4QPRA

Crystal structure of gaf domain of potassium sensor histidine kinase kdpd from escherichia coli
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
GAMDLYEMSKALAVGRSPQDIAATSEQFIASTFHARSQVLLPDDNGKLQPLTHPQGMTPWDDAIAQWSFDKGLPAGAGTDTLPGVPYQILPLKSGEKTYGLVVVEPGNLRQLMIPEQQRLLETFTLLVANALERLTKLAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Gaf Domain of Potassium Sensor Histidine Kinase Kdpd from Escherichia Coli
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Sensor protein KdpD
total genus 38
structure length 142
sequence length 142
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13492 GAF_3 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4qprA00
2W1TA 2O9CA 4IUKA 1YKDA 4RQ9A 4Y5FA 1YSPA 1STZA 3IBJA 2VKSA 3TRCA 3NOUC 3S7OA 5HPIA 2O9BA 4MN7A 2W3GA 4O8GA 4ETXA 4R70A 5HL6A 4Q0JA 2XRNA 4Y2FA 4IUHA 3MMHA 2O9AA 4MMNA 2O0YA 2VJWA 3BJNA 4GW9A 1ZTUA 3K2NA 2W3FA 4DN0A 2W3EA 4YOFA 4EUVA 4Z1WA 4LRYC 4G3KA 5HSQA 3NHQA 2W1TB 4O0PA 3KSFA 5AJGA 4ZRRA 4CQHA 3KO6A 2O99A 2QYBA 3OOVA 3S7PA 3CI6A 2Y8HA 4FOFA 3NOTC 2W1RA 4YNRA 2W3DA 3D3OA 5I5LA 5DFYA 3KSIA 4LRXC 2LB5A 1VHMA 2K2NA 2M7UA 2XROA 4BWIA 3IBRA 4LRZE 3S7QA 1YSQA 5LBRA 3S7NA 3W2ZA 2GX5A 3E98A 3RFBA 4Y3IA 5C5KA 1MKMA 4QPRA 3VV4A 2KOIA 2ZMFA 4E04A 2W3HA 3R4KA 2KLIA 3EEAA 4EU0A 2M7VA 3MF0A 4G3VA 4MCWA 1TF1A 5DFXA 3HCYA 1MC0A 3ZQ5A 3LFVA 4O01A 4R6LA 2G7UA 4MDZA 2HGVA 4Q0IA 1TD5A 3DBAA 4PAUA 5K5BA 3NOPC 5L8MA 2K31A 3O5YA 3KSHA 4ETZA 5TJJA 3KSGA 3MQ0A 2VEAA 5HPFA 4GLQA 4DMZA 2OOLA 3CITA 4ME4A 3G6OA 4Q0HA 2VZWA 2IA2A 2LB9A 1F5MA 4G3WA 3C2WA 3E0YA 2B18A 3OBFA 2XSSA 2Y79A 4IJGA
chains in the Genus database with same CATH superfamily
4DE1A 3GSGA 1FSYA 3MXQA 4P6BA 2J3TC 1LLBA 4PM6A 2OLVA 5AQ7A 4JLFA 5L09A 2WKQA 5HD3A 1ZC2A 3O3VA 3MS6A 2W3EA 1DJAA 1O7EA 2QPNA 5EOEA 3VE3A 4JXSA 2BLSA 2W0NA 1JNUA 4PKYA 5DJTA 2IWBA 4HI4A 1CEGA 2G2UA 5D3OA 3VE4A 1VETB 1E25A 2XLNA 1MWSA 4XXRA 5FA7A 4LRZE 3IF5A 1YSQA 1SHVA 1PZOA 5DTKA 4E04A 1TDLA 2JKTI 5FAPA 2OAP1 3NCKA 1GCEA 2EX8A 4P87A 2WGWB 4LV0A 4UA7A 1MC0A 2K7SA 5GLDA 1FQGA 2JKTM 3S22A 4ARZB 5CEDA 4D2OA 5GHXA 3QP6A 1HD8A 4E3OA 3QHYA 4H6JA 2HP6A 4MN6A 2UV0E 1CEFA 3BFEA 3G2YA 4R4RA 3CWFA 3K3DA 3IWOA 1K57A 1K56A 1F5MA 5J3WA 4LLOB 1T18A 2INWA 4UA6A 1SCWA 4R1GA 2ZD8A 3T4OA 1BT5A 4KG2A 2VKSA 4JXGA 1IEMA 3N8SA 3NOUC 3EOIA 1S67L 4QD4A 5CHUA 1LI9A 1DP6A 2ZQ9A 1GHIA 3LY4A 5HFOA 2VGKA 2C6WB 4EESA 2HDQA 1PIOA 3OPHA 1EROA 4P6ZM 4WLAA 1J9MA 2V2FF 2XDMA 2WAEA 5GHZA 4ZJ2A 5EM0A 4GHIB 1L0GA 3PAEA 2W3DA 3M2JA 5HX9A 4HP9A 2OAQ1 4KZ6A 4ZJ1A 3VP0A 4Y17A 3RXWA 5M19A 1GSVA 4F3LB 1SKOB 4GDNA 4LV3A 2EXAA 3H82B 2QKPA 4WZ5A 2J3WA 4YWZA 4BD0A 2ZC5B 2H28A 1XFQA 3B47A 5EM1A 2XGNA 1Z6FA 4EEPA 2G7UA 1IOUA 4RA7A 3PYPA 5L07A 2K31A 3LR0A 3TG9A 1AXBA 3RTYA 2AVXA 1K54C 2P7JA 4CPKA 3MQQA 4UQIS 4HESA 4NG2A 4EETB 3RJUA 3D4FA 1E3UA 3HLEA 4DXCA 5AVEA 4M4XA 1CI9A 2XQZA 5AQ9A 2Q0OA 1PWDA 3UO9A 1H8YA 4RQ9A 3HLGA 1OTIA 3Q81A 4U3TA 3UPPA 2O9BA 2VLGA 1G5UA 3TW8A 4Y2FA 4L9FA 2HF6A 1PW8A 2EX9A 4Z1WA 4PPRA 5GLCA 3G35A 2JKRM 2V1AA 5HAPA 3LCEA 2W1TB 4S2MA 3CPTB 3G30A 1BLCA 2WGWA 4OPYA 3RH8B 4DE0A 4OH0A 2J9OA 1S4RA 5F1FA 1ESUA 4H6JB 4FH2A 4JGRA 4HJ3A 4DXBA 1G68A 4OOLA 2V8CA 3IXBA 5DTSA 3CG5A 4KUOA 4P85A 2BASA 4EQ1A 1OMEA 4OQIA 5KIZA 2X02A 4GB7A 4I5SA 4MCWA 4Y0OA 4HP4A 3PBNA 1PI4A 1Y4OA 3IQAA 2CMNA 2V8FA 1PFLA 1GHMA 5TJJA 3HLBA 5HWTA 3FKWA 3CITA 3CAXA 4E3NA 4I39A 3NULA 5E2HA 2DRWA 3UE0A 5J8XA 3D9YA 4EBNA 3W4PA 5F82A 4OQGA 1LL5A 5A8BA 2JCHA 3T4TA 3E4QA 5CX7A 3MKFA 4OP8A 3C5AA 3ZNYA 3NC8A 3E2KA 3NJAA 3BFCA 1ZKJA 2P74A 3VP4A 4ETXA 4N9KA 1IYPA 3PHYA 3BJNA 2PR6A 3FG8A 1YQSA 2BG1A 5KSCA 2XD5A 5I94A 1L2SA 4HEFA 1D06A 5AJGA 2Y2NA 4QHCA 3MR0A 5MC7A 1DRMA 3CI6A 4QY6A 3D3OA 1XGIA 1YMSA 2ZC6B 3CUEA 4S2NA 1MPLA 5GLAA 1QMFA 5HDCA 3UDXA 4OVDA 4KZ4A 2PBYA 1P97A 4YFMA 4DE3A 5FI7A 4JGOA 4S2OA 5CGXA 4QU3A 2Y2QA 4NXFA 2OSUA 2L0WA 3WS5A 5FDHA 1K56D 3MKEA 1GA0A 4ETZA 5HPFA 5M18A 3SH8A 3T4JA 2RCXA 3M6HA 4OQ0A 2EWWA 3OPRA 1S66L 1F9IA 3PBTA 5TBMB 4ZJ3A 2WUQA 4CLCE 5KZHA 1Z09A 1ZG6A 3MQOA 3LR3A 4EWFA 1KE4A 3Q7ZA 3OPPA 3WRTA 5FATA 3BEBA 1I2WA 2XRNA 2V1ZA 3EQUA 5F6AA 1SDNA 5J7EA 4YOFA 3BLSA 3F1OB 5IS1A 1LL8A 2J8YA 1RP5A 1PWGA 2ZM2A 5FEFA 3HBRA 2Y2JA 1G28A 4KG6A 4X1LA 3VP3A 1EI5A 3BFGA 2QYBA 3S7PA 1I5QA 3T50A 4YNRA 5IT5A 3WRZA 1GHPA 1DJCA 2H0TA 4BL3A 1Y28A 4CLCB 1P9RA 4F3LA 4EQIA 1SKOA 3IBRA 4ZTKA 3IX8A 4GKUA 3DTMA 1JWZA 4GN2A 3T1QB 2XF3A 3MSHA 1IELA 2JE5A 2ZOHA 3B42A 3ULFA 1E4DA 5L10A 3R4KA 3C7VA 2YKFA 1TF1A 5IU1A 2A24A 3HCYA 2Z2LB 3VMAA 4PAUA 1LI0A 2R9XA 1RGYA 3CZDA 1TS6A 3VOLA 4PKYG 4WL9A 3LIFA 4FSFA 1XFNA 3MQ0A 4L0LA 3P09A 4DMZA 1Y54A 3KYQA 1MWUA 4N92A 3TSGA 2WKIA 4DE2A 2VGJA 3VSKA 2XD1A 4HH2A 1KVLA 3OBFA 5FI2A 4R0QA 5DTTA 5HDDA 4IUKA 4E3LA 3T1XA 4Y5FA 3UB7A 1UWPX 3OCLA 4KG5A 5HDSA 3DWKA 2DCFA 4HY8A 3TJZC 3A0SA 2ZC4B 1PYYA 3LO7A 3VP2A 4CLCD 4GW9A 2Q9MA 1TVFA 4KZ9A 4BD1A 4XT2A 1KDWA 2B5RA 3IXHA 4WZ4A 4LCMA 1BYWA 3Q07A 3UMEA 1DP9A 3LUQA 4X69A 3UNWA 4B9OA 5HW3A 2JBFA 5EUAA 4EXOA 4OONA 4K08A 4FOFA 4IEDA 5CXWA 5DF7A 1VHMA 3T1RA 3FZCA 2J3TD 2X01A 4HJ6A 4C6YA 1NWZA 1NYYA 2WGVA 1W5DA 3GECA 3QP8A 1MKMA 1N9OA 4HNBA 2Y2GA 2H0YA 4UEYA 3BWLA 3GV9A 2A3UA 4NETA 1JTDA 1L0EA 3CHWP 2Y55A 4GHIA 2FH5A 3QP4A 1ODVA 2A49A 2Y4AA 4F94A 2D02A 4WMCD 2QWSA 4K0WA 2XFTA 3NI9A 5FEGA 4MEZA 3N8LA 5CTNA 3DW0A 1TS7A 4G3WA 4L9EA 2WKHA 1ES2A 3MFXA 2J80A 4FUWA 2E8JA 3R7WB 3WS1A 1YLZA 4IHQA 3WS2A 2ZL1A 3C7UA 3B33A 4EBLA 2W3GA 3IX4A 4N1XA 1H8MA 3K2NA 2ZMVA 4DJ2A 2XA7M 2Z2MB 3Q7VA 3F1NB 2GDNA 4G3KA 1L0DA 1NXYA 3OPLA 2HZ5A 4O0PA 1YLPA 1ERMA 4II7A 2WKRA 2A24B 3AGFA 3ICYA 5F83A 2ZQCA 3VP1A 1KE0A 3BFFA 1AWIA 1CF0A 3NECA 2WADA 1XXMA 2VK3A 3G4PA 1H0MA 1FR1A 3S7QA 1FCNA 4FH4A 5LBRA 3W2ZA 4QPRA 3VV4A 3UB6A 3QNBA 4E3IA 4B88A 4GOGA 4I3JA 3MF0A 5E2GA 4G3VA 3PBSA 1K0KA 1BLPA 5DFXA 1A0KA 3DAVA 4OOYA 4OP5A 1OT6A 2PU4A 3JVVA 1H8ZA 5F1GA 5L2FA 1NZUA 1FR6A 1CK3A 4CJNA 3H7WA 1YPRA 2FFFB 3NBLA 3G6OA 2VA0A 3I7JA 3OC2A 1NRFA 2PD8A 5DF9A 1F98A 4GNUA 4HJ4A 5FAOA 4EEUA 3OLOA 1XJ4A 1P9WA 4S2LA 3W8KA 4KQRA 5FQIA 3LR5A 3A3EA 4IJGA 4R6LA 1X0OA 1YKDA 4PMAA 1HTZA 4K0XA 3T4QA 4BBTA 3ZG0A 3V50A 1SZVA 3HVFA 3PTEA 1UGUA 5KSHA 5HWWA 3F1OA 2O9AA 3IXGA 4UAAA 3UY6A 5TFQA 1LSVA 4CLCC 3IF6C 4ESPA 3ZG8B 2HV1A 2JN7A 4X55A 5HSQA 3LIAA 4HOIA 3T4KA 2PAVP 4LGWA 1XA1A 1ES3A 4CQHA 4X68A 2Y91A 3CJMA 1NZOA 1IYOA 4K91A 4FTXA 3D72A 1XP4A 5DFYA 3KSIA 4LRXC 3N7WA 3BYDA 1PRQA 3L7HA 2PYPA 2WGIA 3WS0A 3LYXA 5FAQA 1W63Q 5EFWA 5JYPA 2HP5A 4X1MA 4WMCA 3MBZA 5A93A 2GX5A 4Y15A 4Y3IA 3A0RA 2KOIA 5DKKA 3UB5P 1K4EA 5EOOA 3V67A 2J9PA 3M6BA 1OJGA 1TS0A 1BZAA 2PHYA 2VV8A 1OT9A 2WAFA 5FSRA 3QNCA 3LIEA 5FQKA 5HD5A 3ZYTA 3T4SA 1LL9A 4FD8A 2P9VA 1EW0A 3DWZA 1V9YA 3U4LP 2GNXA 2OOLA 2Y2LA 4MBHA 3HJKA 1N4OA 5CTMA 3EQVA 2VZWA 3LEZA 1PZPA 4KZ7A 2E8IA 3MZFA 1PI5A 4Q8IA 3W4QA 1STZA 3IBJA 1YLTA 2QMIA 3O87A 2WK0A 3VSLA 4OPRA 2WZZA 4N1HA 4RX2A 3MZEA 3UE1A 3N8RA 4B4XA 1S1YA 4QWOA 4R23A 2KX6A 4HIAA 2OV5A 1ZTUA 5FQMA 5TBMA 4KQQA 4RYEA 1ERQA 1YLYA 5FL3A 3HLWA 3KSFA 1JWPA 5F68A 2UWXA 3SS3A 2RL3A 3HREA 1UWNX 5G18A 4IBRA 2VGLS 4BQMA 2XROA 3E4PA 2V20A 2Z6CA 1H5XA 3IHBA 3E98A 2ZQDA 2B95A 2Y2HA 2PT7A 4OLGA 3EEAA 2H5SA 4XUZA 3H82A 4PM5A 3ZQ5A 4U0XA 3ZGAB 1CI8A 1W8QA 1YMXA 3FPWA 1S4SA 3HUOA 2I72A 5GLBA 4CLCA 1HZOA 4MBFA 3A3FA 3LGOA 1KGGA 3KSGA 4OPZA 4MLLA 2DNSA 3BM6A 1NLYA 2ZC7A 1MWTA 2HPBA 2JKRI 1C3BA 1PWCA 3M2KA 3ZFZA 1WYBA 2O9CA 1OTBA 1FCMA 1KOUA 2GZAA 5AQAA 3JPUA 5IHVA 4X6TA 3IWQA 2J7VA 3S7OA 5HPIA 4I3AA 1ZHHB 3LY3A 4WEJA 3PBQA 4QJGA 5HWVA 1J3WA 1OPXA 3A0VA 2VJWA 4RVAA 1XJ2A 1T19A 3BFDA 2GJ3A 3WS4A 3BQAA 4ZRRA 5FI6A 3JVUA 4DKIA 2WZXA 3IT9A 3UE6A 5A90A 3RXXA 4NEED 1PNEA 5HL1A 4DJ3A 3NDEA 2EX6A 2ZM8A 1KGFA 2ZQAA 2OWHA 2ZBBA 3ITAA 4M3KA 2ZM0A 1E3UD 1XA7A 4MBKA 2V1BA 2PU2A 1YM1A 5EPHA 1T1BA 1VEUB 3TOIA 3PBOA 5DKLA 1M6KA 2HGVA 4ZBEA 1NRJA 3H7WB 3NOPC 2QJ7A 4QY5A 4S2KA 2Q9NA 1CJFA 3P98A 1K4FA 1LSWA 1FOFA 3E4OA 2JKFA 4KZAA 3IWIA 1O07A 1SDEA 2PR5A 2ZMAA 1S1ZA 5JYOA 1IKGA 3VOZA 1PW1A 5G4YA 3IF6B 1T1AA 3EGDC 1IYQA 4GS9B 4O7DA 2HP9A 1YSPA 2IWCA 2IWDA 4UHUA 4A5RA 3TRCA 5M1AA 3CLOA 4WUJA 4BJPA 2HJ9C 4O8GA 4D60A 2W3FA 3BW6A 4ZDXA 3O88A 1ESIA 1LHYA 4EUVA 2B02A 4S2NC 3KYEA 4R3JA 2D01A 4UQIM 4HBUA 5E2EA 5FDSA 4R38A 3IH9A 1YLWA 5HARA 3G32A 4PM7A 2ZL1B 4HH3A 5I5LA 3PR6A 5DJUA 4KUKA 4Z9QA 1W79A 4WM9A 2Y2MA 2CC1A 3UB8A 4N9LA 4WBGA 3QP1A 5CECA 3UPOA 3PBRA 3F1NA 3RFBA 1ES4A 4JGQA 3T4LA 3V3RA 2DMWA 2M7VA 1IKIA 1K6RA 3C4PA 3WWXA 2NUTC 2H10A 1T1CA 4JXVA 4FCFA 4EW7A 3EEHA 4NKPA 2YKHA 3Q1FA 3C8CA 1FCOA 1TS8A 3BRMA 4RX3A 3A3DA 4JF5A 2BTFP 3LI9A 5CHMA 5KMWA 3SH7A 3FKVA 3LEQA 3SW1A 4Y0UA 1KVMA 3LR4A 3PAGA 3FV7A 3HUMA 2Y79A 2A2LA 1K54A 3VFHA 2Y2PA 1MXOA 2XH9A 3FYZA 4E3JA 1S6RA 4MN7A 5HL6A 3IHAA 4MN5A 3MXRA 4B93A 3KX0X 3P7NA 5EVIA 1DJBA 2P04A 1P0ZA 3H9WA 2HDRA 3CUEC 3IX3A 4LRYC 3ZVTA 4LFUA 3AGEA 1W7FA 2I9VA 1BLSA 3UE3A 4E6XA 3NOTC 2OLUA 2XR0A 3BY8A 4JF6A 1YT4A 1N9LA 3ZCZA 3MZDA 5E43A 5EVID 2R9WA 3HJIA 4R4SA 4AFIA 3OCNA 4BBVA 3MJQA 4E3KA 4OQHA 4DRTA 4E6WA 3QP5A 5EVLA 3TE8A 1FSWA 4WELA 2PYRA 4LV2A 3A3JA 4OPQA 4E3MA 3BLMA 3AGDA 3HL9A 2PDRA 4OOMA 2Y2KA 3LFVA 2Z6DA 5EV0A 1VM1A 4S2JA 4QB8A 3BECA 3G2ZA 3O5YA 2XK1A 4S2PA 2Y2OA 4GLQA 3N6IA 1ONHA 1XKZA 4B4ZA 3N4IA 2EFUA 4GCZA 5AQBA 3FC7A 1N9BA 1W63M 2B18A 4OKPA 1MY8A 3LIBA 4DDYA 3S1YA 3E2LA 2HDUA 3C38A 1KDSA 1W8YA 3G31A 3W4OA 1K38A 2P9VB 3V39A 1VETA 4X53A 3SZTA 4MMNA 2O0YA 1G6AA 3IS2A 4P6ZS 2PRFA 1ALQA 3T1SA 3BY9A 5FQ9A 4LPZA 5CGWA 5CEBA 3NHQA 1OTAA 1D7EA 1VQQA 4BL2A 3UDIA 1TDGA 2O99A 3FWLA 1HLUP 4KZ3A 3O86A 1NYMA 5EE8A 2Y8HA 1BTLA 4ARZA 1FIKA 3F1PB 3JYIA 4BWIA 4GDBA 1BSGA 2WKPA 5E2FA 3UN7A 4NXEA 1WE4A 2PD7A 3S7NA 1K57C 1K55C 1LSXA 2QHKA 3GDIA 2ZQ7A 4C3QA 4EU0A 4X56A 4IBXA 1XPBA 2L1MA 3HLFA 4O01A 5BOHA 4MNRA 4GD8A 4Q0IA 1TD5A 5K5BA 1OJ5A 3SH9A 2JHEA 1NJ4A 3NIAA 1L0FA 4BMWA 4PM8A 4LV1A 1Q2QA 1SKFA 1IYSA 1MWRA 4GJ4A 5AVFA 2QZ6A 1K6SA 5HAQA 2ZOIA 1HVBA 3UMDA 3HUNA 5CERA 3IF6A 2M1CA 1GSXA 3C2WA 4PM9A 2KDKA 4GS9A 5F5YA 1EWZA 3SOIA 4KENB 1CQAA 4JXWA 3ZHHA 1MKIA 3V3SA 2FFYA 2XA7S 3GQZA 4NXGA 2XFSA 4Q0JA 4XUXA 4KQDA 4IUHA 3GVBA 3ZG7B 3HLCA 4WN5A 4LENA 1NLZA 3GR2A 5GL9A 1JWVA 2MJ6A 3DTIA 1M40A 3G34A 3S4XA 1YLJA 3Q7VB 3GMWA 1I2SA 4JBFA 3IH8A 4BENA 3KO6A 2V0WA 3OZHA 1NY0A 3C30A 2P08A 1D1JA 1G6OA 1OTDA 2HDSA 2LB5A 2K2NA 2M7UA 4IVIA 3C4OA 1V9ZA 1GA9A 5C5KA 3IXDA 4ID4A 4Y13A 2JKGA 5A91A 4U0TA 4YINA 3NY4A 3NDGA 2X71A 1IFQA 5FQJA 2EXBA 5L8MA 2V9AA 4WYYA 4R3BA 5TR7A 3ISGA 3IS2B 2IA2A 4KZ8A 3PXPA 5FQQA 2ZQ8A 1VEUA 4BLMA 3GTCA 3MXSA 2WYXA 3EGXC 2W1TA 2EFXA 1Q2PA 2Y2IA 4WEKA 4I3IA 4KZBA 1KE3A 1RCJA 3K3CA 2XEPA 3UDFA 3SS4A 1L3LA 1XX2A 1KGEA 4R70A 5EVIB 4IVKA 4XT2B 3B3XA 4KZ5A 3GRJA 3CMZA 4H8RA 4Y0TA 4I38A 3UPNA 4JGPA 1F2KA 2VX8A 5G4ZA 2FZ0A 3P01A 4DDSA 2JC7A 5CGSA 1DP8A 1JTGA 3QP2A 1OTEA 1K25A 4S2IA 4GZBA 1JVJA 3DTKA 3FPVA 3U2AA 4WZ5C 1FILA 5FASA 1ZG4A 1WA9A 2W3HA 5J4EA 2KLIA 4JPMA 2PBDP 5HZHA 2EWVA 2VV7A 4KQOA 2VV6A 4P0MA 1H3QA 4MDZA 3DBAA 1S0WA 4Y7PA 5GHYA 3VFFA 1U60A 5EVEA 4LCLA 4HHDA 3KYZA 2VGLM 1RGZA 1BUEA 2VEAA 5DVAA 1BULA 3A3IA 4ME4A 4WF0A 2ZJ9A 4GD6A 2WKEA 4X25A 4Q0HA 2EX2A 2LB9A 1BLHA 1MZUA 3E0YA 5CHJA 3ZDJA 5HAIA 2G2WA 4ZAMA 3EWKA 3R7WA 2XSSA 3DTEA 1VB6A 1YAXA 5F69A 3Q82A 4JKTA 3MFDA 4EBPA 1ACFA 4L9GA 2ZLYA 3ZG5A 3T12B 3MMHA 3ZG9B 4EV4A 1N9NA 5TGFA 4DN0A 5DF8A 1DY6A 2V0UA 3BQ8A 4HQAA 4BBUA 1GSWA 2OWJA 4HBTA 3VOYA 1ES5A 2QJ5A 1ONGA 3UB9A 1XGJA 2ACGA 3F1PA 3OOVA 2C5WB 2W27A 2W1RA 5EVIC 3CPTA 3ZVWA 4PHTA 4DF6A 3HLDA 1MBLA 3LICA 4R3AA 3ITBA 5CRFA 5U47A 2ZMFA 2Y59A 2HJEA 4UA9A 1K55A 4NK3A 2R78A 2EA9A 3L9KA 1LT0A 2ZC3B 5A92A 1WYCA 2L4RA 3KSHA 3SS5A 4OLDA 1XJ3A 4EUZA 1QMEA 3LIDA 2NUPC 4EERA 3LI8A 4JF4A 4C75A 3ZNTA 1XJ6A 5EECA 1TEMA 4NXBA 3V5MA
chains in the Genus database with same CATH topology
3C38A 1STZA 3IBJA 3MXQA 2J3TC 2XRNA 3EQUA 1S1YA 5F6AA 2WKQA 2KX6A 4HIAA 5HD3A 4MMNA 2O0YA 1ZTUA 5J7EA 3IS2A 4P6ZS 2W3EA 4YOFA 3F1OB 5TBMA 3BY9A 5IS1A 1LL8A 4LPZA 3VE3A 3NHQA 1G28A 1OTAA 1D7EA 5FL3A 3KSFA 2O99A 2W0NA 1JNUA 4PKYA 5DJTA 2QYBA 4HI4A 5F68A 3S7PA 3T50A 2Y8HA 4YNRA 4ARZA 1UWNX 3VE4A 5IT5A 3F1PB 1Y28A 4CLCB 1P9RA 2VGLS 4F3LA 2XROA 4BWIA 3E4PA 3IBRA 2WKPA 4LRZE 2Z6CA 1YSQA 4NXEA 2PD7A 3S7NA 3E98A 2ZOHA 3B42A 1LSXA 2QHKA 3GDIA 3ULFA 4E04A 3R4KA 2PT7A 3EEAA 4EU0A 2JKTI 2OAP1 2YKFA 3H82A 1TF1A 5IU1A 2A24A 3HCYA 1MC0A 3ZQ5A 2L1MA 2K7SA 4O01A 2JKTM 4Q0IA 1TD5A 4ARZB 4PAUA 5K5BA 1OJ5A 2JHEA 3FPWA 1S4SA 1TS6A 3VOLA 4BMWA 4CLCA 4PKYG 4WL9A 3LIFA 4H6JA 4FSFA 4MN6A 1XFNA 3KSGA 3MQ0A 4L0LA 4DMZA 3CWFA 3KYQA 4GJ4A 3K3DA 5AVFA 2ZOIA 3UMDA 1NLYA 1F5MA 2M1CA 5J3WA 1GSXA 4LLOB 3C2WA 1T18A 2KDKA 4GS9A 2JKRI 4HH2A 5F5YA 2INWA 3OBFA 5HDDA 2O9CA 1OTBA 4IUKA 1KOUA 3T4OA 4Y5FA 2GZAA 2VKSA 3NOUC 3UB7A 3EOIA 1UWPX 3OCLA 3S7OA 1S67L 5HPIA 4I3AA 2XA7S 1ZHHB 5HDSA 4WEJA 4NXGA 1DP6A 4HY8A 3TJZC 3A0SA 4CLCD 4Q0JA 3PBQA 5HWVA 4KQDA 4IUHA 1OPXA 3A0VA 2VJWA 4GW9A 1XJ2A 4WN5A 4EESA 1NLZA 1T19A 2MJ6A 4XT2A 2GJ3A 4P6ZM 4WLAA 1BYWA 3BQAA 3UMEA 1DP9A 3LUQA 4ZRRA 4B9OA 3JVUA 3KO6A 4EXOA 2V0WA 4K08A 3C30A 4GHIB 4FOFA 2P08A 3UE6A 1G6OA 2W3DA 1OTDA 4NEED 2LB5A 1VHMA 2K2NA 2J3TD 4DJ3A 2M7UA 4HP9A 2OAQ1 1V9ZA 4HJ6A 2OWHA 2ZBBA 1NWZA 1GSVA 2V1BA 4F3LB 3GECA 5C5KA 1MKMA 1N9OA 3H82B 4HNBA 2QKPA 1T1BA 2J3WA 4YWZA 4UEYA 3BWLA 2H28A 3PBOA 1XFQA 3B47A 5DKLA 4EEPA 4GHIA 2G7UA 2FH5A 1IFQA 2HGVA 1IOUA 1ODVA 1NRJA 3H7WB 3NOPC 5L8MA 2QJ7A 2V9AA 3PYPA 2D02A 2K31A 3LR0A 3RTYA 2P7JA 2QWSA 1LSWA 3MQQA 3E4OA 4UQIS 3IS2B 4EETB 2IA2A 2PR5A 3PXPA 1S1ZA 1TS7A 4G3WA 4L9EA 5AVEA 4M4XA 3MFXA 2J80A 5G4YA 1T1AA 3EGXC 3EGDC 2W1TA 4GS9B 4RQ9A 1YSPA 4I3IA 4WEKA 3R7WB 3TRCA 3CLOA 4WUJA 4BJPA 4IHQA 1OTIA 3K3CA 2HJ9C 3B33A 2O9BA 2W3GA 2VLGA 4O8GA 4R70A 3TW8A 4Y2FA 4L9FA 4XT2B 1H8MA 2HF6A 3K2NA 2W3FA 2ZMVA 3BW6A 4DJ2A 2XA7M 4I38A 4EUVA 4Z1WA 3F1NB 2B02A 4G3KA 4JGPA 2JKRM 2V1AA 2W1TB 2VX8A 4O0PA 5G4ZA 2FZ0A 4II7A 2D01A 2WKRA 4UQIM 2A24B 3RH8B 3P01A 4R38A 3ICYA 1S4RA 1DP8A 4HH3A 5I5LA 3PR6A 5DJUA 1OTEA 4KUKA 4H6JB 4JGRA 4HJ3A 3UB8A 3FPVA 3U2AA 4OOLA 3S7QA 5LBRA 3PBRA 3F1NA 4KUOA 3W2ZA 1WA9A 3RFBA 4JGQA 4QPRA 3VV4A 3UB6A 2BASA 4EQ1A 3T4LA 2W3HA 5J4EA 5KIZA 2KLIA 2DMWA 4I3JA 5HZHA 2EWVA 2M7VA 3MF0A 4G3VA 4I5SA 4MCWA 3PBSA 2VV7A 4KQOA 5DFXA 2VV6A 1OT6A 2NUTC 1H3QA 4HP4A 4MDZA 3PBNA 3DBAA 3JVVA 1T1CA 2CMNA 4EW7A 4HHDA 3EEHA 4NKPA 2YKHA 3KYZA 3H7WA 5TJJA 2VGLM 3C8CA 1TS8A 2VEAA 5HWTA 3CITA 3CAXA 4ME4A 3G6OA 2VA0A 4WF0A 4I39A 3OC2A 4Q0HA 3LI9A 2LB9A 2PD8A 5DF9A 1F98A 3SW1A 4HJ4A 1MZUA 5A8BA 3E0YA 3T4TA 3OLOA 4EEUA 1XJ4A 1P9WA 3EWKA 3LR4A 3R7WA 2XSSA 3E4QA 3LR5A 2Y79A 4IJGA 4R6LA 5CX7A 1VB6A 1X0OA 1YKDA 2A2LA 1YAXA 5F69A 3T4QA 4BBTA 3NJAA 4L9GA 4MN7A 4ETXA 1UGUA 5HL6A 5KSHA 4MN5A 5HWWA 3MMHA 4B93A 3F1OA 2O9AA 3PHYA 3KX0X 3P7NA 3BJNA 1N9NA 1LSVA 4DN0A 4CLCC 2P04A 1P0ZA 2PR6A 3H9WA 3FG8A 3CUEC 4LRYC 2HV1A 2V0UA 2JN7A 3BQ8A 4HQAA 4BBUA 1GSWA 2OWJA 5HSQA 3LIAA 4HOIA 3T4KA 2QJ5A 1D06A 3UB9A 5AJGA 4CQHA 3F1PA 2I9VA 3MR0A 3OOVA 1DRMA 2W27A 3UE3A 3CI6A 5MC7A 3NOTC 2W1RA 3BY8A 3D72A 3D3OA 5DFYA 1N9LA 3KSIA 4LRXC 2PYPA 3HJIA 4PHTA 3LYXA 3CUEA 1W63Q 4AFIA 5EFWA 3LICA 4R3AA 3OCNA 4BBVA 3MJQA 2GX5A 4Y3IA 3TE8A 3A0RA 4WELA 2KOIA 2ZMFA 5DKKA 2PYRA 2HJEA 5HDCA 3V67A 1OJGA 1P97A 1TS0A 2PDRA 2R78A 4JGOA 2PHYA 4OOMA 3LFVA 2EA9A 2VV8A 1OT9A 2Z6DA 1LT0A 4NXFA 2L0WA 3LIEA 5HD5A 3ZYTA 3T4SA 3O5YA 2L4RA 3KSHA 4ETZA 1XJ3A 1EW0A 5HPFA 1V9YA 4GLQA 2GNXA 2OOLA 3LIDA 2NUPC 3HJKA 3T4JA 3EQVA 2VZWA 4EERA 2EWWA 3LI8A 4GCZA 1S66L 1F9IA 3FC7A 3PBTA 5TBMB 1W63M 1XJ6A 4CLCE 2B18A 3MQOA 3LIBA 4NXBA 3LR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W1T A;  2O9C A;  4IUK A;  1YKD A;  4RQ9 A;  4Y5F A;  1YSP A;  1STZ A;  3IBJ A;  2VKS A;  3TRC A;  3NOU C;  3S7O A;  5HPI A;  2O9B A;  4MN7 A;  2W3G A;  4O8G A;  4ETX A;  4R70 A;  5HL6 A;  4Q0J A;  2XRN A;  4Y2F A;  4IUH A;  3MMH A;  2O9A A;  4MMN A;  2O0Y A;  2VJW A;  3BJN A;  4GW9 A;  1ZTU A;  3K2N A;  2W3F A;  4DN0 A;  2W3E A;  4YOF A;  4EUV A;  4Z1W A;  4LRY C;  4G3K A;  5HSQ A;  3NHQ A;  2W1T B;  4O0P A;  3KSF A;  5AJG A;  4ZRR A;  4CQH A;  3KO6 A;  2O99 A;  2QYB A;  3OOV A;  3S7P A;  3CI6 A;  2Y8H A;  4FOF A;  3NOT C;  2W1R A;  4YNR A;  2W3D A;  3D3O A;  5I5L A;  5DFY A;  3KSI A;  4LRX C;  2LB5 A;  1VHM A;  2K2N A;  2M7U A;  2XRO A;  4BWI A;  3IBR A;  4LRZ E;  3S7Q A;  1YSQ A;  5LBR A;  3S7N A;  3W2Z A;  2GX5 A;  3E98 A;  3RFB A;  4Y3I A;  5C5K A;  1MKM A;  4QPR A;  3VV4 A;  2KOI A;  2ZMF A;  4E04 A;  2W3H A;  3R4K A;  2KLI A;  3EEA A;  4EU0 A;  2M7V A;  3MF0 A;  4G3V A;  4MCW A;  1TF1 A;  5DFX A;  3HCY A;  1MC0 A;  3ZQ5 A;  3LFV A;  4O01 A;  4R6L A;  2G7U A;  4MDZ A;  2HGV A;  4Q0I A;  1TD5 A;  3DBA A;  4PAU A;  5K5B A;  3NOP C;  5L8M A;  2K31 A;  3O5Y A;  3KSH A;  4ETZ A;  5TJJ A;  3KSG A;  3MQ0 A;  2VEA A;  5HPF A;  4GLQ A;  4DMZ A;  2OOL A;  3CIT A;  4ME4 A;  3G6O A;  4Q0H A;  2VZW A;  2IA2 A;  2LB9 A;  1F5M A;  4G3W A;  3C2W A;  3E0Y A;  2B18 A;  3OBF A;  2XSS A;  2Y79 A;  4IJG A; 
#chains in the Genus database with same CATH topology
 4DE1 A;  3GSG A;  1FSY A;  3MXQ A;  4P6B A;  2J3T C;  1LLB A;  4PM6 A;  2OLV A;  5AQ7 A;  4JLF A;  5L09 A;  2WKQ A;  5HD3 A;  1ZC2 A;  3O3V A;  3MS6 A;  2W3E A;  1DJA A;  1O7E A;  2QPN A;  5EOE A;  3VE3 A;  4JXS A;  2BLS A;  2W0N A;  1JNU A;  4PKY A;  5DJT A;  2IWB A;  4HI4 A;  1CEG A;  2G2U A;  5D3O A;  3VE4 A;  1VET B;  1E25 A;  2XLN A;  1MWS A;  4XXR A;  5FA7 A;  4LRZ E;  3IF5 A;  1YSQ A;  1SHV A;  1PZO A;  5DTK A;  4E04 A;  1TDL A;  2JKT I;  5FAP A;  2OAP 1;  3NCK A;  1GCE A;  2EX8 A;  4P87 A;  2WGW B;  4LV0 A;  4UA7 A;  1MC0 A;  2K7S A;  5GLD A;  1FQG A;  2JKT M;  3S22 A;  4ARZ B;  5CED A;  4D2O A;  5GHX A;  3QP6 A;  1HD8 A;  4E3O A;  3QHY A;  4H6J A;  2HP6 A;  4MN6 A;  2UV0 E;  1CEF A;  3BFE A;  3G2Y A;  4R4R A;  3CWF A;  3K3D A;  3IWO A;  1K57 A;  1K56 A;  1F5M A;  5J3W A;  4LLO B;  1T18 A;  2INW A;  4UA6 A;  1SCW A;  4R1G A;  2ZD8 A;  3T4O A;  1BT5 A;  4KG2 A;  2VKS A;  4JXG A;  1IEM A;  3N8S A;  3NOU C;  3EOI A;  1S67 L;  4QD4 A;  5CHU A;  1LI9 A;  1DP6 A;  2ZQ9 A;  1GHI A;  3LY4 A;  5HFO A;  2VGK A;  2C6W B;  4EES A;  2HDQ A;  1PIO A;  3OPH A;  1ERO A;  4P6Z M;  4WLA A;  1J9M A;  2V2F F;  2XDM A;  2WAE A;  5GHZ A;  4ZJ2 A;  5EM0 A;  4GHI B;  1L0G A;  3PAE A;  2W3D A;  3M2J A;  5HX9 A;  4HP9 A;  2OAQ 1;  4KZ6 A;  4ZJ1 A;  3VP0 A;  4Y17 A;  3RXW A;  5M19 A;  1GSV A;  4F3L B;  1SKO B;  4GDN A;  4LV3 A;  2EXA A;  3H82 B;  2QKP A;  4WZ5 A;  2J3W A;  4YWZ A;  4BD0 A;  2ZC5 B;  2H28 A;  1XFQ A;  3B47 A;  5EM1 A;  2XGN A;  1Z6F A;  4EEP A;  2G7U A;  1IOU A;  4RA7 A;  3PYP A;  5L07 A;  2K31 A;  3LR0 A;  3TG9 A;  1AXB A;  3RTY A;  2AVX A;  1K54 C;  2P7J A;  4CPK A;  3MQQ A;  4UQI S;  4HES A;  4NG2 A;  4EET B;  3RJU A;  3D4F A;  1E3U A;  3HLE A;  4DXC A;  5AVE A;  4M4X A;  1CI9 A;  2XQZ A;  5AQ9 A;  2Q0O A;  1PWD A;  3UO9 A;  1H8Y A;  4RQ9 A;  3HLG A;  1OTI A;  3Q81 A;  4U3T A;  3UPP A;  2O9B A;  2VLG A;  1G5U A;  3TW8 A;  4Y2F A;  4L9F A;  2HF6 A;  1PW8 A;  2EX9 A;  4Z1W A;  4PPR A;  5GLC A;  3G35 A;  2JKR M;  2V1A A;  5HAP A;  3LCE A;  2W1T B;  4S2M A;  3CPT B;  3G30 A;  1BLC A;  2WGW A;  4OPY A;  3RH8 B;  4DE0 A;  4OH0 A;  2J9O A;  1S4R A;  5F1F A;  1ESU A;  4H6J B;  4FH2 A;  4JGR A;  4HJ3 A;  4DXB A;  1G68 A;  4OOL A;  2V8C A;  3IXB A;  5DTS A;  3CG5 A;  4KUO A;  4P85 A;  2BAS A;  4EQ1 A;  1OME A;  4OQI A;  5KIZ A;  2X02 A;  4GB7 A;  4I5S A;  4MCW A;  4Y0O A;  4HP4 A;  3PBN A;  1PI4 A;  1Y4O A;  3IQA A;  2CMN A;  2V8F A;  1PFL A;  1GHM A;  5TJJ A;  3HLB A;  5HWT A;  3FKW A;  3CIT A;  3CAX A;  4E3N A;  4I39 A;  3NUL A;  5E2H A;  2DRW A;  3UE0 A;  5J8X A;  3D9Y A;  4EBN A;  3W4P A;  5F82 A;  4OQG A;  1LL5 A;  5A8B A;  2JCH A;  3T4T A;  3E4Q A;  5CX7 A;  3MKF A;  4OP8 A;  3C5A A;  3ZNY A;  3NC8 A;  3E2K A;  3NJA A;  3BFC A;  1ZKJ A;  2P74 A;  3VP4 A;  4ETX A;  4N9K A;  1IYP A;  3PHY A;  3BJN A;  2PR6 A;  3FG8 A;  1YQS A;  2BG1 A;  5KSC A;  2XD5 A;  5I94 A;  1L2S A;  4HEF A;  1D06 A;  5AJG A;  2Y2N A;  4QHC A;  3MR0 A;  5MC7 A;  1DRM A;  3CI6 A;  4QY6 A;  3D3O A;  1XGI A;  1YMS A;  2ZC6 B;  3CUE A;  4S2N A;  1MPL A;  5GLA A;  1QMF A;  5HDC A;  3UDX A;  4OVD A;  4KZ4 A;  2PBY A;  1P97 A;  4YFM A;  4DE3 A;  5FI7 A;  4JGO A;  4S2O A;  5CGX A;  4QU3 A;  2Y2Q A;  4NXF A;  2OSU A;  2L0W A;  3WS5 A;  5FDH A;  1K56 D;  3MKE A;  1GA0 A;  4ETZ A;  5HPF A;  5M18 A;  3SH8 A;  3T4J A;  2RCX A;  3M6H A;  4OQ0 A;  2EWW A;  3OPR A;  1S66 L;  1F9I A;  3PBT A;  5TBM B;  4ZJ3 A;  2WUQ A;  4CLC E;  5KZH A;  1Z09 A;  1ZG6 A;  3MQO A;  3LR3 A;  4EWF A;  1KE4 A;  3Q7Z A;  3OPP A;  3WRT A;  5FAT A;  3BEB A;  1I2W A;  2XRN A;  2V1Z A;  3EQU A;  5F6A A;  1SDN A;  5J7E A;  4YOF A;  3BLS A;  3F1O B;  5IS1 A;  1LL8 A;  2J8Y A;  1RP5 A;  1PWG A;  2ZM2 A;  5FEF A;  3HBR A;  2Y2J A;  1G28 A;  4KG6 A;  4X1L A;  3VP3 A;  1EI5 A;  3BFG A;  2QYB A;  3S7P A;  1I5Q A;  3T50 A;  4YNR A;  5IT5 A;  3WRZ A;  1GHP A;  1DJC A;  2H0T A;  4BL3 A;  1Y28 A;  4CLC B;  1P9R A;  4F3L A;  4EQI A;  1SKO A;  3IBR A;  4ZTK A;  3IX8 A;  4GKU A;  3DTM A;  1JWZ A;  4GN2 A;  3T1Q B;  2XF3 A;  3MSH A;  1IEL A;  2JE5 A;  2ZOH A;  3B42 A;  3ULF A;  1E4D A;  5L10 A;  3R4K A;  3C7V A;  2YKF A;  1TF1 A;  5IU1 A;  2A24 A;  3HCY A;  2Z2L B;  3VMA A;  4PAU A;  1LI0 A;  2R9X A;  1RGY A;  3CZD A;  1TS6 A;  3VOL A;  4PKY G;  4WL9 A;  3LIF A;  4FSF A;  1XFN A;  3MQ0 A;  4L0L A;  3P09 A;  4DMZ A;  1Y54 A;  3KYQ A;  1MWU A;  4N92 A;  3TSG A;  2WKI A;  4DE2 A;  2VGJ A;  3VSK A;  2XD1 A;  4HH2 A;  1KVL A;  3OBF A;  5FI2 A;  4R0Q A;  5DTT A;  5HDD A;  4IUK A;  4E3L A;  3T1X A;  4Y5F A;  3UB7 A;  1UWP X;  3OCL A;  4KG5 A;  5HDS A;  3DWK A;  2DCF A;  4HY8 A;  3TJZ C;  3A0S A;  2ZC4 B;  1PYY A;  3LO7 A;  3VP2 A;  4CLC D;  4GW9 A;  2Q9M A;  1TVF A;  4KZ9 A;  4BD1 A;  4XT2 A;  1KDW A;  2B5R A;  3IXH A;  4WZ4 A;  4LCM A;  1BYW A;  3Q07 A;  3UME A;  1DP9 A;  3LUQ A;  4X69 A;  3UNW A;  4B9O A;  5HW3 A;  2JBF A;  5EUA A;  4EXO A;  4OON A;  4K08 A;  4FOF A;  4IED A;  5CXW A;  5DF7 A;  1VHM A;  3T1R A;  3FZC A;  2J3T D;  2X01 A;  4HJ6 A;  4C6Y A;  1NWZ A;  1NYY A;  2WGV A;  1W5D A;  3GEC A;  3QP8 A;  1MKM A;  1N9O A;  4HNB A;  2Y2G A;  2H0Y A;  4UEY A;  3BWL A;  3GV9 A;  2A3U A;  4NET A;  1JTD A;  1L0E A;  3CHW P;  2Y55 A;  4GHI A;  2FH5 A;  3QP4 A;  1ODV A;  2A49 A;  2Y4A A;  4F94 A;  2D02 A;  4WMC D;  2QWS A;  4K0W A;  2XFT A;  3NI9 A;  5FEG A;  4MEZ A;  3N8L A;  5CTN A;  3DW0 A;  1TS7 A;  4G3W A;  4L9E A;  2WKH A;  1ES2 A;  3MFX A;  2J80 A;  4FUW A;  2E8J A;  3R7W B;  3WS1 A;  1YLZ A;  4IHQ A;  3WS2 A;  2ZL1 A;  3C7U A;  3B33 A;  4EBL A;  2W3G A;  3IX4 A;  4N1X A;  1H8M A;  3K2N A;  2ZMV A;  4DJ2 A;  2XA7 M;  2Z2M B;  3Q7V A;  3F1N B;  2GDN A;  4G3K A;  1L0D A;  1NXY A;  3OPL A;  2HZ5 A;  4O0P A;  1YLP A;  1ERM A;  4II7 A;  2WKR A;  2A24 B;  3AGF A;  3ICY A;  5F83 A;  2ZQC A;  3VP1 A;  1KE0 A;  3BFF A;  1AWI A;  1CF0 A;  3NEC A;  2WAD A;  1XXM A;  2VK3 A;  3G4P A;  1H0M A;  1FR1 A;  3S7Q A;  1FCN A;  4FH4 A;  5LBR A;  3W2Z A;  4QPR A;  3VV4 A;  3UB6 A;  3QNB A;  4E3I A;  4B88 A;  4GOG A;  4I3J A;  3MF0 A;  5E2G A;  4G3V A;  3PBS A;  1K0K A;  1BLP A;  5DFX A;  1A0K A;  3DAV A;  4OOY A;  4OP5 A;  1OT6 A;  2PU4 A;  3JVV A;  1H8Z A;  5F1G A;  5L2F A;  1NZU A;  1FR6 A;  1CK3 A;  4CJN A;  3H7W A;  1YPR A;  2FFF B;  3NBL A;  3G6O A;  2VA0 A;  3I7J A;  3OC2 A;  1NRF A;  2PD8 A;  5DF9 A;  1F98 A;  4GNU A;  4HJ4 A;  5FAO A;  4EEU A;  3OLO A;  1XJ4 A;  1P9W A;  4S2L A;  3W8K A;  4KQR A;  5FQI A;  3LR5 A;  3A3E A;  4IJG A;  4R6L A;  1X0O A;  1YKD A;  4PMA A;  1HTZ A;  4K0X A;  3T4Q A;  4BBT A;  3ZG0 A;  3V50 A;  1SZV A;  3HVF A;  3PTE A;  1UGU A;  5KSH A;  5HWW A;  3F1O A;  2O9A A;  3IXG A;  4UAA A;  3UY6 A;  5TFQ A;  1LSV A;  4CLC C;  3IF6 C;  4ESP A;  3ZG8 B;  2HV1 A;  2JN7 A;  4X55 A;  5HSQ A;  3LIA A;  4HOI A;  3T4K A;  2PAV P;  4LGW A;  1XA1 A;  1ES3 A;  4CQH A;  4X68 A;  2Y91 A;  3CJM A;  1NZO A;  1IYO A;  4K91 A;  4FTX A;  3D72 A;  1XP4 A;  5DFY A;  3KSI A;  4LRX C;  3N7W A;  3BYD A;  1PRQ A;  3L7H A;  2PYP A;  2WGI A;  3WS0 A;  3LYX A;  5FAQ A;  1W63 Q;  5EFW A;  5JYP A;  2HP5 A;  4X1M A;  4WMC A;  3MBZ A;  5A93 A;  2GX5 A;  4Y15 A;  4Y3I A;  3A0R A;  2KOI A;  5DKK A;  3UB5 P;  1K4E A;  5EOO A;  3V67 A;  2J9P A;  3M6B A;  1OJG A;  1TS0 A;  1BZA A;  2PHY A;  2VV8 A;  1OT9 A;  2WAF A;  5FSR A;  3QNC A;  3LIE A;  5FQK A;  5HD5 A;  3ZYT A;  3T4S A;  1LL9 A;  4FD8 A;  2P9V A;  1EW0 A;  3DWZ A;  1V9Y A;  3U4L P;  2GNX A;  2OOL A;  2Y2L A;  4MBH A;  3HJK A;  1N4O A;  5CTM A;  3EQV A;  2VZW A;  3LEZ A;  1PZP A;  4KZ7 A;  2E8I A;  3MZF A;  1PI5 A;  4Q8I A;  3W4Q A;  1STZ A;  3IBJ A;  1YLT A;  2QMI A;  3O87 A;  2WK0 A;  3VSL A;  4OPR A;  2WZZ A;  4N1H A;  4RX2 A;  3MZE A;  3UE1 A;  3N8R A;  4B4X A;  1S1Y A;  4QWO A;  4R23 A;  2KX6 A;  4HIA A;  2OV5 A;  1ZTU A;  5FQM A;  5TBM A;  4KQQ A;  4RYE A;  1ERQ A;  1YLY A;  5FL3 A;  3HLW A;  3KSF A;  1JWP A;  5F68 A;  2UWX A;  3SS3 A;  2RL3 A;  3HRE A;  1UWN X;  5G18 A;  4IBR A;  2VGL S;  4BQM A;  2XRO A;  3E4P A;  2V20 A;  2Z6C A;  1H5X A;  3IHB A;  3E98 A;  2ZQD A;  2B95 A;  2Y2H A;  2PT7 A;  4OLG A;  3EEA A;  2H5S A;  4XUZ A;  3H82 A;  4PM5 A;  3ZQ5 A;  4U0X A;  3ZGA B;  1CI8 A;  1W8Q A;  1YMX A;  3FPW A;  1S4S A;  3HUO A;  2I72 A;  5GLB A;  4CLC A;  1HZO A;  4MBF A;  3A3F A;  3LGO A;  1KGG A;  3KSG A;  4OPZ A;  4MLL A;  2DNS A;  3BM6 A;  1NLY A;  2ZC7 A;  1MWT A;  2HPB A;  2JKR I;  1C3B A;  1PWC A;  3M2K A;  3ZFZ A;  1WYB A;  2O9C A;  1OTB A;  1FCM A;  1KOU A;  2GZA A;  5AQA A;  3JPU A;  5IHV A;  4X6T A;  3IWQ A;  2J7V A;  3S7O A;  5HPI A;  4I3A A;  1ZHH B;  3LY3 A;  4WEJ A;  3PBQ A;  4QJG A;  5HWV A;  1J3W A;  1OPX A;  3A0V A;  2VJW A;  4RVA A;  1XJ2 A;  1T19 A;  3BFD A;  2GJ3 A;  3WS4 A;  3BQA A;  4ZRR A;  5FI6 A;  3JVU A;  4DKI A;  2WZX A;  3IT9 A;  3UE6 A;  5A90 A;  3RXX A;  4NEE D;  1PNE A;  5HL1 A;  4DJ3 A;  3NDE A;  2EX6 A;  2ZM8 A;  1KGF A;  2ZQA A;  2OWH A;  2ZBB A;  3ITA A;  4M3K A;  2ZM0 A;  1E3U D;  1XA7 A;  4MBK A;  2V1B A;  2PU2 A;  1YM1 A;  5EPH A;  1T1B A;  1VEU B;  3TOI A;  3PBO A;  5DKL A;  1M6K A;  2HGV A;  4ZBE A;  1NRJ A;  3H7W B;  3NOP C;  2QJ7 A;  4QY5 A;  4S2K A;  2Q9N A;  1CJF A;  3P98 A;  1K4F A;  1LSW A;  1FOF A;  3E4O A;  2JKF A;  4KZA A;  3IWI A;  1O07 A;  1SDE A;  2PR5 A;  2ZMA A;  1S1Z A;  5JYO A;  1IKG A;  3VOZ A;  1PW1 A;  5G4Y A;  3IF6 B;  1T1A A;  3EGD C;  1IYQ A;  4GS9 B;  4O7D A;  2HP9 A;  1YSP A;  2IWC A;  2IWD A;  4UHU A;  4A5R A;  3TRC A;  5M1A A;  3CLO A;  4WUJ A;  4BJP A;  2HJ9 C;  4O8G A;  4D60 A;  2W3F A;  3BW6 A;  4ZDX A;  3O88 A;  1ESI A;  1LHY A;  4EUV A;  2B02 A;  4S2N C;  3KYE A;  4R3J A;  2D01 A;  4UQI M;  4HBU A;  5E2E A;  5FDS A;  4R38 A;  3IH9 A;  1YLW A;  5HAR A;  3G32 A;  4PM7 A;  2ZL1 B;  4HH3 A;  5I5L A;  3PR6 A;  5DJU A;  4KUK A;  4Z9Q A;  1W79 A;  4WM9 A;  2Y2M A;  2CC1 A;  3UB8 A;  4N9L A;  4WBG A;  3QP1 A;  5CEC A;  3UPO A;  3PBR A;  3F1N A;  3RFB A;  1ES4 A;  4JGQ A;  3T4L A;  3V3R A;  2DMW A;  2M7V A;  1IKI A;  1K6R A;  3C4P A;  3WWX A;  2NUT C;  2H10 A;  1T1C A;  4JXV A;  4FCF A;  4EW7 A;  3EEH A;  4NKP A;  2YKH A;  3Q1F A;  3C8C A;  1FCO A;  1TS8 A;  3BRM A;  4RX3 A;  3A3D A;  4JF5 A;  2BTF P;  3LI9 A;  5CHM A;  5KMW A;  3SH7 A;  3FKV A;  3LEQ A;  3SW1 A;  4Y0U A;  1KVM A;  3LR4 A;  3PAG A;  3FV7 A;  3HUM A;  2Y79 A;  2A2L A;  1K54 A;  3VFH A;  2Y2P A;  1MXO A;  2XH9 A;  3FYZ A;  4E3J A;  1S6R A;  4MN7 A;  5HL6 A;  3IHA A;  4MN5 A;  3MXR A;  4B93 A;  3KX0 X;  3P7N A;  5EVI A;  1DJB A;  2P04 A;  1P0Z A;  3H9W A;  2HDR A;  3CUE C;  3IX3 A;  4LRY C;  3ZVT A;  4LFU A;  3AGE A;  1W7F A;  2I9V A;  1BLS A;  3UE3 A;  4E6X A;  3NOT C;  2OLU A;  2XR0 A;  3BY8 A;  4JF6 A;  1YT4 A;  1N9L A;  3ZCZ A;  3MZD A;  5E43 A;  5EVI D;  2R9W A;  3HJI A;  4R4S A;  4AFI A;  3OCN A;  4BBV A;  3MJQ A;  4E3K A;  4OQH A;  4DRT A;  4E6W A;  3QP5 A;  5EVL A;  3TE8 A;  1FSW A;  4WEL A;  2PYR A;  4LV2 A;  3A3J A;  4OPQ A;  4E3M A;  3BLM A;  3AGD A;  3HL9 A;  2PDR A;  4OOM A;  2Y2K A;  3LFV A;  2Z6D A;  5EV0 A;  1VM1 A;  4S2J A;  4QB8 A;  3BEC A;  3G2Z A;  3O5Y A;  2XK1 A;  4S2P A;  2Y2O A;  4GLQ A;  3N6I A;  1ONH A;  1XKZ A;  4B4Z A;  3N4I A;  2EFU A;  4GCZ A;  5AQB A;  3FC7 A;  1N9B A;  1W63 M;  2B18 A;  4OKP A;  1MY8 A;  3LIB A;  4DDY A;  3S1Y A;  3E2L A;  2HDU A;  3C38 A;  1KDS A;  1W8Y A;  3G31 A;  3W4O A;  1K38 A;  2P9V B;  3V39 A;  1VET A;  4X53 A;  3SZT A;  4MMN A;  2O0Y A;  1G6A A;  3IS2 A;  4P6Z S;  2PRF A;  1ALQ A;  3T1S A;  3BY9 A;  5FQ9 A;  4LPZ A;  5CGW A;  5CEB A;  3NHQ A;  1OTA A;  1D7E A;  1VQQ A;  4BL2 A;  3UDI A;  1TDG A;  2O99 A;  3FWL A;  1HLU P;  4KZ3 A;  3O86 A;  1NYM A;  5EE8 A;  2Y8H A;  1BTL A;  4ARZ A;  1FIK A;  3F1P B;  3JYI A;  4BWI A;  4GDB A;  1BSG A;  2WKP A;  5E2F A;  3UN7 A;  4NXE A;  1WE4 A;  2PD7 A;  3S7N A;  1K57 C;  1K55 C;  1LSX A;  2QHK A;  3GDI A;  2ZQ7 A;  4C3Q A;  4EU0 A;  4X56 A;  4IBX A;  1XPB A;  2L1M A;  3HLF A;  4O01 A;  5BOH A;  4MNR A;  4GD8 A;  4Q0I A;  1TD5 A;  5K5B A;  1OJ5 A;  3SH9 A;  2JHE A;  1NJ4 A;  3NIA A;  1L0F A;  4BMW A;  4PM8 A;  4LV1 A;  1Q2Q A;  1SKF A;  1IYS A;  1MWR A;  4GJ4 A;  5AVF A;  2QZ6 A;  1K6S A;  5HAQ A;  2ZOI A;  1HVB A;  3UMD A;  3HUN A;  5CER A;  3IF6 A;  2M1C A;  1GSX A;  3C2W A;  4PM9 A;  2KDK A;  4GS9 A;  5F5Y A;  1EWZ A;  3SOI A;  4KEN B;  1CQA A;  4JXW A;  3ZHH A;  1MKI A;  3V3S A;  2FFY A;  2XA7 S;  3GQZ A;  4NXG A;  2XFS A;  4Q0J A;  4XUX A;  4KQD A;  4IUH A;  3GVB A;  3ZG7 B;  3HLC A;  4WN5 A;  4LEN A;  1NLZ A;  3GR2 A;  5GL9 A;  1JWV A;  2MJ6 A;  3DTI A;  1M40 A;  3G34 A;  3S4X A;  1YLJ A;  3Q7V B;  3GMW A;  1I2S A;  4JBF A;  3IH8 A;  4BEN A;  3KO6 A;  2V0W A;  3OZH A;  1NY0 A;  3C30 A;  2P08 A;  1D1J A;  1G6O A;  1OTD A;  2HDS A;  2LB5 A;  2K2N A;  2M7U A;  4IVI A;  3C4O A;  1V9Z A;  1GA9 A;  5C5K A;  3IXD A;  4ID4 A;  4Y13 A;  2JKG A;  5A91 A;  4U0T A;  4YIN A;  3NY4 A;  3NDG A;  2X71 A;  1IFQ A;  5FQJ A;  2EXB A;  5L8M A;  2V9A A;  4WYY A;  4R3B A;  5TR7 A;  3ISG A;  3IS2 B;  2IA2 A;  4KZ8 A;  3PXP A;  5FQQ A;  2ZQ8 A;  1VEU A;  4BLM A;  3GTC A;  3MXS A;  2WYX A;  3EGX C;  2W1T A;  2EFX A;  1Q2P A;  2Y2I A;  4WEK A;  4I3I A;  4KZB A;  1KE3 A;  1RCJ A;  3K3C A;  2XEP A;  3UDF A;  3SS4 A;  1L3L A;  1XX2 A;  1KGE A;  4R70 A;  5EVI B;  4IVK A;  4XT2 B;  3B3X A;  4KZ5 A;  3GRJ A;  3CMZ A;  4H8R A;  4Y0T A;  4I38 A;  3UPN A;  4JGP A;  1F2K A;  2VX8 A;  5G4Z A;  2FZ0 A;  3P01 A;  4DDS A;  2JC7 A;  5CGS A;  1DP8 A;  1JTG A;  3QP2 A;  1OTE A;  1K25 A;  4S2I A;  4GZB A;  1JVJ A;  3DTK A;  3FPV A;  3U2A A;  4WZ5 C;  1FIL A;  5FAS A;  1ZG4 A;  1WA9 A;  2W3H A;  5J4E A;  2KLI A;  4JPM A;  2PBD P;  5HZH A;  2EWV A;  2VV7 A;  4KQO A;  2VV6 A;  4P0M A;  1H3Q A;  4MDZ A;  3DBA A;  1S0W A;  4Y7P A;  5GHY A;  3VFF A;  1U60 A;  5EVE A;  4LCL A;  4HHD A;  3KYZ A;  2VGL M;  1RGZ A;  1BUE A;  2VEA A;  5DVA A;  1BUL A;  3A3I A;  4ME4 A;  4WF0 A;  2ZJ9 A;  4GD6 A;  2WKE A;  4X25 A;  4Q0H A;  2EX2 A;  2LB9 A;  1BLH A;  1MZU A;  3E0Y A;  5CHJ A;  3ZDJ A;  5HAI A;  2G2W A;  4ZAM A;  3EWK A;  3R7W A;  2XSS A;  3DTE A;  1VB6 A;  1YAX A;  5F69 A;  3Q82 A;  4JKT A;  3MFD A;  4EBP A;  1ACF A;  4L9G A;  2ZLY A;  3ZG5 A;  3T12 B;  3MMH A;  3ZG9 B;  4EV4 A;  1N9N A;  5TGF A;  4DN0 A;  5DF8 A;  1DY6 A;  2V0U A;  3BQ8 A;  4HQA A;  4BBU A;  1GSW A;  2OWJ A;  4HBT A;  3VOY A;  1ES5 A;  2QJ5 A;  1ONG A;  3UB9 A;  1XGJ A;  2ACG A;  3F1P A;  3OOV A;  2C5W B;  2W27 A;  2W1R A;  5EVI C;  3CPT A;  3ZVW A;  4PHT A;  4DF6 A;  3HLD A;  1MBL A;  3LIC A;  4R3A A;  3ITB A;  5CRF A;  5U47 A;  2ZMF A;  2Y59 A;  2HJE A;  4UA9 A;  1K55 A;  4NK3 A;  2R78 A;  2EA9 A;  3L9K A;  1LT0 A;  2ZC3 B;  5A92 A;  1WYC A;  2L4R A;  3KSH A;  3SS5 A;  4OLD A;  1XJ3 A;  4EUZ A;  1QME A;  3LID A;  2NUP C;  4EER A;  3LI8 A;  4JF4 A;  4C75 A;  3ZNT A;  1XJ6 A;  5EEC A;  1TEM A;  4NXB A;  3V5M A; 
#chains in the Genus database with same CATH homology
 3C38 A;  1STZ A;  3IBJ A;  3MXQ A;  2J3T C;  2XRN A;  3EQU A;  1S1Y A;  5F6A A;  2WKQ A;  2KX6 A;  4HIA A;  5HD3 A;  4MMN A;  2O0Y A;  1ZTU A;  5J7E A;  3IS2 A;  4P6Z S;  2W3E A;  4YOF A;  3F1O B;  5TBM A;  3BY9 A;  5IS1 A;  1LL8 A;  4LPZ A;  3VE3 A;  3NHQ A;  1G28 A;  1OTA A;  1D7E A;  5FL3 A;  3KSF A;  2O99 A;  2W0N A;  1JNU A;  4PKY A;  5DJT A;  2QYB A;  4HI4 A;  5F68 A;  3S7P A;  3T50 A;  2Y8H A;  4YNR A;  4ARZ A;  1UWN X;  3VE4 A;  5IT5 A;  3F1P B;  1Y28 A;  4CLC B;  1P9R A;  2VGL S;  4F3L A;  2XRO A;  4BWI A;  3E4P A;  3IBR A;  2WKP A;  4LRZ E;  2Z6C A;  1YSQ A;  4NXE A;  2PD7 A;  3S7N A;  3E98 A;  2ZOH A;  3B42 A;  1LSX A;  2QHK A;  3GDI A;  3ULF A;  4E04 A;  3R4K A;  2PT7 A;  3EEA A;  4EU0 A;  2JKT I;  2OAP 1;  2YKF A;  3H82 A;  1TF1 A;  5IU1 A;  2A24 A;  3HCY A;  1MC0 A;  3ZQ5 A;  2L1M A;  2K7S A;  4O01 A;  2JKT M;  4Q0I A;  1TD5 A;  4ARZ B;  4PAU A;  5K5B A;  1OJ5 A;  2JHE A;  3FPW A;  1S4S A;  1TS6 A;  3VOL A;  4BMW A;  4CLC A;  4PKY G;  4WL9 A;  3LIF A;  4H6J A;  4FSF A;  4MN6 A;  1XFN A;  3KSG A;  3MQ0 A;  4L0L A;  4DMZ A;  3CWF A;  3KYQ A;  4GJ4 A;  3K3D A;  5AVF A;  2ZOI A;  3UMD A;  1NLY A;  1F5M A;  2M1C A;  5J3W A;  1GSX A;  4LLO B;  3C2W A;  1T18 A;  2KDK A;  4GS9 A;  2JKR I;  4HH2 A;  5F5Y A;  2INW A;  3OBF A;  5HDD A;  2O9C A;  1OTB A;  4IUK A;  1KOU A;  3T4O A;  4Y5F A;  2GZA A;  2VKS A;  3NOU C;  3UB7 A;  3EOI A;  1UWP X;  3OCL A;  3S7O A;  1S67 L;  5HPI A;  4I3A A;  2XA7 S;  1ZHH B;  5HDS A;  4WEJ A;  4NXG A;  1DP6 A;  4HY8 A;  3TJZ C;  3A0S A;  4CLC D;  4Q0J A;  3PBQ A;  5HWV A;  4KQD A;  4IUH A;  1OPX A;  3A0V A;  2VJW A;  4GW9 A;  1XJ2 A;  4WN5 A;  4EES A;  1NLZ A;  1T19 A;  2MJ6 A;  4XT2 A;  2GJ3 A;  4P6Z M;  4WLA A;  1BYW A;  3BQA A;  3UME A;  1DP9 A;  3LUQ A;  4ZRR A;  4B9O A;  3JVU A;  3KO6 A;  4EXO A;  2V0W A;  4K08 A;  3C30 A;  4GHI B;  4FOF A;  2P08 A;  3UE6 A;  1G6O A;  2W3D A;  1OTD A;  4NEE D;  2LB5 A;  1VHM A;  2K2N A;  2J3T D;  4DJ3 A;  2M7U A;  4HP9 A;  2OAQ 1;  1V9Z A;  4HJ6 A;  2OWH A;  2ZBB A;  1NWZ A;  1GSV A;  2V1B A;  4F3L B;  3GEC A;  5C5K A;  1MKM A;  1N9O A;  3H82 B;  4HNB A;  2QKP A;  1T1B A;  2J3W A;  4YWZ A;  4UEY A;  3BWL A;  2H28 A;  3PBO A;  1XFQ A;  3B47 A;  5DKL A;  4EEP A;  4GHI A;  2G7U A;  2FH5 A;  1IFQ A;  2HGV A;  1IOU A;  1ODV A;  1NRJ A;  3H7W B;  3NOP C;  5L8M A;  2QJ7 A;  2V9A A;  3PYP A;  2D02 A;  2K31 A;  3LR0 A;  3RTY A;  2P7J A;  2QWS A;  1LSW A;  3MQQ A;  3E4O A;  4UQI S;  3IS2 B;  4EET B;  2IA2 A;  2PR5 A;  3PXP A;  1S1Z A;  1TS7 A;  4G3W A;  4L9E A;  5AVE A;  4M4X A;  3MFX A;  2J80 A;  5G4Y A;  1T1A A;  3EGX C;  3EGD C;  2W1T A;  4GS9 B;  4RQ9 A;  1YSP A;  4I3I A;  4WEK A;  3R7W B;  3TRC A;  3CLO A;  4WUJ A;  4BJP A;  4IHQ A;  1OTI A;  3K3C A;  2HJ9 C;  3B33 A;  2O9B A;  2W3G A;  2VLG A;  4O8G A;  4R70 A;  3TW8 A;  4Y2F A;  4L9F A;  4XT2 B;  1H8M A;  2HF6 A;  3K2N A;  2W3F A;  2ZMV A;  3BW6 A;  4DJ2 A;  2XA7 M;  4I38 A;  4EUV A;  4Z1W A;  3F1N B;  2B02 A;  4G3K A;  4JGP A;  2JKR M;  2V1A A;  2W1T B;  2VX8 A;  4O0P A;  5G4Z A;  2FZ0 A;  4II7 A;  2D01 A;  2WKR A;  4UQI M;  2A24 B;  3RH8 B;  3P01 A;  4R38 A;  3ICY A;  1S4R A;  1DP8 A;  4HH3 A;  5I5L A;  3PR6 A;  5DJU A;  1OTE A;  4KUK A;  4H6J B;  4JGR A;  4HJ3 A;  3UB8 A;  3FPV A;  3U2A A;  4OOL A;  3S7Q A;  5LBR A;  3PBR A;  3F1N A;  4KUO A;  3W2Z A;  1WA9 A;  3RFB A;  4JGQ A;  4QPR A;  3VV4 A;  3UB6 A;  2BAS A;  4EQ1 A;  3T4L A;  2W3H A;  5J4E A;  5KIZ A;  2KLI A;  2DMW A;  4I3J A;  5HZH A;  2EWV A;  2M7V A;  3MF0 A;  4G3V A;  4I5S A;  4MCW A;  3PBS A;  2VV7 A;  4KQO A;  5DFX A;  2VV6 A;  1OT6 A;  2NUT C;  1H3Q A;  4HP4 A;  4MDZ A;  3PBN A;  3DBA A;  3JVV A;  1T1C A;  2CMN A;  4EW7 A;  4HHD A;  3EEH A;  4NKP A;  2YKH A;  3KYZ A;  3H7W A;  5TJJ A;  2VGL M;  3C8C A;  1TS8 A;  2VEA A;  5HWT A;  3CIT A;  3CAX A;  4ME4 A;  3G6O A;  2VA0 A;  4WF0 A;  4I39 A;  3OC2 A;  4Q0H A;  3LI9 A;  2LB9 A;  2PD8 A;  5DF9 A;  1F98 A;  3SW1 A;  4HJ4 A;  1MZU A;  5A8B A;  3E0Y A;  3T4T A;  3OLO A;  4EEU A;  1XJ4 A;  1P9W A;  3EWK A;  3LR4 A;  3R7W A;  2XSS A;  3E4Q A;  3LR5 A;  2Y79 A;  4IJG A;  4R6L A;  5CX7 A;  1VB6 A;  1X0O A;  1YKD A;  2A2L A;  1YAX A;  5F69 A;  3T4Q A;  4BBT A;  3NJA A;  4L9G A;  4MN7 A;  4ETX A;  1UGU A;  5HL6 A;  5KSH A;  4MN5 A;  5HWW A;  3MMH A;  4B93 A;  3F1O A;  2O9A A;  3PHY A;  3KX0 X;  3P7N A;  3BJN A;  1N9N A;  1LSV A;  4DN0 A;  4CLC C;  2P04 A;  1P0Z A;  2PR6 A;  3H9W A;  3FG8 A;  3CUE C;  4LRY C;  2HV1 A;  2V0U A;  2JN7 A;  3BQ8 A;  4HQA A;  4BBU A;  1GSW A;  2OWJ A;  5HSQ A;  3LIA A;  4HOI A;  3T4K A;  2QJ5 A;  1D06 A;  3UB9 A;  5AJG A;  4CQH A;  3F1P A;  2I9V A;  3MR0 A;  3OOV A;  1DRM A;  2W27 A;  3UE3 A;  3CI6 A;  5MC7 A;  3NOT C;  2W1R A;  3BY8 A;  3D72 A;  3D3O A;  5DFY A;  1N9L A;  3KSI A;  4LRX C;  2PYP A;  3HJI A;  4PHT A;  3LYX A;  3CUE A;  1W63 Q;  4AFI A;  5EFW A;  3LIC A;  4R3A A;  3OCN A;  4BBV A;  3MJQ A;  2GX5 A;  4Y3I A;  3TE8 A;  3A0R A;  4WEL A;  2KOI A;  2ZMF A;  5DKK A;  2PYR A;  2HJE A;  5HDC A;  3V67 A;  1OJG A;  1P97 A;  1TS0 A;  2PDR A;  2R78 A;  4JGO A;  2PHY A;  4OOM A;  3LFV A;  2EA9 A;  2VV8 A;  1OT9 A;  2Z6D A;  1LT0 A;  4NXF A;  2L0W A;  3LIE A;  5HD5 A;  3ZYT A;  3T4S A;  3O5Y A;  2L4R A;  3KSH A;  4ETZ A;  1XJ3 A;  1EW0 A;  5HPF A;  1V9Y A;  4GLQ A;  2GNX A;  2OOL A;  3LID A;  2NUP C;  3HJK A;  3T4J A;  3EQV A;  2VZW A;  4EER A;  2EWW A;  3LI8 A;  4GCZ A;  1S66 L;  1F9I A;  3FC7 A;  3PBT A;  5TBM B;  1W63 M;  1XJ6 A;  4CLC E;  2B18 A;  3MQO A;  3LIB A;  4NXB A;  3LR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...