4QPRA

Crystal structure of gaf domain of potassium sensor histidine kinase kdpd from escherichia coli
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
142
structure length
142
Chain Sequence
GAMDLYEMSKALAVGRSPQDIAATSEQFIASTFHARSQVLLPDDNGKLQPLTHPQGMTPWDDAIAQWSFDKGLPAGAGTDTLPGVPYQILPLKSGEKTYGLVVVEPGNLRQLMIPEQQRLLETFTLLVANALERLTKLAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor protein KdpD
publication title Crystal Structure of Gaf Domain of Potassium Sensor Histidine Kinase Kdpd from Escherichia Coli
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 38
structure length 142
sequence length 142
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13492 GAF_3 GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4qprA00
1YSPA 1STZA 3KSHA 3CITA 4MDZA 4Y3IA 4CQHA 3S7PA 2ZMFA 3OOVA 1TF1A 5HSQA 4MN7A 2QYBA 2M7VA 4LRYC 5LBRA 4IJGA 1ZTUA 3CI6A 4IUKA 3NHQA 2Y8HA 3MQ0A 4EU0A 2K31A 3K2NA 2M7UA 5AJGA 3RFBA 4ZRRA 2K2NA 2W1TB 2O9BA 3S7OA 1MKMA 2KLIA 4Q0IA 4PAUA 4DN0A 4GLQA 2W3FA 3E98A 5DFXA 3KSIA 3VV4A 4Q0HA 3ZQ5A 2OOLA 4R6LA 3NOPC 3BJNA 4Y5FA 4BWIA 2KOIA 3G6OA 2W1RA 4DMZA 5I5LA 4ME4A 3C2WA 4FOFA 4ETZA 2VZWA 4ETXA 2W3DA 1YSQA 3IBJA 4O0PA 4IUHA 4YNRA 4YOFA 3TRCA 3D3OA 4LRXC 3NOUC 3KSGA 2W3HA 2O9AA 2LB5A 3EEAA 2VJWA 4MMNA 4Z1WA 3NOTC 4LRZE 3R4KA 3DBAA 4G3KA 3OBFA 5K5BA 2XRNA 4R70A 2XSSA 3E0YA 2VEAA 4GW9A 4RQ9A 1YKDA 3HCYA 4O01A 2XROA 3S7NA 4O8GA 5HL6A 2G7UA 5HPIA 2W3EA 3KO6A 1MC0A 2IA2A 3W2ZA 4G3WA 2W3GA 3MMHA 3KSFA 5TJJA 1TD5A 2Y79A 1F5MA 4MCWA 4G3VA 5HPFA 3LFVA 2LB9A 3MF0A 2HGVA 2O99A 3S7QA 2B18A 4Q0JA 4QPRA 2O9CA 2W1TA 5L8MA 3IBRA 4Y2FA 3O5YA 5DFYA 4E04A 2GX5A 1VHMA 2O0YA 2VKSA 4EUVA 5C5KA
chains in the Genus database with same CATH superfamily
4S2NA 3QP1A 3GR2A 4KQQA 2QMIA 3C5AA 3IWQA 1GHMA 5FQJA 1S1YA 4DF6A 5LBRA 4HBUA 2Q0OA 4GD8A 2EX8A 3GVBA 4R3BA 1N9NA 3UE6A 3G32A 4WM9A 4QB8A 2P74A 4S2IA 3TJZC 3T50A 2Z2MB 1K25A 2OOLA 2QPNA 4EESA 3CJMA 3CHWP 4P6ZM 4WZ5C 2W3DA 4GJ4A 1SZVA 4O0PA 3CPTB 4UQIS 3WS0A 2VV8A 5DTSA 1CEFA 3FPWA 4KZ8A 5FQIA 1H8MA 4HESA 3MZFA 3A0RA 1S0WA 1ONGA 2UWXA 1YLPA 2ZQAA 4PM7A 4WN5A 1IYPA 1YMSA 4S2JA 2G7UA 4R4SA 2VA0A 1VB6A 2PYRA 5J7EA 1ACFA 3LIBA 4FH2A 4UHUA 3OPPA 2ZLYA 3D9YA 4X69A 5FI2A 1P0ZA 1UWNX 3G2YA 1N4OA 4MN5A 3T1SA 2PD8A 5IHVA 2GJ3A 5HFOA 4LGWA 4XUZA 2XD5A 2PAVP 5DFYA 4WMCA 4S2LA 2XD1A 1OPXA 4CPKA 3N7WA 5HZHA 3JYIA 4M4XA 3IS2A 3R7WA 1I2SA 3KYEA 3E4PA 1V9YA 1XXMA 2ZM2A 2ZC6B 3HLFA 3MXSA 4B9OA 4OOYA 4BMWA 3T4LA 3BM6A 5A8BA 2Y8HA 1AWIA 4GNUA 2K31A 1H8ZA 1NWZA 5HDDA 3S7OA 5AQAA 1K6SA 3PBNA 3OLOA 3MQOA 1W63M 2OSUA 4Y0OA 2W27A 1MWRA 4JBFA 2Q9MA 2H28A 3A3IA 3RH8B 4R38A 4QWOA 4JXGA 3E4QA 3VMAA 2WK0A 1KDWA 1CK3A 2J8YA 2P9VA 2ZOHA 4RA7A 3BW6A 4UA9A 3UDFA 3QP2A 3NECA 2A24A 3B47A 5FQ9A 2K7SA 2HJEA 5A93A 2Y2PA 2XROA 4EBLA 5HPIA 4G3WA 4H6JB 3IX4A 1E3UD 3WS1A 3H7WB 3P09A 3SW1A 4IVKA 1BT5A 2V1AA 4WBGA 3UO9A 1H0MA 4NG2A 4DKIA 4JGPA 2INWA 4DE2A 2P08A 3SH8A 5JYOA 3G31A 4ZTKA 3EQVA 2O0YA 3IF6B 1N9LA 2ZQCA 4B4ZA 4EUZA 5C5KA 4EV4A 1S1ZA 2V8FA 3UPNA 2JBFA 2J9PA 1ES3A 4Y3IA 1OTIA 1K4FA 3B33A 1HTZA 1NRJA 4QY5A 4PKYA 2Y2QA 3L7HA 4ZRRA 3G35A 5JYPA 3LEQA 5GLCA 2KLIA 4GD6A 3IX3A 4OLDA 4E6XA 4CJNA 2PYPA 1NZOA 5CECA 2X01A 2EFUA 3H9WA 3G6OA 1BLSA 3PAGA 3NCKA 4ME4A 2XF3A 4ETZA 3BQAA 3BFFA 2V8CA 4GN2A 3ZG5A 3IT9A 3NULA 2O9AA 5GHYA 1Z09A 3LIEA 4KUOA 5CXWA 3OBFA 1L0GA 3W8KA 1VETB 1YKDA 3MKEA 5F82A 5CX7A 4B4XA 3BLMA 3MMHA 1NZUA 4HEFA 4DRTA 3O88A 1ALQA 2BLSA 1L0DA 3JVVA 2J3TC 1K57A 2Y2KA 3PAEA 1N9OA 4KZ9A 4Q0JA 2HF6A 3K3CA 5HD5A 1Z6FA 2OWHA 3K3DA 1UGUA 5L07A 4HBTA 5CGWA 3W4QA 1K57C 4GS9B 3BFCA 1MBLA 3T4SA 2VKSA 1Y28A 1RP5A 4LLOB 4EEPA 4EUVA 2EWVA 2PBYA 1MWUA 4YINA 4EWFA 3BFEA 1ZHHB 4MN7A 4XXRA 2BASA 5J8XA 3VP3A 1FIKA 5IU1A 4E3MA 5FQQA 5HDCA 4IUKA 1WYBA 4DE3A 3IWOA 3UE1A 2JKTM 3LGOA 3C7VA 1PWGA 4LCMA 3V5MA 2WKPA 4UEYA 3NDGA 1XJ4A 1ES5A 3F1PA 1L3LA 4XT2A 4R6LA 3A3JA 1UWPX 5I94A 2KOIA 3Q7ZA 4OQGA 2I9VA 3P7NA 3GTCA 4P0MA 3EEAA 4MMNA 5F5YA 2R9XA 3W4OA 2HPBA 2GZAA 5K5BA 2OV5A 1XGIA 3Q7VB 1OMEA 5DF9A 2W3EA 1S4RA 4HOIA 1I2WA 1VEUA 4E3IA 1N9BA 4QHCA 3IH8A 3EGDC 5G18A 2WUQA 4KQDA 3C4OA 3CMZA 2PBDP 3W4PA 2J7VA 3M2KA 1A0KA 2A3UA 1RGZA 4E04A 5DKLA 4HHDA 2WKIA 1VHMA 4EEUA 4R4RA 2EX9A 2ZOIA 1K56D 1MPLA 2R9WA 2ZMFA 1JTGA 3OOVA 3VP0A 3BY8A 4IJGA 3MBZA 4R1GA 1OTBA 3CUEC 3MQ0A 4HH3A 4UQIM 3FYZA 4OPZA 2Y2NA 4OPQA 1KE3A 1ZG4A 4Q0IA 3IHAA 4U3TA 4O7DA 5KSCA 3GMWA 3MR0A 2C5WB 3Q07A 3UMDA 3DWZA 1KGEA 1ESIA 4BQMA 2WKHA 3UB5P 2ZM0A 4EXOA 4X25A 4FOFA 4EERA 1MZUA 4FUWA 4GKUA 1SDNA 4DXBA 3EEHA 4B93A 4CLCE 4X55A 4JF5A 3NOTC 3P98A 1L0EA 2WKEA 5DJUA 4RQ9A 3MZDA 5EVID 5EM1A 1KGFA 4O8GA 5J3WA 3PXPA 2VGJA 3GQZA 3HLWA 1F5MA 2B95A 2HZ5A 3S22A 1NRFA 3V3SA 2WADA 5F6AA 3S7QA 4PHTA 1YM1A 1GSWA 5F68A 3F1OB 3OPRA 3FWLA 2A2LA 2QHKA 2XA7S 2J9OA 2H10A 2ZMVA 3V67A 3LYXA 2M1CA 3VSLA 2B02A 4MBKA 2CMNA 5DKKA 1LT0A 4II7A 2OWJA 4OOLA 1J9MA 2XK1A 3UB7A 1KOUA 3LI9A 3TG9A 3KYQA 3V50A 5FDHA 5HX9A 3BRMA 2HDQA 4BLMA 1OT9A 1XKZA 5EVIB 1SDEA 2HDRA 1PRQA 3F1NA 3HREA 1T18A 4Q0HA 4ZJ3A 5FSRA 3BFGA 3CWFA 2FH5A 1H3QA 3ZVWA 1HZOA 3MSHA 3DTEA 2W1RA 3KYZA 4GHIB 5FEGA 4PM9A 3OCLA 2HJ9C 2Y2HA 3IF5A 4PPRA 5GLAA 2OLUA 1E25A 1FR1A 2QKPA 5TGFA 4N9LA 4IEDA 2ZL1B 4C75A 3A0SA 3ZG0A 2KDKA 1K0KA 4JXWA 4WZ5A 4M3KA 2Y91A 3B3XA 1G6AA 3LIFA 3MKFA 2Y2MA 3Q1FA 5F69A 3T1RA 4QJGA 1DJAA 1YLWA 1W7FA 2HDSA 2J3WA 3N8LA 4HH2A 5F1GA 3PTEA 3NBLA 3SH7A 1G68A 2JN7A 3LI8A 1F98A 4KZAA 3VFHA 2DRWA 3LFVA 3G30A 5GLDA 1L2SA 2L0WA 3LEZA 3HLCA 5FASA 2W1TA 3VP4A 3FG8A 3B42A 5D3OA 2DCFA 3LR4A 3LY4A 4JXSA 5A91A 3PHYA 3LR5A 2EA9A 2ZQ7A 1CEGA 4BD0A 1KDSA 1XP4A 3E2LA 3ZG8B 1DJCA 3HUNA 1FOFA 1ZG6A 4EU0A 3ZNYA 3NIAA 1ZC2A 2JE5A 1TDLA 3AGEA 2W3FA 4X68A 5CHUA 1S67L 3UY6A 3HVFA 3FKVA 2XLNA 4KG5A 1LL8A 4BL3A 1YLYA 3Q81A 3UPOA 1T1AA 4YNRA 4YFMA 1IKGA 3A0VA 3IF6C 3CZDA 2AVXA 4K91A 3R4KA 1YPRA 3DBAA 4UA7A 4R70A 3CLOA 2G2WA 1IOUA 4WMCD 4DJ3A 3ZNTA 4JGOA 3SS4A 2ZC5B 4LV0A 3LIAA 3TOIA 1LL5A 3WS5A 1KVMA 4NXGA 1FSWA 4ZBEA 4IBRA 1NYYA 4KUKA 4XUXA 3C4PA 4RVAA 4EW7A 2B18A 5FAPA 4I3IA 3Q82A 2IWDA 3UDIA 1OTDA 2GX5A 2BG1A 5EOOA 5EFWA 2ZC4B 3MFXA 4K0XA 3ZHHA 1S4SA 4KENB 5HWTA 1YQSA 1JNUA 1RCJA 4Y7PA 4KZ4A 5DF8A 2Y2OA 4BENA 2ZBBA 4RYEA 2GNXA 4C3QA 1ONHA 1FCMA 3FKWA 1FQGA 3K2NA 1FILA 1K54C 3QP5A 1QMFA 1X0OA 3M6HA 4NEED 3HLDA 4HJ3A 5AVEA 4MLLA 4E3NA 2VV7A 3IS2B 3HUOA 1WA9A 2P04A 4NXBA 4NXEA 4DMZA 1CF0A 3BFDA 3OC2A 3MZEA 1S66L 1YSQA 4ESPA 3BY9A 3AGFA 4I5SA 1U60A 4BBTA 2HP6A 2I72A 2VK3A 1BUEA 1PZOA 2RL3A 5KSHA 4LRZE 3PBTA 2HP9A 1KVLA 3OCNA 5G4YA 1YMXA 1XGJA 2ZMAA 5HAQA 4Z9QA 5HL6A 4PMAA 2HDUA 3ITBA 3E2KA 3HLBA 2V1BA 2VGLS 2Y79A 3WWXA 2C6WB 3C7UA 4UAAA 2Y59A 2WAFA 5FEFA 1FCNA 2J80A 5EV0A 2VV6A 5DF7A 2P9VB 3HL9A 3N8SA 4FSFA 5MC7A 1LI9A 2FZ0A 1KE0A 3BECA 5EPHA 5U47A 2G2UA 2EWWA 2A24B 4DDYA 1XA1A 4WYYA 1XFQA 2JKRI 1W5DA 1M40A 2ZC3B 4E3KA 2Y55A 4C6YA 3Q7VA 1TF1A 5HSQA 4LRYC 4N1HA 3S1YA 2V2FF 4BJPA 5J4EA 2ZJ9A 3DTMA 4OQ0A 2M7UA 4E6WA 5CHJA 1DP9A 3SS5A 1ERQA 4WL9A 5BOHA 1KGGA 4OKPA 3UDXA 4DE1A 1YLJA 4P85A 2E8IA 5TBMA 4OP5A 5DTTA 2RCXA 2JC7A 3UE0A 3VE4A 2Z2LB 1G5UA 4GDBA 2QJ5A 3O86A 4Y5FA 4L9GA 3JVUA 5EVEA 3QP4A 4NK3A 4F94A 4E3OA 4FH4A 1FR6A 5F83A 1XA7A 5FI7A 4KG6A 3T4QA 2Y2LA 5M18A 2J3TD 1BLCA 4NETA 3H82A 3HUMA 4CLCA 2UV0E 5HARA 1SHVA 1D1JA 2XA7M 4JF4A 4DE0A 3A3FA 2XRNA 1E4DA 2XSSA 4WEKA 4CLCC 1TDGA 4JGRA 3A3EA 5EOEA 2FFYA 5FAOA 5GHXA 5EVLA 4N1XA 4PM8A 3RTYA 4R23A 3M2JA 5HPFA 1KE4A 2FFFB 3PBOA 3IX8A 2A49A 4N9KA 1BSGA 4KZ3A 3C38A 1PI4A 3NC8A 1SKOA 5FI6A 4S2KA 4PKYG 4GCZA 3IXBA 1YSPA 1K55A 4EETB 1ZKJA 4FTXA 2QYBA 1V9ZA 2XDMA 4ARZA 1YT4A 5CERA 1K55C 3KX0X 3EWKA 1W63Q 1T1BA 5CTNA 4H8RA 1EWZA 1OJGA 5GLBA 3FZCA 1H8YA 1XJ6A 4JGQA 1MKIA 3CUEA 3VV4A 1BLHA 4Y0TA 3IHBA 4GZBA 5L09A 3M6BA 5HD3A 1NLYA 3A3DA 1CQAA 4S2PA 2JKFA 5I5LA 4Y13A 3G34A 3C30A 1T1CA 1IYOA 4ETXA 4BBUA 2QJ7A 4YOFA 4F3LA 1WYCA 2DNSA 3MXRA 1LSXA 1OJ5A 1BULA 1PZPA 5TR7A 3LICA 4JPMA 3F1PB 1I5QA 1PFLA 4XT2B 4GW9A 1PW8A 1D06A 3HCYA 2GDNA 3BYDA 5HDSA 3ZG7B 3DTIA 1BTLA 4R3AA 3KSFA 5TJJA 2PU2A 3RXXA 2B5RA 3ICYA 3MF0A 2WGWB 2P7JA 1RGYA 1ES2A 4HNBA 4U0XA 1XX2A 2R78A 3O5YA 5DJTA 3SOIA 5DTKA 4FCFA 4BL2A 1K38A 1VEUB 3N6IA 2PT7A 1BZAA 4MDZA 5HWVA 4CQHA 3TE8A 2IWBA 3UB9A 5HWWA 4MBHA 3FV7A 1YLTA 3CPTA 3QNBA 3GDIA 1GA9A 1LI0A 4LENA 4JF6A 3GSGA 3UB8A 3E98A 3TSGA 4P87A 3ZQ5A 1P9WA 1LSWA 3BJNA 3T12B 1WE4A 3O87A 5AQ9A 4X1MA 4N92A 5M1AA 5E43A 2Q9NA 3C2WA 2VZWA 3IBJA 3NDEA 1GHIA 1S6RA 4DXCA 5AQ7A 3VE3A 3NOUC 2W3HA 4KZ7A 2VJWA 4Z1WA 2EXBA 3LUQA 2XGNA 1MWSA 3S7NA 3VP2A 4X56A 1DP6A 2Y2GA 2ZD8A 5CEBA 1TD5A 2V9AA 4ID4A 2HP5A 2HV1A 3O3VA 1YLZA 1ESUA 2LB9A 3MS6A 4QPRA 3MFDA 4WF0A 4IBXA 4S2NC 2O9CA 1ODVA 3QP6A 3MJQA 3T1XA 1Y4OA 2JKGA 4S2MA 3QNCA 3TW8A 1ES4A 1L0FA 3T4OA 4RX2A 2V0UA 3T4TA 4B88A 4WUJA 5CGXA 5KIZA 3NHQA 3VOYA 4AFIA 4FD8A 1MKMA 4PM6A 2WKQA 2Y2IA 2PR5A 1JWPA 5DFXA 4EBNA 1PNEA 2ZM8A 3VSKA 3LIDA 2ZQ8A 4BWIA 2D02A 4LCLA 4H6JA 2VGLM 4WZ4A 4I38A 3H7WA 3T4KA 1SCWA 2Y4AA 1IYQA 5IT5A 5DVAA 3FC7A 1ERMA 3F1NB 4JKTA 3UPPA 2L1MA 2H5SA 1NLZA 3U4LP 3CG5A 1CI8A 3IF6A 3HJIA 4KG2A 3PBQA 2OLVA 2JKRM 1M6KA 3ISGA 1LL9A 2ZQDA 3V3RA 3AGDA 3DTKA 1GSXA 2OAQ1 2XFSA 4BD1A 5E2EA 2CC1A 1W79A 3JPUA 5L8MA 2OAP1 4LV2A 3ZG9B 3VFFA 3WRZA 4OVDA 2NUTC 5F1FA 2WAEA 4OLGA 1E3UA 5M19A 1TS7A 1LHYA 2Z6DA 1W8QA 3UB6A 1JTDA 1BLPA 3QP8A 3DW0A 3CITA 2VLGA 2WYXA 5CHMA 4QU3A 5KZHA 3WRTA 4MBFA 1ZTUA 4LPZA 2EX2A 3ZFZA 5AJGA 4OPRA 2W1TB 2O9BA 2Z6CA 2YKHA 3VOZA 2V20A 5A92A 4HQAA 1OT6A 1XFNA 1EROA 4GLQA 1EI5A 3UMEA 1VETA 1K54A 2WKRA 3MXQA 1CI9A 1F2KA 4I39A 4X53A 3VP1A 1K6RA 1PWCA 3D72A 2ACGA 1TS6A 2V0WA 3P01A 4IUHA 4A5RA 4K0WA 3BWLA 4R0QA 4PM5A 1GCEA 1XJ3A 2JHEA 4IVIA 1BYWA 4HI4A 1SKFA 2XH9A 3R7WB 4G3KA 5L2FA 2VEAA 4GS9A 4ZJ1A 1IKIA 1W8YA 5EM0A 4L0LA 5E2GA 1Y54A 2IWCA 1MC0A 2KX6A 4P6ZS 3OZHA 5G4ZA 4HJ6A 5FATA 4IHQA 3MQQA 2WGIA 4X6TA 2H0TA 3RXWA 1TS0A 5AVFA 3BQ8A 2H0YA 3V39A 4Y2FA 3N4IA 1P97A 5HL1A 4ZAMA 3FPVA 2PDRA 5TFQA 4WEJA 1VM1A 3S4XA 3ZDJA 2XQZA 4DDSA 5FQKA 2XFTA 4QD4A 3RJUA 3SH9A 2WZZA 2EXAA 5EUAA 4YWZA 3ULFA 4U0TA 3CI6A 3OPHA 1FCOA 5AQBA 3LR3A 1QMEA 2K2NA 3IQAA 4PAUA 4UA6A 1MWTA 3HJKA 3CAXA 3NOPC 4EQIA 1Q2QA 2L4RA 2NUPC 1O07A 1G6OA 2VGKA 1JWVA 3NJAA 5L10A 3BLSA 4NXFA 3UE3A 4EQ1A 4Y17A 4OH0A 1DJBA 2Y2JA 5HAIA 4ZDXA 3QHYA 1LSVA 4GOGA 4OOMA 4WLAA 4ZJ2A 3NI9A 3E0YA 4Y15A 2EFXA 3UN7A 2EX6A 3KO6A 4I3JA 4NKPA 4OPYA 3IWIA 3LO7A 5CRFA 3T1QB 3ZVTA 2ZQ9A 4E3JA 4Y0UA 3BEBA 5A90A 2JCHA 1JVJA 1DY6A 2DMWA 1DRMA 1P9RA 1GSVA 1OTAA 4OQHA 3C8CA 3G4PA 1PIOA 4JLFA 1C3BA 1LLBA 5FDSA 1G28A 1OTEA 4EBPA 2XR0A 4KZ6A 5GL9A 4OP8A 2PD7A 4JXVA 2WGWA 4DN0A 5HAPA 4CLCD 4X1LA 3L9KA 1CJFA 3UNWA 3KSIA 5CEDA 4HJ4A 4BBVA 3GV9A 2QZ6A 1FSYA 1K56A 3IXHA 3HLGA 1Q2PA 1PW1A 2ZC7A 2XEPA 5FL3A 1TS8A 5FQMA 3GECA 4KZBA 3IXDA 4KQOA 3HLEA 1EW0A 4KZ5A 2E8JA 4Q8IA 4HIAA 3D3OA 4LRXC 1HVBA 3WS4A 5TBMB 3F1OA 3ITAA 4QY6A 4OONA 1O7EA 3PBSA 2PR6A 2IA2A 2W3GA 1T19A 3G2ZA 4LV3A 4WELA 4GB7A 4G3VA 1K4EA 5CGSA 3H82B 4CLCB 5FAQA 5HW3A 3IH9A 3GRJA 1TEMA 3E4OA 2X71A 2WZXA 3IBRA 5EVIA 4D2OA 3PBRA 4RX3A 1IYSA 1PI5A 3EQUA 4I3AA 4GDNA 2YKFA 5CTMA 1IELA 3LCEA 2PU4A 2V1ZA 4LV1A 4L9FA 5EVIC 3IXGA 1STZA 3KSHA 3ZGAB 2QWSA 3S7PA 5GHZA 2M7VA 4GHIA 3DAVA 2PRFA 4P6BA 4L9EA 1JWZA 3RFBA 2ZL1A 1MY8A 1NYMA 1J3WA 4HP9A 2BTFP 3D4FA 3LR0A 1SKOB 5FA7A 1PYYA 1D7EA 3SZTA 4HY8A 1H5XA 2W0NA 4K08A 3NY4A 3EOIA 4HP4A 1NXYA 4KQRA 1HD8A 3ZCZA 4ARZB 3I7JA 3ZYTA 2JKTI 3SS3A 1IFQA 4E3LA 3DWKA 5IS1A 3TRCA 1NY0A 5EE8A 1XPBA 4R3JA 3KSGA 3HBRA 2LB5A 1MXOA 2D01A 2PHYA 1GA0A 3PR6A 1NJ4A 2X02A 3VOLA 2MJ6A 5KMWA 1VQQA 4O01A 4D60A 2VX8A 4MEZA 3WS2A 4MNRA 3W2ZA 1HLUP 3T4JA 3U2AA 1F9IA 4MCWA 5E2HA 4DJ2A 4F3LB 4OQIA 1XJ2A 1YAXA 2HGVA 1AXBA 3OPLA 3EGXC 2O99A 1PWDA 2WGVA 3LY3A 5EECA 1GHPA 4LFUA 1IEMA 4MN6A 1DP8A 5E2FA 3N8RA 1TVFA 4S2OA 3PYPA
chains in the Genus database with same CATH topology
3CITA 2VLGA 2ZOIA 2ZMFA 3OOVA 1TF1A 5HSQA 4LRYC 1S1YA 5LBRA 3BY8A 4IJGA 1ZTUA 1OTBA 3CUEC 4LPZA 4BJPA 3MQ0A 4HH3A 5J4EA 2M7UA 5AJGA 4UQIM 1N9NA 1DP9A 3UE6A 4WL9A 2W1TB 2O9BA 2Z6CA 2YKHA 4HQAA 4Q0IA 1OT6A 1XFNA 5TBMA 4GLQA 3TJZC 3T50A 3VE4A 2OOLA 3UMEA 3MR0A 2QJ5A 2WKRA 4Y5FA 4L9GA 3JVUA 3MXQA 4EESA 3UMDA 4I39A 4P6ZM 4EXOA 3T4QA 4FOFA 3D72A 2J3TD 4EERA 2W3DA 1TS6A 4GJ4A 1MZUA 2V0WA 3P01A 4O0PA 4IUHA 3BWLA 3H82A 4CLCA 1XJ3A 4UQIS 2VV8A 3EEHA 4B93A 2JHEA 4CLCE 3FPWA 1BYWA 4HI4A 3NOTC 1H8MA 3R7WB 3A0RA 2XA7M 4G3KA 2XRNA 2XSSA 4WEKA 2VEAA 4GS9A 5DJUA 4CLCC 4RQ9A 4WN5A 4L0LA 4O8GA 2G7UA 4JGRA 1MC0A 2VA0A 1VB6A 2PYRA 5J7EA 5J3WA 2KX6A 3LIBA 4P6ZS 3PXPA 1F5MA 5G4ZA 4HJ6A 3RTYA 1P0ZA 1UWNX 4IHQA 5HPFA 4MN5A 3MQQA 5F6AA 3S7QA 3PBOA 2PD8A 2GJ3A 4PHTA 1TS0A 5AVFA 3BQ8A 1GSWA 5F68A 3F1OB 4Y2FA 5DFYA 1P97A 2A2LA 2QHKA 2XA7S 3C38A 3FPVA 2ZMVA 3V67A 1OPXA 2PDRA 5HZHA 3LYXA 2M1CA 2B02A 4WEJA 2CMNA 5DKKA 4PKYG 1LT0A 4GCZA 4M4XA 3IS2A 3R7WA 1YSPA 4II7A 4EETB 2OWJA 4OOLA 3E4PA 3UB7A 1KOUA 1V9YA 2QYBA 1V9ZA 3LI9A 4B9OA 4ARZA 4BMWA 3KYQA 4YWZA 3ULFA 3T4LA 3CI6A 5A8BA 3KX0X 2Y8HA 1W63Q 3EWKA 1T1BA 2K31A 1NWZA 3LR3A 5HDDA 2K2NA 1OT9A 3S7OA 3OLOA 3MQOA 3PBNA 1W63M 1OJGA 4PAUA 3F1NA 2W27A 1T18A 1XJ6A 4JGQA 3CUEA 3VV4A 3HJKA 4Q0HA 3CAXA 3NOPC 2H28A 3CWFA 2L4RA 2NUPC 5HD3A 3RH8B 2FH5A 1H3QA 4R38A 3E4QA 1NLYA 1G6OA 2W1RA 3KYZA 3NJAA 4GHIB 5I5LA 3C30A 1T1CA 4ETXA 4NXFA 3OCLA 3UE3A 2QJ7A 4YOFA 2HJ9C 4BBUA 4EQ1A 4F3LA 2QKPA 2ZOHA 1LSXA 1OJ5A 1LSVA 3A0SA 3BW6A 4OOMA 2KDKA 3LICA 4WLAA 3LIFA 3F1PB 2A24A 3B47A 3E0YA 4XT2B 2K7SA 4GW9A 2HJEA 1D06A 3HCYA 5F69A 2XROA 5HDSA 5HPIA 3KO6A 4I3JA 4NKPA 4G3WA 4H6JB 4R3AA 3KSFA 5TJJA 2J3WA 3H7WB 4HH2A 3SW1A 2JN7A 2V1AA 3LI8A 1F98A 3ICYA 3LFVA 3MF0A 2P7JA 2L0WA 4JGPA 2INWA 4HNBA 2W1TA 2P08A 2R78A 3O5YA 2DMWA 3FG8A 1DRMA 1P9RA 1GSVA 1OTAA 5DJTA 3B42A 3EQVA 2O0YA 3C8CA 1N9LA 3LR4A 5C5KA 1S1ZA 3PHYA 2PT7A 2EA9A 3LR5A 4MDZA 5HWVA 4Y3IA 4CQHA 3TE8A 1OTIA 3B33A 1NRJA 1G28A 1OTEA 4PKYA 3UB9A 5HWWA 4EU0A 3GDIA 4ZRRA 2PD7A 2KLIA 4DN0A 3UB8A 4CLCD 2W3FA 3E98A 2PYPA 3KSIA 4HJ4A 3ZQ5A 4BBVA 1P9WA 1S67L 1LSWA 3BJNA 3H9WA 3G6OA 1LL8A 1TS8A 5FL3A 3GECA 4KQOA 3C2WA 4ME4A 4ETZA 2VZWA 3BQAA 1EW0A 1T1AA 3IBJA 4YNRA 4HIAA 3D3OA 4LRXC 3VE3A 3A0VA 3NOUC 2W3HA 2O9AA 2VJWA 5TBMB 4Z1WA 3LIEA 3F1OA 3R4KA 4KUOA 3DBAA 3OBFA 3LUQA 4R70A 3CLOA 1IOUA 1YKDA 3S7NA 5CX7A 3PBSA 4DJ3A 2PR6A 1DP6A 4JGOA 2IA2A 2W3GA 3MMHA 1T19A 3LIAA 1TD5A 2V9AA 4WELA 2HV1A 4NXGA 4G3VA 4KUKA 2LB9A 3H82B 2J3TC 3JVVA 4CLCB 4EW7A 1N9OA 2B18A 4Q0JA 2HF6A 3K3CA 4I3IA 4QPRA 5HD5A 4WF0A 3E4OA 2O9CA 2OWHA 3K3DA 1UGUA 3IBRA 1ODVA 3PBRA 1OTDA 3MJQA 4I3AA 3EQUA 2GX5A 4GS9B 2YKFA 3T4SA 2VKSA 1Y28A 5EFWA 4LLOB 4EEPA 4EUVA 3TW8A 3MFXA 1S4SA 2EWVA 4L9FA 3T4OA 1STZA 5HWTA 3KSHA 2V0UA 1JNUA 3T4TA 2QWSA 4WUJA 3S7PA 1ZHHB 4MN7A 2M7VA 4GHIA 2BASA 5KIZA 2ZBBA 2GNXA 5IU1A 5HDCA 4IUKA 3NHQA 4AFIA 3K2NA 4L9EA 3RFBA 2JKTM 1X0OA 4NEED 1MKMA 2WKQA 4HP9A 2PR5A 2WKPA 3LR0A 4HJ3A 5AVEA 4UEYA 5DFXA 1XJ4A 3F1PA 1D7EA 3LIDA 4R6LA 4XT2A 2VV7A 3IS2B 4HY8A 1UWPX 4BWIA 2D02A 1WA9A 2W0NA 2KOIA 2P04A 4NXBA 4K08A 4NXEA 4H6JA 2VGLM 3EOIA 4HP4A 4DMZA 3OC2A 4I38A 3H7WA 4ARZB 3ZYTA 2JKTI 1S66L 1IFQA 2I9VA 1YSQA 3T4KA 3BY9A 5IS1A 3P7NA 3TRCA 4I5SA 5IT5A 3KSGA 4BBTA 2LB5A 2D01A 3EEAA 3FC7A 4MMNA 5F5YA 2PHYA 3F1NB 5KSHA 4LRZE 3PR6A 3PBTA 2GZAA 5K5BA 3OCNA 2L1MA 3VOLA 2MJ6A 5G4YA 1NLZA 4O01A 5DF9A 2VX8A 5HL6A 3HJIA 2W3EA 1S4RA 4HOIA 3W2ZA 3T4JA 3U2AA 1F9IA 2V1BA 2VGLS 3PBQA 2Y79A 2JKRM 4MCWA 4DJ2A 4F3LB 2J80A 1XJ2A 3EGDC 1YAXA 2VV6A 2HGVA 3EGXC 2O99A 1GSXA 4FSFA 2OAQ1 5MC7A 4KQDA 2FZ0A 5L8MA 2OAP1 4MN6A 2EWWA 2A24B 4E04A 1DP8A 5DKLA 2NUTC 4HHDA 1VHMA 4EEUA 1TS7A 2Z6DA 3UB6A 1XFQA 2JKRI 3PYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YSP A;  1STZ A;  3KSH A;  3CIT A;  4MDZ A;  4Y3I A;  4CQH A;  3S7P A;  2ZMF A;  3OOV A;  1TF1 A;  5HSQ A;  4MN7 A;  2QYB A;  2M7V A;  4LRY C;  5LBR A;  4IJG A;  1ZTU A;  3CI6 A;  4IUK A;  3NHQ A;  2Y8H A;  3MQ0 A;  4EU0 A;  2K31 A;  3K2N A;  2M7U A;  5AJG A;  3RFB A;  4ZRR A;  2K2N A;  2W1T B;  2O9B A;  3S7O A;  1MKM A;  2KLI A;  4Q0I A;  4PAU A;  4DN0 A;  4GLQ A;  2W3F A;  3E98 A;  5DFX A;  3KSI A;  3VV4 A;  4Q0H A;  3ZQ5 A;  2OOL A;  4R6L A;  3NOP C;  3BJN A;  4Y5F A;  4BWI A;  2KOI A;  3G6O A;  2W1R A;  4DMZ A;  5I5L A;  4ME4 A;  3C2W A;  4FOF A;  4ETZ A;  2VZW A;  4ETX A;  2W3D A;  1YSQ A;  3IBJ A;  4O0P A;  4IUH A;  4YNR A;  4YOF A;  3TRC A;  3D3O A;  4LRX C;  3NOU C;  3KSG A;  2W3H A;  2O9A A;  2LB5 A;  3EEA A;  2VJW A;  4MMN A;  4Z1W A;  3NOT C;  4LRZ E;  3R4K A;  3DBA A;  4G3K A;  3OBF A;  5K5B A;  2XRN A;  4R70 A;  2XSS A;  3E0Y A;  2VEA A;  4GW9 A;  4RQ9 A;  1YKD A;  3HCY A;  4O01 A;  2XRO A;  3S7N A;  4O8G A;  5HL6 A;  2G7U A;  5HPI A;  2W3E A;  3KO6 A;  1MC0 A;  2IA2 A;  3W2Z A;  4G3W A;  2W3G A;  3MMH A;  3KSF A;  5TJJ A;  1TD5 A;  2Y79 A;  1F5M A;  4MCW A;  4G3V A;  5HPF A;  3LFV A;  2LB9 A;  3MF0 A;  2HGV A;  2O99 A;  3S7Q A;  2B18 A;  4Q0J A;  4QPR A;  2O9C A;  2W1T A;  5L8M A;  3IBR A;  4Y2F A;  3O5Y A;  5DFY A;  4E04 A;  2GX5 A;  1VHM A;  2O0Y A;  2VKS A;  4EUV A;  5C5K A; 
#chains in the Genus database with same CATH topology
 4S2N A;  3QP1 A;  3GR2 A;  4KQQ A;  2QMI A;  3C5A A;  3IWQ A;  1GHM A;  5FQJ A;  1S1Y A;  4DF6 A;  5LBR A;  4HBU A;  2Q0O A;  4GD8 A;  2EX8 A;  3GVB A;  4R3B A;  1N9N A;  3UE6 A;  3G32 A;  4WM9 A;  4QB8 A;  2P74 A;  4S2I A;  3TJZ C;  3T50 A;  2Z2M B;  1K25 A;  2OOL A;  2QPN A;  4EES A;  3CJM A;  3CHW P;  4P6Z M;  4WZ5 C;  2W3D A;  4GJ4 A;  1SZV A;  4O0P A;  3CPT B;  4UQI S;  3WS0 A;  2VV8 A;  5DTS A;  1CEF A;  3FPW A;  4KZ8 A;  5FQI A;  1H8M A;  4HES A;  3MZF A;  3A0R A;  1S0W A;  1ONG A;  2UWX A;  1YLP A;  2ZQA A;  4PM7 A;  4WN5 A;  1IYP A;  1YMS A;  4S2J A;  2G7U A;  4R4S A;  2VA0 A;  1VB6 A;  2PYR A;  5J7E A;  1ACF A;  3LIB A;  4FH2 A;  4UHU A;  3OPP A;  2ZLY A;  3D9Y A;  4X69 A;  5FI2 A;  1P0Z A;  1UWN X;  3G2Y A;  1N4O A;  4MN5 A;  3T1S A;  2PD8 A;  5IHV A;  2GJ3 A;  5HFO A;  4LGW A;  4XUZ A;  2XD5 A;  2PAV P;  5DFY A;  4WMC A;  4S2L A;  2XD1 A;  1OPX A;  4CPK A;  3N7W A;  5HZH A;  3JYI A;  4M4X A;  3IS2 A;  3R7W A;  1I2S A;  3KYE A;  3E4P A;  1V9Y A;  1XXM A;  2ZM2 A;  2ZC6 B;  3HLF A;  3MXS A;  4B9O A;  4OOY A;  4BMW A;  3T4L A;  3BM6 A;  5A8B A;  2Y8H A;  1AWI A;  4GNU A;  2K31 A;  1H8Z A;  1NWZ A;  5HDD A;  3S7O A;  5AQA A;  1K6S A;  3PBN A;  3OLO A;  3MQO A;  1W63 M;  2OSU A;  4Y0O A;  2W27 A;  1MWR A;  4JBF A;  2Q9M A;  2H28 A;  3A3I A;  3RH8 B;  4R38 A;  4QWO A;  4JXG A;  3E4Q A;  3VMA A;  2WK0 A;  1KDW A;  1CK3 A;  2J8Y A;  2P9V A;  2ZOH A;  4RA7 A;  3BW6 A;  4UA9 A;  3UDF A;  3QP2 A;  3NEC A;  2A24 A;  3B47 A;  5FQ9 A;  2K7S A;  2HJE A;  5A93 A;  2Y2P A;  2XRO A;  4EBL A;  5HPI A;  4G3W A;  4H6J B;  3IX4 A;  1E3U D;  3WS1 A;  3H7W B;  3P09 A;  3SW1 A;  4IVK A;  1BT5 A;  2V1A A;  4WBG A;  3UO9 A;  1H0M A;  4NG2 A;  4DKI A;  4JGP A;  2INW A;  4DE2 A;  2P08 A;  3SH8 A;  5JYO A;  3G31 A;  4ZTK A;  3EQV A;  2O0Y A;  3IF6 B;  1N9L A;  2ZQC A;  4B4Z A;  4EUZ A;  5C5K A;  4EV4 A;  1S1Z A;  2V8F A;  3UPN A;  2JBF A;  2J9P A;  1ES3 A;  4Y3I A;  1OTI A;  1K4F A;  3B33 A;  1HTZ A;  1NRJ A;  4QY5 A;  4PKY A;  2Y2Q A;  3L7H A;  4ZRR A;  3G35 A;  5JYP A;  3LEQ A;  5GLC A;  2KLI A;  4GD6 A;  3IX3 A;  4OLD A;  4E6X A;  4CJN A;  2PYP A;  1NZO A;  5CEC A;  2X01 A;  2EFU A;  3H9W A;  3G6O A;  1BLS A;  3PAG A;  3NCK A;  4ME4 A;  2XF3 A;  4ETZ A;  3BQA A;  3BFF A;  2V8C A;  4GN2 A;  3ZG5 A;  3IT9 A;  3NUL A;  2O9A A;  5GHY A;  1Z09 A;  3LIE A;  4KUO A;  5CXW A;  3OBF A;  1L0G A;  3W8K A;  1VET B;  1YKD A;  3MKE A;  5F82 A;  5CX7 A;  4B4X A;  3BLM A;  3MMH A;  1NZU A;  4HEF A;  4DRT A;  3O88 A;  1ALQ A;  2BLS A;  1L0D A;  3JVV A;  2J3T C;  1K57 A;  2Y2K A;  3PAE A;  1N9O A;  4KZ9 A;  4Q0J A;  2HF6 A;  3K3C A;  5HD5 A;  1Z6F A;  2OWH A;  3K3D A;  1UGU A;  5L07 A;  4HBT A;  5CGW A;  3W4Q A;  1K57 C;  4GS9 B;  3BFC A;  1MBL A;  3T4S A;  2VKS A;  1Y28 A;  1RP5 A;  4LLO B;  4EEP A;  4EUV A;  2EWV A;  2PBY A;  1MWU A;  4YIN A;  4EWF A;  3BFE A;  1ZHH B;  4MN7 A;  4XXR A;  2BAS A;  5J8X A;  3VP3 A;  1FIK A;  5IU1 A;  4E3M A;  5FQQ A;  5HDC A;  4IUK A;  1WYB A;  4DE3 A;  3IWO A;  3UE1 A;  2JKT M;  3LGO A;  3C7V A;  1PWG A;  4LCM A;  3V5M A;  2WKP A;  4UEY A;  3NDG A;  1XJ4 A;  1ES5 A;  3F1P A;  1L3L A;  4XT2 A;  4R6L A;  3A3J A;  1UWP X;  5I94 A;  2KOI A;  3Q7Z A;  4OQG A;  2I9V A;  3P7N A;  3GTC A;  4P0M A;  3EEA A;  4MMN A;  5F5Y A;  2R9X A;  3W4O A;  2HPB A;  2GZA A;  5K5B A;  2OV5 A;  1XGI A;  3Q7V B;  1OME A;  5DF9 A;  2W3E A;  1S4R A;  4HOI A;  1I2W A;  1VEU A;  4E3I A;  1N9B A;  4QHC A;  3IH8 A;  3EGD C;  5G18 A;  2WUQ A;  4KQD A;  3C4O A;  3CMZ A;  2PBD P;  3W4P A;  2J7V A;  3M2K A;  1A0K A;  2A3U A;  1RGZ A;  4E04 A;  5DKL A;  4HHD A;  2WKI A;  1VHM A;  4EEU A;  4R4R A;  2EX9 A;  2ZOI A;  1K56 D;  1MPL A;  2R9W A;  2ZMF A;  1JTG A;  3OOV A;  3VP0 A;  3BY8 A;  4IJG A;  3MBZ A;  4R1G A;  1OTB A;  3CUE C;  3MQ0 A;  4HH3 A;  4UQI M;  3FYZ A;  4OPZ A;  2Y2N A;  4OPQ A;  1KE3 A;  1ZG4 A;  4Q0I A;  3IHA A;  4U3T A;  4O7D A;  5KSC A;  3GMW A;  3MR0 A;  2C5W B;  3Q07 A;  3UMD A;  3DWZ A;  1KGE A;  1ESI A;  4BQM A;  2WKH A;  3UB5 P;  2ZM0 A;  4EXO A;  4X25 A;  4FOF A;  4EER A;  1MZU A;  4FUW A;  4GKU A;  1SDN A;  4DXB A;  3EEH A;  4B93 A;  4CLC E;  4X55 A;  4JF5 A;  3NOT C;  3P98 A;  1L0E A;  2WKE A;  5DJU A;  4RQ9 A;  3MZD A;  5EVI D;  5EM1 A;  1KGF A;  4O8G A;  5J3W A;  3PXP A;  2VGJ A;  3GQZ A;  3HLW A;  1F5M A;  2B95 A;  2HZ5 A;  3S22 A;  1NRF A;  3V3S A;  2WAD A;  5F6A A;  3S7Q A;  4PHT A;  1YM1 A;  1GSW A;  5F68 A;  3F1O B;  3OPR A;  3FWL A;  2A2L A;  2QHK A;  2XA7 S;  2J9O A;  2H10 A;  2ZMV A;  3V67 A;  3LYX A;  2M1C A;  3VSL A;  2B02 A;  4MBK A;  2CMN A;  5DKK A;  1LT0 A;  4II7 A;  2OWJ A;  4OOL A;  1J9M A;  2XK1 A;  3UB7 A;  1KOU A;  3LI9 A;  3TG9 A;  3KYQ A;  3V50 A;  5FDH A;  5HX9 A;  3BRM A;  2HDQ A;  4BLM A;  1OT9 A;  1XKZ A;  5EVI B;  1SDE A;  2HDR A;  1PRQ A;  3F1N A;  3HRE A;  1T18 A;  4Q0H A;  4ZJ3 A;  5FSR A;  3BFG A;  3CWF A;  2FH5 A;  1H3Q A;  3ZVW A;  1HZO A;  3MSH A;  3DTE A;  2W1R A;  3KYZ A;  4GHI B;  5FEG A;  4PM9 A;  3OCL A;  2HJ9 C;  2Y2H A;  3IF5 A;  4PPR A;  5GLA A;  2OLU A;  1E25 A;  1FR1 A;  2QKP A;  5TGF A;  4N9L A;  4IED A;  2ZL1 B;  4C75 A;  3A0S A;  3ZG0 A;  2KDK A;  1K0K A;  4JXW A;  4WZ5 A;  4M3K A;  2Y91 A;  3B3X A;  1G6A A;  3LIF A;  3MKF A;  2Y2M A;  3Q1F A;  5F69 A;  3T1R A;  4QJG A;  1DJA A;  1YLW A;  1W7F A;  2HDS A;  2J3W A;  3N8L A;  4HH2 A;  5F1G A;  3PTE A;  3NBL A;  3SH7 A;  1G68 A;  2JN7 A;  3LI8 A;  1F98 A;  4KZA A;  3VFH A;  2DRW A;  3LFV A;  3G30 A;  5GLD A;  1L2S A;  2L0W A;  3LEZ A;  3HLC A;  5FAS A;  2W1T A;  3VP4 A;  3FG8 A;  3B42 A;  5D3O A;  2DCF A;  3LR4 A;  3LY4 A;  4JXS A;  5A91 A;  3PHY A;  3LR5 A;  2EA9 A;  2ZQ7 A;  1CEG A;  4BD0 A;  1KDS A;  1XP4 A;  3E2L A;  3ZG8 B;  1DJC A;  3HUN A;  1FOF A;  1ZG6 A;  4EU0 A;  3ZNY A;  3NIA A;  1ZC2 A;  2JE5 A;  1TDL A;  3AGE A;  2W3F A;  4X68 A;  5CHU A;  1S67 L;  3UY6 A;  3HVF A;  3FKV A;  2XLN A;  4KG5 A;  1LL8 A;  4BL3 A;  1YLY A;  3Q81 A;  3UPO A;  1T1A A;  4YNR A;  4YFM A;  1IKG A;  3A0V A;  3IF6 C;  3CZD A;  2AVX A;  4K91 A;  3R4K A;  1YPR A;  3DBA A;  4UA7 A;  4R70 A;  3CLO A;  2G2W A;  1IOU A;  4WMC D;  4DJ3 A;  3ZNT A;  4JGO A;  3SS4 A;  2ZC5 B;  4LV0 A;  3LIA A;  3TOI A;  1LL5 A;  3WS5 A;  1KVM A;  4NXG A;  1FSW A;  4ZBE A;  4IBR A;  1NYY A;  4KUK A;  4XUX A;  3C4P A;  4RVA A;  4EW7 A;  2B18 A;  5FAP A;  4I3I A;  3Q82 A;  2IWD A;  3UDI A;  1OTD A;  2GX5 A;  2BG1 A;  5EOO A;  5EFW A;  2ZC4 B;  3MFX A;  4K0X A;  3ZHH A;  1S4S A;  4KEN B;  5HWT A;  1YQS A;  1JNU A;  1RCJ A;  4Y7P A;  4KZ4 A;  5DF8 A;  2Y2O A;  4BEN A;  2ZBB A;  4RYE A;  2GNX A;  4C3Q A;  1ONH A;  1FCM A;  3FKW A;  1FQG A;  3K2N A;  1FIL A;  1K54 C;  3QP5 A;  1QMF A;  1X0O A;  3M6H A;  4NEE D;  3HLD A;  4HJ3 A;  5AVE A;  4MLL A;  4E3N A;  2VV7 A;  3IS2 B;  3HUO A;  1WA9 A;  2P04 A;  4NXB A;  4NXE A;  4DMZ A;  1CF0 A;  3BFD A;  3OC2 A;  3MZE A;  1S66 L;  1YSQ A;  4ESP A;  3BY9 A;  3AGF A;  4I5S A;  1U60 A;  4BBT A;  2HP6 A;  2I72 A;  2VK3 A;  1BUE A;  1PZO A;  2RL3 A;  5KSH A;  4LRZ E;  3PBT A;  2HP9 A;  1KVL A;  3OCN A;  5G4Y A;  1YMX A;  1XGJ A;  2ZMA A;  5HAQ A;  4Z9Q A;  5HL6 A;  4PMA A;  2HDU A;  3ITB A;  3E2K A;  3HLB A;  2V1B A;  2VGL S;  2Y79 A;  3WWX A;  2C6W B;  3C7U A;  4UAA A;  2Y59 A;  2WAF A;  5FEF A;  1FCN A;  2J80 A;  5EV0 A;  2VV6 A;  5DF7 A;  2P9V B;  3HL9 A;  3N8S A;  4FSF A;  5MC7 A;  1LI9 A;  2FZ0 A;  1KE0 A;  3BEC A;  5EPH A;  5U47 A;  2G2U A;  2EWW A;  2A24 B;  4DDY A;  1XA1 A;  4WYY A;  1XFQ A;  2JKR I;  1W5D A;  1M40 A;  2ZC3 B;  4E3K A;  2Y55 A;  4C6Y A;  3Q7V A;  1TF1 A;  5HSQ A;  4LRY C;  4N1H A;  3S1Y A;  2V2F F;  4BJP A;  5J4E A;  2ZJ9 A;  3DTM A;  4OQ0 A;  2M7U A;  4E6W A;  5CHJ A;  1DP9 A;  3SS5 A;  1ERQ A;  4WL9 A;  5BOH A;  1KGG A;  4OKP A;  3UDX A;  4DE1 A;  1YLJ A;  4P85 A;  2E8I A;  5TBM A;  4OP5 A;  5DTT A;  2RCX A;  2JC7 A;  3UE0 A;  3VE4 A;  2Z2L B;  1G5U A;  4GDB A;  2QJ5 A;  3O86 A;  4Y5F A;  4L9G A;  3JVU A;  5EVE A;  3QP4 A;  4NK3 A;  4F94 A;  4E3O A;  4FH4 A;  1FR6 A;  5F83 A;  1XA7 A;  5FI7 A;  4KG6 A;  3T4Q A;  2Y2L A;  5M18 A;  2J3T D;  1BLC A;  4NET A;  3H82 A;  3HUM A;  4CLC A;  2UV0 E;  5HAR A;  1SHV A;  1D1J A;  2XA7 M;  4JF4 A;  4DE0 A;  3A3F A;  2XRN A;  1E4D A;  2XSS A;  4WEK A;  4CLC C;  1TDG A;  4JGR A;  3A3E A;  5EOE A;  2FFY A;  5FAO A;  5GHX A;  5EVL A;  4N1X A;  4PM8 A;  3RTY A;  4R23 A;  3M2J A;  5HPF A;  1KE4 A;  2FFF B;  3PBO A;  3IX8 A;  2A49 A;  4N9K A;  1BSG A;  4KZ3 A;  3C38 A;  1PI4 A;  3NC8 A;  1SKO A;  5FI6 A;  4S2K A;  4PKY G;  4GCZ A;  3IXB A;  1YSP A;  1K55 A;  4EET B;  1ZKJ A;  4FTX A;  2QYB A;  1V9Z A;  2XDM A;  4ARZ A;  1YT4 A;  5CER A;  1K55 C;  3KX0 X;  3EWK A;  1W63 Q;  1T1B A;  5CTN A;  4H8R A;  1EWZ A;  1OJG A;  5GLB A;  3FZC A;  1H8Y A;  1XJ6 A;  4JGQ A;  1MKI A;  3CUE A;  3VV4 A;  1BLH A;  4Y0T A;  3IHB A;  4GZB A;  5L09 A;  3M6B A;  5HD3 A;  1NLY A;  3A3D A;  1CQA A;  4S2P A;  2JKF A;  5I5L A;  4Y13 A;  3G34 A;  3C30 A;  1T1C A;  1IYO A;  4ETX A;  4BBU A;  2QJ7 A;  4YOF A;  4F3L A;  1WYC A;  2DNS A;  3MXR A;  1LSX A;  1OJ5 A;  1BUL A;  1PZP A;  5TR7 A;  3LIC A;  4JPM A;  3F1P B;  1I5Q A;  1PFL A;  4XT2 B;  4GW9 A;  1PW8 A;  1D06 A;  3HCY A;  2GDN A;  3BYD A;  5HDS A;  3ZG7 B;  3DTI A;  1BTL A;  4R3A A;  3KSF A;  5TJJ A;  2PU2 A;  3RXX A;  2B5R A;  3ICY A;  3MF0 A;  2WGW B;  2P7J A;  1RGY A;  1ES2 A;  4HNB A;  4U0X A;  1XX2 A;  2R78 A;  3O5Y A;  5DJT A;  3SOI A;  5DTK A;  4FCF A;  4BL2 A;  1K38 A;  1VEU B;  3N6I A;  2PT7 A;  1BZA A;  4MDZ A;  5HWV A;  4CQH A;  3TE8 A;  2IWB A;  3UB9 A;  5HWW A;  4MBH A;  3FV7 A;  1YLT A;  3CPT A;  3QNB A;  3GDI A;  1GA9 A;  1LI0 A;  4LEN A;  4JF6 A;  3GSG A;  3UB8 A;  3E98 A;  3TSG A;  4P87 A;  3ZQ5 A;  1P9W A;  1LSW A;  3BJN A;  3T12 B;  1WE4 A;  3O87 A;  5AQ9 A;  4X1M A;  4N92 A;  5M1A A;  5E43 A;  2Q9N A;  3C2W A;  2VZW A;  3IBJ A;  3NDE A;  1GHI A;  1S6R A;  4DXC A;  5AQ7 A;  3VE3 A;  3NOU C;  2W3H A;  4KZ7 A;  2VJW A;  4Z1W A;  2EXB A;  3LUQ A;  2XGN A;  1MWS A;  3S7N A;  3VP2 A;  4X56 A;  1DP6 A;  2Y2G A;  2ZD8 A;  5CEB A;  1TD5 A;  2V9A A;  4ID4 A;  2HP5 A;  2HV1 A;  3O3V A;  1YLZ A;  1ESU A;  2LB9 A;  3MS6 A;  4QPR A;  3MFD A;  4WF0 A;  4IBX A;  4S2N C;  2O9C A;  1ODV A;  3QP6 A;  3MJQ A;  3T1X A;  1Y4O A;  2JKG A;  4S2M A;  3QNC A;  3TW8 A;  1ES4 A;  1L0F A;  3T4O A;  4RX2 A;  2V0U A;  3T4T A;  4B88 A;  4WUJ A;  5CGX A;  5KIZ A;  3NHQ A;  3VOY A;  4AFI A;  4FD8 A;  1MKM A;  4PM6 A;  2WKQ A;  2Y2I A;  2PR5 A;  1JWP A;  5DFX A;  4EBN A;  1PNE A;  2ZM8 A;  3VSK A;  3LID A;  2ZQ8 A;  4BWI A;  2D02 A;  4LCL A;  4H6J A;  2VGL M;  4WZ4 A;  4I38 A;  3H7W A;  3T4K A;  1SCW A;  2Y4A A;  1IYQ A;  5IT5 A;  5DVA A;  3FC7 A;  1ERM A;  3F1N B;  4JKT A;  3UPP A;  2L1M A;  2H5S A;  1NLZ A;  3U4L P;  3CG5 A;  1CI8 A;  3IF6 A;  3HJI A;  4KG2 A;  3PBQ A;  2OLV A;  2JKR M;  1M6K A;  3ISG A;  1LL9 A;  2ZQD A;  3V3R A;  3AGD A;  3DTK A;  1GSX A;  2OAQ 1;  2XFS A;  4BD1 A;  5E2E A;  2CC1 A;  1W79 A;  3JPU A;  5L8M A;  2OAP 1;  4LV2 A;  3ZG9 B;  3VFF A;  3WRZ A;  4OVD A;  2NUT C;  5F1F A;  2WAE A;  4OLG A;  1E3U A;  5M19 A;  1TS7 A;  1LHY A;  2Z6D A;  1W8Q A;  3UB6 A;  1JTD A;  1BLP A;  3QP8 A;  3DW0 A;  3CIT A;  2VLG A;  2WYX A;  5CHM A;  4QU3 A;  5KZH A;  3WRT A;  4MBF A;  1ZTU A;  4LPZ A;  2EX2 A;  3ZFZ A;  5AJG A;  4OPR A;  2W1T B;  2O9B A;  2Z6C A;  2YKH A;  3VOZ A;  2V20 A;  5A92 A;  4HQA A;  1OT6 A;  1XFN A;  1ERO A;  4GLQ A;  1EI5 A;  3UME A;  1VET A;  1K54 A;  2WKR A;  3MXQ A;  1CI9 A;  1F2K A;  4I39 A;  4X53 A;  3VP1 A;  1K6R A;  1PWC A;  3D72 A;  2ACG A;  1TS6 A;  2V0W A;  3P01 A;  4IUH A;  4A5R A;  4K0W A;  3BWL A;  4R0Q A;  4PM5 A;  1GCE A;  1XJ3 A;  2JHE A;  4IVI A;  1BYW A;  4HI4 A;  1SKF A;  2XH9 A;  3R7W B;  4G3K A;  5L2F A;  2VEA A;  4GS9 A;  4ZJ1 A;  1IKI A;  1W8Y A;  5EM0 A;  4L0L A;  5E2G A;  1Y54 A;  2IWC A;  1MC0 A;  2KX6 A;  4P6Z S;  3OZH A;  5G4Z A;  4HJ6 A;  5FAT A;  4IHQ A;  3MQQ A;  2WGI A;  4X6T A;  2H0T A;  3RXW A;  1TS0 A;  5AVF A;  3BQ8 A;  2H0Y A;  3V39 A;  4Y2F A;  3N4I A;  1P97 A;  5HL1 A;  4ZAM A;  3FPV A;  2PDR A;  5TFQ A;  4WEJ A;  1VM1 A;  3S4X A;  3ZDJ A;  2XQZ A;  4DDS A;  5FQK A;  2XFT A;  4QD4 A;  3RJU A;  3SH9 A;  2WZZ A;  2EXA A;  5EUA A;  4YWZ A;  3ULF A;  4U0T A;  3CI6 A;  3OPH A;  1FCO A;  5AQB A;  3LR3 A;  1QME A;  2K2N A;  3IQA A;  4PAU A;  4UA6 A;  1MWT A;  3HJK A;  3CAX A;  3NOP C;  4EQI A;  1Q2Q A;  2L4R A;  2NUP C;  1O07 A;  1G6O A;  2VGK A;  1JWV A;  3NJA A;  5L10 A;  3BLS A;  4NXF A;  3UE3 A;  4EQ1 A;  4Y17 A;  4OH0 A;  1DJB A;  2Y2J A;  5HAI A;  4ZDX A;  3QHY A;  1LSV A;  4GOG A;  4OOM A;  4WLA A;  4ZJ2 A;  3NI9 A;  3E0Y A;  4Y15 A;  2EFX A;  3UN7 A;  2EX6 A;  3KO6 A;  4I3J A;  4NKP A;  4OPY A;  3IWI A;  3LO7 A;  5CRF A;  3T1Q B;  3ZVT A;  2ZQ9 A;  4E3J A;  4Y0U A;  3BEB A;  5A90 A;  2JCH A;  1JVJ A;  1DY6 A;  2DMW A;  1DRM A;  1P9R A;  1GSV A;  1OTA A;  4OQH A;  3C8C A;  3G4P A;  1PIO A;  4JLF A;  1C3B A;  1LLB A;  5FDS A;  1G28 A;  1OTE A;  4EBP A;  2XR0 A;  4KZ6 A;  5GL9 A;  4OP8 A;  2PD7 A;  4JXV A;  2WGW A;  4DN0 A;  5HAP A;  4CLC D;  4X1L A;  3L9K A;  1CJF A;  3UNW A;  3KSI A;  5CED A;  4HJ4 A;  4BBV A;  3GV9 A;  2QZ6 A;  1FSY A;  1K56 A;  3IXH A;  3HLG A;  1Q2P A;  1PW1 A;  2ZC7 A;  2XEP A;  5FL3 A;  1TS8 A;  5FQM A;  3GEC A;  4KZB A;  3IXD A;  4KQO A;  3HLE A;  1EW0 A;  4KZ5 A;  2E8J A;  4Q8I A;  4HIA A;  3D3O A;  4LRX C;  1HVB A;  3WS4 A;  5TBM B;  3F1O A;  3ITA A;  4QY6 A;  4OON A;  1O7E A;  3PBS A;  2PR6 A;  2IA2 A;  2W3G A;  1T19 A;  3G2Z A;  4LV3 A;  4WEL A;  4GB7 A;  4G3V A;  1K4E A;  5CGS A;  3H82 B;  4CLC B;  5FAQ A;  5HW3 A;  3IH9 A;  3GRJ A;  1TEM A;  3E4O A;  2X71 A;  2WZX A;  3IBR A;  5EVI A;  4D2O A;  3PBR A;  4RX3 A;  1IYS A;  1PI5 A;  3EQU A;  4I3A A;  4GDN A;  2YKF A;  5CTM A;  1IEL A;  3LCE A;  2PU4 A;  2V1Z A;  4LV1 A;  4L9F A;  5EVI C;  3IXG A;  1STZ A;  3KSH A;  3ZGA B;  2QWS A;  3S7P A;  5GHZ A;  2M7V A;  4GHI A;  3DAV A;  2PRF A;  4P6B A;  4L9E A;  1JWZ A;  3RFB A;  2ZL1 A;  1MY8 A;  1NYM A;  1J3W A;  4HP9 A;  2BTF P;  3D4F A;  3LR0 A;  1SKO B;  5FA7 A;  1PYY A;  1D7E A;  3SZT A;  4HY8 A;  1H5X A;  2W0N A;  4K08 A;  3NY4 A;  3EOI A;  4HP4 A;  1NXY A;  4KQR A;  1HD8 A;  3ZCZ A;  4ARZ B;  3I7J A;  3ZYT A;  2JKT I;  3SS3 A;  1IFQ A;  4E3L A;  3DWK A;  5IS1 A;  3TRC A;  1NY0 A;  5EE8 A;  1XPB A;  4R3J A;  3KSG A;  3HBR A;  2LB5 A;  1MXO A;  2D01 A;  2PHY A;  1GA0 A;  3PR6 A;  1NJ4 A;  2X02 A;  3VOL A;  2MJ6 A;  5KMW A;  1VQQ A;  4O01 A;  4D60 A;  2VX8 A;  4MEZ A;  3WS2 A;  4MNR A;  3W2Z A;  1HLU P;  3T4J A;  3U2A A;  1F9I A;  4MCW A;  5E2H A;  4DJ2 A;  4F3L B;  4OQI A;  1XJ2 A;  1YAX A;  2HGV A;  1AXB A;  3OPL A;  3EGX C;  2O99 A;  1PWD A;  2WGV A;  3LY3 A;  5EEC A;  1GHP A;  4LFU A;  1IEM A;  4MN6 A;  1DP8 A;  5E2F A;  3N8R A;  1TVF A;  4S2O A;  3PYP A; 
#chains in the Genus database with same CATH homology
 3CIT A;  2VLG A;  2ZOI A;  2ZMF A;  3OOV A;  1TF1 A;  5HSQ A;  4LRY C;  1S1Y A;  5LBR A;  3BY8 A;  4IJG A;  1ZTU A;  1OTB A;  3CUE C;  4LPZ A;  4BJP A;  3MQ0 A;  4HH3 A;  5J4E A;  2M7U A;  5AJG A;  4UQI M;  1N9N A;  1DP9 A;  3UE6 A;  4WL9 A;  2W1T B;  2O9B A;  2Z6C A;  2YKH A;  4HQA A;  4Q0I A;  1OT6 A;  1XFN A;  5TBM A;  4GLQ A;  3TJZ C;  3T50 A;  3VE4 A;  2OOL A;  3UME A;  3MR0 A;  2QJ5 A;  2WKR A;  4Y5F A;  4L9G A;  3JVU A;  3MXQ A;  4EES A;  3UMD A;  4I39 A;  4P6Z M;  4EXO A;  3T4Q A;  4FOF A;  3D72 A;  2J3T D;  4EER A;  2W3D A;  1TS6 A;  4GJ4 A;  1MZU A;  2V0W A;  3P01 A;  4O0P A;  4IUH A;  3BWL A;  3H82 A;  4CLC A;  1XJ3 A;  4UQI S;  2VV8 A;  3EEH A;  4B93 A;  2JHE A;  4CLC E;  3FPW A;  1BYW A;  4HI4 A;  3NOT C;  1H8M A;  3R7W B;  3A0R A;  2XA7 M;  4G3K A;  2XRN A;  2XSS A;  4WEK A;  2VEA A;  4GS9 A;  5DJU A;  4CLC C;  4RQ9 A;  4WN5 A;  4L0L A;  4O8G A;  2G7U A;  4JGR A;  1MC0 A;  2VA0 A;  1VB6 A;  2PYR A;  5J7E A;  5J3W A;  2KX6 A;  3LIB A;  4P6Z S;  3PXP A;  1F5M A;  5G4Z A;  4HJ6 A;  3RTY A;  1P0Z A;  1UWN X;  4IHQ A;  5HPF A;  4MN5 A;  3MQQ A;  5F6A A;  3S7Q A;  3PBO A;  2PD8 A;  2GJ3 A;  4PHT A;  1TS0 A;  5AVF A;  3BQ8 A;  1GSW A;  5F68 A;  3F1O B;  4Y2F A;  5DFY A;  1P97 A;  2A2L A;  2QHK A;  2XA7 S;  3C38 A;  3FPV A;  2ZMV A;  3V67 A;  1OPX A;  2PDR A;  5HZH A;  3LYX A;  2M1C A;  2B02 A;  4WEJ A;  2CMN A;  5DKK A;  4PKY G;  1LT0 A;  4GCZ A;  4M4X A;  3IS2 A;  3R7W A;  1YSP A;  4II7 A;  4EET B;  2OWJ A;  4OOL A;  3E4P A;  3UB7 A;  1KOU A;  1V9Y A;  2QYB A;  1V9Z A;  3LI9 A;  4B9O A;  4ARZ A;  4BMW A;  3KYQ A;  4YWZ A;  3ULF A;  3T4L A;  3CI6 A;  5A8B A;  3KX0 X;  2Y8H A;  1W63 Q;  3EWK A;  1T1B A;  2K31 A;  1NWZ A;  3LR3 A;  5HDD A;  2K2N A;  1OT9 A;  3S7O A;  3OLO A;  3MQO A;  3PBN A;  1W63 M;  1OJG A;  4PAU A;  3F1N A;  2W27 A;  1T18 A;  1XJ6 A;  4JGQ A;  3CUE A;  3VV4 A;  3HJK A;  4Q0H A;  3CAX A;  3NOP C;  2H28 A;  3CWF A;  2L4R A;  2NUP C;  5HD3 A;  3RH8 B;  2FH5 A;  1H3Q A;  4R38 A;  3E4Q A;  1NLY A;  1G6O A;  2W1R A;  3KYZ A;  3NJA A;  4GHI B;  5I5L A;  3C30 A;  1T1C A;  4ETX A;  4NXF A;  3OCL A;  3UE3 A;  2QJ7 A;  4YOF A;  2HJ9 C;  4BBU A;  4EQ1 A;  4F3L A;  2QKP A;  2ZOH A;  1LSX A;  1OJ5 A;  1LSV A;  3A0S A;  3BW6 A;  4OOM A;  2KDK A;  3LIC A;  4WLA A;  3LIF A;  3F1P B;  2A24 A;  3B47 A;  3E0Y A;  4XT2 B;  2K7S A;  4GW9 A;  2HJE A;  1D06 A;  3HCY A;  5F69 A;  2XRO A;  5HDS A;  5HPI A;  3KO6 A;  4I3J A;  4NKP A;  4G3W A;  4H6J B;  4R3A A;  3KSF A;  5TJJ A;  2J3W A;  3H7W B;  4HH2 A;  3SW1 A;  2JN7 A;  2V1A A;  3LI8 A;  1F98 A;  3ICY A;  3LFV A;  3MF0 A;  2P7J A;  2L0W A;  4JGP A;  2INW A;  4HNB A;  2W1T A;  2P08 A;  2R78 A;  3O5Y A;  2DMW A;  3FG8 A;  1DRM A;  1P9R A;  1GSV A;  1OTA A;  5DJT A;  3B42 A;  3EQV A;  2O0Y A;  3C8C A;  1N9L A;  3LR4 A;  5C5K A;  1S1Z A;  3PHY A;  2PT7 A;  2EA9 A;  3LR5 A;  4MDZ A;  5HWV A;  4Y3I A;  4CQH A;  3TE8 A;  1OTI A;  3B33 A;  1NRJ A;  1G28 A;  1OTE A;  4PKY A;  3UB9 A;  5HWW A;  4EU0 A;  3GDI A;  4ZRR A;  2PD7 A;  2KLI A;  4DN0 A;  3UB8 A;  4CLC D;  2W3F A;  3E98 A;  2PYP A;  3KSI A;  4HJ4 A;  3ZQ5 A;  4BBV A;  1P9W A;  1S67 L;  1LSW A;  3BJN A;  3H9W A;  3G6O A;  1LL8 A;  1TS8 A;  5FL3 A;  3GEC A;  4KQO A;  3C2W A;  4ME4 A;  4ETZ A;  2VZW A;  3BQA A;  1EW0 A;  1T1A A;  3IBJ A;  4YNR A;  4HIA A;  3D3O A;  4LRX C;  3VE3 A;  3A0V A;  3NOU C;  2W3H A;  2O9A A;  2VJW A;  5TBM B;  4Z1W A;  3LIE A;  3F1O A;  3R4K A;  4KUO A;  3DBA A;  3OBF A;  3LUQ A;  4R70 A;  3CLO A;  1IOU A;  1YKD A;  3S7N A;  5CX7 A;  3PBS A;  4DJ3 A;  2PR6 A;  1DP6 A;  4JGO A;  2IA2 A;  2W3G A;  3MMH A;  1T19 A;  3LIA A;  1TD5 A;  2V9A A;  4WEL A;  2HV1 A;  4NXG A;  4G3V A;  4KUK A;  2LB9 A;  3H82 B;  2J3T C;  3JVV A;  4CLC B;  4EW7 A;  1N9O A;  2B18 A;  4Q0J A;  2HF6 A;  3K3C A;  4I3I A;  4QPR A;  5HD5 A;  4WF0 A;  3E4O A;  2O9C A;  2OWH A;  3K3D A;  1UGU A;  3IBR A;  1ODV A;  3PBR A;  1OTD A;  3MJQ A;  4I3A A;  3EQU A;  2GX5 A;  4GS9 B;  2YKF A;  3T4S A;  2VKS A;  1Y28 A;  5EFW A;  4LLO B;  4EEP A;  4EUV A;  3TW8 A;  3MFX A;  1S4S A;  2EWV A;  4L9F A;  3T4O A;  1STZ A;  5HWT A;  3KSH A;  2V0U A;  1JNU A;  3T4T A;  2QWS A;  4WUJ A;  3S7P A;  1ZHH B;  4MN7 A;  2M7V A;  4GHI A;  2BAS A;  5KIZ A;  2ZBB A;  2GNX A;  5IU1 A;  5HDC A;  4IUK A;  3NHQ A;  4AFI A;  3K2N A;  4L9E A;  3RFB A;  2JKT M;  1X0O A;  4NEE D;  1MKM A;  2WKQ A;  4HP9 A;  2PR5 A;  2WKP A;  3LR0 A;  4HJ3 A;  5AVE A;  4UEY A;  5DFX A;  1XJ4 A;  3F1P A;  1D7E A;  3LID A;  4R6L A;  4XT2 A;  2VV7 A;  3IS2 B;  4HY8 A;  1UWP X;  4BWI A;  2D02 A;  1WA9 A;  2W0N A;  2KOI A;  2P04 A;  4NXB A;  4K08 A;  4NXE A;  4H6J A;  2VGL M;  3EOI A;  4HP4 A;  4DMZ A;  3OC2 A;  4I38 A;  3H7W A;  4ARZ B;  3ZYT A;  2JKT I;  1S66 L;  1IFQ A;  2I9V A;  1YSQ A;  3T4K A;  3BY9 A;  5IS1 A;  3P7N A;  3TRC A;  4I5S A;  5IT5 A;  3KSG A;  4BBT A;  2LB5 A;  2D01 A;  3EEA A;  3FC7 A;  4MMN A;  5F5Y A;  2PHY A;  3F1N B;  5KSH A;  4LRZ E;  3PR6 A;  3PBT A;  2GZA A;  5K5B A;  3OCN A;  2L1M A;  3VOL A;  2MJ6 A;  5G4Y A;  1NLZ A;  4O01 A;  5DF9 A;  2VX8 A;  5HL6 A;  3HJI A;  2W3E A;  1S4R A;  4HOI A;  3W2Z A;  3T4J A;  3U2A A;  1F9I A;  2V1B A;  2VGL S;  3PBQ A;  2Y79 A;  2JKR M;  4MCW A;  4DJ2 A;  4F3L B;  2J80 A;  1XJ2 A;  3EGD C;  1YAX A;  2VV6 A;  2HGV A;  3EGX C;  2O99 A;  1GSX A;  4FSF A;  2OAQ 1;  5MC7 A;  4KQD A;  2FZ0 A;  5L8M A;  2OAP 1;  4MN6 A;  2EWW A;  2A24 B;  4E04 A;  1DP8 A;  5DKL A;  2NUT C;  4HHD A;  1VHM A;  4EEU A;  1TS7 A;  2Z6D A;  3UB6 A;  1XFQ A;  2JKR I;  3PYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...