1LI9A

Crystal structure of tem-34 beta-lactamase at 1.5 angstrom
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMVSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Class A beta-Lactamase- TEM-34
publication title The structural bases of antibiotic resistance in the clinically derived mutant beta-lactamases TEM-30, TEM-32, and TEM-34.
pubmed doi rcsb
source organism Escherichia coli
total genus 95
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1li9A00
3SH7A 3IF5A 3HLGA 3DWZA 2ZQ8A 5E2FA 1WYCA 2WGWA 3DW0A 4E3MA 3D4FA 4WZ5C 1L0GA 1W8QA 1BLPA 4U0XA 2IWDA 4UA9A 3V3SA 4EUZA 1N9BA 4WEKA 5F1GA 5GHZA 3UY6A 3LY4A 1PWGA 3MKEA 1ALQA 4LV0A 4WEJA 4RA7A 5DTSA 4DDYA 4K91A 3P09A 1PWCA 3HL9A 3OPLA 3BM6A 4GKUA 3ZNTA 1E25A 4XXRA 3VFFA 3GVBA 5HAIA 3NIAA 2ZM2A 3Q7ZA 4PM8A 3BECA 4BJPA 1CEFA 1W8YA 1MPLA 1YMXA 4X56A 4Y7PA 1W7FA 5GLDA 4PM5A 1O07A 1K4FA 2X71A 4S2LA 2G2UA 5M1AA 4LV2A 4OPQA 1BZAA 1K38A 1ZKJA 1EROA 3FZCA 2VGKA 3LY3A 4S2KA 5FAPA 2P9VB 4D2OA 3C4OA 1ESUA 2Y2QA 3MZDA 3WRTA 4EWFA 1ES4A 3SH8A 1I2SA 1JTDA 1IKGA 2H10A 1TEMA 2XD5A 4S2JA 1GHMA 3IH8A 1SDNA 4QJGA 4KZ5A 4WZ5A 5CTMA 1Q2PA 1CI9A 3FYZA 3AGEA 4KZ7A 1LLBA 4QY6A 2DNSA 2Y2GA 4FD8A 4WBGA 4NK3A 4MBFA 4OKPA 2G2WA 3JYIA 1K56D 1JWZA 3G32A 5TR7A 3IWOA 3UE3A 1QMEA 3V39A 1MY8A 4WYYA 1ZG4A 5AQBA 3VP4A 4H8RA 1G6AA 1DJAA 3CZDA 3RJUA 4BL2A 3PBQA 3RXWA 3G2YA 4KZ4A 1L2SA 3HUNA 1FOFA 4WZ4A 4O7DA 3GMWA 3MXSA 2R9XA 2WAFA 3N4IA 2I72A 1K4EA 3ITAA 4Q8IA 4E3JA 1DJBA 2HDRA 5DVAA 2UWXA 5KMWA 4M3KA 1H8ZA 5CEDA 1K56A 2V1ZA 1HZOA 4OVDA 4JKTA 2ZQCA 2Y55A 4KZ8A 5L2FA 3N8LA 4DXBA 3Q1FA 1MXOA 3O87A 3VP1A 4DXCA 4E3OA 1C3BA 2EXAA 2R9WA 2EX6A 5F1FA 5E2HA 3BFGA 4X6TA 4FH2A 1MWRA 2EX9A 2ZM0A 4K0WA 1YQSA 3M6HA 4HBUA 2J7VA 3HUOA 1CI8A 3WS0A 3IWQA 1U60A 4LV1A 1LHYA 4P0MA 4QU3A 4ZJ2A 3HREA 1CK3A 3CG5A 3V50A 1FSWA 3AGFA 3UO9A 2ZC5B 4X68A 1K6RA 2IWBA 4R23A 4LV3A 5DTKA 2ZQ7A 3GV9A 2QPNA 3BFDA 4BENA 4R3BA 1RCJA 3PTEA 3VOYA 1IELA 5F83A 2FFYA 4P87A 5EUAA 1JWPA 1PI4A 1XXMA 2ZQ9A 3W4QA 1K54C 4N1HA 5CRFA 1PW8A 4KZ3A 2XFTA 1L0EA 2EX2A 1Z6FA 3OPHA 5J8XA 1I2WA 2ZC3B 4JF4A 5CHUA 1ONHA 5FA7A 4KZAA 3S22A 2OV5A 4EBNA 3PBRA 2XR0A 2Y2JA 4FCFA 1NY0A 3HLCA 5CXWA 2WYXA 1AXBA 2WKEA 1BT5A 3Q07A 1WE4A 5FAQA 3Q82A 3A3FA 5EVIC 3HUMA 4WMCD 1YLPA 1VM1A 3ISGA 4IEDA 2WAEA 4LCLA 2H5SA 1PWDA 5FAOA 5A90A 1MKIA 4S2NC 5FI6A 3CJMA 3A3DA 1YM1A 4JXVA 3WWXA 5GLBA 3M2JA 1KE0A 4KG5A 3G2ZA 5GLCA 1MWUA 1FCOA 2WGIA 3GR2A 3PAEA 4NETA 4RX2A 2JC7A 4EBLA 5GHXA 4KG6A 4OOMA 3ZNYA 3E2LA 3ZCZA 3LCEA 4LENA 3IH9A 4MLLA 4S2PA 3IF6B 1O7EA 1ESIA 4GN2A 3N8SA 4WMCA 5CTNA 1PZOA 2V2FF 4CJNA 2OLUA 3V3RA 3MFDA 4Y0UA 3RXXA 5U47A 3UE0A 5E43A 1KDSA 2Y2HA 1FR1A 5HARA 3UNWA 4X55A 5EPHA 3NCKA 3OPPA 3P98A 4U3TA 5CGWA 2PU4A 3PAGA 5FASA 5M19A 2Y2MA 2J8YA 4KENB 1W79A 2J9OA 2Y2KA 1K25A 5CGXA 1FCNA 4UA7A 3IWIA 4KQOA 1K57C 3W4OA 4UAAA 5HW3A 3Q7VB 3GRJA 5I94A 3UDIA 4BD1A 1H5XA 4EQIA 3EQUA 2WGVA 3PBSA 1E3UD 1NYYA 2HP6A 5DF9A 4ZAMA 1XA7A 2E8IA 2XD1A 3OZHA 4IVKA 1I5QA 2XK1A 3NC8A 5TFQA 4KQRA 2EFUA 2WZZA 1NYMA 1BULA 1NXYA 1TDGA 1KGGA 1EWZA 3BYDA 4EV4A 4DE0A 3HBRA 3C7UA 2J9PA 1IKIA 2DCFA 1XP4A 3G35A 4PM6A 1IYPA 1W5DA 1M40A 4S2IA 3WS1A 3ZVWA 4L0LA 2DRWA 4BL3A 1LI0A 2Y2NA 1PIOA 4OPYA 1EI5A 4ZBEA 1E3UA 3MBZA 4GZBA 2JBFA 5EOOA 2VGJA 4GB7A 2Q9MA 5HFOA 3WS4A 3WRZA 1PZPA 3BRMA 4KQQA 2Y59A 1GA0A 1RGYA 5HL1A 1HTZA 4BQMA 1S0WA 3UE1A 4BLMA 5EE8A 3ZHHA 1QMFA 2PU2A 3W8KA 5FQKA 1G68A 4GNUA 3BLSA 3DWKA 3SOIA 5AQAA 4OQGA 3ZG5A 5BOHA 3GQZA 2WKIA 4RVAA 3N7WA 1XA1A 4PMAA 2P74A 4OP8A 5AQ9A 3WS5A 3ZDJA 4KG2A 5KSCA 4JF6A 5FSRA 1IYSA 3DTMA 4RYEA 1XX2A 2Q9NA 3LO7A 2ZM8A 4UHUA 4P6BA 1YLJA 1YLWA 3OCNA 2WGWB 4WM9A 3G4PA 4Y0OA 2BLSA 3G31A 3QHYA 2Y2LA 3TOIA 5JYOA 4FSFA 4GOGA 1ERQA 2QZ6A 4QD4A 2H0TA 5DF8A 3UPNA 2CC1A 3TG9A 1NJ4A 3G34A 4R4RA 3M2KA 4OQHA 5CEBA 4JXWA 1SCWA 1Q2QA 1CEGA 1OMEA 1LI9A 3HVFA 4ZTKA 4B4ZA 1NRFA 3VP3A 3C5AA 4F94A 2HDUA 5AQ7A 5GL9A 4U0TA 3S1YA 4E3NA 4P85A 4JLFA 4OQ0A 3BLMA 2OSUA 1FSYA 4BD0A 3HLEA 1GHPA 4ZJ3A 5CGSA 1ES5A 3UPPA 3MXRA 4DKIA 3IXHA 5FQQA 2XF3A 3CMZA 3MKFA 2ZD8A 5E2GA 4E6WA 2X01A 3N6IA 3PBNA 4E3LA 3MZFA 4MBHA 4GDNA 2ZJ9A 3S4XA 4DRTA 3QNBA 3BEBA 4X53A 2ZMAA 4OLDA 3ZG0A 1HD8A 2Y4AA 5EVID 4K0XA 4LCMA 5FQ9A 4N9LA 5DF7A 1BSGA 5FATA 1E4DA 2XLNA 2Y91A 1VQQA 1WYBA 1K54A 1K55C 4JXSA 1ES2A 4DDSA 3ZG8B 1Y54A 2RCXA 3VSKA 1KVLA 4E6XA 1BUEA 1TVFA 1ES3A 2EFXA 3BFCA 5HAPA 1YLYA 3ITBA 5FQJA 3PBTA 3FKVA 5CHJA 3BFFA 3IT9A 2XDMA 2EXBA 2Y2IA 1H8YA 1S6RA 3AGDA 4MEZA 4OH0A 1ZG6A 3IXDA 4YINA 1MWSA 4QHCA 3SS3A 5EVIA 3FV7A 4HBTA 4JBFA 1L0DA 4R4SA 1BLCA 4X69A 1PI5A 3IF6C 5GHYA 4EBPA 4S2NA 3NY4A 1IYOA 2XGNA 4XUXA 3ZG9B 4GDBA 1FR6A 1KVMA 1SDEA 1BTLA 1JWVA 2X02A 3UDFA 3ZVTA 4Y0TA 4HEFA 5EECA 5FI7A 3MZEA 4IVIA 4QY5A 1YT4A 3EQVA 1J9MA 2B5RA 2WKHA 1K55A 5KSHA 3NDEA 1SKFA 2EX8A 3IQAA 4OP5A 2RL3A 3IXGA 3NI9A 1FQGA 5M18A 4Z9QA 2XH9A 3IHAA 4OONA 1IYQA 4IBXA 2HP5A 5G18A 5TGFA 3GSGA 3HLBA 1DY6A 3NDGA 4XUZA 4N9KA 2JE5A 2GDNA 3OCLA 1GCEA 2H0YA 2A49A 4R0QA 1PYYA 3IXBA 4DE1A 1BLHA 4C3QA 1N4OA 4IBRA 5GLAA 2QMIA 3HLDA 3TSGA 5HAQA 3V5MA 1DJCA 2Z2LB 3C7VA 2WUQA 3IF6A 3OPRA 4C6YA 1YMSA 3VMAA 1ZC2A 2HDQA 4MBKA 3C4PA 2IWCA 3FWLA 4PM9A 4JF5A 2WZXA 1M6KA 2XEPA 5FQMA 3UDXA 3VFHA 1K57A 4E3KA 1K6SA 1ONGA 4WELA 1IEMA 3HLWA 1HVBA 4DF6A 2Z2MB 5D3OA 4ZDXA 3SS4A 2ZC7A 5HX9A 5EOEA 4ID4A 4PPRA 1XGIA 3SH9A 2P9VA 3OC2A 1RGZA 4S2MA 5E2EA 4R1GA 2WK0A 2JCHA 1SHVA 2ZQDA 3A3EA 2XQZA 4KZ6A 5CERA 3Q7VA 1KGEA 1PW1A 5F82A 4DE2A 1KGFA 1RP5A 3W4PA 5A92A 2ZC4B 3WS2A 2Y2OA 3I7JA 2HDSA 3A3JA 2XFSA 4ZJ1A 1GA9A 4E3IA 3BFEA 3VSLA 2ZLYA 3UPOA 1TDLA 3M6BA 4PM7A 4C75A 3G30A 4S2OA 4UA6A 3QNCA 2HP9A 2PBYA 3GTCA 5EVLA 1MWTA 4OOYA 4OLGA 4KZ9A 3LEZA 1NZOA 1ERMA 4JPMA 5FI2A 1L0FA 4GD8A 3UN7A 1YLTA 2C5WB 3A3IA 4A5RA 1LL9A 3ZGAB 3NBLA 5CHMA 2A3UA 4CPKA 4YFMA 4R3JA 2ZC6B 3ZFZA 4B4XA 1LL5A 2HPBA 5FDHA 3O3VA 3Q81A 5IHVA 1JTGA 4GD6A 4HESA 5A93A 2ZQAA 4B88A 5EVIB 5JYPA 1YLZA 1GHIA 1XKZA 3E2KA 4JXGA 4OQIA 3IHBA 4FH4A 1XPBA 3PBOA 4KZBA 4OPZA 3VP2A 4OPRA 2WADA 3N8RA 3FKWA 2FFFB 2C6WB 1XGJA 1BLSA 3VOZA 1NZUA 3O88A 5DTTA 3SS5A 2Y2PA 5KZHA 3O86A 5FQIA 4N1XA 3HLFA 4OOLA 2BG1A 1KE4A 4QB8A 3ZG7B 4DE3A 3B3XA 4RX3A 5A91A 5CECA 1KDWA 2V20A 4N92A 1KE3A 3VP0A 1MBLA 1FCMA 4MNRA 2OLVA 1JVJA
chains in the Genus database with same CATH superfamily
3R7WA 3HLGA 3DWZA 3TJZC 2WGWA 1L0GA 3D3OA 1W8QA 4EUZA 3F1OA 4WEKA 3UY6A 3LY4A 1PWGA 2JKRI 3BM6A 3ZNTA 3NULA 3GECA 3GVBA 5HAIA 4PM8A 3BECA 4BJPA 1MPLA 1F9IA 4X56A 4Y7PA 5FEFA 4S2LA 1ZKJA 5FAPA 2PAVP 1ES4A 3SH8A 1JTDA 2H10A 2V1AA 2XD5A 4HP4A 2Z6CA 1SDNA 4WZ5A 1Q2PA 1CI9A 4NXGA 4QY6A 2DNSA 4FD8A 4UEYA 4OKPA 3NJAA 1JWZA 3UMDA 3BJNA 1ZG4A 1G6AA 4KZ4A 1L2SA 1FOFA 4WZ4A 4O7DA 3LICA 2R9XA 2WAFA 3ULFA 4E3JA 2HDRA 5DVAA 2UWXA 5DKLA 4OVDA 2PR6A 3FC7A 3N8LA 3Q1FA 3JVVA 3NECA 2KOIA 4WLAA 3K2NA 2EXAA 2EX6A 2O9AA 4FH2A 4HI4A 2FH5A 3IWQA 3KSGA 4DJ3A 3DBAA 5TBMB 3O5YA 4ZJ2A 1P9RA 4DN0A 3V50A 3KYZA 3UO9A 4HQAA 1TS7A 4R23A 4LV3A 2O0YA 2QPNA 3BFDA 4BENA 4R3BA 1RCJA 3F1OB 2ZQ9A 4Y2FA 3W4QA 3LR4A 4N1HA 4KZ3A 1Z6FA 4JF4A 5CHUA 1ONHA 5FA7A 5EM1A 3PBRA 2XR0A 3LIEA 1WE4A 1G28A 3Q82A 3A3FA 5EVIC 5FAQA 1VM1A 3ISGA 5DJTA 3CJMA 1YM1A 4JXVA 4R38A 3ZQ5A 1KE0A 4AFIA 5GLCA 2LB9A 1P0ZA 4LPZA 4EBLA 4KG6A 3MJQA 1ESIA 3N8SA 1PZOA 2V2FF 4CJNA 3BWLA 5HARA 5EPHA 3MFXA 3P98A 4U3TA 3VE3A 4B93A 2L4RA 2J8YA 4EW7A 3MF0A 4KQOA 2A24A 2OAQ1 4EQIA 3EQUA 3PBSA 1NYYA 5C5KA 4ARZA 1G5UA 5EM0A 4Y5FA 1I5QA 4KQRA 4P6ZS 2WZZA 2MJ6A 1TDGA 2GJ3A 4EV4A 4DE0A 2J9PA 2QJ7A 1XP4A 3ICYA 2J3TC 1M40A 2E8JA 3MBZA 5EOOA 2JBFA 5HFOA 2Q9MA 1OTAA 1PZPA 3LI9A 4BQMA 3UE1A 1QMFA 5AVFA 3DWKA 3CAXA 3SOIA 1VETB 3C38A 1TS0A 2JKRM 3N7WA 2P74A 4GLQA 2JKGA 4KUOA 3LO7A 4I38A 2DMWA 4Y0OA 5JYOA 1XJ4A 2Y2LA 3TOIA 2H0TA 2CC1A 4HP9A 4R4RA 4OQHA 4JXWA 3GDIA 1CEGA 2FZ0A 3DAVA 4HHDA 3C5AA 5AQ7A 5FL3A 4JGOA 4P85A 4JLFA 3BLMA 1FSYA 1ES5A 3MXRA 3IXHA 3IX4A 3CMZA 4YOFA 2X01A 1W63M 1XJ2A 4HH3A 3QP1A 4X53A 2ZMAA 4I3JA 3LGOA 3T1SA 4LCMA 4NXFA 3B47A 3OOVA 4B9OA 1VQQA 2KLIA 1K54A 4JXSA 1LL8A 4DDSA 3VSKA 4E6XA 1YLYA 5CHJA 2EXBA 1H8YA 1OTIA 4MEZA 3FV7A 4JBFA 1L0DA 4R4SA 4X69A 3IF6C 3BQ8A 4EBPA 2ZL1A 1IYOA 2XGNA 3H9WA 4GDBA 3DTKA 3LUQA 4LRXC 1SDEA 1BTLA 4Y0TA 4EESA 5EVEA 1SKFA 2RL3A 2XH9A 3IHAA 2ZOHA 4XUZA 3NDGA 4N9KA 2JE5A 3OCLA 4R0QA 1BLHA 4C3QA 5GLAA 1S67L 4CLCC 3QP8A 4CLCE 3C4PA 4ME4A 3VFHA 1M6KA 1ONGA 3MS6A 3HLWA 2Z2MB 5D3OA 1DP6A 5EOEA 4HJ6A 3A0RA 3Q7VA 1PW1A 4X1MA 4JGQA 5F82A 4DE2A 2Y2OA 2OWJA 2XFSA 4ZJ1A 1GA9A 4E3IA 3UPOA 3M6BA 3T4TA 4C75A 3T4JA 2HP9A 3F1PA 4R6LA 4KZ9A 5FI2A 1L0FA 3L7HA 4CPKA 4YFMA 2ZC6B 2EWVA 2W1RA 5EFWA 5FDHA 3IS2B 3E2KA 2UV0E 4D60A 1XPBA 3PBOA 1SKOB 3FKWA 2C6WB 3O88A 4N1XA 3ZG7B 4QB8A 1P9WA 3MSHA 2YKHA 2JN7A 3VP0A 4N92A 1MBLA 4LRYC 1FCMA 2J3WA 4MNRA 1JVJA 5MC7A 3G6OA 1EW0A 4E3MA 3D4FA 4MCWA 3MXQA 3V3SA 2GX5A 1OPXA 3MKEA 4IJGA 3P09A 3CUEA 3HL9A 2W1TA 2LB5A 3H82B 1W7FA 4PM5A 1O07A 1K4FA 1T1AA 2G2UA 5M1AA 4LV2A 4OPQA 5FEGA 3CPTB 4EEUA 1EROA 4D2OA 4S2KA 2IA2A 1ESUA 3LIAA 3ZYTA 3MQQA 1IKGA 1S66L 1TEMA 3K3CA 1GHMA 4QJGA 5DFXA 2PR5A 3AGEA 3UB6A 1STZA 3E0YA 4ESPA 2Y2GA 2G2WA 4WF0A 1GSVA 3G32A 3UE3A 4II7A 4WYYA 3VP4A 3RFBA 3U2AA 3PBQA 4O8GA 3RXWA 3HUNA 3N4IA 3LR0A 5IT5A 3OLOA 4M3KA 1CJFA 3VE4A 5L09A 4JKTA 1KOUA 4KZ8A 1MXOA 4HNBA 1C3BA 4Z1WA 5F1FA 4X6TA 4FTXA 4K0WA 2WKQA 4M4XA 4MN7A 4X68A 5DTKA 2PT7A 1NLZA 1IELA 5F83A 2FFYA 5EUAA 1XXMA 5CRFA 1PW8A 2ZC3B 2OV5A 2Y2JA 4Y13A 3KSHA 4CQHA 2WYXA 1AXBA 3Q07A 1XJ6A 2WKEA 4BBUA 4EETB 2H5SA 1PWDA 4PKYA 4S2NC 2PYPA 3A3DA 4BBTA 2VV7A 4PAUA 1OTEA 3FG8A 3M2JA 3NOPC 1MWUA 1YAXA 5EV0A 3PAEA 4NETA 2JC7A 5F69A 3ZNYA 1D1JA 4LENA 4MLLA 4I3IA 5HDSA 1DRMA 3MFDA 4Y0UA 5U47A 4GS9A 2PD8A 5E43A 1FR1A 3UNWA 4GW9A 1NLYA 3T50A 3OPPA 3CWFA 5CGWA 2H28A 4GHIB 4KENB 4GCZA 2Y2KA 5HW3A 1FCNA 1K57C 4UAAA 3B33A 1N9OA 1CQAA 1ZTUA 2VK3A 5DF9A 3T1QB 4ZAMA 2XD1A 2HJEA 1BULA 1NWZA 5L10A 1EWZA 3G35A 1IYPA 1W5DA 1YSPA 3P7NA 4ETXA 2P08A 2DRWA 4BL3A 1LI0A 2Q0OA 3WS4A 3BRMA 1GA0A 1HTZA 2OAP1 3D72A 3UB9A 3ZHHA 3TE8A 3W8KA 4GNUA 2VGLM 3BLSA 2XA7S 3D9YA 4H6JA 1YKDA 3GQZA 3SW1A 4RVAA 4FUWA 3KX0X 4OP8A 5AQ9A 3ZDJA 5FSRA 1IYSA 3QP2A 4UHUA 3R7WB 5HD3A 1N9LA 1YLJA 1YLWA 5DJUA 2WGWB 2R78A 4WM9A 2EWWA 3QHYA 2QZ6A 5DF8A 3PYPA 3TG9A 3M2KA 1SCWA 1OMEA 3B42A 1LI9A 5TJJA 4B4ZA 2B95A 4F94A 4UQIM 5GL9A 3A0VA 4OQ0A 3LEQA 3HLEA 1GHPA 2M7UA 3TRCA 3UPPA 4DKIA 4MN6A 3MKFA 5E2GA 4E3LA 2BTFP 3N6IA 3MZFA 2D02A 4MBHA 2VLGA 2QJ5A 1LSWA 3LI8A 4DRTA 3BEBA 4E04A 1HD8A 2PRFA 5CX7A 5FQ9A 1UGUA 5DF7A 1E4DA 2V9AA 2XLNA 3T12B 5HL6A 1ES2A 2RCXA 3IBRA 2KDKA 1ES3A 4BWIA 4NKPA 5FQJA 3SZTA 2XDMA 2O99A 2Y2IA 3FPVA 5F68A 3AGDA 1ZG6A 2PDRA 1MWSA 4QHCA 2J80A 4HBTA 1H3QA 5GHYA 3UB5P 3NY4A 4IUKA 1JWVA 1GSXA 3QP6A 5FI7A 1YT4A 3EQVA 1J9MA 2B5RA 3E4OA 5KSHA 2EX8A 2VA0A 5M18A 1FQGA 1OJ5A 4Z9QA 1IFQA 2HP5A 1GCEA 2H0YA 2A49A 1PYYA 3IXBA 2JHEA 4IBRA 1LSXA 4MDZA 1F2KA 3HLDA 5HAQA 1DJCA 3C7VA 3IF6A 3OPRA 4PM9A 2HDQA 3KSFA 2XEPA 1S4SA 1T18A 4E3KA 1K6SA 4ZDXA 3SS4A 1DP8A 2P9VA 1XFQA 1OTBA 1OT6A 5CERA 1Y4OA 3IX8A 1D06A 2ZC4B 4L9EA 1V9YA 2ZLYA 4HIAA 2PBYA 3GTCA 3T4KA 2AVXA 5EVLA 1NZOA 4GD8A 3UN7A 4G3KA 4A5RA 4WUJA 3T4SA 5L07A 1LL9A 3NOTC 3NBLA 4R3JA 2VZWA 3EWKA 3LFVA 1VB6A 3O3VA 3R4KA 5A93A 3QP4A 1T1BA 2PHYA 3KSIA 3A0SA 4FH4A 1TS6A 3VP2A 4OPRA 2WADA 3N8RA 1BLSA 2A24B 4I5SA 5LBRA 5DTTA 2QWSA 3O86A 3HLFA 3B3XA 3F1NA 4ARZB 1KDWA 1KE3A 2OLVA 4G3VA 4RYEA 3BW6A 5E2FA 4G3WA 1BLPA 4UA9A 1N9BA 3TW8A 5DTSA 4K91A 1PWCA 1PNEA 4Q0HA 4GKUA 1E25A 4XXRA 4YWZA 4F3LA 1W8YA 1YSQA 3E4QA 3HJKA 2X71A 4LRZE 1BZAA 3FZCA 2P9VB 3MZDA 5G4ZA 4EWFA 1PFLA 4S2JA 4KZ5A 5CTMA 3EGXC 4KZ7A 5TR7A 3V39A 5IU1A 5DKKA 2K2NA 3GMWA 3MXSA 4L9GA 1K4EA 3ITAA 2V8FA 5CEDA 1HZOA 2ZQCA 2Y55A 5J3WA 4DXBA 2G7UA 3CHWP 3O87A 3VP1A 5E2HA 3UE6A 2EX9A 3VV4A 2J7VA 1CI8A 3WS0A 4Y15A 2VX8A 4LV1A 3HREA 3LR5A 1CK3A 3AGFA 2ZC5B 3K3DA 2IWBA 1FILA 2L1MA 4P6ZM 3GV9A 3MQOA 3W2ZA 3PTEA 1PI4A 2OOLA 1K54C 3S7QA 2GZAA 2XFTA 1L0EA 4RQ9A 2EX2A 3MR0A 2ZL1B 3OPHA 5J8XA 1I2WA 1MC0A 1NY0A 3HLCA 1BT5A 2CMNA 3HUMA 2NUTC 3JVUA 1YLPA 1D7EA 5FI6A 1H0MA 4DJ2A 3WWXA 5GLBA 3C8CA 4KG5A 1FCOA 3GR2A 4RX2A 3PHYA 5DFYA 4WN5A 3E4PA 5GHXA 3ZCZA 1O7EA 1LT0A 5CTNA 2OLUA 3V3RA 3UE0A 4I39A 4XT2A 4O01A 3KYQA 2PU4A 3PAGA 4ZRRA 5M19A 4BMWA 2VJWA 2J9OA 3EOIA 1K25A 1GSWA 4HH2A 2PBDP 3IWIA 3Q7VB 3GRJA 2W3DA 1T1CA 4BD1A 3FPWA 2HV1A 5FDSA 1XA7A 2E8IA 2M1CA 3OZHA 4IVKA 3NC8A 1NYMA 1BYWA 1KGGA 3F1PB 4X25A 2VEAA 3BYDA 4HOIA 5HWVA 2DCFA 3S7OA 5AVEA 3P01A 5J4EA 1Y28A 4MN5A 5HWWA 4S2IA 3WS1A 3ZVWA 4L0LA 3S7NA 2Y2NA 4OPYA 4ZBEA 1EI5A 4DE3A 4GZBA 2VGJA 4GB7A 4KQQA 2Y59A 1XJ3A 4I3AA 1ZHHB 4Q0IA 5FQKA 3L9KA 4QPRA 3PXPA 1IOUA 3KYEA 4OQGA 2WKIA 4L9FA 2B02A 1XA1A 4PMAA 4KG2A 5KSCA 4NG2A 4JF6A 3DTMA 2ZOIA 3G4PA 3G31A 3QP5A 4GOGA 1ERQA 4QD4A 3UPNA 2GNXA 3G34A 3HJIA 3HVFA 4ZTKA 1NRFA 3VP3A 2HDUA 2W1TB 4U0TA 4E3NA 2O9CA 4BD0A 3LIDA 2HGVA 5CGSA 4JGRA 5FQQA 1FIKA 2XF3A 2XRNA 2ZD8A 2JKFA 4E6WA 1Z09A 2V1BA 3CUEC 3S4XA 1NRJA 4OLDA 3ZG0A 3T1RA 5EVID 1BSGA 5FATA 1N9NA 5TBMA 2Y91A 3CITA 1K55C 5HZHA 4YNRA 3ZG8B 1Y54A 1TVFA 3BFCA 3EEAA 5HAPA 3ITBA 3RH8B 3PBTA 3FKVA 3IT9A 1S6RA 3SS3A 5EVIA 1S1YA 1BLCA 5F5YA 1PI5A 4XUXA 3H7WA 4DMZA 1KVMA 2VKSA 2X02A 3ZVTA 5EECA 4IVIA 4WL9A 3DTEA 2WKHA 1MKMA 3IQAA 4OP5A 3RTYA 2WKRA 3IXGA 3NI9A 1A0KA 2L0WA 1IYQA 3PR6A 5G4YA 3GSGA 2W3HA 1DY6A 3EEHA 2QMIA 3TSGA 4C6YA 4IUHA 1YMSA 2JKTI 3VMAA 5HPFA 3FWLA 3UDXA 4JF5A 3BY8A 4WELA 2J3TD 4DF6A 2ZC7A 3BY9A 4ID4A 2QHKA 4PPRA 5E2EA 4R1GA 2WK0A 2JCHA 1SHVA 1T19A 2ZQDA 4KZ6A 1KGEA 1KGFA 3W4PA 3WS2A 2HDSA 3A3JA 1OJGA 1MZUA 3BFEA 3VSLA 4KQDA 3QNCA 1MWTA 3OBFA 4OLGA 1ERMA 3JPUA 1YLTA 2C5WB 1F5MA 2A3UA 4GS9B 3ZFZA 1LL5A 2HPBA 5IHVA 4EERA 1JTGA 4HESA 2ZQAA 5EVIB 1YLZA 1J3WA 1GHIA 1XKZA 4JXGA 4KZBA 4OPZA 4FOFA 2INWA 5IS1A 2FFFB 1VETA 2PD7A 2M7VA 1XGJA 3CLOA 3VOZA 3SS5A 3H7WB 5KZHA 4OOLA 1KE4A 1HLUP 2D01A 4RX3A 5A91A 2V20A 2K7SA 3SH7A 3IF5A 2ZQ8A 1WYCA 3DW0A 4WZ5C 2P7JA 5HD5A 4U0XA 2IWDA 1S4RA 5F1GA 5GHZA 1W63Q 1ALQA 4LV0A 4WEJA 4RA7A 4DDYA 3OPLA 3VFFA 3NIAA 2ZM2A 3Q7ZA 1VEUA 5KIZA 1CEFA 1YMXA 3LIBA 5GLDA 4LGWA 4HJ3A 5I5LA 1K38A 3LY3A 2VGKA 3C4OA 1ACFA 2Y2QA 4H6JB 4JGPA 1P97A 3WRTA 1I2SA 2ZMVA 4EUVA 3IH8A 3FYZA 1LLBA 2WKPA 5HPIA 4WBGA 4NK3A 4MBFA 1XFNA 3JYIA 1K56D 3IWOA 2PYRA 1QMEA 1MY8A 5HWTA 5AQBA 4H8RA 3CZDA 1DJAA 3RJUA 4BL2A 4PHTA 3G2YA 4CLCD 2W27A 2I9VA 2I72A 4Q8IA 2K31A 1DJBA 5KMWA 1DP9A 3VOLA 1H8ZA 2OWHA 4NXEA 2KX6A 1K56A 2V1ZA 4LFUA 2V0UA 5L2FA 2XROA 2HF6A 4BBVA 4Q0JA 4E3OA 4HY8A 4DXCA 3CI6A 2R9WA 3BFGA 3HCYA 4CLCA 1MWRA 2ZM0A 1YQSA 3M6HA 4HBUA 3HUOA 1WA9A 3E98A 1U60A 1LHYA 4P0MA 4QU3A 1G6OA 3CG5A 1FSWA 4NEED 1AWIA 1K6RA 2ZQ7A 3LYXA 3VOYA 4GJ4A 4P87A 1JWPA 3S7PA 1X0OA 3S22A 4KZAA 4EBNA 3T4LA 4EQ1A 1VEUB 4FCFA 1CF0A 5CXWA 1OTDA 2W3FA 5A8BA 1H8MA 2JKTM 4WMCD 4IEDA 4LCLA 2WAEA 4EXOA 5A90A 5FAOA 1MKIA 1JNUA 4Y3IA 1UWNX 2XA7M 3G2ZA 2WGIA 4O0PA 4OOMA 3E2LA 3IX3A 3LCEA 3IH9A 4S2PA 3IF6B 4GN2A 4WMCA 4Y17A 3RXXA 1KDSA 2Y2HA 3U4LP 3UB8A 4X55A 3NCKA 3IS2A 5FASA 1K0KA 2O9BA 2Y2MA 2HZ5A 2A2LA 1W79A 1SKOA 2VV8A 5CGXA 4UA7A 3W4OA 5I94A 3UDIA 1H5XA 3T4QA 2WGVA 1E3UD 3EGDC 2HP6A 1OT9A 2XK1A 4CLCB 5TFQA 2EFUA 1NXYA 3BQAA 5L8MA 5J7EA 3HBRA 3C7UA 1S1ZA 3UB7A 2Y79A 5AJGA 1IKIA 4PM6A 1VHMA 1PIOA 4BLMA 5HDDA 1E3UA 3WRZA 1PRQA 3C30A 1RGYA 3H82A 5HL1A 1S0WA 2ZMFA 5EE8A 2PU2A 3CPTA 1G68A 4X1LA 5AQAA 3ZG5A 5BOHA 1TF1A 3F1NB 3WS5A 1XX2A 2Q9NA 2ZBBA 2ZM8A 4P6BA 1TS8A 3IBJA 3OCNA 2BLSA 2P04A 4FSFA 1NJ4A 3KO6A 5CEBA 1Q2QA 2ACGA 4ETZA 3S1YA 2BASA 2OSUA 4F3LB 4ZJ3A 1UWPX 2NUPC 4EEPA 3PBNA 3LR3A 4GDNA 2ZJ9A 3QNBA 5K5BA 2Y4AA 4K0XA 3T1XA 4N9LA 1WYBA 1KVLA 1SZVA 1BUEA 2EFXA 1TD5A 3MQ0A 3BFFA 2QKPA 2B18A 4OH0A 4PKYG 4YINA 3IXDA 2VGLS 2XSSA 3LIFA 4QWOA 5HSQA 2VV6A 4S2NA 4MMNA 1LSVA 2QYBA 4NXBA 3ZG9B 1FR6A 1ODVA 1F98A 3UDFA 4HEFA 3MZEA 4QY5A 4IHQA 1K55A 3NDEA 4K08A 4OONA 4IBXA 5G18A 5TGFA 3UMEA 3HLBA 2GDNA 4DE1A 1N4OA 4KUKA 4UQIS 4R3AA 2V8CA 3V5MA 2Z2LB 2WUQA 5HDCA 1ZC2A 4MBKA 2IWCA 2WZXA 5FQMA 1K57A 1YPRA 1IEMA 1HVBA 5HX9A 3DTIA 1XGIA 3SH9A 3OC2A 1RGZA 4S2MA 4GHIA 2W3GA 4EU0A 3A3EA 3MMHA 1RP5A 4R70A 2W3EA 5A92A 3I7JA 1L3LA 4HJ4A 3V67A 2Y8HA 1TDLA 4PM7A 3G30A 4S2OA 4UA6A 3T4OA 3NOUC 4OOYA 2EA9A 3LEZA 4JPMA 3A3IA 3NHQA 2HJ9C 4LLOB 3ZGAB 3C2WA 5CHMA 4B4XA 4XT2B 3Q81A 4GD6A 2V0WA 4B88A 5JYPA 2YKFA 5F6AA 2Z6DA 4OQIA 3IHBA 1NZUA 2Y2PA 5FQIA 1V9ZA 2BG1A 5CECA 2XQZA 2W0NA
chains in the Genus database with same CATH topology
3SH7A 3IF5A 3HLGA 3DWZA 2ZQ8A 5E2FA 1WYCA 2WGWA 3DW0A 4E3MA 3D4FA 4WZ5C 1L0GA 1W8QA 1BLPA 4U0XA 2IWDA 4UA9A 3V3SA 4EUZA 1N9BA 4WEKA 5F1GA 5GHZA 3UY6A 3LY4A 1PWGA 3MKEA 1ALQA 4LV0A 4WEJA 4RA7A 5DTSA 4DDYA 4K91A 3P09A 1PWCA 3HL9A 3OPLA 3BM6A 4GKUA 3ZNTA 1E25A 4XXRA 3VFFA 3GVBA 5HAIA 3NIAA 2ZM2A 3Q7ZA 4PM8A 3BECA 4BJPA 1CEFA 1W8YA 1MPLA 1YMXA 4X56A 4Y7PA 1W7FA 5GLDA 4PM5A 1O07A 1K4FA 2X71A 4S2LA 2G2UA 5M1AA 4LV2A 4OPQA 1BZAA 1K38A 1ZKJA 1EROA 3FZCA 2VGKA 3LY3A 4S2KA 5FAPA 2P9VB 4D2OA 3C4OA 1ESUA 2Y2QA 3MZDA 3WRTA 4EWFA 1ES4A 3SH8A 1I2SA 1JTDA 1IKGA 2H10A 1TEMA 2XD5A 4S2JA 1GHMA 3IH8A 1SDNA 4QJGA 4KZ5A 4WZ5A 5CTMA 1Q2PA 1CI9A 3FYZA 3AGEA 4KZ7A 1LLBA 4QY6A 2DNSA 2Y2GA 4FD8A 4WBGA 4NK3A 4MBFA 4OKPA 2G2WA 3JYIA 1K56D 1JWZA 3G32A 5TR7A 3IWOA 3UE3A 1QMEA 3V39A 1MY8A 4WYYA 1ZG4A 5AQBA 3VP4A 4H8RA 1G6AA 1DJAA 3CZDA 3RJUA 4BL2A 3PBQA 3RXWA 3G2YA 4KZ4A 1L2SA 3HUNA 1FOFA 4WZ4A 4O7DA 3GMWA 3MXSA 2R9XA 2WAFA 3N4IA 2I72A 1K4EA 3ITAA 4Q8IA 4E3JA 1DJBA 2HDRA 5DVAA 2UWXA 5KMWA 4M3KA 1H8ZA 5CEDA 1K56A 2V1ZA 1HZOA 4OVDA 4JKTA 2ZQCA 2Y55A 4KZ8A 5L2FA 3N8LA 4DXBA 3Q1FA 1MXOA 3O87A 3VP1A 4DXCA 4E3OA 1C3BA 2EXAA 2R9WA 2EX6A 5F1FA 5E2HA 3BFGA 4X6TA 4FH2A 1MWRA 2EX9A 2ZM0A 4K0WA 1YQSA 3M6HA 4HBUA 2J7VA 3HUOA 1CI8A 3WS0A 3IWQA 1U60A 4LV1A 1LHYA 4P0MA 4QU3A 4ZJ2A 3HREA 1CK3A 3CG5A 3V50A 1FSWA 3AGFA 3UO9A 2ZC5B 4X68A 1K6RA 2IWBA 4R23A 4LV3A 5DTKA 2ZQ7A 3GV9A 2QPNA 3BFDA 4BENA 4R3BA 1RCJA 3PTEA 3VOYA 1IELA 5F83A 2FFYA 4P87A 5EUAA 1JWPA 1PI4A 1XXMA 2ZQ9A 3W4QA 1K54C 4N1HA 5CRFA 1PW8A 4KZ3A 2XFTA 1L0EA 2EX2A 1Z6FA 3OPHA 5J8XA 1I2WA 2ZC3B 4JF4A 5CHUA 1ONHA 5FA7A 4KZAA 3S22A 2OV5A 4EBNA 3PBRA 2XR0A 2Y2JA 4FCFA 1NY0A 3HLCA 5CXWA 2WYXA 1AXBA 2WKEA 1BT5A 3Q07A 1WE4A 5FAQA 3Q82A 3A3FA 5EVIC 3HUMA 4WMCD 1YLPA 1VM1A 3ISGA 4IEDA 2WAEA 4LCLA 2H5SA 1PWDA 5FAOA 5A90A 1MKIA 4S2NC 5FI6A 3CJMA 3A3DA 1YM1A 4JXVA 3WWXA 5GLBA 3M2JA 1KE0A 4KG5A 3G2ZA 5GLCA 1MWUA 1FCOA 2WGIA 3GR2A 3PAEA 4NETA 4RX2A 2JC7A 4EBLA 5GHXA 4KG6A 4OOMA 3ZNYA 3E2LA 3ZCZA 3LCEA 4LENA 3IH9A 4MLLA 4S2PA 3IF6B 1O7EA 1ESIA 4GN2A 3N8SA 4WMCA 5CTNA 1PZOA 2V2FF 4CJNA 2OLUA 3V3RA 3MFDA 4Y0UA 3RXXA 5U47A 3UE0A 5E43A 1KDSA 2Y2HA 1FR1A 5HARA 3UNWA 4X55A 5EPHA 3NCKA 3OPPA 3P98A 4U3TA 5CGWA 2PU4A 3PAGA 5FASA 5M19A 2Y2MA 2J8YA 4KENB 1W79A 2J9OA 2Y2KA 1K25A 5CGXA 1FCNA 4UA7A 3IWIA 4KQOA 1K57C 3W4OA 4UAAA 5HW3A 3Q7VB 3GRJA 5I94A 3UDIA 4BD1A 1H5XA 4EQIA 3EQUA 2WGVA 3PBSA 1E3UD 1NYYA 2HP6A 5DF9A 4ZAMA 1XA7A 2E8IA 2XD1A 3OZHA 4IVKA 1I5QA 2XK1A 3NC8A 5TFQA 4KQRA 2EFUA 2WZZA 1NYMA 1BULA 1NXYA 1TDGA 1KGGA 1EWZA 3BYDA 4EV4A 4DE0A 3HBRA 3C7UA 2J9PA 1IKIA 2DCFA 1XP4A 3G35A 4PM6A 1IYPA 1W5DA 1M40A 4S2IA 3WS1A 3ZVWA 4L0LA 2DRWA 4BL3A 1LI0A 2Y2NA 1PIOA 4OPYA 1EI5A 4ZBEA 1E3UA 3MBZA 4GZBA 2JBFA 5EOOA 2VGJA 4GB7A 2Q9MA 5HFOA 3WS4A 3WRZA 1PZPA 3BRMA 4KQQA 2Y59A 1GA0A 1RGYA 5HL1A 1HTZA 4BQMA 1S0WA 3UE1A 4BLMA 5EE8A 3ZHHA 1QMFA 2PU2A 3W8KA 5FQKA 1G68A 4GNUA 3BLSA 3DWKA 3SOIA 5AQAA 4OQGA 3ZG5A 5BOHA 3GQZA 2WKIA 4RVAA 3N7WA 1XA1A 4PMAA 2P74A 4OP8A 5AQ9A 3WS5A 3ZDJA 4KG2A 5KSCA 4JF6A 5FSRA 1IYSA 3DTMA 4RYEA 1XX2A 2Q9NA 3LO7A 2ZM8A 4UHUA 4P6BA 1YLJA 1YLWA 3OCNA 2WGWB 4WM9A 3G4PA 4Y0OA 2BLSA 3G31A 3QHYA 2Y2LA 3TOIA 5JYOA 4FSFA 4GOGA 1ERQA 2QZ6A 4QD4A 2H0TA 5DF8A 3UPNA 2CC1A 3TG9A 1NJ4A 3G34A 4R4RA 3M2KA 4OQHA 5CEBA 4JXWA 1SCWA 1Q2QA 1CEGA 1OMEA 1LI9A 3HVFA 4ZTKA 4B4ZA 1NRFA 3VP3A 3C5AA 4F94A 2HDUA 5AQ7A 5GL9A 4U0TA 3S1YA 4E3NA 4P85A 4JLFA 4OQ0A 3BLMA 2OSUA 1FSYA 4BD0A 3HLEA 1GHPA 4ZJ3A 5CGSA 1ES5A 3UPPA 3MXRA 4DKIA 3IXHA 5FQQA 2XF3A 3CMZA 3MKFA 2ZD8A 5E2GA 4E6WA 2X01A 3N6IA 3PBNA 4E3LA 3MZFA 4MBHA 4GDNA 2ZJ9A 3S4XA 4DRTA 3QNBA 3BEBA 4X53A 2ZMAA 4OLDA 3ZG0A 1HD8A 2Y4AA 5EVID 4K0XA 4LCMA 5FQ9A 4N9LA 5DF7A 1BSGA 5FATA 1E4DA 2XLNA 2Y91A 1VQQA 1WYBA 1K54A 1K55C 4JXSA 1ES2A 4DDSA 3ZG8B 1Y54A 2RCXA 3VSKA 1KVLA 4E6XA 1BUEA 1TVFA 1ES3A 2EFXA 3BFCA 5HAPA 1YLYA 3ITBA 5FQJA 3PBTA 3FKVA 5CHJA 3BFFA 3IT9A 2XDMA 2EXBA 2Y2IA 1H8YA 1S6RA 3AGDA 4MEZA 4OH0A 1ZG6A 3IXDA 4YINA 1MWSA 4QHCA 3SS3A 5EVIA 3FV7A 4HBTA 4JBFA 1L0DA 4R4SA 1BLCA 4X69A 1PI5A 3IF6C 5GHYA 4EBPA 4S2NA 3NY4A 1IYOA 2XGNA 4XUXA 3ZG9B 4GDBA 1FR6A 1KVMA 1SDEA 1BTLA 1JWVA 2X02A 3UDFA 3ZVTA 4Y0TA 4HEFA 5EECA 5FI7A 3MZEA 4IVIA 4QY5A 1YT4A 3EQVA 1J9MA 2B5RA 2WKHA 1K55A 5KSHA 3NDEA 1SKFA 2EX8A 3IQAA 4OP5A 2RL3A 3IXGA 3NI9A 1FQGA 5M18A 4Z9QA 2XH9A 3IHAA 4OONA 1IYQA 4IBXA 2HP5A 5G18A 5TGFA 3GSGA 3HLBA 1DY6A 3NDGA 4XUZA 4N9KA 2JE5A 2GDNA 3OCLA 1GCEA 2H0YA 2A49A 4R0QA 1PYYA 3IXBA 4DE1A 1BLHA 4C3QA 1N4OA 4IBRA 5GLAA 2QMIA 3HLDA 3TSGA 5HAQA 3V5MA 1DJCA 2Z2LB 3C7VA 2WUQA 3IF6A 3OPRA 4C6YA 1YMSA 3VMAA 1ZC2A 2HDQA 4MBKA 3C4PA 2IWCA 3FWLA 4PM9A 4JF5A 2WZXA 1M6KA 2XEPA 5FQMA 3UDXA 3VFHA 1K57A 4E3KA 1K6SA 1ONGA 4WELA 1IEMA 3HLWA 1HVBA 4DF6A 2Z2MB 5D3OA 4ZDXA 3SS4A 2ZC7A 5HX9A 5EOEA 4ID4A 4PPRA 1XGIA 3SH9A 2P9VA 3OC2A 1RGZA 4S2MA 5E2EA 4R1GA 2WK0A 2JCHA 1SHVA 2ZQDA 3A3EA 2XQZA 4KZ6A 5CERA 3Q7VA 1KGEA 1PW1A 5F82A 4DE2A 1KGFA 1RP5A 3W4PA 5A92A 2ZC4B 3WS2A 2Y2OA 3I7JA 2HDSA 3A3JA 2XFSA 4ZJ1A 1GA9A 4E3IA 3BFEA 3VSLA 2ZLYA 3UPOA 1TDLA 3M6BA 4PM7A 4C75A 3G30A 4S2OA 4UA6A 3QNCA 2HP9A 2PBYA 3GTCA 5EVLA 1MWTA 4OOYA 4OLGA 4KZ9A 3LEZA 1NZOA 1ERMA 4JPMA 5FI2A 1L0FA 4GD8A 3UN7A 1YLTA 2C5WB 3A3IA 4A5RA 1LL9A 3ZGAB 3NBLA 5CHMA 2A3UA 4CPKA 4YFMA 4R3JA 2ZC6B 3ZFZA 4B4XA 1LL5A 2HPBA 5FDHA 3O3VA 3Q81A 5IHVA 1JTGA 4GD6A 4HESA 5A93A 2ZQAA 4B88A 5EVIB 5JYPA 1YLZA 1GHIA 1XKZA 3E2KA 4JXGA 4OQIA 3IHBA 4FH4A 1XPBA 3PBOA 4KZBA 4OPZA 3VP2A 4OPRA 2WADA 3N8RA 3FKWA 2FFFB 2C6WB 1XGJA 1BLSA 3VOZA 1NZUA 3O88A 5DTTA 3SS5A 2Y2PA 5KZHA 3O86A 5FQIA 4N1XA 3HLFA 4OOLA 2BG1A 1KE4A 4QB8A 3ZG7B 4DE3A 3B3XA 4RX3A 5A91A 5CECA 1KDWA 2V20A 4N92A 1KE3A 3VP0A 1MBLA 1FCMA 4MNRA 2OLVA 1JVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SH7 A;  3IF5 A;  3HLG A;  3DWZ A;  2ZQ8 A;  5E2F A;  1WYC A;  2WGW A;  3DW0 A;  4E3M A;  3D4F A;  4WZ5 C;  1L0G A;  1W8Q A;  1BLP A;  4U0X A;  2IWD A;  4UA9 A;  3V3S A;  4EUZ A;  1N9B A;  4WEK A;  5F1G A;  5GHZ A;  3UY6 A;  3LY4 A;  1PWG A;  3MKE A;  1ALQ A;  4LV0 A;  4WEJ A;  4RA7 A;  5DTS A;  4DDY A;  4K91 A;  3P09 A;  1PWC A;  3HL9 A;  3OPL A;  3BM6 A;  4GKU A;  3ZNT A;  1E25 A;  4XXR A;  3VFF A;  3GVB A;  5HAI A;  3NIA A;  2ZM2 A;  3Q7Z A;  4PM8 A;  3BEC A;  4BJP A;  1CEF A;  1W8Y A;  1MPL A;  1YMX A;  4X56 A;  4Y7P A;  1W7F A;  5GLD A;  4PM5 A;  1O07 A;  1K4F A;  2X71 A;  4S2L A;  2G2U A;  5M1A A;  4LV2 A;  4OPQ A;  1BZA A;  1K38 A;  1ZKJ A;  1ERO A;  3FZC A;  2VGK A;  3LY3 A;  4S2K A;  5FAP A;  2P9V B;  4D2O A;  3C4O A;  1ESU A;  2Y2Q A;  3MZD A;  3WRT A;  4EWF A;  1ES4 A;  3SH8 A;  1I2S A;  1JTD A;  1IKG A;  2H10 A;  1TEM A;  2XD5 A;  4S2J A;  1GHM A;  3IH8 A;  1SDN A;  4QJG A;  4KZ5 A;  4WZ5 A;  5CTM A;  1Q2P A;  1CI9 A;  3FYZ A;  3AGE A;  4KZ7 A;  1LLB A;  4QY6 A;  2DNS A;  2Y2G A;  4FD8 A;  4WBG A;  4NK3 A;  4MBF A;  4OKP A;  2G2W A;  3JYI A;  1K56 D;  1JWZ A;  3G32 A;  5TR7 A;  3IWO A;  3UE3 A;  1QME A;  3V39 A;  1MY8 A;  4WYY A;  1ZG4 A;  5AQB A;  3VP4 A;  4H8R A;  1G6A A;  1DJA A;  3CZD A;  3RJU A;  4BL2 A;  3PBQ A;  3RXW A;  3G2Y A;  4KZ4 A;  1L2S A;  3HUN A;  1FOF A;  4WZ4 A;  4O7D A;  3GMW A;  3MXS A;  2R9X A;  2WAF A;  3N4I A;  2I72 A;  1K4E A;  3ITA A;  4Q8I A;  4E3J A;  1DJB A;  2HDR A;  5DVA A;  2UWX A;  5KMW A;  4M3K A;  1H8Z A;  5CED A;  1K56 A;  2V1Z A;  1HZO A;  4OVD A;  4JKT A;  2ZQC A;  2Y55 A;  4KZ8 A;  5L2F A;  3N8L A;  4DXB A;  3Q1F A;  1MXO A;  3O87 A;  3VP1 A;  4DXC A;  4E3O A;  1C3B A;  2EXA A;  2R9W A;  2EX6 A;  5F1F A;  5E2H A;  3BFG A;  4X6T A;  4FH2 A;  1MWR A;  2EX9 A;  2ZM0 A;  4K0W A;  1YQS A;  3M6H A;  4HBU A;  2J7V A;  3HUO A;  1CI8 A;  3WS0 A;  3IWQ A;  1U60 A;  4LV1 A;  1LHY A;  4P0M A;  4QU3 A;  4ZJ2 A;  3HRE A;  1CK3 A;  3CG5 A;  3V50 A;  1FSW A;  3AGF A;  3UO9 A;  2ZC5 B;  4X68 A;  1K6R A;  2IWB A;  4R23 A;  4LV3 A;  5DTK A;  2ZQ7 A;  3GV9 A;  2QPN A;  3BFD A;  4BEN A;  4R3B A;  1RCJ A;  3PTE A;  3VOY A;  1IEL A;  5F83 A;  2FFY A;  4P87 A;  5EUA A;  1JWP A;  1PI4 A;  1XXM A;  2ZQ9 A;  3W4Q A;  1K54 C;  4N1H A;  5CRF A;  1PW8 A;  4KZ3 A;  2XFT A;  1L0E A;  2EX2 A;  1Z6F A;  3OPH A;  5J8X A;  1I2W A;  2ZC3 B;  4JF4 A;  5CHU A;  1ONH A;  5FA7 A;  4KZA A;  3S22 A;  2OV5 A;  4EBN A;  3PBR A;  2XR0 A;  2Y2J A;  4FCF A;  1NY0 A;  3HLC A;  5CXW A;  2WYX A;  1AXB A;  2WKE A;  1BT5 A;  3Q07 A;  1WE4 A;  5FAQ A;  3Q82 A;  3A3F A;  5EVI C;  3HUM A;  4WMC D;  1YLP A;  1VM1 A;  3ISG A;  4IED A;  2WAE A;  4LCL A;  2H5S A;  1PWD A;  5FAO A;  5A90 A;  1MKI A;  4S2N C;  5FI6 A;  3CJM A;  3A3D A;  1YM1 A;  4JXV A;  3WWX A;  5GLB A;  3M2J A;  1KE0 A;  4KG5 A;  3G2Z A;  5GLC A;  1MWU A;  1FCO A;  2WGI A;  3GR2 A;  3PAE A;  4NET A;  4RX2 A;  2JC7 A;  4EBL A;  5GHX A;  4KG6 A;  4OOM A;  3ZNY A;  3E2L A;  3ZCZ A;  3LCE A;  4LEN A;  3IH9 A;  4MLL A;  4S2P A;  3IF6 B;  1O7E A;  1ESI A;  4GN2 A;  3N8S A;  4WMC A;  5CTN A;  1PZO A;  2V2F F;  4CJN A;  2OLU A;  3V3R A;  3MFD A;  4Y0U A;  3RXX A;  5U47 A;  3UE0 A;  5E43 A;  1KDS A;  2Y2H A;  1FR1 A;  5HAR A;  3UNW A;  4X55 A;  5EPH A;  3NCK A;  3OPP A;  3P98 A;  4U3T A;  5CGW A;  2PU4 A;  3PAG A;  5FAS A;  5M19 A;  2Y2M A;  2J8Y A;  4KEN B;  1W79 A;  2J9O A;  2Y2K A;  1K25 A;  5CGX A;  1FCN A;  4UA7 A;  3IWI A;  4KQO A;  1K57 C;  3W4O A;  4UAA A;  5HW3 A;  3Q7V B;  3GRJ A;  5I94 A;  3UDI A;  4BD1 A;  1H5X A;  4EQI A;  3EQU A;  2WGV A;  3PBS A;  1E3U D;  1NYY A;  2HP6 A;  5DF9 A;  4ZAM A;  1XA7 A;  2E8I A;  2XD1 A;  3OZH A;  4IVK A;  1I5Q A;  2XK1 A;  3NC8 A;  5TFQ A;  4KQR A;  2EFU A;  2WZZ A;  1NYM A;  1BUL A;  1NXY A;  1TDG A;  1KGG A;  1EWZ A;  3BYD A;  4EV4 A;  4DE0 A;  3HBR A;  3C7U A;  2J9P A;  1IKI A;  2DCF A;  1XP4 A;  3G35 A;  4PM6 A;  1IYP A;  1W5D A;  1M40 A;  4S2I A;  3WS1 A;  3ZVW A;  4L0L A;  2DRW A;  4BL3 A;  1LI0 A;  2Y2N A;  1PIO A;  4OPY A;  1EI5 A;  4ZBE A;  1E3U A;  3MBZ A;  4GZB A;  2JBF A;  5EOO A;  2VGJ A;  4GB7 A;  2Q9M A;  5HFO A;  3WS4 A;  3WRZ A;  1PZP A;  3BRM A;  4KQQ A;  2Y59 A;  1GA0 A;  1RGY A;  5HL1 A;  1HTZ A;  4BQM A;  1S0W A;  3UE1 A;  4BLM A;  5EE8 A;  3ZHH A;  1QMF A;  2PU2 A;  3W8K A;  5FQK A;  1G68 A;  4GNU A;  3BLS A;  3DWK A;  3SOI A;  5AQA A;  4OQG A;  3ZG5 A;  5BOH A;  3GQZ A;  2WKI A;  4RVA A;  3N7W A;  1XA1 A;  4PMA A;  2P74 A;  4OP8 A;  5AQ9 A;  3WS5 A;  3ZDJ A;  4KG2 A;  5KSC A;  4JF6 A;  5FSR A;  1IYS A;  3DTM A;  4RYE A;  1XX2 A;  2Q9N A;  3LO7 A;  2ZM8 A;  4UHU A;  4P6B A;  1YLJ A;  1YLW A;  3OCN A;  2WGW B;  4WM9 A;  3G4P A;  4Y0O A;  2BLS A;  3G31 A;  3QHY A;  2Y2L A;  3TOI A;  5JYO A;  4FSF A;  4GOG A;  1ERQ A;  2QZ6 A;  4QD4 A;  2H0T A;  5DF8 A;  3UPN A;  2CC1 A;  3TG9 A;  1NJ4 A;  3G34 A;  4R4R A;  3M2K A;  4OQH A;  5CEB A;  4JXW A;  1SCW A;  1Q2Q A;  1CEG A;  1OME A;  1LI9 A;  3HVF A;  4ZTK A;  4B4Z A;  1NRF A;  3VP3 A;  3C5A A;  4F94 A;  2HDU A;  5AQ7 A;  5GL9 A;  4U0T A;  3S1Y A;  4E3N A;  4P85 A;  4JLF A;  4OQ0 A;  3BLM A;  2OSU A;  1FSY A;  4BD0 A;  3HLE A;  1GHP A;  4ZJ3 A;  5CGS A;  1ES5 A;  3UPP A;  3MXR A;  4DKI A;  3IXH A;  5FQQ A;  2XF3 A;  3CMZ A;  3MKF A;  2ZD8 A;  5E2G A;  4E6W A;  2X01 A;  3N6I A;  3PBN A;  4E3L A;  3MZF A;  4MBH A;  4GDN A;  2ZJ9 A;  3S4X A;  4DRT A;  3QNB A;  3BEB A;  4X53 A;  2ZMA A;  4OLD A;  3ZG0 A;  1HD8 A;  2Y4A A;  5EVI D;  4K0X A;  4LCM A;  5FQ9 A;  4N9L A;  5DF7 A;  1BSG A;  5FAT A;  1E4D A;  2XLN A;  2Y91 A;  1VQQ A;  1WYB A;  1K54 A;  1K55 C;  4JXS A;  1ES2 A;  4DDS A;  3ZG8 B;  1Y54 A;  2RCX A;  3VSK A;  1KVL A;  4E6X A;  1BUE A;  1TVF A;  1ES3 A;  2EFX A;  3BFC A;  5HAP A;  1YLY A;  3ITB A;  5FQJ A;  3PBT A;  3FKV A;  5CHJ A;  3BFF A;  3IT9 A;  2XDM A;  2EXB A;  2Y2I A;  1H8Y A;  1S6R A;  3AGD A;  4MEZ A;  4OH0 A;  1ZG6 A;  3IXD A;  4YIN A;  1MWS A;  4QHC A;  3SS3 A;  5EVI A;  3FV7 A;  4HBT A;  4JBF A;  1L0D A;  4R4S A;  1BLC A;  4X69 A;  1PI5 A;  3IF6 C;  5GHY A;  4EBP A;  4S2N A;  3NY4 A;  1IYO A;  2XGN A;  4XUX A;  3ZG9 B;  4GDB A;  1FR6 A;  1KVM A;  1SDE A;  1BTL A;  1JWV A;  2X02 A;  3UDF A;  3ZVT A;  4Y0T A;  4HEF A;  5EEC A;  5FI7 A;  3MZE A;  4IVI A;  4QY5 A;  1YT4 A;  3EQV A;  1J9M A;  2B5R A;  2WKH A;  1K55 A;  5KSH A;  3NDE A;  1SKF A;  2EX8 A;  3IQA A;  4OP5 A;  2RL3 A;  3IXG A;  3NI9 A;  1FQG A;  5M18 A;  4Z9Q A;  2XH9 A;  3IHA A;  4OON A;  1IYQ A;  4IBX A;  2HP5 A;  5G18 A;  5TGF A;  3GSG A;  3HLB A;  1DY6 A;  3NDG A;  4XUZ A;  4N9K A;  2JE5 A;  2GDN A;  3OCL A;  1GCE A;  2H0Y A;  2A49 A;  4R0Q A;  1PYY A;  3IXB A;  4DE1 A;  1BLH A;  4C3Q A;  1N4O A;  4IBR A;  5GLA A;  2QMI A;  3HLD A;  3TSG A;  5HAQ A;  3V5M A;  1DJC A;  2Z2L B;  3C7V A;  2WUQ A;  3IF6 A;  3OPR A;  4C6Y A;  1YMS A;  3VMA A;  1ZC2 A;  2HDQ A;  4MBK A;  3C4P A;  2IWC A;  3FWL A;  4PM9 A;  4JF5 A;  2WZX A;  1M6K A;  2XEP A;  5FQM A;  3UDX A;  3VFH A;  1K57 A;  4E3K A;  1K6S A;  1ONG A;  4WEL A;  1IEM A;  3HLW A;  1HVB A;  4DF6 A;  2Z2M B;  5D3O A;  4ZDX A;  3SS4 A;  2ZC7 A;  5HX9 A;  5EOE A;  4ID4 A;  4PPR A;  1XGI A;  3SH9 A;  2P9V A;  3OC2 A;  1RGZ A;  4S2M A;  5E2E A;  4R1G A;  2WK0 A;  2JCH A;  1SHV A;  2ZQD A;  3A3E A;  2XQZ A;  4KZ6 A;  5CER A;  3Q7V A;  1KGE A;  1PW1 A;  5F82 A;  4DE2 A;  1KGF A;  1RP5 A;  3W4P A;  5A92 A;  2ZC4 B;  3WS2 A;  2Y2O A;  3I7J A;  2HDS A;  3A3J A;  2XFS A;  4ZJ1 A;  1GA9 A;  4E3I A;  3BFE A;  3VSL A;  2ZLY A;  3UPO A;  1TDL A;  3M6B A;  4PM7 A;  4C75 A;  3G30 A;  4S2O A;  4UA6 A;  3QNC A;  2HP9 A;  2PBY A;  3GTC A;  5EVL A;  1MWT A;  4OOY A;  4OLG A;  4KZ9 A;  3LEZ A;  1NZO A;  1ERM A;  4JPM A;  5FI2 A;  1L0F A;  4GD8 A;  3UN7 A;  1YLT A;  2C5W B;  3A3I A;  4A5R A;  1LL9 A;  3ZGA B;  3NBL A;  5CHM A;  2A3U A;  4CPK A;  4YFM A;  4R3J A;  2ZC6 B;  3ZFZ A;  4B4X A;  1LL5 A;  2HPB A;  5FDH A;  3O3V A;  3Q81 A;  5IHV A;  1JTG A;  4GD6 A;  4HES A;  5A93 A;  2ZQA A;  4B88 A;  5EVI B;  5JYP A;  1YLZ A;  1GHI A;  1XKZ A;  3E2K A;  4JXG A;  4OQI A;  3IHB A;  4FH4 A;  1XPB A;  3PBO A;  4KZB A;  4OPZ A;  3VP2 A;  4OPR A;  2WAD A;  3N8R A;  3FKW A;  2FFF B;  2C6W B;  1XGJ A;  1BLS A;  3VOZ A;  1NZU A;  3O88 A;  5DTT A;  3SS5 A;  2Y2P A;  5KZH A;  3O86 A;  5FQI A;  4N1X A;  3HLF A;  4OOL A;  2BG1 A;  1KE4 A;  4QB8 A;  3ZG7 B;  4DE3 A;  3B3X A;  4RX3 A;  5A91 A;  5CEC A;  1KDW A;  2V20 A;  4N92 A;  1KE3 A;  3VP0 A;  1MBL A;  1FCM A;  4MNR A;  2OLV A;  1JVJ A; 
#chains in the Genus database with same CATH topology
 3R7W A;  3HLG A;  3DWZ A;  3TJZ C;  2WGW A;  1L0G A;  3D3O A;  1W8Q A;  4EUZ A;  3F1O A;  4WEK A;  3UY6 A;  3LY4 A;  1PWG A;  2JKR I;  3BM6 A;  3ZNT A;  3NUL A;  3GEC A;  3GVB A;  5HAI A;  4PM8 A;  3BEC A;  4BJP A;  1MPL A;  1F9I A;  4X56 A;  4Y7P A;  5FEF A;  4S2L A;  1ZKJ A;  5FAP A;  2PAV P;  1ES4 A;  3SH8 A;  1JTD A;  2H10 A;  2V1A A;  2XD5 A;  4HP4 A;  2Z6C A;  1SDN A;  4WZ5 A;  1Q2P A;  1CI9 A;  4NXG A;  4QY6 A;  2DNS A;  4FD8 A;  4UEY A;  4OKP A;  3NJA A;  1JWZ A;  3UMD A;  3BJN A;  1ZG4 A;  1G6A A;  4KZ4 A;  1L2S A;  1FOF A;  4WZ4 A;  4O7D A;  3LIC A;  2R9X A;  2WAF A;  3ULF A;  4E3J A;  2HDR A;  5DVA A;  2UWX A;  5DKL A;  4OVD A;  2PR6 A;  3FC7 A;  3N8L A;  3Q1F A;  3JVV A;  3NEC A;  2KOI A;  4WLA A;  3K2N A;  2EXA A;  2EX6 A;  2O9A A;  4FH2 A;  4HI4 A;  2FH5 A;  3IWQ A;  3KSG A;  4DJ3 A;  3DBA A;  5TBM B;  3O5Y A;  4ZJ2 A;  1P9R A;  4DN0 A;  3V50 A;  3KYZ A;  3UO9 A;  4HQA A;  1TS7 A;  4R23 A;  4LV3 A;  2O0Y A;  2QPN A;  3BFD A;  4BEN A;  4R3B A;  1RCJ A;  3F1O B;  2ZQ9 A;  4Y2F A;  3W4Q A;  3LR4 A;  4N1H A;  4KZ3 A;  1Z6F A;  4JF4 A;  5CHU A;  1ONH A;  5FA7 A;  5EM1 A;  3PBR A;  2XR0 A;  3LIE A;  1WE4 A;  1G28 A;  3Q82 A;  3A3F A;  5EVI C;  5FAQ A;  1VM1 A;  3ISG A;  5DJT A;  3CJM A;  1YM1 A;  4JXV A;  4R38 A;  3ZQ5 A;  1KE0 A;  4AFI A;  5GLC A;  2LB9 A;  1P0Z A;  4LPZ A;  4EBL A;  4KG6 A;  3MJQ A;  1ESI A;  3N8S A;  1PZO A;  2V2F F;  4CJN A;  3BWL A;  5HAR A;  5EPH A;  3MFX A;  3P98 A;  4U3T A;  3VE3 A;  4B93 A;  2L4R A;  2J8Y A;  4EW7 A;  3MF0 A;  4KQO A;  2A24 A;  2OAQ 1;  4EQI A;  3EQU A;  3PBS A;  1NYY A;  5C5K A;  4ARZ A;  1G5U A;  5EM0 A;  4Y5F A;  1I5Q A;  4KQR A;  4P6Z S;  2WZZ A;  2MJ6 A;  1TDG A;  2GJ3 A;  4EV4 A;  4DE0 A;  2J9P A;  2QJ7 A;  1XP4 A;  3ICY A;  2J3T C;  1M40 A;  2E8J A;  3MBZ A;  5EOO A;  2JBF A;  5HFO A;  2Q9M A;  1OTA A;  1PZP A;  3LI9 A;  4BQM A;  3UE1 A;  1QMF A;  5AVF A;  3DWK A;  3CAX A;  3SOI A;  1VET B;  3C38 A;  1TS0 A;  2JKR M;  3N7W A;  2P74 A;  4GLQ A;  2JKG A;  4KUO A;  3LO7 A;  4I38 A;  2DMW A;  4Y0O A;  5JYO A;  1XJ4 A;  2Y2L A;  3TOI A;  2H0T A;  2CC1 A;  4HP9 A;  4R4R A;  4OQH A;  4JXW A;  3GDI A;  1CEG A;  2FZ0 A;  3DAV A;  4HHD A;  3C5A A;  5AQ7 A;  5FL3 A;  4JGO A;  4P85 A;  4JLF A;  3BLM A;  1FSY A;  1ES5 A;  3MXR A;  3IXH A;  3IX4 A;  3CMZ A;  4YOF A;  2X01 A;  1W63 M;  1XJ2 A;  4HH3 A;  3QP1 A;  4X53 A;  2ZMA A;  4I3J A;  3LGO A;  3T1S A;  4LCM A;  4NXF A;  3B47 A;  3OOV A;  4B9O A;  1VQQ A;  2KLI A;  1K54 A;  4JXS A;  1LL8 A;  4DDS A;  3VSK A;  4E6X A;  1YLY A;  5CHJ A;  2EXB A;  1H8Y A;  1OTI A;  4MEZ A;  3FV7 A;  4JBF A;  1L0D A;  4R4S A;  4X69 A;  3IF6 C;  3BQ8 A;  4EBP A;  2ZL1 A;  1IYO A;  2XGN A;  3H9W A;  4GDB A;  3DTK A;  3LUQ A;  4LRX C;  1SDE A;  1BTL A;  4Y0T A;  4EES A;  5EVE A;  1SKF A;  2RL3 A;  2XH9 A;  3IHA A;  2ZOH A;  4XUZ A;  3NDG A;  4N9K A;  2JE5 A;  3OCL A;  4R0Q A;  1BLH A;  4C3Q A;  5GLA A;  1S67 L;  4CLC C;  3QP8 A;  4CLC E;  3C4P A;  4ME4 A;  3VFH A;  1M6K A;  1ONG A;  3MS6 A;  3HLW A;  2Z2M B;  5D3O A;  1DP6 A;  5EOE A;  4HJ6 A;  3A0R A;  3Q7V A;  1PW1 A;  4X1M A;  4JGQ A;  5F82 A;  4DE2 A;  2Y2O A;  2OWJ A;  2XFS A;  4ZJ1 A;  1GA9 A;  4E3I A;  3UPO A;  3M6B A;  3T4T A;  4C75 A;  3T4J A;  2HP9 A;  3F1P A;  4R6L A;  4KZ9 A;  5FI2 A;  1L0F A;  3L7H A;  4CPK A;  4YFM A;  2ZC6 B;  2EWV A;  2W1R A;  5EFW A;  5FDH A;  3IS2 B;  3E2K A;  2UV0 E;  4D60 A;  1XPB A;  3PBO A;  1SKO B;  3FKW A;  2C6W B;  3O88 A;  4N1X A;  3ZG7 B;  4QB8 A;  1P9W A;  3MSH A;  2YKH A;  2JN7 A;  3VP0 A;  4N92 A;  1MBL A;  4LRY C;  1FCM A;  2J3W A;  4MNR A;  1JVJ A;  5MC7 A;  3G6O A;  1EW0 A;  4E3M A;  3D4F A;  4MCW A;  3MXQ A;  3V3S A;  2GX5 A;  1OPX A;  3MKE A;  4IJG A;  3P09 A;  3CUE A;  3HL9 A;  2W1T A;  2LB5 A;  3H82 B;  1W7F A;  4PM5 A;  1O07 A;  1K4F A;  1T1A A;  2G2U A;  5M1A A;  4LV2 A;  4OPQ A;  5FEG A;  3CPT B;  4EEU A;  1ERO A;  4D2O A;  4S2K A;  2IA2 A;  1ESU A;  3LIA A;  3ZYT A;  3MQQ A;  1IKG A;  1S66 L;  1TEM A;  3K3C A;  1GHM A;  4QJG A;  5DFX A;  2PR5 A;  3AGE A;  3UB6 A;  1STZ A;  3E0Y A;  4ESP A;  2Y2G A;  2G2W A;  4WF0 A;  1GSV A;  3G32 A;  3UE3 A;  4II7 A;  4WYY A;  3VP4 A;  3RFB A;  3U2A A;  3PBQ A;  4O8G A;  3RXW A;  3HUN A;  3N4I A;  3LR0 A;  5IT5 A;  3OLO A;  4M3K A;  1CJF A;  3VE4 A;  5L09 A;  4JKT A;  1KOU A;  4KZ8 A;  1MXO A;  4HNB A;  1C3B A;  4Z1W A;  5F1F A;  4X6T A;  4FTX A;  4K0W A;  2WKQ A;  4M4X A;  4MN7 A;  4X68 A;  5DTK A;  2PT7 A;  1NLZ A;  1IEL A;  5F83 A;  2FFY A;  5EUA A;  1XXM A;  5CRF A;  1PW8 A;  2ZC3 B;  2OV5 A;  2Y2J A;  4Y13 A;  3KSH A;  4CQH A;  2WYX A;  1AXB A;  3Q07 A;  1XJ6 A;  2WKE A;  4BBU A;  4EET B;  2H5S A;  1PWD A;  4PKY A;  4S2N C;  2PYP A;  3A3D A;  4BBT A;  2VV7 A;  4PAU A;  1OTE A;  3FG8 A;  3M2J A;  3NOP C;  1MWU A;  1YAX A;  5EV0 A;  3PAE A;  4NET A;  2JC7 A;  5F69 A;  3ZNY A;  1D1J A;  4LEN A;  4MLL A;  4I3I A;  5HDS A;  1DRM A;  3MFD A;  4Y0U A;  5U47 A;  4GS9 A;  2PD8 A;  5E43 A;  1FR1 A;  3UNW A;  4GW9 A;  1NLY A;  3T50 A;  3OPP A;  3CWF A;  5CGW A;  2H28 A;  4GHI B;  4KEN B;  4GCZ A;  2Y2K A;  5HW3 A;  1FCN A;  1K57 C;  4UAA A;  3B33 A;  1N9O A;  1CQA A;  1ZTU A;  2VK3 A;  5DF9 A;  3T1Q B;  4ZAM A;  2XD1 A;  2HJE A;  1BUL A;  1NWZ A;  5L10 A;  1EWZ A;  3G35 A;  1IYP A;  1W5D A;  1YSP A;  3P7N A;  4ETX A;  2P08 A;  2DRW A;  4BL3 A;  1LI0 A;  2Q0O A;  3WS4 A;  3BRM A;  1GA0 A;  1HTZ A;  2OAP 1;  3D72 A;  3UB9 A;  3ZHH A;  3TE8 A;  3W8K A;  4GNU A;  2VGL M;  3BLS A;  2XA7 S;  3D9Y A;  4H6J A;  1YKD A;  3GQZ A;  3SW1 A;  4RVA A;  4FUW A;  3KX0 X;  4OP8 A;  5AQ9 A;  3ZDJ A;  5FSR A;  1IYS A;  3QP2 A;  4UHU A;  3R7W B;  5HD3 A;  1N9L A;  1YLJ A;  1YLW A;  5DJU A;  2WGW B;  2R78 A;  4WM9 A;  2EWW A;  3QHY A;  2QZ6 A;  5DF8 A;  3PYP A;  3TG9 A;  3M2K A;  1SCW A;  1OME A;  3B42 A;  1LI9 A;  5TJJ A;  4B4Z A;  2B95 A;  4F94 A;  4UQI M;  5GL9 A;  3A0V A;  4OQ0 A;  3LEQ A;  3HLE A;  1GHP A;  2M7U A;  3TRC A;  3UPP A;  4DKI A;  4MN6 A;  3MKF A;  5E2G A;  4E3L A;  2BTF P;  3N6I A;  3MZF A;  2D02 A;  4MBH A;  2VLG A;  2QJ5 A;  1LSW A;  3LI8 A;  4DRT A;  3BEB A;  4E04 A;  1HD8 A;  2PRF A;  5CX7 A;  5FQ9 A;  1UGU A;  5DF7 A;  1E4D A;  2V9A A;  2XLN A;  3T12 B;  5HL6 A;  1ES2 A;  2RCX A;  3IBR A;  2KDK A;  1ES3 A;  4BWI A;  4NKP A;  5FQJ A;  3SZT A;  2XDM A;  2O99 A;  2Y2I A;  3FPV A;  5F68 A;  3AGD A;  1ZG6 A;  2PDR A;  1MWS A;  4QHC A;  2J80 A;  4HBT A;  1H3Q A;  5GHY A;  3UB5 P;  3NY4 A;  4IUK A;  1JWV A;  1GSX A;  3QP6 A;  5FI7 A;  1YT4 A;  3EQV A;  1J9M A;  2B5R A;  3E4O A;  5KSH A;  2EX8 A;  2VA0 A;  5M18 A;  1FQG A;  1OJ5 A;  4Z9Q A;  1IFQ A;  2HP5 A;  1GCE A;  2H0Y A;  2A49 A;  1PYY A;  3IXB A;  2JHE A;  4IBR A;  1LSX A;  4MDZ A;  1F2K A;  3HLD A;  5HAQ A;  1DJC A;  3C7V A;  3IF6 A;  3OPR A;  4PM9 A;  2HDQ A;  3KSF A;  2XEP A;  1S4S A;  1T18 A;  4E3K A;  1K6S A;  4ZDX A;  3SS4 A;  1DP8 A;  2P9V A;  1XFQ A;  1OTB A;  1OT6 A;  5CER A;  1Y4O A;  3IX8 A;  1D06 A;  2ZC4 B;  4L9E A;  1V9Y A;  2ZLY A;  4HIA A;  2PBY A;  3GTC A;  3T4K A;  2AVX A;  5EVL A;  1NZO A;  4GD8 A;  3UN7 A;  4G3K A;  4A5R A;  4WUJ A;  3T4S A;  5L07 A;  1LL9 A;  3NOT C;  3NBL A;  4R3J A;  2VZW A;  3EWK A;  3LFV A;  1VB6 A;  3O3V A;  3R4K A;  5A93 A;  3QP4 A;  1T1B A;  2PHY A;  3KSI A;  3A0S A;  4FH4 A;  1TS6 A;  3VP2 A;  4OPR A;  2WAD A;  3N8R A;  1BLS A;  2A24 B;  4I5S A;  5LBR A;  5DTT A;  2QWS A;  3O86 A;  3HLF A;  3B3X A;  3F1N A;  4ARZ B;  1KDW A;  1KE3 A;  2OLV A;  4G3V A;  4RYE A;  3BW6 A;  5E2F A;  4G3W A;  1BLP A;  4UA9 A;  1N9B A;  3TW8 A;  5DTS A;  4K91 A;  1PWC A;  1PNE A;  4Q0H A;  4GKU A;  1E25 A;  4XXR A;  4YWZ A;  4F3L A;  1W8Y A;  1YSQ A;  3E4Q A;  3HJK A;  2X71 A;  4LRZ E;  1BZA A;  3FZC A;  2P9V B;  3MZD A;  5G4Z A;  4EWF A;  1PFL A;  4S2J A;  4KZ5 A;  5CTM A;  3EGX C;  4KZ7 A;  5TR7 A;  3V39 A;  5IU1 A;  5DKK A;  2K2N A;  3GMW A;  3MXS A;  4L9G A;  1K4E A;  3ITA A;  2V8F A;  5CED A;  1HZO A;  2ZQC A;  2Y55 A;  5J3W A;  4DXB A;  2G7U A;  3CHW P;  3O87 A;  3VP1 A;  5E2H A;  3UE6 A;  2EX9 A;  3VV4 A;  2J7V A;  1CI8 A;  3WS0 A;  4Y15 A;  2VX8 A;  4LV1 A;  3HRE A;  3LR5 A;  1CK3 A;  3AGF A;  2ZC5 B;  3K3D A;  2IWB A;  1FIL A;  2L1M A;  4P6Z M;  3GV9 A;  3MQO A;  3W2Z A;  3PTE A;  1PI4 A;  2OOL A;  1K54 C;  3S7Q A;  2GZA A;  2XFT A;  1L0E A;  4RQ9 A;  2EX2 A;  3MR0 A;  2ZL1 B;  3OPH A;  5J8X A;  1I2W A;  1MC0 A;  1NY0 A;  3HLC A;  1BT5 A;  2CMN A;  3HUM A;  2NUT C;  3JVU A;  1YLP A;  1D7E A;  5FI6 A;  1H0M A;  4DJ2 A;  3WWX A;  5GLB A;  3C8C A;  4KG5 A;  1FCO A;  3GR2 A;  4RX2 A;  3PHY A;  5DFY A;  4WN5 A;  3E4P A;  5GHX A;  3ZCZ A;  1O7E A;  1LT0 A;  5CTN A;  2OLU A;  3V3R A;  3UE0 A;  4I39 A;  4XT2 A;  4O01 A;  3KYQ A;  2PU4 A;  3PAG A;  4ZRR A;  5M19 A;  4BMW A;  2VJW A;  2J9O A;  3EOI A;  1K25 A;  1GSW A;  4HH2 A;  2PBD P;  3IWI A;  3Q7V B;  3GRJ A;  2W3D A;  1T1C A;  4BD1 A;  3FPW A;  2HV1 A;  5FDS A;  1XA7 A;  2E8I A;  2M1C A;  3OZH A;  4IVK A;  3NC8 A;  1NYM A;  1BYW A;  1KGG A;  3F1P B;  4X25 A;  2VEA A;  3BYD A;  4HOI A;  5HWV A;  2DCF A;  3S7O A;  5AVE A;  3P01 A;  5J4E A;  1Y28 A;  4MN5 A;  5HWW A;  4S2I A;  3WS1 A;  3ZVW A;  4L0L A;  3S7N A;  2Y2N A;  4OPY A;  4ZBE A;  1EI5 A;  4DE3 A;  4GZB A;  2VGJ A;  4GB7 A;  4KQQ A;  2Y59 A;  1XJ3 A;  4I3A A;  1ZHH B;  4Q0I A;  5FQK A;  3L9K A;  4QPR A;  3PXP A;  1IOU A;  3KYE A;  4OQG A;  2WKI A;  4L9F A;  2B02 A;  1XA1 A;  4PMA A;  4KG2 A;  5KSC A;  4NG2 A;  4JF6 A;  3DTM A;  2ZOI A;  3G4P A;  3G31 A;  3QP5 A;  4GOG A;  1ERQ A;  4QD4 A;  3UPN A;  2GNX A;  3G34 A;  3HJI A;  3HVF A;  4ZTK A;  1NRF A;  3VP3 A;  2HDU A;  2W1T B;  4U0T A;  4E3N A;  2O9C A;  4BD0 A;  3LID A;  2HGV A;  5CGS A;  4JGR A;  5FQQ A;  1FIK A;  2XF3 A;  2XRN A;  2ZD8 A;  2JKF A;  4E6W A;  1Z09 A;  2V1B A;  3CUE C;  3S4X A;  1NRJ A;  4OLD A;  3ZG0 A;  3T1R A;  5EVI D;  1BSG A;  5FAT A;  1N9N A;  5TBM A;  2Y91 A;  3CIT A;  1K55 C;  5HZH A;  4YNR A;  3ZG8 B;  1Y54 A;  1TVF A;  3BFC A;  3EEA A;  5HAP A;  3ITB A;  3RH8 B;  3PBT A;  3FKV A;  3IT9 A;  1S6R A;  3SS3 A;  5EVI A;  1S1Y A;  1BLC A;  5F5Y A;  1PI5 A;  4XUX A;  3H7W A;  4DMZ A;  1KVM A;  2VKS A;  2X02 A;  3ZVT A;  5EEC A;  4IVI A;  4WL9 A;  3DTE A;  2WKH A;  1MKM A;  3IQA A;  4OP5 A;  3RTY A;  2WKR A;  3IXG A;  3NI9 A;  1A0K A;  2L0W A;  1IYQ A;  3PR6 A;  5G4Y A;  3GSG A;  2W3H A;  1DY6 A;  3EEH A;  2QMI A;  3TSG A;  4C6Y A;  4IUH A;  1YMS A;  2JKT I;  3VMA A;  5HPF A;  3FWL A;  3UDX A;  4JF5 A;  3BY8 A;  4WEL A;  2J3T D;  4DF6 A;  2ZC7 A;  3BY9 A;  4ID4 A;  2QHK A;  4PPR A;  5E2E A;  4R1G A;  2WK0 A;  2JCH A;  1SHV A;  1T19 A;  2ZQD A;  4KZ6 A;  1KGE A;  1KGF A;  3W4P A;  3WS2 A;  2HDS A;  3A3J A;  1OJG A;  1MZU A;  3BFE A;  3VSL A;  4KQD A;  3QNC A;  1MWT A;  3OBF A;  4OLG A;  1ERM A;  3JPU A;  1YLT A;  2C5W B;  1F5M A;  2A3U A;  4GS9 B;  3ZFZ A;  1LL5 A;  2HPB A;  5IHV A;  4EER A;  1JTG A;  4HES A;  2ZQA A;  5EVI B;  1YLZ A;  1J3W A;  1GHI A;  1XKZ A;  4JXG A;  4KZB A;  4OPZ A;  4FOF A;  2INW A;  5IS1 A;  2FFF B;  1VET A;  2PD7 A;  2M7V A;  1XGJ A;  3CLO A;  3VOZ A;  3SS5 A;  3H7W B;  5KZH A;  4OOL A;  1KE4 A;  1HLU P;  2D01 A;  4RX3 A;  5A91 A;  2V20 A;  2K7S A;  3SH7 A;  3IF5 A;  2ZQ8 A;  1WYC A;  3DW0 A;  4WZ5 C;  2P7J A;  5HD5 A;  4U0X A;  2IWD A;  1S4R A;  5F1G A;  5GHZ A;  1W63 Q;  1ALQ A;  4LV0 A;  4WEJ A;  4RA7 A;  4DDY A;  3OPL A;  3VFF A;  3NIA A;  2ZM2 A;  3Q7Z A;  1VEU A;  5KIZ A;  1CEF A;  1YMX A;  3LIB A;  5GLD A;  4LGW A;  4HJ3 A;  5I5L A;  1K38 A;  3LY3 A;  2VGK A;  3C4O A;  1ACF A;  2Y2Q A;  4H6J B;  4JGP A;  1P97 A;  3WRT A;  1I2S A;  2ZMV A;  4EUV A;  3IH8 A;  3FYZ A;  1LLB A;  2WKP A;  5HPI A;  4WBG A;  4NK3 A;  4MBF A;  1XFN A;  3JYI A;  1K56 D;  3IWO A;  2PYR A;  1QME A;  1MY8 A;  5HWT A;  5AQB A;  4H8R A;  3CZD A;  1DJA A;  3RJU A;  4BL2 A;  4PHT A;  3G2Y A;  4CLC D;  2W27 A;  2I9V A;  2I72 A;  4Q8I A;  2K31 A;  1DJB A;  5KMW A;  1DP9 A;  3VOL A;  1H8Z A;  2OWH A;  4NXE A;  2KX6 A;  1K56 A;  2V1Z A;  4LFU A;  2V0U A;  5L2F A;  2XRO A;  2HF6 A;  4BBV A;  4Q0J A;  4E3O A;  4HY8 A;  4DXC A;  3CI6 A;  2R9W A;  3BFG A;  3HCY A;  4CLC A;  1MWR A;  2ZM0 A;  1YQS A;  3M6H A;  4HBU A;  3HUO A;  1WA9 A;  3E98 A;  1U60 A;  1LHY A;  4P0M A;  4QU3 A;  1G6O A;  3CG5 A;  1FSW A;  4NEE D;  1AWI A;  1K6R A;  2ZQ7 A;  3LYX A;  3VOY A;  4GJ4 A;  4P87 A;  1JWP A;  3S7P A;  1X0O A;  3S22 A;  4KZA A;  4EBN A;  3T4L A;  4EQ1 A;  1VEU B;  4FCF A;  1CF0 A;  5CXW A;  1OTD A;  2W3F A;  5A8B A;  1H8M A;  2JKT M;  4WMC D;  4IED A;  4LCL A;  2WAE A;  4EXO A;  5A90 A;  5FAO A;  1MKI A;  1JNU A;  4Y3I A;  1UWN X;  2XA7 M;  3G2Z A;  2WGI A;  4O0P A;  4OOM A;  3E2L A;  3IX3 A;  3LCE A;  3IH9 A;  4S2P A;  3IF6 B;  4GN2 A;  4WMC A;  4Y17 A;  3RXX A;  1KDS A;  2Y2H A;  3U4L P;  3UB8 A;  4X55 A;  3NCK A;  3IS2 A;  5FAS A;  1K0K A;  2O9B A;  2Y2M A;  2HZ5 A;  2A2L A;  1W79 A;  1SKO A;  2VV8 A;  5CGX A;  4UA7 A;  3W4O A;  5I94 A;  3UDI A;  1H5X A;  3T4Q A;  2WGV A;  1E3U D;  3EGD C;  2HP6 A;  1OT9 A;  2XK1 A;  4CLC B;  5TFQ A;  2EFU A;  1NXY A;  3BQA A;  5L8M A;  5J7E A;  3HBR A;  3C7U A;  1S1Z A;  3UB7 A;  2Y79 A;  5AJG A;  1IKI A;  4PM6 A;  1VHM A;  1PIO A;  4BLM A;  5HDD A;  1E3U A;  3WRZ A;  1PRQ A;  3C30 A;  1RGY A;  3H82 A;  5HL1 A;  1S0W A;  2ZMF A;  5EE8 A;  2PU2 A;  3CPT A;  1G68 A;  4X1L A;  5AQA A;  3ZG5 A;  5BOH A;  1TF1 A;  3F1N B;  3WS5 A;  1XX2 A;  2Q9N A;  2ZBB A;  2ZM8 A;  4P6B A;  1TS8 A;  3IBJ A;  3OCN A;  2BLS A;  2P04 A;  4FSF A;  1NJ4 A;  3KO6 A;  5CEB A;  1Q2Q A;  2ACG A;  4ETZ A;  3S1Y A;  2BAS A;  2OSU A;  4F3L B;  4ZJ3 A;  1UWP X;  2NUP C;  4EEP A;  3PBN A;  3LR3 A;  4GDN A;  2ZJ9 A;  3QNB A;  5K5B A;  2Y4A A;  4K0X A;  3T1X A;  4N9L A;  1WYB A;  1KVL A;  1SZV A;  1BUE A;  2EFX A;  1TD5 A;  3MQ0 A;  3BFF A;  2QKP A;  2B18 A;  4OH0 A;  4PKY G;  4YIN A;  3IXD A;  2VGL S;  2XSS A;  3LIF A;  4QWO A;  5HSQ A;  2VV6 A;  4S2N A;  4MMN A;  1LSV A;  2QYB A;  4NXB A;  3ZG9 B;  1FR6 A;  1ODV A;  1F98 A;  3UDF A;  4HEF A;  3MZE A;  4QY5 A;  4IHQ A;  1K55 A;  3NDE A;  4K08 A;  4OON A;  4IBX A;  5G18 A;  5TGF A;  3UME A;  3HLB A;  2GDN A;  4DE1 A;  1N4O A;  4KUK A;  4UQI S;  4R3A A;  2V8C A;  3V5M A;  2Z2L B;  2WUQ A;  5HDC A;  1ZC2 A;  4MBK A;  2IWC A;  2WZX A;  5FQM A;  1K57 A;  1YPR A;  1IEM A;  1HVB A;  5HX9 A;  3DTI A;  1XGI A;  3SH9 A;  3OC2 A;  1RGZ A;  4S2M A;  4GHI A;  2W3G A;  4EU0 A;  3A3E A;  3MMH A;  1RP5 A;  4R70 A;  2W3E A;  5A92 A;  3I7J A;  1L3L A;  4HJ4 A;  3V67 A;  2Y8H A;  1TDL A;  4PM7 A;  3G30 A;  4S2O A;  4UA6 A;  3T4O A;  3NOU C;  4OOY A;  2EA9 A;  3LEZ A;  4JPM A;  3A3I A;  3NHQ A;  2HJ9 C;  4LLO B;  3ZGA B;  3C2W A;  5CHM A;  4B4X A;  4XT2 B;  3Q81 A;  4GD6 A;  2V0W A;  4B88 A;  5JYP A;  2YKF A;  5F6A A;  2Z6D A;  4OQI A;  3IHB A;  1NZU A;  2Y2P A;  5FQI A;  1V9Z A;  2BG1 A;  5CEC A;  2XQZ A;  2W0N A; 
#chains in the Genus database with same CATH homology
 3SH7 A;  3IF5 A;  3HLG A;  3DWZ A;  2ZQ8 A;  5E2F A;  1WYC A;  2WGW A;  3DW0 A;  4E3M A;  3D4F A;  4WZ5 C;  1L0G A;  1W8Q A;  1BLP A;  4U0X A;  2IWD A;  4UA9 A;  3V3S A;  4EUZ A;  1N9B A;  4WEK A;  5F1G A;  5GHZ A;  3UY6 A;  3LY4 A;  1PWG A;  3MKE A;  1ALQ A;  4LV0 A;  4WEJ A;  4RA7 A;  5DTS A;  4DDY A;  4K91 A;  3P09 A;  1PWC A;  3HL9 A;  3OPL A;  3BM6 A;  4GKU A;  3ZNT A;  1E25 A;  4XXR A;  3VFF A;  3GVB A;  5HAI A;  3NIA A;  2ZM2 A;  3Q7Z A;  4PM8 A;  3BEC A;  4BJP A;  1CEF A;  1W8Y A;  1MPL A;  1YMX A;  4X56 A;  4Y7P A;  1W7F A;  5GLD A;  4PM5 A;  1O07 A;  1K4F A;  2X71 A;  4S2L A;  2G2U A;  5M1A A;  4LV2 A;  4OPQ A;  1BZA A;  1K38 A;  1ZKJ A;  1ERO A;  3FZC A;  2VGK A;  3LY3 A;  4S2K A;  5FAP A;  2P9V B;  4D2O A;  3C4O A;  1ESU A;  2Y2Q A;  3MZD A;  3WRT A;  4EWF A;  1ES4 A;  3SH8 A;  1I2S A;  1JTD A;  1IKG A;  2H10 A;  1TEM A;  2XD5 A;  4S2J A;  1GHM A;  3IH8 A;  1SDN A;  4QJG A;  4KZ5 A;  4WZ5 A;  5CTM A;  1Q2P A;  1CI9 A;  3FYZ A;  3AGE A;  4KZ7 A;  1LLB A;  4QY6 A;  2DNS A;  2Y2G A;  4FD8 A;  4WBG A;  4NK3 A;  4MBF A;  4OKP A;  2G2W A;  3JYI A;  1K56 D;  1JWZ A;  3G32 A;  5TR7 A;  3IWO A;  3UE3 A;  1QME A;  3V39 A;  1MY8 A;  4WYY A;  1ZG4 A;  5AQB A;  3VP4 A;  4H8R A;  1G6A A;  1DJA A;  3CZD A;  3RJU A;  4BL2 A;  3PBQ A;  3RXW A;  3G2Y A;  4KZ4 A;  1L2S A;  3HUN A;  1FOF A;  4WZ4 A;  4O7D A;  3GMW A;  3MXS A;  2R9X A;  2WAF A;  3N4I A;  2I72 A;  1K4E A;  3ITA A;  4Q8I A;  4E3J A;  1DJB A;  2HDR A;  5DVA A;  2UWX A;  5KMW A;  4M3K A;  1H8Z A;  5CED A;  1K56 A;  2V1Z A;  1HZO A;  4OVD A;  4JKT A;  2ZQC A;  2Y55 A;  4KZ8 A;  5L2F A;  3N8L A;  4DXB A;  3Q1F A;  1MXO A;  3O87 A;  3VP1 A;  4DXC A;  4E3O A;  1C3B A;  2EXA A;  2R9W A;  2EX6 A;  5F1F A;  5E2H A;  3BFG A;  4X6T A;  4FH2 A;  1MWR A;  2EX9 A;  2ZM0 A;  4K0W A;  1YQS A;  3M6H A;  4HBU A;  2J7V A;  3HUO A;  1CI8 A;  3WS0 A;  3IWQ A;  1U60 A;  4LV1 A;  1LHY A;  4P0M A;  4QU3 A;  4ZJ2 A;  3HRE A;  1CK3 A;  3CG5 A;  3V50 A;  1FSW A;  3AGF A;  3UO9 A;  2ZC5 B;  4X68 A;  1K6R A;  2IWB A;  4R23 A;  4LV3 A;  5DTK A;  2ZQ7 A;  3GV9 A;  2QPN A;  3BFD A;  4BEN A;  4R3B A;  1RCJ A;  3PTE A;  3VOY A;  1IEL A;  5F83 A;  2FFY A;  4P87 A;  5EUA A;  1JWP A;  1PI4 A;  1XXM A;  2ZQ9 A;  3W4Q A;  1K54 C;  4N1H A;  5CRF A;  1PW8 A;  4KZ3 A;  2XFT A;  1L0E A;  2EX2 A;  1Z6F A;  3OPH A;  5J8X A;  1I2W A;  2ZC3 B;  4JF4 A;  5CHU A;  1ONH A;  5FA7 A;  4KZA A;  3S22 A;  2OV5 A;  4EBN A;  3PBR A;  2XR0 A;  2Y2J A;  4FCF A;  1NY0 A;  3HLC A;  5CXW A;  2WYX A;  1AXB A;  2WKE A;  1BT5 A;  3Q07 A;  1WE4 A;  5FAQ A;  3Q82 A;  3A3F A;  5EVI C;  3HUM A;  4WMC D;  1YLP A;  1VM1 A;  3ISG A;  4IED A;  2WAE A;  4LCL A;  2H5S A;  1PWD A;  5FAO A;  5A90 A;  1MKI A;  4S2N C;  5FI6 A;  3CJM A;  3A3D A;  1YM1 A;  4JXV A;  3WWX A;  5GLB A;  3M2J A;  1KE0 A;  4KG5 A;  3G2Z A;  5GLC A;  1MWU A;  1FCO A;  2WGI A;  3GR2 A;  3PAE A;  4NET A;  4RX2 A;  2JC7 A;  4EBL A;  5GHX A;  4KG6 A;  4OOM A;  3ZNY A;  3E2L A;  3ZCZ A;  3LCE A;  4LEN A;  3IH9 A;  4MLL A;  4S2P A;  3IF6 B;  1O7E A;  1ESI A;  4GN2 A;  3N8S A;  4WMC A;  5CTN A;  1PZO A;  2V2F F;  4CJN A;  2OLU A;  3V3R A;  3MFD A;  4Y0U A;  3RXX A;  5U47 A;  3UE0 A;  5E43 A;  1KDS A;  2Y2H A;  1FR1 A;  5HAR A;  3UNW A;  4X55 A;  5EPH A;  3NCK A;  3OPP A;  3P98 A;  4U3T A;  5CGW A;  2PU4 A;  3PAG A;  5FAS A;  5M19 A;  2Y2M A;  2J8Y A;  4KEN B;  1W79 A;  2J9O A;  2Y2K A;  1K25 A;  5CGX A;  1FCN A;  4UA7 A;  3IWI A;  4KQO A;  1K57 C;  3W4O A;  4UAA A;  5HW3 A;  3Q7V B;  3GRJ A;  5I94 A;  3UDI A;  4BD1 A;  1H5X A;  4EQI A;  3EQU A;  2WGV A;  3PBS A;  1E3U D;  1NYY A;  2HP6 A;  5DF9 A;  4ZAM A;  1XA7 A;  2E8I A;  2XD1 A;  3OZH A;  4IVK A;  1I5Q A;  2XK1 A;  3NC8 A;  5TFQ A;  4KQR A;  2EFU A;  2WZZ A;  1NYM A;  1BUL A;  1NXY A;  1TDG A;  1KGG A;  1EWZ A;  3BYD A;  4EV4 A;  4DE0 A;  3HBR A;  3C7U A;  2J9P A;  1IKI A;  2DCF A;  1XP4 A;  3G35 A;  4PM6 A;  1IYP A;  1W5D A;  1M40 A;  4S2I A;  3WS1 A;  3ZVW A;  4L0L A;  2DRW A;  4BL3 A;  1LI0 A;  2Y2N A;  1PIO A;  4OPY A;  1EI5 A;  4ZBE A;  1E3U A;  3MBZ A;  4GZB A;  2JBF A;  5EOO A;  2VGJ A;  4GB7 A;  2Q9M A;  5HFO A;  3WS4 A;  3WRZ A;  1PZP A;  3BRM A;  4KQQ A;  2Y59 A;  1GA0 A;  1RGY A;  5HL1 A;  1HTZ A;  4BQM A;  1S0W A;  3UE1 A;  4BLM A;  5EE8 A;  3ZHH A;  1QMF A;  2PU2 A;  3W8K A;  5FQK A;  1G68 A;  4GNU A;  3BLS A;  3DWK A;  3SOI A;  5AQA A;  4OQG A;  3ZG5 A;  5BOH A;  3GQZ A;  2WKI A;  4RVA A;  3N7W A;  1XA1 A;  4PMA A;  2P74 A;  4OP8 A;  5AQ9 A;  3WS5 A;  3ZDJ A;  4KG2 A;  5KSC A;  4JF6 A;  5FSR A;  1IYS A;  3DTM A;  4RYE A;  1XX2 A;  2Q9N A;  3LO7 A;  2ZM8 A;  4UHU A;  4P6B A;  1YLJ A;  1YLW A;  3OCN A;  2WGW B;  4WM9 A;  3G4P A;  4Y0O A;  2BLS A;  3G31 A;  3QHY A;  2Y2L A;  3TOI A;  5JYO A;  4FSF A;  4GOG A;  1ERQ A;  2QZ6 A;  4QD4 A;  2H0T A;  5DF8 A;  3UPN A;  2CC1 A;  3TG9 A;  1NJ4 A;  3G34 A;  4R4R A;  3M2K A;  4OQH A;  5CEB A;  4JXW A;  1SCW A;  1Q2Q A;  1CEG A;  1OME A;  1LI9 A;  3HVF A;  4ZTK A;  4B4Z A;  1NRF A;  3VP3 A;  3C5A A;  4F94 A;  2HDU A;  5AQ7 A;  5GL9 A;  4U0T A;  3S1Y A;  4E3N A;  4P85 A;  4JLF A;  4OQ0 A;  3BLM A;  2OSU A;  1FSY A;  4BD0 A;  3HLE A;  1GHP A;  4ZJ3 A;  5CGS A;  1ES5 A;  3UPP A;  3MXR A;  4DKI A;  3IXH A;  5FQQ A;  2XF3 A;  3CMZ A;  3MKF A;  2ZD8 A;  5E2G A;  4E6W A;  2X01 A;  3N6I A;  3PBN A;  4E3L A;  3MZF A;  4MBH A;  4GDN A;  2ZJ9 A;  3S4X A;  4DRT A;  3QNB A;  3BEB A;  4X53 A;  2ZMA A;  4OLD A;  3ZG0 A;  1HD8 A;  2Y4A A;  5EVI D;  4K0X A;  4LCM A;  5FQ9 A;  4N9L A;  5DF7 A;  1BSG A;  5FAT A;  1E4D A;  2XLN A;  2Y91 A;  1VQQ A;  1WYB A;  1K54 A;  1K55 C;  4JXS A;  1ES2 A;  4DDS A;  3ZG8 B;  1Y54 A;  2RCX A;  3VSK A;  1KVL A;  4E6X A;  1BUE A;  1TVF A;  1ES3 A;  2EFX A;  3BFC A;  5HAP A;  1YLY A;  3ITB A;  5FQJ A;  3PBT A;  3FKV A;  5CHJ A;  3BFF A;  3IT9 A;  2XDM A;  2EXB A;  2Y2I A;  1H8Y A;  1S6R A;  3AGD A;  4MEZ A;  4OH0 A;  1ZG6 A;  3IXD A;  4YIN A;  1MWS A;  4QHC A;  3SS3 A;  5EVI A;  3FV7 A;  4HBT A;  4JBF A;  1L0D A;  4R4S A;  1BLC A;  4X69 A;  1PI5 A;  3IF6 C;  5GHY A;  4EBP A;  4S2N A;  3NY4 A;  1IYO A;  2XGN A;  4XUX A;  3ZG9 B;  4GDB A;  1FR6 A;  1KVM A;  1SDE A;  1BTL A;  1JWV A;  2X02 A;  3UDF A;  3ZVT A;  4Y0T A;  4HEF A;  5EEC A;  5FI7 A;  3MZE A;  4IVI A;  4QY5 A;  1YT4 A;  3EQV A;  1J9M A;  2B5R A;  2WKH A;  1K55 A;  5KSH A;  3NDE A;  1SKF A;  2EX8 A;  3IQA A;  4OP5 A;  2RL3 A;  3IXG A;  3NI9 A;  1FQG A;  5M18 A;  4Z9Q A;  2XH9 A;  3IHA A;  4OON A;  1IYQ A;  4IBX A;  2HP5 A;  5G18 A;  5TGF A;  3GSG A;  3HLB A;  1DY6 A;  3NDG A;  4XUZ A;  4N9K A;  2JE5 A;  2GDN A;  3OCL A;  1GCE A;  2H0Y A;  2A49 A;  4R0Q A;  1PYY A;  3IXB A;  4DE1 A;  1BLH A;  4C3Q A;  1N4O A;  4IBR A;  5GLA A;  2QMI A;  3HLD A;  3TSG A;  5HAQ A;  3V5M A;  1DJC A;  2Z2L B;  3C7V A;  2WUQ A;  3IF6 A;  3OPR A;  4C6Y A;  1YMS A;  3VMA A;  1ZC2 A;  2HDQ A;  4MBK A;  3C4P A;  2IWC A;  3FWL A;  4PM9 A;  4JF5 A;  2WZX A;  1M6K A;  2XEP A;  5FQM A;  3UDX A;  3VFH A;  1K57 A;  4E3K A;  1K6S A;  1ONG A;  4WEL A;  1IEM A;  3HLW A;  1HVB A;  4DF6 A;  2Z2M B;  5D3O A;  4ZDX A;  3SS4 A;  2ZC7 A;  5HX9 A;  5EOE A;  4ID4 A;  4PPR A;  1XGI A;  3SH9 A;  2P9V A;  3OC2 A;  1RGZ A;  4S2M A;  5E2E A;  4R1G A;  2WK0 A;  2JCH A;  1SHV A;  2ZQD A;  3A3E A;  2XQZ A;  4KZ6 A;  5CER A;  3Q7V A;  1KGE A;  1PW1 A;  5F82 A;  4DE2 A;  1KGF A;  1RP5 A;  3W4P A;  5A92 A;  2ZC4 B;  3WS2 A;  2Y2O A;  3I7J A;  2HDS A;  3A3J A;  2XFS A;  4ZJ1 A;  1GA9 A;  4E3I A;  3BFE A;  3VSL A;  2ZLY A;  3UPO A;  1TDL A;  3M6B A;  4PM7 A;  4C75 A;  3G30 A;  4S2O A;  4UA6 A;  3QNC A;  2HP9 A;  2PBY A;  3GTC A;  5EVL A;  1MWT A;  4OOY A;  4OLG A;  4KZ9 A;  3LEZ A;  1NZO A;  1ERM A;  4JPM A;  5FI2 A;  1L0F A;  4GD8 A;  3UN7 A;  1YLT A;  2C5W B;  3A3I A;  4A5R A;  1LL9 A;  3ZGA B;  3NBL A;  5CHM A;  2A3U A;  4CPK A;  4YFM A;  4R3J A;  2ZC6 B;  3ZFZ A;  4B4X A;  1LL5 A;  2HPB A;  5FDH A;  3O3V A;  3Q81 A;  5IHV A;  1JTG A;  4GD6 A;  4HES A;  5A93 A;  2ZQA A;  4B88 A;  5EVI B;  5JYP A;  1YLZ A;  1GHI A;  1XKZ A;  3E2K A;  4JXG A;  4OQI A;  3IHB A;  4FH4 A;  1XPB A;  3PBO A;  4KZB A;  4OPZ A;  3VP2 A;  4OPR A;  2WAD A;  3N8R A;  3FKW A;  2FFF B;  2C6W B;  1XGJ A;  1BLS A;  3VOZ A;  1NZU A;  3O88 A;  5DTT A;  3SS5 A;  2Y2P A;  5KZH A;  3O86 A;  5FQI A;  4N1X A;  3HLF A;  4OOL A;  2BG1 A;  1KE4 A;  4QB8 A;  3ZG7 B;  4DE3 A;  3B3X A;  4RX3 A;  5A91 A;  5CEC A;  1KDW A;  2V20 A;  4N92 A;  1KE3 A;  3VP0 A;  1MBL A;  1FCM A;  4MNR A;  2OLV A;  1JVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...