1LI9A

Crystal structure of tem-34 beta-lactamase at 1.5 angstrom
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMVSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural bases of antibiotic resistance in the clinically derived mutant beta-lactamases TEM-30, TEM-32, and TEM-34.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Class A beta-Lactamase- TEM-34
total genus 95
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1li9A00
4KQOA 1Y54A 4ZTKA 4D2OA 3Q82A 2X71A 5EECA 4PMAA 3WS1A 4HBTA 4WZ5A 2Y2LA 3RJUA 5EPHA 5HAQA 3BLMA 3IH8A 3N8RA 5FQQA 3S4XA 1W7FA 4DXBA 1K54C 3GV9A 3LO7A 1OMEA 5CTNA 5FI6A 1DJAA 1BZAA 1ZC2A 1PYYA 1GHMA 1ES5A 4L0LA 4XUZA 3VP3A 4R4RA 2XH9A 4X68A 2Y91A 1QMFA 2PU2A 1VM1A 3N7WA 4QD4A 1K56A 1YLTA 5J8XA 5HW3A 5CHMA 3WWXA 2HPBA 3M6HA 5FASA 3V5MA 4E3LA 1YQSA 3A3EA 3TSGA 2H5SA 4KZAA 3EQUA 5DTSA 4BLMA 2Y59A 5CGXA 2XDMA 3FV7A 1KE4A 2X02A 3FZCA 1IKGA 4RX2A 4ZBEA 5U47A 4E3NA 4EV4A 4R4SA 4OPRA 5G18A 2ZC6B 3M2KA 3PBSA 4KZ5A 3ZVTA 1XKZA 5HFOA 4PM6A 1PZPA 4PM5A 1BSGA 1SKFA 4R1GA 1FQGA 2IWDA 3IWIA 4WYYA 5HAIA 4QHCA 2WYXA 4ID4A 4MLLA 2Y2MA 1LI9A 3IHAA 4E3MA 1PZOA 2HDUA 1N4OA 2WKEA 1YLYA 4MNRA 1BLHA 2V20A 4DE3A 3SH7A 3MKEA 2WUQA 3UDFA 3G2YA 2FFYA 3IT9A 4UA9A 1K54A 4XUXA 1K38A 3UPNA 4OOYA 1BLPA 2XFTA 4OP5A 5KZHA 1J9MA 2Y2GA 1VQQA 4Y0TA 4KZ9A 3G34A 3HVFA 3PAGA 1ZG6A 2WK0A 4OLDA 3VOZA 4IBXA 1NYMA 4KZ4A 4ZJ3A 3WS4A 2A49A 4KZ7A 5CEBA 5CXWA 2QZ6A 3BM6A 1RGYA 4P0MA 4PM9A 4QY6A 1XGJA 5KSCA 3DTMA 1GA9A 4GD8A 4S2NA 4F94A 1KGEA 2Y55A 1EI5A 3BECA 5FQMA 1L2SA 1XA7A 2VGKA 3BYDA 3G2ZA 1RGZA 5E2HA 5A91A 2JCHA 4FH4A 2XF3A 1BTLA 4WMCD 2HP5A 3ZG5A 4EQIA 1AXBA 3DWKA 1GHIA 3MKFA 2ZQ9A 5GHYA 1IELA 3W8KA 5L2FA 2V2FF 4A5RA 1E25A 4N1HA 2Y2PA 1K6RA 2ZM8A 3FKVA 4U3TA 3QNCA 3MZEA 1SDNA 3OZHA 3E2LA 3UPPA 3WRTA 3G35A 1SDEA 3GRJA 4WBGA 2ZD8A 2XK1A 4K0WA 4OQ0A 3LCEA 4OVDA 4OPZA 1ES4A 2R9XA 3HLDA 2ZLYA 5EOOA 1KE3A 4DE1A 3EQVA 2Q9MA 3QNBA 4R3BA 1HVBA 5DTTA 3RXWA 3OCLA 3OPRA 5AQAA 4O7DA 5DVAA 1JTDA 2BLSA 3A3JA 3BLSA 5AQ7A 2Y2JA 3SOIA 3ZG8B 1M40A 1ONGA 1W79A 1TDGA 2ZC5B 4X53A 4DRTA 3IWQA 2WKHA 3OPHA 5D3OA 2WGWA 3ZVWA 2J9OA 3TG9A 1FOFA 1JTGA 5I94A 4JXSA 4JF4A 3SS3A 3MBZA 1ERMA 3VSKA 4E3KA 5M18A 4KENB 3Q81A 3HLCA 3W4OA 3G4PA 1YMSA 5EVIA 3MXRA 1BUEA 2Z2LB 3VSLA 5CTMA 1JVJA 3E2KA 5BOHA 5JYPA 1CK3A 2WAFA 4CPKA 2WZXA 5E2FA 3IWOA 3VP0A 1K4EA 5A93A 1H8YA 4GNUA 4MBFA 4LENA 1MPLA 4BD1A 2X01A 1CI8A 4LV3A 4OONA 2ZQAA 1GHPA 1IYSA 1IEMA 2G2WA 3IXBA 2WGVA 3Q7ZA 4LCMA 3N4IA 4Y0OA 3AGEA 2P74A 1DJBA 3FYZA 3ITBA 3VOYA 2J8YA 4BJPA 3ITAA 1YT4A 2RL3A 2HP9A 1K57C 5CHJA 4Y7PA 3AGDA 1CEGA 1U60A 1EROA 3C4PA 3PBRA 2WAEA 4RA7A 5GL9A 1PW8A 3IH9A 1L0GA 1KVMA 4JXGA 2EXAA 2C5WB 3UE0A 4BD0A 4DE0A 4P87A 1EWZA 4HEFA 1WYCA 4N9LA 1LL5A 3O86A 1NJ4A 4LV2A 4C75A 1KGGA 4WEKA 3UDXA 2EFUA 3CMZA 4MBHA 1G6AA 2ZC7A 3OCNA 1MWSA 1IYPA 3VFHA 4ZDXA 2H0TA 3FKWA 4E3OA 4X55A 3ZFZA 1ESUA 5F1FA 4EBLA 4B88A 5EVIC 1K6SA 2EX2A 4LV1A 3O87A 4OOMA 5HL1A 4KZ3A 1LL9A 2QPNA 4OP8A 3ZCZA 3V39A 1KDSA 1IKIA 1ZG4A 3CZDA 4S2LA 4JBFA 4IVKA 4LV0A 4DDYA 1PWGA 5EOEA 4PPRA 4GKUA 4S2PA 1BULA 1E4DA 1ALQA 1NRFA 2H10A 4FCFA 4UA7A 1W8YA 1BT5A 5DF7A 4RYEA 4E6XA 5FAQA 4S2JA 2EFXA 5HARA 1MWTA 5F82A 4OQIA 1E3UD 1JWZA 3IXGA 1WYBA 4JF5A 2P9VB 4X56A 2RCXA 3V50A 3ZDJA 3HREA 4E6WA 3UDIA 1TVFA 3I7JA 4PM8A 4JLFA 4Q8IA 3SS4A 3UY6A 3NI9A 1HTZA 2IWCA 3BFCA 1YM1A 4GOGA 3OC2A 4WEJA 1FR6A 4R3JA 3CJMA 3ZNTA 2WGWB 3VP1A 5F1GA 3DWZA 1I2SA 3HUNA 2WKIA 1ESIA 3PBQA 5CGWA 2FFFB 2XEPA 3MZFA 2JE5A 4P85A 4JPMA 2HDRA 1H5XA 3SH9A 5A90A 1ES3A 3QHYA 1Q2PA 4EBNA 1DY6A 1JWVA 2PBYA 4ZAMA 4WELA 5KSHA 3G30A 1MBLA 5GHZA 3N6IA 1FCOA 1LI0A 1NZOA 2E8IA 1S6RA 3BEBA 4S2MA 4C3QA 1PWDA 4H8RA 3MFDA 3UO9A 1LLBA 3C5AA 3NIAA 4XXRA 1FR1A 4U0XA 1JWPA 4BL3A 1GA0A 4YINA 5DF9A 3HLGA 4WM9A 3VFFA 1K25A 4N9KA 4QY5A 2OSUA 2XR0A 2QMIA 3Q7VB 5CHUA 3ZHHA 1CI9A 4C6YA 5EE8A 4S2OA 4K0XA 3ZG0A 3IF6A 3ZNYA 3IF5A 4N1XA 3GSGA 3WS5A 4BQMA 5CRFA 3LEZA 1H8ZA 5DTKA 2G2UA 4X6TA 1NZUA 3BFDA 2JBFA 3BFFA 2UWXA 4JF6A 4S2NC 5TGFA 2Y2NA 5E43A 3N8SA 1TDLA 1NY0A 1E3UA 4KZ6A 3IHBA 4UHUA 5FATA 2BG1A 3GR2A 3GVBA 1ERQA 1YLPA 1XX2A 4Z9QA 5HAPA 1HZOA 5EUAA 4EWFA 4FSFA 4IBRA 3HLFA 3P98A 5F83A 1N9BA 3A3DA 1NYYA 5FSRA 4KQRA 2J9PA 1K55C 1O07A 2C6WB 2OLVA 3UNWA 3W4PA 3A3FA 4QJGA 2Y2IA 4DXCA 3NDGA 3OPLA 2ZM2A 1IYQA 4K91A 4U0TA 1K56D 4CJNA 4S2KA 3O88A 4ZJ2A 2Y2QA 4X69A 3O3VA 5CERA 3Q1FA 3ZGAB 5GLAA 3MXSA 2Y2OA 3Q07A 1Q2QA 3HUOA 1ES2A 1FSWA 3JYIA 2EX6A 1CEFA 2WGIA 3IXDA 4M3KA 2ZQCA 4OKPA 4OH0A 3VMAA 1FSYA 2H0YA 4JXWA 1PIOA 1I5QA 4GDBA 4GN2A 5FI2A 2J7VA 3M2JA 4NK3A 2Q9NA 2VGJA 4GDNA 1MY8A 4MEZA 1ONHA 5FQJA 2P9VA 2XLNA 2ZM0A 3W4QA 4GD6A 3LY3A 1L0FA 3N8LA 1SHVA 3SH8A 5TR7A 4FD8A 3C4OA 3PBNA 4EUZA 1W5DA 4MBKA 3V3RA 4PM7A 1FCNA 2R9WA 1M6KA 4DF6A 1RP5A 2Y2HA 1K4FA 3HLBA 4ZJ1A 3GQZA 3PAEA 1GCEA 4WZ4A 5EVLA 3HUMA 4R23A 2EXBA 3D4FA 4R0QA 4DE2A 3IQAA 3VP2A 3GTCA 3PBOA 1MKIA 4RVAA 3PTEA 4KZBA 5FDHA 2XFSA 4KG6A 4BL2A 3HL9A 1L0DA 2A3UA 5AQ9A 2HDQA 1BLCA 4S2IA 5GLCA 3NCKA 5M1AA 1K57A 1O7EA 2V1ZA 5FQKA 2WADA 4UAAA 1YLWA 3WS0A 1KE0A 4B4XA 5FAOA 5GLDA 1PW1A 3AGFA 1XGIA 4OLGA 2ZC4B 3CG5A 3NC8A 4HESA 5GLBA 5CECA 5E2GA 2ZQ7A 1YMXA 1PWCA 3BRMA 4WZ5C 5GHXA 3UE3A 2CC1A 3ISGA 2OLUA 3UN7A 5FQIA 1W8QA 3B3XA 4BENA 1HD8A 4OPYA 4JXVA 2Y4AA 4N92A 3P09A 5M19A 4KZ8A 5CGSA 3V3SA 4Y0UA 3GMWA 4OQGA 4GZBA 1BLSA 4HBUA 5CEDA 5FQ9A 4GB7A 1K55A 3MZDA 1G68A 1IYOA 4OQHA 3UE1A 2XGNA 3A3IA 5E2EA 3ZG9B 1FCMA 4KQQA 3IF6C 1MWRA 2B5RA 1KDWA 2JC7A 5FI7A 3HLEA 4RX3A 3HBRA 4OOLA 1I2WA 5FAPA 5IHVA 1QMEA 1KVLA 2Y2KA 1L0EA 5FA7A 5KMWA 3C7UA 4IVIA 3IXHA 3BFEA 4DKIA 2ZMAA 1RCJA 4NETA 1XPBA 3DW0A 2DCFA 1SCWA 1ZKJA 4P6BA 4E3IA 1WE4A 1NXYA 3TOIA 1MWUA 4YFMA 4KG5A 3BFGA 1KGFA 4WMCA 5DF8A 3SS5A 2ZQ8A 4E3JA 1XP4A 2I72A 2HDSA 2ZQDA 2XD1A 4OPQA 5HX9A 3ZG7B 5JYOA 4DDSA 4B4ZA 1C3BA 4FH2A 1MXOA 3RXXA 5EVIB 1S0WA 3WRZA 3FWLA 1PI4A 2ZC3B 4LCLA 1TEMA 3G32A 3S1YA 3WS2A 2XQZA 2ZJ9A 5AQBA 3M6BA 1XXMA 2WZZA 2IWBA 3HLWA 4QB8A 3S22A 3NBLA 1YLZA 3LY4A 4JKTA 2XD5A 2HP6A 2Z2MB 3C7VA 4UA6A 2EX9A 4EBPA 4IEDA 2EX8A 4QU3A 2DNSA 1XA1A 3OPPA 1DJCA 3NDEA 1YLJA 3UPOA 5EVID 3IF6B 3PBTA 1LHYA 3Q7VA 1PI5A 1Z6FA 3G31A 2PU4A 5TFQA 5A92A 3NY4A 2GDNA 3VP4A 2OV5A 4KG2A 2DRWA
chains in the Genus database with same CATH superfamily
1OJ5A 3F1OB 1Y54A 4ZTKA 1VHMA 2X71A 4R6LA 4DXBA 3S7PA 1OMEA 4LPZA 1PYYA 4L0LA 2P08A 4XUZA 4YNRA 4Z1WA 4Y17A 5HW3A 3WWXA 2HPBA 3M6HA 3HJIA 1SZVA 1YQSA 3NHQA 2H5SA 1P97A 2XDMA 1UWPX 1F5MA 1W63M 3D72A 1MC0A 1XKZA 3W2ZA 4PM6A 1PZPA 4L9GA 3KYQA 1ZHHB 5G4YA 2WYXA 1UGUA 4HP9A 1N4OA 4G3VA 1BLHA 2Z6CA 4DE3A 3KSIA 3MKEA 1CJFA 3UDFA 3EEAA 2W3FA 1K54A 3UPNA 1X0OA 3QP1A 4LFUA 5IS1A 4EUVA 2WK0A 3VOZA 4IBXA 1T1BA 1NYMA 4KZ4A 5EVEA 5KIZA 2MJ6A 3P7NA 4KZ7A 3LR5A 3CLOA 2PYRA 2HF6A 1XGJA 4F94A 2Y55A 1EI5A 5E2HA 4FH4A 2XF3A 2PR5A 2ZL1A 4EQIA 3DWKA 2OAQ1 2ZQ9A 1E25A 1D06A 1K6RA 2ZM8A 3QNCA 1NLZA 3MZEA 1SDEA 2ZD8A 4K0WA 3QP6A 1ES4A 3HLDA 5EOOA 2Q9MA 4R3BA 2PBDP 5IU1A 3RXWA 3OPRA 2PD8A 2Y8HA 4O7DA 5DVAA 2BLSA 4CLCE 2Y2JA 1ONGA 4I38A 4DRTA 2ZC5B 3IWQA 3OPHA 5D3OA 3ZVWA 4JXSA 5J7EA 1S4SA 5M18A 5LBRA 5EVIA 4II7A 2Z2LB 5CTMA 1JVJA 5BOHA 5JYPA 1CK3A 2WAFA 4CPKA 3IWOA 3VP0A 5A93A 1H8YA 2W3GA 4OONA 1GHPA 4Y0OA 3FYZA 4Y15A 2G7UA 2RL3A 5G4ZA 1OT9A 1L0GA 2C5WB 3LIDA 4BD0A 3BQ8A 1XFNA 3UDXA 4MBHA 2ZC7A 1MWSA 4ZDXA 1ESUA 3KYEA 4KUKA 3VOLA 3O87A 2VEAA 4OOMA 4DJ2A 3ZCZA 1XFQA 1ZG4A 4S2LA 5FEGA 4LV0A 4FTXA 1PWGA 5EOEA 3IX3A 4S2PA 3VE4A 1NRFA 1D7EA 1W8YA 5DF7A 1MWTA 4OQIA 1JWZA 4X56A 3ZDJA 2W3DA 1F2KA 5DFXA 4Q8IA 1VEUB 2IWCA 3PYPA 3ZNTA 1FR6A 4R3JA 5F1GA 3F1NA 4EETB 1ESIA 5CGWA 1G28A 2JE5A 4P85A 2HDRA 3SH9A 4GLQA 1DY6A 2PBYA 1S4RA 3BY9A 4WELA 5HWVA 3EGXC 3G30A 1MBLA 5GHZA 1TS7A 3N6IA 1FCOA 3CPTB 1S6RA 4S2MA 3E4OA 3C5AA 3NIAA 3LI9A 2VV6A 4U0XA 2L0WA 2BASA 1JWPA 4BL3A 2WKQA 3HLGA 4N9KA 1S1YA 2QMIA 5CHUA 2JKRM 5EE8A 5FDSA 3WS5A 4BQMA 3LEZA 1H8ZA 4I39A 3BFDA 3QP8A 4S2NC 3N8SA 1E3UA 5HDCA 4EEPA 1HLUP 5DJUA 2ACGA 3GR2A 3GVBA 5HAPA 4FSFA 3HLFA 5F83A 4RQ9A 5FSRA 2JKRI 1K55C 3W4PA 3A3FA 2HJ9C 3T4TA 1S1ZA 4ZJ2A 3PR6A 2VGLS 4NG2A 3Q07A 3HUOA 2QYBA 3JYIA 4HP4A 4NEED 3VMAA 2PR6A 1I5QA 4X1LA 3ULFA 4GDNA 4Y13A 1A0KA 3TRCA 4GD6A 5TR7A 2JKTM 3PBNA 2W1TA 1W5DA 1F98A 1M6KA 2J3WA 1K4FA 3JVVA 2L1MA 4NXGA 5EVLA 4Q0JA 4MCWA 3PBOA 3PTEA 5FDHA 2XFSA 3H82B 4KG6A 4BL2A 3FPWA 3S7OA 2VV7A 2OAP1 5M1AA 1Y4OA 1O7EA 4UAAA 2V9AA 3MS6A 4DN0A 1KE0A 5GLDA 3QP2A 1PW1A 3AGFA 2ZC4B 4HESA 5GLBA 3UE3A 3UN7A 3GDIA 1HD8A 3PHYA 4JXVA 4P6ZS 4KZ8A 2ZBBA 5CGSA 3V3SA 2OOLA 1BLSA 4HBUA 4CLCD 3TW8A 1K55A 3MZDA 4ETXA 3UE1A 3ZG9B 4KQQA 1I2WA 2Y2KA 4CLCA 3D3OA 5FA7A 5KMWA 2YKHA 3C7UA 4IVIA 2ZMAA 5DJTA 3IBRA 4KG5A 5EFWA 2ZOHA 1XP4A 2I72A 1C3BA 2ZC3B 2HGVA 2WZZA 2PYPA 4GJ4A 3IS2B 2XD5A 2HP6A 4EBPA 3BY8A 3NDEA 4KQDA 5EVID 3IF6B 5A92A 1CF0A 2DRWA 1YAXA 1ACFA 4I3JA 4PMAA 4HBTA 3RJUA 5HAQA 5FQQA 5FI6A 5CTNA 5HZHA 3H7WB 1ZC2A 4K08A 3VP3A 2XH9A 4X68A 2ZMVA 1K56A 2W1RA 3TSGA 3EQUA 4BLMA 2O9CA 4L9FA 3FV7A 4R4SA 3E0YA 3M2KA 4KZ5A 3LGOA 4PM5A 3LUQA 1FQGA 5HAIA 4ID4A 3LI8A 4MLLA 1LI9A 3IHAA 3UB5P 1YLYA 2V20A 2KLIA 1VETA 4GCZA 3G2YA 2FFYA 4UA9A 4UQIS 5HDSA 4OP5A 5K5BA 5AVEA 1J9MA 2Y2GA 4WL9A 5EM1A 1VQQA 1ZG6A 2GZAA 3WS4A 5CEBA 3MMHA 5CXWA 2GX5A 1RGYA 4PM9A 2W27A 4GS9B 3LFVA 3O5YA 4S2NA 4GD8A 3BECA 3G2ZA 3BYDA 3RH8B 4YWZA 3KYZA 2HP5A 3ZG5A 3CITA 1AXBA 5DKLA 1GHIA 3MKFA 5GHYA 2V2FF 4A5RA 2Y2PA 2QJ5A 1SKOB 3LIBA 3WRTA 1OPXA 4OPZA 2R9XA 4PKYG 2W0NA 2ZLYA 3EQVA 3K2NA 3OCLA 1JTDA 4CLCB 2P04A 3DTKA 3SOIA 5HDDA 3ZG8B 1CQAA 1TDGA 4X53A 2WGWA 1S66L 5I94A 3SS3A 1GSXA 4E3KA 1ERMA 4EU0A 3E98A 3G4PA 1YMSA 3MXRA 1BUEA 3QP4A 4HY8A 2PT7A 1XJ2A 1K4EA 3KSGA 5C5KA 4MBFA 3T4SA 3Q7ZA 2WGVA 4LCMA 3VOYA 5CHJA 4Y7PA 4EESA 5GL9A 1PW8A 1KVMA 4WN5A 4DE0A 4P87A 3CWFA 4HEFA 1WYCA 2W3HA 4C75A 1KGGA 1LL8A 1LSVA 3CMZA 3LYXA 4HNBA 3VFHA 4P6ZM 4E3OA 3ZFZA 4B88A 5IT5A 3MF0A 1LL9A 2QPNA 1KDSA 3CZDA 4IVKA 4DDYA 4GKUA 1ALQA 4ZRRA 2J3TD 4S2JA 2EFXA 5F82A 2VV8A 4JGRA 2XRNA 4JF5A 1LSXA 2XSSA 3HREA 4PM8A 4JLFA 3EGDC 3UY6A 1HTZA 3K3CA 4GOGA 4WEJA 3OC2A 4PHTA 3UB6A 1GSWA 3HUNA 3V67A 4B93A 3F1NB 3PBQA 2XEPA 1P0ZA 3MZFA 1T19A 4JPMA 1H5XA 3QHYA 2OWHA 4AFIA 2WKRA 3MQQA 2E8IA 4C3QA 1PWDA 3UO9A 3T4JA 2JN7A 2VGLM 4LRZE 4XXRA 4HHDA 1S67L 2ZL1B 3VFFA 5EM0A 2XR0A 3GSGA 2K7SA 4BBVA 5CRFA 5DTKA 4X6TA 1NZUA 4HJ3A 1TDLA 4KZ6A 3MR0A 4I5SA 3DAVA 1ERQA 1YLPA 1XX2A 1PRQA 4Z9QA 2YKFA 5HD5A 3RTYA 5EUAA 2JKTI 3A3DA 3LEQA 1NYYA 1O07A 2OLVA 3KSHA 4QJGA 2Y2IA 4DXCA 5TJJA 1DP9A 1IYQA 3P01A 5EV0A 4S2KA 3HCYA 5GLAA 3PXPA 4EERA 1FSWA 2WGIA 2ZQCA 4BWIA 1FSYA 2CMNA 2H0YA 4GDBA 3M2JA 2VGJA 1MY8A 1ONHA 4BBTA 5FQJA 2P9VA 4H6JA 3W4QA 3UMEA 3T1XA 3D9YA 5AVFA 4UQIM 3SH8A 4FD8A 4IHQA 1Y28A 2R9WA 4ARZB 1IFQA 3EEHA 3PAEA 2NUPC 4WZ4A 4R0QA 4DE2A 1FIKA 1MKIA 4RVAA 4KZBA 1K0KA 2HDQA 5GLCA 3NCKA 4LRYC 3WS0A 1W63Q 1V9ZA 5CECA 3OOVA 4EXOA 5E2GA 5GHXA 3BRMA 5HSQA 2DMWA 2CC1A 3IX8A 4BENA 4OPYA 4N92A 2Y4AA 3P09A 4Y0UA 1XJ6A 5FQ9A 4GB7A 3ICYA 1OTBA 2XGNA 2D01A 3IF6C 5CX7A 2B5RA 3HLEA 4RX3A 2QHKA 1ODVA 4DKIA 2GJ3A 1RCJA 5HPIA 4P6BA 1PNEA 1WE4A 1NXYA 4E3IA 3CUEC 3DBAA 3T50A 2VJWA 4LLOB 4UEYA 2B18A 4YFMA 5DF8A 3SS5A 2ZQ8A 5TBMA 1H8MA 5JYOA 1P9RA 3EOIA 5HX9A 1PFLA 3R7WB 3RXXA 3LIFA 3UB8A 1PI4A 4LCLA 3G32A 3S1YA 4I3IA 4O01A 3WS2A 2ZJ9A 1OT6A 4X1MA 3HLWA 3NBLA 3T4LA 5J4EA 4QWOA 3LY4A 1OTAA 2PD7A 5F6AA 3C7VA 2FZ0A 4B9OA 1XA1A 2VA0A 3OPPA 2FH5A 1DJCA 1YLJA 3PBTA 5TFQA 1PI5A 1Z6FA 2PU4A 2GDNA 4KG2A 4KQOA 5A8BA 4D2OA 2Y2LA 4Y2FA 3BW6A 3T4OA 1K54C 3GV9A 1DJAA 1BZAA 4JGOA 1ES5A 2PAVP 3CAXA 2Y91A 1QMFA 2PU2A 1VM1A 3U4LP 1TS6A 1EW0A 5FASA 3V5MA 2HJEA 2INWA 4BBUA 4PKYA 2PRFA 3A3EA 4RX2A 1KE4A 2X02A 3FZCA 1IKGA 4ZBEA 5U47A 4EV4A 4OPRA 5DFYA 5G18A 2B02A 3ZVTA 4XT2A 1GSVA 3DTEA 1SKFA 5L09A 1YSQA 3IWIA 2H28A 4QHCA 2WKEA 4MNRA 3UB9A 3F1PB 2P7JA 3T1RA 3IT9A 1L3LA 4XUXA 1K38A 5KZHA 1MZUA 1T1CA 3A0RA 4KZ9A 3HVFA 3PAGA 4OLDA 5FEFA 1AWIA 2A49A 2QZ6A 3BM6A 4HH3A 4P0MA 4EW7A 4PAUA 3DTMA 5FQMA 1L2SA 1RGZA 4R3AA 2JCHA 4F3LB 1LSWA 4Y3IA 1T1AA 5I5LA 5L2FA 4HJ6A 4N1HA 4U3TA 2Y79A 1SDNA 3OZHA 3G35A 4WBGA 3LCEA 1KE3A 5DTTA 4DMZA 3A3JA 5AQ7A 1M40A 4HOIA 2VX8A 1F9IA 1STZA 2VZWA 4JF4A 4G3KA 2A24A 2VKSA 3LICA 3MBZA 3Q81A 4ETZA 3HLCA 3W4OA 2EWVA 2W3EA 3VSLA 2QKPA 5F5YA 1H0MA 3CPTA 4IUHA 2WZXA 3NOTC 5E2FA 2KDKA 4BD1A 3CI6A 2X01A 1CI8A 4LV3A 2ZQAA 2GNXA 2G2WA 3E4PA 3EWKA 3IXBA 3N4IA 3AGEA 2P74A 1DJBA 2V8CA 1YT4A 2ZMFA 3AGDA 1CEGA 1U60A 3KX0X 3C4PA 3PBRA 4RA7A 3IH9A 2EXAA 2Z6DA 4GHIA 1EWZA 2OWJA 3KSFA 4FOFA 4N9LA 1XJ4A 3O86A 4LGWA 4WEKA 3BQAA 5F68A 1G6AA 4HH2A 1G5UA 2H0TA 3U2AA 3FKWA 4X55A 4EBLA 5EVIC 3S7NA 2EA9A 5HL1A 4KZ3A 5HWWA 3V39A 1IKIA 4JBFA 4PPRA 1E4DA 2O9AA 2LB9A 4UA7A 1BT5A 3JPUA 1E3UD 3IXGA 3OLOA 2P9VB 3V50A 2RCXA 4Q0IA 3UDIA 2HZ5A 3SS4A 3NI9A 1N9LA 4EEUA 4EQ1A 1VETB 5DKKA 3VP1A 3DWZA 1I2SA 4R70A 2FFFB 2O99A 2XA7S 4HI4A 3FG8A 5A90A 2IA2A 1Q2PA 3C38A 3FC7A 3B47A 1LI0A 1VB6A 3T1SA 1TS0A 4FUWA 1LLBA 1YKDA 4IJGA 1IOUA 4WM9A 4QY5A 1J3WA 2R78A 2D02A 2OSUA 3Q7VB 4F3LA 3UMDA 3ZHHA 3ZG0A 4K0XA 3ZNYA 4N1XA 2JHEA 2V1AA 4CLCC 2JBFA 5TGFA 3IHBA 1LT0A 2M1CA 2BTFP 4IBRA 3P98A 1N9BA 5HWTA 5J3WA 3JVUA 2J9PA 2C6WB 4ME4A 2ZM2A 1K56D 4CJNA 5CERA 3O88A 4X69A 3ZGAB 3O3VA 2Y2OA 1Q2QA 1ES2A 2A24B 3IXDA 4OH0A 3NJAA 4JXWA 3LIEA 5FI2A 2J7VA 4D60A 4NK3A 5HPFA 3KO6A 1V9YA 2XLNA 3N8LA 4EUZA 4MBKA 4PM7A 1RP5A 4ZJ1A 3HLBA 2EWWA 4YOFA 3IQAA 3GTCA 3H82A 1L0DA 1WA9A 2A3UA 4S2IA 1OTEA 1BLCA 3C8CA 1K57A 2HV1A 2V1ZA 2K31A 5AJGA 5FQKA 1YLWA 4B4XA 4NXFA 4OLGA 1XGIA 3CG5A 3NC8A 2V0WA 1YMXA 4WZ5C 4QPRA 3ISGA 5FQIA 3B3XA 2J3TC 1ZTUA 1XJ3A 1NWZA 5F69A 5MC7A 5M19A 4GZBA 4HQAA 1G68A 4OQHA 3A3IA 1FCMA 1MWRA 1KDWA 2JC7A 5FI7A 5FAPA 5IHVA 4DJ3A 3IXHA 3BFEA 3G6OA 2JKGA 2DCFA 1JNUA 2V8FA 5L07A 3MQOA 3TOIA 1MWUA 3BFGA 1KGFA 3MSHA 3K3DA 3MJQA 4E3JA 1N9OA 2HDSA 2XD1A 4DDSA 3C2WA 4FH2A 4HJ4A 1TEMA 5AQBA 3M6BA 1NRJA 1XXMA 1TD5A 2IWBA 2UV0E 1KOUA 3GECA 4GS9A 2A2LA 4JKTA 2I9VA 4UA6A 4IEDA 2EX8A 2DNSA 3QP5A 2KX6A 1LHYA 4MN7A 3B42A 3NY4A 3HJKA 3Q82A 5EECA 3R4KA 3WS1A 4WZ5A 5HD3A 5EPHA 2V0UA 3BLMA 3BWLA 3IH8A 3N8RA 3S4XA 1W7FA 3LO7A 4CQHA 1GHMA 1DP6A 4R4RA 3N7WA 4QD4A 1YLTA 3MQ0A 5J8XA 5CHMA 5HL6A 1D1JA 4IUKA 5FL3A 4E3LA 3T4QA 4KZAA 5DTSA 2Y59A 5CGXA 4E3NA 2NUTC 5L10A 4X25A 3ZQ5A 2ZC6B 3PBSA 5HFOA 3B33A 3L7HA 1BSGA 4R1GA 4XT2B 2PHYA 2IWDA 4WYYA 3C30A 1DRMA 2Y2MA 3SW1A 4E3MA 1PZOA 2XROA 2HDUA 1VEUA 3SH7A 2WUQA 4ARZA 2O9BA 3L9KA 1BLPA 2XFTA 4OOYA 4Y0TA 3G34A 4ZJ3A 2B95A 4QY6A 5KSCA 1GA9A 1KGEA 1OTDA 2VGKA 1XA7A 5A91A 1BTLA 3IX4A 4WMCD 3UB7A 3W8KA 1IELA 3FKVA 4LRXC 3F1OA 3MXQA 3E2LA 3UPPA 3GRJA 4OQ0A 2XK1A 4OVDA 4M4XA 4Y5FA 1FILA 4DE1A 3QNBA 1HVBA 5AQAA 1TF1A 2ZOIA 3BLSA 3ZYTA 1W79A 1YSPA 2WKHA 2M7VA 2J9OA 3TG9A 3CHWP 1FOFA 1JTGA 5TBMB 3VSKA 4KENB 4BMWA 3R7WA 3T1QB 3LR0A 3E2KA 3BJNA 2XA7M 3IS2A 2V1BA 4R38A 1NLYA 3NULA 4GNUA 2JKFA 4LENA 1MPLA 3IBJA 2VK3A 1IYSA 1IEMA 2W1TB 4O0PA 3VV4A 3ITBA 2J8YA 4Q0HA 3ITAA 3MFXA 4BJPA 2HP9A 1K57C 4L9EA 1EROA 2J80A 3FPVA 2WAEA 4JXGA 3UE0A 4JGPA 3LR3A 4GHIB 1LL5A 1NJ4A 4LV2A 2EFUA 2O0YA 4NXBA 3TE8A 3OCNA 1TS8A 1IYPA 2E8JA 2KOIA 5F1FA 1K6SA 2EX2A 4LV1A 4OP8A 4HIAA 3OBFA 4GW9A 1P9WA 1BULA 2M7UA 2H10A 4FCFA 3SZTA 4RYEA 4E6XA 5FAQA 5HARA 4MDZA 1WYBA 4E6WA 4MN6A 2AVXA 1TVFA 3I7JA 3BFCA 1YM1A 3CJMA 3F1PA 3A0SA 2L4RA 2WGWB 2WKIA 1ES3A 4EBNA 4KUOA 1JWVA 4ZAMA 3NOPC 5KSHA 3T4KA 3NECA 1NZOA 3BEBA 1UWNX 4H8RA 2WKPA 3MFDA 2LB5A 1FR1A 1GA0A 4YINA 5DF9A 1K25A 4C6YA 1CI9A 4S2OA 1OJGA 3IF6A 3DTIA 3IF5A 2G2UA 1H3QA 3BFFA 2UWXA 4JF6A 2Y2NA 5E43A 1NY0A 4UHUA 5FATA 2BG1A 3H7WA 1HZOA 4NXEA 4EWFA 1YPRA 4KQRA 3UNWA 3NOUC 3NDGA 3OPLA 4K91A 4U0TA 3RFBA 2Y2QA 3Q1FA 2PDRA 3S7QA 3MXSA 4OKPA 2EX6A 1CEFA 4M3KA 4MMNA 1PIOA 4GN2A 2Q9NA 4MEZA 1Z09A 2ZM0A 3LY3A 1L0FA 4H6JB 1SHVA 3C4OA 3V3RA 1FCNA 4DF6A 2Y2HA 3UE6A 3GQZA 1GCEA 1DP8A 3A0VA 1MKMA 3HUMA 4R23A 2EXBA 3D4FA 3VP2A 3HL9A 3CUEA 5AQ9A 3TJZC 1OTIA 2WADA 4MN5A 4WUJA 5FAOA 4O8GA 3LR4A 2VLGA 2ZQ7A 1PWCA 2OLUA 1W8QA 3GMWA 4OQGA 2QJ7A 4NKPA 5CEDA 1SKOA 1IYOA 5E2EA 4WLAA 1N9NA 4I3AA 3HBRA 4OOLA 1QMEA 1KVLA 1L0EA 4E04A 2K2NA 4NETA 1XPBA 3DW0A 1T18A 1SCWA 1ZKJA 4WMCA 2ZQDA 4OPQA 3ZG7B 4B4ZA 4ESPA 1MXOA 4G3WA 5EVIB 1BYWA 1S0WA 3E4QA 3FWLA 3WRZA 2XQZA 3LIAA 5L8MA 4QB8A 2Q0OA 3S22A 1YLZA 1G6OA 2QWSA 3VE3A 2Z2MB 2EX9A 3T12B 3H9WA 4QU3A 4WF0A 3UPOA 3Q7VA 3G31A 3VP4A 4JGQA 2OV5A
chains in the Genus database with same CATH topology
4KQOA 1Y54A 4ZTKA 4D2OA 3Q82A 2X71A 5EECA 4PMAA 3WS1A 4HBTA 4WZ5A 2Y2LA 3RJUA 5EPHA 5HAQA 3BLMA 3IH8A 3N8RA 5FQQA 3S4XA 1W7FA 4DXBA 1K54C 3GV9A 3LO7A 1OMEA 5CTNA 5FI6A 1DJAA 1BZAA 1ZC2A 1PYYA 1GHMA 1ES5A 4L0LA 4XUZA 3VP3A 4R4RA 2XH9A 4X68A 2Y91A 1QMFA 2PU2A 1VM1A 3N7WA 4QD4A 1K56A 1YLTA 5J8XA 5HW3A 5CHMA 3WWXA 2HPBA 3M6HA 5FASA 3V5MA 4E3LA 1YQSA 3A3EA 3TSGA 2H5SA 4KZAA 3EQUA 5DTSA 4BLMA 2Y59A 5CGXA 2XDMA 3FV7A 1KE4A 2X02A 3FZCA 1IKGA 4RX2A 4ZBEA 5U47A 4E3NA 4EV4A 4R4SA 4OPRA 5G18A 2ZC6B 3M2KA 3PBSA 4KZ5A 3ZVTA 1XKZA 5HFOA 4PM6A 1PZPA 4PM5A 1BSGA 1SKFA 4R1GA 1FQGA 2IWDA 3IWIA 4WYYA 5HAIA 4QHCA 2WYXA 4ID4A 4MLLA 2Y2MA 1LI9A 3IHAA 4E3MA 1PZOA 2HDUA 1N4OA 2WKEA 1YLYA 4MNRA 1BLHA 2V20A 4DE3A 3SH7A 3MKEA 2WUQA 3UDFA 3G2YA 2FFYA 3IT9A 4UA9A 1K54A 4XUXA 1K38A 3UPNA 4OOYA 1BLPA 2XFTA 4OP5A 5KZHA 1J9MA 2Y2GA 1VQQA 4Y0TA 4KZ9A 3G34A 3HVFA 3PAGA 1ZG6A 2WK0A 4OLDA 3VOZA 4IBXA 1NYMA 4KZ4A 4ZJ3A 3WS4A 2A49A 4KZ7A 5CEBA 5CXWA 2QZ6A 3BM6A 1RGYA 4P0MA 4PM9A 4QY6A 1XGJA 5KSCA 3DTMA 1GA9A 4GD8A 4S2NA 4F94A 1KGEA 2Y55A 1EI5A 3BECA 5FQMA 1L2SA 1XA7A 2VGKA 3BYDA 3G2ZA 1RGZA 5E2HA 5A91A 2JCHA 4FH4A 2XF3A 1BTLA 4WMCD 2HP5A 3ZG5A 4EQIA 1AXBA 3DWKA 1GHIA 3MKFA 2ZQ9A 5GHYA 1IELA 3W8KA 5L2FA 2V2FF 4A5RA 1E25A 4N1HA 2Y2PA 1K6RA 2ZM8A 3FKVA 4U3TA 3QNCA 3MZEA 1SDNA 3OZHA 3E2LA 3UPPA 3WRTA 3G35A 1SDEA 3GRJA 4WBGA 2ZD8A 2XK1A 4K0WA 4OQ0A 3LCEA 4OVDA 4OPZA 1ES4A 2R9XA 3HLDA 2ZLYA 5EOOA 1KE3A 4DE1A 3EQVA 2Q9MA 3QNBA 4R3BA 1HVBA 5DTTA 3RXWA 3OCLA 3OPRA 5AQAA 4O7DA 5DVAA 1JTDA 2BLSA 3A3JA 3BLSA 5AQ7A 2Y2JA 3SOIA 3ZG8B 1M40A 1ONGA 1W79A 1TDGA 2ZC5B 4X53A 4DRTA 3IWQA 2WKHA 3OPHA 5D3OA 2WGWA 3ZVWA 2J9OA 3TG9A 1FOFA 1JTGA 5I94A 4JXSA 4JF4A 3SS3A 3MBZA 1ERMA 3VSKA 4E3KA 5M18A 4KENB 3Q81A 3HLCA 3W4OA 3G4PA 1YMSA 5EVIA 3MXRA 1BUEA 2Z2LB 3VSLA 5CTMA 1JVJA 3E2KA 5BOHA 5JYPA 1CK3A 2WAFA 4CPKA 2WZXA 5E2FA 3IWOA 3VP0A 1K4EA 5A93A 1H8YA 4GNUA 4MBFA 4LENA 1MPLA 4BD1A 2X01A 1CI8A 4LV3A 4OONA 2ZQAA 1GHPA 1IYSA 1IEMA 2G2WA 3IXBA 2WGVA 3Q7ZA 4LCMA 3N4IA 4Y0OA 3AGEA 2P74A 1DJBA 3FYZA 3ITBA 3VOYA 2J8YA 4BJPA 3ITAA 1YT4A 2RL3A 2HP9A 1K57C 5CHJA 4Y7PA 3AGDA 1CEGA 1U60A 1EROA 3C4PA 3PBRA 2WAEA 4RA7A 5GL9A 1PW8A 3IH9A 1L0GA 1KVMA 4JXGA 2EXAA 2C5WB 3UE0A 4BD0A 4DE0A 4P87A 1EWZA 4HEFA 1WYCA 4N9LA 1LL5A 3O86A 1NJ4A 4LV2A 4C75A 1KGGA 4WEKA 3UDXA 2EFUA 3CMZA 4MBHA 1G6AA 2ZC7A 3OCNA 1MWSA 1IYPA 3VFHA 4ZDXA 2H0TA 3FKWA 4E3OA 4X55A 3ZFZA 1ESUA 5F1FA 4EBLA 4B88A 5EVIC 1K6SA 2EX2A 4LV1A 3O87A 4OOMA 5HL1A 4KZ3A 1LL9A 2QPNA 4OP8A 3ZCZA 3V39A 1KDSA 1IKIA 1ZG4A 3CZDA 4S2LA 4JBFA 4IVKA 4LV0A 4DDYA 1PWGA 5EOEA 4PPRA 4GKUA 4S2PA 1BULA 1E4DA 1ALQA 1NRFA 2H10A 4FCFA 4UA7A 1W8YA 1BT5A 5DF7A 4RYEA 4E6XA 5FAQA 4S2JA 2EFXA 5HARA 1MWTA 5F82A 4OQIA 1E3UD 1JWZA 3IXGA 1WYBA 4JF5A 2P9VB 4X56A 2RCXA 3V50A 3ZDJA 3HREA 4E6WA 3UDIA 1TVFA 3I7JA 4PM8A 4JLFA 4Q8IA 3SS4A 3UY6A 3NI9A 1HTZA 2IWCA 3BFCA 1YM1A 4GOGA 3OC2A 4WEJA 1FR6A 4R3JA 3CJMA 3ZNTA 2WGWB 3VP1A 5F1GA 3DWZA 1I2SA 3HUNA 2WKIA 1ESIA 3PBQA 5CGWA 2FFFB 2XEPA 3MZFA 2JE5A 4P85A 4JPMA 2HDRA 1H5XA 3SH9A 5A90A 1ES3A 3QHYA 1Q2PA 4EBNA 1DY6A 1JWVA 2PBYA 4ZAMA 4WELA 5KSHA 3G30A 1MBLA 5GHZA 3N6IA 1FCOA 1LI0A 1NZOA 2E8IA 1S6RA 3BEBA 4S2MA 4C3QA 1PWDA 4H8RA 3MFDA 3UO9A 1LLBA 3C5AA 3NIAA 4XXRA 1FR1A 4U0XA 1JWPA 4BL3A 1GA0A 4YINA 5DF9A 3HLGA 4WM9A 3VFFA 1K25A 4N9KA 4QY5A 2OSUA 2XR0A 2QMIA 3Q7VB 5CHUA 3ZHHA 1CI9A 4C6YA 5EE8A 4S2OA 4K0XA 3ZG0A 3IF6A 3ZNYA 3IF5A 4N1XA 3GSGA 3WS5A 4BQMA 5CRFA 3LEZA 1H8ZA 5DTKA 2G2UA 4X6TA 1NZUA 3BFDA 2JBFA 3BFFA 2UWXA 4JF6A 4S2NC 5TGFA 2Y2NA 5E43A 3N8SA 1TDLA 1NY0A 1E3UA 4KZ6A 3IHBA 4UHUA 5FATA 2BG1A 3GR2A 3GVBA 1ERQA 1YLPA 1XX2A 4Z9QA 5HAPA 1HZOA 5EUAA 4EWFA 4FSFA 4IBRA 3HLFA 3P98A 5F83A 1N9BA 3A3DA 1NYYA 5FSRA 4KQRA 2J9PA 1K55C 1O07A 2C6WB 2OLVA 3UNWA 3W4PA 3A3FA 4QJGA 2Y2IA 4DXCA 3NDGA 3OPLA 2ZM2A 1IYQA 4K91A 4U0TA 1K56D 4CJNA 4S2KA 3O88A 4ZJ2A 2Y2QA 4X69A 3O3VA 5CERA 3Q1FA 3ZGAB 5GLAA 3MXSA 2Y2OA 3Q07A 1Q2QA 3HUOA 1ES2A 1FSWA 3JYIA 2EX6A 1CEFA 2WGIA 3IXDA 4M3KA 2ZQCA 4OKPA 4OH0A 3VMAA 1FSYA 2H0YA 4JXWA 1PIOA 1I5QA 4GDBA 4GN2A 5FI2A 2J7VA 3M2JA 4NK3A 2Q9NA 2VGJA 4GDNA 1MY8A 4MEZA 1ONHA 5FQJA 2P9VA 2XLNA 2ZM0A 3W4QA 4GD6A 3LY3A 1L0FA 3N8LA 1SHVA 3SH8A 5TR7A 4FD8A 3C4OA 3PBNA 4EUZA 1W5DA 4MBKA 3V3RA 4PM7A 1FCNA 2R9WA 1M6KA 4DF6A 1RP5A 2Y2HA 1K4FA 3HLBA 4ZJ1A 3GQZA 3PAEA 1GCEA 4WZ4A 5EVLA 3HUMA 4R23A 2EXBA 3D4FA 4R0QA 4DE2A 3IQAA 3VP2A 3GTCA 3PBOA 1MKIA 4RVAA 3PTEA 4KZBA 5FDHA 2XFSA 4KG6A 4BL2A 3HL9A 1L0DA 2A3UA 5AQ9A 2HDQA 1BLCA 4S2IA 5GLCA 3NCKA 5M1AA 1K57A 1O7EA 2V1ZA 5FQKA 2WADA 4UAAA 1YLWA 3WS0A 1KE0A 4B4XA 5FAOA 5GLDA 1PW1A 3AGFA 1XGIA 4OLGA 2ZC4B 3CG5A 3NC8A 4HESA 5GLBA 5CECA 5E2GA 2ZQ7A 1YMXA 1PWCA 3BRMA 4WZ5C 5GHXA 3UE3A 2CC1A 3ISGA 2OLUA 3UN7A 5FQIA 1W8QA 3B3XA 4BENA 1HD8A 4OPYA 4JXVA 2Y4AA 4N92A 3P09A 5M19A 4KZ8A 5CGSA 3V3SA 4Y0UA 3GMWA 4OQGA 4GZBA 1BLSA 4HBUA 5CEDA 5FQ9A 4GB7A 1K55A 3MZDA 1G68A 1IYOA 4OQHA 3UE1A 2XGNA 3A3IA 5E2EA 3ZG9B 1FCMA 4KQQA 3IF6C 1MWRA 2B5RA 1KDWA 2JC7A 5FI7A 3HLEA 4RX3A 3HBRA 4OOLA 1I2WA 5FAPA 5IHVA 1QMEA 1KVLA 2Y2KA 1L0EA 5FA7A 5KMWA 3C7UA 4IVIA 3IXHA 3BFEA 4DKIA 2ZMAA 1RCJA 4NETA 1XPBA 3DW0A 2DCFA 1SCWA 1ZKJA 4P6BA 4E3IA 1WE4A 1NXYA 3TOIA 1MWUA 4YFMA 4KG5A 3BFGA 1KGFA 4WMCA 5DF8A 3SS5A 2ZQ8A 4E3JA 1XP4A 2I72A 2HDSA 2ZQDA 2XD1A 4OPQA 5HX9A 3ZG7B 5JYOA 4DDSA 4B4ZA 1C3BA 4FH2A 1MXOA 3RXXA 5EVIB 1S0WA 3WRZA 3FWLA 1PI4A 2ZC3B 4LCLA 1TEMA 3G32A 3S1YA 3WS2A 2XQZA 2ZJ9A 5AQBA 3M6BA 1XXMA 2WZZA 2IWBA 3HLWA 4QB8A 3S22A 3NBLA 1YLZA 3LY4A 4JKTA 2XD5A 2HP6A 2Z2MB 3C7VA 4UA6A 2EX9A 4EBPA 4IEDA 2EX8A 4QU3A 2DNSA 1XA1A 3OPPA 1DJCA 3NDEA 1YLJA 3UPOA 5EVID 3IF6B 3PBTA 1LHYA 3Q7VA 1PI5A 1Z6FA 3G31A 2PU4A 5TFQA 5A92A 3NY4A 2GDNA 3VP4A 2OV5A 4KG2A 2DRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KQO A;  1Y54 A;  4ZTK A;  4D2O A;  3Q82 A;  2X71 A;  5EEC A;  4PMA A;  3WS1 A;  4HBT A;  4WZ5 A;  2Y2L A;  3RJU A;  5EPH A;  5HAQ A;  3BLM A;  3IH8 A;  3N8R A;  5FQQ A;  3S4X A;  1W7F A;  4DXB A;  1K54 C;  3GV9 A;  3LO7 A;  1OME A;  5CTN A;  5FI6 A;  1DJA A;  1BZA A;  1ZC2 A;  1PYY A;  1GHM A;  1ES5 A;  4L0L A;  4XUZ A;  3VP3 A;  4R4R A;  2XH9 A;  4X68 A;  2Y91 A;  1QMF A;  2PU2 A;  1VM1 A;  3N7W A;  4QD4 A;  1K56 A;  1YLT A;  5J8X A;  5HW3 A;  5CHM A;  3WWX A;  2HPB A;  3M6H A;  5FAS A;  3V5M A;  4E3L A;  1YQS A;  3A3E A;  3TSG A;  2H5S A;  4KZA A;  3EQU A;  5DTS A;  4BLM A;  2Y59 A;  5CGX A;  2XDM A;  3FV7 A;  1KE4 A;  2X02 A;  3FZC A;  1IKG A;  4RX2 A;  4ZBE A;  5U47 A;  4E3N A;  4EV4 A;  4R4S A;  4OPR A;  5G18 A;  2ZC6 B;  3M2K A;  3PBS A;  4KZ5 A;  3ZVT A;  1XKZ A;  5HFO A;  4PM6 A;  1PZP A;  4PM5 A;  1BSG A;  1SKF A;  4R1G A;  1FQG A;  2IWD A;  3IWI A;  4WYY A;  5HAI A;  4QHC A;  2WYX A;  4ID4 A;  4MLL A;  2Y2M A;  1LI9 A;  3IHA A;  4E3M A;  1PZO A;  2HDU A;  1N4O A;  2WKE A;  1YLY A;  4MNR A;  1BLH A;  2V20 A;  4DE3 A;  3SH7 A;  3MKE A;  2WUQ A;  3UDF A;  3G2Y A;  2FFY A;  3IT9 A;  4UA9 A;  1K54 A;  4XUX A;  1K38 A;  3UPN A;  4OOY A;  1BLP A;  2XFT A;  4OP5 A;  5KZH A;  1J9M A;  2Y2G A;  1VQQ A;  4Y0T A;  4KZ9 A;  3G34 A;  3HVF A;  3PAG A;  1ZG6 A;  2WK0 A;  4OLD A;  3VOZ A;  4IBX A;  1NYM A;  4KZ4 A;  4ZJ3 A;  3WS4 A;  2A49 A;  4KZ7 A;  5CEB A;  5CXW A;  2QZ6 A;  3BM6 A;  1RGY A;  4P0M A;  4PM9 A;  4QY6 A;  1XGJ A;  5KSC A;  3DTM A;  1GA9 A;  4GD8 A;  4S2N A;  4F94 A;  1KGE A;  2Y55 A;  1EI5 A;  3BEC A;  5FQM A;  1L2S A;  1XA7 A;  2VGK A;  3BYD A;  3G2Z A;  1RGZ A;  5E2H A;  5A91 A;  2JCH A;  4FH4 A;  2XF3 A;  1BTL A;  4WMC D;  2HP5 A;  3ZG5 A;  4EQI A;  1AXB A;  3DWK A;  1GHI A;  3MKF A;  2ZQ9 A;  5GHY A;  1IEL A;  3W8K A;  5L2F A;  2V2F F;  4A5R A;  1E25 A;  4N1H A;  2Y2P A;  1K6R A;  2ZM8 A;  3FKV A;  4U3T A;  3QNC A;  3MZE A;  1SDN A;  3OZH A;  3E2L A;  3UPP A;  3WRT A;  3G35 A;  1SDE A;  3GRJ A;  4WBG A;  2ZD8 A;  2XK1 A;  4K0W A;  4OQ0 A;  3LCE A;  4OVD A;  4OPZ A;  1ES4 A;  2R9X A;  3HLD A;  2ZLY A;  5EOO A;  1KE3 A;  4DE1 A;  3EQV A;  2Q9M A;  3QNB A;  4R3B A;  1HVB A;  5DTT A;  3RXW A;  3OCL A;  3OPR A;  5AQA A;  4O7D A;  5DVA A;  1JTD A;  2BLS A;  3A3J A;  3BLS A;  5AQ7 A;  2Y2J A;  3SOI A;  3ZG8 B;  1M40 A;  1ONG A;  1W79 A;  1TDG A;  2ZC5 B;  4X53 A;  4DRT A;  3IWQ A;  2WKH A;  3OPH A;  5D3O A;  2WGW A;  3ZVW A;  2J9O A;  3TG9 A;  1FOF A;  1JTG A;  5I94 A;  4JXS A;  4JF4 A;  3SS3 A;  3MBZ A;  1ERM A;  3VSK A;  4E3K A;  5M18 A;  4KEN B;  3Q81 A;  3HLC A;  3W4O A;  3G4P A;  1YMS A;  5EVI A;  3MXR A;  1BUE A;  2Z2L B;  3VSL A;  5CTM A;  1JVJ A;  3E2K A;  5BOH A;  5JYP A;  1CK3 A;  2WAF A;  4CPK A;  2WZX A;  5E2F A;  3IWO A;  3VP0 A;  1K4E A;  5A93 A;  1H8Y A;  4GNU A;  4MBF A;  4LEN A;  1MPL A;  4BD1 A;  2X01 A;  1CI8 A;  4LV3 A;  4OON A;  2ZQA A;  1GHP A;  1IYS A;  1IEM A;  2G2W A;  3IXB A;  2WGV A;  3Q7Z A;  4LCM A;  3N4I A;  4Y0O A;  3AGE A;  2P74 A;  1DJB A;  3FYZ A;  3ITB A;  3VOY A;  2J8Y A;  4BJP A;  3ITA A;  1YT4 A;  2RL3 A;  2HP9 A;  1K57 C;  5CHJ A;  4Y7P A;  3AGD A;  1CEG A;  1U60 A;  1ERO A;  3C4P A;  3PBR A;  2WAE A;  4RA7 A;  5GL9 A;  1PW8 A;  3IH9 A;  1L0G A;  1KVM A;  4JXG A;  2EXA A;  2C5W B;  3UE0 A;  4BD0 A;  4DE0 A;  4P87 A;  1EWZ A;  4HEF A;  1WYC A;  4N9L A;  1LL5 A;  3O86 A;  1NJ4 A;  4LV2 A;  4C75 A;  1KGG A;  4WEK A;  3UDX A;  2EFU A;  3CMZ A;  4MBH A;  1G6A A;  2ZC7 A;  3OCN A;  1MWS A;  1IYP A;  3VFH A;  4ZDX A;  2H0T A;  3FKW A;  4E3O A;  4X55 A;  3ZFZ A;  1ESU A;  5F1F A;  4EBL A;  4B88 A;  5EVI C;  1K6S A;  2EX2 A;  4LV1 A;  3O87 A;  4OOM A;  5HL1 A;  4KZ3 A;  1LL9 A;  2QPN A;  4OP8 A;  3ZCZ A;  3V39 A;  1KDS A;  1IKI A;  1ZG4 A;  3CZD A;  4S2L A;  4JBF A;  4IVK A;  4LV0 A;  4DDY A;  1PWG A;  5EOE A;  4PPR A;  4GKU A;  4S2P A;  1BUL A;  1E4D A;  1ALQ A;  1NRF A;  2H10 A;  4FCF A;  4UA7 A;  1W8Y A;  1BT5 A;  5DF7 A;  4RYE A;  4E6X A;  5FAQ A;  4S2J A;  2EFX A;  5HAR A;  1MWT A;  5F82 A;  4OQI A;  1E3U D;  1JWZ A;  3IXG A;  1WYB A;  4JF5 A;  2P9V B;  4X56 A;  2RCX A;  3V50 A;  3ZDJ A;  3HRE A;  4E6W A;  3UDI A;  1TVF A;  3I7J A;  4PM8 A;  4JLF A;  4Q8I A;  3SS4 A;  3UY6 A;  3NI9 A;  1HTZ A;  2IWC A;  3BFC A;  1YM1 A;  4GOG A;  3OC2 A;  4WEJ A;  1FR6 A;  4R3J A;  3CJM A;  3ZNT A;  2WGW B;  3VP1 A;  5F1G A;  3DWZ A;  1I2S A;  3HUN A;  2WKI A;  1ESI A;  3PBQ A;  5CGW A;  2FFF B;  2XEP A;  3MZF A;  2JE5 A;  4P85 A;  4JPM A;  2HDR A;  1H5X A;  3SH9 A;  5A90 A;  1ES3 A;  3QHY A;  1Q2P A;  4EBN A;  1DY6 A;  1JWV A;  2PBY A;  4ZAM A;  4WEL A;  5KSH A;  3G30 A;  1MBL A;  5GHZ A;  3N6I A;  1FCO A;  1LI0 A;  1NZO A;  2E8I A;  1S6R A;  3BEB A;  4S2M A;  4C3Q A;  1PWD A;  4H8R A;  3MFD A;  3UO9 A;  1LLB A;  3C5A A;  3NIA A;  4XXR A;  1FR1 A;  4U0X A;  1JWP A;  4BL3 A;  1GA0 A;  4YIN A;  5DF9 A;  3HLG A;  4WM9 A;  3VFF A;  1K25 A;  4N9K A;  4QY5 A;  2OSU A;  2XR0 A;  2QMI A;  3Q7V B;  5CHU A;  3ZHH A;  1CI9 A;  4C6Y A;  5EE8 A;  4S2O A;  4K0X A;  3ZG0 A;  3IF6 A;  3ZNY A;  3IF5 A;  4N1X A;  3GSG A;  3WS5 A;  4BQM A;  5CRF A;  3LEZ A;  1H8Z A;  5DTK A;  2G2U A;  4X6T A;  1NZU A;  3BFD A;  2JBF A;  3BFF A;  2UWX A;  4JF6 A;  4S2N C;  5TGF A;  2Y2N A;  5E43 A;  3N8S A;  1TDL A;  1NY0 A;  1E3U A;  4KZ6 A;  3IHB A;  4UHU A;  5FAT A;  2BG1 A;  3GR2 A;  3GVB A;  1ERQ A;  1YLP A;  1XX2 A;  4Z9Q A;  5HAP A;  1HZO A;  5EUA A;  4EWF A;  4FSF A;  4IBR A;  3HLF A;  3P98 A;  5F83 A;  1N9B A;  3A3D A;  1NYY A;  5FSR A;  4KQR A;  2J9P A;  1K55 C;  1O07 A;  2C6W B;  2OLV A;  3UNW A;  3W4P A;  3A3F A;  4QJG A;  2Y2I A;  4DXC A;  3NDG A;  3OPL A;  2ZM2 A;  1IYQ A;  4K91 A;  4U0T A;  1K56 D;  4CJN A;  4S2K A;  3O88 A;  4ZJ2 A;  2Y2Q A;  4X69 A;  3O3V A;  5CER A;  3Q1F A;  3ZGA B;  5GLA A;  3MXS A;  2Y2O A;  3Q07 A;  1Q2Q A;  3HUO A;  1ES2 A;  1FSW A;  3JYI A;  2EX6 A;  1CEF A;  2WGI A;  3IXD A;  4M3K A;  2ZQC A;  4OKP A;  4OH0 A;  3VMA A;  1FSY A;  2H0Y A;  4JXW A;  1PIO A;  1I5Q A;  4GDB A;  4GN2 A;  5FI2 A;  2J7V A;  3M2J A;  4NK3 A;  2Q9N A;  2VGJ A;  4GDN A;  1MY8 A;  4MEZ A;  1ONH A;  5FQJ A;  2P9V A;  2XLN A;  2ZM0 A;  3W4Q A;  4GD6 A;  3LY3 A;  1L0F A;  3N8L A;  1SHV A;  3SH8 A;  5TR7 A;  4FD8 A;  3C4O A;  3PBN A;  4EUZ A;  1W5D A;  4MBK A;  3V3R A;  4PM7 A;  1FCN A;  2R9W A;  1M6K A;  4DF6 A;  1RP5 A;  2Y2H A;  1K4F A;  3HLB A;  4ZJ1 A;  3GQZ A;  3PAE A;  1GCE A;  4WZ4 A;  5EVL A;  3HUM A;  4R23 A;  2EXB A;  3D4F A;  4R0Q A;  4DE2 A;  3IQA A;  3VP2 A;  3GTC A;  3PBO A;  1MKI A;  4RVA A;  3PTE A;  4KZB A;  5FDH A;  2XFS A;  4KG6 A;  4BL2 A;  3HL9 A;  1L0D A;  2A3U A;  5AQ9 A;  2HDQ A;  1BLC A;  4S2I A;  5GLC A;  3NCK A;  5M1A A;  1K57 A;  1O7E A;  2V1Z A;  5FQK A;  2WAD A;  4UAA A;  1YLW A;  3WS0 A;  1KE0 A;  4B4X A;  5FAO A;  5GLD A;  1PW1 A;  3AGF A;  1XGI A;  4OLG A;  2ZC4 B;  3CG5 A;  3NC8 A;  4HES A;  5GLB A;  5CEC A;  5E2G A;  2ZQ7 A;  1YMX A;  1PWC A;  3BRM A;  4WZ5 C;  5GHX A;  3UE3 A;  2CC1 A;  3ISG A;  2OLU A;  3UN7 A;  5FQI A;  1W8Q A;  3B3X A;  4BEN A;  1HD8 A;  4OPY A;  4JXV A;  2Y4A A;  4N92 A;  3P09 A;  5M19 A;  4KZ8 A;  5CGS A;  3V3S A;  4Y0U A;  3GMW A;  4OQG A;  4GZB A;  1BLS A;  4HBU A;  5CED A;  5FQ9 A;  4GB7 A;  1K55 A;  3MZD A;  1G68 A;  1IYO A;  4OQH A;  3UE1 A;  2XGN A;  3A3I A;  5E2E A;  3ZG9 B;  1FCM A;  4KQQ A;  3IF6 C;  1MWR A;  2B5R A;  1KDW A;  2JC7 A;  5FI7 A;  3HLE A;  4RX3 A;  3HBR A;  4OOL A;  1I2W A;  5FAP A;  5IHV A;  1QME A;  1KVL A;  2Y2K A;  1L0E A;  5FA7 A;  5KMW A;  3C7U A;  4IVI A;  3IXH A;  3BFE A;  4DKI A;  2ZMA A;  1RCJ A;  4NET A;  1XPB A;  3DW0 A;  2DCF A;  1SCW A;  1ZKJ A;  4P6B A;  4E3I A;  1WE4 A;  1NXY A;  3TOI A;  1MWU A;  4YFM A;  4KG5 A;  3BFG A;  1KGF A;  4WMC A;  5DF8 A;  3SS5 A;  2ZQ8 A;  4E3J A;  1XP4 A;  2I72 A;  2HDS A;  2ZQD A;  2XD1 A;  4OPQ A;  5HX9 A;  3ZG7 B;  5JYO A;  4DDS A;  4B4Z A;  1C3B A;  4FH2 A;  1MXO A;  3RXX A;  5EVI B;  1S0W A;  3WRZ A;  3FWL A;  1PI4 A;  2ZC3 B;  4LCL A;  1TEM A;  3G32 A;  3S1Y A;  3WS2 A;  2XQZ A;  2ZJ9 A;  5AQB A;  3M6B A;  1XXM A;  2WZZ A;  2IWB A;  3HLW A;  4QB8 A;  3S22 A;  3NBL A;  1YLZ A;  3LY4 A;  4JKT A;  2XD5 A;  2HP6 A;  2Z2M B;  3C7V A;  4UA6 A;  2EX9 A;  4EBP A;  4IED A;  2EX8 A;  4QU3 A;  2DNS A;  1XA1 A;  3OPP A;  1DJC A;  3NDE A;  1YLJ A;  3UPO A;  5EVI D;  3IF6 B;  3PBT A;  1LHY A;  3Q7V A;  1PI5 A;  1Z6F A;  3G31 A;  2PU4 A;  5TFQ A;  5A92 A;  3NY4 A;  2GDN A;  3VP4 A;  2OV5 A;  4KG2 A;  2DRW A; 
#chains in the Genus database with same CATH topology
 1OJ5 A;  3F1O B;  1Y54 A;  4ZTK A;  1VHM A;  2X71 A;  4R6L A;  4DXB A;  3S7P A;  1OME A;  4LPZ A;  1PYY A;  4L0L A;  2P08 A;  4XUZ A;  4YNR A;  4Z1W A;  4Y17 A;  5HW3 A;  3WWX A;  2HPB A;  3M6H A;  3HJI A;  1SZV A;  1YQS A;  3NHQ A;  2H5S A;  1P97 A;  2XDM A;  1UWP X;  1F5M A;  1W63 M;  3D72 A;  1MC0 A;  1XKZ A;  3W2Z A;  4PM6 A;  1PZP A;  4L9G A;  3KYQ A;  1ZHH B;  5G4Y A;  2WYX A;  1UGU A;  4HP9 A;  1N4O A;  4G3V A;  1BLH A;  2Z6C A;  4DE3 A;  3KSI A;  3MKE A;  1CJF A;  3UDF A;  3EEA A;  2W3F A;  1K54 A;  3UPN A;  1X0O A;  3QP1 A;  4LFU A;  5IS1 A;  4EUV A;  2WK0 A;  3VOZ A;  4IBX A;  1T1B A;  1NYM A;  4KZ4 A;  5EVE A;  5KIZ A;  2MJ6 A;  3P7N A;  4KZ7 A;  3LR5 A;  3CLO A;  2PYR A;  2HF6 A;  1XGJ A;  4F94 A;  2Y55 A;  1EI5 A;  5E2H A;  4FH4 A;  2XF3 A;  2PR5 A;  2ZL1 A;  4EQI A;  3DWK A;  2OAQ 1;  2ZQ9 A;  1E25 A;  1D06 A;  1K6R A;  2ZM8 A;  3QNC A;  1NLZ A;  3MZE A;  1SDE A;  2ZD8 A;  4K0W A;  3QP6 A;  1ES4 A;  3HLD A;  5EOO A;  2Q9M A;  4R3B A;  2PBD P;  5IU1 A;  3RXW A;  3OPR A;  2PD8 A;  2Y8H A;  4O7D A;  5DVA A;  2BLS A;  4CLC E;  2Y2J A;  1ONG A;  4I38 A;  4DRT A;  2ZC5 B;  3IWQ A;  3OPH A;  5D3O A;  3ZVW A;  4JXS A;  5J7E A;  1S4S A;  5M18 A;  5LBR A;  5EVI A;  4II7 A;  2Z2L B;  5CTM A;  1JVJ A;  5BOH A;  5JYP A;  1CK3 A;  2WAF A;  4CPK A;  3IWO A;  3VP0 A;  5A93 A;  1H8Y A;  2W3G A;  4OON A;  1GHP A;  4Y0O A;  3FYZ A;  4Y15 A;  2G7U A;  2RL3 A;  5G4Z A;  1OT9 A;  1L0G A;  2C5W B;  3LID A;  4BD0 A;  3BQ8 A;  1XFN A;  3UDX A;  4MBH A;  2ZC7 A;  1MWS A;  4ZDX A;  1ESU A;  3KYE A;  4KUK A;  3VOL A;  3O87 A;  2VEA A;  4OOM A;  4DJ2 A;  3ZCZ A;  1XFQ A;  1ZG4 A;  4S2L A;  5FEG A;  4LV0 A;  4FTX A;  1PWG A;  5EOE A;  3IX3 A;  4S2P A;  3VE4 A;  1NRF A;  1D7E A;  1W8Y A;  5DF7 A;  1MWT A;  4OQI A;  1JWZ A;  4X56 A;  3ZDJ A;  2W3D A;  1F2K A;  5DFX A;  4Q8I A;  1VEU B;  2IWC A;  3PYP A;  3ZNT A;  1FR6 A;  4R3J A;  5F1G A;  3F1N A;  4EET B;  1ESI A;  5CGW A;  1G28 A;  2JE5 A;  4P85 A;  2HDR A;  3SH9 A;  4GLQ A;  1DY6 A;  2PBY A;  1S4R A;  3BY9 A;  4WEL A;  5HWV A;  3EGX C;  3G30 A;  1MBL A;  5GHZ A;  1TS7 A;  3N6I A;  1FCO A;  3CPT B;  1S6R A;  4S2M A;  3E4O A;  3C5A A;  3NIA A;  3LI9 A;  2VV6 A;  4U0X A;  2L0W A;  2BAS A;  1JWP A;  4BL3 A;  2WKQ A;  3HLG A;  4N9K A;  1S1Y A;  2QMI A;  5CHU A;  2JKR M;  5EE8 A;  5FDS A;  3WS5 A;  4BQM A;  3LEZ A;  1H8Z A;  4I39 A;  3BFD A;  3QP8 A;  4S2N C;  3N8S A;  1E3U A;  5HDC A;  4EEP A;  1HLU P;  5DJU A;  2ACG A;  3GR2 A;  3GVB A;  5HAP A;  4FSF A;  3HLF A;  5F83 A;  4RQ9 A;  5FSR A;  2JKR I;  1K55 C;  3W4P A;  3A3F A;  2HJ9 C;  3T4T A;  1S1Z A;  4ZJ2 A;  3PR6 A;  2VGL S;  4NG2 A;  3Q07 A;  3HUO A;  2QYB A;  3JYI A;  4HP4 A;  4NEE D;  3VMA A;  2PR6 A;  1I5Q A;  4X1L A;  3ULF A;  4GDN A;  4Y13 A;  1A0K A;  3TRC A;  4GD6 A;  5TR7 A;  2JKT M;  3PBN A;  2W1T A;  1W5D A;  1F98 A;  1M6K A;  2J3W A;  1K4F A;  3JVV A;  2L1M A;  4NXG A;  5EVL A;  4Q0J A;  4MCW A;  3PBO A;  3PTE A;  5FDH A;  2XFS A;  3H82 B;  4KG6 A;  4BL2 A;  3FPW A;  3S7O A;  2VV7 A;  2OAP 1;  5M1A A;  1Y4O A;  1O7E A;  4UAA A;  2V9A A;  3MS6 A;  4DN0 A;  1KE0 A;  5GLD A;  3QP2 A;  1PW1 A;  3AGF A;  2ZC4 B;  4HES A;  5GLB A;  3UE3 A;  3UN7 A;  3GDI A;  1HD8 A;  3PHY A;  4JXV A;  4P6Z S;  4KZ8 A;  2ZBB A;  5CGS A;  3V3S A;  2OOL A;  1BLS A;  4HBU A;  4CLC D;  3TW8 A;  1K55 A;  3MZD A;  4ETX A;  3UE1 A;  3ZG9 B;  4KQQ A;  1I2W A;  2Y2K A;  4CLC A;  3D3O A;  5FA7 A;  5KMW A;  2YKH A;  3C7U A;  4IVI A;  2ZMA A;  5DJT A;  3IBR A;  4KG5 A;  5EFW A;  2ZOH A;  1XP4 A;  2I72 A;  1C3B A;  2ZC3 B;  2HGV A;  2WZZ A;  2PYP A;  4GJ4 A;  3IS2 B;  2XD5 A;  2HP6 A;  4EBP A;  3BY8 A;  3NDE A;  4KQD A;  5EVI D;  3IF6 B;  5A92 A;  1CF0 A;  2DRW A;  1YAX A;  1ACF A;  4I3J A;  4PMA A;  4HBT A;  3RJU A;  5HAQ A;  5FQQ A;  5FI6 A;  5CTN A;  5HZH A;  3H7W B;  1ZC2 A;  4K08 A;  3VP3 A;  2XH9 A;  4X68 A;  2ZMV A;  1K56 A;  2W1R A;  3TSG A;  3EQU A;  4BLM A;  2O9C A;  4L9F A;  3FV7 A;  4R4S A;  3E0Y A;  3M2K A;  4KZ5 A;  3LGO A;  4PM5 A;  3LUQ A;  1FQG A;  5HAI A;  4ID4 A;  3LI8 A;  4MLL A;  1LI9 A;  3IHA A;  3UB5 P;  1YLY A;  2V20 A;  2KLI A;  1VET A;  4GCZ A;  3G2Y A;  2FFY A;  4UA9 A;  4UQI S;  5HDS A;  4OP5 A;  5K5B A;  5AVE A;  1J9M A;  2Y2G A;  4WL9 A;  5EM1 A;  1VQQ A;  1ZG6 A;  2GZA A;  3WS4 A;  5CEB A;  3MMH A;  5CXW A;  2GX5 A;  1RGY A;  4PM9 A;  2W27 A;  4GS9 B;  3LFV A;  3O5Y A;  4S2N A;  4GD8 A;  3BEC A;  3G2Z A;  3BYD A;  3RH8 B;  4YWZ A;  3KYZ A;  2HP5 A;  3ZG5 A;  3CIT A;  1AXB A;  5DKL A;  1GHI A;  3MKF A;  5GHY A;  2V2F F;  4A5R A;  2Y2P A;  2QJ5 A;  1SKO B;  3LIB A;  3WRT A;  1OPX A;  4OPZ A;  2R9X A;  4PKY G;  2W0N A;  2ZLY A;  3EQV A;  3K2N A;  3OCL A;  1JTD A;  4CLC B;  2P04 A;  3DTK A;  3SOI A;  5HDD A;  3ZG8 B;  1CQA A;  1TDG A;  4X53 A;  2WGW A;  1S66 L;  5I94 A;  3SS3 A;  1GSX A;  4E3K A;  1ERM A;  4EU0 A;  3E98 A;  3G4P A;  1YMS A;  3MXR A;  1BUE A;  3QP4 A;  4HY8 A;  2PT7 A;  1XJ2 A;  1K4E A;  3KSG A;  5C5K A;  4MBF A;  3T4S A;  3Q7Z A;  2WGV A;  4LCM A;  3VOY A;  5CHJ A;  4Y7P A;  4EES A;  5GL9 A;  1PW8 A;  1KVM A;  4WN5 A;  4DE0 A;  4P87 A;  3CWF A;  4HEF A;  1WYC A;  2W3H A;  4C75 A;  1KGG A;  1LL8 A;  1LSV A;  3CMZ A;  3LYX A;  4HNB A;  3VFH A;  4P6Z M;  4E3O A;  3ZFZ A;  4B88 A;  5IT5 A;  3MF0 A;  1LL9 A;  2QPN A;  1KDS A;  3CZD A;  4IVK A;  4DDY A;  4GKU A;  1ALQ A;  4ZRR A;  2J3T D;  4S2J A;  2EFX A;  5F82 A;  2VV8 A;  4JGR A;  2XRN A;  4JF5 A;  1LSX A;  2XSS A;  3HRE A;  4PM8 A;  4JLF A;  3EGD C;  3UY6 A;  1HTZ A;  3K3C A;  4GOG A;  4WEJ A;  3OC2 A;  4PHT A;  3UB6 A;  1GSW A;  3HUN A;  3V67 A;  4B93 A;  3F1N B;  3PBQ A;  2XEP A;  1P0Z A;  3MZF A;  1T19 A;  4JPM A;  1H5X A;  3QHY A;  2OWH A;  4AFI A;  2WKR A;  3MQQ A;  2E8I A;  4C3Q A;  1PWD A;  3UO9 A;  3T4J A;  2JN7 A;  2VGL M;  4LRZ E;  4XXR A;  4HHD A;  1S67 L;  2ZL1 B;  3VFF A;  5EM0 A;  2XR0 A;  3GSG A;  2K7S A;  4BBV A;  5CRF A;  5DTK A;  4X6T A;  1NZU A;  4HJ3 A;  1TDL A;  4KZ6 A;  3MR0 A;  4I5S A;  3DAV A;  1ERQ A;  1YLP A;  1XX2 A;  1PRQ A;  4Z9Q A;  2YKF A;  5HD5 A;  3RTY A;  5EUA A;  2JKT I;  3A3D A;  3LEQ A;  1NYY A;  1O07 A;  2OLV A;  3KSH A;  4QJG A;  2Y2I A;  4DXC A;  5TJJ A;  1DP9 A;  1IYQ A;  3P01 A;  5EV0 A;  4S2K A;  3HCY A;  5GLA A;  3PXP A;  4EER A;  1FSW A;  2WGI A;  2ZQC A;  4BWI A;  1FSY A;  2CMN A;  2H0Y A;  4GDB A;  3M2J A;  2VGJ A;  1MY8 A;  1ONH A;  4BBT A;  5FQJ A;  2P9V A;  4H6J A;  3W4Q A;  3UME A;  3T1X A;  3D9Y A;  5AVF A;  4UQI M;  3SH8 A;  4FD8 A;  4IHQ A;  1Y28 A;  2R9W A;  4ARZ B;  1IFQ A;  3EEH A;  3PAE A;  2NUP C;  4WZ4 A;  4R0Q A;  4DE2 A;  1FIK A;  1MKI A;  4RVA A;  4KZB A;  1K0K A;  2HDQ A;  5GLC A;  3NCK A;  4LRY C;  3WS0 A;  1W63 Q;  1V9Z A;  5CEC A;  3OOV A;  4EXO A;  5E2G A;  5GHX A;  3BRM A;  5HSQ A;  2DMW A;  2CC1 A;  3IX8 A;  4BEN A;  4OPY A;  4N92 A;  2Y4A A;  3P09 A;  4Y0U A;  1XJ6 A;  5FQ9 A;  4GB7 A;  3ICY A;  1OTB A;  2XGN A;  2D01 A;  3IF6 C;  5CX7 A;  2B5R A;  3HLE A;  4RX3 A;  2QHK A;  1ODV A;  4DKI A;  2GJ3 A;  1RCJ A;  5HPI A;  4P6B A;  1PNE A;  1WE4 A;  1NXY A;  4E3I A;  3CUE C;  3DBA A;  3T50 A;  2VJW A;  4LLO B;  4UEY A;  2B18 A;  4YFM A;  5DF8 A;  3SS5 A;  2ZQ8 A;  5TBM A;  1H8M A;  5JYO A;  1P9R A;  3EOI A;  5HX9 A;  1PFL A;  3R7W B;  3RXX A;  3LIF A;  3UB8 A;  1PI4 A;  4LCL A;  3G32 A;  3S1Y A;  4I3I A;  4O01 A;  3WS2 A;  2ZJ9 A;  1OT6 A;  4X1M A;  3HLW A;  3NBL A;  3T4L A;  5J4E A;  4QWO A;  3LY4 A;  1OTA A;  2PD7 A;  5F6A A;  3C7V A;  2FZ0 A;  4B9O A;  1XA1 A;  2VA0 A;  3OPP A;  2FH5 A;  1DJC A;  1YLJ A;  3PBT A;  5TFQ A;  1PI5 A;  1Z6F A;  2PU4 A;  2GDN A;  4KG2 A;  4KQO A;  5A8B A;  4D2O A;  2Y2L A;  4Y2F A;  3BW6 A;  3T4O A;  1K54 C;  3GV9 A;  1DJA A;  1BZA A;  4JGO A;  1ES5 A;  2PAV P;  3CAX A;  2Y91 A;  1QMF A;  2PU2 A;  1VM1 A;  3U4L P;  1TS6 A;  1EW0 A;  5FAS A;  3V5M A;  2HJE A;  2INW A;  4BBU A;  4PKY A;  2PRF A;  3A3E A;  4RX2 A;  1KE4 A;  2X02 A;  3FZC A;  1IKG A;  4ZBE A;  5U47 A;  4EV4 A;  4OPR A;  5DFY A;  5G18 A;  2B02 A;  3ZVT A;  4XT2 A;  1GSV A;  3DTE A;  1SKF A;  5L09 A;  1YSQ A;  3IWI A;  2H28 A;  4QHC A;  2WKE A;  4MNR A;  3UB9 A;  3F1P B;  2P7J A;  3T1R A;  3IT9 A;  1L3L A;  4XUX A;  1K38 A;  5KZH A;  1MZU A;  1T1C A;  3A0R A;  4KZ9 A;  3HVF A;  3PAG A;  4OLD A;  5FEF A;  1AWI A;  2A49 A;  2QZ6 A;  3BM6 A;  4HH3 A;  4P0M A;  4EW7 A;  4PAU A;  3DTM A;  5FQM A;  1L2S A;  1RGZ A;  4R3A A;  2JCH A;  4F3L B;  1LSW A;  4Y3I A;  1T1A A;  5I5L A;  5L2F A;  4HJ6 A;  4N1H A;  4U3T A;  2Y79 A;  1SDN A;  3OZH A;  3G35 A;  4WBG A;  3LCE A;  1KE3 A;  5DTT A;  4DMZ A;  3A3J A;  5AQ7 A;  1M40 A;  4HOI A;  2VX8 A;  1F9I A;  1STZ A;  2VZW A;  4JF4 A;  4G3K A;  2A24 A;  2VKS A;  3LIC A;  3MBZ A;  3Q81 A;  4ETZ A;  3HLC A;  3W4O A;  2EWV A;  2W3E A;  3VSL A;  2QKP A;  5F5Y A;  1H0M A;  3CPT A;  4IUH A;  2WZX A;  3NOT C;  5E2F A;  2KDK A;  4BD1 A;  3CI6 A;  2X01 A;  1CI8 A;  4LV3 A;  2ZQA A;  2GNX A;  2G2W A;  3E4P A;  3EWK A;  3IXB A;  3N4I A;  3AGE A;  2P74 A;  1DJB A;  2V8C A;  1YT4 A;  2ZMF A;  3AGD A;  1CEG A;  1U60 A;  3KX0 X;  3C4P A;  3PBR A;  4RA7 A;  3IH9 A;  2EXA A;  2Z6D A;  4GHI A;  1EWZ A;  2OWJ A;  3KSF A;  4FOF A;  4N9L A;  1XJ4 A;  3O86 A;  4LGW A;  4WEK A;  3BQA A;  5F68 A;  1G6A A;  4HH2 A;  1G5U A;  2H0T A;  3U2A A;  3FKW A;  4X55 A;  4EBL A;  5EVI C;  3S7N A;  2EA9 A;  5HL1 A;  4KZ3 A;  5HWW A;  3V39 A;  1IKI A;  4JBF A;  4PPR A;  1E4D A;  2O9A A;  2LB9 A;  4UA7 A;  1BT5 A;  3JPU A;  1E3U D;  3IXG A;  3OLO A;  2P9V B;  3V50 A;  2RCX A;  4Q0I A;  3UDI A;  2HZ5 A;  3SS4 A;  3NI9 A;  1N9L A;  4EEU A;  4EQ1 A;  1VET B;  5DKK A;  3VP1 A;  3DWZ A;  1I2S A;  4R70 A;  2FFF B;  2O99 A;  2XA7 S;  4HI4 A;  3FG8 A;  5A90 A;  2IA2 A;  1Q2P A;  3C38 A;  3FC7 A;  3B47 A;  1LI0 A;  1VB6 A;  3T1S A;  1TS0 A;  4FUW A;  1LLB A;  1YKD A;  4IJG A;  1IOU A;  4WM9 A;  4QY5 A;  1J3W A;  2R78 A;  2D02 A;  2OSU A;  3Q7V B;  4F3L A;  3UMD A;  3ZHH A;  3ZG0 A;  4K0X A;  3ZNY A;  4N1X A;  2JHE A;  2V1A A;  4CLC C;  2JBF A;  5TGF A;  3IHB A;  1LT0 A;  2M1C A;  2BTF P;  4IBR A;  3P98 A;  1N9B A;  5HWT A;  5J3W A;  3JVU A;  2J9P A;  2C6W B;  4ME4 A;  2ZM2 A;  1K56 D;  4CJN A;  5CER A;  3O88 A;  4X69 A;  3ZGA B;  3O3V A;  2Y2O A;  1Q2Q A;  1ES2 A;  2A24 B;  3IXD A;  4OH0 A;  3NJA A;  4JXW A;  3LIE A;  5FI2 A;  2J7V A;  4D60 A;  4NK3 A;  5HPF A;  3KO6 A;  1V9Y A;  2XLN A;  3N8L A;  4EUZ A;  4MBK A;  4PM7 A;  1RP5 A;  4ZJ1 A;  3HLB A;  2EWW A;  4YOF A;  3IQA A;  3GTC A;  3H82 A;  1L0D A;  1WA9 A;  2A3U A;  4S2I A;  1OTE A;  1BLC A;  3C8C A;  1K57 A;  2HV1 A;  2V1Z A;  2K31 A;  5AJG A;  5FQK A;  1YLW A;  4B4X A;  4NXF A;  4OLG A;  1XGI A;  3CG5 A;  3NC8 A;  2V0W A;  1YMX A;  4WZ5 C;  4QPR A;  3ISG A;  5FQI A;  3B3X A;  2J3T C;  1ZTU A;  1XJ3 A;  1NWZ A;  5F69 A;  5MC7 A;  5M19 A;  4GZB A;  4HQA A;  1G68 A;  4OQH A;  3A3I A;  1FCM A;  1MWR A;  1KDW A;  2JC7 A;  5FI7 A;  5FAP A;  5IHV A;  4DJ3 A;  3IXH A;  3BFE A;  3G6O A;  2JKG A;  2DCF A;  1JNU A;  2V8F A;  5L07 A;  3MQO A;  3TOI A;  1MWU A;  3BFG A;  1KGF A;  3MSH A;  3K3D A;  3MJQ A;  4E3J A;  1N9O A;  2HDS A;  2XD1 A;  4DDS A;  3C2W A;  4FH2 A;  4HJ4 A;  1TEM A;  5AQB A;  3M6B A;  1NRJ A;  1XXM A;  1TD5 A;  2IWB A;  2UV0 E;  1KOU A;  3GEC A;  4GS9 A;  2A2L A;  4JKT A;  2I9V A;  4UA6 A;  4IED A;  2EX8 A;  2DNS A;  3QP5 A;  2KX6 A;  1LHY A;  4MN7 A;  3B42 A;  3NY4 A;  3HJK A;  3Q82 A;  5EEC A;  3R4K A;  3WS1 A;  4WZ5 A;  5HD3 A;  5EPH A;  2V0U A;  3BLM A;  3BWL A;  3IH8 A;  3N8R A;  3S4X A;  1W7F A;  3LO7 A;  4CQH A;  1GHM A;  1DP6 A;  4R4R A;  3N7W A;  4QD4 A;  1YLT A;  3MQ0 A;  5J8X A;  5CHM A;  5HL6 A;  1D1J A;  4IUK A;  5FL3 A;  4E3L A;  3T4Q A;  4KZA A;  5DTS A;  2Y59 A;  5CGX A;  4E3N A;  2NUT C;  5L10 A;  4X25 A;  3ZQ5 A;  2ZC6 B;  3PBS A;  5HFO A;  3B33 A;  3L7H A;  1BSG A;  4R1G A;  4XT2 B;  2PHY A;  2IWD A;  4WYY A;  3C30 A;  1DRM A;  2Y2M A;  3SW1 A;  4E3M A;  1PZO A;  2XRO A;  2HDU A;  1VEU A;  3SH7 A;  2WUQ A;  4ARZ A;  2O9B A;  3L9K A;  1BLP A;  2XFT A;  4OOY A;  4Y0T A;  3G34 A;  4ZJ3 A;  2B95 A;  4QY6 A;  5KSC A;  1GA9 A;  1KGE A;  1OTD A;  2VGK A;  1XA7 A;  5A91 A;  1BTL A;  3IX4 A;  4WMC D;  3UB7 A;  3W8K A;  1IEL A;  3FKV A;  4LRX C;  3F1O A;  3MXQ A;  3E2L A;  3UPP A;  3GRJ A;  4OQ0 A;  2XK1 A;  4OVD A;  4M4X A;  4Y5F A;  1FIL A;  4DE1 A;  3QNB A;  1HVB A;  5AQA A;  1TF1 A;  2ZOI A;  3BLS A;  3ZYT A;  1W79 A;  1YSP A;  2WKH A;  2M7V A;  2J9O A;  3TG9 A;  3CHW P;  1FOF A;  1JTG A;  5TBM B;  3VSK A;  4KEN B;  4BMW A;  3R7W A;  3T1Q B;  3LR0 A;  3E2K A;  3BJN A;  2XA7 M;  3IS2 A;  2V1B A;  4R38 A;  1NLY A;  3NUL A;  4GNU A;  2JKF A;  4LEN A;  1MPL A;  3IBJ A;  2VK3 A;  1IYS A;  1IEM A;  2W1T B;  4O0P A;  3VV4 A;  3ITB A;  2J8Y A;  4Q0H A;  3ITA A;  3MFX A;  4BJP A;  2HP9 A;  1K57 C;  4L9E A;  1ERO A;  2J80 A;  3FPV A;  2WAE A;  4JXG A;  3UE0 A;  4JGP A;  3LR3 A;  4GHI B;  1LL5 A;  1NJ4 A;  4LV2 A;  2EFU A;  2O0Y A;  4NXB A;  3TE8 A;  3OCN A;  1TS8 A;  1IYP A;  2E8J A;  2KOI A;  5F1F A;  1K6S A;  2EX2 A;  4LV1 A;  4OP8 A;  4HIA A;  3OBF A;  4GW9 A;  1P9W A;  1BUL A;  2M7U A;  2H10 A;  4FCF A;  3SZT A;  4RYE A;  4E6X A;  5FAQ A;  5HAR A;  4MDZ A;  1WYB A;  4E6W A;  4MN6 A;  2AVX A;  1TVF A;  3I7J A;  3BFC A;  1YM1 A;  3CJM A;  3F1P A;  3A0S A;  2L4R A;  2WGW B;  2WKI A;  1ES3 A;  4EBN A;  4KUO A;  1JWV A;  4ZAM A;  3NOP C;  5KSH A;  3T4K A;  3NEC A;  1NZO A;  3BEB A;  1UWN X;  4H8R A;  2WKP A;  3MFD A;  2LB5 A;  1FR1 A;  1GA0 A;  4YIN A;  5DF9 A;  1K25 A;  4C6Y A;  1CI9 A;  4S2O A;  1OJG A;  3IF6 A;  3DTI A;  3IF5 A;  2G2U A;  1H3Q A;  3BFF A;  2UWX A;  4JF6 A;  2Y2N A;  5E43 A;  1NY0 A;  4UHU A;  5FAT A;  2BG1 A;  3H7W A;  1HZO A;  4NXE A;  4EWF A;  1YPR A;  4KQR A;  3UNW A;  3NOU C;  3NDG A;  3OPL A;  4K91 A;  4U0T A;  3RFB A;  2Y2Q A;  3Q1F A;  2PDR A;  3S7Q A;  3MXS A;  4OKP A;  2EX6 A;  1CEF A;  4M3K A;  4MMN A;  1PIO A;  4GN2 A;  2Q9N A;  4MEZ A;  1Z09 A;  2ZM0 A;  3LY3 A;  1L0F A;  4H6J B;  1SHV A;  3C4O A;  3V3R A;  1FCN A;  4DF6 A;  2Y2H A;  3UE6 A;  3GQZ A;  1GCE A;  1DP8 A;  3A0V A;  1MKM A;  3HUM A;  4R23 A;  2EXB A;  3D4F A;  3VP2 A;  3HL9 A;  3CUE A;  5AQ9 A;  3TJZ C;  1OTI A;  2WAD A;  4MN5 A;  4WUJ A;  5FAO A;  4O8G A;  3LR4 A;  2VLG A;  2ZQ7 A;  1PWC A;  2OLU A;  1W8Q A;  3GMW A;  4OQG A;  2QJ7 A;  4NKP A;  5CED A;  1SKO A;  1IYO A;  5E2E A;  4WLA A;  1N9N A;  4I3A A;  3HBR A;  4OOL A;  1QME A;  1KVL A;  1L0E A;  4E04 A;  2K2N A;  4NET A;  1XPB A;  3DW0 A;  1T18 A;  1SCW A;  1ZKJ A;  4WMC A;  2ZQD A;  4OPQ A;  3ZG7 B;  4B4Z A;  4ESP A;  1MXO A;  4G3W A;  5EVI B;  1BYW A;  1S0W A;  3E4Q A;  3FWL A;  3WRZ A;  2XQZ A;  3LIA A;  5L8M A;  4QB8 A;  2Q0O A;  3S22 A;  1YLZ A;  1G6O A;  2QWS A;  3VE3 A;  2Z2M B;  2EX9 A;  3T12 B;  3H9W A;  4QU3 A;  4WF0 A;  3UPO A;  3Q7V A;  3G31 A;  3VP4 A;  4JGQ A;  2OV5 A; 
#chains in the Genus database with same CATH homology
 4KQO A;  1Y54 A;  4ZTK A;  4D2O A;  3Q82 A;  2X71 A;  5EEC A;  4PMA A;  3WS1 A;  4HBT A;  4WZ5 A;  2Y2L A;  3RJU A;  5EPH A;  5HAQ A;  3BLM A;  3IH8 A;  3N8R A;  5FQQ A;  3S4X A;  1W7F A;  4DXB A;  1K54 C;  3GV9 A;  3LO7 A;  1OME A;  5CTN A;  5FI6 A;  1DJA A;  1BZA A;  1ZC2 A;  1PYY A;  1GHM A;  1ES5 A;  4L0L A;  4XUZ A;  3VP3 A;  4R4R A;  2XH9 A;  4X68 A;  2Y91 A;  1QMF A;  2PU2 A;  1VM1 A;  3N7W A;  4QD4 A;  1K56 A;  1YLT A;  5J8X A;  5HW3 A;  5CHM A;  3WWX A;  2HPB A;  3M6H A;  5FAS A;  3V5M A;  4E3L A;  1YQS A;  3A3E A;  3TSG A;  2H5S A;  4KZA A;  3EQU A;  5DTS A;  4BLM A;  2Y59 A;  5CGX A;  2XDM A;  3FV7 A;  1KE4 A;  2X02 A;  3FZC A;  1IKG A;  4RX2 A;  4ZBE A;  5U47 A;  4E3N A;  4EV4 A;  4R4S A;  4OPR A;  5G18 A;  2ZC6 B;  3M2K A;  3PBS A;  4KZ5 A;  3ZVT A;  1XKZ A;  5HFO A;  4PM6 A;  1PZP A;  4PM5 A;  1BSG A;  1SKF A;  4R1G A;  1FQG A;  2IWD A;  3IWI A;  4WYY A;  5HAI A;  4QHC A;  2WYX A;  4ID4 A;  4MLL A;  2Y2M A;  1LI9 A;  3IHA A;  4E3M A;  1PZO A;  2HDU A;  1N4O A;  2WKE A;  1YLY A;  4MNR A;  1BLH A;  2V20 A;  4DE3 A;  3SH7 A;  3MKE A;  2WUQ A;  3UDF A;  3G2Y A;  2FFY A;  3IT9 A;  4UA9 A;  1K54 A;  4XUX A;  1K38 A;  3UPN A;  4OOY A;  1BLP A;  2XFT A;  4OP5 A;  5KZH A;  1J9M A;  2Y2G A;  1VQQ A;  4Y0T A;  4KZ9 A;  3G34 A;  3HVF A;  3PAG A;  1ZG6 A;  2WK0 A;  4OLD A;  3VOZ A;  4IBX A;  1NYM A;  4KZ4 A;  4ZJ3 A;  3WS4 A;  2A49 A;  4KZ7 A;  5CEB A;  5CXW A;  2QZ6 A;  3BM6 A;  1RGY A;  4P0M A;  4PM9 A;  4QY6 A;  1XGJ A;  5KSC A;  3DTM A;  1GA9 A;  4GD8 A;  4S2N A;  4F94 A;  1KGE A;  2Y55 A;  1EI5 A;  3BEC A;  5FQM A;  1L2S A;  1XA7 A;  2VGK A;  3BYD A;  3G2Z A;  1RGZ A;  5E2H A;  5A91 A;  2JCH A;  4FH4 A;  2XF3 A;  1BTL A;  4WMC D;  2HP5 A;  3ZG5 A;  4EQI A;  1AXB A;  3DWK A;  1GHI A;  3MKF A;  2ZQ9 A;  5GHY A;  1IEL A;  3W8K A;  5L2F A;  2V2F F;  4A5R A;  1E25 A;  4N1H A;  2Y2P A;  1K6R A;  2ZM8 A;  3FKV A;  4U3T A;  3QNC A;  3MZE A;  1SDN A;  3OZH A;  3E2L A;  3UPP A;  3WRT A;  3G35 A;  1SDE A;  3GRJ A;  4WBG A;  2ZD8 A;  2XK1 A;  4K0W A;  4OQ0 A;  3LCE A;  4OVD A;  4OPZ A;  1ES4 A;  2R9X A;  3HLD A;  2ZLY A;  5EOO A;  1KE3 A;  4DE1 A;  3EQV A;  2Q9M A;  3QNB A;  4R3B A;  1HVB A;  5DTT A;  3RXW A;  3OCL A;  3OPR A;  5AQA A;  4O7D A;  5DVA A;  1JTD A;  2BLS A;  3A3J A;  3BLS A;  5AQ7 A;  2Y2J A;  3SOI A;  3ZG8 B;  1M40 A;  1ONG A;  1W79 A;  1TDG A;  2ZC5 B;  4X53 A;  4DRT A;  3IWQ A;  2WKH A;  3OPH A;  5D3O A;  2WGW A;  3ZVW A;  2J9O A;  3TG9 A;  1FOF A;  1JTG A;  5I94 A;  4JXS A;  4JF4 A;  3SS3 A;  3MBZ A;  1ERM A;  3VSK A;  4E3K A;  5M18 A;  4KEN B;  3Q81 A;  3HLC A;  3W4O A;  3G4P A;  1YMS A;  5EVI A;  3MXR A;  1BUE A;  2Z2L B;  3VSL A;  5CTM A;  1JVJ A;  3E2K A;  5BOH A;  5JYP A;  1CK3 A;  2WAF A;  4CPK A;  2WZX A;  5E2F A;  3IWO A;  3VP0 A;  1K4E A;  5A93 A;  1H8Y A;  4GNU A;  4MBF A;  4LEN A;  1MPL A;  4BD1 A;  2X01 A;  1CI8 A;  4LV3 A;  4OON A;  2ZQA A;  1GHP A;  1IYS A;  1IEM A;  2G2W A;  3IXB A;  2WGV A;  3Q7Z A;  4LCM A;  3N4I A;  4Y0O A;  3AGE A;  2P74 A;  1DJB A;  3FYZ A;  3ITB A;  3VOY A;  2J8Y A;  4BJP A;  3ITA A;  1YT4 A;  2RL3 A;  2HP9 A;  1K57 C;  5CHJ A;  4Y7P A;  3AGD A;  1CEG A;  1U60 A;  1ERO A;  3C4P A;  3PBR A;  2WAE A;  4RA7 A;  5GL9 A;  1PW8 A;  3IH9 A;  1L0G A;  1KVM A;  4JXG A;  2EXA A;  2C5W B;  3UE0 A;  4BD0 A;  4DE0 A;  4P87 A;  1EWZ A;  4HEF A;  1WYC A;  4N9L A;  1LL5 A;  3O86 A;  1NJ4 A;  4LV2 A;  4C75 A;  1KGG A;  4WEK A;  3UDX A;  2EFU A;  3CMZ A;  4MBH A;  1G6A A;  2ZC7 A;  3OCN A;  1MWS A;  1IYP A;  3VFH A;  4ZDX A;  2H0T A;  3FKW A;  4E3O A;  4X55 A;  3ZFZ A;  1ESU A;  5F1F A;  4EBL A;  4B88 A;  5EVI C;  1K6S A;  2EX2 A;  4LV1 A;  3O87 A;  4OOM A;  5HL1 A;  4KZ3 A;  1LL9 A;  2QPN A;  4OP8 A;  3ZCZ A;  3V39 A;  1KDS A;  1IKI A;  1ZG4 A;  3CZD A;  4S2L A;  4JBF A;  4IVK A;  4LV0 A;  4DDY A;  1PWG A;  5EOE A;  4PPR A;  4GKU A;  4S2P A;  1BUL A;  1E4D A;  1ALQ A;  1NRF A;  2H10 A;  4FCF A;  4UA7 A;  1W8Y A;  1BT5 A;  5DF7 A;  4RYE A;  4E6X A;  5FAQ A;  4S2J A;  2EFX A;  5HAR A;  1MWT A;  5F82 A;  4OQI A;  1E3U D;  1JWZ A;  3IXG A;  1WYB A;  4JF5 A;  2P9V B;  4X56 A;  2RCX A;  3V50 A;  3ZDJ A;  3HRE A;  4E6W A;  3UDI A;  1TVF A;  3I7J A;  4PM8 A;  4JLF A;  4Q8I A;  3SS4 A;  3UY6 A;  3NI9 A;  1HTZ A;  2IWC A;  3BFC A;  1YM1 A;  4GOG A;  3OC2 A;  4WEJ A;  1FR6 A;  4R3J A;  3CJM A;  3ZNT A;  2WGW B;  3VP1 A;  5F1G A;  3DWZ A;  1I2S A;  3HUN A;  2WKI A;  1ESI A;  3PBQ A;  5CGW A;  2FFF B;  2XEP A;  3MZF A;  2JE5 A;  4P85 A;  4JPM A;  2HDR A;  1H5X A;  3SH9 A;  5A90 A;  1ES3 A;  3QHY A;  1Q2P A;  4EBN A;  1DY6 A;  1JWV A;  2PBY A;  4ZAM A;  4WEL A;  5KSH A;  3G30 A;  1MBL A;  5GHZ A;  3N6I A;  1FCO A;  1LI0 A;  1NZO A;  2E8I A;  1S6R A;  3BEB A;  4S2M A;  4C3Q A;  1PWD A;  4H8R A;  3MFD A;  3UO9 A;  1LLB A;  3C5A A;  3NIA A;  4XXR A;  1FR1 A;  4U0X A;  1JWP A;  4BL3 A;  1GA0 A;  4YIN A;  5DF9 A;  3HLG A;  4WM9 A;  3VFF A;  1K25 A;  4N9K A;  4QY5 A;  2OSU A;  2XR0 A;  2QMI A;  3Q7V B;  5CHU A;  3ZHH A;  1CI9 A;  4C6Y A;  5EE8 A;  4S2O A;  4K0X A;  3ZG0 A;  3IF6 A;  3ZNY A;  3IF5 A;  4N1X A;  3GSG A;  3WS5 A;  4BQM A;  5CRF A;  3LEZ A;  1H8Z A;  5DTK A;  2G2U A;  4X6T A;  1NZU A;  3BFD A;  2JBF A;  3BFF A;  2UWX A;  4JF6 A;  4S2N C;  5TGF A;  2Y2N A;  5E43 A;  3N8S A;  1TDL A;  1NY0 A;  1E3U A;  4KZ6 A;  3IHB A;  4UHU A;  5FAT A;  2BG1 A;  3GR2 A;  3GVB A;  1ERQ A;  1YLP A;  1XX2 A;  4Z9Q A;  5HAP A;  1HZO A;  5EUA A;  4EWF A;  4FSF A;  4IBR A;  3HLF A;  3P98 A;  5F83 A;  1N9B A;  3A3D A;  1NYY A;  5FSR A;  4KQR A;  2J9P A;  1K55 C;  1O07 A;  2C6W B;  2OLV A;  3UNW A;  3W4P A;  3A3F A;  4QJG A;  2Y2I A;  4DXC A;  3NDG A;  3OPL A;  2ZM2 A;  1IYQ A;  4K91 A;  4U0T A;  1K56 D;  4CJN A;  4S2K A;  3O88 A;  4ZJ2 A;  2Y2Q A;  4X69 A;  3O3V A;  5CER A;  3Q1F A;  3ZGA B;  5GLA A;  3MXS A;  2Y2O A;  3Q07 A;  1Q2Q A;  3HUO A;  1ES2 A;  1FSW A;  3JYI A;  2EX6 A;  1CEF A;  2WGI A;  3IXD A;  4M3K A;  2ZQC A;  4OKP A;  4OH0 A;  3VMA A;  1FSY A;  2H0Y A;  4JXW A;  1PIO A;  1I5Q A;  4GDB A;  4GN2 A;  5FI2 A;  2J7V A;  3M2J A;  4NK3 A;  2Q9N A;  2VGJ A;  4GDN A;  1MY8 A;  4MEZ A;  1ONH A;  5FQJ A;  2P9V A;  2XLN A;  2ZM0 A;  3W4Q A;  4GD6 A;  3LY3 A;  1L0F A;  3N8L A;  1SHV A;  3SH8 A;  5TR7 A;  4FD8 A;  3C4O A;  3PBN A;  4EUZ A;  1W5D A;  4MBK A;  3V3R A;  4PM7 A;  1FCN A;  2R9W A;  1M6K A;  4DF6 A;  1RP5 A;  2Y2H A;  1K4F A;  3HLB A;  4ZJ1 A;  3GQZ A;  3PAE A;  1GCE A;  4WZ4 A;  5EVL A;  3HUM A;  4R23 A;  2EXB A;  3D4F A;  4R0Q A;  4DE2 A;  3IQA A;  3VP2 A;  3GTC A;  3PBO A;  1MKI A;  4RVA A;  3PTE A;  4KZB A;  5FDH A;  2XFS A;  4KG6 A;  4BL2 A;  3HL9 A;  1L0D A;  2A3U A;  5AQ9 A;  2HDQ A;  1BLC A;  4S2I A;  5GLC A;  3NCK A;  5M1A A;  1K57 A;  1O7E A;  2V1Z A;  5FQK A;  2WAD A;  4UAA A;  1YLW A;  3WS0 A;  1KE0 A;  4B4X A;  5FAO A;  5GLD A;  1PW1 A;  3AGF A;  1XGI A;  4OLG A;  2ZC4 B;  3CG5 A;  3NC8 A;  4HES A;  5GLB A;  5CEC A;  5E2G A;  2ZQ7 A;  1YMX A;  1PWC A;  3BRM A;  4WZ5 C;  5GHX A;  3UE3 A;  2CC1 A;  3ISG A;  2OLU A;  3UN7 A;  5FQI A;  1W8Q A;  3B3X A;  4BEN A;  1HD8 A;  4OPY A;  4JXV A;  2Y4A A;  4N92 A;  3P09 A;  5M19 A;  4KZ8 A;  5CGS A;  3V3S A;  4Y0U A;  3GMW A;  4OQG A;  4GZB A;  1BLS A;  4HBU A;  5CED A;  5FQ9 A;  4GB7 A;  1K55 A;  3MZD A;  1G68 A;  1IYO A;  4OQH A;  3UE1 A;  2XGN A;  3A3I A;  5E2E A;  3ZG9 B;  1FCM A;  4KQQ A;  3IF6 C;  1MWR A;  2B5R A;  1KDW A;  2JC7 A;  5FI7 A;  3HLE A;  4RX3 A;  3HBR A;  4OOL A;  1I2W A;  5FAP A;  5IHV A;  1QME A;  1KVL A;  2Y2K A;  1L0E A;  5FA7 A;  5KMW A;  3C7U A;  4IVI A;  3IXH A;  3BFE A;  4DKI A;  2ZMA A;  1RCJ A;  4NET A;  1XPB A;  3DW0 A;  2DCF A;  1SCW A;  1ZKJ A;  4P6B A;  4E3I A;  1WE4 A;  1NXY A;  3TOI A;  1MWU A;  4YFM A;  4KG5 A;  3BFG A;  1KGF A;  4WMC A;  5DF8 A;  3SS5 A;  2ZQ8 A;  4E3J A;  1XP4 A;  2I72 A;  2HDS A;  2ZQD A;  2XD1 A;  4OPQ A;  5HX9 A;  3ZG7 B;  5JYO A;  4DDS A;  4B4Z A;  1C3B A;  4FH2 A;  1MXO A;  3RXX A;  5EVI B;  1S0W A;  3WRZ A;  3FWL A;  1PI4 A;  2ZC3 B;  4LCL A;  1TEM A;  3G32 A;  3S1Y A;  3WS2 A;  2XQZ A;  2ZJ9 A;  5AQB A;  3M6B A;  1XXM A;  2WZZ A;  2IWB A;  3HLW A;  4QB8 A;  3S22 A;  3NBL A;  1YLZ A;  3LY4 A;  4JKT A;  2XD5 A;  2HP6 A;  2Z2M B;  3C7V A;  4UA6 A;  2EX9 A;  4EBP A;  4IED A;  2EX8 A;  4QU3 A;  2DNS A;  1XA1 A;  3OPP A;  1DJC A;  3NDE A;  1YLJ A;  3UPO A;  5EVI D;  3IF6 B;  3PBT A;  1LHY A;  3Q7V A;  1PI5 A;  1Z6F A;  3G31 A;  2PU4 A;  5TFQ A;  5A92 A;  3NY4 A;  2GDN A;  3VP4 A;  2OV5 A;  4KG2 A;  2DRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...