4QPRA

Crystal structure of gaf domain of potassium sensor histidine kinase kdpd from escherichia coli
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
GAMDLYEMSKALAVGRSPQDIAATSEQFIASTFHARSQVLLPDDNGKLQPLTHPQGMTPWDDAIAQWSFDKGLPAGAGTDTLPGVPYQILPLKSGEKTYGLVVVEPGNLRQLMIPEQQRLLETFTLLVANALERLTKLAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein KdpD
publication title Crystal Structure of Gaf Domain of Potassium Sensor Histidine Kinase Kdpd from Escherichia Coli
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 38
structure length 142
sequence length 142
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13492 GAF_3 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4qprA00
3MMHA 2W3HA 2LB5A 4Z1WA 4EU0A 1TF1A 3IBJA 4GLQA 4E04A 2G7UA 2W1RA 3W2ZA 5DFXA 4ETZA 2B18A 4ZRRA 4G3VA 3KSFA 3CITA 2LB9A 2M7UA 3OBFA 4O0PA 4O01A 2XROA 5L8MA 4YNRA 3TRCA 5DFYA 1STZA 3MF0A 5TJJA 4QPRA 3E98A 4Q0HA 2KOIA 1F5MA 5HPIA 4MMNA 4EUVA 1TD5A 4YOFA 3O5YA 4R70A 1MKMA 2M7VA 3NOTC 4LRYC 4G3KA 1YSPA 2KLIA 3KO6A 4FOFA 4G3WA 5C5KA 3NHQA 3E0YA 2O9BA 4Y3IA 3S7PA 4LRZE 3C2WA 4ME4A 3S7NA 2Y79A 2O99A 2QYBA 3NOUC 3R4KA 2W1TA 3MQ0A 3S7QA 2K2NA 3K2NA 2VJWA 2GX5A 3VV4A 2XSSA 5LBRA 4DMZA 3CI6A 4O8GA 2W3FA 3EEAA 5HL6A 4BWIA 3KSIA 3S7OA 4RQ9A 4Q0JA 4IUHA 3HCYA 2IA2A 4GW9A 1VHMA 2O0YA 5K5BA 4ETXA 4IUKA 2W3DA 4Q0IA 4R6LA 3D3OA 3G6OA 2VKSA 3RFBA 3ZQ5A 4CQHA 5HPFA 4MCWA 1YKDA 3NOPC 2ZMFA 2OOLA 2HGVA 3IBRA 3BJNA 1MC0A 2W3GA 3DBAA 3KSHA 4MDZA 4DN0A 3LFVA 3KSGA 2W3EA 4Y5FA 5HSQA 2VEAA 2XRNA 1ZTUA 2O9AA 2W1TB 4PAUA 5AJGA 4Y2FA 2O9CA 2VZWA 3OOVA 4IJGA 1YSQA 4LRXC 4MN7A 2K31A 2Y8HA 5I5LA
chains in the Genus database with same CATH superfamily
3OZHA 3IQAA 3NECA 1XFNA 1K57C 2VGKA 3PXPA 1LSXA 4YINA 4EU0A 1GCEA 3MBZA 3GVBA 2V1BA 3GQZA 5L8MA 5DFYA 1JTGA 1PNEA 4KZ9A 1MWTA 2HJEA 1MWSA 1DJAA 5HPIA 5HDSA 2ZC3B 5L10A 1KVMA 2NUPC 3HUOA 3ZG7B 1SKFA 3LO7A 4LRYC 2IWCA 1GA9A 2Y59A 4BBTA 3QNCA 2JKFA 4AFIA 4YFMA 1ACFA 1CF0A 2ZQ8A 4JGQA 2ZJ9A 4UQIS 1ES3A 3Q1FA 4GD8A 2Y2HA 2XSSA 3IHAA 1BLCA 1IYOA 3RXXA 3W4QA 3GRJA 3WWXA 4N9KA 1ALQA 5DJTA 2EWVA 3ZVTA 5FQKA 2XEPA 1XKZA 3EOIA 3MQQA 4MDZA 4WZ5A 3UE6A 3Q82A 1H5XA 5F1FA 2XRNA 2Y2LA 4S2NC 4IBXA 3K3CA 1F9IA 3ZYTA 3H7WB 1G68A 3LGOA 3V3SA 1XJ2A 1DP9A 2P9VB 4HJ4A 2Y91A 4LPZA 3DAVA 3PR6A 5TBMB 1I2SA 4R0QA 3OLOA 2B95A 3SS3A 3L9KA 4E3OA 1F5MA 1ZHHB 5DKKA 3NOTC 5A93A 1QMFA 3D72A 4ZJ1A 1MWUA 1IYQA 4DJ2A 1TS8A 1AWIA 4QJGA 1IYPA 4KG2A 3VFFA 3HLGA 4Y7PA 4ESPA 3IXDA 3QP6A 3MQ0A 1YLZA 3OPRA 2HF6A 2XA7M 4WM9A 3UB7A 4BLMA 1VB6A 4DMZA 3LR4A 3AGDA 2VK3A 1WE4A 1JTDA 3QP8A 4RQ9A 2D02A 4JLFA 3CHWP 5HX9A 4JF6A 4GS9A 3W4PA 1TS7A 5K5BA 4ETXA 3F1OA 3CG5A 1G6OA 2A49A 3A3EA 2PD8A 3T50A 1IEMA 1ZG4A 2XD5A 4LLOB 1W63Q 4HIAA 1Y4OA 1XX2A 3WS2A 5HW3A 3DTIA 1PI5A 1K56A 2VX8A 1SCWA 1ONGA 4RX2A 1G6AA 2OAQ1 2GJ3A 3NBLA 3S22A 1FOFA 4Y15A 2EA9A 2PYPA 2Y55A 5FSRA 4FSFA 2VV6A 4KZ6A 2J7VA 1Y54A 2Z2LB 1NRFA 4HOIA 1RCJA 4GS9B 1RP5A 2PU4A 3UDFA 3MSHA 4NXGA 5CHJA 3IT9A 2ZM8A 4GB7A 3MF0A 3BW6A 3UO9A 1BUEA 1E25A 3HL9A 1ONHA 2WZXA 1F2KA 3C4PA 3LIAA 2WADA 5FA7A 3TG9A 1BYWA 4EXOA 4JF4A 1J9MA 1H0MA 4DJ3A 4KZ3A 2QYBA 3S7QA 1HZOA 3G35A 1NZUA 1IOUA 2HPBA 5HL6A 2UV0E 3S7OA 4WZ4A 1H8MA 2K7SA 2IWDA 3UB8A 2FH5A 4OPQA 3D9YA 3G30A 3U4LP 3KYZA 3VSKA 2P74A 1Q2QA 2W3DA 4KUKA 1CI9A 3B42A 3QP5A 5AVEA 5I94A 2VKSA 4K91A 3ZG8B 3LR3A 3Q81A 4IBRA 1OTEA 4FH4A 4Y5FA 4XUXA 3IH8A 2PT7A 4KENB 5GHZA 5CTMA 4OPYA 5AJGA 3IF6A 3FWLA 4ZJ2A 2Y2IA 1GHMA 2JKRM 2BTFP 4UEYA 1DP6A 2V0WA 4XUZA 4Y0TA 3NDEA 2L4RA 2QMIA 3AGFA 2ZD8A 1VEUA 5F83A 4Y0UA 2H28A 1XJ6A 1YQSA 3KSFA 1J3WA 4YNRA 3IH9A 4JXWA 4JXVA 1K55C 3VFHA 1YLJA 2JC7A 4ARZA 4X56A 3VE3A 3M2JA 5D3OA 4JF5A 3LR0A 2ZQCA 4WYYA 2HP6A 4A5RA 1UGUA 4FOFA 3E4PA 4S2PA 5C5KA 5HAIA 2O9BA 2J80A 5AQ7A 3S7NA 1D1JA 5GHYA 2GNXA 2G2UA 4KZ4A 3ZFZA 3SW1A 3PBRA 3K2NA 3DWKA 4Q0JA 3IXGA 2EFUA 4GDBA 4GJ4A 2OWJA 3PBSA 1O7EA 1LSWA 1VHMA 4ARZB 2HDQA 5FDHA 4PHTA 4DE3A 1SDEA 2E8JA 3D3OA 1BLSA 4NXEA 2XA7S 2Z6CA 4E3NA 4DKIA 3LYXA 2WKEA 3ITAA 1UWPX 3FKVA 5HARA 4R23A 4X68A 1K4EA 3BQAA 4QU3A 2VEAA 1ZTUA 1YLWA 1XGJA 2G2WA 4R3BA 1I5QA 5AQBA 3HJIA 2ZMVA 3LUQA 4B93A 4EV4A 4I39A 3CJMA 2VV7A 4PM9A 3UMEA 4KUOA 4C6YA 1S1ZA 3NIAA 4R4SA 5HD3A 3VP1A 3AGEA 5A90A 3TRCA 5AVFA 1KDSA 2W0NA 1NJ4A 4B9OA 4NETA 4R70A 4EEUA 1PIOA 4KQDA 1CI8A 3NI9A 5G4YA 4D60A 3FPVA 1GSWA 4K0WA 5GL9A 3QHYA 4MBFA 1JWZA 4EQ1A 3NJAA 2Y79A 2X71A 3MKEA 1LL5A 4E6WA 2M1CA 3ISGA 1ES2A 1W8YA 2WYXA 3HUMA 1K0KA 3UDXA 3BFGA 1YM1A 1N9NA 3G2ZA 4QD4A 4UA6A 3P7NA 5U47A 1NYMA 2HDUA 1OT9A 2WKIA 2R78A 4KQQA 1K4FA 1VETA 5FAOA 3H82A 3G6OA 3N8SA 2DMWA 2QJ7A 1WYCA 1SHVA 2DCFA 4BD1A 2OOLA 4LV0A 3FZCA 1KVLA 4P6BA 4WLAA 1Z6FA 3LIEA 4K08A 1FIKA 4BD0A 3A3DA 2DRWA 1L0EA 1DP8A 2PR5A 2W27A 1OTDA 4HQAA 3IF5A 4HY8A 3F1NA 3LIFA 3ZNTA 1L2SA 3CAXA 5DFXA 1XA1A 3HLBA 1T18A 4HHDA 4H6JA 4OONA 2X02A 1VETB 4O0PA 4DDYA 2VLGA 4DRTA 5DVAA 2ZLYA 1OJGA 4QPRA 1ZG6A 3T4TA 4QY6A 4HH3A 2MJ6A 4B88A 4EQIA 4OPZA 5FAPA 2PBDP 4G3WA 3A3JA 5FI7A 5G4ZA 4U0XA 2JKTM 4F3LA 2VA0A 5EPHA 1K54C 2Y2MA 4EUZA 3LEZA 2ZQ9A 2AVXA 3JVUA 3C7UA 5DTTA 4H6JB 3N8RA 4CLCA 3KSIA 3ZDJA 3RXWA 2INWA 2IA2A 3C4OA 2ZMAA 2J3WA 3ZVWA 4HESA 3T4LA 1O07A 2WKQA 1YPRA 3V3RA 4CQHA 1S4SA 3CZDA 1W5DA 1S1YA 1XJ3A 4PKYG 3KSHA 5CX7A 2XK1A 4GCZA 1EWZA 1BLPA 4FTXA 2A3UA 1PWCA 5HSQA 1DY6A 1TEMA 4F3LB 4DE2A 4OQHA 2B5RA 3O87A 4PM8A 2Y8HA 4CLCB 4S2OA 5E43A 4MN5A 1U60A 4MBKA 1TF1A 4I3AA 4GN2A 3WS1A 3UB5P 1ZC2A 4HI4A 2ZC6B 4X53A 3ZGAB 3RJUA 3ZHHA 4RX3A 4OH0A 4X1LA 4Q0HA 4R1GA 3M2KA 1IFQA 1A0KA 1JWVA 2XQZA 1T19A 2A2LA 4DDSA 1K6RA 3QP2A 2P08A 1DJCA 4HNBA 3KO6A 1NXYA 1XGIA 2OLUA 2H0YA 4YWZA 2Y2PA 4JGRA 2PD7A 3E0YA 1FCNA 2Z6DA 2V9AA 1SDNA 2JKGA 3NOUC 4U0TA 1DRMA 3EEHA 3PBQA 3V67A 3JPUA 2PHYA 4OVDA 4EERA 3GTCA 5HD5A 1CEGA 3UPPA 4OQGA 2J9OA 3TOIA 4N1XA 1CK3A 4GDNA 5IT5A 5FI2A 4X55A 1PRQA 2HGVA 2WAEA 3IBRA 1T1AA 4D2OA 1OTIA 3LFVA 2WGVA 4I38A 4OKPA 3BECA 3T12B 3CMZA 4MN7A 3PAGA 4N9LA 5EECA 2GDNA 5EVIA 3VSLA 3LICA 3VOZA 4L9GA 4E3KA 4S2IA 2V2FF 4FD8A 2B18A 1HD8A 4MEZA 2ZM0A 2OV5A 3C38A 4WZ5C 3TSGA 3SS4A 4KG6A 3E98A 1EW0A 2ZM2A 3FV7A 3UPNA 3HUNA 4WMCA 5AQ9A 4PPRA 3HLFA 3QP1A 2BG1A 1YSPA 5M18A 3F1OB 4K0XA 5DKLA 5DF7A 3C2WA 2R9WA 4PMAA 1TDGA 4FH2A 1BULA 3DTMA 2QJ5A 5F82A 5F6AA 4WEKA 1S6RA 1YMXA 5TGFA 5EE8A 4E3MA 3G2YA 3BEBA 1KGGA 5IU1A 4LCLA 5EM1A 1G5UA 3ZG0A 2PR6A 4X1MA 3V50A 2ZL1A 2ZOIA 1E4DA 4JKTA 3GR2A 3UB9A 4LCMA 1MXOA 4BENA 1GHPA 2JKRI 4BL2A 4S2MA 3BRMA 1MBLA 5L2FA 5JYPA 3B3XA 1N4OA 4O7DA 4XT2A 5F1GA 2O9AA 3IX4A 3WS0A 1Q2PA 3O3VA 2Y2JA 1IELA 3BYDA 2WAFA 2Y2GA 3BFCA 1FR1A 5EVLA 4JXSA 1PWGA 4WN5A 4OQIA 3UDIA 1P0ZA 5TFQA 3T1SA 3IBJA 4BBUA 2XH9A 1PWDA 2QWSA 1TS0A 1WA9A 2ZL1B 4G3VA 3BLMA 5EOEA 2XROA 3PTEA 1HLUP 4DF6A 1KE3A 4GNUA 1XJ4A 4EBNA 3BY8A 3P98A 2KOIA 3EGXC 3CUEA 5HDDA 5F69A 1MKMA 2PYRA 5DTSA 5HFOA 3P09A 4HP4A 4G3KA 3S1YA 2KLIA 1GA0A 4RA7A 2ZC7A 4WF0A 2FZ0A 3F1PA 1TS6A 3S7PA 4LRZE 4MLLA 2J9PA 5CHUA 5F5YA 3R4KA 5FQMA 4HJ3A 4QY5A 4IEDA 3E4OA 1P97A 1IKGA 4LV3A 1FSWA 3WRTA 2W3FA 3EQUA 4JGOA 1MPLA 2EX9A 2YKFA 5HAPA 3IF6B 1FSYA 4GW9A 3PAEA 2HV1A 2ACGA 4X69A 2HZ5A 4IUKA 4Q0IA 5FI6A 5FQJA 5HPFA 4MCWA 3OCNA 4R3JA 1VEUB 3LY3A 3QP4A 1MC0A 4CLCD 5HWTA 2EXAA 3DBAA 2HP5A 1H8YA 1W8QA 3BFEA 5EV0A 1GSXA 3HVFA 5HL1A 1GSVA 3EGDC 1YSQA 1Y28A 1V9YA 4S2LA 3SH9A 3GECA 2V1AA 4EW7A 3N6IA 4S2KA 4GLQA 3A3FA 1VQQA 3QNBA 3JYIA 1BT5A 4RYEA 2EWWA 5FQ9A 3FYZA 2X01A 4DE1A 2IWBA 4WELA 3T4OA 4GD6A 2J3TC 4BQMA 4GHIA 4QWOA 5KZHA 3T4QA 3R7WA 3I7JA 3TJZC 4PM5A 3NC8A 4IVKA 3D4FA 1H3QA 5CECA 4Y3IA 2B02A 5JYOA 4LFUA 4MNRA 4N92A 1CQAA 1EROA 4C75A 3CI6A 4LV1A 4P0MA 1T1CA 3CWFA 4B4ZA 2C6WB 4Y0OA 3VP4A 4I5SA 3H9WA 4GZBA 1TVFA 2KDKA 3HCYA 3NDGA 3VP2A 1K57A 1OMEA 2XDMA 3HLWA 4GHIB 3PBNA 3UY6A 2BASA 3LIDA 5HZHA 2JBFA 3SH8A 1KGFA 2ZMFA 3BFFA 3VOYA 1YT4A 2L0WA 1ES5A 3WRZA 5GHXA 2NUTC 2WZZA 3HLCA 4LGWA 4M4XA 3IXHA 4R4RA 2O9CA 4DXCA 5CGXA 1UWNX 3BM6A 4NKPA 5CEBA 4N1HA 5CGSA 1L0FA 2WKRA 2Y2KA 4Z1WA 1M40A 3MZEA 3P01A 3T1RA 2A24A 4E3IA 5E2FA 1V9ZA 1E3UA 3PBOA 1KOUA 4ZDXA 5MC7A 4NG2A 1HTZA 5FATA 2V0UA 2CMNA 4O01A 2VV8A 4IHQA 3T1QB 5A92A 1STZA 4HBTA 1T1BA 3NY4A 4KQRA 3O86A 4YOFA 3T4SA 2JKTI 2QPNA 2Q9NA 1N9LA 1K56D 2I9VA 3KYQA 3PBTA 1JWPA 5E2HA 3WS5A 3H82B 1FQGA 5EM0A 2O99A 3MS6A 4KZ7A 3FC7A 3SS5A 1JNUA 5FEGA 3HJKA 3UN7A 4WMCD 2K2NA 2FFFB 2GX5A 1XPBA 3IHBA 4S2NA 4O8GA 3EEAA 4FUWA 4PM7A 3IWOA 4OLGA 5FAQA 2O0YA 3BLSA 1XXMA 3E2LA 5A8BA 1OTAA 2DNSA 3GV9A 2YKHA 5DF9A 3G34A 1KDWA 5L07A 5CHMA 4E6XA 1ERMA 5M1AA 3F1NB 3ULFA 5EOOA 3MXRA 4BMWA 4OQ0A 5GLDA 1WYBA 2XR0A 4UA7A 2ZQAA 1ESUA 2XFTA 3KYEA 3W8KA 5HWVA 3V39A 1P9RA 4X25A 5I5LA 3MMHA 3VOLA 1KE0A 2ZBBA 4IVIA 4LENA 2W1RA 2H10A 3MZFA 1ZKJA 1MZUA 2LB9A 5EFWA 4HH2A 3V5MA 4EBLA 1IKIA 3LR5A 3MZDA 1N9OA 4JPMA 4RVAA 1M6KA 3O5YA 3H7WA 5FQQA 2Q0OA 3VE4A 3DWZA 2JE5A 1LT0A 4HP9A 2P9VA 1F98A 1S4RA 3MKFA 4H8RA 5E2EA 4P6ZM 5HDCA 2J3TD 5KSHA 1MWRA 5AQAA 5TBMA 3HLDA 1XA7A 3ZCZA 1AXBA 3UNWA 2WGWA 5E2GA 4ZBEA 3S4XA 3VV4A 2XF3A 1W63M 4R3AA 2PAVP 4BWIA 3DW0A 4ID4A 4XXRA 1NZOA 3HBRA 4HEFA 4ZJ3A 4GKUA 5CEDA 5KIZA 2PBYA 3C7VA 3A0RA 4CJNA 1N9BA 2WKHA 1L0GA 1LL8A 4I3JA 4BBVA 1W7FA 2ZQDA 1BLHA 2I72A 3TE8A 2VGLM 4WUJA 3KSGA 2W3EA 4JGPA 3G32A 4UAAA 1S0WA 4QB8A 1PW8A 2H0TA 3PYPA 4CLCC 4PAUA 1P9WA 4Y2FA 1XFQA 2JCHA 3NCKA 4BJPA 5HWWA 4OOYA 2P7JA 2WGWB 2FFYA 4EEPA 2V1ZA 3MQOA 2W3HA 1OPXA 1MY8A 4S2JA 4MN6A 3ITBA 2WK0A 1MKIA 1H8ZA 1I2WA 4II7A 4E3JA 4ZRRA 1SZVA 1Z09A 1PW1A 2Q9MA 2V8FA 4Q8IA 1PZOA 4E3LA 1OJ5A 3UE0A 5FQIA 4MMNA 2H5SA 5J7EA 5CTNA 2M7VA 1XP4A 2E8IA 1FR6A 4UHUA 3T1XA 2OLVA 4B4XA 4KZAA 4OOLA 5CXWA 3IX3A 2JN7A 1KE4A 5J3WA 2KX6A 3BWLA 1LI0A 3B47A 5CGWA 3N4IA 2V20A 1RGYA 3N7WA 3HLEA 2R9XA 5CERA 3LIBA 1DJBA 1FCMA 4WL9A 3UPOA 3LI8A 4X6TA 2HJ9C 5GLAA 1X0OA 3JVVA 3CPTA 1W79A 1NRJA 5EVIB 1ODVA 3RFBA 3UE1A 3CLOA 3IS2A 1NWZA 1K25A 3G4PA 4NXBA 3L7HA 3C8CA 4KQOA 1K55A 3TW8A 4EETB 1PI4A 1KGEA 1YAXA 1YLYA 2L1MA 3VMAA 3K3DA 5FEFA 5J8XA 4ZAMA 5M19A 3EWKA 4HJ6A 4WBGA 1TDLA 4CLCE 4GOGA 4ZTKA 1PYYA 2OSUA 3OC2A 5HAQA 1PFLA 4E04A 3MJQA 3OPHA 3EQVA 4WEJA 4ETZA 3CPTB 2C5WB 3CITA 2M7UA 3OBFA 3LCEA 2EFXA 3IS2B 3E2KA 1CJFA 1YLPA 1SKOA 5GLBA 4EUVA 1TD5A 2JHEA 3NULA 4KG5A 1BZAA 1E3UD 3C5AA 4JXGA 4OLDA 3FKWA 5EVIC 4Y13A 4DE0A 3ZNYA 3NHQA 1BSGA 3OPPA 4BL3A 2VGJA 1K6SA 2XLNA 3ZG9B 2EX2A 2Y2QA 4LV2A 4KZ5A 3KX0X 3SH7A 5LBRA 3T4JA 2J8YA 3MXSA 2OWHA 4PM6A 4XT2B 4HBUA 1NLZA 3Q07A 4P6ZS 3WS4A 3MR0A 3BFDA 3DTEA 5BOHA 1SKOB 3LY4A 1NY0A 1LL9A 3T4KA 2PDRA 2HDRA 5F68A 2QKPA 3MFDA 4L0LA 2HDSA 3ZQ5A 2HP9A 3NOPC 5FDSA 4OPRA 5EUAA 3BJNA 1C3BA 2ZOHA 1JVJA 4R38A 2W3GA 4MBHA 2ZQ7A 3BQ8A 3G31A 5DJUA 1ESIA 2P04A 3LI9A 2UWXA 1ES4A 4NXFA 3MXQA 2OAP1 3OOVA 4DXBA 1LSVA 2XGNA 3OPLA 3UE3A 1BTLA 2LB5A 1LI9A 2VGLS 2QZ6A 2GZAA 5DTKA 2G7UA 3F1PB 5KSCA 3U2AA 1HVBA 3PHYA 1CEFA 2EX6A 3ICYA 3IWIA 4P85A 1LHYA 5TJJA 2WGIA 4NK3A 4UQIM 1EI5A 3A3IA 4OOMA 1LLBA 5IHVA 1S66L 3RTYA 3M6HA 3M6BA 1GHIA 3A0VA 2CC1A 3ZG5A 2Y2OA 1FCOA 2Y2NA 1NYYA 2RL3A 2W1TA 3IX8A 1OT6A 5FASA 4JBFA 3E4QA 3IF6C 4OP8A 5FL3A 3A0SA 2QHKA 3IXBA 3CUEC 3SZTA 2PU2A 1K38A 3VP0A 3B33A 2Z2MB 4C3QA 1YKDA 1D06A 4P87A 1D7EA 5G18A 1YLTA 4EWFA 1NLYA 4Z9QA 1RGZA 3SOIA 3DTKA 3O88A 2W1TB 3C30A 4F94A 1FILA 1YMSA 4IJGA 4LRXC 5CRFA 3RH8B 1G28A 3FG8A 3R7WB 3HREA 5TR7A 2BLSA 3GMWA 4FCFA 3W2ZA 1K54A 4OP5A 3Q7VA 4EBPA 2Y4AA 3FPWA 5DF8A 1OTBA 5GLCA 2D01A 1VM1A 1QMEA 2ZC4B 4NEED 3UB6A 3IWQA 1PZPA 5KMWA 3BY9A 2WUQA 4EESA 5L09A 2EXBA 2XD1A 4KZBA 4ME4A 3W4OA 2XFSA 2PRFA 2ZC5B 3GDIA 3MFXA 5EVID 2VJWA 4QHCA 4KZ8A 2WKPA 4L9FA 4CPKA 3Q7VB 4IUHA 3UMDA 5J4EA 3Q7ZA 4UA9A 5A91A 1L0DA 4L9EA 4R6LA 3LEQA 3VP3A 5IS1A 4I3IA 1L3LA 2A24B 3GSGA 5EVEA 4M3KA 1IYSA 4U3TA 4PKYA 3OCLA 3N8LA 1S67L 2RCXA 4DN0A 2EX8A 4Y17A 1ERQA 2V8CA 2K31A 2VZWA
chains in the Genus database with same CATH topology
2W3HA 1OPXA 3HJIA 2ZMVA 4WN5A 1XFNA 3PXPA 3LUQA 1P0ZA 4MN6A 1LSXA 4B93A 4I39A 2VV7A 3UMEA 4EU0A 3IBJA 4KUOA 4BBUA 2QWSA 4II7A 1TS0A 1WA9A 4ZRRA 4G3VA 1S1ZA 5HD3A 2V1BA 2XROA 5L8MA 3TRCA 5DFYA 1OJ5A 5AVFA 1XJ4A 2HJEA 3BY8A 2KOIA 2W0NA 3EGXC 5HPIA 4MMNA 4B9OA 5HDSA 3CUEA 5HDDA 4R70A 4EEUA 5F69A 1MKMA 2PYRA 2NUPC 5J7EA 4KQDA 2M7VA 4LRYC 4HP4A 5G4YA 4BBTA 3FPVA 4G3KA 2KLIA 4AFIA 1GSWA 4WF0A 2FZ0A 3F1PA 1TS6A 4OOLA 3S7PA 4EQ1A 4LRZE 3NJAA 2Y79A 4JGQA 2JN7A 4UQIS 5F5YA 3R4KA 5J3WA 2KX6A 3BWLA 3B47A 2M1CA 4HJ3A 3E4OA 1P97A 2XSSA 2W3FA 3LIBA 3EQUA 4JGOA 1N9NA 4WL9A 2YKFA 3LI8A 3P7NA 2HJ9C 4GW9A 1OT9A 1X0OA 3JVVA 2HV1A 2R78A 5DJTA 1NRJA 4IUKA 4Q0IA 3H82A 3G6OA 1ODVA 3RFBA 5HPFA 2DMWA 2EWVA 3OCNA 4MCWA 2QJ7A 3CLOA 3IS2A 2OOLA 1NWZA 1MC0A 4CLCD 5HWTA 3DBAA 3EOIA 3MQQA 4NXBA 4WLAA 3C8CA 4MDZA 4KQOA 3UE6A 3TW8A 4EETB 2XRNA 3LIEA 1GSXA 4K08A 1YAXA 3K3CA 2L1MA 1F9IA 1GSVA 3K3DA 3EGDC 1YSQA 3ZYTA 3H7WB 1DP8A 2PR5A 3EWKA 4HJ6A 1Y28A 1V9YA 3GECA 2W27A 1OTDA 1XJ2A 1DP9A 4CLCE 2V1AA 4EW7A 3OC2A 4HJ4A 4HQAA 4E04A 4GLQA 3F1NA 3MJQA 4HY8A 3LIFA 3EQVA 4WEJA 3CAXA 4LPZA 5DFXA 4ETZA 1T18A 3CITA 4HHDA 3PR6A 4H6JA 2M7UA 3OBFA 4O0PA 5TBMB 2VLGA 2EWWA 3OLOA 3IS2B 1OJGA 4QPRA 3T4TA 1F5MA 4HH3A 4WELA 4EUVA 1TD5A 3T4OA 2J3TC 1ZHHB 2JHEA 2MJ6A 4GHIA 5DKKA 3NOTC 3T4QA 3D72A 3R7WA 4DJ2A 3TJZC 1TS8A 4G3WA 3NHQA 1H3QA 4Y3IA 5G4ZA 2B02A 2JKTM 4F3LA 2VA0A 3MQ0A 2HF6A 2XA7M 3KX0X 3UB7A 3JVUA 1VB6A 5LBRA 3T4JA 3CI6A 3LR4A 4DMZA 1T1CA 4H6JB 3CWFA 2OWHA 4CLCA 3KSIA 4XT2B 4I5SA 4RQ9A 3H9WA 2D02A 1NLZA 2KDKA 4P6ZS 2INWA 3HCYA 3MR0A 2IA2A 2J3WA 4GS9A 3T4LA 1TS7A 5K5BA 4ETXA 3F1OA 2WKQA 4GHIB 3T4KA 1G6OA 2PDRA 5F68A 2QKPA 3PBNA 4L0LA 2PD8A 3ZQ5A 3T50A 4CQHA 2BASA 3LIDA 1S4SA 5HZHA 4LLOB 3NOPC 1W63Q 2ZMFA 4HIAA 3BJNA 1S1YA 2ZOHA 1XJ3A 4R38A 4PKYG 2W3GA 2L0WA 3KSHA 5CX7A 3BQ8A 4GCZA 5DJUA 2NUTC 2P04A 2VX8A 3LI9A 5HSQA 4M4XA 4F3LB 2OAQ1 2GJ3A 2O9CA 4NXFA 3MXQA 1UWNX 2OAP1 3OOVA 4NKPA 1LSVA 2EA9A 2PYPA 2Y8HA 2WKRA 4FSFA 2VV6A 3UE3A 4CLCB 2LB5A 2VGLS 4Z1WA 3P01A 4MN5A 2A24A 2GZAA 1V9ZA 1TF1A 3PBOA 4HOIA 2G7UA 1KOUA 4I3AA 3F1PB 4GS9B 5MC7A 3U2AA 3PHYA 2V0UA 2CMNA 4NXGA 4O01A 4HI4A 2VV8A 4IHQA 3ICYA 1STZA 3MF0A 5TJJA 3BW6A 1T1BA 4UQIM 4Q0HA 4OOMA 1IFQA 4YOFA 1S66L 3T4SA 3RTYA 2JKTI 1T19A 2A2LA 3LIAA 1BYWA 1N9LA 2P08A 4EXOA 2I9VA 3KYQA 4HNBA 3KO6A 3PBTA 4YWZA 4JGRA 3A0VA 2PD7A 3E0YA 2Z6DA 3H82B 4DJ3A 2V9AA 2O99A 2QYBA 3FC7A 1JNUA 3NOUC 3HJKA 2W1TA 1OT6A 3S7QA 1DRMA 3EEHA 3PBQA 3E4QA 3V67A 2K2NA 2GX5A 5FL3A 1IOUA 3A0SA 2PHYA 4O8GA 2QHKA 3EEAA 5HL6A 3S7OA 1H8MA 2K7SA 3CUEC 4EERA 3UB8A 2FH5A 3KYZA 5HD5A 2O0YA 5A8BA 3B33A 1OTAA 2W3DA 4KUKA 3B42A 5AVEA 2YKHA 2VKSA 5DF9A 5IT5A 1YKDA 1D06A 1D7EA 2HGVA 3F1NB 3IBRA 3ULFA 1NLYA 4BMWA 3LR3A 1T1AA 1OTEA 1OTIA 3LFVA 4Y5FA 4I38A 2PT7A 2W1TB 3C30A 5AJGA 4IJGA 5HWVA 4LRXC 2JKRM 4MN7A 3RH8B 1P9RA 4UEYA 5I5LA 1G28A 3FG8A 1DP6A 3MMHA 2V0WA 2L4RA 3R7WB 3VOLA 2ZBBA 3LICA 4L9GA 2H28A 2W1RA 3W2ZA 1XJ6A 2B18A 3KSFA 1MZUA 2LB9A 5EFWA 4HH2A 4YNRA 3C38A 3LR5A 3E98A 4ARZA 3VE3A 1N9OA 1EW0A 3FPWA 1OTBA 2D01A 3O5YA 3H7WA 3LR0A 3VE4A 4NEED 3UB6A 1LT0A 4HP9A 1YSPA 1UGUA 1F98A 1S4RA 3BY9A 4FOFA 3E4PA 4EESA 3F1OB 5C5KA 4P6ZM 5HDCA 5DKLA 2O9BA 2J3TD 2J80A 3C2WA 4ME4A 3S7NA 5KSHA 5TBMA 3GDIA 2GNXA 3MFXA 3SW1A 3PBRA 2QJ5A 5F6AA 4WEKA 3K2NA 2VJWA 3VV4A 1W63M 2WKPA 4R3AA 4L9FA 4BWIA 4Q0JA 4IUHA 3UMDA 5J4EA 5IU1A 4GJ4A 2OWJA 3PBSA 4ARZB 1LSWA 1VHMA 2PR6A 4PHTA 2ZOIA 4L9EA 5KIZA 4R6LA 3D3OA 3A0RA 4NXEA 5IS1A 2XA7S 2Z6CA 3UB9A 4I3IA 1LL8A 4I3JA 2A24B 4BBVA 3LYXA 4PKYA 1UWPX 2JKRI 3OCLA 3TE8A 1S67L 2VGLM 4WUJA 4DN0A 3KSGA 2W3EA 3BQAA 4JGPA 2VEAA 4XT2A 1ZTUA 2O9AA 3PYPA 4CLCC 4PAUA 1P9WA 1XFQA 4Y2FA 4BJPA 5HWWA 2P7JA 4EEPA 2K31A 2VZWA 3MQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MMH A;  2W3H A;  2LB5 A;  4Z1W A;  4EU0 A;  1TF1 A;  3IBJ A;  4GLQ A;  4E04 A;  2G7U A;  2W1R A;  3W2Z A;  5DFX A;  4ETZ A;  2B18 A;  4ZRR A;  4G3V A;  3KSF A;  3CIT A;  2LB9 A;  2M7U A;  3OBF A;  4O0P A;  4O01 A;  2XRO A;  5L8M A;  4YNR A;  3TRC A;  5DFY A;  1STZ A;  3MF0 A;  5TJJ A;  4QPR A;  3E98 A;  4Q0H A;  2KOI A;  1F5M A;  5HPI A;  4MMN A;  4EUV A;  1TD5 A;  4YOF A;  3O5Y A;  4R70 A;  1MKM A;  2M7V A;  3NOT C;  4LRY C;  4G3K A;  1YSP A;  2KLI A;  3KO6 A;  4FOF A;  4G3W A;  5C5K A;  3NHQ A;  3E0Y A;  2O9B A;  4Y3I A;  3S7P A;  4LRZ E;  3C2W A;  4ME4 A;  3S7N A;  2Y79 A;  2O99 A;  2QYB A;  3NOU C;  3R4K A;  2W1T A;  3MQ0 A;  3S7Q A;  2K2N A;  3K2N A;  2VJW A;  2GX5 A;  3VV4 A;  2XSS A;  5LBR A;  4DMZ A;  3CI6 A;  4O8G A;  2W3F A;  3EEA A;  5HL6 A;  4BWI A;  3KSI A;  3S7O A;  4RQ9 A;  4Q0J A;  4IUH A;  3HCY A;  2IA2 A;  4GW9 A;  1VHM A;  2O0Y A;  5K5B A;  4ETX A;  4IUK A;  2W3D A;  4Q0I A;  4R6L A;  3D3O A;  3G6O A;  2VKS A;  3RFB A;  3ZQ5 A;  4CQH A;  5HPF A;  4MCW A;  1YKD A;  3NOP C;  2ZMF A;  2OOL A;  2HGV A;  3IBR A;  3BJN A;  1MC0 A;  2W3G A;  3DBA A;  3KSH A;  4MDZ A;  4DN0 A;  3LFV A;  3KSG A;  2W3E A;  4Y5F A;  5HSQ A;  2VEA A;  2XRN A;  1ZTU A;  2O9A A;  2W1T B;  4PAU A;  5AJG A;  4Y2F A;  2O9C A;  2VZW A;  3OOV A;  4IJG A;  1YSQ A;  4LRX C;  4MN7 A;  2K31 A;  2Y8H A;  5I5L A; 
#chains in the Genus database with same CATH topology
 3OZH A;  3IQA A;  3NEC A;  1XFN A;  1K57 C;  2VGK A;  3PXP A;  1LSX A;  4YIN A;  4EU0 A;  1GCE A;  3MBZ A;  3GVB A;  2V1B A;  3GQZ A;  5L8M A;  5DFY A;  1JTG A;  1PNE A;  4KZ9 A;  1MWT A;  2HJE A;  1MWS A;  1DJA A;  5HPI A;  5HDS A;  2ZC3 B;  5L10 A;  1KVM A;  2NUP C;  3HUO A;  3ZG7 B;  1SKF A;  3LO7 A;  4LRY C;  2IWC A;  1GA9 A;  2Y59 A;  4BBT A;  3QNC A;  2JKF A;  4AFI A;  4YFM A;  1ACF A;  1CF0 A;  2ZQ8 A;  4JGQ A;  2ZJ9 A;  4UQI S;  1ES3 A;  3Q1F A;  4GD8 A;  2Y2H A;  2XSS A;  3IHA A;  1BLC A;  1IYO A;  3RXX A;  3W4Q A;  3GRJ A;  3WWX A;  4N9K A;  1ALQ A;  5DJT A;  2EWV A;  3ZVT A;  5FQK A;  2XEP A;  1XKZ A;  3EOI A;  3MQQ A;  4MDZ A;  4WZ5 A;  3UE6 A;  3Q82 A;  1H5X A;  5F1F A;  2XRN A;  2Y2L A;  4S2N C;  4IBX A;  3K3C A;  1F9I A;  3ZYT A;  3H7W B;  1G68 A;  3LGO A;  3V3S A;  1XJ2 A;  1DP9 A;  2P9V B;  4HJ4 A;  2Y91 A;  4LPZ A;  3DAV A;  3PR6 A;  5TBM B;  1I2S A;  4R0Q A;  3OLO A;  2B95 A;  3SS3 A;  3L9K A;  4E3O A;  1F5M A;  1ZHH B;  5DKK A;  3NOT C;  5A93 A;  1QMF A;  3D72 A;  4ZJ1 A;  1MWU A;  1IYQ A;  4DJ2 A;  1TS8 A;  1AWI A;  4QJG A;  1IYP A;  4KG2 A;  3VFF A;  3HLG A;  4Y7P A;  4ESP A;  3IXD A;  3QP6 A;  3MQ0 A;  1YLZ A;  3OPR A;  2HF6 A;  2XA7 M;  4WM9 A;  3UB7 A;  4BLM A;  1VB6 A;  4DMZ A;  3LR4 A;  3AGD A;  2VK3 A;  1WE4 A;  1JTD A;  3QP8 A;  4RQ9 A;  2D02 A;  4JLF A;  3CHW P;  5HX9 A;  4JF6 A;  4GS9 A;  3W4P A;  1TS7 A;  5K5B A;  4ETX A;  3F1O A;  3CG5 A;  1G6O A;  2A49 A;  3A3E A;  2PD8 A;  3T50 A;  1IEM A;  1ZG4 A;  2XD5 A;  4LLO B;  1W63 Q;  4HIA A;  1Y4O A;  1XX2 A;  3WS2 A;  5HW3 A;  3DTI A;  1PI5 A;  1K56 A;  2VX8 A;  1SCW A;  1ONG A;  4RX2 A;  1G6A A;  2OAQ 1;  2GJ3 A;  3NBL A;  3S22 A;  1FOF A;  4Y15 A;  2EA9 A;  2PYP A;  2Y55 A;  5FSR A;  4FSF A;  2VV6 A;  4KZ6 A;  2J7V A;  1Y54 A;  2Z2L B;  1NRF A;  4HOI A;  1RCJ A;  4GS9 B;  1RP5 A;  2PU4 A;  3UDF A;  3MSH A;  4NXG A;  5CHJ A;  3IT9 A;  2ZM8 A;  4GB7 A;  3MF0 A;  3BW6 A;  3UO9 A;  1BUE A;  1E25 A;  3HL9 A;  1ONH A;  2WZX A;  1F2K A;  3C4P A;  3LIA A;  2WAD A;  5FA7 A;  3TG9 A;  1BYW A;  4EXO A;  4JF4 A;  1J9M A;  1H0M A;  4DJ3 A;  4KZ3 A;  2QYB A;  3S7Q A;  1HZO A;  3G35 A;  1NZU A;  1IOU A;  2HPB A;  5HL6 A;  2UV0 E;  3S7O A;  4WZ4 A;  1H8M A;  2K7S A;  2IWD A;  3UB8 A;  2FH5 A;  4OPQ A;  3D9Y A;  3G30 A;  3U4L P;  3KYZ A;  3VSK A;  2P74 A;  1Q2Q A;  2W3D A;  4KUK A;  1CI9 A;  3B42 A;  3QP5 A;  5AVE A;  5I94 A;  2VKS A;  4K91 A;  3ZG8 B;  3LR3 A;  3Q81 A;  4IBR A;  1OTE A;  4FH4 A;  4Y5F A;  4XUX A;  3IH8 A;  2PT7 A;  4KEN B;  5GHZ A;  5CTM A;  4OPY A;  5AJG A;  3IF6 A;  3FWL A;  4ZJ2 A;  2Y2I A;  1GHM A;  2JKR M;  2BTF P;  4UEY A;  1DP6 A;  2V0W A;  4XUZ A;  4Y0T A;  3NDE A;  2L4R A;  2QMI A;  3AGF A;  2ZD8 A;  1VEU A;  5F83 A;  4Y0U A;  2H28 A;  1XJ6 A;  1YQS A;  3KSF A;  1J3W A;  4YNR A;  3IH9 A;  4JXW A;  4JXV A;  1K55 C;  3VFH A;  1YLJ A;  2JC7 A;  4ARZ A;  4X56 A;  3VE3 A;  3M2J A;  5D3O A;  4JF5 A;  3LR0 A;  2ZQC A;  4WYY A;  2HP6 A;  4A5R A;  1UGU A;  4FOF A;  3E4P A;  4S2P A;  5C5K A;  5HAI A;  2O9B A;  2J80 A;  5AQ7 A;  3S7N A;  1D1J A;  5GHY A;  2GNX A;  2G2U A;  4KZ4 A;  3ZFZ A;  3SW1 A;  3PBR A;  3K2N A;  3DWK A;  4Q0J A;  3IXG A;  2EFU A;  4GDB A;  4GJ4 A;  2OWJ A;  3PBS A;  1O7E A;  1LSW A;  1VHM A;  4ARZ B;  2HDQ A;  5FDH A;  4PHT A;  4DE3 A;  1SDE A;  2E8J A;  3D3O A;  1BLS A;  4NXE A;  2XA7 S;  2Z6C A;  4E3N A;  4DKI A;  3LYX A;  2WKE A;  3ITA A;  1UWP X;  3FKV A;  5HAR A;  4R23 A;  4X68 A;  1K4E A;  3BQA A;  4QU3 A;  2VEA A;  1ZTU A;  1YLW A;  1XGJ A;  2G2W A;  4R3B A;  1I5Q A;  5AQB A;  3HJI A;  2ZMV A;  3LUQ A;  4B93 A;  4EV4 A;  4I39 A;  3CJM A;  2VV7 A;  4PM9 A;  3UME A;  4KUO A;  4C6Y A;  1S1Z A;  3NIA A;  4R4S A;  5HD3 A;  3VP1 A;  3AGE A;  5A90 A;  3TRC A;  5AVF A;  1KDS A;  2W0N A;  1NJ4 A;  4B9O A;  4NET A;  4R70 A;  4EEU A;  1PIO A;  4KQD A;  1CI8 A;  3NI9 A;  5G4Y A;  4D60 A;  3FPV A;  1GSW A;  4K0W A;  5GL9 A;  3QHY A;  4MBF A;  1JWZ A;  4EQ1 A;  3NJA A;  2Y79 A;  2X71 A;  3MKE A;  1LL5 A;  4E6W A;  2M1C A;  3ISG A;  1ES2 A;  1W8Y A;  2WYX A;  3HUM A;  1K0K A;  3UDX A;  3BFG A;  1YM1 A;  1N9N A;  3G2Z A;  4QD4 A;  4UA6 A;  3P7N A;  5U47 A;  1NYM A;  2HDU A;  1OT9 A;  2WKI A;  2R78 A;  4KQQ A;  1K4F A;  1VET A;  5FAO A;  3H82 A;  3G6O A;  3N8S A;  2DMW A;  2QJ7 A;  1WYC A;  1SHV A;  2DCF A;  4BD1 A;  2OOL A;  4LV0 A;  3FZC A;  1KVL A;  4P6B A;  4WLA A;  1Z6F A;  3LIE A;  4K08 A;  1FIK A;  4BD0 A;  3A3D A;  2DRW A;  1L0E A;  1DP8 A;  2PR5 A;  2W27 A;  1OTD A;  4HQA A;  3IF5 A;  4HY8 A;  3F1N A;  3LIF A;  3ZNT A;  1L2S A;  3CAX A;  5DFX A;  1XA1 A;  3HLB A;  1T18 A;  4HHD A;  4H6J A;  4OON A;  2X02 A;  1VET B;  4O0P A;  4DDY A;  2VLG A;  4DRT A;  5DVA A;  2ZLY A;  1OJG A;  4QPR A;  1ZG6 A;  3T4T A;  4QY6 A;  4HH3 A;  2MJ6 A;  4B88 A;  4EQI A;  4OPZ A;  5FAP A;  2PBD P;  4G3W A;  3A3J A;  5FI7 A;  5G4Z A;  4U0X A;  2JKT M;  4F3L A;  2VA0 A;  5EPH A;  1K54 C;  2Y2M A;  4EUZ A;  3LEZ A;  2ZQ9 A;  2AVX A;  3JVU A;  3C7U A;  5DTT A;  4H6J B;  3N8R A;  4CLC A;  3KSI A;  3ZDJ A;  3RXW A;  2INW A;  2IA2 A;  3C4O A;  2ZMA A;  2J3W A;  3ZVW A;  4HES A;  3T4L A;  1O07 A;  2WKQ A;  1YPR A;  3V3R A;  4CQH A;  1S4S A;  3CZD A;  1W5D A;  1S1Y A;  1XJ3 A;  4PKY G;  3KSH A;  5CX7 A;  2XK1 A;  4GCZ A;  1EWZ A;  1BLP A;  4FTX A;  2A3U A;  1PWC A;  5HSQ A;  1DY6 A;  1TEM A;  4F3L B;  4DE2 A;  4OQH A;  2B5R A;  3O87 A;  4PM8 A;  2Y8H A;  4CLC B;  4S2O A;  5E43 A;  4MN5 A;  1U60 A;  4MBK A;  1TF1 A;  4I3A A;  4GN2 A;  3WS1 A;  3UB5 P;  1ZC2 A;  4HI4 A;  2ZC6 B;  4X53 A;  3ZGA B;  3RJU A;  3ZHH A;  4RX3 A;  4OH0 A;  4X1L A;  4Q0H A;  4R1G A;  3M2K A;  1IFQ A;  1A0K A;  1JWV A;  2XQZ A;  1T19 A;  2A2L A;  4DDS A;  1K6R A;  3QP2 A;  2P08 A;  1DJC A;  4HNB A;  3KO6 A;  1NXY A;  1XGI A;  2OLU A;  2H0Y A;  4YWZ A;  2Y2P A;  4JGR A;  2PD7 A;  3E0Y A;  1FCN A;  2Z6D A;  2V9A A;  1SDN A;  2JKG A;  3NOU C;  4U0T A;  1DRM A;  3EEH A;  3PBQ A;  3V67 A;  3JPU A;  2PHY A;  4OVD A;  4EER A;  3GTC A;  5HD5 A;  1CEG A;  3UPP A;  4OQG A;  2J9O A;  3TOI A;  4N1X A;  1CK3 A;  4GDN A;  5IT5 A;  5FI2 A;  4X55 A;  1PRQ A;  2HGV A;  2WAE A;  3IBR A;  1T1A A;  4D2O A;  1OTI A;  3LFV A;  2WGV A;  4I38 A;  4OKP A;  3BEC A;  3T12 B;  3CMZ A;  4MN7 A;  3PAG A;  4N9L A;  5EEC A;  2GDN A;  5EVI A;  3VSL A;  3LIC A;  3VOZ A;  4L9G A;  4E3K A;  4S2I A;  2V2F F;  4FD8 A;  2B18 A;  1HD8 A;  4MEZ A;  2ZM0 A;  2OV5 A;  3C38 A;  4WZ5 C;  3TSG A;  3SS4 A;  4KG6 A;  3E98 A;  1EW0 A;  2ZM2 A;  3FV7 A;  3UPN A;  3HUN A;  4WMC A;  5AQ9 A;  4PPR A;  3HLF A;  3QP1 A;  2BG1 A;  1YSP A;  5M18 A;  3F1O B;  4K0X A;  5DKL A;  5DF7 A;  3C2W A;  2R9W A;  4PMA A;  1TDG A;  4FH2 A;  1BUL A;  3DTM A;  2QJ5 A;  5F82 A;  5F6A A;  4WEK A;  1S6R A;  1YMX A;  5TGF A;  5EE8 A;  4E3M A;  3G2Y A;  3BEB A;  1KGG A;  5IU1 A;  4LCL A;  5EM1 A;  1G5U A;  3ZG0 A;  2PR6 A;  4X1M A;  3V50 A;  2ZL1 A;  2ZOI A;  1E4D A;  4JKT A;  3GR2 A;  3UB9 A;  4LCM A;  1MXO A;  4BEN A;  1GHP A;  2JKR I;  4BL2 A;  4S2M A;  3BRM A;  1MBL A;  5L2F A;  5JYP A;  3B3X A;  1N4O A;  4O7D A;  4XT2 A;  5F1G A;  2O9A A;  3IX4 A;  3WS0 A;  1Q2P A;  3O3V A;  2Y2J A;  1IEL A;  3BYD A;  2WAF A;  2Y2G A;  3BFC A;  1FR1 A;  5EVL A;  4JXS A;  1PWG A;  4WN5 A;  4OQI A;  3UDI A;  1P0Z A;  5TFQ A;  3T1S A;  3IBJ A;  4BBU A;  2XH9 A;  1PWD A;  2QWS A;  1TS0 A;  1WA9 A;  2ZL1 B;  4G3V A;  3BLM A;  5EOE A;  2XRO A;  3PTE A;  1HLU P;  4DF6 A;  1KE3 A;  4GNU A;  1XJ4 A;  4EBN A;  3BY8 A;  3P98 A;  2KOI A;  3EGX C;  3CUE A;  5HDD A;  5F69 A;  1MKM A;  2PYR A;  5DTS A;  5HFO A;  3P09 A;  4HP4 A;  4G3K A;  3S1Y A;  2KLI A;  1GA0 A;  4RA7 A;  2ZC7 A;  4WF0 A;  2FZ0 A;  3F1P A;  1TS6 A;  3S7P A;  4LRZ E;  4MLL A;  2J9P A;  5CHU A;  5F5Y A;  3R4K A;  5FQM A;  4HJ3 A;  4QY5 A;  4IED A;  3E4O A;  1P97 A;  1IKG A;  4LV3 A;  1FSW A;  3WRT A;  2W3F A;  3EQU A;  4JGO A;  1MPL A;  2EX9 A;  2YKF A;  5HAP A;  3IF6 B;  1FSY A;  4GW9 A;  3PAE A;  2HV1 A;  2ACG A;  4X69 A;  2HZ5 A;  4IUK A;  4Q0I A;  5FI6 A;  5FQJ A;  5HPF A;  4MCW A;  3OCN A;  4R3J A;  1VEU B;  3LY3 A;  3QP4 A;  1MC0 A;  4CLC D;  5HWT A;  2EXA A;  3DBA A;  2HP5 A;  1H8Y A;  1W8Q A;  3BFE A;  5EV0 A;  1GSX A;  3HVF A;  5HL1 A;  1GSV A;  3EGD C;  1YSQ A;  1Y28 A;  1V9Y A;  4S2L A;  3SH9 A;  3GEC A;  2V1A A;  4EW7 A;  3N6I A;  4S2K A;  4GLQ A;  3A3F A;  1VQQ A;  3QNB A;  3JYI A;  1BT5 A;  4RYE A;  2EWW A;  5FQ9 A;  3FYZ A;  2X01 A;  4DE1 A;  2IWB A;  4WEL A;  3T4O A;  4GD6 A;  2J3T C;  4BQM A;  4GHI A;  4QWO A;  5KZH A;  3T4Q A;  3R7W A;  3I7J A;  3TJZ C;  4PM5 A;  3NC8 A;  4IVK A;  3D4F A;  1H3Q A;  5CEC A;  4Y3I A;  2B02 A;  5JYO A;  4LFU A;  4MNR A;  4N92 A;  1CQA A;  1ERO A;  4C75 A;  3CI6 A;  4LV1 A;  4P0M A;  1T1C A;  3CWF A;  4B4Z A;  2C6W B;  4Y0O A;  3VP4 A;  4I5S A;  3H9W A;  4GZB A;  1TVF A;  2KDK A;  3HCY A;  3NDG A;  3VP2 A;  1K57 A;  1OME A;  2XDM A;  3HLW A;  4GHI B;  3PBN A;  3UY6 A;  2BAS A;  3LID A;  5HZH A;  2JBF A;  3SH8 A;  1KGF A;  2ZMF A;  3BFF A;  3VOY A;  1YT4 A;  2L0W A;  1ES5 A;  3WRZ A;  5GHX A;  2NUT C;  2WZZ A;  3HLC A;  4LGW A;  4M4X A;  3IXH A;  4R4R A;  2O9C A;  4DXC A;  5CGX A;  1UWN X;  3BM6 A;  4NKP A;  5CEB A;  4N1H A;  5CGS A;  1L0F A;  2WKR A;  2Y2K A;  4Z1W A;  1M40 A;  3MZE A;  3P01 A;  3T1R A;  2A24 A;  4E3I A;  5E2F A;  1V9Z A;  1E3U A;  3PBO A;  1KOU A;  4ZDX A;  5MC7 A;  4NG2 A;  1HTZ A;  5FAT A;  2V0U A;  2CMN A;  4O01 A;  2VV8 A;  4IHQ A;  3T1Q B;  5A92 A;  1STZ A;  4HBT A;  1T1B A;  3NY4 A;  4KQR A;  3O86 A;  4YOF A;  3T4S A;  2JKT I;  2QPN A;  2Q9N A;  1N9L A;  1K56 D;  2I9V A;  3KYQ A;  3PBT A;  1JWP A;  5E2H A;  3WS5 A;  3H82 B;  1FQG A;  5EM0 A;  2O99 A;  3MS6 A;  4KZ7 A;  3FC7 A;  3SS5 A;  1JNU A;  5FEG A;  3HJK A;  3UN7 A;  4WMC D;  2K2N A;  2FFF B;  2GX5 A;  1XPB A;  3IHB A;  4S2N A;  4O8G A;  3EEA A;  4FUW A;  4PM7 A;  3IWO A;  4OLG A;  5FAQ A;  2O0Y A;  3BLS A;  1XXM A;  3E2L A;  5A8B A;  1OTA A;  2DNS A;  3GV9 A;  2YKH A;  5DF9 A;  3G34 A;  1KDW A;  5L07 A;  5CHM A;  4E6X A;  1ERM A;  5M1A A;  3F1N B;  3ULF A;  5EOO A;  3MXR A;  4BMW A;  4OQ0 A;  5GLD A;  1WYB A;  2XR0 A;  4UA7 A;  2ZQA A;  1ESU A;  2XFT A;  3KYE A;  3W8K A;  5HWV A;  3V39 A;  1P9R A;  4X25 A;  5I5L A;  3MMH A;  3VOL A;  1KE0 A;  2ZBB A;  4IVI A;  4LEN A;  2W1R A;  2H10 A;  3MZF A;  1ZKJ A;  1MZU A;  2LB9 A;  5EFW A;  4HH2 A;  3V5M A;  4EBL A;  1IKI A;  3LR5 A;  3MZD A;  1N9O A;  4JPM A;  4RVA A;  1M6K A;  3O5Y A;  3H7W A;  5FQQ A;  2Q0O A;  3VE4 A;  3DWZ A;  2JE5 A;  1LT0 A;  4HP9 A;  2P9V A;  1F98 A;  1S4R A;  3MKF A;  4H8R A;  5E2E A;  4P6Z M;  5HDC A;  2J3T D;  5KSH A;  1MWR A;  5AQA A;  5TBM A;  3HLD A;  1XA7 A;  3ZCZ A;  1AXB A;  3UNW A;  2WGW A;  5E2G A;  4ZBE A;  3S4X A;  3VV4 A;  2XF3 A;  1W63 M;  4R3A A;  2PAV P;  4BWI A;  3DW0 A;  4ID4 A;  4XXR A;  1NZO A;  3HBR A;  4HEF A;  4ZJ3 A;  4GKU A;  5CED A;  5KIZ A;  2PBY A;  3C7V A;  3A0R A;  4CJN A;  1N9B A;  2WKH A;  1L0G A;  1LL8 A;  4I3J A;  4BBV A;  1W7F A;  2ZQD A;  1BLH A;  2I72 A;  3TE8 A;  2VGL M;  4WUJ A;  3KSG A;  2W3E A;  4JGP A;  3G32 A;  4UAA A;  1S0W A;  4QB8 A;  1PW8 A;  2H0T A;  3PYP A;  4CLC C;  4PAU A;  1P9W A;  4Y2F A;  1XFQ A;  2JCH A;  3NCK A;  4BJP A;  5HWW A;  4OOY A;  2P7J A;  2WGW B;  2FFY A;  4EEP A;  2V1Z A;  3MQO A;  2W3H A;  1OPX A;  1MY8 A;  4S2J A;  4MN6 A;  3ITB A;  2WK0 A;  1MKI A;  1H8Z A;  1I2W A;  4II7 A;  4E3J A;  4ZRR A;  1SZV A;  1Z09 A;  1PW1 A;  2Q9M A;  2V8F A;  4Q8I A;  1PZO A;  4E3L A;  1OJ5 A;  3UE0 A;  5FQI A;  4MMN A;  2H5S A;  5J7E A;  5CTN A;  2M7V A;  1XP4 A;  2E8I A;  1FR6 A;  4UHU A;  3T1X A;  2OLV A;  4B4X A;  4KZA A;  4OOL A;  5CXW A;  3IX3 A;  2JN7 A;  1KE4 A;  5J3W A;  2KX6 A;  3BWL A;  1LI0 A;  3B47 A;  5CGW A;  3N4I A;  2V20 A;  1RGY A;  3N7W A;  3HLE A;  2R9X A;  5CER A;  3LIB A;  1DJB A;  1FCM A;  4WL9 A;  3UPO A;  3LI8 A;  4X6T A;  2HJ9 C;  5GLA A;  1X0O A;  3JVV A;  3CPT A;  1W79 A;  1NRJ A;  5EVI B;  1ODV A;  3RFB A;  3UE1 A;  3CLO A;  3IS2 A;  1NWZ A;  1K25 A;  3G4P A;  4NXB A;  3L7H A;  3C8C A;  4KQO A;  1K55 A;  3TW8 A;  4EET B;  1PI4 A;  1KGE A;  1YAX A;  1YLY A;  2L1M A;  3VMA A;  3K3D A;  5FEF A;  5J8X A;  4ZAM A;  5M19 A;  3EWK A;  4HJ6 A;  4WBG A;  1TDL A;  4CLC E;  4GOG A;  4ZTK A;  1PYY A;  2OSU A;  3OC2 A;  5HAQ A;  1PFL A;  4E04 A;  3MJQ A;  3OPH A;  3EQV A;  4WEJ A;  4ETZ A;  3CPT B;  2C5W B;  3CIT A;  2M7U A;  3OBF A;  3LCE A;  2EFX A;  3IS2 B;  3E2K A;  1CJF A;  1YLP A;  1SKO A;  5GLB A;  4EUV A;  1TD5 A;  2JHE A;  3NUL A;  4KG5 A;  1BZA A;  1E3U D;  3C5A A;  4JXG A;  4OLD A;  3FKW A;  5EVI C;  4Y13 A;  4DE0 A;  3ZNY A;  3NHQ A;  1BSG A;  3OPP A;  4BL3 A;  2VGJ A;  1K6S A;  2XLN A;  3ZG9 B;  2EX2 A;  2Y2Q A;  4LV2 A;  4KZ5 A;  3KX0 X;  3SH7 A;  5LBR A;  3T4J A;  2J8Y A;  3MXS A;  2OWH A;  4PM6 A;  4XT2 B;  4HBU A;  1NLZ A;  3Q07 A;  4P6Z S;  3WS4 A;  3MR0 A;  3BFD A;  3DTE A;  5BOH A;  1SKO B;  3LY4 A;  1NY0 A;  1LL9 A;  3T4K A;  2PDR A;  2HDR A;  5F68 A;  2QKP A;  3MFD A;  4L0L A;  2HDS A;  3ZQ5 A;  2HP9 A;  3NOP C;  5FDS A;  4OPR A;  5EUA A;  3BJN A;  1C3B A;  2ZOH A;  1JVJ A;  4R38 A;  2W3G A;  4MBH A;  2ZQ7 A;  3BQ8 A;  3G31 A;  5DJU A;  1ESI A;  2P04 A;  3LI9 A;  2UWX A;  1ES4 A;  4NXF A;  3MXQ A;  2OAP 1;  3OOV A;  4DXB A;  1LSV A;  2XGN A;  3OPL A;  3UE3 A;  1BTL A;  2LB5 A;  1LI9 A;  2VGL S;  2QZ6 A;  2GZA A;  5DTK A;  2G7U A;  3F1P B;  5KSC A;  3U2A A;  1HVB A;  3PHY A;  1CEF A;  2EX6 A;  3ICY A;  3IWI A;  4P85 A;  1LHY A;  5TJJ A;  2WGI A;  4NK3 A;  4UQI M;  1EI5 A;  3A3I A;  4OOM A;  1LLB A;  5IHV A;  1S66 L;  3RTY A;  3M6H A;  3M6B A;  1GHI A;  3A0V A;  2CC1 A;  3ZG5 A;  2Y2O A;  1FCO A;  2Y2N A;  1NYY A;  2RL3 A;  2W1T A;  3IX8 A;  1OT6 A;  5FAS A;  4JBF A;  3E4Q A;  3IF6 C;  4OP8 A;  5FL3 A;  3A0S A;  2QHK A;  3IXB A;  3CUE C;  3SZT A;  2PU2 A;  1K38 A;  3VP0 A;  3B33 A;  2Z2M B;  4C3Q A;  1YKD A;  1D06 A;  4P87 A;  1D7E A;  5G18 A;  1YLT A;  4EWF A;  1NLY A;  4Z9Q A;  1RGZ A;  3SOI A;  3DTK A;  3O88 A;  2W1T B;  3C30 A;  4F94 A;  1FIL A;  1YMS A;  4IJG A;  4LRX C;  5CRF A;  3RH8 B;  1G28 A;  3FG8 A;  3R7W B;  3HRE A;  5TR7 A;  2BLS A;  3GMW A;  4FCF A;  3W2Z A;  1K54 A;  4OP5 A;  3Q7V A;  4EBP A;  2Y4A A;  3FPW A;  5DF8 A;  1OTB A;  5GLC A;  2D01 A;  1VM1 A;  1QME A;  2ZC4 B;  4NEE D;  3UB6 A;  3IWQ A;  1PZP A;  5KMW A;  3BY9 A;  2WUQ A;  4EES A;  5L09 A;  2EXB A;  2XD1 A;  4KZB A;  4ME4 A;  3W4O A;  2XFS A;  2PRF A;  2ZC5 B;  3GDI A;  3MFX A;  5EVI D;  2VJW A;  4QHC A;  4KZ8 A;  2WKP A;  4L9F A;  4CPK A;  3Q7V B;  4IUH A;  3UMD A;  5J4E A;  3Q7Z A;  4UA9 A;  5A91 A;  1L0D A;  4L9E A;  4R6L A;  3LEQ A;  3VP3 A;  5IS1 A;  4I3I A;  1L3L A;  2A24 B;  3GSG A;  5EVE A;  4M3K A;  1IYS A;  4U3T A;  4PKY A;  3OCL A;  3N8L A;  1S67 L;  2RCX A;  4DN0 A;  2EX8 A;  4Y17 A;  1ERQ A;  2V8C A;  2K31 A;  2VZW A; 
#chains in the Genus database with same CATH homology
 2W3H A;  1OPX A;  3HJI A;  2ZMV A;  4WN5 A;  1XFN A;  3PXP A;  3LUQ A;  1P0Z A;  4MN6 A;  1LSX A;  4B93 A;  4I39 A;  2VV7 A;  3UME A;  4EU0 A;  3IBJ A;  4KUO A;  4BBU A;  2QWS A;  4II7 A;  1TS0 A;  1WA9 A;  4ZRR A;  4G3V A;  1S1Z A;  5HD3 A;  2V1B A;  2XRO A;  5L8M A;  3TRC A;  5DFY A;  1OJ5 A;  5AVF A;  1XJ4 A;  2HJE A;  3BY8 A;  2KOI A;  2W0N A;  3EGX C;  5HPI A;  4MMN A;  4B9O A;  5HDS A;  3CUE A;  5HDD A;  4R70 A;  4EEU A;  5F69 A;  1MKM A;  2PYR A;  2NUP C;  5J7E A;  4KQD A;  2M7V A;  4LRY C;  4HP4 A;  5G4Y A;  4BBT A;  3FPV A;  4G3K A;  2KLI A;  4AFI A;  1GSW A;  4WF0 A;  2FZ0 A;  3F1P A;  1TS6 A;  4OOL A;  3S7P A;  4EQ1 A;  4LRZ E;  3NJA A;  2Y79 A;  4JGQ A;  2JN7 A;  4UQI S;  5F5Y A;  3R4K A;  5J3W A;  2KX6 A;  3BWL A;  3B47 A;  2M1C A;  4HJ3 A;  3E4O A;  1P97 A;  2XSS A;  2W3F A;  3LIB A;  3EQU A;  4JGO A;  1N9N A;  4WL9 A;  2YKF A;  3LI8 A;  3P7N A;  2HJ9 C;  4GW9 A;  1OT9 A;  1X0O A;  3JVV A;  2HV1 A;  2R78 A;  5DJT A;  1NRJ A;  4IUK A;  4Q0I A;  3H82 A;  3G6O A;  1ODV A;  3RFB A;  5HPF A;  2DMW A;  2EWV A;  3OCN A;  4MCW A;  2QJ7 A;  3CLO A;  3IS2 A;  2OOL A;  1NWZ A;  1MC0 A;  4CLC D;  5HWT A;  3DBA A;  3EOI A;  3MQQ A;  4NXB A;  4WLA A;  3C8C A;  4MDZ A;  4KQO A;  3UE6 A;  3TW8 A;  4EET B;  2XRN A;  3LIE A;  1GSX A;  4K08 A;  1YAX A;  3K3C A;  2L1M A;  1F9I A;  1GSV A;  3K3D A;  3EGD C;  1YSQ A;  3ZYT A;  3H7W B;  1DP8 A;  2PR5 A;  3EWK A;  4HJ6 A;  1Y28 A;  1V9Y A;  3GEC A;  2W27 A;  1OTD A;  1XJ2 A;  1DP9 A;  4CLC E;  2V1A A;  4EW7 A;  3OC2 A;  4HJ4 A;  4HQA A;  4E04 A;  4GLQ A;  3F1N A;  3MJQ A;  4HY8 A;  3LIF A;  3EQV A;  4WEJ A;  3CAX A;  4LPZ A;  5DFX A;  4ETZ A;  1T18 A;  3CIT A;  4HHD A;  3PR6 A;  4H6J A;  2M7U A;  3OBF A;  4O0P A;  5TBM B;  2VLG A;  2EWW A;  3OLO A;  3IS2 B;  1OJG A;  4QPR A;  3T4T A;  1F5M A;  4HH3 A;  4WEL A;  4EUV A;  1TD5 A;  3T4O A;  2J3T C;  1ZHH B;  2JHE A;  2MJ6 A;  4GHI A;  5DKK A;  3NOT C;  3T4Q A;  3D72 A;  3R7W A;  4DJ2 A;  3TJZ C;  1TS8 A;  4G3W A;  3NHQ A;  1H3Q A;  4Y3I A;  5G4Z A;  2B02 A;  2JKT M;  4F3L A;  2VA0 A;  3MQ0 A;  2HF6 A;  2XA7 M;  3KX0 X;  3UB7 A;  3JVU A;  1VB6 A;  5LBR A;  3T4J A;  3CI6 A;  3LR4 A;  4DMZ A;  1T1C A;  4H6J B;  3CWF A;  2OWH A;  4CLC A;  3KSI A;  4XT2 B;  4I5S A;  4RQ9 A;  3H9W A;  2D02 A;  1NLZ A;  2KDK A;  4P6Z S;  2INW A;  3HCY A;  3MR0 A;  2IA2 A;  2J3W A;  4GS9 A;  3T4L A;  1TS7 A;  5K5B A;  4ETX A;  3F1O A;  2WKQ A;  4GHI B;  3T4K A;  1G6O A;  2PDR A;  5F68 A;  2QKP A;  3PBN A;  4L0L A;  2PD8 A;  3ZQ5 A;  3T50 A;  4CQH A;  2BAS A;  3LID A;  1S4S A;  5HZH A;  4LLO B;  3NOP C;  1W63 Q;  2ZMF A;  4HIA A;  3BJN A;  1S1Y A;  2ZOH A;  1XJ3 A;  4R38 A;  4PKY G;  2W3G A;  2L0W A;  3KSH A;  5CX7 A;  3BQ8 A;  4GCZ A;  5DJU A;  2NUT C;  2P04 A;  2VX8 A;  3LI9 A;  5HSQ A;  4M4X A;  4F3L B;  2OAQ 1;  2GJ3 A;  2O9C A;  4NXF A;  3MXQ A;  1UWN X;  2OAP 1;  3OOV A;  4NKP A;  1LSV A;  2EA9 A;  2PYP A;  2Y8H A;  2WKR A;  4FSF A;  2VV6 A;  3UE3 A;  4CLC B;  2LB5 A;  2VGL S;  4Z1W A;  3P01 A;  4MN5 A;  2A24 A;  2GZA A;  1V9Z A;  1TF1 A;  3PBO A;  4HOI A;  2G7U A;  1KOU A;  4I3A A;  3F1P B;  4GS9 B;  5MC7 A;  3U2A A;  3PHY A;  2V0U A;  2CMN A;  4NXG A;  4O01 A;  4HI4 A;  2VV8 A;  4IHQ A;  3ICY A;  1STZ A;  3MF0 A;  5TJJ A;  3BW6 A;  1T1B A;  4UQI M;  4Q0H A;  4OOM A;  1IFQ A;  4YOF A;  1S66 L;  3T4S A;  3RTY A;  2JKT I;  1T19 A;  2A2L A;  3LIA A;  1BYW A;  1N9L A;  2P08 A;  4EXO A;  2I9V A;  3KYQ A;  4HNB A;  3KO6 A;  3PBT A;  4YWZ A;  4JGR A;  3A0V A;  2PD7 A;  3E0Y A;  2Z6D A;  3H82 B;  4DJ3 A;  2V9A A;  2O99 A;  2QYB A;  3FC7 A;  1JNU A;  3NOU C;  3HJK A;  2W1T A;  1OT6 A;  3S7Q A;  1DRM A;  3EEH A;  3PBQ A;  3E4Q A;  3V67 A;  2K2N A;  2GX5 A;  5FL3 A;  1IOU A;  3A0S A;  2PHY A;  4O8G A;  2QHK A;  3EEA A;  5HL6 A;  3S7O A;  1H8M A;  2K7S A;  3CUE C;  4EER A;  3UB8 A;  2FH5 A;  3KYZ A;  5HD5 A;  2O0Y A;  5A8B A;  3B33 A;  1OTA A;  2W3D A;  4KUK A;  3B42 A;  5AVE A;  2YKH A;  2VKS A;  5DF9 A;  5IT5 A;  1YKD A;  1D06 A;  1D7E A;  2HGV A;  3F1N B;  3IBR A;  3ULF A;  1NLY A;  4BMW A;  3LR3 A;  1T1A A;  1OTE A;  1OTI A;  3LFV A;  4Y5F A;  4I38 A;  2PT7 A;  2W1T B;  3C30 A;  5AJG A;  4IJG A;  5HWV A;  4LRX C;  2JKR M;  4MN7 A;  3RH8 B;  1P9R A;  4UEY A;  5I5L A;  1G28 A;  3FG8 A;  1DP6 A;  3MMH A;  2V0W A;  2L4R A;  3R7W B;  3VOL A;  2ZBB A;  3LIC A;  4L9G A;  2H28 A;  2W1R A;  3W2Z A;  1XJ6 A;  2B18 A;  3KSF A;  1MZU A;  2LB9 A;  5EFW A;  4HH2 A;  4YNR A;  3C38 A;  3LR5 A;  3E98 A;  4ARZ A;  3VE3 A;  1N9O A;  1EW0 A;  3FPW A;  1OTB A;  2D01 A;  3O5Y A;  3H7W A;  3LR0 A;  3VE4 A;  4NEE D;  3UB6 A;  1LT0 A;  4HP9 A;  1YSP A;  1UGU A;  1F98 A;  1S4R A;  3BY9 A;  4FOF A;  3E4P A;  4EES A;  3F1O B;  5C5K A;  4P6Z M;  5HDC A;  5DKL A;  2O9B A;  2J3T D;  2J80 A;  3C2W A;  4ME4 A;  3S7N A;  5KSH A;  5TBM A;  3GDI A;  2GNX A;  3MFX A;  3SW1 A;  3PBR A;  2QJ5 A;  5F6A A;  4WEK A;  3K2N A;  2VJW A;  3VV4 A;  1W63 M;  2WKP A;  4R3A A;  4L9F A;  4BWI A;  4Q0J A;  4IUH A;  3UMD A;  5J4E A;  5IU1 A;  4GJ4 A;  2OWJ A;  3PBS A;  4ARZ B;  1LSW A;  1VHM A;  2PR6 A;  4PHT A;  2ZOI A;  4L9E A;  5KIZ A;  4R6L A;  3D3O A;  3A0R A;  4NXE A;  5IS1 A;  2XA7 S;  2Z6C A;  3UB9 A;  4I3I A;  1LL8 A;  4I3J A;  2A24 B;  4BBV A;  3LYX A;  4PKY A;  1UWP X;  2JKR I;  3OCL A;  3TE8 A;  1S67 L;  2VGL M;  4WUJ A;  4DN0 A;  3KSG A;  2W3E A;  3BQA A;  4JGP A;  2VEA A;  4XT2 A;  1ZTU A;  2O9A A;  3PYP A;  4CLC C;  4PAU A;  1P9W A;  1XFQ A;  4Y2F A;  4BJP A;  5HWW A;  2P7J A;  4EEP A;  2K31 A;  2VZW A;  3MQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...