 2EX6A 3UE1A 2G2UA 4RA7A 1BZAA 4OOMA 2XQZA 4F94A 4KENB 5TGFA 1FOFA 1E3UA 2XLNA 2ZLYA 3O88A 1PYYA 1MPLA 4B88A 5F1FA 1VM1A 1K25A 5TR7A 2QZ6A 3ZVTA 4JF5A 1KE4A 4QY5A 5CHUA 5EPHA 4X55A 3WS0A 3PBNA 4WELA 1IYQA 3ZG8B 3A3JA 3BFEA 4KQOA 1PI5A 3V39A 3QNCA 5HAPA 1YLTA 1JWPA 1K57A 3OPHA 4E3OA 3PAEA 3VFHA 4BD0A 2X01A 3NIAA 4HEFA 3MKEA 1ALQA 5E2GA 5JYOA 1HVBA 1PW8A 2HP6A 4GNUA 1MY8A 3Q7VB 2P74A 4JF6A 4QD4A 3IWIA 1ERQA 2HP5A 4OP8A 5KSCA 4WZ4A 2P9VA 2WGIA 5GHXA 1EROA 4P85A 2Q9MA 4JLFA 5KZHA 5M19A 2IWCA 3O86A 2XFTA 1YQSA 1M40A 1E25A 3W4OA 5L2FA 2H10A 4N92A 4JPMA 4KZ8A 4X56A 2ZC4B 4LCMA 1CEFA 3M2JA 1SHVA 3N8SA 3Q7VA 1CK3A 4QJGA 1RCJA 3ZFZA 3MXRA 4NETA 4DXBA 4FCFA 3NY4A 1E4DA 2ZQDA 4KZ9A 3IT9A 3ITBA 3WRZA 3RXWA 3UN7A 1ESUA 4YFMA 4BL3A 2Y55A 4WEKA 1KVMA 5E2FA 4R4SA 5FAOA 2HDSA 1XGJA 2Y59A 3ZNTA 4X68A 1H5XA 2Y2JA 3SS4A 4KZBA 4PMAA 3ZDJA 1XKZA 5AQBA 2FFYA 3IXGA 4BL2A 1FSYA 3IXDA 5EVLA 5CRFA 2G2WA 4UHUA 5GHYA 3VFFA 3Q07A 3ZNYA 4EUZA 3LEZA 2XD1A 1HD8A 2ZMAA 3HLWA 4R23A 4BLMA 2CC1A 4GDNA 2VGJA 3WS5A 1JTGA 2ZJ9A 4LENA 2WGWB 1K4FA 4IBRA 1K57C 2I72A 4WM9A 3UO9A 1XP4A 1NRFA 3S4XA 1LLBA 2JC7A 3A3EA 5E2HA 4X69A 3LCEA 1Q2QA 4IVKA 3HUOA 5TFQA 1VQQA 4KQQA 1WYCA 3G4PA 3QNBA 4CJNA 4EBPA 1IYOA 4Q8IA 3VP0A 4HBTA 2EXBA 3OPLA 1YT4A 5AQ7A 4KZ7A 2ZQ8A 2WGWA 3NCKA 4DXCA 1S0WA 1G68A 5HAQA 4L0LA 3PBOA 3ZG7B 4K91A 3S1YA 2V2FF 4GZBA 5DVAA 1CI9A 2HPBA 4EV4A 4LV1A 4DDSA 3NC8A 1IKGA 3E2KA 4QHCA 4KG6A 3C4OA 3M6BA 1PWCA 2ZC3B 3VMAA 2GDNA 2JCHA 4CPKA 5A90A 3G32A 2H0TA 5IHVA 1J9MA 5AQ9A 3G35A 1E3UD 5A91A 5M18A 4OQHA 1RP5A 4ZJ2A 3GQZA 4PM8A 4KZ6A 5EVID 5FQMA 4KQRA 2X71A 4OQIA 4A5RA 3G34A 3HLDA 3BLMA 1K54A 4KG5A 2B5RA 2HDQA 3GV9A 4WBGA 3MZEA 4DKIA 5FI7A 4LV0A 3IWOA 1FQGA 3RXXA 4E6WA 1K6SA 2WGVA 2WZXA 4XUZA 5HFOA 1ES4A 1LI9A 3UDIA 3V5MA 2WADA 2DRWA 1NZUA 4Y0UA 3ZG0A 4LCLA 3OCNA 5HL1A 1I5QA 4OPRA 3Q1FA 1CEGA 1W8YA 1H8YA 3NI9A 4KG2A 1K6RA 2VGKA 4RVAA 5EECA 5FDHA 4BD1A 5EUAA 1IELA 3HL9A 4U3TA 4GN2A 2ZM8A 3BRMA 3G2ZA 1BSGA 5CERA 4MBHA 5KSHA 4E3MA 4WYYA 3EQUA 5EVIA 2XR0A 3VSKA 1XX2A 2ZC7A 1ONHA 2R9XA 2XH9A 4BENA 3G31A 5FATA 4R1GA 3GTCA 2ZM0A 3UE0A 1MXOA 3NBLA 2WAFA 4XXRA 1YLPA 3SS5A 4DE2A 5A92A 3GR2A 3C4PA 1ONGA 3BFFA 3IF6B 1HZOA 3N8RA 3V3SA 4N1XA 1MWTA 3BYDA 3BM6A 1BLPA 3PBQA 1IEMA 2HP9A 4LV3A 5FQQA 1ES5A 3MZFA 3IHBA 2XF3A 5CHMA 3IXBA 1Q2PA 4UA9A 5FI6A 4DE3A 1NXYA 3IF6A 3G2YA 1I2WA 2ZQ7A 4S2PA 1W5DA 1KVLA 4FH2A 2ZQCA 3S22A 1IYSA 5DF7A 3HBRA 1LHYA 3IWQA 4PM7A 3GRJA 1DJCA 2ZQAA 3AGEA 4JXSA 4PM9A 3OC2A 4KZ5A 1CI8A 1MWRA 3AGDA 5CGWA 5AQAA 2ZC5B 3HLFA 3MBZA 1OMEA 3A3DA 1ZKJA 3PBSA 1MKIA 1SDEA 5FI2A 2RCXA 4S2IA 3O3VA 4OQGA 1ES2A 1MWSA 1RGYA 1PW1A 4ZDXA 3UPNA 1YLYA 1Y54A 3Q82A 2EFUA 2JE5A 3ZCZA 1K55A 5F1GA 3A3FA 2OSUA 1PIOA 3UDXA 4C75A 4PPRA 1FR6A 5EVIC 4EQIA 3CMZA 3BFCA 1LL5A 5GLDA 1MBLA 2WYXA 3Q7ZA 4ID4A 3UPPA 4DF6A 2JBFA 4PM5A 4GDBA 3VSLA 4OKPA 2Y2HA 4RX2A 3UY6A 1ESIA 2V1ZA 3Q81A 4UAAA 4C3QA 1W79A 1ZC2A 3D4FA 2A49A 3E2LA 3WWXA 3P09A 4DDYA 4S2LA 5M1AA 2J9PA 3IH9A 1G6AA 3DTMA 1TEMA 5EE8A 1KGFA 1YLZA 1GHMA 2A3UA 2UWXA 4OP5A 4P6BA 2C6WB 4JXWA 1N4OA 3IH8A 1JTDA 3PAGA 2EFXA 4P0MA 4K0XA 4S2NA 3N8LA 3CZDA 1K56D 1LL9A 1O7EA 2J7VA 4M3KA 5FA7A 5BOHA 2WZZA 5DTKA 4MLLA 2J8YA 3C5AA 1ERMA 3M6HA 3SH7A 2FFFB 4D2OA 4XUXA 5DF9A 1AXBA 4R3JA 5CECA 1K4EA 3C7VA 2J9OA 2OV5A 5CHJA 4FSFA 1ZG4A 5CEBA 3LY3A 1N9BA 3NDEA 1XPBA 4IBXA 4IEDA 1KE3A 4N9LA 4O7DA 4ZTKA 4OVDA 3OPRA 1FSWA 5FAQA 2R9WA 1GCEA 5HAIA 1FCMA 4RX3A 4GOGA 4OLDA 1FCNA 1TVFA 4BJPA 3AGFA 1GHPA 3MFDA 3FKVA 1NYMA 2C5WB 4ZJ1A 1K56A 3TOIA 2WK0A 4RYEA 1ZG6A 1DY6A 3B3XA 3UPOA 3ZGAB 1L0DA 2DNSA 3SH9A 2XEPA 1DJBA 3FKWA 5E2EA 4EBLA 1YMXA 3W8KA 5CGSA 3VP1A 1LI0A 1PWGA 4E3NA 3N4IA 1KGEA 2Y2OA 5J8XA 1QMFA 3C7UA 1Z6FA 2BG1A 1W8QA 4MNRA 3SOIA 4IVIA 2ZQ9A 4FD8A 4OOYA 4Y7PA 2Y2GA 3ZHHA 3ZVWA 4OPZA 4S2JA 3BFDA 3WS4A 5DF8A 2IWBA 4C6YA 5JYPA 1BULA 1BLHA 1BUEA 4ZAMA 1JWVA 1EI5A 1DJAA 3V3RA 1ES3A 4JKTA 1TDGA 5KMWA 4QU3A 3UE3A 3MKFA 4OPYA 2PBYA 5FSRA 3IF5A 3QHYA 3ITAA 1BLCA 4NK3A 1HTZA 1JWZA 4QY6A 1FR1A 1NJ4A 1IYPA 1PZPA 3N7WA 4OOLA 3NDGA 3OCLA 1M6KA 3M2KA 5I94A 2Y91A 2P9VB 3CJMA 3LY4A 4EWFA 5CEDA 5GHZA 1PI4A 4UA6A 3V50A 1NZOA 1K54C 4KZAA 5FQJA 4OH0A 4MEZA 3HVFA 4R3BA 3P98A 1KE0A 2Y2MA 4H8RA 4B4XA 1BTLA 1WYBA 3VP3A 3IQAA 3HUMA 4OLGA 3VOZA 4Y0OA 2HDUA 4ZJ3A 2WKIA 3JYIA 1C3BA 1GHIA 4S2KA 4KZ4A 4EBNA 4JXGA 4U0TA 4QB8A 2XGNA 1WE4A 3CG5A 1JVJA 2IWDA 4OONA 1XXMA 4K0WA 4JBFA 1YLJA 5HARA 3O87A 5EOEA 4PM6A 1FCOA 4WEJA 2WKEA 4DRTA 3FYZA 3G30A 4Y0TA 2Y2LA 1XA7A 2QPNA 1L2SA 3N6IA 2Y2KA 1RGZA 3FV7A 4UA7A 2PU2A 2EX9A 2OLUA 4JXVA 2XD5A 4R4RA 4BQMA 4X6TA 1KGGA 1SDNA 4GD8A 3PBRA 1GA0A 5A93A 3A3IA 5FASA 4OQ0A 3PBTA 2E8IA 4GKUA 2Z2MB 3GMWA 5D3OA 2BLSA 5E43A 2Y2IA 4WZ5A 1XA1A 3HREA 1K38A 1U60A 3MXSA 3ZG9B 3WRTA 4WMCD 3SS3A 3TG9A 2WAEA 5FAPA 1PZOA 4E3LA 2WKHA 4P87A 3BFGA 1GA9A 1KDWA 3HLBA 3UNWA 2OLVA 2PU4A 4E3KA 3MZDA 5CXWA 1YMSA 4HBUA 3DWKA 3IHAA 1SCWA 3IF6C 1L0GA 3OZHA 4U0XA 2RL3A 3HLEA 3PTEA 4S2OA 5FQIA 3VP2A 5GLAA 4X53A 2V20A 3ISGA 1PWDA 4MBKA 1H8ZA 2ZC6B 3VP4A 4N9KA 2Z2LB 1L0FA 4JF4A 2DCFA 4KZ3A 2WUQA 3BECA 3BLSA 3GSGA 3EQVA 4FH4A 4GB7A 4N1HA 1XGIA 3DW0A 3OPPA 5CGXA 4GD6A 3ZG5A 1L0EA 2EX8A 1IKIA 4WMCA 5HW3A 4OPQA 5F82A 3FZCA 2H5SA 4S2MA 4E3IA 2ZD8A 5GLBA 5HX9A 3HLGA 1K55C 5EOOA 2EXAA 2Y2QA 5G18A 5FQKA 4E6XA 2ZM2A 1O07A 3HLCA 5CTMA 3W4PA 2HDRA 3W4QA 4DE1A 2QMIA 2H0YA 2Y4AA 5FQ9A 1KDSA 4YINA 2EX2A 3UDFA 3WS2A 3GVBA 5F83A 2XK1A 1QMEA 3FWLA 3IXHA 3LO7A 4ZBEA 1YLWA 4DE0A 4HESA 2Q9NA 5U47A 4LV2A 2X02A 3HUNA 1SKFA 2Y2PA
chains in the Genus database with same CATH superfamily
3SH8A 2XDMA 3T12B 4Z9QA 2XFSA 5CTNA 1YM1A 4NXEA 1TDLA 2EX6A 1FOFA 1E3UA 1PYYA 1K25A 5TR7A 3ZVTA 4DN0A 5EPHA 4WELA 4KQOA 1V9YA 1PI5A 3V39A 1K0KA 1JWPA 4IUKA 4BD0A 2J3WA 1XJ2A 1PW8A 2HP6A 4GNUA 4JF6A 1ERQA 2HJ9C 2WGIA 3HJKA 5DKLA 3O86A 2XFTA 3UB6A 2H10A 3F1NB 2L1MA 4LCMA 4I3JA 1CEFA 3M2JA 3K3CA 1SHVA 1CK3A 1RCJA 4NETA 4KZ9A 3IT9A 1GSXA 2ZMVA 3RXWA 3UN7A 4BL3A 2Y55A 2PT7A 3LFVA 2Y59A 3ZNTA 1BYWA 1SZVA 2Y2JA 1FSYA 5CRFA 2G2WA 4UHUA 3Q07A 3ZNYA 4GLQA 3HLWA 5HWVA 4WM9A 1OT6A 4FUWA 3HUOA 3HCYA 3G4PA 4EBPA 3VP0A 2EXBA 3LIEA 1YT4A 5EVEA 4GS9B 1S0WA 1G68A 2BASA 3S1YA 4ETXA 4GZBA 5DVAA 2HPBA 3NC8A 2D02A 4KG6A 4GS9A 3M6BA 5A90A 2WKPA 2GJ3A 4OQHA 3GQZA 4PM8A 4KZ6A 5FQMA 4KQRA 4OQIA 3OOVA 2UV0E 3GV9A 4GJ4A 4WBGA 4HJ6A 3IWOA 1P9WA 4CLCD 4XUZA 5HFOA 1ES4A 1F98A 1LI9A 3UDIA 1NZUA 4LCLA 5HL1A 1CEGA 5FDHA 1K6RA 2VGKA 3LIDA 1G6OA 1IELA 3HL9A 4GN2A 1BSGA 4MBHA 3LUQA 5KSHA 3L9KA 2QJ5A 4WYYA 5EVIA 2ZC7A 1ONHA 2B18A 3G31A 2ZM0A 3NBLA 3SS5A 5A92A 4HNBA 3GR2A 3IF6B 3N8RA 1CF0A 1BLPA 1IEMA 3V67A 3JVVA 3MZFA 4AFIA 3IHBA 5CHMA 4LRYC 4DE3A 1ACFA 2ZBBA 3IF6A 3G2YA 2ZQ7A 1KVLA 5DF7A 3HBRA 1LHYA 3IWQA 4I5SA 3T4TA 1DJCA 3IX4A 4PHTA 3NOPC 2ZC5B 3CUEC 1OMEA 3MMHA 1S4RA 1MKIA 3LI9A 3VE4A 3O3VA 4B93A 1RGYA 1PW1A 1H8MA 3VE3A 2JE5A 4RQ9A 5F1GA 5A8BA 1DP6A 2HGVA 1PIOA 4C75A 4PPRA 4EQIA 1LL5A 2NUPC 3UPPA 4DF6A 3UY6A 4ESPA 3U4LP 3Q81A 5AVEA 3E2LA 5M1AA 1TEMA 2OAP1 2UWXA 4OP5A 1JTDA 4P0MA 2Q0OA 4K0XA 1K56D 4KQDA 4M3KA 3IBRA 2WZZA 4MLLA 2J8YA 3C5AA 5DF9A 2J9OA 2XA7M 5CHJA 1ZG4A 3NDEA 2V0UA 4O7DA 4OVDA 3CPTB 1GCEA 3BY8A 4OLDA 3UB5P 1G5UA 2VGLS 4ZJ1A 3TOIA 2OAQ1 3C8CA 1Z09A 1LSXA 4BBUA 1DJBA 3FKWA 3IS2B 3EEAA 1YMXA 3W8KA 3UB9A 2W3DA 2DMWA 2O9CA 5J8XA 4Y17A 1W8QA 3LR4A 2ZQ9A 4Y7PA 4WN5A 5IT5A 4OPZA 3IS2A 3LIFA 4JKTA 1TDGA 3IF5A 4F3LA 1BLCA 1N9OA 4ZRRA 3R7WA 4OOLA 3NDGA 3M2KA 3DTKA 1PI4A 2EWVA 5AVFA 2GNXA 5FQJA 3P98A 3U2AA 2VEAA 4ZJ3A 4Q0IA 1YPRA 2XGNA 3CG5A 1NLYA 5HARA 2WKEA 3S7OA 3FYZA 1ZHHB 2PU2A 2JKRM 2OLUA 4JXVA 4R3AA 1VHMA 4R4RA 4X6TA 4GD8A 1OTDA 3PBRA 3MQOA 5FASA 2W27A 2E8IA 4GKUA 1XA1A 1K38A 3MXSA 3TG9A 1PZOA 2WKHA 1XFNA 4D60A 1V9ZA 1GA9A 2PU4A 3MZDA 5CXWA 1J3WA 3A0SA 3HLEA 5FQIA 4G3KA 4KUKA 1OPXA 1PWDA 4MBKA 3LYXA 3NOUC 3TRCA 5CX7A 2BTFP 3BECA 3EQVA 3DW0A 3OPPA 5CGXA 4X25A 3ZG5A 1UWPX 2J3TC 2EX8A 4WMCA 5EM0A 5F82A 4E3IA 5GLBA 4MCWA 4I3IA 4ETZA 5FQKA 4E6XA 1O07A 3W4PA 3LIBA 3T4LA 5EM1A 2Y4AA 5HSQA 3UDFA 2IA2A 1LSVA 2XK1A 2V0WA 2M7UA 4PKYG 2X02A 3DTEA 4MBFA 1D7EA 1NY0A 4WZ5C 2JKGA 4Q0JA 2PBDP 1NYYA 1SKOA 1EWZA 1W7FA 5DTTA 3VOYA 4S2NC 2ZOHA 3CUEA 4PAUA 5DTSA 3RJUA 3BWLA 4E3JA 2G2UA 4JGPA 1BZAA 3B33A 1S4SA 4HQAA 4KENB 3P7NA 2ZLYA 3EEHA 1ODVA 2GZAA 5F1FA 4JF5A 3ZG8B 3A3JA 3S7PA 3VFHA 4JGQA 1HVBA 3IWIA 4OP8A 3DAVA 2P9VA 2QWSA 3E4QA 3E0YA 1YQSA 1E25A 3W4OA 3EOIA 5L2FA 2P7JA 4N92A 4KZ8A 2HV1A 2A24B 1F5MA 2OOLA 3ITBA 4ME4A 3MF0A 1KVMA 5E2FA 5FAOA 2HDSA 1H5XA 3SS4A 4PMAA 1LL8A 4BL2A 4MN5A 5GHYA 4CLCE 1LSWA 1P9RA 4EUZA 4LPZA 2W0NA 2ZMAA 2CC1A 2VGJA 4H6JB 2ZJ9A 4LENA 1K4FA 4IBRA 1K57C 2I72A 3UO9A 5E2HA 2JC7A 3A3EA 1OTBA 3LCEA 2CMNA 4IVKA 5TFQA 4KQQA 4E04A 4NG2A 4Y3IA 2NUTC 4EERA 4CJNA 2K31A 5HPFA 5AQ7A 3OPLA 3JPUA 2ZQ8A 1P97A 5EFWA 3NCKA 1NLZA 2R78A 4L0LA 3PBOA 4K91A 1NWZA 4EQ1A 4KUOA 3E2KA 1D1JA 4FTXA 3C4OA 3VMAA 2GDNA 2QYBA 2JCHA 4CPKA 3G32A 5IHVA 4LGWA 1J9MA 3LR5A 3G35A 1CQAA 4ZJ2A 3FG8A 5EVID 4A5RA 4DJ3A 3BLMA 3MZEA 4DKIA 3RH8B 5FI7A 4Y5FA 1FQGA 1FILA 2W3HA 3V5MA 4Y0UA 3JVUA 5EECA 1H8YA 4O8GA 3MQ0A 5IS1A 2ZM8A 1TF1A 3H7WB 1N9LA 1XX2A 4HOIA 2FZ0A 3EGXC 5FATA 3GTCA 1A0KA 4DE2A 5DJUA 3C4PA 4N1XA 4HH2A 3PBQA 4LV3A 2XA7S 5FQQA 3BJNA 4UA9A 1NXYA 4YOFA 5L09A 1MZUA 1IYSA 5HD5A 3AGEA 3OC2A 4KZ5A 3BQ8A 1MWRA 3AGDA 5AQAA 4JGOA 3CAXA 4HIAA 3A3DA 1ZKJA 1IOUA 4S2IA 3F1NA 1MWSA 2K2NA 3LGOA 1YLYA 3Q82A 3A3FA 2OSUA 3BFCA 1DRMA 4CQHA 3NOTC 2JBFA 2Y2HA 4NKPA 1S1ZA 2V1ZA 4UAAA 3D4FA 4HHDA 4CLCC 4S2LA 2KDKA 1CJFA 1G6AA 1KGFA 1YLZA 4PKYA 2ACGA 5TBMB 2VX8A 2EFXA 4S2NA 3KSFA 3CZDA 1O7EA 2J7VA 2INWA 2LB9A 5FA7A 3UE6A 5BOHA 3L7HA 3TW8A 3M6HA 4I39A 2FFFB 1VETB 1AXBA 1YSQA 3C7VA 1N9BA 2G7UA 4IBXA 4IEDA 1KE3A 4BBTA 1UGUA 1T1BA 5HAIA 1FCMA 1FCNA 3AGFA 1YAXA 1NYMA 3MJQA 3UPOA 3KO6A 3KX0X 4EBLA 5TJJA 1Y4OA 3VP1A 1Y28A 4B9OA 4E3NA 3E4PA 5F6AA 2PAVP 4LRXC 3C7UA 3IX8A 2VA0A 4FD8A 4K08A 3ZHHA 1MC0A 2KLIA 3BFDA 5DF8A 4C6YA 1BLHA 1JWVA 3KYQA 2PD8A 3V3RA 4X1MA 3MKFA 4HJ3A 4OPYA 5FSRA 5HWTA 1JWZA 3CI6A 3OCLA 1M6KA 3CITA 3CJMA 3LY4A 5CEDA 4MN7A 4UA6A 1K54C 4X1LA 1H3QA 3ZQ5A 4MEZA 4WL9A 1W63Q 2HDUA 5F69A 2M7VA 1X0OA 2B95A 4JXGA 4U0TA 1XXMA 5EOEA 3KSIA 4DRTA 2Y2LA 3PYPA 3CHWP 2QPNA 5HDDA 1RGZA 3FV7A 4WLAA 4BQMA 5HD3A 2QJ7A 3A3IA 3PBTA 5D3OA 2BLSA 5E43A 2J80A 3D3OA 4L9FA 1LT0A 4WMCD 2WAEA 1NRJA 3ULFA 1KDWA 4E3KA 4HBUA 1SCWA 1L0GA 5DFYA 4S2OA 1H8ZA 2ZC6B 1L0FA 2DCFA 4GB7A 1S67L 1XGIA 2VK3A 2KX6A 2PR5A 3MXQA 1IKIA 4OPQA 4NXGA 5G18A 4EEPA 5L07A 3HLCA 4BWIA 2HDRA 2QMIA 2O0YA 3LIAA 4YINA 5F83A 3ICYA 3CPTA 1QMEA 1YKDA 3FWLA 3IXHA 1YLWA 3BQAA 3E4OA 4HESA 2Q9NA 5U47A 5DKKA 3I7JA 3DWZA 2V1AA 2V1BA 2Y2NA 1BLSA 3CWFA 2AVXA 5GL9A 3LI8A 5F68A 3UE1A 1OTEA 4RA7A 4OOMA 4Y15A 2XQZA 2W1TB 3NJAA 5TGFA 3O88A 1MPLA 4CLCB 2XSSA 1VM1A 2QZ6A 3WS0A 5DJTA 4X55A 1IYQA 3B42A 3BFEA 4MMNA 3QNCA 1XFQA 5HAPA 3B47A 1YLTA 3OPHA 2W1TA 3NIAA 4HEFA 3MKEA 4CLCA 1MY8A 1OJGA 2P74A 4QD4A 3NECA 2HP5A 1TS0A 5KSCA 4WZ4A 2YKHA 5GHXA 4WUJA 4P85A 4JLFA 1F9IA 4Y13A 2IWCA 1M40A 4EEUA 4M4XA 4JPMA 2ZC4B 5L10A 3ZFZA 2HZ5A 2Z6CA 4DXBA 3NY4A 1ESUA 4EUVA 4WEKA 3F1OB 5IU1A 3ZDJA 4LFUA 1PNEA 3IXGA 3IXDA 5EVLA 1GSWA 1HD8A 1F2KA 4BLMA 4EESA 4XT2B 4GDNA 3WS5A 1JTGA 4EXOA 2WGWB 3PHYA 3S4XA 3T4SA 1LLBA 1FIKA 4X69A 1Q2QA 1WYCA 4QWOA 2MJ6A 4Q8IA 4XT2A 4HBTA 4KZ7A 2WGWA 4DXCA 2VV8A 4I3AA 2W3GA 4LV1A 1IKGA 3T50A 4QHCA 3PXPA 2ZC3B 5AQ9A 4EU0A 1E3UD 5A91A 3SW1A 2JN7A 2I9VA 2VZWA 2X71A 3DBAA 3HLDA 4LRZE 1K54A 2B5RA 5AJGA 1TS7A 2VV6A 2WZXA 2V9AA 4MN6A 2WADA 1TS6A 1I5QA 2XROA 4OPRA 4I38A 3NI9A 4BD1A 5EUAA 3T4QA 1JNUA 5L8MA 3EQUA 3VSKA 2R9XA 4BENA 4ARZB 3VOLA 2WAFA 3H82B 2PR6A 5HPIA 3BFFA 1TD5A 3V3SA 1MWTA 3BM6A 4G3WA 3MSHA 2XF3A 3FPWA 4ARZA 3IXBA 5KIZA 3S7NA 3H82A 1HLUP 4S2PA 4HH3A 4FH2A 1T1AA 5CGWA 3HJIA 1VEUB 3HLFA 3LICA 5I5LA 2XRNA 2LB5A 4NEED 4OQGA 3UPNA 1XJ6A 1Y54A 3K2NA 4L9GA 3ZCZA 2A24A 3QP4A 3UDXA 3UMDA 1VEUA 5EVIC 3T4KA 5DFXA 1MBLA 2WYXA 3Q7ZA 4ID4A 4PM5A 3VSLA 4OKPA 4C3QA 1W79A 4DDYA 3DTMA 5EE8A 2VKSA 2E8JA 4G3VA 4H6JA 2A3UA 4P6BA 2C6WB 3QP5A 4JXWA 3RTYA 3N8LA 2PRFA 1LL9A 4NXBA 1ERMA 2JKTI 4XUXA 2HF6A 3OBFA 4R3JA 2OV5A 4IJGA 1L3LA 4FSFA 5CEBA 4EBNA 4N9LA 3OPRA 1S1YA 1FSWA 5FAQA 2R9WA 4GOGA 1GHPA 3MFDA 2C5WB 3T1SA 4RYEA 1ZG6A 3ZGAB 1L0DA 2DNSA 3SH9A 4DJ2A 2XEPA 4Z1WA 1PWGA 3RFBA 2Y2OA 3T4JA 2BG1A 3KYZA 4MNRA 3P01A 3SOIA 4IVIA 4OOYA 2Y2GA 2W1RA 4HJ4A 3WS4A 5JYPA 3E98A 3QP1A 1BULA 1BUEA 4ZAMA 1DJAA 5G4ZA 1ES3A 5KMWA 4LLOB 3UE3A 4P6ZM 4GW9A 2PBYA 3H7WA 3QHYA 4BMWA 3ITAA 4BBVA 1OJ5A 4QY6A 2WKQA 4UQIM 1PZPA 3N7WA 5I94A 4EW7A 2ZL1B 3SZTA 4HI4A 5GHZA 4WF0A 4II7A 3V50A 1NZOA 4R3BA 2Y2MA 1DP8A 3VOZA 4OLGA 4Y0OA 1C3BA 1GHIA 3DTIA 2ZL1A 5C5KA 2O9AA 3BY9A 4KZ4A 4HY8A 2IWDA 4K0WA 4JBFA 2GX5A 4WEJA 4JGRA 1G28A 2PYRA 3O5YA 1L2SA 3N6IA 2Y2KA 5HDCA 1KGGA 1GA0A 5A93A 2VLGA 2Y2IA 4WZ5A 3HREA 1U60A 1STZA 3W2ZA 5FAPA 4R38A 1T19A 3BFGA 2QHKA 4IHQA 3HLBA 3UNWA 2OLVA 1YMSA 1W63M 1T1CA 3DWKA 3IHAA 4NXFA 3ISGA 3VP4A 5HL6A 2Z2LB 5TBMA 4KZ3A 3BLSA 3GSGA 3H9WA 4N1HA 4O01A 1OT9A 2H28A 2WKRA 5HW3A 1XJ3A 1K55C 2EXAA 2Y2QA 1VETA 3GDIA 3W4QA 4DE1A 2EX2A 3WS2A 4ZBEA 4DE0A 2D01A 4LV2A 3HUNA 1SKFA 2Y2PA 5GLCA 3PR6A 4R0QA 2YKFA 2B02A 1BT5A 4B4ZA 1YSPA 1S6RA 1I2SA 3TSGA 1MWUA 3A0RA 5EVIB 3WS1A 3EGDC 3BEBA 3TJZC 3MS6A 4F94A 1ZTUA 2XLNA 3OLOA 4B88A 1KE4A 4QY5A 5CHUA 3PBNA 3S7QA 4GCZA 4UEYA 1K57A 4E3OA 3PAEA 2X01A 1ALQA 2L4RA 5E2GA 5JYOA 3KSGA 3Q7VB 3T4OA 3D9YA 1OTAA 2W3FA 1EROA 2Q9MA 5M19A 5HDSA 2O99A 5KZHA 1IFQA 4X56A 3N8SA 3Q7VA 4QJGA 3MXRA 4FCFA 1TS8A 2PHYA 1E4DA 2ZQDA 3WRZA 3K3DA 4YFMA 2O9BA 2VJWA 4R4SA 1XGJA 4X68A 4KZBA 2W3EA 1XKZA 2EA9A 3G6OA 5AQBA 2FFYA 3QP8A 3VFFA 3LEZA 2XD1A 4R23A 2ZOIA 2L0WA 1PRQA 1XP4A 1NRFA 3EWKA 3F1PB 4QPRA 2JHEA 4R70A 1VQQA 3QNBA 2Z6DA 5K5BA 1IYOA 1WA9A 3F1PA 5HAQA 3ZG7B 2V2FF 3FC7A 1CI9A 4EV4A 1S66L 1D06A 4DDSA 1PWCA 2H0TA 1MKMA 5M18A 1RP5A 1UWNX 2Y8HA 3G34A 4KG5A 2HDQA 2FH5A 3T1QB 4LV0A 3KYEA 3RXXA 4E6WA 1K6SA 2WGVA 3QP2A 2DRWA 3ZG0A 3OCNA 3LR3A 3Q1FA 1W8YA 4RVAA 4KG2A 4U3TA 3BRMA 5CERA 3G2ZA 4E3MA 1OTIA 4F3LB 4Q0HA 2XR0A 3T1RA 2XH9A 3R7WB 4R1GA 3UE0A 1MXOA 4XXRA 1YLPA 1ONGA 1HZOA 5G4YA 2PDRA 3BYDA 2HP9A 3LR0A 5MC7A 1ES5A 4Y2FA 1Q2PA 5FI6A 1I2WA 1W5DA 3S22A 2ZQCA 2PD7A 5J4EA 4PM7A 3GRJA 2ZQAA 3IBJA 4JXSA 4O0PA 4PM9A 5HZHA 1CI8A 2QKPA 3MBZA 3PBSA 1SDEA 5FI2A 3T1XA 2RCXA 5HWWA 1ES2A 4ZDXA 2EFUA 1K55A 4HP9A 1KOUA 1FR6A 3CLOA 3CMZA 3F1OA 5GLDA 2KOIA 5F5YA 4GDBA 4RX2A 1ESIA 3C2WA 3MFXA 1ZC2A 2A49A 4P6ZS 3WWXA 3P09A 2OWJA 2J9PA 3IH9A 1GHMA 3C38A 4UQIS 1N4OA 3IH8A 3PAGA 2Y79A 2JKRI 5DTKA 3SH7A 2V8FA 1P0ZA 4D2OA 5CECA 1K4EA 4L9EA 3LY3A 1XPBA 3UB8A 1VB6A 4ZTKA 4YNRA 4RX3A 2ZMFA 1TVFA 4BJPA 5J7EA 3FKVA 1K56A 2WK0A 2PYPA 1DY6A 3B3XA 2VV7A 4FOFA 1SKOB 5E2EA 1GSVA 5CGSA 1LI0A 2OWHA 2JKFA 3N4IA 1XJ4A 1KGEA 2HJEA 1QMFA 3KSHA 1Z6FA 1EW0A 3ZVWA 4S2JA 3MR0A 2IWBA 2K7SA 1EI5A 4QU3A 5FDSA 4NK3A 2J3TD 3UMEA 1HTZA 1FR1A 1H0MA 1NJ4A 1IYPA 3R4KA 1PFLA 5LBRA 2Y91A 3GECA 2P9VB 4EWFA 4R6LA 4KZAA 4OH0A 1DP9A 3HVFA 1KE0A 1N9NA 4H8RA 4B4XA 3NHQA 1BTLA 1WYBA 3VP3A 3IQAA 3HUMA 2WKIA 4S2KA 3JYIA 3LEQA 1AWIA 5FEFA 4QB8A 1WE4A 1JVJA 4OONA 1YLJA 1T18A 3O87A 4PM6A 3ZYTA 1FCOA 3UB7A 5FEGA 3G30A 4Y0TA 2VGLM 1XA7A 3C30A 4UA7A 4YWZA 2EX9A 2XD5A 1SDNA 2JKTM 4OQ0A 2Z2MB 3GMWA 2EWWA 4HP4A 3ZG9B 3WRTA 3SS3A 4IUHA 4E3LA 3D72A 4P87A 4GHIB 3TE8A 4MDZA 2A2LA 3IF6C 3A0VA 3OZHA 4U0XA 2RL3A 3PTEA 3MQQA 3VP2A 3NULA 5GLAA 4X53A 3FPVA 2V20A 4N9KA 4JF4A 2WUQA 4FH4A 4GHIA 2P04A 4GD6A 3IX3A 4EETB 2P08A 1L0EA 5FL3A 3FZCA 2H5SA 4S2MA 2ZD8A 5HX9A 3HLGA 5EOOA 2M1CA 2ZM2A 5CTMA 4DMZA 2H0YA 5FQ9A 1KDSA 3GVBA 3LO7A 3BW6A 5J3WA 3QP6A 3VV4A 2V8CA 5EV0A
chains in the Genus database with same CATH topology
3I7JA 5GLCA 4MBFA 1NY0A 4WZ5C 3DWZA 4R0QA 2Y2NA 1BT5A 3SH8A 4B4ZA 1NYYA 1S6RA 1EWZA 1I2SA 1BLSA 1W7FA 2XDMA 5DTTA 4Z9QA 3VOYA 3TSGA 2XFSA 5CTNA 4S2NC 5GL9A 1MWUA 5EVIB 3WS1A 3BEBA 1YM1A 5DTSA 1TDLA 3RJUA 4E3JA 2EX6A 3UE1A 2G2UA 4RA7A 1BZAA 4OOMA 2XQZA 4F94A 4KENB 5TGFA 1FOFA 1E3UA 2XLNA 2ZLYA 3O88A 1PYYA 1MPLA 4B88A 5F1FA 1VM1A 1K25A 5TR7A 2QZ6A 3ZVTA 4JF5A 1KE4A 4QY5A 5CHUA 5EPHA 4X55A 3WS0A 3PBNA 4WELA 1IYQA 3ZG8B 3A3JA 3BFEA 4KQOA 1PI5A 3V39A 3QNCA 5HAPA 1YLTA 1JWPA 1K57A 3OPHA 4E3OA 3PAEA 3VFHA 4BD0A 2X01A 3NIAA 4HEFA 3MKEA 1ALQA 5E2GA 5JYOA 1HVBA 1PW8A 2HP6A 4GNUA 1MY8A 3Q7VB 2P74A 4JF6A 4QD4A 3IWIA 1ERQA 2HP5A 4OP8A 5KSCA 4WZ4A 2P9VA 2WGIA 5GHXA 1EROA 4P85A 2Q9MA 4JLFA 5KZHA 5M19A 2IWCA 3O86A 2XFTA 1YQSA 1M40A 1E25A 3W4OA 5L2FA 2H10A 4N92A 4JPMA 4KZ8A 4X56A 2ZC4B 4LCMA 1CEFA 3M2JA 1SHVA 3N8SA 3Q7VA 1CK3A 4QJGA 1RCJA 3ZFZA 3MXRA 4NETA 4DXBA 4FCFA 3NY4A 1E4DA 2ZQDA 4KZ9A 3IT9A 3ITBA 3WRZA 3RXWA 3UN7A 1ESUA 4YFMA 4BL3A 2Y55A 4WEKA 1KVMA 5E2FA 4R4SA 5FAOA 2HDSA 1XGJA 2Y59A 3ZNTA 4X68A 1H5XA 2Y2JA 3SS4A 4KZBA 4PMAA 3ZDJA 1XKZA 5AQBA 2FFYA 3IXGA 4BL2A 1FSYA 3IXDA 5EVLA 5CRFA 2G2WA 4UHUA 5GHYA 3VFFA 3Q07A 3ZNYA 4EUZA 3LEZA 2XD1A 1HD8A 2ZMAA 3HLWA 4R23A 4BLMA 2CC1A 4GDNA 2VGJA 3WS5A 1JTGA 2ZJ9A 4LENA 2WGWB 1K4FA 4IBRA 1K57C 2I72A 4WM9A 3UO9A 1XP4A 1NRFA 3S4XA 1LLBA 2JC7A 3A3EA 5E2HA 4X69A 3LCEA 1Q2QA 4IVKA 3HUOA 5TFQA 1VQQA 4KQQA 1WYCA 3G4PA 3QNBA 4CJNA 4EBPA 1IYOA 4Q8IA 3VP0A 4HBTA 2EXBA 3OPLA 1YT4A 5AQ7A 4KZ7A 2ZQ8A 2WGWA 3NCKA 4DXCA 1S0WA 1G68A 5HAQA 4L0LA 3PBOA 3ZG7B 4K91A 3S1YA 2V2FF 4GZBA 5DVAA 1CI9A 2HPBA 4EV4A 4LV1A 4DDSA 3NC8A 1IKGA 3E2KA 4QHCA 4KG6A 3C4OA 3M6BA 1PWCA 2ZC3B 3VMAA 2GDNA 2JCHA 4CPKA 5A90A 3G32A 2H0TA 5IHVA 1J9MA 5AQ9A 3G35A 1E3UD 5A91A 5M18A 4OQHA 1RP5A 4ZJ2A 3GQZA 4PM8A 4KZ6A 5EVID 5FQMA 4KQRA 2X71A 4OQIA 4A5RA 3G34A 3HLDA 3BLMA 1K54A 4KG5A 2B5RA 2HDQA 3GV9A 4WBGA 3MZEA 4DKIA 5FI7A 4LV0A 3IWOA 1FQGA 3RXXA 4E6WA 1K6SA 2WGVA 2WZXA 4XUZA 5HFOA 1ES4A 1LI9A 3UDIA 3V5MA 2WADA 2DRWA 1NZUA 4Y0UA 3ZG0A 4LCLA 3OCNA 5HL1A 1I5QA 4OPRA 3Q1FA 1CEGA 1W8YA 1H8YA 3NI9A 4KG2A 1K6RA 2VGKA 4RVAA 5EECA 5FDHA 4BD1A 5EUAA 1IELA 3HL9A 4U3TA 4GN2A 2ZM8A 3BRMA 3G2ZA 1BSGA 5CERA 4MBHA 5KSHA 4E3MA 4WYYA 3EQUA 5EVIA 2XR0A 3VSKA 1XX2A 2ZC7A 1ONHA 2R9XA 2XH9A 4BENA 3G31A 5FATA 4R1GA 3GTCA 2ZM0A 3UE0A 1MXOA 3NBLA 2WAFA 4XXRA 1YLPA 3SS5A 4DE2A 5A92A 3GR2A 3C4PA 1ONGA 3BFFA 3IF6B 1HZOA 3N8RA 3V3SA 4N1XA 1MWTA 3BYDA 3BM6A 1BLPA 3PBQA 1IEMA 2HP9A 4LV3A 5FQQA 1ES5A 3MZFA 3IHBA 2XF3A 5CHMA 3IXBA 1Q2PA 4UA9A 5FI6A 4DE3A 1NXYA 3IF6A 3G2YA 1I2WA 2ZQ7A 4S2PA 1W5DA 1KVLA 4FH2A 2ZQCA 3S22A 1IYSA 5DF7A 3HBRA 1LHYA 3IWQA 4PM7A 3GRJA 1DJCA 2ZQAA 3AGEA 4JXSA 4PM9A 3OC2A 4KZ5A 1CI8A 1MWRA 3AGDA 5CGWA 5AQAA 2ZC5B 3HLFA 3MBZA 1OMEA 3A3DA 1ZKJA 3PBSA 1MKIA 1SDEA 5FI2A 2RCXA 4S2IA 3O3VA 4OQGA 1ES2A 1MWSA 1RGYA 1PW1A 4ZDXA 3UPNA 1YLYA 1Y54A 3Q82A 2EFUA 2JE5A 3ZCZA 1K55A 5F1GA 3A3FA 2OSUA 1PIOA 3UDXA 4C75A 4PPRA 1FR6A 5EVIC 4EQIA 3CMZA 3BFCA 1LL5A 5GLDA 1MBLA 2WYXA 3Q7ZA 4ID4A 3UPPA 4DF6A 2JBFA 4PM5A 4GDBA 3VSLA 4OKPA 2Y2HA 4RX2A 3UY6A 1ESIA 2V1ZA 3Q81A 4UAAA 4C3QA 1W79A 1ZC2A 3D4FA 2A49A 3E2LA 3WWXA 3P09A 4DDYA 4S2LA 5M1AA 2J9PA 3IH9A 1G6AA 3DTMA 1TEMA 5EE8A 1KGFA 1YLZA 1GHMA 2A3UA 2UWXA 4OP5A 4P6BA 2C6WB 4JXWA 1N4OA 3IH8A 1JTDA 3PAGA 2EFXA 4P0MA 4K0XA 4S2NA 3N8LA 3CZDA 1K56D 1LL9A 1O7EA 2J7VA 4M3KA 5FA7A 5BOHA 2WZZA 5DTKA 4MLLA 2J8YA 3C5AA 1ERMA 3M6HA 3SH7A 2FFFB 4D2OA 4XUXA 5DF9A 1AXBA 4R3JA 5CECA 1K4EA 3C7VA 2J9OA 2OV5A 5CHJA 4FSFA 1ZG4A 5CEBA 3LY3A 1N9BA 3NDEA 1XPBA 4IBXA 4IEDA 1KE3A 4N9LA 4O7DA 4ZTKA 4OVDA 3OPRA 1FSWA 5FAQA 2R9WA 1GCEA 5HAIA 1FCMA 4RX3A 4GOGA 4OLDA 1FCNA 1TVFA 4BJPA 3AGFA 1GHPA 3MFDA 3FKVA 1NYMA 2C5WB 4ZJ1A 1K56A 3TOIA 2WK0A 4RYEA 1ZG6A 1DY6A 3B3XA 3UPOA 3ZGAB 1L0DA 2DNSA 3SH9A 2XEPA 1DJBA 3FKWA 5E2EA 4EBLA 1YMXA 3W8KA 5CGSA 3VP1A 1LI0A 1PWGA 4E3NA 3N4IA 1KGEA 2Y2OA 5J8XA 1QMFA 3C7UA 1Z6FA 2BG1A 1W8QA 4MNRA 3SOIA 4IVIA 2ZQ9A 4FD8A 4OOYA 4Y7PA 2Y2GA 3ZHHA 3ZVWA 4OPZA 4S2JA 3BFDA 3WS4A 5DF8A 2IWBA 4C6YA 5JYPA 1BULA 1BLHA 1BUEA 4ZAMA 1JWVA 1EI5A 1DJAA 3V3RA 1ES3A 4JKTA 1TDGA 5KMWA 4QU3A 3UE3A 3MKFA 4OPYA 2PBYA 5FSRA 3IF5A 3QHYA 3ITAA 1BLCA 4NK3A 1HTZA 1JWZA 4QY6A 1FR1A 1NJ4A 1IYPA 1PZPA 3N7WA 4OOLA 3NDGA 3OCLA 1M6KA 3M2KA 5I94A 2Y91A 2P9VB 3CJMA 3LY4A 4EWFA 5CEDA 5GHZA 1PI4A 4UA6A 3V50A 1NZOA 1K54C 4KZAA 5FQJA 4OH0A 4MEZA 3HVFA 4R3BA 3P98A 1KE0A 2Y2MA 4H8RA 4B4XA 1BTLA 1WYBA 3VP3A 3IQAA 3HUMA 4OLGA 3VOZA 4Y0OA 2HDUA 4ZJ3A 2WKIA 3JYIA 1C3BA 1GHIA 4S2KA 4KZ4A 4EBNA 4JXGA 4U0TA 4QB8A 2XGNA 1WE4A 3CG5A 1JVJA 2IWDA 4OONA 1XXMA 4K0WA 4JBFA 1YLJA 5HARA 3O87A 5EOEA 4PM6A 1FCOA 4WEJA 2WKEA 4DRTA 3FYZA 3G30A 4Y0TA 2Y2LA 1XA7A 2QPNA 1L2SA 3N6IA 2Y2KA 1RGZA 3FV7A 4UA7A 2PU2A 2EX9A 2OLUA 4JXVA 2XD5A 4R4RA 4BQMA 4X6TA 1KGGA 1SDNA 4GD8A 3PBRA 1GA0A 5A93A 3A3IA 5FASA 4OQ0A 3PBTA 2E8IA 4GKUA 2Z2MB 3GMWA 5D3OA 2BLSA 5E43A 2Y2IA 4WZ5A 1XA1A 3HREA 1K38A 1U60A 3MXSA 3ZG9B 3WRTA 4WMCD 3SS3A 3TG9A 2WAEA 5FAPA 1PZOA 4E3LA 2WKHA 4P87A 3BFGA 1GA9A 1KDWA 3HLBA 3UNWA 2OLVA 2PU4A 4E3KA 3MZDA 5CXWA 1YMSA 4HBUA 3DWKA 3IHAA 1SCWA 3IF6C 1L0GA 3OZHA 4U0XA 2RL3A 3HLEA 3PTEA 4S2OA 5FQIA 3VP2A 5GLAA 4X53A 2V20A 3ISGA 1PWDA 4MBKA 1H8ZA 2ZC6B 3VP4A 4N9KA 2Z2LB 1L0FA 4JF4A 2DCFA 4KZ3A 2WUQA 3BECA 3BLSA 3GSGA 3EQVA 4FH4A 4GB7A 4N1HA 1XGIA 3DW0A 3OPPA 5CGXA 4GD6A 3ZG5A 1L0EA 2EX8A 1IKIA 4WMCA 5HW3A 4OPQA 5F82A 3FZCA 2H5SA 4S2MA 4E3IA 2ZD8A 5GLBA 5HX9A 3HLGA 1K55C 5EOOA 2EXAA 2Y2QA 5G18A 5FQKA 4E6XA 2ZM2A 1O07A 3HLCA 5CTMA 3W4PA 2HDRA 3W4QA 4DE1A 2QMIA 2H0YA 2Y4AA 5FQ9A 1KDSA 4YINA 2EX2A 3UDFA 3WS2A 3GVBA 5F83A 2XK1A 1QMEA 3FWLA 3IXHA 3LO7A 4ZBEA 1YLWA 4DE0A 4HESA 2Q9NA 5U47A 4LV2A 2X02A 3HUNA 1SKFA 2Y2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7J A;  5GLC A;  4MBF A;  1NY0 A;  4WZ5 C;  3DWZ A;  4R0Q A;  2Y2N A;  1BT5 A;  3SH8 A;  4B4Z A;  1NYY A;  1S6R A;  1EWZ A;  1I2S A;  1BLS A;  1W7F A;  2XDM A;  5DTT A;  4Z9Q A;  3VOY A;  3TSG A;  2XFS A;  5CTN A;  4S2N C;  5GL9 A;  1MWU A;  5EVI B;  3WS1 A;  3BEB A;  1YM1 A;  5DTS A;  1TDL A;  3RJU A;  4E3J A;  2EX6 A;  3UE1 A;  2G2U A;  4RA7 A;  1BZA A;  4OOM A;  2XQZ A;  4F94 A;  4KEN B;  5TGF A;  1FOF A;  1E3U A;  2XLN A;  2ZLY A;  3O88 A;  1PYY A;  1MPL A;  4B88 A;  5F1F A;  1VM1 A;  1K25 A;  5TR7 A;  2QZ6 A;  3ZVT A;  4JF5 A;  1KE4 A;  4QY5 A;  5CHU A;  5EPH A;  4X55 A;  3WS0 A;  3PBN A;  4WEL A;  1IYQ A;  3ZG8 B;  3A3J A;  3BFE A;  4KQO A;  1PI5 A;  3V39 A;  3QNC A;  5HAP A;  1YLT A;  1JWP A;  1K57 A;  3OPH A;  4E3O A;  3PAE A;  3VFH A;  4BD0 A;  2X01 A;  3NIA A;  4HEF A;  3MKE A;  1ALQ A;  5E2G A;  5JYO A;  1HVB A;  1PW8 A;  2HP6 A;  4GNU A;  1MY8 A;  3Q7V B;  2P74 A;  4JF6 A;  4QD4 A;  3IWI A;  1ERQ A;  2HP5 A;  4OP8 A;  5KSC A;  4WZ4 A;  2P9V A;  2WGI A;  5GHX A;  1ERO A;  4P85 A;  2Q9M A;  4JLF A;  5KZH A;  5M19 A;  2IWC A;  3O86 A;  2XFT A;  1YQS A;  1M40 A;  1E25 A;  3W4O A;  5L2F A;  2H10 A;  4N92 A;  4JPM A;  4KZ8 A;  4X56 A;  2ZC4 B;  4LCM A;  1CEF A;  3M2J A;  1SHV A;  3N8S A;  3Q7V A;  1CK3 A;  4QJG A;  1RCJ A;  3ZFZ A;  3MXR A;  4NET A;  4DXB A;  4FCF A;  3NY4 A;  1E4D A;  2ZQD A;  4KZ9 A;  3IT9 A;  3ITB A;  3WRZ A;  3RXW A;  3UN7 A;  1ESU A;  4YFM A;  4BL3 A;  2Y55 A;  4WEK A;  1KVM A;  5E2F A;  4R4S A;  5FAO A;  2HDS A;  1XGJ A;  2Y59 A;  3ZNT A;  4X68 A;  1H5X A;  2Y2J A;  3SS4 A;  4KZB A;  4PMA A;  3ZDJ A;  1XKZ A;  5AQB A;  2FFY A;  3IXG A;  4BL2 A;  1FSY A;  3IXD A;  5EVL A;  5CRF A;  2G2W A;  4UHU A;  5GHY A;  3VFF A;  3Q07 A;  3ZNY A;  4EUZ A;  3LEZ A;  2XD1 A;  1HD8 A;  2ZMA A;  3HLW A;  4R23 A;  4BLM A;  2CC1 A;  4GDN A;  2VGJ A;  3WS5 A;  1JTG A;  2ZJ9 A;  4LEN A;  2WGW B;  1K4F A;  4IBR A;  1K57 C;  2I72 A;  4WM9 A;  3UO9 A;  1XP4 A;  1NRF A;  3S4X A;  1LLB A;  2JC7 A;  3A3E A;  5E2H A;  4X69 A;  3LCE A;  1Q2Q A;  4IVK A;  3HUO A;  5TFQ A;  1VQQ A;  4KQQ A;  1WYC A;  3G4P A;  3QNB A;  4CJN A;  4EBP A;  1IYO A;  4Q8I A;  3VP0 A;  4HBT A;  2EXB A;  3OPL A;  1YT4 A;  5AQ7 A;  4KZ7 A;  2ZQ8 A;  2WGW A;  3NCK A;  4DXC A;  1S0W A;  1G68 A;  5HAQ A;  4L0L A;  3PBO A;  3ZG7 B;  4K91 A;  3S1Y A;  2V2F F;  4GZB A;  5DVA A;  1CI9 A;  2HPB A;  4EV4 A;  4LV1 A;  4DDS A;  3NC8 A;  1IKG A;  3E2K A;  4QHC A;  4KG6 A;  3C4O A;  3M6B A;  1PWC A;  2ZC3 B;  3VMA A;  2GDN A;  2JCH A;  4CPK A;  5A90 A;  3G32 A;  2H0T A;  5IHV A;  1J9M A;  5AQ9 A;  3G35 A;  1E3U D;  5A91 A;  5M18 A;  4OQH A;  1RP5 A;  4ZJ2 A;  3GQZ A;  4PM8 A;  4KZ6 A;  5EVI D;  5FQM A;  4KQR A;  2X71 A;  4OQI A;  4A5R A;  3G34 A;  3HLD A;  3BLM A;  1K54 A;  4KG5 A;  2B5R A;  2HDQ A;  3GV9 A;  4WBG A;  3MZE A;  4DKI A;  5FI7 A;  4LV0 A;  3IWO A;  1FQG A;  3RXX A;  4E6W A;  1K6S A;  2WGV A;  2WZX A;  4XUZ A;  5HFO A;  1ES4 A;  1LI9 A;  3UDI A;  3V5M A;  2WAD A;  2DRW A;  1NZU A;  4Y0U A;  3ZG0 A;  4LCL A;  3OCN A;  5HL1 A;  1I5Q A;  4OPR A;  3Q1F A;  1CEG A;  1W8Y A;  1H8Y A;  3NI9 A;  4KG2 A;  1K6R A;  2VGK A;  4RVA A;  5EEC A;  5FDH A;  4BD1 A;  5EUA A;  1IEL A;  3HL9 A;  4U3T A;  4GN2 A;  2ZM8 A;  3BRM A;  3G2Z A;  1BSG A;  5CER A;  4MBH A;  5KSH A;  4E3M A;  4WYY A;  3EQU A;  5EVI A;  2XR0 A;  3VSK A;  1XX2 A;  2ZC7 A;  1ONH A;  2R9X A;  2XH9 A;  4BEN A;  3G31 A;  5FAT A;  4R1G A;  3GTC A;  2ZM0 A;  3UE0 A;  1MXO A;  3NBL A;  2WAF A;  4XXR A;  1YLP A;  3SS5 A;  4DE2 A;  5A92 A;  3GR2 A;  3C4P A;  1ONG A;  3BFF A;  3IF6 B;  1HZO A;  3N8R A;  3V3S A;  4N1X A;  1MWT A;  3BYD A;  3BM6 A;  1BLP A;  3PBQ A;  1IEM A;  2HP9 A;  4LV3 A;  5FQQ A;  1ES5 A;  3MZF A;  3IHB A;  2XF3 A;  5CHM A;  3IXB A;  1Q2P A;  4UA9 A;  5FI6 A;  4DE3 A;  1NXY A;  3IF6 A;  3G2Y A;  1I2W A;  2ZQ7 A;  4S2P A;  1W5D A;  1KVL A;  4FH2 A;  2ZQC A;  3S22 A;  1IYS A;  5DF7 A;  3HBR A;  1LHY A;  3IWQ A;  4PM7 A;  3GRJ A;  1DJC A;  2ZQA A;  3AGE A;  4JXS A;  4PM9 A;  3OC2 A;  4KZ5 A;  1CI8 A;  1MWR A;  3AGD A;  5CGW A;  5AQA A;  2ZC5 B;  3HLF A;  3MBZ A;  1OME A;  3A3D A;  1ZKJ A;  3PBS A;  1MKI A;  1SDE A;  5FI2 A;  2RCX A;  4S2I A;  3O3V A;  4OQG A;  1ES2 A;  1MWS A;  1RGY A;  1PW1 A;  4ZDX A;  3UPN A;  1YLY A;  1Y54 A;  3Q82 A;  2EFU A;  2JE5 A;  3ZCZ A;  1K55 A;  5F1G A;  3A3F A;  2OSU A;  1PIO A;  3UDX A;  4C75 A;  4PPR A;  1FR6 A;  5EVI C;  4EQI A;  3CMZ A;  3BFC A;  1LL5 A;  5GLD A;  1MBL A;  2WYX A;  3Q7Z A;  4ID4 A;  3UPP A;  4DF6 A;  2JBF A;  4PM5 A;  4GDB A;  3VSL A;  4OKP A;  2Y2H A;  4RX2 A;  3UY6 A;  1ESI A;  2V1Z A;  3Q81 A;  4UAA A;  4C3Q A;  1W79 A;  1ZC2 A;  3D4F A;  2A49 A;  3E2L A;  3WWX A;  3P09 A;  4DDY A;  4S2L A;  5M1A A;  2J9P A;  3IH9 A;  1G6A A;  3DTM A;  1TEM A;  5EE8 A;  1KGF A;  1YLZ A;  1GHM A;  2A3U A;  2UWX A;  4OP5 A;  4P6B A;  2C6W B;  4JXW A;  1N4O A;  3IH8 A;  1JTD A;  3PAG A;  2EFX A;  4P0M A;  4K0X A;  4S2N A;  3N8L A;  3CZD A;  1K56 D;  1LL9 A;  1O7E A;  2J7V A;  4M3K A;  5FA7 A;  5BOH A;  2WZZ A;  5DTK A;  4MLL A;  2J8Y A;  3C5A A;  1ERM A;  3M6H A;  3SH7 A;  2FFF B;  4D2O A;  4XUX A;  5DF9 A;  1AXB A;  4R3J A;  5CEC A;  1K4E A;  3C7V A;  2J9O A;  2OV5 A;  5CHJ A;  4FSF A;  1ZG4 A;  5CEB A;  3LY3 A;  1N9B A;  3NDE A;  1XPB A;  4IBX A;  4IED A;  1KE3 A;  4N9L A;  4O7D A;  4ZTK A;  4OVD A;  3OPR A;  1FSW A;  5FAQ A;  2R9W A;  1GCE A;  5HAI A;  1FCM A;  4RX3 A;  4GOG A;  4OLD A;  1FCN A;  1TVF A;  4BJP A;  3AGF A;  1GHP A;  3MFD A;  3FKV A;  1NYM A;  2C5W B;  4ZJ1 A;  1K56 A;  3TOI A;  2WK0 A;  4RYE A;  1ZG6 A;  1DY6 A;  3B3X A;  3UPO A;  3ZGA B;  1L0D A;  2DNS A;  3SH9 A;  2XEP A;  1DJB A;  3FKW A;  5E2E A;  4EBL A;  1YMX A;  3W8K A;  5CGS A;  3VP1 A;  1LI0 A;  1PWG A;  4E3N A;  3N4I A;  1KGE A;  2Y2O A;  5J8X A;  1QMF A;  3C7U A;  1Z6F A;  2BG1 A;  1W8Q A;  4MNR A;  3SOI A;  4IVI A;  2ZQ9 A;  4FD8 A;  4OOY A;  4Y7P A;  2Y2G A;  3ZHH A;  3ZVW A;  4OPZ A;  4S2J A;  3BFD A;  3WS4 A;  5DF8 A;  2IWB A;  4C6Y A;  5JYP A;  1BUL A;  1BLH A;  1BUE A;  4ZAM A;  1JWV A;  1EI5 A;  1DJA A;  3V3R A;  1ES3 A;  4JKT A;  1TDG A;  5KMW A;  4QU3 A;  3UE3 A;  3MKF A;  4OPY A;  2PBY A;  5FSR A;  3IF5 A;  3QHY A;  3ITA A;  1BLC A;  4NK3 A;  1HTZ A;  1JWZ A;  4QY6 A;  1FR1 A;  1NJ4 A;  1IYP A;  1PZP A;  3N7W A;  4OOL A;  3NDG A;  3OCL A;  1M6K A;  3M2K A;  5I94 A;  2Y91 A;  2P9V B;  3CJM A;  3LY4 A;  4EWF A;  5CED A;  5GHZ A;  1PI4 A;  4UA6 A;  3V50 A;  1NZO A;  1K54 C;  4KZA A;  5FQJ A;  4OH0 A;  4MEZ A;  3HVF A;  4R3B A;  3P98 A;  1KE0 A;  2Y2M A;  4H8R A;  4B4X A;  1BTL A;  1WYB A;  3VP3 A;  3IQA A;  3HUM A;  4OLG A;  3VOZ A;  4Y0O A;  2HDU A;  4ZJ3 A;  2WKI A;  3JYI A;  1C3B A;  1GHI A;  4S2K A;  4KZ4 A;  4EBN A;  4JXG A;  4U0T A;  4QB8 A;  2XGN A;  1WE4 A;  3CG5 A;  1JVJ A;  2IWD A;  4OON A;  1XXM A;  4K0W A;  4JBF A;  1YLJ A;  5HAR A;  3O87 A;  5EOE A;  4PM6 A;  1FCO A;  4WEJ A;  2WKE A;  4DRT A;  3FYZ A;  3G30 A;  4Y0T A;  2Y2L A;  1XA7 A;  2QPN A;  1L2S A;  3N6I A;  2Y2K A;  1RGZ A;  3FV7 A;  4UA7 A;  2PU2 A;  2EX9 A;  2OLU A;  4JXV A;  2XD5 A;  4R4R A;  4BQM A;  4X6T A;  1KGG A;  1SDN A;  4GD8 A;  3PBR A;  1GA0 A;  5A93 A;  3A3I A;  5FAS A;  4OQ0 A;  3PBT A;  2E8I A;  4GKU A;  2Z2M B;  3GMW A;  5D3O A;  2BLS A;  5E43 A;  2Y2I A;  4WZ5 A;  1XA1 A;  3HRE A;  1K38 A;  1U60 A;  3MXS A;  3ZG9 B;  3WRT A;  4WMC D;  3SS3 A;  3TG9 A;  2WAE A;  5FAP A;  1PZO A;  4E3L A;  2WKH A;  4P87 A;  3BFG A;  1GA9 A;  1KDW A;  3HLB A;  3UNW A;  2OLV A;  2PU4 A;  4E3K A;  3MZD A;  5CXW A;  1YMS A;  4HBU A;  3DWK A;  3IHA A;  1SCW A;  3IF6 C;  1L0G A;  3OZH A;  4U0X A;  2RL3 A;  3HLE A;  3PTE A;  4S2O A;  5FQI A;  3VP2 A;  5GLA A;  4X53 A;  2V20 A;  3ISG A;  1PWD A;  4MBK A;  1H8Z A;  2ZC6 B;  3VP4 A;  4N9K A;  2Z2L B;  1L0F A;  4JF4 A;  2DCF A;  4KZ3 A;  2WUQ A;  3BEC A;  3BLS A;  3GSG A;  3EQV A;  4FH4 A;  4GB7 A;  4N1H A;  1XGI A;  3DW0 A;  3OPP A;  5CGX A;  4GD6 A;  3ZG5 A;  1L0E A;  2EX8 A;  1IKI A;  4WMC A;  5HW3 A;  4OPQ A;  5F82 A;  3FZC A;  2H5S A;  4S2M A;  4E3I A;  2ZD8 A;  5GLB A;  5HX9 A;  3HLG A;  1K55 C;  5EOO A;  2EXA A;  2Y2Q A;  5G18 A;  5FQK A;  4E6X A;  2ZM2 A;  1O07 A;  3HLC A;  5CTM A;  3W4P A;  2HDR A;  3W4Q A;  4DE1 A;  2QMI A;  2H0Y A;  2Y4A A;  5FQ9 A;  1KDS A;  4YIN A;  2EX2 A;  3UDF A;  3WS2 A;  3GVB A;  5F83 A;  2XK1 A;  1QME A;  3FWL A;  3IXH A;  3LO7 A;  4ZBE A;  1YLW A;  4DE0 A;  4HES A;  2Q9N A;  5U47 A;  4LV2 A;  2X02 A;  3HUN A;  1SKF A;  2Y2P A; 
#chains in the Genus database with same CATH topology
 3SH8 A;  2XDM A;  3T12 B;  4Z9Q A;  2XFS A;  5CTN A;  1YM1 A;  4NXE A;  1TDL A;  2EX6 A;  1FOF A;  1E3U A;  1PYY A;  1K25 A;  5TR7 A;  3ZVT A;  4DN0 A;  5EPH A;  4WEL A;  4KQO A;  1V9Y A;  1PI5 A;  3V39 A;  1K0K A;  1JWP A;  4IUK A;  4BD0 A;  2J3W A;  1XJ2 A;  1PW8 A;  2HP6 A;  4GNU A;  4JF6 A;  1ERQ A;  2HJ9 C;  2WGI A;  3HJK A;  5DKL A;  3O86 A;  2XFT A;  3UB6 A;  2H10 A;  3F1N B;  2L1M A;  4LCM A;  4I3J A;  1CEF A;  3M2J A;  3K3C A;  1SHV A;  1CK3 A;  1RCJ A;  4NET A;  4KZ9 A;  3IT9 A;  1GSX A;  2ZMV A;  3RXW A;  3UN7 A;  4BL3 A;  2Y55 A;  2PT7 A;  3LFV A;  2Y59 A;  3ZNT A;  1BYW A;  1SZV A;  2Y2J A;  1FSY A;  5CRF A;  2G2W A;  4UHU A;  3Q07 A;  3ZNY A;  4GLQ A;  3HLW A;  5HWV A;  4WM9 A;  1OT6 A;  4FUW A;  3HUO A;  3HCY A;  3G4P A;  4EBP A;  3VP0 A;  2EXB A;  3LIE A;  1YT4 A;  5EVE A;  4GS9 B;  1S0W A;  1G68 A;  2BAS A;  3S1Y A;  4ETX A;  4GZB A;  5DVA A;  2HPB A;  3NC8 A;  2D02 A;  4KG6 A;  4GS9 A;  3M6B A;  5A90 A;  2WKP A;  2GJ3 A;  4OQH A;  3GQZ A;  4PM8 A;  4KZ6 A;  5FQM A;  4KQR A;  4OQI A;  3OOV A;  2UV0 E;  3GV9 A;  4GJ4 A;  4WBG A;  4HJ6 A;  3IWO A;  1P9W A;  4CLC D;  4XUZ A;  5HFO A;  1ES4 A;  1F98 A;  1LI9 A;  3UDI A;  1NZU A;  4LCL A;  5HL1 A;  1CEG A;  5FDH A;  1K6R A;  2VGK A;  3LID A;  1G6O A;  1IEL A;  3HL9 A;  4GN2 A;  1BSG A;  4MBH A;  3LUQ A;  5KSH A;  3L9K A;  2QJ5 A;  4WYY A;  5EVI A;  2ZC7 A;  1ONH A;  2B18 A;  3G31 A;  2ZM0 A;  3NBL A;  3SS5 A;  5A92 A;  4HNB A;  3GR2 A;  3IF6 B;  3N8R A;  1CF0 A;  1BLP A;  1IEM A;  3V67 A;  3JVV A;  3MZF A;  4AFI A;  3IHB A;  5CHM A;  4LRY C;  4DE3 A;  1ACF A;  2ZBB A;  3IF6 A;  3G2Y A;  2ZQ7 A;  1KVL A;  5DF7 A;  3HBR A;  1LHY A;  3IWQ A;  4I5S A;  3T4T A;  1DJC A;  3IX4 A;  4PHT A;  3NOP C;  2ZC5 B;  3CUE C;  1OME A;  3MMH A;  1S4R A;  1MKI A;  3LI9 A;  3VE4 A;  3O3V A;  4B93 A;  1RGY A;  1PW1 A;  1H8M A;  3VE3 A;  2JE5 A;  4RQ9 A;  5F1G A;  5A8B A;  1DP6 A;  2HGV A;  1PIO A;  4C75 A;  4PPR A;  4EQI A;  1LL5 A;  2NUP C;  3UPP A;  4DF6 A;  3UY6 A;  4ESP A;  3U4L P;  3Q81 A;  5AVE A;  3E2L A;  5M1A A;  1TEM A;  2OAP 1;  2UWX A;  4OP5 A;  1JTD A;  4P0M A;  2Q0O A;  4K0X A;  1K56 D;  4KQD A;  4M3K A;  3IBR A;  2WZZ A;  4MLL A;  2J8Y A;  3C5A A;  5DF9 A;  2J9O A;  2XA7 M;  5CHJ A;  1ZG4 A;  3NDE A;  2V0U A;  4O7D A;  4OVD A;  3CPT B;  1GCE A;  3BY8 A;  4OLD A;  3UB5 P;  1G5U A;  2VGL S;  4ZJ1 A;  3TOI A;  2OAQ 1;  3C8C A;  1Z09 A;  1LSX A;  4BBU A;  1DJB A;  3FKW A;  3IS2 B;  3EEA A;  1YMX A;  3W8K A;  3UB9 A;  2W3D A;  2DMW A;  2O9C A;  5J8X A;  4Y17 A;  1W8Q A;  3LR4 A;  2ZQ9 A;  4Y7P A;  4WN5 A;  5IT5 A;  4OPZ A;  3IS2 A;  3LIF A;  4JKT A;  1TDG A;  3IF5 A;  4F3L A;  1BLC A;  1N9O A;  4ZRR A;  3R7W A;  4OOL A;  3NDG A;  3M2K A;  3DTK A;  1PI4 A;  2EWV A;  5AVF A;  2GNX A;  5FQJ A;  3P98 A;  3U2A A;  2VEA A;  4ZJ3 A;  4Q0I A;  1YPR A;  2XGN A;  3CG5 A;  1NLY A;  5HAR A;  2WKE A;  3S7O A;  3FYZ A;  1ZHH B;  2PU2 A;  2JKR M;  2OLU A;  4JXV A;  4R3A A;  1VHM A;  4R4R A;  4X6T A;  4GD8 A;  1OTD A;  3PBR A;  3MQO A;  5FAS A;  2W27 A;  2E8I A;  4GKU A;  1XA1 A;  1K38 A;  3MXS A;  3TG9 A;  1PZO A;  2WKH A;  1XFN A;  4D60 A;  1V9Z A;  1GA9 A;  2PU4 A;  3MZD A;  5CXW A;  1J3W A;  3A0S A;  3HLE A;  5FQI A;  4G3K A;  4KUK A;  1OPX A;  1PWD A;  4MBK A;  3LYX A;  3NOU C;  3TRC A;  5CX7 A;  2BTF P;  3BEC A;  3EQV A;  3DW0 A;  3OPP A;  5CGX A;  4X25 A;  3ZG5 A;  1UWP X;  2J3T C;  2EX8 A;  4WMC A;  5EM0 A;  5F82 A;  4E3I A;  5GLB A;  4MCW A;  4I3I A;  4ETZ A;  5FQK A;  4E6X A;  1O07 A;  3W4P A;  3LIB A;  3T4L A;  5EM1 A;  2Y4A A;  5HSQ A;  3UDF A;  2IA2 A;  1LSV A;  2XK1 A;  2V0W A;  2M7U A;  4PKY G;  2X02 A;  3DTE A;  4MBF A;  1D7E A;  1NY0 A;  4WZ5 C;  2JKG A;  4Q0J A;  2PBD P;  1NYY A;  1SKO A;  1EWZ A;  1W7F A;  5DTT A;  3VOY A;  4S2N C;  2ZOH A;  3CUE A;  4PAU A;  5DTS A;  3RJU A;  3BWL A;  4E3J A;  2G2U A;  4JGP A;  1BZA A;  3B33 A;  1S4S A;  4HQA A;  4KEN B;  3P7N A;  2ZLY A;  3EEH A;  1ODV A;  2GZA A;  5F1F A;  4JF5 A;  3ZG8 B;  3A3J A;  3S7P A;  3VFH A;  4JGQ A;  1HVB A;  3IWI A;  4OP8 A;  3DAV A;  2P9V A;  2QWS A;  3E4Q A;  3E0Y A;  1YQS A;  1E25 A;  3W4O A;  3EOI A;  5L2F A;  2P7J A;  4N92 A;  4KZ8 A;  2HV1 A;  2A24 B;  1F5M A;  2OOL A;  3ITB A;  4ME4 A;  3MF0 A;  1KVM A;  5E2F A;  5FAO A;  2HDS A;  1H5X A;  3SS4 A;  4PMA A;  1LL8 A;  4BL2 A;  4MN5 A;  5GHY A;  4CLC E;  1LSW A;  1P9R A;  4EUZ A;  4LPZ A;  2W0N A;  2ZMA A;  2CC1 A;  2VGJ A;  4H6J B;  2ZJ9 A;  4LEN A;  1K4F A;  4IBR A;  1K57 C;  2I72 A;  3UO9 A;  5E2H A;  2JC7 A;  3A3E A;  1OTB A;  3LCE A;  2CMN A;  4IVK A;  5TFQ A;  4KQQ A;  4E04 A;  4NG2 A;  4Y3I A;  2NUT C;  4EER A;  4CJN A;  2K31 A;  5HPF A;  5AQ7 A;  3OPL A;  3JPU A;  2ZQ8 A;  1P97 A;  5EFW A;  3NCK A;  1NLZ A;  2R78 A;  4L0L A;  3PBO A;  4K91 A;  1NWZ A;  4EQ1 A;  4KUO A;  3E2K A;  1D1J A;  4FTX A;  3C4O A;  3VMA A;  2GDN A;  2QYB A;  2JCH A;  4CPK A;  3G32 A;  5IHV A;  4LGW A;  1J9M A;  3LR5 A;  3G35 A;  1CQA A;  4ZJ2 A;  3FG8 A;  5EVI D;  4A5R A;  4DJ3 A;  3BLM A;  3MZE A;  4DKI A;  3RH8 B;  5FI7 A;  4Y5F A;  1FQG A;  1FIL A;  2W3H A;  3V5M A;  4Y0U A;  3JVU A;  5EEC A;  1H8Y A;  4O8G A;  3MQ0 A;  5IS1 A;  2ZM8 A;  1TF1 A;  3H7W B;  1N9L A;  1XX2 A;  4HOI A;  2FZ0 A;  3EGX C;  5FAT A;  3GTC A;  1A0K A;  4DE2 A;  5DJU A;  3C4P A;  4N1X A;  4HH2 A;  3PBQ A;  4LV3 A;  2XA7 S;  5FQQ A;  3BJN A;  4UA9 A;  1NXY A;  4YOF A;  5L09 A;  1MZU A;  1IYS A;  5HD5 A;  3AGE A;  3OC2 A;  4KZ5 A;  3BQ8 A;  1MWR A;  3AGD A;  5AQA A;  4JGO A;  3CAX A;  4HIA A;  3A3D A;  1ZKJ A;  1IOU A;  4S2I A;  3F1N A;  1MWS A;  2K2N A;  3LGO A;  1YLY A;  3Q82 A;  3A3F A;  2OSU A;  3BFC A;  1DRM A;  4CQH A;  3NOT C;  2JBF A;  2Y2H A;  4NKP A;  1S1Z A;  2V1Z A;  4UAA A;  3D4F A;  4HHD A;  4CLC C;  4S2L A;  2KDK A;  1CJF A;  1G6A A;  1KGF A;  1YLZ A;  4PKY A;  2ACG A;  5TBM B;  2VX8 A;  2EFX A;  4S2N A;  3KSF A;  3CZD A;  1O7E A;  2J7V A;  2INW A;  2LB9 A;  5FA7 A;  3UE6 A;  5BOH A;  3L7H A;  3TW8 A;  3M6H A;  4I39 A;  2FFF B;  1VET B;  1AXB A;  1YSQ A;  3C7V A;  1N9B A;  2G7U A;  4IBX A;  4IED A;  1KE3 A;  4BBT A;  1UGU A;  1T1B A;  5HAI A;  1FCM A;  1FCN A;  3AGF A;  1YAX A;  1NYM A;  3MJQ A;  3UPO A;  3KO6 A;  3KX0 X;  4EBL A;  5TJJ A;  1Y4O A;  3VP1 A;  1Y28 A;  4B9O A;  4E3N A;  3E4P A;  5F6A A;  2PAV P;  4LRX C;  3C7U A;  3IX8 A;  2VA0 A;  4FD8 A;  4K08 A;  3ZHH A;  1MC0 A;  2KLI A;  3BFD A;  5DF8 A;  4C6Y A;  1BLH A;  1JWV A;  3KYQ A;  2PD8 A;  3V3R A;  4X1M A;  3MKF A;  4HJ3 A;  4OPY A;  5FSR A;  5HWT A;  1JWZ A;  3CI6 A;  3OCL A;  1M6K A;  3CIT A;  3CJM A;  3LY4 A;  5CED A;  4MN7 A;  4UA6 A;  1K54 C;  4X1L A;  1H3Q A;  3ZQ5 A;  4MEZ A;  4WL9 A;  1W63 Q;  2HDU A;  5F69 A;  2M7V A;  1X0O A;  2B95 A;  4JXG A;  4U0T A;  1XXM A;  5EOE A;  3KSI A;  4DRT A;  2Y2L A;  3PYP A;  3CHW P;  2QPN A;  5HDD A;  1RGZ A;  3FV7 A;  4WLA A;  4BQM A;  5HD3 A;  2QJ7 A;  3A3I A;  3PBT A;  5D3O A;  2BLS A;  5E43 A;  2J80 A;  3D3O A;  4L9F A;  1LT0 A;  4WMC D;  2WAE A;  1NRJ A;  3ULF A;  1KDW A;  4E3K A;  4HBU A;  1SCW A;  1L0G A;  5DFY A;  4S2O A;  1H8Z A;  2ZC6 B;  1L0F A;  2DCF A;  4GB7 A;  1S67 L;  1XGI A;  2VK3 A;  2KX6 A;  2PR5 A;  3MXQ A;  1IKI A;  4OPQ A;  4NXG A;  5G18 A;  4EEP A;  5L07 A;  3HLC A;  4BWI A;  2HDR A;  2QMI A;  2O0Y A;  3LIA A;  4YIN A;  5F83 A;  3ICY A;  3CPT A;  1QME A;  1YKD A;  3FWL A;  3IXH A;  1YLW A;  3BQA A;  3E4O A;  4HES A;  2Q9N A;  5U47 A;  5DKK A;  3I7J A;  3DWZ A;  2V1A A;  2V1B A;  2Y2N A;  1BLS A;  3CWF A;  2AVX A;  5GL9 A;  3LI8 A;  5F68 A;  3UE1 A;  1OTE A;  4RA7 A;  4OOM A;  4Y15 A;  2XQZ A;  2W1T B;  3NJA A;  5TGF A;  3O88 A;  1MPL A;  4CLC B;  2XSS A;  1VM1 A;  2QZ6 A;  3WS0 A;  5DJT A;  4X55 A;  1IYQ A;  3B42 A;  3BFE A;  4MMN A;  3QNC A;  1XFQ A;  5HAP A;  3B47 A;  1YLT A;  3OPH A;  2W1T A;  3NIA A;  4HEF A;  3MKE A;  4CLC A;  1MY8 A;  1OJG A;  2P74 A;  4QD4 A;  3NEC A;  2HP5 A;  1TS0 A;  5KSC A;  4WZ4 A;  2YKH A;  5GHX A;  4WUJ A;  4P85 A;  4JLF A;  1F9I A;  4Y13 A;  2IWC A;  1M40 A;  4EEU A;  4M4X A;  4JPM A;  2ZC4 B;  5L10 A;  3ZFZ A;  2HZ5 A;  2Z6C A;  4DXB A;  3NY4 A;  1ESU A;  4EUV A;  4WEK A;  3F1O B;  5IU1 A;  3ZDJ A;  4LFU A;  1PNE A;  3IXG A;  3IXD A;  5EVL A;  1GSW A;  1HD8 A;  1F2K A;  4BLM A;  4EES A;  4XT2 B;  4GDN A;  3WS5 A;  1JTG A;  4EXO A;  2WGW B;  3PHY A;  3S4X A;  3T4S A;  1LLB A;  1FIK A;  4X69 A;  1Q2Q A;  1WYC A;  4QWO A;  2MJ6 A;  4Q8I A;  4XT2 A;  4HBT A;  4KZ7 A;  2WGW A;  4DXC A;  2VV8 A;  4I3A A;  2W3G A;  4LV1 A;  1IKG A;  3T50 A;  4QHC A;  3PXP A;  2ZC3 B;  5AQ9 A;  4EU0 A;  1E3U D;  5A91 A;  3SW1 A;  2JN7 A;  2I9V A;  2VZW A;  2X71 A;  3DBA A;  3HLD A;  4LRZ E;  1K54 A;  2B5R A;  5AJG A;  1TS7 A;  2VV6 A;  2WZX A;  2V9A A;  4MN6 A;  2WAD A;  1TS6 A;  1I5Q A;  2XRO A;  4OPR A;  4I38 A;  3NI9 A;  4BD1 A;  5EUA A;  3T4Q A;  1JNU A;  5L8M A;  3EQU A;  3VSK A;  2R9X A;  4BEN A;  4ARZ B;  3VOL A;  2WAF A;  3H82 B;  2PR6 A;  5HPI A;  3BFF A;  1TD5 A;  3V3S A;  1MWT A;  3BM6 A;  4G3W A;  3MSH A;  2XF3 A;  3FPW A;  4ARZ A;  3IXB A;  5KIZ A;  3S7N A;  3H82 A;  1HLU P;  4S2P A;  4HH3 A;  4FH2 A;  1T1A A;  5CGW A;  3HJI A;  1VEU B;  3HLF A;  3LIC A;  5I5L A;  2XRN A;  2LB5 A;  4NEE D;  4OQG A;  3UPN A;  1XJ6 A;  1Y54 A;  3K2N A;  4L9G A;  3ZCZ A;  2A24 A;  3QP4 A;  3UDX A;  3UMD A;  1VEU A;  5EVI C;  3T4K A;  5DFX A;  1MBL A;  2WYX A;  3Q7Z A;  4ID4 A;  4PM5 A;  3VSL A;  4OKP A;  4C3Q A;  1W79 A;  4DDY A;  3DTM A;  5EE8 A;  2VKS A;  2E8J A;  4G3V A;  4H6J A;  2A3U A;  4P6B A;  2C6W B;  3QP5 A;  4JXW A;  3RTY A;  3N8L A;  2PRF A;  1LL9 A;  4NXB A;  1ERM A;  2JKT I;  4XUX A;  2HF6 A;  3OBF A;  4R3J A;  2OV5 A;  4IJG A;  1L3L A;  4FSF A;  5CEB A;  4EBN A;  4N9L A;  3OPR A;  1S1Y A;  1FSW A;  5FAQ A;  2R9W A;  4GOG A;  1GHP A;  3MFD A;  2C5W B;  3T1S A;  4RYE A;  1ZG6 A;  3ZGA B;  1L0D A;  2DNS A;  3SH9 A;  4DJ2 A;  2XEP A;  4Z1W A;  1PWG A;  3RFB A;  2Y2O A;  3T4J A;  2BG1 A;  3KYZ A;  4MNR A;  3P01 A;  3SOI A;  4IVI A;  4OOY A;  2Y2G A;  2W1R A;  4HJ4 A;  3WS4 A;  5JYP A;  3E98 A;  3QP1 A;  1BUL A;  1BUE A;  4ZAM A;  1DJA A;  5G4Z A;  1ES3 A;  5KMW A;  4LLO B;  3UE3 A;  4P6Z M;  4GW9 A;  2PBY A;  3H7W A;  3QHY A;  4BMW A;  3ITA A;  4BBV A;  1OJ5 A;  4QY6 A;  2WKQ A;  4UQI M;  1PZP A;  3N7W A;  5I94 A;  4EW7 A;  2ZL1 B;  3SZT A;  4HI4 A;  5GHZ A;  4WF0 A;  4II7 A;  3V50 A;  1NZO A;  4R3B A;  2Y2M A;  1DP8 A;  3VOZ A;  4OLG A;  4Y0O A;  1C3B A;  1GHI A;  3DTI A;  2ZL1 A;  5C5K A;  2O9A A;  3BY9 A;  4KZ4 A;  4HY8 A;  2IWD A;  4K0W A;  4JBF A;  2GX5 A;  4WEJ A;  4JGR A;  1G28 A;  2PYR A;  3O5Y A;  1L2S A;  3N6I A;  2Y2K A;  5HDC A;  1KGG A;  1GA0 A;  5A93 A;  2VLG A;  2Y2I A;  4WZ5 A;  3HRE A;  1U60 A;  1STZ A;  3W2Z A;  5FAP A;  4R38 A;  1T19 A;  3BFG A;  2QHK A;  4IHQ A;  3HLB A;  3UNW A;  2OLV A;  1YMS A;  1W63 M;  1T1C A;  3DWK A;  3IHA A;  4NXF A;  3ISG A;  3VP4 A;  5HL6 A;  2Z2L B;  5TBM A;  4KZ3 A;  3BLS A;  3GSG A;  3H9W A;  4N1H A;  4O01 A;  1OT9 A;  2H28 A;  2WKR A;  5HW3 A;  1XJ3 A;  1K55 C;  2EXA A;  2Y2Q A;  1VET A;  3GDI A;  3W4Q A;  4DE1 A;  2EX2 A;  3WS2 A;  4ZBE A;  4DE0 A;  2D01 A;  4LV2 A;  3HUN A;  1SKF A;  2Y2P A;  5GLC A;  3PR6 A;  4R0Q A;  2YKF A;  2B02 A;  1BT5 A;  4B4Z A;  1YSP A;  1S6R A;  1I2S A;  3TSG A;  1MWU A;  3A0R A;  5EVI B;  3WS1 A;  3EGD C;  3BEB A;  3TJZ C;  3MS6 A;  4F94 A;  1ZTU A;  2XLN A;  3OLO A;  4B88 A;  1KE4 A;  4QY5 A;  5CHU A;  3PBN A;  3S7Q A;  4GCZ A;  4UEY A;  1K57 A;  4E3O A;  3PAE A;  2X01 A;  1ALQ A;  2L4R A;  5E2G A;  5JYO A;  3KSG A;  3Q7V B;  3T4O A;  3D9Y A;  1OTA A;  2W3F A;  1ERO A;  2Q9M A;  5M19 A;  5HDS A;  2O99 A;  5KZH A;  1IFQ A;  4X56 A;  3N8S A;  3Q7V A;  4QJG A;  3MXR A;  4FCF A;  1TS8 A;  2PHY A;  1E4D A;  2ZQD A;  3WRZ A;  3K3D A;  4YFM A;  2O9B A;  2VJW A;  4R4S A;  1XGJ A;  4X68 A;  4KZB A;  2W3E A;  1XKZ A;  2EA9 A;  3G6O A;  5AQB A;  2FFY A;  3QP8 A;  3VFF A;  3LEZ A;  2XD1 A;  4R23 A;  2ZOI A;  2L0W A;  1PRQ A;  1XP4 A;  1NRF A;  3EWK A;  3F1P B;  4QPR A;  2JHE A;  4R70 A;  1VQQ A;  3QNB A;  2Z6D A;  5K5B A;  1IYO A;  1WA9 A;  3F1P A;  5HAQ A;  3ZG7 B;  2V2F F;  3FC7 A;  1CI9 A;  4EV4 A;  1S66 L;  1D06 A;  4DDS A;  1PWC A;  2H0T A;  1MKM A;  5M18 A;  1RP5 A;  1UWN X;  2Y8H A;  3G34 A;  4KG5 A;  2HDQ A;  2FH5 A;  3T1Q B;  4LV0 A;  3KYE A;  3RXX A;  4E6W A;  1K6S A;  2WGV A;  3QP2 A;  2DRW A;  3ZG0 A;  3OCN A;  3LR3 A;  3Q1F A;  1W8Y A;  4RVA A;  4KG2 A;  4U3T A;  3BRM A;  5CER A;  3G2Z A;  4E3M A;  1OTI A;  4F3L B;  4Q0H A;  2XR0 A;  3T1R A;  2XH9 A;  3R7W B;  4R1G A;  3UE0 A;  1MXO A;  4XXR A;  1YLP A;  1ONG A;  1HZO A;  5G4Y A;  2PDR A;  3BYD A;  2HP9 A;  3LR0 A;  5MC7 A;  1ES5 A;  4Y2F A;  1Q2P A;  5FI6 A;  1I2W A;  1W5D A;  3S22 A;  2ZQC A;  2PD7 A;  5J4E A;  4PM7 A;  3GRJ A;  2ZQA A;  3IBJ A;  4JXS A;  4O0P A;  4PM9 A;  5HZH A;  1CI8 A;  2QKP A;  3MBZ A;  3PBS A;  1SDE A;  5FI2 A;  3T1X A;  2RCX A;  5HWW A;  1ES2 A;  4ZDX A;  2EFU A;  1K55 A;  4HP9 A;  1KOU A;  1FR6 A;  3CLO A;  3CMZ A;  3F1O A;  5GLD A;  2KOI A;  5F5Y A;  4GDB A;  4RX2 A;  1ESI A;  3C2W A;  3MFX A;  1ZC2 A;  2A49 A;  4P6Z S;  3WWX A;  3P09 A;  2OWJ A;  2J9P A;  3IH9 A;  1GHM A;  3C38 A;  4UQI S;  1N4O A;  3IH8 A;  3PAG A;  2Y79 A;  2JKR I;  5DTK A;  3SH7 A;  2V8F A;  1P0Z A;  4D2O A;  5CEC A;  1K4E A;  4L9E A;  3LY3 A;  1XPB A;  3UB8 A;  1VB6 A;  4ZTK A;  4YNR A;  4RX3 A;  2ZMF A;  1TVF A;  4BJP A;  5J7E A;  3FKV A;  1K56 A;  2WK0 A;  2PYP A;  1DY6 A;  3B3X A;  2VV7 A;  4FOF A;  1SKO B;  5E2E A;  1GSV A;  5CGS A;  1LI0 A;  2OWH A;  2JKF A;  3N4I A;  1XJ4 A;  1KGE A;  2HJE A;  1QMF A;  3KSH A;  1Z6F A;  1EW0 A;  3ZVW A;  4S2J A;  3MR0 A;  2IWB A;  2K7S A;  1EI5 A;  4QU3 A;  5FDS A;  4NK3 A;  2J3T D;  3UME A;  1HTZ A;  1FR1 A;  1H0M A;  1NJ4 A;  1IYP A;  3R4K A;  1PFL A;  5LBR A;  2Y91 A;  3GEC A;  2P9V B;  4EWF A;  4R6L A;  4KZA A;  4OH0 A;  1DP9 A;  3HVF A;  1KE0 A;  1N9N A;  4H8R A;  4B4X A;  3NHQ A;  1BTL A;  1WYB A;  3VP3 A;  3IQA A;  3HUM A;  2WKI A;  4S2K A;  3JYI A;  3LEQ A;  1AWI A;  5FEF A;  4QB8 A;  1WE4 A;  1JVJ A;  4OON A;  1YLJ A;  1T18 A;  3O87 A;  4PM6 A;  3ZYT A;  1FCO A;  3UB7 A;  5FEG A;  3G30 A;  4Y0T A;  2VGL M;  1XA7 A;  3C30 A;  4UA7 A;  4YWZ A;  2EX9 A;  2XD5 A;  1SDN A;  2JKT M;  4OQ0 A;  2Z2M B;  3GMW A;  2EWW A;  4HP4 A;  3ZG9 B;  3WRT A;  3SS3 A;  4IUH A;  4E3L A;  3D72 A;  4P87 A;  4GHI B;  3TE8 A;  4MDZ A;  2A2L A;  3IF6 C;  3A0V A;  3OZH A;  4U0X A;  2RL3 A;  3PTE A;  3MQQ A;  3VP2 A;  3NUL A;  5GLA A;  4X53 A;  3FPV A;  2V20 A;  4N9K A;  4JF4 A;  2WUQ A;  4FH4 A;  4GHI A;  2P04 A;  4GD6 A;  3IX3 A;  4EET B;  2P08 A;  1L0E A;  5FL3 A;  3FZC A;  2H5S A;  4S2M A;  2ZD8 A;  5HX9 A;  3HLG A;  5EOO A;  2M1C A;  2ZM2 A;  5CTM A;  4DMZ A;  2H0Y A;  5FQ9 A;  1KDS A;  3GVB A;  3LO7 A;  3BW6 A;  5J3W A;  3QP6 A;  3VV4 A;  2V8C A;  5EV0 A; 
#chains in the Genus database with same CATH homology
 3I7J A;  5GLC A;  4MBF A;  1NY0 A;  4WZ5 C;  3DWZ A;  4R0Q A;  2Y2N A;  1BT5 A;  3SH8 A;  4B4Z A;  1NYY A;  1S6R A;  1EWZ A;  1I2S A;  1BLS A;  1W7F A;  2XDM A;  5DTT A;  4Z9Q A;  3VOY A;  3TSG A;  2XFS A;  5CTN A;  4S2N C;  5GL9 A;  1MWU A;  5EVI B;  3WS1 A;  3BEB A;  1YM1 A;  5DTS A;  1TDL A;  3RJU A;  4E3J A;  2EX6 A;  3UE1 A;  2G2U A;  4RA7 A;  1BZA A;  4OOM A;  2XQZ A;  4F94 A;  4KEN B;  5TGF A;  1FOF A;  1E3U A;  2XLN A;  2ZLY A;  3O88 A;  1PYY A;  1MPL A;  4B88 A;  5F1F A;  1VM1 A;  1K25 A;  5TR7 A;  2QZ6 A;  3ZVT A;  4JF5 A;  1KE4 A;  4QY5 A;  5CHU A;  5EPH A;  4X55 A;  3WS0 A;  3PBN A;  4WEL A;  1IYQ A;  3ZG8 B;  3A3J A;  3BFE A;  4KQO A;  1PI5 A;  3V39 A;  3QNC A;  5HAP A;  1YLT A;  1JWP A;  1K57 A;  3OPH A;  4E3O A;  3PAE A;  3VFH A;  4BD0 A;  2X01 A;  3NIA A;  4HEF A;  3MKE A;  1ALQ A;  5E2G A;  5JYO A;  1HVB A;  1PW8 A;  2HP6 A;  4GNU A;  1MY8 A;  3Q7V B;  2P74 A;  4JF6 A;  4QD4 A;  3IWI A;  1ERQ A;  2HP5 A;  4OP8 A;  5KSC A;  4WZ4 A;  2P9V A;  2WGI A;  5GHX A;  1ERO A;  4P85 A;  2Q9M A;  4JLF A;  5KZH A;  5M19 A;  2IWC A;  3O86 A;  2XFT A;  1YQS A;  1M40 A;  1E25 A;  3W4O A;  5L2F A;  2H10 A;  4N92 A;  4JPM A;  4KZ8 A;  4X56 A;  2ZC4 B;  4LCM A;  1CEF A;  3M2J A;  1SHV A;  3N8S A;  3Q7V A;  1CK3 A;  4QJG A;  1RCJ A;  3ZFZ A;  3MXR A;  4NET A;  4DXB A;  4FCF A;  3NY4 A;  1E4D A;  2ZQD A;  4KZ9 A;  3IT9 A;  3ITB A;  3WRZ A;  3RXW A;  3UN7 A;  1ESU A;  4YFM A;  4BL3 A;  2Y55 A;  4WEK A;  1KVM A;  5E2F A;  4R4S A;  5FAO A;  2HDS A;  1XGJ A;  2Y59 A;  3ZNT A;  4X68 A;  1H5X A;  2Y2J A;  3SS4 A;  4KZB A;  4PMA A;  3ZDJ A;  1XKZ A;  5AQB A;  2FFY A;  3IXG A;  4BL2 A;  1FSY A;  3IXD A;  5EVL A;  5CRF A;  2G2W A;  4UHU A;  5GHY A;  3VFF A;  3Q07 A;  3ZNY A;  4EUZ A;  3LEZ A;  2XD1 A;  1HD8 A;  2ZMA A;  3HLW A;  4R23 A;  4BLM A;  2CC1 A;  4GDN A;  2VGJ A;  3WS5 A;  1JTG A;  2ZJ9 A;  4LEN A;  2WGW B;  1K4F A;  4IBR A;  1K57 C;  2I72 A;  4WM9 A;  3UO9 A;  1XP4 A;  1NRF A;  3S4X A;  1LLB A;  2JC7 A;  3A3E A;  5E2H A;  4X69 A;  3LCE A;  1Q2Q A;  4IVK A;  3HUO A;  5TFQ A;  1VQQ A;  4KQQ A;  1WYC A;  3G4P A;  3QNB A;  4CJN A;  4EBP A;  1IYO A;  4Q8I A;  3VP0 A;  4HBT A;  2EXB A;  3OPL A;  1YT4 A;  5AQ7 A;  4KZ7 A;  2ZQ8 A;  2WGW A;  3NCK A;  4DXC A;  1S0W A;  1G68 A;  5HAQ A;  4L0L A;  3PBO A;  3ZG7 B;  4K91 A;  3S1Y A;  2V2F F;  4GZB A;  5DVA A;  1CI9 A;  2HPB A;  4EV4 A;  4LV1 A;  4DDS A;  3NC8 A;  1IKG A;  3E2K A;  4QHC A;  4KG6 A;  3C4O A;  3M6B A;  1PWC A;  2ZC3 B;  3VMA A;  2GDN A;  2JCH A;  4CPK A;  5A90 A;  3G32 A;  2H0T A;  5IHV A;  1J9M A;  5AQ9 A;  3G35 A;  1E3U D;  5A91 A;  5M18 A;  4OQH A;  1RP5 A;  4ZJ2 A;  3GQZ A;  4PM8 A;  4KZ6 A;  5EVI D;  5FQM A;  4KQR A;  2X71 A;  4OQI A;  4A5R A;  3G34 A;  3HLD A;  3BLM A;  1K54 A;  4KG5 A;  2B5R A;  2HDQ A;  3GV9 A;  4WBG A;  3MZE A;  4DKI A;  5FI7 A;  4LV0 A;  3IWO A;  1FQG A;  3RXX A;  4E6W A;  1K6S A;  2WGV A;  2WZX A;  4XUZ A;  5HFO A;  1ES4 A;  1LI9 A;  3UDI A;  3V5M A;  2WAD A;  2DRW A;  1NZU A;  4Y0U A;  3ZG0 A;  4LCL A;  3OCN A;  5HL1 A;  1I5Q A;  4OPR A;  3Q1F A;  1CEG A;  1W8Y A;  1H8Y A;  3NI9 A;  4KG2 A;  1K6R A;  2VGK A;  4RVA A;  5EEC A;  5FDH A;  4BD1 A;  5EUA A;  1IEL A;  3HL9 A;  4U3T A;  4GN2 A;  2ZM8 A;  3BRM A;  3G2Z A;  1BSG A;  5CER A;  4MBH A;  5KSH A;  4E3M A;  4WYY A;  3EQU A;  5EVI A;  2XR0 A;  3VSK A;  1XX2 A;  2ZC7 A;  1ONH A;  2R9X A;  2XH9 A;  4BEN A;  3G31 A;  5FAT A;  4R1G A;  3GTC A;  2ZM0 A;  3UE0 A;  1MXO A;  3NBL A;  2WAF A;  4XXR A;  1YLP A;  3SS5 A;  4DE2 A;  5A92 A;  3GR2 A;  3C4P A;  1ONG A;  3BFF A;  3IF6 B;  1HZO A;  3N8R A;  3V3S A;  4N1X A;  1MWT A;  3BYD A;  3BM6 A;  1BLP A;  3PBQ A;  1IEM A;  2HP9 A;  4LV3 A;  5FQQ A;  1ES5 A;  3MZF A;  3IHB A;  2XF3 A;  5CHM A;  3IXB A;  1Q2P A;  4UA9 A;  5FI6 A;  4DE3 A;  1NXY A;  3IF6 A;  3G2Y A;  1I2W A;  2ZQ7 A;  4S2P A;  1W5D A;  1KVL A;  4FH2 A;  2ZQC A;  3S22 A;  1IYS A;  5DF7 A;  3HBR A;  1LHY A;  3IWQ A;  4PM7 A;  3GRJ A;  1DJC A;  2ZQA A;  3AGE A;  4JXS A;  4PM9 A;  3OC2 A;  4KZ5 A;  1CI8 A;  1MWR A;  3AGD A;  5CGW A;  5AQA A;  2ZC5 B;  3HLF A;  3MBZ A;  1OME A;  3A3D A;  1ZKJ A;  3PBS A;  1MKI A;  1SDE A;  5FI2 A;  2RCX A;  4S2I A;  3O3V A;  4OQG A;  1ES2 A;  1MWS A;  1RGY A;  1PW1 A;  4ZDX A;  3UPN A;  1YLY A;  1Y54 A;  3Q82 A;  2EFU A;  2JE5 A;  3ZCZ A;  1K55 A;  5F1G A;  3A3F A;  2OSU A;  1PIO A;  3UDX A;  4C75 A;  4PPR A;  1FR6 A;  5EVI C;  4EQI A;  3CMZ A;  3BFC A;  1LL5 A;  5GLD A;  1MBL A;  2WYX A;  3Q7Z A;  4ID4 A;  3UPP A;  4DF6 A;  2JBF A;  4PM5 A;  4GDB A;  3VSL A;  4OKP A;  2Y2H A;  4RX2 A;  3UY6 A;  1ESI A;  2V1Z A;  3Q81 A;  4UAA A;  4C3Q A;  1W79 A;  1ZC2 A;  3D4F A;  2A49 A;  3E2L A;  3WWX A;  3P09 A;  4DDY A;  4S2L A;  5M1A A;  2J9P A;  3IH9 A;  1G6A A;  3DTM A;  1TEM A;  5EE8 A;  1KGF A;  1YLZ A;  1GHM A;  2A3U A;  2UWX A;  4OP5 A;  4P6B A;  2C6W B;  4JXW A;  1N4O A;  3IH8 A;  1JTD A;  3PAG A;  2EFX A;  4P0M A;  4K0X A;  4S2N A;  3N8L A;  3CZD A;  1K56 D;  1LL9 A;  1O7E A;  2J7V A;  4M3K A;  5FA7 A;  5BOH A;  2WZZ A;  5DTK A;  4MLL A;  2J8Y A;  3C5A A;  1ERM A;  3M6H A;  3SH7 A;  2FFF B;  4D2O A;  4XUX A;  5DF9 A;  1AXB A;  4R3J A;  5CEC A;  1K4E A;  3C7V A;  2J9O A;  2OV5 A;  5CHJ A;  4FSF A;  1ZG4 A;  5CEB A;  3LY3 A;  1N9B A;  3NDE A;  1XPB A;  4IBX A;  4IED A;  1KE3 A;  4N9L A;  4O7D A;  4ZTK A;  4OVD A;  3OPR A;  1FSW A;  5FAQ A;  2R9W A;  1GCE A;  5HAI A;  1FCM A;  4RX3 A;  4GOG A;  4OLD A;  1FCN A;  1TVF A;  4BJP A;  3AGF A;  1GHP A;  3MFD A;  3FKV A;  1NYM A;  2C5W B;  4ZJ1 A;  1K56 A;  3TOI A;  2WK0 A;  4RYE A;  1ZG6 A;  1DY6 A;  3B3X A;  3UPO A;  3ZGA B;  1L0D A;  2DNS A;  3SH9 A;  2XEP A;  1DJB A;  3FKW A;  5E2E A;  4EBL A;  1YMX A;  3W8K A;  5CGS A;  3VP1 A;  1LI0 A;  1PWG A;  4E3N A;  3N4I A;  1KGE A;  2Y2O A;  5J8X A;  1QMF A;  3C7U A;  1Z6F A;  2BG1 A;  1W8Q A;  4MNR A;  3SOI A;  4IVI A;  2ZQ9 A;  4FD8 A;  4OOY A;  4Y7P A;  2Y2G A;  3ZHH A;  3ZVW A;  4OPZ A;  4S2J A;  3BFD A;  3WS4 A;  5DF8 A;  2IWB A;  4C6Y A;  5JYP A;  1BUL A;  1BLH A;  1BUE A;  4ZAM A;  1JWV A;  1EI5 A;  1DJA A;  3V3R A;  1ES3 A;  4JKT A;  1TDG A;  5KMW A;  4QU3 A;  3UE3 A;  3MKF A;  4OPY A;  2PBY A;  5FSR A;  3IF5 A;  3QHY A;  3ITA A;  1BLC A;  4NK3 A;  1HTZ A;  1JWZ A;  4QY6 A;  1FR1 A;  1NJ4 A;  1IYP A;  1PZP A;  3N7W A;  4OOL A;  3NDG A;  3OCL A;  1M6K A;  3M2K A;  5I94 A;  2Y91 A;  2P9V B;  3CJM A;  3LY4 A;  4EWF A;  5CED A;  5GHZ A;  1PI4 A;  4UA6 A;  3V50 A;  1NZO A;  1K54 C;  4KZA A;  5FQJ A;  4OH0 A;  4MEZ A;  3HVF A;  4R3B A;  3P98 A;  1KE0 A;  2Y2M A;  4H8R A;  4B4X A;  1BTL A;  1WYB A;  3VP3 A;  3IQA A;  3HUM A;  4OLG A;  3VOZ A;  4Y0O A;  2HDU A;  4ZJ3 A;  2WKI A;  3JYI A;  1C3B A;  1GHI A;  4S2K A;  4KZ4 A;  4EBN A;  4JXG A;  4U0T A;  4QB8 A;  2XGN A;  1WE4 A;  3CG5 A;  1JVJ A;  2IWD A;  4OON A;  1XXM A;  4K0W A;  4JBF A;  1YLJ A;  5HAR A;  3O87 A;  5EOE A;  4PM6 A;  1FCO A;  4WEJ A;  2WKE A;  4DRT A;  3FYZ A;  3G30 A;  4Y0T A;  2Y2L A;  1XA7 A;  2QPN A;  1L2S A;  3N6I A;  2Y2K A;  1RGZ A;  3FV7 A;  4UA7 A;  2PU2 A;  2EX9 A;  2OLU A;  4JXV A;  2XD5 A;  4R4R A;  4BQM A;  4X6T A;  1KGG A;  1SDN A;  4GD8 A;  3PBR A;  1GA0 A;  5A93 A;  3A3I A;  5FAS A;  4OQ0 A;  3PBT A;  2E8I A;  4GKU A;  2Z2M B;  3GMW A;  5D3O A;  2BLS A;  5E43 A;  2Y2I A;  4WZ5 A;  1XA1 A;  3HRE A;  1K38 A;  1U60 A;  3MXS A;  3ZG9 B;  3WRT A;  4WMC D;  3SS3 A;  3TG9 A;  2WAE A;  5FAP A;  1PZO A;  4E3L A;  2WKH A;  4P87 A;  3BFG A;  1GA9 A;  1KDW A;  3HLB A;  3UNW A;  2OLV A;  2PU4 A;  4E3K A;  3MZD A;  5CXW A;  1YMS A;  4HBU A;  3DWK A;  3IHA A;  1SCW A;  3IF6 C;  1L0G A;  3OZH A;  4U0X A;  2RL3 A;  3HLE A;  3PTE A;  4S2O A;  5FQI A;  3VP2 A;  5GLA A;  4X53 A;  2V20 A;  3ISG A;  1PWD A;  4MBK A;  1H8Z A;  2ZC6 B;  3VP4 A;  4N9K A;  2Z2L B;  1L0F A;  4JF4 A;  2DCF A;  4KZ3 A;  2WUQ A;  3BEC A;  3BLS A;  3GSG A;  3EQV A;  4FH4 A;  4GB7 A;  4N1H A;  1XGI A;  3DW0 A;  3OPP A;  5CGX A;  4GD6 A;  3ZG5 A;  1L0E A;  2EX8 A;  1IKI A;  4WMC A;  5HW3 A;  4OPQ A;  5F82 A;  3FZC A;  2H5S A;  4S2M A;  4E3I A;  2ZD8 A;  5GLB A;  5HX9 A;  3HLG A;  1K55 C;  5EOO A;  2EXA A;  2Y2Q A;  5G18 A;  5FQK A;  4E6X A;  2ZM2 A;  1O07 A;  3HLC A;  5CTM A;  3W4P A;  2HDR A;  3W4Q A;  4DE1 A;  2QMI A;  2H0Y A;  2Y4A A;  5FQ9 A;  1KDS A;  4YIN A;  2EX2 A;  3UDF A;  3WS2 A;  3GVB A;  5F83 A;  2XK1 A;  1QME A;  3FWL A;  3IXH A;  3LO7 A;  4ZBE A;  1YLW A;  4DE0 A;  4HES A;  2Q9N A;  5U47 A;  4LV2 A;  2X02 A;  3HUN A;  1SKF A;  2Y2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...