4QPRA

Crystal structure of gaf domain of potassium sensor histidine kinase kdpd from escherichia coli
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
b'GAMDLYEMSKALAVGRSPQDIAATSEQFIASTFHARSQVLLPDDNGKLQPLTHPQGMTPWDDAIAQWSFDKGLPAGAGTDTLPGVPYQILPLKSGEKTYGLVVVEPGNLRQLMIPEQQRLLETFTLLVANALERLTKLAAAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein KdpD
molecule tags Transferase
source organism Escherichia coli
publication title Crystal Structure of Gaf Domain of Potassium Sensor Histidine Kinase Kdpd from Escherichia Coli
rcsb
total genus 38
structure length 142
sequence length 142
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13492 GAF_3 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4qprA00
4ZRRA 4EUVA 2W3GA 2O9BA 2W1TB 2Y8HA 3E0YA 3ZQ5A 1YKDA 3HCYA 4MCWA 4BWIA 3KSIA 4Q0IA 2GX5A 1STZA 4Z1WA 3D3OA 2VKSA 2M7VA 2LB9A 3S7QA 4E04A 4GLQA 4Y3IA 4GW9A 2Y79A 5DFYA 2O99A 1VHMA 3KSGA 5HPFA 2W3EA 3MQ0A 5HSQA 4LRXC 4ME4A 4MDZA 2KOIA 2XRNA 2VZWA 4LRZE 3KSHA 3NOTC 3CITA 3NOPC 4CQHA 5C5KA 4G3KA 5LBRA 4ETXA 5HPIA 3S7PA 4DN0A 4YNRA 2HGVA 3RFBA 3CI6A 2W3DA 4ETZA 2K2NA 2OOLA 4MMNA 3IBRA 3VV4A 4PAUA 2B18A 2W3FA 4DMZA 2O9AA 3TRCA 5I5LA 2XSSA 3KSFA 2KLIA 4R6LA 1MKMA 4IUKA 4Y5FA 5TJJA 4Q0JA 4Y2FA 2K31A 1ZTUA 4G3WA 2G7UA 3IBJA 3S7NA 3G6OA 3NOUC 2LB5A 1TF1A 3W2ZA 3DBAA 3EEAA 4MN7A 4G3VA 5HL6A 2XROA 3NHQA 4FOFA 4LRYC 3OBFA 4O01A 4RQ9A 2VEAA 2ZMFA 3C2WA 2W1TA 3BJNA 3OOVA 5AJGA 4IUHA 1TD5A 4IJGA 2M7UA 1F5MA 1YSQA 3O5YA 2O0YA 3R4KA 4O0PA 2W3HA 4EU0A 2VJWA 5L8MA 4R70A 2W1RA 1MC0A 2O9CA 4Q0HA 3E98A 3MMHA 4QPRA 3S7OA 5DFXA 3LFVA 5K5BA 1YSPA 4O8GA 2IA2A 3K2NA 3MF0A 4YOFA 2QYBA 3KO6A
chains in the Genus database with same CATH superfamily
2ACGA 4EUVA 1O7EA 3H9WA 2VV8A 3F1NB 1E3UD 1W8QA 3HCYA 1F2KA 4JGOA 2K7SA 4S2MA 3DWKA 4OQHA 5HD5A 2XH9A 3G30A 4MDZA 4N9KA 2EA9A 4OPQA 4LRZE 3UDXA 3NOPC 2OLUA 1PWGA 3M2JA 4DN0A 1BZAA 3IX4A 1IKIA 4DF6A 2W3DA 1N9OA 1IYSA 2OLVA 1Y28A 2J8YA 4KZ8A 2HDRA 4H8RA 3UNWA 3KSFA 2FH5A 4RVAA 4EETB 4IUKA 2J7VA 1DJCA 3TOIA 1NRJA 1X0OA 3DTEA 5I94A 1SZVA 2WAFA 3FZCA 4GS9A 5HL1A 3EGXC 5E43A 2W1TA 1ODVA 3UPPA 3V67A 1OJGA 2ZC6B 5HDDA 3F1PA 1YMSA 1YSQA 3NY4A 2VJWA 3UN7A 3G35A 2O9CA 2P9VA 5DJTA 4EBNA 2X02A 2A24B 4K08A 3ULFA 3T1RA 4U3TA 5FQIA 1XA1A 4UHUA 4MN6A 3UMDA 4JF5A 1YKDA 4MCWA 1D1JA 3C7UA 3EQUA 1FQGA 1S0WA 5AQ9A 4QD4A 4PM5A 2E8IA 1K54A 4ZAMA 1SHVA 4EESA 1SKOA 1BYWA 1LL8A 1WA9A 3NI9A 1DP6A 4KQDA 3CITA 4DJ3A 4G3KA 5HARA 3NULA 1WYBA 3NIAA 1VM1A 3LYXA 2K2NA 2NUTC 3IBRA 3UMEA 5CTNA 3SH8A 4X69A 5DVAA 1NZOA 3O87A 4JGQA 3B33A 4GD6A 2WKQA 5M1AA 5HWWA 1KGEA 2R78A 3M2KA 2HPBA 4O01A 5HWTA 3RXXA 4JXGA 4IVKA 5F82A 1T1CA 1OPXA 3O5YA 3HLEA 1IKGA 2JKFA 4ARZB 4P6ZS 4BBUA 2WKEA 2OWJA 5FL3A 3F1OA 4XT2B 5F5YA 3N8LA 4HQAA 1CJFA 2WADA 1TS7A 2W0NA 4E3MA 3E4PA 3WRZA 3MQOA 2ZQDA 3UE0A 2O9BA 4MBHA 1YLWA 1L3LA 3ZQ5A 2PDRA 3ISGA 3Q7VA 3LIDA 3E4QA 3KSIA 4CLCE 3FPVA 1L0EA 3OCNA 4R3JA 2ZC7A 1LSXA 2VKSA 4NG2A 4BJPA 4EBLA 4WZ5C 1TDLA 4K91A 4WELA 4E3JA 3G32A 5AQBA 2H10A 2PBYA 1HLUP 4P0MA 3VSKA 4R38A 4EUZA 3C7VA 3KSHA 3S4XA 3MZDA 3G34A 3GECA 5DF9A 2EX2A 3S7PA 4F3LB 5A92A 5E2HA 4DDYA 4DRTA 3CI6A 2Q0OA 2HDQA 2JKGA 2QMIA 2HF6A 1MKMA 2FFYA 1ES3A 3BYDA 1ZC2A 4G3WA 4Y2FA 5IT5A 2WKPA 3LY3A 2EXBA 1V9YA 3T4QA 5GLBA 4YFMA 3CUEC 4EEPA 3EEHA 4KZ4A 4HIAA 3G2ZA 4WEJA 1HTZA 3BFGA 3F1NA 3M6HA 3FYZA 2Y2MA 4HOIA 4LV2A 3ZFZA 5DJUA 4D2OA 2VGKA 5CHMA 4AFIA 5FEFA 3SOIA 5EVIC 3P09A 4WL9A 5FQKA 5IS1A 4L0LA 4CJNA 3S7OA 5DFXA 4O8GA 3ZNTA 3ZDJA 3IH9A 2B95A 2JKTM 3N4IA 4DDSA 3T4KA 1T1AA 2PAVP 2VA0A 3DW0A 5AQAA 3BFCA 3JYIA 2O99A 4S2IA 3A3EA 2H0TA 1KDSA 1DJAA 3PXPA 1D7EA 4BBTA 1N9BA 3B42A 3RH8B 2BASA 1NLZA 2J3TD 4OOLA 3BLMA 3IXDA 1L0DA 5KZHA 4LV3A 2ZM2A 3ZCZA 3IH8A 3GMWA 4B93A 1CI8A 5DKKA 1EW0A 3PBTA 4MMNA 4X55A 5FAQA 4ZDXA 1JWPA 2HP5A 3IWQA 4EWFA 5F1FA 4Q0JA 2Y91A 3M6BA 4EV4A 3DBAA 4B88A 5A93A 1ESUA 1OJ5A 3NJAA 1K56A 4PHTA 2ZC5B 5G18A 1K6SA 2QPNA 2ZMFA 5F68A 5FA7A 3FV7A 3BJNA 4MLLA 3LIFA 4RYEA 3EWKA 3LIAA 3ZG8B 1GHMA 1CEFA 5JYOA 1W5DA 3T12B 4NKPA 4RX3A 2A24A 3LICA 5A8BA 3ZGAB 1PWDA 2Z6DA 2FZ0A 1S66L 3KYEA 1NZUA 1P9WA 4ARZA 1BLHA 1YLPA 3BFDA 2HP9A 1W63M 5HAPA 2Y2KA 3JPUA 1VETA 1CK3A 1T18A 1KVLA 2P7JA 3O86A 1PRQA 2J9PA 3U4LP 3PAGA 2JE5A 3DTKA 1S67L 2GZAA 4KQOA 2H5SA 3KSGA 3RTYA 5KSCA 2RL3A 3IWOA 4CLCB 3AGEA 1NJ4A 3QP5A 2OV5A 4C6YA 2WGVA 1XX2A 5BOHA 5CHUA 3PBRA 5HDSA 3UE1A 1F98A 4ETZA 4NXFA 1NLYA 1O07A 1OT9A 4DMZA 2K31A 3V3SA 3W8KA 3IS2B 4MN7A 2ZC3B 3SW1A 5GLDA 3PBSA 1JNUA 1LLBA 3CPTB 2YKFA 5FI2A 4FCFA 1M6KA 1GCEA 4GDBA 3R4KA 4Y13A 5CX7A 5FQ9A 2ZOIA 2WZZA 1JWVA 2XF3A 2QKPA 2ZQCA 1TS8A 3UDIA 1I2SA 2HV1A 1Y4OA 2HJEA 2JKTI 1MWSA 1BT5A 3K3CA 5CECA 3O88A 5CGXA 1FOFA 1ES2A 3ICYA 4KZ5A 1A0KA 1DP9A 3IF5A 4R3BA 3UB8A 4PMAA 5CERA 4MBFA 2Y79A 2IWDA 5DFYA 1K4EA 3S22A 2BLSA 1VHMA 3GRJA 3WRTA 5TBMA 1S1YA 3H82B 1P9RA 3HBRA 2Z6CA 5HDCA 4NEED 4CQHA 1BTLA 1XJ4A 2J3TC 1N9LA 3T1SA 5FQJA 4WMCA 2HGVA 3S1YA 4GD8A 4BL2A 4BD0A 2H28A 4JLFA 2W3FA 2P08A 1YLZA 2V1BA 5I5LA 2XSSA 2HZ5A 4E3LA 1OTEA 2DRWA 1K55A 1LSWA 4EBPA 3ZG9B 3S7NA 5GL9A 3E2LA 1W63Q 2C5WB 5JYPA 2ZQ8A 4WF0A 2VEAA 1OTAA 1BUEA 3GVBA 3FPWA 3LIEA 4N9LA 3VOYA 3HJKA 2A2LA 1XGJA 3RXWA 5L8MA 2I72A 4NETA 4N92A 1K55C 4JPMA 3MXSA 5FSRA 3LFVA 3Q1FA 5AQ7A 2IA2A 4YOFA 2QYBA 3G31A 2V9AA 4R23A 1LL9A 3CWFA 1ERMA 5IU1A 3VFFA 2WYXA 3LY4A 2EX9A 4KG2A 2Y2JA 2WGIA 2Z2MB 3PBNA 2QZ6A 1PNEA 1FR6A 4LLOB 2HDSA 2XFSA 4E04A 1PZOA 2GDNA 4HESA 3MFDA 3PYPA 3OC2A 5DKLA 4C3QA 4HJ6A 2XRNA 2JN7A 4LV0A 3B47A 3BFFA 5C5KA 5CEBA 4ZJ1A 4PPRA 1C3BA 2A3UA 1GSXA 4NXEA 1LI0A 4OVDA 1SDNA 2CC1A 2ZC4B 4HBUA 3VP3A 1XFQA 1XXMA 2VLGA 3G6OA 4P85A 4DKIA 5M18A 3CG5A 2XDMA 3BY9A 3UPNA 2WKHA 3FG8A 3H82A 3IHBA 4IUHA 4HI4A 1IYQA 1F5MA 2EXAA 4EU0A 2PT7A 4NXBA 3VFHA 2J3WA 3HLDA 2XGNA 2Y2NA 3W4QA 3HLBA 5FQQA 4P6BA 3E98A 2XLNA 3MMHA 3VMAA 3QP6A 3SS3A 5HX9A 1YSPA 3SS5A 4KQQA 4E3IA 5EUAA 3KO6A 1YQSA 3A0RA 3BECA 3EGDC 5DF7A 1P97A 2QJ5A 2PRFA 2AVXA 3UPOA 3NCKA 4EQ1A 3UB6A 1ZKJA 2EFUA 3QP8A 3A3JA 4X68A 5J8XA 1S6RA 1FCNA 5EOEA 1F9IA 5FAOA 3SH7A 1OTBA 1YPRA 4S2KA 4P87A 1BULA 2JHEA 4E3KA 5TBMB 4KZBA 4JXSA 4HH2A 5LBRA 3LI9A 2XR0A 1NYYA 3D72A 3MKEA 2M1CA 3PBQA 4YNRA 3QHYA 3U2AA 2PR5A 4I39A 3GQZA 4JGPA 3VV4A 3V50A 4HBTA 1N9NA 1FSYA 1K6RA 1QMFA 5GHZA 3UB9A 3WWXA 3A3FA 3LEZA 3HUMA 1L0GA 3C38A 4E3OA 4WYYA 1ACFA 2DCFA 3VP4A 3MSHA 4B9OA 1YMXA 4BQMA 4OQGA 5IHVA 2PBDP 3CHWP 2HDUA 2J80A 4I38A 5J4EA 1OTIA 1FCOA 4WZ5A 3OOVA 4R0QA 2ZM8A 2G2WA 3HLFA 4PM7A 1XP4A 2JCHA 1L2SA 4M3KA 5EM1A 1NXYA 3GSGA 1EROA 4OH0A 5HAIA 5EVID 2Y4AA 5CRFA 1RGZA 3FKWA 2V1AA 3CMZA 3F1PB 4JF6A 4XUZA 1GHIA 4JKTA 2W1TB 2Y2LA 4IHQA 3HREA 4OPZA 3IXGA 4KZ3A 4Z9QA 1H0MA 4GS9B 2VX8A 3P98A 4I3IA 3S7QA 1LT0A 4C75A 4GLQA 3MXRA 1TDGA 1GHPA 2KOIA 4KZ9A 3BQAA 4GOGA 1PW1A 3NOTC 4WM9A 3UO9A 2JKRI 3T4SA 1UGUA 3GTCA 4HJ4A 3SS4A 3LR4A 3WS5A 4PAUA 3LEQA 2O9AA 2XK1A 4Y0OA 2JBFA 5FASA 4Y5FA 1FR1A 1H8YA 4BBVA 3HLCA 4CLCD 1ZTUA 4X53A 2PR6A 5M19A 1PWCA 4FSFA 5EVIA 1I5QA 3NOUC 2LB5A 2ZLYA 5EVLA 2WAEA 3NDGA 4G3VA 1PI5A 5CGSA 1NWZA 3BFEA 2EWWA 3SH9A 3NHQA 2B5RA 4GJ4A 5A91A 1IYPA 3C2WA 1PIOA 5FI6A 4O7DA 4Y15A 2WGWB 4QY6A 3CUEA 4CPKA 4DE1A 5L09A 5E2EA 3LGOA 4QY5A 4EQIA 2ZOHA 3IXBA 4GKUA 2P74A 4PM9A 2IWBA 3W4OA 2JKRM 1EWZA 3LR3A 2ZMAA 4K0WA 4Y0TA 3RJUA 4ZRRA 4BENA 3QP1A 2BTFP 3AGDA 2FFFB 2GJ3A 1IOUA 3IX3A 4UA6A 4Q0IA 1STZA 5MC7A 2L1MA 2I9VA 4HNBA 2Y59A 2G2UA 5HW3A 1YLJA 2Y2QA 1T19A 4OPRA 2EWVA 3N8RA 3A0VA 4LRXC 5L07A 4HJ3A 3JVVA 3C4OA 5GHXA 3WS1A 1K0KA 5HPIA 2YKHA 3IF6B 1LL5A 3ITAA 3V3RA 5CXWA 5E2FA 3FC7A 3MQQA 1RGYA 2B18A 4B4ZA 1E3UA 4S2JA 1I2WA 3B3XA 2OWHA 4LCLA 3KYZA 4JF4A 3T4LA 3CLOA 3ZG7B 4JBFA 1J9MA 5HL6A 3C8CA 4R3AA 4LRYC 5J3WA 4RQ9A 3LIBA 4GNUA 4KQRA 4KG5A 4NK3A 4L9FA 4XXRA 3LCEA 1TD5A 2WZXA 5L10A 3QNBA 3BM6A 5FQMA 2W27A 1P0ZA 3P01A 4Y0UA 5DTTA 4S2LA 3K3DA 5EM0A 4GHIB 3HUOA 3ZNYA 4H6JA 2ZM0A 4QPRA 3Q7ZA 2WK0A 2Y2PA 2P04A 3IQAA 4FD8A 4OQIA 3IF6C 5L2FA 2V1ZA 2L0WA 2WKIA 4MN5A 3UB5P 1EI5A 3GV9A 4DXBA 1SDEA 2Y8HA 1WE4A 2VV6A 2ZJ9A 4HP4A 1W79A 2NUPC 5KMWA 1KE3A 5U47A 2EX8A 2D02A 3FWLA 4X1LA 4I3AA 2Q9NA 4F3LA 3HLGA 1K54C 1JTDA 3MZFA 3LUQA 4YWZA 2MJ6A 3MQ0A 3MKFA 2EFXA 1BLCA 4F94A 1BLPA 3UDFA 2QWSA 5EFWA 4GZBA 1GSVA 5KSHA 3VP2A 3QP2A 1N4OA 4ZJ3A 1MWTA 4EERA 4KENB 2OAQ1 5HFOA 1Y54A 4QHCA 1VETB 1KVMA 1L0FA 4OP5A 4I5SA 5FEGA 3Q81A 4BMWA 4FUWA 2QHKA 3VOZA 5TR7A 3ZVTA 2BG1A 3OLOA 1KE4A 4QJGA 1G28A 2XROA 4FOFA 3ZG5A 5F69A 2UWXA 3F1OB 4XT2A 3A0SA 3ZVWA 5AJGA 1V9ZA 3PR6A 3HLWA 3QNCA 4IJGA 3DTMA 1JWZA 4DE2A 1K38A 4ZTKA 5DF8A 3H7WB 2J9OA 1OT6A 3OPLA 1UWPX 4HY8A 2JC7A 5AVFA 4KZAA 1XGIA 1DY6A 1HD8A 2HJ9C 2Y2IA 4BD1A 1Z09A 3IHAA 2A49A 3A3DA 3UE6A 3T50A 3HVFA 4BWIA 2P9VB 2V0WA 4JGRA 2GX5A 2R9WA 3DAVA 2PYPA 4KZ7A 4E6XA 4IBXA 2CMNA 4Y3IA 3BRMA 3DWZA 2PD7A 2ZD8A 2E8JA 3VSLA 5HD3A 1MXOA 1JVJA 4MBKA 1FCMA 1DJBA 3GDIA 1ALQA 4P6ZM 4Y17A 2X01A 1KGFA 1NRFA 2DNSA 2OOLA 5FAPA 1QMEA 4ZBEA 3TRCA 4UEYA 1MKIA 3T4JA 1M40A 1ERQA 1H3QA 1YAXA 1H5XA 1XJ6A 3VE4A 1TF1A 2L4RA 2VV7A 3T4TA 3MJQA 4X6TA 2VK3A 4CLCA 4PM8A 2H0YA 2VGLS 3BW6A 3P7NA 3BEBA 5D3OA 3PTEA 4OP8A 3KYQA 1CEGA 2O0YA 4S2PA 4XUXA 3HJIA 2Y2GA 2X71A 4GCZA 1GSWA 3H7WA 1S4RA 2KDKA 4S2NC 5DTKA 5J7EA 2Y2OA 4QB8A 1IEMA 2VGJA 3IT9A 4A5RA 2OSUA 3OCLA 3UE3A 3IWIA 3E0YA 1Q2QA 4R1GA 3UY6A 4NXGA 3TW8A 1ZG4A 2Y2HA 3R7WB 3VOLA 2M7VA 5E2GA 2DMWA 2INWA 2D01A 1ONGA 4UA7A 4GW9A 1MY8A 3MZEA 4IEDA 5HPFA 2PYRA 2Y55A 5HSQA 1Z6FA 1G6AA 1SCWA 4JXVA 4KUOA 5GHYA 1LI9A 1E25A 2ZQAA 3E2KA 3V39A 4N1HA 3UB7A 4OKPA 5F1GA 3NECA 3FKVA 3Q7VB 1HZOA 2R9XA 3WS0A 1G6OA 2QJ7A 3KX0X 4ESPA 1TEMA 4R4SA 4QU3A 4ID4A 3HUNA 5EPHA 1TS6A 3W2ZA 4BL3A 3OZHA 2IWCA 2C6WB 1VEUB 2WKRA 4QWOA 3TE8A 3G2YA 1VEUA 2B02A 3DTIA 3NBLA 3IX8A 1K57C 1PW8A 3Q07A 1XKZA 2UV0E 2M7UA 3BLSA 3L9KA 2W3HA 1BLSA 4M4XA 5EV0A 1PZPA 4U0TA 4R70A 4GN2A 1H8ZA 1E4DA 4UAAA 5EVEA 3V5MA 4GHIA 3C5AA 3LO7A 1UWNX 5F83A 3PAEA 5K5BA 3CJMA 3VP1A 3MF0A 3MS6A 1ES4A 2W3GA 3N7WA 4LGWA 2XEPA 2WGWA 1W7FA 1KE0A 4ZJ2A 4HHDA 4EW7A 1J3WA 1ZG6A 3E4OA 4Z1WA 3D3OA 5GLAA 1MPLA 4KG6A 3L7HA 4OPYA 4HEFA 4WMCD 2PD8A 3G4PA 4DXCA 5EVIB 3T1QB 1FSWA 3CZDA 5EE8A 4UQIM 2XD1A 2EX6A 4WBGA 2V8CA 1JTGA 4ETXA 1RCJA 4X56A 3RFBA 4WUJA 5HAQA 4B4XA 5CEDA 2KLIA 1MWUA 1PYYA 4UA9A 3Q82A 4X1MA 5HWVA 2V0UA 4HP9A 1LSVA 3I7JA 5TGFA 5EECA 3QP4A 3R7WA 3ZG0A 1S4SA 3OBFA 5EOOA 4EXOA 2PHYA 4E3NA 4OLDA 4RX2A 5KIZA 4KZ6A 5G4YA 1AXBA 4WLAA 4OONA 1MC0A 3CPTA 4D60A 4RA7A 1PFLA 3K2NA 4S2NA 4DE3A 2ZMVA 3BWLA 3PBOA 3OPPA 1NYMA 4GDNA 1S1ZA 3MR0A 4K0XA 1ONHA 5FI7A 1MZUA 1YT4A 3A3IA 1YLTA 3TG9A 1RP5A 2ZQ7A 1PI4A 3LR5A 3EOIA 1WYCA 1K25A 4LFUA 4LPZA 2ZBBA 4I3JA 3IS2A 4WEKA 3PHYA 4OLGA 4FH4A 4JXWA 4CLCC 1TVFA 5A90A 1IYOA 3WS2A 3WS4A 1IELA 3BY8A 4MNRA 4L9GA 4FH2A 1VB6A 5AVEA 2XFTA 4OOYA 2PU2A 3W4PA 4GB7A 1XPBA 1GA9A 5CTMA 1XA7A 3VP0A 4DE0A 4R6LA 5HZHA 3MFXA 3MXQA 1XJ3A 2XD5A 5TFQA 5F6AA 2Q9MA 3IBJA 3T1XA 1GA0A 5FATA 4Q8IA 1K57A 5CGWA 4WN5A 1H8MA 1YM1A 4L9EA 3MBZA 1OTDA 1SKOB 4LCMA 4PM6A 1DRMA 4OOMA 1FILA 4BLMA 2W1RA 3JVUA 4H6JB 1ES5A 3OPRA 4Q0HA 2Z2LB 4LV1A 2ZL1B 4N1XA 3TSGA 2OAP1 3C4PA 1T1BA 3EQVA 2XA7M 4R4RA 3GR2A 4OQ0A 2VGLM 3OPHA 3N6IA 2GNXA 1G68A 3T4OA 4WZ4A 1ZHHB 1KOUA 4HH3A 3SZTA 1YLYA 1VQQA 1MWRA 4E6WA 1D06A 5FDSA 1ESIA 1HVBA 2LB9A 3AGFA 1AWIA 3O3VA 4MEZA 2XQZA 4DJ2A 4PKYG 3D9YA 2W3EA 1SKFA 5FDHA 1K4FA 1G5UA 4ME4A 4EEUA 2V8FA 2VZWA 1MBLA 4LENA 1Q2PA 3IXHA 1KDWA 1CI9A 3TJZC 3NDEA 2V20A 1DP8A 3ITBA 4U0XA 1LHYA 2ZQ9A 3HL9A 4Y7PA 5DTSA 4YINA 4PKYA 4FTXA 2WUQA 4IVIA 1OMEA 3LR0A 4KUKA 3BQ8A 4S2OA 5TJJA 3NC8A 2RCXA 3ZYTA 1NY0A 3N8SA 2G7UA 1KGGA 3EEAA 2PU4A 2ZL1A 1U60A 1FIKA 1XFNA 3D4FA 1BSGA 3LI8A 2XA7S 1K56D 3C30A 4II7A 4O0PA 5GLCA 1TS0A 5G4ZA 1XJ2A 3VE3A 1IFQA 2KX6A 1CF0A 3CAXA 2V2FF 4X25A 4IBRA 5CHJA 4UQIS 2HP6A 3IF6A 3ZHHA 1W8YA 1CQAA
chains in the Genus database with same CATH topology
1P9WA 4ARZA 4EUVA 2W1TB 4IHQA 3OCLA 1W63M 3H9WA 2VV8A 3UE3A 3E0YA 3F1NB 3HCYA 4JGOA 1T18A 2P7JA 4NXGA 4GS9B 3TW8A 2K7SA 2VX8A 3R7WB 3VOLA 2M7VA 4I3IA 3S7QA 1LT0A 2DMWA 2INWA 4GLQA 2D01A 4GW9A 1S67L 2GZAA 4KQOA 3KSGA 5HPFA 2PYRA 3RTYA 5HD5A 5HSQA 4CLCB 4MDZA 2KOIA 2EA9A 4KUOA 4LRZE 3BQAA 3NOTC 3NOPC 2JKRI 4DN0A 3T4SA 1UGUA 4HJ4A 3UB7A 3PBRA 3LR4A 5HDSA 1F98A 2W3DA 4ETZA 1N9OA 4NXFA 1NLYA 1OT9A 4PAUA 1Y28A 4DMZA 2O9AA 3KSFA 2FH5A 4EETB 1G6OA 4IUKA 2QJ7A 4Y5FA 3KX0X 4BBVA 4CLCD 2K31A 1ZTUA 2PR6A 1NRJA 1X0OA 4FSFA 3NOUC 2LB5A 3IS2B 3W2ZA 1TS6A 4MN7A 4GS9A 4G3VA 3EGXC 2WKRA 1NWZA 3SW1A 2EWWA 3NHQA 3TE8A 4GJ4A 3PBSA 2B02A 1JNUA 3C2WA 2W1TA 2YKFA 1ODVA 3V67A 1OJGA 5HDDA 2M7UA 3CUEA 3F1PA 1YSQA 3R4KA 2W3HA 5CX7A 4M4XA 2ZOIA 2VJWA 4R70A 2O9CA 2ZOHA 4GHIA 5DJTA 1UWNX 2JKRM 2A24B 3LR3A 5K5BA 2QKPA 4K08A 1TS8A 3MF0A 3ULFA 2HV1A 4ZRRA 2HJEA 2JKTI 4MN6A 2W3GA 3K3CA 3UMDA 3ICYA 1IOUA 2GJ3A 1YKDA 4HHDA 4MCWA 1DP9A 4EW7A 3E4OA 4Q0IA 4Z1WA 1STZA 3EQUA 3D3OA 5MC7A 2L1MA 3UB8A 2I9VA 4HNBA 2PD8A 2Y79A 5DFYA 1VHMA 4EESA 5TBMA 1BYWA 1T19A 2EWVA 1S1YA 3A0VA 4LRXC 3H82B 1LL8A 4HJ3A 1P9RA 3JVVA 4UQIM 2Z6CA 5HDCA 4NEED 1WA9A 1DP6A 4KQDA 3CITA 4CQHA 4DJ3A 4G3KA 4ETXA 5HPIA 2YKHA 1XJ4A 2J3TC 1N9LA 2HGVA 3LYXA 3RFBA 4WUJA 3FC7A 2K2NA 2NUTC 2H28A 3IBRA 3MQQA 2B18A 2W3FA 2P08A 2V1BA 5I5LA 2XSSA 3UMEA 2KLIA 1OTEA 5HWVA 1LSWA 2V0UA 2OWHA 3S7NA 3KYZA 4JGQA 3B33A 4HP9A 2WKQA 1LSVA 3T4LA 3CLOA 1W63Q 5HWWA 2R78A 5HL6A 3R7WA 3C8CA 4R3AA 4LRYC 5J3WA 1S4SA 3OBFA 4O01A 4RQ9A 4WF0A 4EXOA 3LIBA 2VEAA 2PHYA 1OTAA 4L9FA 3FPWA 5HWTA 1TD5A 3LIEA 5KIZA 5G4YA 1T1CA 1OPXA 3O5YA 4WLAA 2W27A 1P0ZA 3HJKA 2A2LA 4ARZB 4BBUA 4P6ZS 3P01A 5L8MA 1MC0A 3K3DA 2OWJA 4GHIB 5FL3A 3F1OA 4H6JA 4XT2B 4QPRA 5F5YA 4HQAA 3LFVA 1TS7A 2P04A 2W0NA 2IA2A 3K2NA 3E4PA 4YOFA 2QYBA 2ZMVA 3BWLA 3PBOA 2V9AA 2L0WA 4MN5A 3MQOA 3CWFA 1S1ZA 3MR0A 5IU1A 2O9BA 2Y8HA 2VV6A 3ZQ5A 2PDRA 1MZUA 3LIDA 4HP4A 2NUPC 3E4QA 3KSIA 4CLCE 3FPVA 3OCNA 3LR5A 1LSXA 2VKSA 3EOIA 3PBNA 4LLOB 4LPZA 2ZBBA 2D02A 3IS2A 4I3JA 4WEKA 4BJPA 3PHYA 4I3AA 4E04A 4F3LA 4CLCC 4WELA 3LUQA 4YWZA 2MJ6A 3MQ0A 3PYPA 3OC2A 5DKLA 4HJ6A 4R38A 2XRNA 3BY8A 4L9GA 2JN7A 3KSHA 1VB6A 2QWSA 3GECA 5DF9A 5EFWA 5AVEA 3B47A 5C5KA 1GSVA 5KSHA 3S7PA 4F3LB 4EERA 2OAQ1 3CI6A 1GSXA 4NXEA 4R6LA 2HF6A 3MFXA 5HZHA 4I5SA 1MKMA 4BMWA 3MXQA 1XJ3A 1XFQA 4Y2FA 4G3WA 5F6AA 5IT5A 2QHKA 3IBJA 2WKPA 2VLGA 3G6OA 1V9YA 3T4QA 3OLOA 3CUEC 4EEPA 3EEHA 1G28A 2XROA 4FOFA 4HIAA 5F69A 4WEJA 4WN5A 3BY9A 3F1OB 4XT2A 3F1NA 3A0SA 1H8MA 3FG8A 3H82A 5AJGA 4HOIA 4IUHA 1V9ZA 3PR6A 4L9EA 1OTDA 4HI4A 4IJGA 5DJUA 1F5MA 1DRMA 4AFIA 4OOMA 4EU0A 2PT7A 4NXBA 2J3WA 2W1RA 3JVUA 4H6JB 3H7WB 4WL9A 5IS1A 4Q0HA 3E98A 3MMHA 1OT6A 4L0LA 3S7OA 5DFXA 1UWPX 1YSPA 4HY8A 4O8GA 2OAP1 5AVFA 1T1BA 3EQVA 2XA7M 3KO6A 3A0RA 2HJ9C 3EGDC 2VGLM 1P97A 2JKTM 2QJ5A 2GNXA 3T4OA 1ZHHB 1KOUA 3UE6A 3T50A 4HH3A 3T4KA 4BWIA 4EQ1A 1T1AA 2V0WA 4JGRA 3UB6A 2GX5A 2VA0A 2PYPA 1D06A 2LB9A 2CMNA 4Y3IA 4DJ2A 4PKYG 2O99A 2PD7A 2W3EA 1F9IA 3PXPA 1OTBA 1D7EA 5HD3A 4ME4A 4BBTA 4EEUA 2VZWA 3B42A 3RH8B 2JHEA 2BASA 1NLZA 5TBMB 2J3TD 4OOLA 3GDIA 4HH2A 5LBRA 3LI9A 3TJZC 3D72A 1DP8A 2M1CA 3PBQA 4YNRA 4P6ZM 3U2AA 2PR5A 4I39A 4B93A 5DKKA 2OOLA 1EW0A 3PBTA 4MMNA 4JGPA 3VV4A 4PKYA 3TRCA 4UEYA 3LR0A 1N9NA 4KUKA 3BQ8A 5TJJA 4Q0JA 3T4JA 3ZYTA 1H3QA 1YAXA 3UB9A 2G7UA 1XJ6A 3C38A 3VE4A 1TF1A 2L4RA 3DBAA 3EEAA 2VV7A 3T4TA 3MJQA 4B9OA 1OJ5A 3NJAA 2J80A 4I38A 5J4EA 4PHTA 1OTIA 4CLCA 2ZMFA 5F68A 2VGLS 1XFNA 3P7NA 3BJNA 3BW6A 3OOVA 3LIFA 3EWKA 3LIAA 3LI8A 2XA7S 3KYQA 3C30A 4NKPA 4II7A 2O0YA 4O0PA 1TS0A 5G4ZA 1XJ2A 2A24A 3LICA 3HJIA 5A8BA 3VE3A 1IFQA 2KX6A 4GCZA 3CAXA 2Z6DA 2FZ0A 1S66L 1GSWA 3H7WA 1S4RA 4UQIS 2KDKA 2V1AA 5J7EA 3F1PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZRR A;  4EUV A;  2W3G A;  2O9B A;  2W1T B;  2Y8H A;  3E0Y A;  3ZQ5 A;  1YKD A;  3HCY A;  4MCW A;  4BWI A;  3KSI A;  4Q0I A;  2GX5 A;  1STZ A;  4Z1W A;  3D3O A;  2VKS A;  2M7V A;  2LB9 A;  3S7Q A;  4E04 A;  4GLQ A;  4Y3I A;  4GW9 A;  2Y79 A;  5DFY A;  2O99 A;  1VHM A;  3KSG A;  5HPF A;  2W3E A;  3MQ0 A;  5HSQ A;  4LRX C;  4ME4 A;  4MDZ A;  2KOI A;  2XRN A;  2VZW A;  4LRZ E;  3KSH A;  3NOT C;  3CIT A;  3NOP C;  4CQH A;  5C5K A;  4G3K A;  5LBR A;  4ETX A;  5HPI A;  3S7P A;  4DN0 A;  4YNR A;  2HGV A;  3RFB A;  3CI6 A;  2W3D A;  4ETZ A;  2K2N A;  2OOL A;  4MMN A;  3IBR A;  3VV4 A;  4PAU A;  2B18 A;  2W3F A;  4DMZ A;  2O9A A;  3TRC A;  5I5L A;  2XSS A;  3KSF A;  2KLI A;  4R6L A;  1MKM A;  4IUK A;  4Y5F A;  5TJJ A;  4Q0J A;  4Y2F A;  2K31 A;  1ZTU A;  4G3W A;  2G7U A;  3IBJ A;  3S7N A;  3G6O A;  3NOU C;  2LB5 A;  1TF1 A;  3W2Z A;  3DBA A;  3EEA A;  4MN7 A;  4G3V A;  5HL6 A;  2XRO A;  3NHQ A;  4FOF A;  4LRY C;  3OBF A;  4O01 A;  4RQ9 A;  2VEA A;  2ZMF A;  3C2W A;  2W1T A;  3BJN A;  3OOV A;  5AJG A;  4IUH A;  1TD5 A;  4IJG A;  2M7U A;  1F5M A;  1YSQ A;  3O5Y A;  2O0Y A;  3R4K A;  4O0P A;  2W3H A;  4EU0 A;  2VJW A;  5L8M A;  4R70 A;  2W1R A;  1MC0 A;  2O9C A;  4Q0H A;  3E98 A;  3MMH A;  4QPR A;  3S7O A;  5DFX A;  3LFV A;  5K5B A;  1YSP A;  4O8G A;  2IA2 A;  3K2N A;  3MF0 A;  4YOF A;  2QYB A;  3KO6 A; 
#chains in the Genus database with same CATH topology
 2ACG A;  4EUV A;  1O7E A;  3H9W A;  2VV8 A;  3F1N B;  1E3U D;  1W8Q A;  3HCY A;  1F2K A;  4JGO A;  2K7S A;  4S2M A;  3DWK A;  4OQH A;  5HD5 A;  2XH9 A;  3G30 A;  4MDZ A;  4N9K A;  2EA9 A;  4OPQ A;  4LRZ E;  3UDX A;  3NOP C;  2OLU A;  1PWG A;  3M2J A;  4DN0 A;  1BZA A;  3IX4 A;  1IKI A;  4DF6 A;  2W3D A;  1N9O A;  1IYS A;  2OLV A;  1Y28 A;  2J8Y A;  4KZ8 A;  2HDR A;  4H8R A;  3UNW A;  3KSF A;  2FH5 A;  4RVA A;  4EET B;  4IUK A;  2J7V A;  1DJC A;  3TOI A;  1NRJ A;  1X0O A;  3DTE A;  5I94 A;  1SZV A;  2WAF A;  3FZC A;  4GS9 A;  5HL1 A;  3EGX C;  5E43 A;  2W1T A;  1ODV A;  3UPP A;  3V67 A;  1OJG A;  2ZC6 B;  5HDD A;  3F1P A;  1YMS A;  1YSQ A;  3NY4 A;  2VJW A;  3UN7 A;  3G35 A;  2O9C A;  2P9V A;  5DJT A;  4EBN A;  2X02 A;  2A24 B;  4K08 A;  3ULF A;  3T1R A;  4U3T A;  5FQI A;  1XA1 A;  4UHU A;  4MN6 A;  3UMD A;  4JF5 A;  1YKD A;  4MCW A;  1D1J A;  3C7U A;  3EQU A;  1FQG A;  1S0W A;  5AQ9 A;  4QD4 A;  4PM5 A;  2E8I A;  1K54 A;  4ZAM A;  1SHV A;  4EES A;  1SKO A;  1BYW A;  1LL8 A;  1WA9 A;  3NI9 A;  1DP6 A;  4KQD A;  3CIT A;  4DJ3 A;  4G3K A;  5HAR A;  3NUL A;  1WYB A;  3NIA A;  1VM1 A;  3LYX A;  2K2N A;  2NUT C;  3IBR A;  3UME A;  5CTN A;  3SH8 A;  4X69 A;  5DVA A;  1NZO A;  3O87 A;  4JGQ A;  3B33 A;  4GD6 A;  2WKQ A;  5M1A A;  5HWW A;  1KGE A;  2R78 A;  3M2K A;  2HPB A;  4O01 A;  5HWT A;  3RXX A;  4JXG A;  4IVK A;  5F82 A;  1T1C A;  1OPX A;  3O5Y A;  3HLE A;  1IKG A;  2JKF A;  4ARZ B;  4P6Z S;  4BBU A;  2WKE A;  2OWJ A;  5FL3 A;  3F1O A;  4XT2 B;  5F5Y A;  3N8L A;  4HQA A;  1CJF A;  2WAD A;  1TS7 A;  2W0N A;  4E3M A;  3E4P A;  3WRZ A;  3MQO A;  2ZQD A;  3UE0 A;  2O9B A;  4MBH A;  1YLW A;  1L3L A;  3ZQ5 A;  2PDR A;  3ISG A;  3Q7V A;  3LID A;  3E4Q A;  3KSI A;  4CLC E;  3FPV A;  1L0E A;  3OCN A;  4R3J A;  2ZC7 A;  1LSX A;  2VKS A;  4NG2 A;  4BJP A;  4EBL A;  4WZ5 C;  1TDL A;  4K91 A;  4WEL A;  4E3J A;  3G32 A;  5AQB A;  2H10 A;  2PBY A;  1HLU P;  4P0M A;  3VSK A;  4R38 A;  4EUZ A;  3C7V A;  3KSH A;  3S4X A;  3MZD A;  3G34 A;  3GEC A;  5DF9 A;  2EX2 A;  3S7P A;  4F3L B;  5A92 A;  5E2H A;  4DDY A;  4DRT A;  3CI6 A;  2Q0O A;  2HDQ A;  2JKG A;  2QMI A;  2HF6 A;  1MKM A;  2FFY A;  1ES3 A;  3BYD A;  1ZC2 A;  4G3W A;  4Y2F A;  5IT5 A;  2WKP A;  3LY3 A;  2EXB A;  1V9Y A;  3T4Q A;  5GLB A;  4YFM A;  3CUE C;  4EEP A;  3EEH A;  4KZ4 A;  4HIA A;  3G2Z A;  4WEJ A;  1HTZ A;  3BFG A;  3F1N A;  3M6H A;  3FYZ A;  2Y2M A;  4HOI A;  4LV2 A;  3ZFZ A;  5DJU A;  4D2O A;  2VGK A;  5CHM A;  4AFI A;  5FEF A;  3SOI A;  5EVI C;  3P09 A;  4WL9 A;  5FQK A;  5IS1 A;  4L0L A;  4CJN A;  3S7O A;  5DFX A;  4O8G A;  3ZNT A;  3ZDJ A;  3IH9 A;  2B95 A;  2JKT M;  3N4I A;  4DDS A;  3T4K A;  1T1A A;  2PAV P;  2VA0 A;  3DW0 A;  5AQA A;  3BFC A;  3JYI A;  2O99 A;  4S2I A;  3A3E A;  2H0T A;  1KDS A;  1DJA A;  3PXP A;  1D7E A;  4BBT A;  1N9B A;  3B42 A;  3RH8 B;  2BAS A;  1NLZ A;  2J3T D;  4OOL A;  3BLM A;  3IXD A;  1L0D A;  5KZH A;  4LV3 A;  2ZM2 A;  3ZCZ A;  3IH8 A;  3GMW A;  4B93 A;  1CI8 A;  5DKK A;  1EW0 A;  3PBT A;  4MMN A;  4X55 A;  5FAQ A;  4ZDX A;  1JWP A;  2HP5 A;  3IWQ A;  4EWF A;  5F1F A;  4Q0J A;  2Y91 A;  3M6B A;  4EV4 A;  3DBA A;  4B88 A;  5A93 A;  1ESU A;  1OJ5 A;  3NJA A;  1K56 A;  4PHT A;  2ZC5 B;  5G18 A;  1K6S A;  2QPN A;  2ZMF A;  5F68 A;  5FA7 A;  3FV7 A;  3BJN A;  4MLL A;  3LIF A;  4RYE A;  3EWK A;  3LIA A;  3ZG8 B;  1GHM A;  1CEF A;  5JYO A;  1W5D A;  3T12 B;  4NKP A;  4RX3 A;  2A24 A;  3LIC A;  5A8B A;  3ZGA B;  1PWD A;  2Z6D A;  2FZ0 A;  1S66 L;  3KYE A;  1NZU A;  1P9W A;  4ARZ A;  1BLH A;  1YLP A;  3BFD A;  2HP9 A;  1W63 M;  5HAP A;  2Y2K A;  3JPU A;  1VET A;  1CK3 A;  1T18 A;  1KVL A;  2P7J A;  3O86 A;  1PRQ A;  2J9P A;  3U4L P;  3PAG A;  2JE5 A;  3DTK A;  1S67 L;  2GZA A;  4KQO A;  2H5S A;  3KSG A;  3RTY A;  5KSC A;  2RL3 A;  3IWO A;  4CLC B;  3AGE A;  1NJ4 A;  3QP5 A;  2OV5 A;  4C6Y A;  2WGV A;  1XX2 A;  5BOH A;  5CHU A;  3PBR A;  5HDS A;  3UE1 A;  1F98 A;  4ETZ A;  4NXF A;  1NLY A;  1O07 A;  1OT9 A;  4DMZ A;  2K31 A;  3V3S A;  3W8K A;  3IS2 B;  4MN7 A;  2ZC3 B;  3SW1 A;  5GLD A;  3PBS A;  1JNU A;  1LLB A;  3CPT B;  2YKF A;  5FI2 A;  4FCF A;  1M6K A;  1GCE A;  4GDB A;  3R4K A;  4Y13 A;  5CX7 A;  5FQ9 A;  2ZOI A;  2WZZ A;  1JWV A;  2XF3 A;  2QKP A;  2ZQC A;  1TS8 A;  3UDI A;  1I2S A;  2HV1 A;  1Y4O A;  2HJE A;  2JKT I;  1MWS A;  1BT5 A;  3K3C A;  5CEC A;  3O88 A;  5CGX A;  1FOF A;  1ES2 A;  3ICY A;  4KZ5 A;  1A0K A;  1DP9 A;  3IF5 A;  4R3B A;  3UB8 A;  4PMA A;  5CER A;  4MBF A;  2Y79 A;  2IWD A;  5DFY A;  1K4E A;  3S22 A;  2BLS A;  1VHM A;  3GRJ A;  3WRT A;  5TBM A;  1S1Y A;  3H82 B;  1P9R A;  3HBR A;  2Z6C A;  5HDC A;  4NEE D;  4CQH A;  1BTL A;  1XJ4 A;  2J3T C;  1N9L A;  3T1S A;  5FQJ A;  4WMC A;  2HGV A;  3S1Y A;  4GD8 A;  4BL2 A;  4BD0 A;  2H28 A;  4JLF A;  2W3F A;  2P08 A;  1YLZ A;  2V1B A;  5I5L A;  2XSS A;  2HZ5 A;  4E3L A;  1OTE A;  2DRW A;  1K55 A;  1LSW A;  4EBP A;  3ZG9 B;  3S7N A;  5GL9 A;  3E2L A;  1W63 Q;  2C5W B;  5JYP A;  2ZQ8 A;  4WF0 A;  2VEA A;  1OTA A;  1BUE A;  3GVB A;  3FPW A;  3LIE A;  4N9L A;  3VOY A;  3HJK A;  2A2L A;  1XGJ A;  3RXW A;  5L8M A;  2I72 A;  4NET A;  4N92 A;  1K55 C;  4JPM A;  3MXS A;  5FSR A;  3LFV A;  3Q1F A;  5AQ7 A;  2IA2 A;  4YOF A;  2QYB A;  3G31 A;  2V9A A;  4R23 A;  1LL9 A;  3CWF A;  1ERM A;  5IU1 A;  3VFF A;  2WYX A;  3LY4 A;  2EX9 A;  4KG2 A;  2Y2J A;  2WGI A;  2Z2M B;  3PBN A;  2QZ6 A;  1PNE A;  1FR6 A;  4LLO B;  2HDS A;  2XFS A;  4E04 A;  1PZO A;  2GDN A;  4HES A;  3MFD A;  3PYP A;  3OC2 A;  5DKL A;  4C3Q A;  4HJ6 A;  2XRN A;  2JN7 A;  4LV0 A;  3B47 A;  3BFF A;  5C5K A;  5CEB A;  4ZJ1 A;  4PPR A;  1C3B A;  2A3U A;  1GSX A;  4NXE A;  1LI0 A;  4OVD A;  1SDN A;  2CC1 A;  2ZC4 B;  4HBU A;  3VP3 A;  1XFQ A;  1XXM A;  2VLG A;  3G6O A;  4P85 A;  4DKI A;  5M18 A;  3CG5 A;  2XDM A;  3BY9 A;  3UPN A;  2WKH A;  3FG8 A;  3H82 A;  3IHB A;  4IUH A;  4HI4 A;  1IYQ A;  1F5M A;  2EXA A;  4EU0 A;  2PT7 A;  4NXB A;  3VFH A;  2J3W A;  3HLD A;  2XGN A;  2Y2N A;  3W4Q A;  3HLB A;  5FQQ A;  4P6B A;  3E98 A;  2XLN A;  3MMH A;  3VMA A;  3QP6 A;  3SS3 A;  5HX9 A;  1YSP A;  3SS5 A;  4KQQ A;  4E3I A;  5EUA A;  3KO6 A;  1YQS A;  3A0R A;  3BEC A;  3EGD C;  5DF7 A;  1P97 A;  2QJ5 A;  2PRF A;  2AVX A;  3UPO A;  3NCK A;  4EQ1 A;  3UB6 A;  1ZKJ A;  2EFU A;  3QP8 A;  3A3J A;  4X68 A;  5J8X A;  1S6R A;  1FCN A;  5EOE A;  1F9I A;  5FAO A;  3SH7 A;  1OTB A;  1YPR A;  4S2K A;  4P87 A;  1BUL A;  2JHE A;  4E3K A;  5TBM B;  4KZB A;  4JXS A;  4HH2 A;  5LBR A;  3LI9 A;  2XR0 A;  1NYY A;  3D72 A;  3MKE A;  2M1C A;  3PBQ A;  4YNR A;  3QHY A;  3U2A A;  2PR5 A;  4I39 A;  3GQZ A;  4JGP A;  3VV4 A;  3V50 A;  4HBT A;  1N9N A;  1FSY A;  1K6R A;  1QMF A;  5GHZ A;  3UB9 A;  3WWX A;  3A3F A;  3LEZ A;  3HUM A;  1L0G A;  3C38 A;  4E3O A;  4WYY A;  1ACF A;  2DCF A;  3VP4 A;  3MSH A;  4B9O A;  1YMX A;  4BQM A;  4OQG A;  5IHV A;  2PBD P;  3CHW P;  2HDU A;  2J80 A;  4I38 A;  5J4E A;  1OTI A;  1FCO A;  4WZ5 A;  3OOV A;  4R0Q A;  2ZM8 A;  2G2W A;  3HLF A;  4PM7 A;  1XP4 A;  2JCH A;  1L2S A;  4M3K A;  5EM1 A;  1NXY A;  3GSG A;  1ERO A;  4OH0 A;  5HAI A;  5EVI D;  2Y4A A;  5CRF A;  1RGZ A;  3FKW A;  2V1A A;  3CMZ A;  3F1P B;  4JF6 A;  4XUZ A;  1GHI A;  4JKT A;  2W1T B;  2Y2L A;  4IHQ A;  3HRE A;  4OPZ A;  3IXG A;  4KZ3 A;  4Z9Q A;  1H0M A;  4GS9 B;  2VX8 A;  3P98 A;  4I3I A;  3S7Q A;  1LT0 A;  4C75 A;  4GLQ A;  3MXR A;  1TDG A;  1GHP A;  2KOI A;  4KZ9 A;  3BQA A;  4GOG A;  1PW1 A;  3NOT C;  4WM9 A;  3UO9 A;  2JKR I;  3T4S A;  1UGU A;  3GTC A;  4HJ4 A;  3SS4 A;  3LR4 A;  3WS5 A;  4PAU A;  3LEQ A;  2O9A A;  2XK1 A;  4Y0O A;  2JBF A;  5FAS A;  4Y5F A;  1FR1 A;  1H8Y A;  4BBV A;  3HLC A;  4CLC D;  1ZTU A;  4X53 A;  2PR6 A;  5M19 A;  1PWC A;  4FSF A;  5EVI A;  1I5Q A;  3NOU C;  2LB5 A;  2ZLY A;  5EVL A;  2WAE A;  3NDG A;  4G3V A;  1PI5 A;  5CGS A;  1NWZ A;  3BFE A;  2EWW A;  3SH9 A;  3NHQ A;  2B5R A;  4GJ4 A;  5A91 A;  1IYP A;  3C2W A;  1PIO A;  5FI6 A;  4O7D A;  4Y15 A;  2WGW B;  4QY6 A;  3CUE A;  4CPK A;  4DE1 A;  5L09 A;  5E2E A;  3LGO A;  4QY5 A;  4EQI A;  2ZOH A;  3IXB A;  4GKU A;  2P74 A;  4PM9 A;  2IWB A;  3W4O A;  2JKR M;  1EWZ A;  3LR3 A;  2ZMA A;  4K0W A;  4Y0T A;  3RJU A;  4ZRR A;  4BEN A;  3QP1 A;  2BTF P;  3AGD A;  2FFF B;  2GJ3 A;  1IOU A;  3IX3 A;  4UA6 A;  4Q0I A;  1STZ A;  5MC7 A;  2L1M A;  2I9V A;  4HNB A;  2Y59 A;  2G2U A;  5HW3 A;  1YLJ A;  2Y2Q A;  1T19 A;  4OPR A;  2EWV A;  3N8R A;  3A0V A;  4LRX C;  5L07 A;  4HJ3 A;  3JVV A;  3C4O A;  5GHX A;  3WS1 A;  1K0K A;  5HPI A;  2YKH A;  3IF6 B;  1LL5 A;  3ITA A;  3V3R A;  5CXW A;  5E2F A;  3FC7 A;  3MQQ A;  1RGY A;  2B18 A;  4B4Z A;  1E3U A;  4S2J A;  1I2W A;  3B3X A;  2OWH A;  4LCL A;  3KYZ A;  4JF4 A;  3T4L A;  3CLO A;  3ZG7 B;  4JBF A;  1J9M A;  5HL6 A;  3C8C A;  4R3A A;  4LRY C;  5J3W A;  4RQ9 A;  3LIB A;  4GNU A;  4KQR A;  4KG5 A;  4NK3 A;  4L9F A;  4XXR A;  3LCE A;  1TD5 A;  2WZX A;  5L10 A;  3QNB A;  3BM6 A;  5FQM A;  2W27 A;  1P0Z A;  3P01 A;  4Y0U A;  5DTT A;  4S2L A;  3K3D A;  5EM0 A;  4GHI B;  3HUO A;  3ZNY A;  4H6J A;  2ZM0 A;  4QPR A;  3Q7Z A;  2WK0 A;  2Y2P A;  2P04 A;  3IQA A;  4FD8 A;  4OQI A;  3IF6 C;  5L2F A;  2V1Z A;  2L0W A;  2WKI A;  4MN5 A;  3UB5 P;  1EI5 A;  3GV9 A;  4DXB A;  1SDE A;  2Y8H A;  1WE4 A;  2VV6 A;  2ZJ9 A;  4HP4 A;  1W79 A;  2NUP C;  5KMW A;  1KE3 A;  5U47 A;  2EX8 A;  2D02 A;  3FWL A;  4X1L A;  4I3A A;  2Q9N A;  4F3L A;  3HLG A;  1K54 C;  1JTD A;  3MZF A;  3LUQ A;  4YWZ A;  2MJ6 A;  3MQ0 A;  3MKF A;  2EFX A;  1BLC A;  4F94 A;  1BLP A;  3UDF A;  2QWS A;  5EFW A;  4GZB A;  1GSV A;  5KSH A;  3VP2 A;  3QP2 A;  1N4O A;  4ZJ3 A;  1MWT A;  4EER A;  4KEN B;  2OAQ 1;  5HFO A;  1Y54 A;  4QHC A;  1VET B;  1KVM A;  1L0F A;  4OP5 A;  4I5S A;  5FEG A;  3Q81 A;  4BMW A;  4FUW A;  2QHK A;  3VOZ A;  5TR7 A;  3ZVT A;  2BG1 A;  3OLO A;  1KE4 A;  4QJG A;  1G28 A;  2XRO A;  4FOF A;  3ZG5 A;  5F69 A;  2UWX A;  3F1O B;  4XT2 A;  3A0S A;  3ZVW A;  5AJG A;  1V9Z A;  3PR6 A;  3HLW A;  3QNC A;  4IJG A;  3DTM A;  1JWZ A;  4DE2 A;  1K38 A;  4ZTK A;  5DF8 A;  3H7W B;  2J9O A;  1OT6 A;  3OPL A;  1UWP X;  4HY8 A;  2JC7 A;  5AVF A;  4KZA A;  1XGI A;  1DY6 A;  1HD8 A;  2HJ9 C;  2Y2I A;  4BD1 A;  1Z09 A;  3IHA A;  2A49 A;  3A3D A;  3UE6 A;  3T50 A;  3HVF A;  4BWI A;  2P9V B;  2V0W A;  4JGR A;  2GX5 A;  2R9W A;  3DAV A;  2PYP A;  4KZ7 A;  4E6X A;  4IBX A;  2CMN A;  4Y3I A;  3BRM A;  3DWZ A;  2PD7 A;  2ZD8 A;  2E8J A;  3VSL A;  5HD3 A;  1MXO A;  1JVJ A;  4MBK A;  1FCM A;  1DJB A;  3GDI A;  1ALQ A;  4P6Z M;  4Y17 A;  2X01 A;  1KGF A;  1NRF A;  2DNS A;  2OOL A;  5FAP A;  1QME A;  4ZBE A;  3TRC A;  4UEY A;  1MKI A;  3T4J A;  1M40 A;  1ERQ A;  1H3Q A;  1YAX A;  1H5X A;  1XJ6 A;  3VE4 A;  1TF1 A;  2L4R A;  2VV7 A;  3T4T A;  3MJQ A;  4X6T A;  2VK3 A;  4CLC A;  4PM8 A;  2H0Y A;  2VGL S;  3BW6 A;  3P7N A;  3BEB A;  5D3O A;  3PTE A;  4OP8 A;  3KYQ A;  1CEG A;  2O0Y A;  4S2P A;  4XUX A;  3HJI A;  2Y2G A;  2X71 A;  4GCZ A;  1GSW A;  3H7W A;  1S4R A;  2KDK A;  4S2N C;  5DTK A;  5J7E A;  2Y2O A;  4QB8 A;  1IEM A;  2VGJ A;  3IT9 A;  4A5R A;  2OSU A;  3OCL A;  3UE3 A;  3IWI A;  3E0Y A;  1Q2Q A;  4R1G A;  3UY6 A;  4NXG A;  3TW8 A;  1ZG4 A;  2Y2H A;  3R7W B;  3VOL A;  2M7V A;  5E2G A;  2DMW A;  2INW A;  2D01 A;  1ONG A;  4UA7 A;  4GW9 A;  1MY8 A;  3MZE A;  4IED A;  5HPF A;  2PYR A;  2Y55 A;  5HSQ A;  1Z6F A;  1G6A A;  1SCW A;  4JXV A;  4KUO A;  5GHY A;  1LI9 A;  1E25 A;  2ZQA A;  3E2K A;  3V39 A;  4N1H A;  3UB7 A;  4OKP A;  5F1G A;  3NEC A;  3FKV A;  3Q7V B;  1HZO A;  2R9X A;  3WS0 A;  1G6O A;  2QJ7 A;  3KX0 X;  4ESP A;  1TEM A;  4R4S A;  4QU3 A;  4ID4 A;  3HUN A;  5EPH A;  1TS6 A;  3W2Z A;  4BL3 A;  3OZH A;  2IWC A;  2C6W B;  1VEU B;  2WKR A;  4QWO A;  3TE8 A;  3G2Y A;  1VEU A;  2B02 A;  3DTI A;  3NBL A;  3IX8 A;  1K57 C;  1PW8 A;  3Q07 A;  1XKZ A;  2UV0 E;  2M7U A;  3BLS A;  3L9K A;  2W3H A;  1BLS A;  4M4X A;  5EV0 A;  1PZP A;  4U0T A;  4R70 A;  4GN2 A;  1H8Z A;  1E4D A;  4UAA A;  5EVE A;  3V5M A;  4GHI A;  3C5A A;  3LO7 A;  1UWN X;  5F83 A;  3PAE A;  5K5B A;  3CJM A;  3VP1 A;  3MF0 A;  3MS6 A;  1ES4 A;  2W3G A;  3N7W A;  4LGW A;  2XEP A;  2WGW A;  1W7F A;  1KE0 A;  4ZJ2 A;  4HHD A;  4EW7 A;  1J3W A;  1ZG6 A;  3E4O A;  4Z1W A;  3D3O A;  5GLA A;  1MPL A;  4KG6 A;  3L7H A;  4OPY A;  4HEF A;  4WMC D;  2PD8 A;  3G4P A;  4DXC A;  5EVI B;  3T1Q B;  1FSW A;  3CZD A;  5EE8 A;  4UQI M;  2XD1 A;  2EX6 A;  4WBG A;  2V8C A;  1JTG A;  4ETX A;  1RCJ A;  4X56 A;  3RFB A;  4WUJ A;  5HAQ A;  4B4X A;  5CED A;  2KLI A;  1MWU A;  1PYY A;  4UA9 A;  3Q82 A;  4X1M A;  5HWV A;  2V0U A;  4HP9 A;  1LSV A;  3I7J A;  5TGF A;  5EEC A;  3QP4 A;  3R7W A;  3ZG0 A;  1S4S A;  3OBF A;  5EOO A;  4EXO A;  2PHY A;  4E3N A;  4OLD A;  4RX2 A;  5KIZ A;  4KZ6 A;  5G4Y A;  1AXB A;  4WLA A;  4OON A;  1MC0 A;  3CPT A;  4D60 A;  4RA7 A;  1PFL A;  3K2N A;  4S2N A;  4DE3 A;  2ZMV A;  3BWL A;  3PBO A;  3OPP A;  1NYM A;  4GDN A;  1S1Z A;  3MR0 A;  4K0X A;  1ONH A;  5FI7 A;  1MZU A;  1YT4 A;  3A3I A;  1YLT A;  3TG9 A;  1RP5 A;  2ZQ7 A;  1PI4 A;  3LR5 A;  3EOI A;  1WYC A;  1K25 A;  4LFU A;  4LPZ A;  2ZBB A;  4I3J A;  3IS2 A;  4WEK A;  3PHY A;  4OLG A;  4FH4 A;  4JXW A;  4CLC C;  1TVF A;  5A90 A;  1IYO A;  3WS2 A;  3WS4 A;  1IEL A;  3BY8 A;  4MNR A;  4L9G A;  4FH2 A;  1VB6 A;  5AVE A;  2XFT A;  4OOY A;  2PU2 A;  3W4P A;  4GB7 A;  1XPB A;  1GA9 A;  5CTM A;  1XA7 A;  3VP0 A;  4DE0 A;  4R6L A;  5HZH A;  3MFX A;  3MXQ A;  1XJ3 A;  2XD5 A;  5TFQ A;  5F6A A;  2Q9M A;  3IBJ A;  3T1X A;  1GA0 A;  5FAT A;  4Q8I A;  1K57 A;  5CGW A;  4WN5 A;  1H8M A;  1YM1 A;  4L9E A;  3MBZ A;  1OTD A;  1SKO B;  4LCM A;  4PM6 A;  1DRM A;  4OOM A;  1FIL A;  4BLM A;  2W1R A;  3JVU A;  4H6J B;  1ES5 A;  3OPR A;  4Q0H A;  2Z2L B;  4LV1 A;  2ZL1 B;  4N1X A;  3TSG A;  2OAP 1;  3C4P A;  1T1B A;  3EQV A;  2XA7 M;  4R4R A;  3GR2 A;  4OQ0 A;  2VGL M;  3OPH A;  3N6I A;  2GNX A;  1G68 A;  3T4O A;  4WZ4 A;  1ZHH B;  1KOU A;  4HH3 A;  3SZT A;  1YLY A;  1VQQ A;  1MWR A;  4E6W A;  1D06 A;  5FDS A;  1ESI A;  1HVB A;  2LB9 A;  3AGF A;  1AWI A;  3O3V A;  4MEZ A;  2XQZ A;  4DJ2 A;  4PKY G;  3D9Y A;  2W3E A;  1SKF A;  5FDH A;  1K4F A;  1G5U A;  4ME4 A;  4EEU A;  2V8F A;  2VZW A;  1MBL A;  4LEN A;  1Q2P A;  3IXH A;  1KDW A;  1CI9 A;  3TJZ C;  3NDE A;  2V20 A;  1DP8 A;  3ITB A;  4U0X A;  1LHY A;  2ZQ9 A;  3HL9 A;  4Y7P A;  5DTS A;  4YIN A;  4PKY A;  4FTX A;  2WUQ A;  4IVI A;  1OME A;  3LR0 A;  4KUK A;  3BQ8 A;  4S2O A;  5TJJ A;  3NC8 A;  2RCX A;  3ZYT A;  1NY0 A;  3N8S A;  2G7U A;  1KGG A;  3EEA A;  2PU4 A;  2ZL1 A;  1U60 A;  1FIK A;  1XFN A;  3D4F A;  1BSG A;  3LI8 A;  2XA7 S;  1K56 D;  3C30 A;  4II7 A;  4O0P A;  5GLC A;  1TS0 A;  5G4Z A;  1XJ2 A;  3VE3 A;  1IFQ A;  2KX6 A;  1CF0 A;  3CAX A;  2V2F F;  4X25 A;  4IBR A;  5CHJ A;  4UQI S;  2HP6 A;  3IF6 A;  3ZHH A;  1W8Y A;  1CQA A; 
#chains in the Genus database with same CATH homology
 1P9W A;  4ARZ A;  4EUV A;  2W1T B;  4IHQ A;  3OCL A;  1W63 M;  3H9W A;  2VV8 A;  3UE3 A;  3E0Y A;  3F1N B;  3HCY A;  4JGO A;  1T18 A;  2P7J A;  4NXG A;  4GS9 B;  3TW8 A;  2K7S A;  2VX8 A;  3R7W B;  3VOL A;  2M7V A;  4I3I A;  3S7Q A;  1LT0 A;  2DMW A;  2INW A;  4GLQ A;  2D01 A;  4GW9 A;  1S67 L;  2GZA A;  4KQO A;  3KSG A;  5HPF A;  2PYR A;  3RTY A;  5HD5 A;  5HSQ A;  4CLC B;  4MDZ A;  2KOI A;  2EA9 A;  4KUO A;  4LRZ E;  3BQA A;  3NOT C;  3NOP C;  2JKR I;  4DN0 A;  3T4S A;  1UGU A;  4HJ4 A;  3UB7 A;  3PBR A;  3LR4 A;  5HDS A;  1F98 A;  2W3D A;  4ETZ A;  1N9O A;  4NXF A;  1NLY A;  1OT9 A;  4PAU A;  1Y28 A;  4DMZ A;  2O9A A;  3KSF A;  2FH5 A;  4EET B;  1G6O A;  4IUK A;  2QJ7 A;  4Y5F A;  3KX0 X;  4BBV A;  4CLC D;  2K31 A;  1ZTU A;  2PR6 A;  1NRJ A;  1X0O A;  4FSF A;  3NOU C;  2LB5 A;  3IS2 B;  3W2Z A;  1TS6 A;  4MN7 A;  4GS9 A;  4G3V A;  3EGX C;  2WKR A;  1NWZ A;  3SW1 A;  2EWW A;  3NHQ A;  3TE8 A;  4GJ4 A;  3PBS A;  2B02 A;  1JNU A;  3C2W A;  2W1T A;  2YKF A;  1ODV A;  3V67 A;  1OJG A;  5HDD A;  2M7U A;  3CUE A;  3F1P A;  1YSQ A;  3R4K A;  2W3H A;  5CX7 A;  4M4X A;  2ZOI A;  2VJW A;  4R70 A;  2O9C A;  2ZOH A;  4GHI A;  5DJT A;  1UWN X;  2JKR M;  2A24 B;  3LR3 A;  5K5B A;  2QKP A;  4K08 A;  1TS8 A;  3MF0 A;  3ULF A;  2HV1 A;  4ZRR A;  2HJE A;  2JKT I;  4MN6 A;  2W3G A;  3K3C A;  3UMD A;  3ICY A;  1IOU A;  2GJ3 A;  1YKD A;  4HHD A;  4MCW A;  1DP9 A;  4EW7 A;  3E4O A;  4Q0I A;  4Z1W A;  1STZ A;  3EQU A;  3D3O A;  5MC7 A;  2L1M A;  3UB8 A;  2I9V A;  4HNB A;  2PD8 A;  2Y79 A;  5DFY A;  1VHM A;  4EES A;  5TBM A;  1BYW A;  1T19 A;  2EWV A;  1S1Y A;  3A0V A;  4LRX C;  3H82 B;  1LL8 A;  4HJ3 A;  1P9R A;  3JVV A;  4UQI M;  2Z6C A;  5HDC A;  4NEE D;  1WA9 A;  1DP6 A;  4KQD A;  3CIT A;  4CQH A;  4DJ3 A;  4G3K A;  4ETX A;  5HPI A;  2YKH A;  1XJ4 A;  2J3T C;  1N9L A;  2HGV A;  3LYX A;  3RFB A;  4WUJ A;  3FC7 A;  2K2N A;  2NUT C;  2H28 A;  3IBR A;  3MQQ A;  2B18 A;  2W3F A;  2P08 A;  2V1B A;  5I5L A;  2XSS A;  3UME A;  2KLI A;  1OTE A;  5HWV A;  1LSW A;  2V0U A;  2OWH A;  3S7N A;  3KYZ A;  4JGQ A;  3B33 A;  4HP9 A;  2WKQ A;  1LSV A;  3T4L A;  3CLO A;  1W63 Q;  5HWW A;  2R78 A;  5HL6 A;  3R7W A;  3C8C A;  4R3A A;  4LRY C;  5J3W A;  1S4S A;  3OBF A;  4O01 A;  4RQ9 A;  4WF0 A;  4EXO A;  3LIB A;  2VEA A;  2PHY A;  1OTA A;  4L9F A;  3FPW A;  5HWT A;  1TD5 A;  3LIE A;  5KIZ A;  5G4Y A;  1T1C A;  1OPX A;  3O5Y A;  4WLA A;  2W27 A;  1P0Z A;  3HJK A;  2A2L A;  4ARZ B;  4BBU A;  4P6Z S;  3P01 A;  5L8M A;  1MC0 A;  3K3D A;  2OWJ A;  4GHI B;  5FL3 A;  3F1O A;  4H6J A;  4XT2 B;  4QPR A;  5F5Y A;  4HQA A;  3LFV A;  1TS7 A;  2P04 A;  2W0N A;  2IA2 A;  3K2N A;  3E4P A;  4YOF A;  2QYB A;  2ZMV A;  3BWL A;  3PBO A;  2V9A A;  2L0W A;  4MN5 A;  3MQO A;  3CWF A;  1S1Z A;  3MR0 A;  5IU1 A;  2O9B A;  2Y8H A;  2VV6 A;  3ZQ5 A;  2PDR A;  1MZU A;  3LID A;  4HP4 A;  2NUP C;  3E4Q A;  3KSI A;  4CLC E;  3FPV A;  3OCN A;  3LR5 A;  1LSX A;  2VKS A;  3EOI A;  3PBN A;  4LLO B;  4LPZ A;  2ZBB A;  2D02 A;  3IS2 A;  4I3J A;  4WEK A;  4BJP A;  3PHY A;  4I3A A;  4E04 A;  4F3L A;  4CLC C;  4WEL A;  3LUQ A;  4YWZ A;  2MJ6 A;  3MQ0 A;  3PYP A;  3OC2 A;  5DKL A;  4HJ6 A;  4R38 A;  2XRN A;  3BY8 A;  4L9G A;  2JN7 A;  3KSH A;  1VB6 A;  2QWS A;  3GEC A;  5DF9 A;  5EFW A;  5AVE A;  3B47 A;  5C5K A;  1GSV A;  5KSH A;  3S7P A;  4F3L B;  4EER A;  2OAQ 1;  3CI6 A;  1GSX A;  4NXE A;  4R6L A;  2HF6 A;  3MFX A;  5HZH A;  4I5S A;  1MKM A;  4BMW A;  3MXQ A;  1XJ3 A;  1XFQ A;  4Y2F A;  4G3W A;  5F6A A;  5IT5 A;  2QHK A;  3IBJ A;  2WKP A;  2VLG A;  3G6O A;  1V9Y A;  3T4Q A;  3OLO A;  3CUE C;  4EEP A;  3EEH A;  1G28 A;  2XRO A;  4FOF A;  4HIA A;  5F69 A;  4WEJ A;  4WN5 A;  3BY9 A;  3F1O B;  4XT2 A;  3F1N A;  3A0S A;  1H8M A;  3FG8 A;  3H82 A;  5AJG A;  4HOI A;  4IUH A;  1V9Z A;  3PR6 A;  4L9E A;  1OTD A;  4HI4 A;  4IJG A;  5DJU A;  1F5M A;  1DRM A;  4AFI A;  4OOM A;  4EU0 A;  2PT7 A;  4NXB A;  2J3W A;  2W1R A;  3JVU A;  4H6J B;  3H7W B;  4WL9 A;  5IS1 A;  4Q0H A;  3E98 A;  3MMH A;  1OT6 A;  4L0L A;  3S7O A;  5DFX A;  1UWP X;  1YSP A;  4HY8 A;  4O8G A;  2OAP 1;  5AVF A;  1T1B A;  3EQV A;  2XA7 M;  3KO6 A;  3A0R A;  2HJ9 C;  3EGD C;  2VGL M;  1P97 A;  2JKT M;  2QJ5 A;  2GNX A;  3T4O A;  1ZHH B;  1KOU A;  3UE6 A;  3T50 A;  4HH3 A;  3T4K A;  4BWI A;  4EQ1 A;  1T1A A;  2V0W A;  4JGR A;  3UB6 A;  2GX5 A;  2VA0 A;  2PYP A;  1D06 A;  2LB9 A;  2CMN A;  4Y3I A;  4DJ2 A;  4PKY G;  2O99 A;  2PD7 A;  2W3E A;  1F9I A;  3PXP A;  1OTB A;  1D7E A;  5HD3 A;  4ME4 A;  4BBT A;  4EEU A;  2VZW A;  3B42 A;  3RH8 B;  2JHE A;  2BAS A;  1NLZ A;  5TBM B;  2J3T D;  4OOL A;  3GDI A;  4HH2 A;  5LBR A;  3LI9 A;  3TJZ C;  3D72 A;  1DP8 A;  2M1C A;  3PBQ A;  4YNR A;  4P6Z M;  3U2A A;  2PR5 A;  4I39 A;  4B93 A;  5DKK A;  2OOL A;  1EW0 A;  3PBT A;  4MMN A;  4JGP A;  3VV4 A;  4PKY A;  3TRC A;  4UEY A;  3LR0 A;  1N9N A;  4KUK A;  3BQ8 A;  5TJJ A;  4Q0J A;  3T4J A;  3ZYT A;  1H3Q A;  1YAX A;  3UB9 A;  2G7U A;  1XJ6 A;  3C38 A;  3VE4 A;  1TF1 A;  2L4R A;  3DBA A;  3EEA A;  2VV7 A;  3T4T A;  3MJQ A;  4B9O A;  1OJ5 A;  3NJA A;  2J80 A;  4I38 A;  5J4E A;  4PHT A;  1OTI A;  4CLC A;  2ZMF A;  5F68 A;  2VGL S;  1XFN A;  3P7N A;  3BJN A;  3BW6 A;  3OOV A;  3LIF A;  3EWK A;  3LIA A;  3LI8 A;  2XA7 S;  3KYQ A;  3C30 A;  4NKP A;  4II7 A;  2O0Y A;  4O0P A;  1TS0 A;  5G4Z A;  1XJ2 A;  2A24 A;  3LIC A;  3HJI A;  5A8B A;  3VE3 A;  1IFQ A;  2KX6 A;  4GCZ A;  3CAX A;  2Z6D A;  2FZ0 A;  1S66 L;  1GSW A;  3H7W A;  1S4R A;  4UQI S;  2KDK A;  2V1A A;  5J7E A;  3F1P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...