4QPRA

Crystal structure of gaf domain of potassium sensor histidine kinase kdpd from escherichia coli
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
GAMDLYEMSKALAVGRSPQDIAATSEQFIASTFHARSQVLLPDDNGKLQPLTHPQGMTPWDDAIAQWSFDKGLPAGAGTDTLPGVPYQILPLKSGEKTYGLVVVEPGNLRQLMIPEQQRLLETFTLLVANALERLTKLAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Sensor protein KdpD
publication title Crystal Structure of Gaf Domain of Potassium Sensor Histidine Kinase Kdpd from Escherichia Coli
rcsb
source organism Escherichia coli
total genus 38
structure length 142
sequence length 142
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13492 GAF_3 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4qprA00
3MF0A 2W3HA 5I5LA 5K5BA 3S7PA 3IBRA 2K31A 3R4KA 5AJGA 2OOLA 4BWIA 3E98A 4Q0JA 5L8MA 1MKMA 4RQ9A 2O99A 3D3OA 3KSHA 3DBAA 4G3WA 3ZQ5A 4O8GA 4Q0IA 4Z1WA 4IUHA 3S7QA 5HPIA 3E0YA 3G6OA 4Y5FA 1TF1A 2W1RA 2XRNA 2W1TA 3EEAA 2GX5A 4EU0A 3BJNA 2M7VA 2W3DA 4E04A 2G7UA 2KOIA 2VJWA 2Y79A 3W2ZA 3MMHA 3KSGA 4EUVA 3NOPC 4ME4A 1STZA 2ZMFA 4O0PA 4FOFA 3RFBA 5C5KA 3O5YA 3IBJA 5DFYA 5HSQA 4LRZE 2M7UA 1YSPA 4CQHA 4IUKA 4QPRA 4DMZA 1ZTUA 4PAUA 2IA2A 4Y3IA 3MQ0A 2XROA 4MN7A 4R70A 5DFXA 3KSIA 2W3EA 4MDZA 3S7OA 3OBFA 4DN0A 3NHQA 4Q0HA 2VKSA 2KLIA 3KSFA 2Y8HA 4MMNA 2O9AA 3KO6A 3VV4A 1YSQA 5LBRA 2O9BA 3NOTC 4MCWA 2XSSA 3S7NA 4Y2FA 3HCYA 5HPFA 3OOVA 2LB9A 2HGVA 2QYBA 4O01A 4G3VA 5HL6A 1TD5A 2W3FA 4GW9A 4G3KA 4LRYC 4R6LA 4ZRRA 3NOUC 4LRXC 2VEAA 5TJJA 1F5MA 2W3GA 1VHMA 3C2WA 1MC0A 2O0YA 2W1TB 4YNRA 4ETXA 4YOFA 3CITA 3CI6A 2VZWA 4GLQA 4IJGA 2B18A 1YKDA 2K2NA 3K2NA 3TRCA 2LB5A 2O9CA 3LFVA 4ETZA
chains in the Genus database with same CATH superfamily
4YWZA 2WADA 1JWPA 1QMEA 3T4KA 4OONA 3MZFA 1OTBA 1YLJA 1Y28A 3IXGA 1H5XA 2XLNA 3B33A 3MKEA 3Q7VA 3TE8A 5FI7A 2ZQ9A 3D4FA 5HX9A 4EU0A 1MWRA 4X25A 4MN5A 2G7UA 3D9YA 4JXGA 5A91A 1EI5A 1F2KA 4EUVA 3NIAA 5HD5A 1OTAA 1KDWA 5F68A 3KYZA 2ZQDA 1MPLA 1ZTUA 1XFNA 2GNXA 1L0EA 2PU2A 4DDYA 5CHJA 2V0WA 2WYXA 1K4FA 4E3IA 2ZOIA 2VKSA 3VFHA 1CQAA 3H82B 1H8ZA 1CF0A 5HD3A 3S7NA 1VM1A 5L2FA 3UO9A 4QD4A 1K6SA 1IFQA 5EM1A 2QPNA 3IXHA 2ZQCA 2EX9A 4ZJ1A 5HL6A 1HLUP 4HIAA 2V8CA 5EVIA 3EQVA 4K0XA 2Y2MA 4ZRRA 1MWSA 2VEAA 1FR1A 1VHMA 3Q81A 5L10A 3UB5P 2XD5A 1PZOA 3TRCA 3MQQA 3JYIA 2J3TC 5TBMB 5CX7A 3R4KA 3A0RA 4BWIA 1PFLA 4HEFA 1T1AA 3ZNTA 3ZNYA 4FTXA 2M1CA 4G3WA 1PI5A 5CXWA 4ZBEA 2Y91A 1MXOA 3BY9A 2WGIA 5HAIA 2W1TA 3ITAA 2FZ0A 3SS5A 2CMNA 3PR6A 3K3DA 2WZZA 1DP6A 4EESA 3IX4A 4S2KA 3LI9A 4OLDA 4FOFA 3RFBA 5FQIA 4KG5A 5DFYA 3B3XA 5DTSA 4UEYA 4EERA 4KZ9A 3BFDA 3EGXC 4I3AA 3N8LA 1NWZA 1MWUA 1NLYA 1BLHA 1E3UD 5A93A 3BFFA 4UA9A 2JKRI 3UPPA 2W0NA 1FSWA 3MSHA 2Y2IA 4RX2A 1L0GA 1PI4A 2XFSA 4EW7A 2EWWA 5EPHA 4L9FA 2IWDA 3LI8A 1A0KA 3Q7VB 3LR5A 3LIAA 1T1CA 2J9PA 3UPNA 4OOMA 3E2KA 4UA7A 4YFMA 5GL9A 2QZ6A 2K7SA 1XJ2A 5E2FA 5HZHA 4S2OA 3V50A 4LPZA 4LV2A 3TOIA 2IWBA 5FQJA 1DJCA 3HUOA 3NBLA 2BTFP 2WAFA 2BASA 1BLSA 2QHKA 3BRMA 1OT6A 3E98A 5CEBA 2OAP1 1OTDA 5DKLA 2J8YA 1XGJA 5CGXA 1JVJA 3MBZA 2QJ7A 5AQ7A 3DTEA 1TF1A 3VOYA 1FCNA 2WUQA 2GX5A 4MNRA 1XPBA 1LL9A 1G6OA 4S2NA 4OH0A 3GQZA 3N4IA 3M2KA 4RA7A 2EX6A 4S2NC 3ZHHA 1OJ5A 3W4QA 1NYYA 2ZQAA 4IUKA 2DCFA 4Y0UA 2ZC5B 4PAUA 4MN7A 4R70A 2PHYA 2WKHA 3BY8A 3OBFA 2H10A 2JCHA 4GOGA 2DRWA 3QP6A 2P7JA 1UWPX 1Z09A 3HUMA 4HOIA 3HCYA 4E3JA 3RH8B 3L9KA 5HDSA 4OVDA 1K57A 4R4RA 4CJNA 4Y17A 3VP1A 5F69A 1IYOA 2W1TB 4YNRA 3NDGA 4ETXA 1I2SA 1FSYA 2YKHA 2VLGA 3EOIA 4Y0TA 2H0YA 5GHXA 2EX8A 4E6WA 2XA7M 1TDLA 1L0FA 4JF5A 1BLPA 3EWKA 4KZ7A 5F1FA 3HLCA 2Q9MA 3Q1FA 1FR6A 2W27A 5A90A 1YLWA 1NLZA 3OZHA 4P6ZS 2VV7A 3VP2A 1XFQA 4S2LA 3MZEA 2HDUA 3MXQA 5JYPA 1T19A 3E0YA 3ZVTA 1ALQA 4OPZA 2R9WA 3PBRA 4GDNA 2BG1A 4XUXA 3BJNA 2ZM0A 2W3DA 2Y79A 2JKGA 4E3NA 5AQAA 4WUJA 2ZL1A 4N9KA 3LYXA 3BW6A 4WYYA 1FIKA 4LCLA 3MZDA 4OQ0A 1G5UA 1W79A 3SH7A 4QPRA 4F3LB 1ES5A 4GKUA 1JNUA 2I72A 2HP6A 2JC7A 4BL2A 5A92A 3OPPA 4LENA 3F1OB 3NHQA 5HAQA 4KZAA 2KLIA 1CI9A 3HLGA 2O9BA 2ZLYA 1KGEA 3P98A 2Y2QA 1GHMA 3PTEA 5FAOA 2HV1A 4R1GA 3RXXA 4ARZA 1KVMA 4EQIA 2HGVA 3MKFA 3CLOA 5EVLA 5KSHA 4GB7A 1W5DA 5KZHA 4LCMA 3IH8A 5CERA 1ERQA 1FOFA 5U47A 2OWHA 3V3SA 1GA9A 4MLLA 3H7WA 2VZWA 5CGWA 4IEDA 3GR2A 4CLCD 4RX3A 2HJ9C 1YPRA 1LI0A 3K3CA 4U0XA 2LB5A 3T4TA 4JPMA 4ETZA 4BENA 3PBSA 3G2YA 4LLOB 1XKZA 5FA7A 3T1SA 5DTTA 2FH5A 2YKFA 3C8CA 5AQ9A 5AVEA 1UWNX 4RVAA 4IBXA 1ES3A 2INWA 3PYPA 3D3OA 3P09A 1E4DA 3C4OA 3WS4A 4ESPA 1HD8A 4GD6A 3VFFA 3LY3A 4WZ4A 2HDQA 4I38A 2B02A 2M7VA 3N7WA 4I39A 3WRZA 3NDEA 3W2ZA 4DE2A 3W8KA 2PRFA 1W63Q 4PMAA 5HSQA 2FFFB 2B5RA 3FV7A 4JGRA 4K0WA 1N9BA 1H8YA 3ULFA 4Y15A 1KE0A 4X55A 4DDSA 1K38A 3KX0X 4KQQA 1NRFA 3T4LA 4Y0OA 4IBRA 3E4OA 1NYMA 4MCWA 4FH2A 3VOZA 1W8YA 2VK3A 1D7EA 1NZOA 1QMFA 3OPRA 5FQMA 3V67A 2P74A 4WLAA 3SS3A 1OMEA 2JN7A 2C6WB 3UDIA 1YLPA 2O0YA 1BT5A 1J3WA 4EEUA 1VQQA 3L7HA 4H6JA 4OQGA 2Y2KA 4C6YA 1PNEA 3LICA 3RTYA 3FPVA 1KVLA 3BFGA 3LCEA 3IX8A 1YM1A 3MF0A 3OCLA 5TR7A 2Y2GA 5M18A 4PM6A 1TS7A 4HESA 2QKPA 3ZQ5A 1GSXA 1BTLA 2OWJA 5HPIA 1PZPA 1O07A 5CRFA 3IWQA 1GHIA 2A2LA 2PBDP 1OJGA 3A3DA 1PW1A 2L1MA 3LO7A 2JHEA 4N1XA 1IKGA 1XGIA 3QP8A 4WMCD 2C5WB 3SW1A 3UPOA 2XDMA 2VGLS 4NXGA 1KGGA 4B93A 1TS8A 1IYSA 3NJAA 5GLAA 5CEDA 3IF6A 3HLEA 1NJ4A 5FDHA 3LR3A 2Y8HA 3C7UA 4B4XA 3LEQA 5FATA 1G68A 3IH9A 1TS0A 1DP8A 3ICYA 2WGWB 3OOVA 3O86A 2VV6A 2QYBA 4ZAMA 3N8SA 3JVVA 3F1PA 5FQ9A 3E4QA 4KZBA 4S2IA 4R38A 4LV3A 1LI9A 2XF3A 3UDXA 4CLCA 2Y2OA 3CITA 1TEMA 3BYDA 2Y2JA 4II7A 4KZ8A 1GHPA 4LFUA 3GSGA 1NXYA 4GZBA 3S22A 5E43A 3CPTB 3CJMA 2K31A 3DTKA 5EVIC 2EFXA 4MBFA 1GA0A 3BFCA 4FCFA 1L0DA 3UE0A 3TG9A 2VA0A 5DF7A 1XX2A 2XRNA 4UQIS 3EEAA 3CAXA 1ES4A 3FYZA 5DTKA 2KOIA 1ESUA 2PDRA 1GSVA 5FQQA 2Y2HA 4QWOA 2Z6CA 3OCNA 4FUWA 5CHMA 3WS1A 3A3IA 4DMZA 2Q0OA 2WK0A 3FWLA 1FCOA 5BOHA 5HAPA 3PBTA 3T50A 3KSIA 1H8MA 3G31A 1F98A 1K0KA 2QWSA 4GCZA 4Y13A 3O3VA 4NKPA 1MY8A 1T18A 3LIFA 5DF9A 4WEJA 2V8FA 1L3LA 5KMWA 5FAQA 3UB9A 2UV0E 2Y59A 2OV5A 4PKYA 4EV4A 3PHYA 2V1AA 2V1BA 4K08A 3FZCA 4GLQA 1U60A 2IWCA 1YAXA 2ZM2A 1DRMA 5K5BA 4QU3A 1OTIA 4I3IA 4S2PA 5HARA 5E2EA 1PYYA 4ZDXA 3G35A 4E3LA 2R78A 5G4YA 3QNBA 1NY0A 1CJFA 3FG8A 3LIEA 5M19A 4EBPA 1MBLA 4PM9A 4WMCA 3GTCA 3UN7A 1Z6FA 1LSXA 3HLFA 5D3OA 1S66L 4JGOA 2EWVA 3IT9A 3S1YA 4DXBA 4N92A 3MR0A 1HZOA 2EXBA 4HNBA 4P6ZM 3BQ8A 1IYPA 1K55A 2VGKA 3MFXA 3LGOA 4OLGA 4WEKA 3U4LP 1CI8A 3KSFA 3UY6A 4OPRA 2Y4AA 5EVIB 3IX3A 4KZ5A 5HFOA 4EBNA 2WGVA 2HP9A 4LV0A 1TD5A 3LR0A 4A5RA 5MC7A 3M2JA 2OLUA 2WKRA 4PM7A 4PHTA 3LY4A 5TJJA 3RXWA 3UNWA 3A0VA 4M4XA 1LL8A 5AVFA 2J9OA 1PWCA 1WA9A 1K56D 3T12B 5DJUA 2K2NA 5HWVA 3LUQA 1VETA 1K4EA 4OOLA 3EEHA 1FQGA 4KQOA 1ZKJA 2ZBBA 3C30A 4HBUA 3BWLA 2QMIA 3T4JA 1K57C 3DWKA 3CZDA 4RQ9A 4Y7PA 2HF6A 3I7JA 1YQSA 4BMWA 2ACGA 4YINA 5CTNA 4KUKA 1P0ZA 3NULA 1NZUA 4B9OA 4HJ6A 4JXVA 1YLYA 4GS9A 3KYEA 4BBUA 1ODVA 3T4SA 4EBLA 5HW3A 5CTMA 2JKFA 4P0MA 2PR6A 5HWWA 4XT2A 3D72A 5DFXA 4C3QA 4PKYG 3T1QB 3ZG0A 1JWVA 1X0OA 3M6BA 3V39A 2XD1A 3VV4A 3AGEA 3IS2A 4EXOA 4ZJ2A 1M40A 4L9EA 2XR0A 3TSGA 1E3UA 2HP5A 4X69A 4MBKA 4NEED 4X56A 4G3KA 1GSWA 4NK3A 1FCMA 3CHWP 4S2JA 1FILA 4WF0A 1J9MA 3QP5A 4GDBA 2OLVA 1SHVA 3S4XA 5E2HA 1YKDA 2J7VA 3G34A 4GN2A 4K91A 1CEFA 1WYBA 3QNCA 3ZG9B 1XA1A 2A24A 1N9NA 4L9GA 2RCXA 4Q0JA 2G2UA 1Q2QA 1SZVA 3Q7ZA 5FL3A 5L8MA 4CPKA 1KGFA 4BL3A 5G4ZA 3OPHA 1WYCA 1GCEA 4UA6A 3VE3A 1XJ3A 4E04A 3SH9A 3IHBA 5EV0A 3Q07A 2ZM8A 2R9XA 3HBRA 4JXWA 1CEGA 1PRQA 4O0PA 3JVUA 1MZUA 5F83A 2GDNA 1V9YA 1YSPA 4Y3IA 1ZG4A 4OPQA 1L2SA 4NXFA 3DAVA 4O7DA 3G32A 4EUZA 5HPFA 2ZC3B 3JPUA 2P04A 4O01A 1OPXA 2ZC6B 4HHDA 2J3TD 3MJQA 2VGLM 3H82A 2V0UA 1RP5A 4E6XA 3H9WA 2X01A 2VX8A 4LRYC 4P87A 1HTZA 2VV8A 4NG2A 1F5MA 1OT9A 2HJEA 2ZMAA 1MC0A 4OQHA 4R0QA 3UB6A 1K56A 3CI6A 2J80A 3NC8A 2V2FF 3RJUA 4IVKA 3IQAA 5HDDA 3O87A 2W3HA 3C4PA 3PAEA 1S67L 3BLSA 3V5MA 5HL1A 4XT2B 2I9VA 2UWXA 1ZC2A 2HDSA 4KZ6A 4QJGA 5L07A 1AXBA 4KQRA 3R7WA 2O99A 2E8JA 5TBMA 1IKIA 2E8IA 4X1LA 1ONHA 4Q0IA 3A0SA 2ZL1B 4Q8IA 1K54A 2FFYA 1E25A 4BJPA 4LGWA 4PM8A 2PAVP 4F94A 4WL9A 2PYRA 4BBVA 2XEPA 4ME4A 1STZA 2ZMFA 4Z9QA 3VP0A 3HREA 1OTEA 1W7FA 2Q9NA 2NUTC 3GVBA 3B42A 4X1MA 4C75A 4WZ5A 1NRJA 3LEZA 3PBNA 4MBHA 4ARZB 1BLCA 3B47A 4HP9A 4WELA 2Z2MB 4UQIM 3V3RA 1TVFA 4E3MA 4R3BA 2EA9A 2WKIA 4JLFA 2P9VA 4OP5A 1KE4A 3PXPA 1SKOA 3H7WB 4D60A 5FQKA 2VGJA 3A3FA 5GLDA 1SDNA 3GDIA 4R6LA 4ID4A 3IF6C 4WN5A 4HI4A 4EQ1A 4YOFA 3GV9A 1BZAA 1BUEA 1ACFA 3DTMA 4DE0A 3UE1A 1ES2A 2B18A 3SOIA 1N9LA 1C3BA 2X02A 2Y2NA 1VB6A 3VE4A 1LHYA 5I5LA 1S4RA 1ZG6A 2OOLA 2V20A 3AGDA 3ZFZA 3Q82A 1XJ6A 3VP4A 1VEUA 2ZD8A 3KSHA 4CLCC 4Z1WA 3QHYA 5EUAA 4Y5FA 2HDRA 2EXAA 5L09A 1T1BA 3ZYTA 4BBTA 1LLBA 4IVIA 3P01A 2BLSA 3IF5A 3U2AA 1I5QA 1W63M 2MJ6A 3O5YA 3IBJA 3FPWA 4LRZE 1BULA 1F9IA 3G4PA 5GHYA 3BM6A 2IA2A 4PM5A 2W3EA 3S7OA 4JKTA 3HL9A 1XA7A 4KZ4A 4B4ZA 1YLZA 2JKTI 3BECA 4DE1A 2EFUA 3NOTC 4R4SA 5FI6A 5EECA 2EX2A 2LB9A 5EOOA 2HZ5A 4LV1A 4G3VA 2D02A 1IYQA 3R7WB 5J3WA 1S1YA 1Y54A 4H6JB 3TJZC 2XK1A 5IT5A 3ZDJA 2XH9A 4DJ3A 5TFQA 3SS4A 3HVFA 5IU1A 3ITBA 3GMWA 1PIOA 5DJTA 2PT7A 3BLMA 3CWFA 5EE8A 3C7VA 5A8BA 5HWTA 4NXBA 3S7PA 2L4RA 4NETA 1P9WA 2G2WA 2QJ5A 4AFIA 1TDGA 4O8GA 3PBOA 4P6BA 5J8XA 3G6OA 2P9VB 1YMXA 3SH8A 1SKOB 1D06A 4FD8A 3KSGA 3WS0A 5FI2A 3UDFA 5GHZA 5KSCA 3IF6B 5DF8A 3OPLA 3UB8A 3T1RA 4KUOA 3MQ0A 1P9RA 3HJKA 3NI9A 1S1ZA 2Y55A 1AWIA 4WBGA 5J4EA 3QP1A 2ZJ9A 1H3QA 4N9LA 2JBFA 4JBFA 4F3LA 4JGPA 3F1PB 3G2ZA 5DKKA 2OAQ1 1XP4A 4HP4A 4Y2FA 5CHUA 3C5AA 1H0MA 4HJ4A 4GJ4A 3F1NA 3F1OA 1VEUB 4ZJ3A 4CLCB 3MFDA 3T4OA 2DMWA 4R23A 4BLMA 5E2GA 2XQZA 1BSGA 3BFEA 1PWDA 4DJ2A 4E3OA 3NOUC 3EGDC 4LRXC 1K55C 3KYQA 1ERMA 2WZXA 4I5SA 3CMZA 4HH3A 3W4PA 2JKTM 5J7EA 2DNSA 1YT4A 4IJGA 3VP3A 1G28A 2ZOHA 2O9CA 2ZMVA 3LFVA 5GLBA 5M1AA 1DY6A 3DW0A 5EM0A 3W4OA 3UMDA 2ZQ8A 5AJGA 4DF6A 1IELA 2Z2LB 1MKMA 3NECA 3PBQA 1SCWA 3WRTA 1Y4OA 1I2WA 4HJ3A 4IUHA 4X6TA 5FEFA 1P97A 1JTDA 2OSUA 2H28A 5FDSA 1S4SA 3HUNA 4BD0A 3UMEA 4MN6A 1O7EA 4RYEA 1EW0A 4OOYA 2H5SA 3IXDA 3NOPC 4P85A 2GJ3A 4QY6A 3M6HA 4DKIA 1IOUA 1BYWA 2M7UA 3MXRA 5CECA 1G6AA 4DE3A 2PBYA 3VOLA 1Q2PA 1KDSA 4XUZA 4KZ3A 3MS6A 4MDZA 4U0TA 3A3JA 4XXRA 2CC1A 4MEZA 3UE3A 3IWIA 2RL3A 3FKVA 5F6AA 4MMNA 2ZC7A 1JTGA 5F82A 3ZG8B 1RGYA 1YSQA 2JKRM 4L0LA 5G18A 3UB7A 1KE3A 2HPBA 1D1JA 4OPYA 1MKIA 4E3KA 4HH2A 1LSWA 4DXCA 3IXBA 3WWXA 4IHQA 5EVEA 2WKQA 4KG2A 4H8RA 3VSLA 3C2WA 4HBTA 2A49A 2V1ZA 3E4PA 2J3WA 5F1GA 5KIZA 4WM9A 2AVXA 3UE6A 4HY8A 4QHCA 3MXSA 4BD1A 1UGUA 2WKPA 1KOUA 4N1HA 3T4QA 3CUEA 1CK3A 1DJBA 5IHVA 4OQIA 4X68A 3CUEC 4EEPA 3DBAA 4JF4A 4JXSA 3GRJA 1IEMA 3FKWA 3IWOA 4GHIA 5F5YA 1N4OA 2P08A 2W1RA 2PR5A 4S2MA 1PWGA 2H0TA 3F1NB 3ZG7B 4EWFA 2VJWA 3GECA 1LT0A 3MMHA 4JF6A 3MQOA 4OP8A 1DP9A 4FSFA 1S0WA 1WE4A 5DVAA 5JYOA 4NXEA 2V9AA 2Z6DA 3NCKA 1MWTA 2A3UA 4U3TA 5FSRA 3BQAA 2PD8A 1M6KA 2PYPA 4Q0HA 1XJ4A 4X53A 4I3JA 3QP2A 3ISGA 3DWZA 2XA7S 2L0WA 1V9ZA 3C38A 4UHUA 3HJIA 3VMAA 3P7NA 4EETB 4GW9A 4R3AA 5EVID 2WGWA 4FH4A 2XGNA 3ZG5A 2W3GA 4QY5A 1VETB 1ESIA 1RCJA 4HQAA 3LIBA 4JGQA 2Y2PA 3ZVWA 2ZC4B 3HLDA 3OC2A 1K6RA 3K2NA 3TW8A 3N8RA 2GZAA 4CLCE 1TS6A 5FASA 2WAEA 4R3JA 1XXMA 3WS5A 3IBRA 3LR4A 4GNUA 1YLTA 3NY4A 2D01A 1LSVA 1RGZA 5IS1A 4KQDA 2XFTA 1ONGA 5AQBA 4ZTKA 3QP4A 4GS9B 3CPTA 3WS2A 3S7QA 3HLWA 4B88A 5FEGA 1YMSA 4UAAA 1HVBA 3ZCZA 2ZQ7A 5HDCA 3G30A 5FAPA 3IHAA 5TGFA 5CGSA 4KENB 3PAGA 5C5KA 1S6RA 3CG5A 1W8QA 4CQHA 1JWZA 1ZHHB 1SKFA 3SZTA 1LL5A 3IS2B 4BQMA 2XROA 4D2OA 3AGFA 1N9OA 2WKEA 1DJAA 1K54C 5I94A 4DN0A 4OKPA 2O9AA 3KO6A 2JE5A 3E2LA 4GD8A 2X71A 5LBRA 2XSSA 5GLCA 2KX6A 4PPRA 3EQUA 3T1XA 3FC7A 2PD7A 2B95A 1EWZA 1K25A 5EOEA 3OLOA 3DTIA 3LIDA 3ZGAB 1EROA 2NUPC 2W3FA 3N6IA 3O88A 3A3EA 4WZ5C 4QB8A 4GHIB 3VSKA 1SDEA 1PW8A 5EFWA 2A24B 4KG6A 4M3KA 3HLBA 2KDKA 4DRTA 2Y2LA 2PU4A 3BEBA
chains in the Genus database with same CATH topology
4OOLA 3EEHA 5A8BA 4KQOA 4YWZA 4LLOB 3T4KA 5HWTA 2ZBBA 3C30A 4NXBA 3S7PA 2L4RA 3BWLA 1OTBA 1P9WA 3T4JA 2FH5A 2YKFA 3C8CA 1Y28A 2QJ5A 4RQ9A 5AVEA 1UWNX 4AFIA 2HF6A 2INWA 3PYPA 3B33A 3D3OA 4O8GA 4BMWA 3PBOA 4KUKA 1P0ZA 3TE8A 3G6OA 4B9OA 4HJ6A 4I38A 2B02A 2M7VA 4EU0A 4I39A 4MN5A 2G7UA 3W2ZA 4GS9A 1D06A 3KSGA 4BBUA 1ODVA 4EUVA 1W63Q 5HD5A 3T4SA 1OTAA 3UB8A 5F68A 3KYZA 5HSQA 1ZTUA 1XFNA 2PR6A 5HWWA 4XT2A 3D72A 4KUOA 2GNXA 4JGRA 3MQ0A 1P9RA 3HJKA 1S1ZA 5DFXA 5J4EA 2V0WA 3ULFA 4PKYG 1H3QA 2ZOIA 1X0OA 2VKSA 3KX0X 4F3LA 3VV4A 4JGPA 3T4LA 3H82B 3IS2A 3F1PB 4EXOA 3E4OA 5DKKA 2OAQ1 5HD3A 4HP4A 4MCWA 4L9EA 3S7NA 4Y2FA 4HJ4A 4GJ4A 1IFQA 3F1NA 3F1OA 4CLCB 5HL6A 3T4OA 4HIAA 2DMWA 1D7EA 3EQVA 3V67A 4NEED 4G3KA 1GSWA 4WLAA 4ZRRA 4DJ2A 3NOUC 3EGDC 2VEAA 4LRXC 2JN7A 3KYQA 1VHMA 2O0YA 4I5SA 4WF0A 4HH3A 2JKTM 4EEUA 5J7EA 4H6JA 4IJGA 3LICA 3RTYA 1G28A 1YKDA 3TRCA 2ZOHA 3FPVA 3MQQA 2O9CA 2ZMVA 3LFVA 2J3TC 5TBMB 3MF0A 2A24A 5CX7A 1N9NA 3OCLA 3R4KA 3A0RA 5AJGA 3UMDA 4BWIA 4L9GA 4Q0JA 5FL3A 5L8MA 1MKMA 1T1AA 1TS7A 3PBQA 2M1CA 4G3WA 2QKPA 3ZQ5A 5G4ZA 1GSXA 4HJ3A 2OWJA 4IUHA 5HPIA 3BY9A 1P97A 2A2LA 2H28A 3VE3A 1OJGA 2W1TA 1S4SA 3UMEA 1XJ3A 2L1MA 4MN6A 2FZ0A 4E04A 2CMNA 1EW0A 3PR6A 2JHEA 3K3DA 1DP6A 4EESA 3NOPC 3SW1A 3LI9A 2GJ3A 4O0PA 4FOFA 3JVUA 3RFBA 4NXGA 1MZUA 2VGLS 5DFYA 1V9YA 1IOUA 1BYWA 2M7UA 1YSPA 4UEYA 4B93A 4EERA 1TS8A 3NJAA 3VOLA 4Y3IA 3EGXC 4I3AA 1NWZA 4MDZA 1NLYA 3LR3A 3UE3A 4NXFA 5F6AA 2Y8HA 4MMNA 2JKRI 2W0NA 1YSQA 2JKRM 4L0LA 1TS0A 1DP8A 3ICYA 3UB7A 5HPFA 3OOVA 2P04A 2VV6A 4EW7A 2QYBA 4O01A 4HH2A 1OPXA 2EWWA 3JVVA 4HHDA 2J3TD 3MJQA 1LSWA 2VGLM 3H82A 2V0UA 3F1PA 3E4QA 4L9FA 4R38A 3LI8A 4IHQA 3H9WA 2VX8A 2WKQA 3LR5A 4LRYC 2VV8A 3LIAA 1T1CA 1F5MA 1OT9A 2HJEA 3C2WA 1MC0A 4CLCA 4OOMA 3UB6A 3CITA 3CI6A 2J80A 3E4PA 2J3WA 2K7SA 5KIZA 1XJ2A 4II7A 5HZHA 3UE6A 4HY8A 4LPZA 5HDDA 2W3HA 1UGUA 2BASA 1S67L 2K31A 2WKPA 2QHKA 1KOUA 4XT2B 1OT6A 2I9VA 3E98A 3T4QA 3CUEA 2OAP1 1OTDA 5DKLA 3R7WA 3CUEC 2O99A 4EEPA 3DBAA 5TBMA 4Q0IA 2QJ7A 3A0SA 2VA0A 4GHIA 5F5YA 1TF1A 2P08A 2W1RA 2PR5A 2XRNA 4UQIS 4BJPA 3EEAA 2GX5A 3CAXA 4WL9A 3F1NB 2KOIA 2PYRA 2VJWA 3GECA 1LT0A 3MMHA 2PDRA 1G6OA 4BBVA 1GSVA 3MQOA 4ME4A 1STZA 2ZMFA 1DP9A 4FSFA 2Z6CA 3OCNA 1OJ5A 4NXEA 2V9AA 2Z6DA 4IUKA 4DMZA 1OTEA 2NUTC 3B42A 4PAUA 1NRJA 3PBTA 4MN7A 3T50A 4R70A 2PHYA 3KSIA 3BQAA 2PD8A 1H8MA 3BY8A 3OBFA 3PBNA 4ARZB 2PYPA 3B47A 1F98A 4HP9A 4WELA 4Q0HA 4UQIM 1XJ4A 2QWSA 4GCZA 4I3JA 2P7JA 2EA9A 1UWPX 2XA7S 4HOIA 3HCYA 4NKPA 3RH8B 3LIFA 1T18A 2L0WA 5DF9A 1V9ZA 4WEJA 3C38A 3PXPA 3HJIA 5HDSA 3H7WB 3P7NA 3UB9A 4EETB 4GW9A 4PKYA 3GDIA 4R6LA 3PHYA 4R3AA 2W3GA 4WN5A 2V1AA 5F69A 2W1TB 4HQAA 4YNRA 4HI4A 2V1BA 4EQ1A 4K08A 4ETXA 4YOFA 3LIBA 4GLQA 4JGQA 2YKHA 2VLGA 3EOIA 2B18A 3OC2A 1N9LA 1YAXA 3K2NA 2XA7M 3TW8A 2GZAA 4CLCE 1VB6A 1TS6A 3VE4A 1DRMA 5I5LA 5K5BA 1OTIA 3IBRA 3LR4A 1S4RA 2OOLA 3EWKA 4I3IA 2D01A 1LSVA 1XJ6A 5IS1A 4KQDA 2W27A 2R78A 1NLZA 3KSHA 4P6ZS 5G4YA 2VV7A 1XFQA 4GS9B 4CLCC 4Z1WA 3MXQA 1T19A 3S7QA 3E0YA 3FG8A 3LIEA 4Y5FA 1T1BA 3ZYTA 3PBRA 4BBTA 3BJNA 2W3DA 3P01A 2Y79A 5HDCA 4WUJA 3LYXA 1LSXA 3BW6A 3U2AA 1S66L 4JGOA 2EWVA 1W63M 5C5KA 2MJ6A 3O5YA 3IBJA 3FPWA 4LRZE 4CQHA 4QPRA 3MR0A 1ZHHB 4F3LB 1F9IA 3IS2B 2IA2A 4HNBA 1JNUA 4P6ZM 3BQ8A 2XROA 1N9OA 2W3EA 3MFXA 3S7OA 4DN0A 3F1OB 4WEKA 3NHQA 2KLIA 3KSFA 2O9AA 3KO6A 2JKTI 5LBRA 2O9BA 3NOTC 2XSSA 2KX6A 3EQUA 2HV1A 3FC7A 4ARZA 2PD7A 2LB9A 2HGVA 3CLOA 5KSHA 4G3VA 3OLOA 2D02A 3LIDA 3R7WB 1TD5A 2NUPC 5J3WA 1S1YA 2W3FA 3LR0A 5MC7A 2WKRA 4H6JB 3TJZC 4PHTA 5IT5A 4GHIB 5TJJA 2OWHA 4DJ3A 3A0VA 4M4XA 5IU1A 1LL8A 5EFWA 3H7WA 5AVFA 2A24B 2VZWA 5DJTA 4CLCD 1WA9A 2PT7A 2HJ9C 2KDKA 3CWFA 5DJUA 3K3CA 2K2NA 2LB5A 3T4TA 5HWVA 3LUQA 4ETZA 3PBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MF0 A;  2W3H A;  5I5L A;  5K5B A;  3S7P A;  3IBR A;  2K31 A;  3R4K A;  5AJG A;  2OOL A;  4BWI A;  3E98 A;  4Q0J A;  5L8M A;  1MKM A;  4RQ9 A;  2O99 A;  3D3O A;  3KSH A;  3DBA A;  4G3W A;  3ZQ5 A;  4O8G A;  4Q0I A;  4Z1W A;  4IUH A;  3S7Q A;  5HPI A;  3E0Y A;  3G6O A;  4Y5F A;  1TF1 A;  2W1R A;  2XRN A;  2W1T A;  3EEA A;  2GX5 A;  4EU0 A;  3BJN A;  2M7V A;  2W3D A;  4E04 A;  2G7U A;  2KOI A;  2VJW A;  2Y79 A;  3W2Z A;  3MMH A;  3KSG A;  4EUV A;  3NOP C;  4ME4 A;  1STZ A;  2ZMF A;  4O0P A;  4FOF A;  3RFB A;  5C5K A;  3O5Y A;  3IBJ A;  5DFY A;  5HSQ A;  4LRZ E;  2M7U A;  1YSP A;  4CQH A;  4IUK A;  4QPR A;  4DMZ A;  1ZTU A;  4PAU A;  2IA2 A;  4Y3I A;  3MQ0 A;  2XRO A;  4MN7 A;  4R70 A;  5DFX A;  3KSI A;  2W3E A;  4MDZ A;  3S7O A;  3OBF A;  4DN0 A;  3NHQ A;  4Q0H A;  2VKS A;  2KLI A;  3KSF A;  2Y8H A;  4MMN A;  2O9A A;  3KO6 A;  3VV4 A;  1YSQ A;  5LBR A;  2O9B A;  3NOT C;  4MCW A;  2XSS A;  3S7N A;  4Y2F A;  3HCY A;  5HPF A;  3OOV A;  2LB9 A;  2HGV A;  2QYB A;  4O01 A;  4G3V A;  5HL6 A;  1TD5 A;  2W3F A;  4GW9 A;  4G3K A;  4LRY C;  4R6L A;  4ZRR A;  3NOU C;  4LRX C;  2VEA A;  5TJJ A;  1F5M A;  2W3G A;  1VHM A;  3C2W A;  1MC0 A;  2O0Y A;  2W1T B;  4YNR A;  4ETX A;  4YOF A;  3CIT A;  3CI6 A;  2VZW A;  4GLQ A;  4IJG A;  2B18 A;  1YKD A;  2K2N A;  3K2N A;  3TRC A;  2LB5 A;  2O9C A;  3LFV A;  4ETZ A; 
#chains in the Genus database with same CATH topology
 4YWZ A;  2WAD A;  1JWP A;  1QME A;  3T4K A;  4OON A;  3MZF A;  1OTB A;  1YLJ A;  1Y28 A;  3IXG A;  1H5X A;  2XLN A;  3B33 A;  3MKE A;  3Q7V A;  3TE8 A;  5FI7 A;  2ZQ9 A;  3D4F A;  5HX9 A;  4EU0 A;  1MWR A;  4X25 A;  4MN5 A;  2G7U A;  3D9Y A;  4JXG A;  5A91 A;  1EI5 A;  1F2K A;  4EUV A;  3NIA A;  5HD5 A;  1OTA A;  1KDW A;  5F68 A;  3KYZ A;  2ZQD A;  1MPL A;  1ZTU A;  1XFN A;  2GNX A;  1L0E A;  2PU2 A;  4DDY A;  5CHJ A;  2V0W A;  2WYX A;  1K4F A;  4E3I A;  2ZOI A;  2VKS A;  3VFH A;  1CQA A;  3H82 B;  1H8Z A;  1CF0 A;  5HD3 A;  3S7N A;  1VM1 A;  5L2F A;  3UO9 A;  4QD4 A;  1K6S A;  1IFQ A;  5EM1 A;  2QPN A;  3IXH A;  2ZQC A;  2EX9 A;  4ZJ1 A;  5HL6 A;  1HLU P;  4HIA A;  2V8C A;  5EVI A;  3EQV A;  4K0X A;  2Y2M A;  4ZRR A;  1MWS A;  2VEA A;  1FR1 A;  1VHM A;  3Q81 A;  5L10 A;  3UB5 P;  2XD5 A;  1PZO A;  3TRC A;  3MQQ A;  3JYI A;  2J3T C;  5TBM B;  5CX7 A;  3R4K A;  3A0R A;  4BWI A;  1PFL A;  4HEF A;  1T1A A;  3ZNT A;  3ZNY A;  4FTX A;  2M1C A;  4G3W A;  1PI5 A;  5CXW A;  4ZBE A;  2Y91 A;  1MXO A;  3BY9 A;  2WGI A;  5HAI A;  2W1T A;  3ITA A;  2FZ0 A;  3SS5 A;  2CMN A;  3PR6 A;  3K3D A;  2WZZ A;  1DP6 A;  4EES A;  3IX4 A;  4S2K A;  3LI9 A;  4OLD A;  4FOF A;  3RFB A;  5FQI A;  4KG5 A;  5DFY A;  3B3X A;  5DTS A;  4UEY A;  4EER A;  4KZ9 A;  3BFD A;  3EGX C;  4I3A A;  3N8L A;  1NWZ A;  1MWU A;  1NLY A;  1BLH A;  1E3U D;  5A93 A;  3BFF A;  4UA9 A;  2JKR I;  3UPP A;  2W0N A;  1FSW A;  3MSH A;  2Y2I A;  4RX2 A;  1L0G A;  1PI4 A;  2XFS A;  4EW7 A;  2EWW A;  5EPH A;  4L9F A;  2IWD A;  3LI8 A;  1A0K A;  3Q7V B;  3LR5 A;  3LIA A;  1T1C A;  2J9P A;  3UPN A;  4OOM A;  3E2K A;  4UA7 A;  4YFM A;  5GL9 A;  2QZ6 A;  2K7S A;  1XJ2 A;  5E2F A;  5HZH A;  4S2O A;  3V50 A;  4LPZ A;  4LV2 A;  3TOI A;  2IWB A;  5FQJ A;  1DJC A;  3HUO A;  3NBL A;  2BTF P;  2WAF A;  2BAS A;  1BLS A;  2QHK A;  3BRM A;  1OT6 A;  3E98 A;  5CEB A;  2OAP 1;  1OTD A;  5DKL A;  2J8Y A;  1XGJ A;  5CGX A;  1JVJ A;  3MBZ A;  2QJ7 A;  5AQ7 A;  3DTE A;  1TF1 A;  3VOY A;  1FCN A;  2WUQ A;  2GX5 A;  4MNR A;  1XPB A;  1LL9 A;  1G6O A;  4S2N A;  4OH0 A;  3GQZ A;  3N4I A;  3M2K A;  4RA7 A;  2EX6 A;  4S2N C;  3ZHH A;  1OJ5 A;  3W4Q A;  1NYY A;  2ZQA A;  4IUK A;  2DCF A;  4Y0U A;  2ZC5 B;  4PAU A;  4MN7 A;  4R70 A;  2PHY A;  2WKH A;  3BY8 A;  3OBF A;  2H10 A;  2JCH A;  4GOG A;  2DRW A;  3QP6 A;  2P7J A;  1UWP X;  1Z09 A;  3HUM A;  4HOI A;  3HCY A;  4E3J A;  3RH8 B;  3L9K A;  5HDS A;  4OVD A;  1K57 A;  4R4R A;  4CJN A;  4Y17 A;  3VP1 A;  5F69 A;  1IYO A;  2W1T B;  4YNR A;  3NDG A;  4ETX A;  1I2S A;  1FSY A;  2YKH A;  2VLG A;  3EOI A;  4Y0T A;  2H0Y A;  5GHX A;  2EX8 A;  4E6W A;  2XA7 M;  1TDL A;  1L0F A;  4JF5 A;  1BLP A;  3EWK A;  4KZ7 A;  5F1F A;  3HLC A;  2Q9M A;  3Q1F A;  1FR6 A;  2W27 A;  5A90 A;  1YLW A;  1NLZ A;  3OZH A;  4P6Z S;  2VV7 A;  3VP2 A;  1XFQ A;  4S2L A;  3MZE A;  2HDU A;  3MXQ A;  5JYP A;  1T19 A;  3E0Y A;  3ZVT A;  1ALQ A;  4OPZ A;  2R9W A;  3PBR A;  4GDN A;  2BG1 A;  4XUX A;  3BJN A;  2ZM0 A;  2W3D A;  2Y79 A;  2JKG A;  4E3N A;  5AQA A;  4WUJ A;  2ZL1 A;  4N9K A;  3LYX A;  3BW6 A;  4WYY A;  1FIK A;  4LCL A;  3MZD A;  4OQ0 A;  1G5U A;  1W79 A;  3SH7 A;  4QPR A;  4F3L B;  1ES5 A;  4GKU A;  1JNU A;  2I72 A;  2HP6 A;  2JC7 A;  4BL2 A;  5A92 A;  3OPP A;  4LEN A;  3F1O B;  3NHQ A;  5HAQ A;  4KZA A;  2KLI A;  1CI9 A;  3HLG A;  2O9B A;  2ZLY A;  1KGE A;  3P98 A;  2Y2Q A;  1GHM A;  3PTE A;  5FAO A;  2HV1 A;  4R1G A;  3RXX A;  4ARZ A;  1KVM A;  4EQI A;  2HGV A;  3MKF A;  3CLO A;  5EVL A;  5KSH A;  4GB7 A;  1W5D A;  5KZH A;  4LCM A;  3IH8 A;  5CER A;  1ERQ A;  1FOF A;  5U47 A;  2OWH A;  3V3S A;  1GA9 A;  4MLL A;  3H7W A;  2VZW A;  5CGW A;  4IED A;  3GR2 A;  4CLC D;  4RX3 A;  2HJ9 C;  1YPR A;  1LI0 A;  3K3C A;  4U0X A;  2LB5 A;  3T4T A;  4JPM A;  4ETZ A;  4BEN A;  3PBS A;  3G2Y A;  4LLO B;  1XKZ A;  5FA7 A;  3T1S A;  5DTT A;  2FH5 A;  2YKF A;  3C8C A;  5AQ9 A;  5AVE A;  1UWN X;  4RVA A;  4IBX A;  1ES3 A;  2INW A;  3PYP A;  3D3O A;  3P09 A;  1E4D A;  3C4O A;  3WS4 A;  4ESP A;  1HD8 A;  4GD6 A;  3VFF A;  3LY3 A;  4WZ4 A;  2HDQ A;  4I38 A;  2B02 A;  2M7V A;  3N7W A;  4I39 A;  3WRZ A;  3NDE A;  3W2Z A;  4DE2 A;  3W8K A;  2PRF A;  1W63 Q;  4PMA A;  5HSQ A;  2FFF B;  2B5R A;  3FV7 A;  4JGR A;  4K0W A;  1N9B A;  1H8Y A;  3ULF A;  4Y15 A;  1KE0 A;  4X55 A;  4DDS A;  1K38 A;  3KX0 X;  4KQQ A;  1NRF A;  3T4L A;  4Y0O A;  4IBR A;  3E4O A;  1NYM A;  4MCW A;  4FH2 A;  3VOZ A;  1W8Y A;  2VK3 A;  1D7E A;  1NZO A;  1QMF A;  3OPR A;  5FQM A;  3V67 A;  2P74 A;  4WLA A;  3SS3 A;  1OME A;  2JN7 A;  2C6W B;  3UDI A;  1YLP A;  2O0Y A;  1BT5 A;  1J3W A;  4EEU A;  1VQQ A;  3L7H A;  4H6J A;  4OQG A;  2Y2K A;  4C6Y A;  1PNE A;  3LIC A;  3RTY A;  3FPV A;  1KVL A;  3BFG A;  3LCE A;  3IX8 A;  1YM1 A;  3MF0 A;  3OCL A;  5TR7 A;  2Y2G A;  5M18 A;  4PM6 A;  1TS7 A;  4HES A;  2QKP A;  3ZQ5 A;  1GSX A;  1BTL A;  2OWJ A;  5HPI A;  1PZP A;  1O07 A;  5CRF A;  3IWQ A;  1GHI A;  2A2L A;  2PBD P;  1OJG A;  3A3D A;  1PW1 A;  2L1M A;  3LO7 A;  2JHE A;  4N1X A;  1IKG A;  1XGI A;  3QP8 A;  4WMC D;  2C5W B;  3SW1 A;  3UPO A;  2XDM A;  2VGL S;  4NXG A;  1KGG A;  4B93 A;  1TS8 A;  1IYS A;  3NJA A;  5GLA A;  5CED A;  3IF6 A;  3HLE A;  1NJ4 A;  5FDH A;  3LR3 A;  2Y8H A;  3C7U A;  4B4X A;  3LEQ A;  5FAT A;  1G68 A;  3IH9 A;  1TS0 A;  1DP8 A;  3ICY A;  2WGW B;  3OOV A;  3O86 A;  2VV6 A;  2QYB A;  4ZAM A;  3N8S A;  3JVV A;  3F1P A;  5FQ9 A;  3E4Q A;  4KZB A;  4S2I A;  4R38 A;  4LV3 A;  1LI9 A;  2XF3 A;  3UDX A;  4CLC A;  2Y2O A;  3CIT A;  1TEM A;  3BYD A;  2Y2J A;  4II7 A;  4KZ8 A;  1GHP A;  4LFU A;  3GSG A;  1NXY A;  4GZB A;  3S22 A;  5E43 A;  3CPT B;  3CJM A;  2K31 A;  3DTK A;  5EVI C;  2EFX A;  4MBF A;  1GA0 A;  3BFC A;  4FCF A;  1L0D A;  3UE0 A;  3TG9 A;  2VA0 A;  5DF7 A;  1XX2 A;  2XRN A;  4UQI S;  3EEA A;  3CAX A;  1ES4 A;  3FYZ A;  5DTK A;  2KOI A;  1ESU A;  2PDR A;  1GSV A;  5FQQ A;  2Y2H A;  4QWO A;  2Z6C A;  3OCN A;  4FUW A;  5CHM A;  3WS1 A;  3A3I A;  4DMZ A;  2Q0O A;  2WK0 A;  3FWL A;  1FCO A;  5BOH A;  5HAP A;  3PBT A;  3T50 A;  3KSI A;  1H8M A;  3G31 A;  1F98 A;  1K0K A;  2QWS A;  4GCZ A;  4Y13 A;  3O3V A;  4NKP A;  1MY8 A;  1T18 A;  3LIF A;  5DF9 A;  4WEJ A;  2V8F A;  1L3L A;  5KMW A;  5FAQ A;  3UB9 A;  2UV0 E;  2Y59 A;  2OV5 A;  4PKY A;  4EV4 A;  3PHY A;  2V1A A;  2V1B A;  4K08 A;  3FZC A;  4GLQ A;  1U60 A;  2IWC A;  1YAX A;  2ZM2 A;  1DRM A;  5K5B A;  4QU3 A;  1OTI A;  4I3I A;  4S2P A;  5HAR A;  5E2E A;  1PYY A;  4ZDX A;  3G35 A;  4E3L A;  2R78 A;  5G4Y A;  3QNB A;  1NY0 A;  1CJF A;  3FG8 A;  3LIE A;  5M19 A;  4EBP A;  1MBL A;  4PM9 A;  4WMC A;  3GTC A;  3UN7 A;  1Z6F A;  1LSX A;  3HLF A;  5D3O A;  1S66 L;  4JGO A;  2EWV A;  3IT9 A;  3S1Y A;  4DXB A;  4N92 A;  3MR0 A;  1HZO A;  2EXB A;  4HNB A;  4P6Z M;  3BQ8 A;  1IYP A;  1K55 A;  2VGK A;  3MFX A;  3LGO A;  4OLG A;  4WEK A;  3U4L P;  1CI8 A;  3KSF A;  3UY6 A;  4OPR A;  2Y4A A;  5EVI B;  3IX3 A;  4KZ5 A;  5HFO A;  4EBN A;  2WGV A;  2HP9 A;  4LV0 A;  1TD5 A;  3LR0 A;  4A5R A;  5MC7 A;  3M2J A;  2OLU A;  2WKR A;  4PM7 A;  4PHT A;  3LY4 A;  5TJJ A;  3RXW A;  3UNW A;  3A0V A;  4M4X A;  1LL8 A;  5AVF A;  2J9O A;  1PWC A;  1WA9 A;  1K56 D;  3T12 B;  5DJU A;  2K2N A;  5HWV A;  3LUQ A;  1VET A;  1K4E A;  4OOL A;  3EEH A;  1FQG A;  4KQO A;  1ZKJ A;  2ZBB A;  3C30 A;  4HBU A;  3BWL A;  2QMI A;  3T4J A;  1K57 C;  3DWK A;  3CZD A;  4RQ9 A;  4Y7P A;  2HF6 A;  3I7J A;  1YQS A;  4BMW A;  2ACG A;  4YIN A;  5CTN A;  4KUK A;  1P0Z A;  3NUL A;  1NZU A;  4B9O A;  4HJ6 A;  4JXV A;  1YLY A;  4GS9 A;  3KYE A;  4BBU A;  1ODV A;  3T4S A;  4EBL A;  5HW3 A;  5CTM A;  2JKF A;  4P0M A;  2PR6 A;  5HWW A;  4XT2 A;  3D72 A;  5DFX A;  4C3Q A;  4PKY G;  3T1Q B;  3ZG0 A;  1JWV A;  1X0O A;  3M6B A;  3V39 A;  2XD1 A;  3VV4 A;  3AGE A;  3IS2 A;  4EXO A;  4ZJ2 A;  1M40 A;  4L9E A;  2XR0 A;  3TSG A;  1E3U A;  2HP5 A;  4X69 A;  4MBK A;  4NEE D;  4X56 A;  4G3K A;  1GSW A;  4NK3 A;  1FCM A;  3CHW P;  4S2J A;  1FIL A;  4WF0 A;  1J9M A;  3QP5 A;  4GDB A;  2OLV A;  1SHV A;  3S4X A;  5E2H A;  1YKD A;  2J7V A;  3G34 A;  4GN2 A;  4K91 A;  1CEF A;  1WYB A;  3QNC A;  3ZG9 B;  1XA1 A;  2A24 A;  1N9N A;  4L9G A;  2RCX A;  4Q0J A;  2G2U A;  1Q2Q A;  1SZV A;  3Q7Z A;  5FL3 A;  5L8M A;  4CPK A;  1KGF A;  4BL3 A;  5G4Z A;  3OPH A;  1WYC A;  1GCE A;  4UA6 A;  3VE3 A;  1XJ3 A;  4E04 A;  3SH9 A;  3IHB A;  5EV0 A;  3Q07 A;  2ZM8 A;  2R9X A;  3HBR A;  4JXW A;  1CEG A;  1PRQ A;  4O0P A;  3JVU A;  1MZU A;  5F83 A;  2GDN A;  1V9Y A;  1YSP A;  4Y3I A;  1ZG4 A;  4OPQ A;  1L2S A;  4NXF A;  3DAV A;  4O7D A;  3G32 A;  4EUZ A;  5HPF A;  2ZC3 B;  3JPU A;  2P04 A;  4O01 A;  1OPX A;  2ZC6 B;  4HHD A;  2J3T D;  3MJQ A;  2VGL M;  3H82 A;  2V0U A;  1RP5 A;  4E6X A;  3H9W A;  2X01 A;  2VX8 A;  4LRY C;  4P87 A;  1HTZ A;  2VV8 A;  4NG2 A;  1F5M A;  1OT9 A;  2HJE A;  2ZMA A;  1MC0 A;  4OQH A;  4R0Q A;  3UB6 A;  1K56 A;  3CI6 A;  2J80 A;  3NC8 A;  2V2F F;  3RJU A;  4IVK A;  3IQA A;  5HDD A;  3O87 A;  2W3H A;  3C4P A;  3PAE A;  1S67 L;  3BLS A;  3V5M A;  5HL1 A;  4XT2 B;  2I9V A;  2UWX A;  1ZC2 A;  2HDS A;  4KZ6 A;  4QJG A;  5L07 A;  1AXB A;  4KQR A;  3R7W A;  2O99 A;  2E8J A;  5TBM A;  1IKI A;  2E8I A;  4X1L A;  1ONH A;  4Q0I A;  3A0S A;  2ZL1 B;  4Q8I A;  1K54 A;  2FFY A;  1E25 A;  4BJP A;  4LGW A;  4PM8 A;  2PAV P;  4F94 A;  4WL9 A;  2PYR A;  4BBV A;  2XEP A;  4ME4 A;  1STZ A;  2ZMF A;  4Z9Q A;  3VP0 A;  3HRE A;  1OTE A;  1W7F A;  2Q9N A;  2NUT C;  3GVB A;  3B42 A;  4X1M A;  4C75 A;  4WZ5 A;  1NRJ A;  3LEZ A;  3PBN A;  4MBH A;  4ARZ B;  1BLC A;  3B47 A;  4HP9 A;  4WEL A;  2Z2M B;  4UQI M;  3V3R A;  1TVF A;  4E3M A;  4R3B A;  2EA9 A;  2WKI A;  4JLF A;  2P9V A;  4OP5 A;  1KE4 A;  3PXP A;  1SKO A;  3H7W B;  4D60 A;  5FQK A;  2VGJ A;  3A3F A;  5GLD A;  1SDN A;  3GDI A;  4R6L A;  4ID4 A;  3IF6 C;  4WN5 A;  4HI4 A;  4EQ1 A;  4YOF A;  3GV9 A;  1BZA A;  1BUE A;  1ACF A;  3DTM A;  4DE0 A;  3UE1 A;  1ES2 A;  2B18 A;  3SOI A;  1N9L A;  1C3B A;  2X02 A;  2Y2N A;  1VB6 A;  3VE4 A;  1LHY A;  5I5L A;  1S4R A;  1ZG6 A;  2OOL A;  2V20 A;  3AGD A;  3ZFZ A;  3Q82 A;  1XJ6 A;  3VP4 A;  1VEU A;  2ZD8 A;  3KSH A;  4CLC C;  4Z1W A;  3QHY A;  5EUA A;  4Y5F A;  2HDR A;  2EXA A;  5L09 A;  1T1B A;  3ZYT A;  4BBT A;  1LLB A;  4IVI A;  3P01 A;  2BLS A;  3IF5 A;  3U2A A;  1I5Q A;  1W63 M;  2MJ6 A;  3O5Y A;  3IBJ A;  3FPW A;  4LRZ E;  1BUL A;  1F9I A;  3G4P A;  5GHY A;  3BM6 A;  2IA2 A;  4PM5 A;  2W3E A;  3S7O A;  4JKT A;  3HL9 A;  1XA7 A;  4KZ4 A;  4B4Z A;  1YLZ A;  2JKT I;  3BEC A;  4DE1 A;  2EFU A;  3NOT C;  4R4S A;  5FI6 A;  5EEC A;  2EX2 A;  2LB9 A;  5EOO A;  2HZ5 A;  4LV1 A;  4G3V A;  2D02 A;  1IYQ A;  3R7W B;  5J3W A;  1S1Y A;  1Y54 A;  4H6J B;  3TJZ C;  2XK1 A;  5IT5 A;  3ZDJ A;  2XH9 A;  4DJ3 A;  5TFQ A;  3SS4 A;  3HVF A;  5IU1 A;  3ITB A;  3GMW A;  1PIO A;  5DJT A;  2PT7 A;  3BLM A;  3CWF A;  5EE8 A;  3C7V A;  5A8B A;  5HWT A;  4NXB A;  3S7P A;  2L4R A;  4NET A;  1P9W A;  2G2W A;  2QJ5 A;  4AFI A;  1TDG A;  4O8G A;  3PBO A;  4P6B A;  5J8X A;  3G6O A;  2P9V B;  1YMX A;  3SH8 A;  1SKO B;  1D06 A;  4FD8 A;  3KSG A;  3WS0 A;  5FI2 A;  3UDF A;  5GHZ A;  5KSC A;  3IF6 B;  5DF8 A;  3OPL A;  3UB8 A;  3T1R A;  4KUO A;  3MQ0 A;  1P9R A;  3HJK A;  3NI9 A;  1S1Z A;  2Y55 A;  1AWI A;  4WBG A;  5J4E A;  3QP1 A;  2ZJ9 A;  1H3Q A;  4N9L A;  2JBF A;  4JBF A;  4F3L A;  4JGP A;  3F1P B;  3G2Z A;  5DKK A;  2OAQ 1;  1XP4 A;  4HP4 A;  4Y2F A;  5CHU A;  3C5A A;  1H0M A;  4HJ4 A;  4GJ4 A;  3F1N A;  3F1O A;  1VEU B;  4ZJ3 A;  4CLC B;  3MFD A;  3T4O A;  2DMW A;  4R23 A;  4BLM A;  5E2G A;  2XQZ A;  1BSG A;  3BFE A;  1PWD A;  4DJ2 A;  4E3O A;  3NOU C;  3EGD C;  4LRX C;  1K55 C;  3KYQ A;  1ERM A;  2WZX A;  4I5S A;  3CMZ A;  4HH3 A;  3W4P A;  2JKT M;  5J7E A;  2DNS A;  1YT4 A;  4IJG A;  3VP3 A;  1G28 A;  2ZOH A;  2O9C A;  2ZMV A;  3LFV A;  5GLB A;  5M1A A;  1DY6 A;  3DW0 A;  5EM0 A;  3W4O A;  3UMD A;  2ZQ8 A;  5AJG A;  4DF6 A;  1IEL A;  2Z2L B;  1MKM A;  3NEC A;  3PBQ A;  1SCW A;  3WRT A;  1Y4O A;  1I2W A;  4HJ3 A;  4IUH A;  4X6T A;  5FEF A;  1P97 A;  1JTD A;  2OSU A;  2H28 A;  5FDS A;  1S4S A;  3HUN A;  4BD0 A;  3UME A;  4MN6 A;  1O7E A;  4RYE A;  1EW0 A;  4OOY A;  2H5S A;  3IXD A;  3NOP C;  4P85 A;  2GJ3 A;  4QY6 A;  3M6H A;  4DKI A;  1IOU A;  1BYW A;  2M7U A;  3MXR A;  5CEC A;  1G6A A;  4DE3 A;  2PBY A;  3VOL A;  1Q2P A;  1KDS A;  4XUZ A;  4KZ3 A;  3MS6 A;  4MDZ A;  4U0T A;  3A3J A;  4XXR A;  2CC1 A;  4MEZ A;  3UE3 A;  3IWI A;  2RL3 A;  3FKV A;  5F6A A;  4MMN A;  2ZC7 A;  1JTG A;  5F82 A;  3ZG8 B;  1RGY A;  1YSQ A;  2JKR M;  4L0L A;  5G18 A;  3UB7 A;  1KE3 A;  2HPB A;  1D1J A;  4OPY A;  1MKI A;  4E3K A;  4HH2 A;  1LSW A;  4DXC A;  3IXB A;  3WWX A;  4IHQ A;  5EVE A;  2WKQ A;  4KG2 A;  4H8R A;  3VSL A;  3C2W A;  4HBT A;  2A49 A;  2V1Z A;  3E4P A;  2J3W A;  5F1G A;  5KIZ A;  4WM9 A;  2AVX A;  3UE6 A;  4HY8 A;  4QHC A;  3MXS A;  4BD1 A;  1UGU A;  2WKP A;  1KOU A;  4N1H A;  3T4Q A;  3CUE A;  1CK3 A;  1DJB A;  5IHV A;  4OQI A;  4X68 A;  3CUE C;  4EEP A;  3DBA A;  4JF4 A;  4JXS A;  3GRJ A;  1IEM A;  3FKW A;  3IWO A;  4GHI A;  5F5Y A;  1N4O A;  2P08 A;  2W1R A;  2PR5 A;  4S2M A;  1PWG A;  2H0T A;  3F1N B;  3ZG7 B;  4EWF A;  2VJW A;  3GEC A;  1LT0 A;  3MMH A;  4JF6 A;  3MQO A;  4OP8 A;  1DP9 A;  4FSF A;  1S0W A;  1WE4 A;  5DVA A;  5JYO A;  4NXE A;  2V9A A;  2Z6D A;  3NCK A;  1MWT A;  2A3U A;  4U3T A;  5FSR A;  3BQA A;  2PD8 A;  1M6K A;  2PYP A;  4Q0H A;  1XJ4 A;  4X53 A;  4I3J A;  3QP2 A;  3ISG A;  3DWZ A;  2XA7 S;  2L0W A;  1V9Z A;  3C38 A;  4UHU A;  3HJI A;  3VMA A;  3P7N A;  4EET B;  4GW9 A;  4R3A A;  5EVI D;  2WGW A;  4FH4 A;  2XGN A;  3ZG5 A;  2W3G A;  4QY5 A;  1VET B;  1ESI A;  1RCJ A;  4HQA A;  3LIB A;  4JGQ A;  2Y2P A;  3ZVW A;  2ZC4 B;  3HLD A;  3OC2 A;  1K6R A;  3K2N A;  3TW8 A;  3N8R A;  2GZA A;  4CLC E;  1TS6 A;  5FAS A;  2WAE A;  4R3J A;  1XXM A;  3WS5 A;  3IBR A;  3LR4 A;  4GNU A;  1YLT A;  3NY4 A;  2D01 A;  1LSV A;  1RGZ A;  5IS1 A;  4KQD A;  2XFT A;  1ONG A;  5AQB A;  4ZTK A;  3QP4 A;  4GS9 B;  3CPT A;  3WS2 A;  3S7Q A;  3HLW A;  4B88 A;  5FEG A;  1YMS A;  4UAA A;  1HVB A;  3ZCZ A;  2ZQ7 A;  5HDC A;  3G30 A;  5FAP A;  3IHA A;  5TGF A;  5CGS A;  4KEN B;  3PAG A;  5C5K A;  1S6R A;  3CG5 A;  1W8Q A;  4CQH A;  1JWZ A;  1ZHH B;  1SKF A;  3SZT A;  1LL5 A;  3IS2 B;  4BQM A;  2XRO A;  4D2O A;  3AGF A;  1N9O A;  2WKE A;  1DJA A;  1K54 C;  5I94 A;  4DN0 A;  4OKP A;  2O9A A;  3KO6 A;  2JE5 A;  3E2L A;  4GD8 A;  2X71 A;  5LBR A;  2XSS A;  5GLC A;  2KX6 A;  4PPR A;  3EQU A;  3T1X A;  3FC7 A;  2PD7 A;  2B95 A;  1EWZ A;  1K25 A;  5EOE A;  3OLO A;  3DTI A;  3LID A;  3ZGA B;  1ERO A;  2NUP C;  2W3F A;  3N6I A;  3O88 A;  3A3E A;  4WZ5 C;  4QB8 A;  4GHI B;  3VSK A;  1SDE A;  1PW8 A;  5EFW A;  2A24 B;  4KG6 A;  4M3K A;  3HLB A;  2KDK A;  4DRT A;  2Y2L A;  2PU4 A;  3BEB A; 
#chains in the Genus database with same CATH homology
 4OOL A;  3EEH A;  5A8B A;  4KQO A;  4YWZ A;  4LLO B;  3T4K A;  5HWT A;  2ZBB A;  3C30 A;  4NXB A;  3S7P A;  2L4R A;  3BWL A;  1OTB A;  1P9W A;  3T4J A;  2FH5 A;  2YKF A;  3C8C A;  1Y28 A;  2QJ5 A;  4RQ9 A;  5AVE A;  1UWN X;  4AFI A;  2HF6 A;  2INW A;  3PYP A;  3B33 A;  3D3O A;  4O8G A;  4BMW A;  3PBO A;  4KUK A;  1P0Z A;  3TE8 A;  3G6O A;  4B9O A;  4HJ6 A;  4I38 A;  2B02 A;  2M7V A;  4EU0 A;  4I39 A;  4MN5 A;  2G7U A;  3W2Z A;  4GS9 A;  1D06 A;  3KSG A;  4BBU A;  1ODV A;  4EUV A;  1W63 Q;  5HD5 A;  3T4S A;  1OTA A;  3UB8 A;  5F68 A;  3KYZ A;  5HSQ A;  1ZTU A;  1XFN A;  2PR6 A;  5HWW A;  4XT2 A;  3D72 A;  4KUO A;  2GNX A;  4JGR A;  3MQ0 A;  1P9R A;  3HJK A;  1S1Z A;  5DFX A;  5J4E A;  2V0W A;  3ULF A;  4PKY G;  1H3Q A;  2ZOI A;  1X0O A;  2VKS A;  3KX0 X;  4F3L A;  3VV4 A;  4JGP A;  3T4L A;  3H82 B;  3IS2 A;  3F1P B;  4EXO A;  3E4O A;  5DKK A;  2OAQ 1;  5HD3 A;  4HP4 A;  4MCW A;  4L9E A;  3S7N A;  4Y2F A;  4HJ4 A;  4GJ4 A;  1IFQ A;  3F1N A;  3F1O A;  4CLC B;  5HL6 A;  3T4O A;  4HIA A;  2DMW A;  1D7E A;  3EQV A;  3V67 A;  4NEE D;  4G3K A;  1GSW A;  4WLA A;  4ZRR A;  4DJ2 A;  3NOU C;  3EGD C;  2VEA A;  4LRX C;  2JN7 A;  3KYQ A;  1VHM A;  2O0Y A;  4I5S A;  4WF0 A;  4HH3 A;  2JKT M;  4EEU A;  5J7E A;  4H6J A;  4IJG A;  3LIC A;  3RTY A;  1G28 A;  1YKD A;  3TRC A;  2ZOH A;  3FPV A;  3MQQ A;  2O9C A;  2ZMV A;  3LFV A;  2J3T C;  5TBM B;  3MF0 A;  2A24 A;  5CX7 A;  1N9N A;  3OCL A;  3R4K A;  3A0R A;  5AJG A;  3UMD A;  4BWI A;  4L9G A;  4Q0J A;  5FL3 A;  5L8M A;  1MKM A;  1T1A A;  1TS7 A;  3PBQ A;  2M1C A;  4G3W A;  2QKP A;  3ZQ5 A;  5G4Z A;  1GSX A;  4HJ3 A;  2OWJ A;  4IUH A;  5HPI A;  3BY9 A;  1P97 A;  2A2L A;  2H28 A;  3VE3 A;  1OJG A;  2W1T A;  1S4S A;  3UME A;  1XJ3 A;  2L1M A;  4MN6 A;  2FZ0 A;  4E04 A;  2CMN A;  1EW0 A;  3PR6 A;  2JHE A;  3K3D A;  1DP6 A;  4EES A;  3NOP C;  3SW1 A;  3LI9 A;  2GJ3 A;  4O0P A;  4FOF A;  3JVU A;  3RFB A;  4NXG A;  1MZU A;  2VGL S;  5DFY A;  1V9Y A;  1IOU A;  1BYW A;  2M7U A;  1YSP A;  4UEY A;  4B93 A;  4EER A;  1TS8 A;  3NJA A;  3VOL A;  4Y3I A;  3EGX C;  4I3A A;  1NWZ A;  4MDZ A;  1NLY A;  3LR3 A;  3UE3 A;  4NXF A;  5F6A A;  2Y8H A;  4MMN A;  2JKR I;  2W0N A;  1YSQ A;  2JKR M;  4L0L A;  1TS0 A;  1DP8 A;  3ICY A;  3UB7 A;  5HPF A;  3OOV A;  2P04 A;  2VV6 A;  4EW7 A;  2QYB A;  4O01 A;  4HH2 A;  1OPX A;  2EWW A;  3JVV A;  4HHD A;  2J3T D;  3MJQ A;  1LSW A;  2VGL M;  3H82 A;  2V0U A;  3F1P A;  3E4Q A;  4L9F A;  4R38 A;  3LI8 A;  4IHQ A;  3H9W A;  2VX8 A;  2WKQ A;  3LR5 A;  4LRY C;  2VV8 A;  3LIA A;  1T1C A;  1F5M A;  1OT9 A;  2HJE A;  3C2W A;  1MC0 A;  4CLC A;  4OOM A;  3UB6 A;  3CIT A;  3CI6 A;  2J80 A;  3E4P A;  2J3W A;  2K7S A;  5KIZ A;  1XJ2 A;  4II7 A;  5HZH A;  3UE6 A;  4HY8 A;  4LPZ A;  5HDD A;  2W3H A;  1UGU A;  2BAS A;  1S67 L;  2K31 A;  2WKP A;  2QHK A;  1KOU A;  4XT2 B;  1OT6 A;  2I9V A;  3E98 A;  3T4Q A;  3CUE A;  2OAP 1;  1OTD A;  5DKL A;  3R7W A;  3CUE C;  2O99 A;  4EEP A;  3DBA A;  5TBM A;  4Q0I A;  2QJ7 A;  3A0S A;  2VA0 A;  4GHI A;  5F5Y A;  1TF1 A;  2P08 A;  2W1R A;  2PR5 A;  2XRN A;  4UQI S;  4BJP A;  3EEA A;  2GX5 A;  3CAX A;  4WL9 A;  3F1N B;  2KOI A;  2PYR A;  2VJW A;  3GEC A;  1LT0 A;  3MMH A;  2PDR A;  1G6O A;  4BBV A;  1GSV A;  3MQO A;  4ME4 A;  1STZ A;  2ZMF A;  1DP9 A;  4FSF A;  2Z6C A;  3OCN A;  1OJ5 A;  4NXE A;  2V9A A;  2Z6D A;  4IUK A;  4DMZ A;  1OTE A;  2NUT C;  3B42 A;  4PAU A;  1NRJ A;  3PBT A;  4MN7 A;  3T50 A;  4R70 A;  2PHY A;  3KSI A;  3BQA A;  2PD8 A;  1H8M A;  3BY8 A;  3OBF A;  3PBN A;  4ARZ B;  2PYP A;  3B47 A;  1F98 A;  4HP9 A;  4WEL A;  4Q0H A;  4UQI M;  1XJ4 A;  2QWS A;  4GCZ A;  4I3J A;  2P7J A;  2EA9 A;  1UWP X;  2XA7 S;  4HOI A;  3HCY A;  4NKP A;  3RH8 B;  3LIF A;  1T18 A;  2L0W A;  5DF9 A;  1V9Z A;  4WEJ A;  3C38 A;  3PXP A;  3HJI A;  5HDS A;  3H7W B;  3P7N A;  3UB9 A;  4EET B;  4GW9 A;  4PKY A;  3GDI A;  4R6L A;  3PHY A;  4R3A A;  2W3G A;  4WN5 A;  2V1A A;  5F69 A;  2W1T B;  4HQA A;  4YNR A;  4HI4 A;  2V1B A;  4EQ1 A;  4K08 A;  4ETX A;  4YOF A;  3LIB A;  4GLQ A;  4JGQ A;  2YKH A;  2VLG A;  3EOI A;  2B18 A;  3OC2 A;  1N9L A;  1YAX A;  3K2N A;  2XA7 M;  3TW8 A;  2GZA A;  4CLC E;  1VB6 A;  1TS6 A;  3VE4 A;  1DRM A;  5I5L A;  5K5B A;  1OTI A;  3IBR A;  3LR4 A;  1S4R A;  2OOL A;  3EWK A;  4I3I A;  2D01 A;  1LSV A;  1XJ6 A;  5IS1 A;  4KQD A;  2W27 A;  2R78 A;  1NLZ A;  3KSH A;  4P6Z S;  5G4Y A;  2VV7 A;  1XFQ A;  4GS9 B;  4CLC C;  4Z1W A;  3MXQ A;  1T19 A;  3S7Q A;  3E0Y A;  3FG8 A;  3LIE A;  4Y5F A;  1T1B A;  3ZYT A;  3PBR A;  4BBT A;  3BJN A;  2W3D A;  3P01 A;  2Y79 A;  5HDC A;  4WUJ A;  3LYX A;  1LSX A;  3BW6 A;  3U2A A;  1S66 L;  4JGO A;  2EWV A;  1W63 M;  5C5K A;  2MJ6 A;  3O5Y A;  3IBJ A;  3FPW A;  4LRZ E;  4CQH A;  4QPR A;  3MR0 A;  1ZHH B;  4F3L B;  1F9I A;  3IS2 B;  2IA2 A;  4HNB A;  1JNU A;  4P6Z M;  3BQ8 A;  2XRO A;  1N9O A;  2W3E A;  3MFX A;  3S7O A;  4DN0 A;  3F1O B;  4WEK A;  3NHQ A;  2KLI A;  3KSF A;  2O9A A;  3KO6 A;  2JKT I;  5LBR A;  2O9B A;  3NOT C;  2XSS A;  2KX6 A;  3EQU A;  2HV1 A;  3FC7 A;  4ARZ A;  2PD7 A;  2LB9 A;  2HGV A;  3CLO A;  5KSH A;  4G3V A;  3OLO A;  2D02 A;  3LID A;  3R7W B;  1TD5 A;  2NUP C;  5J3W A;  1S1Y A;  2W3F A;  3LR0 A;  5MC7 A;  2WKR A;  4H6J B;  3TJZ C;  4PHT A;  5IT5 A;  4GHI B;  5TJJ A;  2OWH A;  4DJ3 A;  3A0V A;  4M4X A;  5IU1 A;  1LL8 A;  5EFW A;  3H7W A;  5AVF A;  2A24 B;  2VZW A;  5DJT A;  4CLC D;  1WA9 A;  2PT7 A;  2HJ9 C;  2KDK A;  3CWF A;  5DJU A;  3K3C A;  2K2N A;  2LB5 A;  3T4T A;  5HWV A;  3LUQ A;  4ETZ A;  3PBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...