3JVVA

Crystal structure of p. aeruginosa pilt with bound amp-pcp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
342
structure length
331
Chain Sequence
MDITELLAFSAKQGASDLHLSAGLPPMIRVDGDVRRINLPPLEHKQVHALIYDIMNDKQRKDFEEFLETDFSFEVPGVARFRVNAFNQNRGAGAVFRTIPSKVLTMEELGMGEVFKRVSDVPRGLVLVTGPTGSGKSTTLAAMLDYLNNTKYHHILTIEDPIEFVHESKKCLVNQREVHRDTLGFSEALRSALREDPDIILVGEMRDLETIRLALTAAETGHLVFGTLHTTSAAKTIDRVVDVFPAEEKAMVRSMLSESLQSVISQTLIKKRVAAHEIMIGTPAIRNLIREDKVAQMYSAIQTGGSLGMQTLDMCLKGSRENAREKAKIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Atp binding protein
molecule keywords Twitching mobility protein
publication title P. aeruginosa PilT structures with and without nucleotide reveal a dynamic type IV pilus retraction motor.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 109
structure length 331
sequence length 342
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3jvvA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3jvvA02
2KB0A 4LJ9A 3WYGA 4D6PA 1Q3HA 5KYKA 3A4LA 1Z6YA 3LNCA 1GITA 5HKKA 5FBWB 3I8SA 2VQSA 4YONB 5CB8A 5JWOA 1B0UA 1SVKA 2GF0A 3ASZA 5G3YA 4GFDA 3WBKA 4P0TA 3VQTA 2VHCA 1Q1EA 2IYLD 3QUSA 1VYUA 3BXZA 1UM8A 1YVDA 2P6RA 3SFZA 1FOEB 2ZRIA 5DLQC 2IYWA 4HDCA 4NCJA 1Z6AA 4Q9HA 3G82C 5FTLA 1ZCBA 3GLFE 3KJIA 1ZU4A 2YWHA 1GL6A 4OHXA 1M6NA 3RS4A 4UNNA 8OHMA 3N5CA 4MKFA 2C9YA 1VTKA 4Q7LA 4FMBB 3EAQA 4RD2A 4U7DA 4QXAA 4B43A 4OBEA 2TMKA 2FX3A 4NZYA 5BYKA 2PZFA 3BGWA 3NHBA 4EJSC 3VU9A 1GTVA 2L0XA 1DBSA 2VP6A 4KU4A 4DDTA 2V1XA 2YC2C 4QGHA 3AF1A 2O5VA 1M7HA 2F6RA 4OK3A 3H86A 4PZYA 1LFDB 5AR1A 2AK3A 4JL5A 3HU2A 3BORA 4YXWD 1P2VA 3C8UA 4EQ6B 4TLDA 1GNQA 4KSBA 4PAMA 4V0LA 5H8WA 2Q6TA 2GJSA 1OXXK 2W6ID 3HPQA 2OLJA 2WZQA 5DSZA 3RLFA 2ZRMA 1R8SA 4URVR 3LLMA 4TMVA 3B9PA 2JLSA 2H8KA 3OF5A 3C15C 3THXA 1IY1A 3HDTA 1ZRHA 2FGJA 3UATA 5FH9A 1KO5A 1H8HA 1Q1QA 1Q44A 3EA0A 1SGWA 4PZLA 1EWRA 2IS2A 1AIPA 3NC1C 4PQRA 1MKYA 4M1MA 1BMFD 2DB3A 2GDJA 1IXSB 1BS1A 1N0WA 4POAA 2ZYVX 5FI1B 2ANCA 4C9BA 3KTAB 3TAHA 1U99A 4HDQB 1YZNA 4QFMA 4X8OA 1BYIA 1TEVA 2EWWA 1LS1A 2EFHB 4KI0A 5FOTA 3VMFA 3B13B 3KXIA 4C4PA 3KQUA 2ZRNA 1E2DA 4HAXA 4AG6A 1KI4A 1YJ5A 2YOHA 4RFVA 4B3XA 1MO4A 4A36A 2FGKA 1FNNA 4BPBA 2CLDX 3B85A 3MAAC 1VPLA 1P73A 2C2HA 2OCAA 1ZJ6A 1KGDA 2GCPA 2YNMA 3AF0A 4HEJA 4NKRA 4Q7KA 4DEYA 1XCMA 1TQ4A 2HCJB 1QDEA 4KJZA 2FH5B 1VG1A 3ZIAD 1A7JA 1T5IA 2ZJBA 4Q02A 3O8CA 2GJAA 3A4MA 2DFLA 3GLHE 4QBFA 5KSPA 2JJ1D 3OAAD 3KXLA 2CE2X 5CJ2A 1XWIA 1KDPA 4D0GA 3ZH9B 2AHOA 2DWQA 1NRJB 5B2ZA 3TUIC 4DXAA 1ELOA 2NZJA 4IRUB 3FMFA 1G3QA 1G3IA 2I1VB 2J0SA 2BC9A 2QN6A 4JYBA 1OH7A 3H1TA 4DSOA 1J7KA 3F3YA 5HTKA 2CVFA 2JA1A 4TQAA 4C2TA 3GJ3A 3WHLA 3QBTA 4A92A 1OKKD 4TZ0A 4B74A 2FDCA 5JMTA 2EFGA 2IF0A 4Q4JA 3B78A 2V6IA 4CEIB 4ZCMA 1CJTC 3VR2A 1ZIOA 3TRFA 4EFNA 4ZO4A 3SYLA 1XD8A 3K0EA 4RZUA 1SVSA 1TF5A 3K09C 1VCNA 2R65A 2CK3A 1JXOA 1BO6A 2E87A 2EYUA 2OLKA 3RSOA 2WMOB 3BERA 1L2TA 1A4RA 2ZI6A 2XTZA 3OIYA 2XZOA 2JLYA 3CKLA 4FCWA 1COWA 2KI5A 2VRWA 1HTWA 3CBQA 3RRZA 1H65A 3ONWA 4TTQA 5D3QA 3SE0A 2MMCA 1P2SA 3RWMB 1E0AA 5JRZA 2OCBA 3KFVA 2FSFA 1R0WA 4L16A 5C4MA 4R2IA 4Q47A 1N6RA 4HB4A 1EFCA 3AM1A 2C78A 3FB4A 4XSHA 4DCUA 2C98A 4JBXA 2EVWX 5G41A 1SXJD 4HSEA 5C2JB 2F1IA 3K9NA 4R7ZA 2BMFA 4IOKA 2FSHA 3BWDD 3KKMA 3GMTA 1GP2A 1QHNA 2ASEA 3F8TA 1MO3A 4A1FA 4AYTA 3THWA 1QBKC 2QY9A 3QPUA 3C7KA 1SKYB 3LW8A 3IPYA 4KLZA 3AB3A 4UXHA 4M1WA 5J4HA 1AGRA 3RC8A 1P9WA 1RPZA 3BH7A 1FX0A 1XCPA 3DDCA 4Q01A 3WRXC 5E7MA 2ZS8A 4B48A 4Q03A 1PLKA 2D4HA 4FIDA 1TF7A 4TMWA 3TSWA 1G3MA 3EW9A 1LY1A 2JEOA 3HJNA 2IHBA 1CR1A 2GILA 4MUAA 2P6UA 4E03A 1YZQA 4QC2A 4MKGA 4AKIA 1Z6TA 3N2EA 1VHTA 4OYHA 2NG1A 4ON9A 4ZIRA 4OHZA 1MR3F 2QGZA 1VKJA 1II0A 1YR8A 4ITRC 3FHTA 3GFPA 2PH1A 2CBZA 1CLUA 3RS3A 3ZYCA 2W83A 2W6IA 2ZETA 4QG7A 3LA6A 2GBLA 1D2EA 3ZVNA 2IL1A 4FD2A 1WCV1 4MYHA 1XZQA 2EQBA 4JLPA 1W4AA 1DG1G 4C0LA 3A4NA 4QNRA 2QNRA 3BAFA 1QVAA 2VA8A 1XEXA 4NYJR 1UKYA 3NHAA 2ZJYA 5BW8A 5CDFA 4F93B 2ZTSA 5H1YA 3CZQA 1E94E 3T35A 1VIYA 4Q5IA 2GTPA 1VCIA 2A5FA 2OILA 1E69A 3QNUA 5KNDA 1IAQA 1U9IA 5EXPA 1MOZA 2V4ZA 3MWKA 1AZSC 4LHXA 4BLTA 4M9XA 5P21A 3U3KA 5CK4A 3C14C 3H4MA 2ZRPA 4BZPA 4LC1A 1XD2B 4A6XA 3MGCA 3CX8A 4BFYA 2EU8A 4EIWA 4LYFA 1KZGB 1R0XA 2VPPA 4TL6A 5F3WB 2RGDA 4DDUA 4FMDB 2ZJ8A 1EG7A 1L4UA 1G8HA 3DMDA 1S3GA 2F1RA 1ZD8A 2I3BA 3PXGA 3QKRA 4US1R 4DBLC 1E2HA 1WRBA 3DO6A 4GOKA 3TKLA 4XVQA 2QZ4A 4JLAA 5J5CA 3RVBA 5JS8A 2RGBA 4LCBA 4KCGA 3OAAA 4OHYA 2PX0A 4KODA 4LBVA 2F1JA 3REGA 4TYYA 2DFTA 3HU3A 3ZQJA 1G3UA 5E3HA 1WBBA 2WSMA 4TMKA 1E9BA 5FL3A 2BV3A 1IXRC 1UBFA 5BN4A 3WYAA 1JNYA 4MGZR 4M1SA 2ZSDA 4V0ME 3SN6A 2WWHA 4X8HA 4A82A 4H1VA 4OKSA 4AK9A 2HDNB 2RMKA 1YR9A 1E79D 3ADBA 2P0EA 2AD1A 2QAGB 3BFVA 2UKDA 5LB2A 4ARZB 1JB1A 1G8PA 3ZS8A 1JAHA 4EKDA 2CJWB 4MYCA 2ZROA 4KBGA 5EP4A 1KMHA 3EA5A 2GVDC 4Q1EA 4TTPA 1KAGA 1E2GA 2ZSFA 1W1WA 4DRZA 2OAQ1 2CCKA 3QVUA 4I81A 4Z1MA 3UMFA 4M9ZA 5JEDA 1FZQA 2YJTD 2WVJA 1S3SA 1GNRA 1NSTA 4JSYA 3NEJA 2JDIA 4IEIA 1UBEA 1CTQA 1F2UA 3KQHA 2P6NA 3U4QA 1T3LA 2G0NA 3EZ7A 4I1OA 2ONKA 3MCAA 4DLTA 4RCYA 4LV8B 4Q1BA 5TDHA 1M7BA 3AF4A 1KDRA 4BZXA 3NH9A 1U94A 5CIWA 3ZQ6A 4QM7A 2V3CC 3N70A 2QROA 1QHIA 4C0BA 1OIWA 3QXSA 2RGNC 4E07A 4OQFA 1NN0A 4QHTA 2FZLA 2QI9C 2UZ3A 1PLLA 2WWIA 4TWZA 4D0NA 2QTFA 2O0KA 4GBMA 5M04A 2IBMA 2X19A 2XTNA 3DZ8A 4WZ6A 1RFLA 1VYTA 5TARA 4EPYA 3DZDA 1NMYA 2KSQA 3CB4A 2KBEA 4KV9A 4Q9JA 2WJYA 3PUYA 1XTKA 3TR0A 4P4SA 1EFRA 1CIPA 2ZPTX 2HLDD 1GSIA 1RYHA 3VR6A 5J4KA 2ZANA 1Q21A 4F4JA 2XXAB 4BZQA 3R9IA 2HJGA 2AD5A 1E2PA 4DLYA 5LD2B 1AK2A 4HAUA 4CT4B 3R9WA 1V5WA 4LJ7A 5G3ZA 3GLFA 1W0JD 2V7QD 1JPNA 2B7BA 2IYXA 2YWFA 3B2EA 4I1SA 1CJVC 2XJ4A 4WBSA 2J0QA 3B82A 4TL9A 1KDOA 2IYYA 1XXHB 5JJLA 2EFCB 2VLIA 4I1VA 4WZAE 4B3GA 3CNOA 4TYQA 1R5NA 2VTKA 2VP4A 5FBRB 1OXTA 1DOAA 3E5HA 2P3SA 2WHXA 4HYYA 1XMVA 1KI1A 2BHRA 3QEJA 4URWR 3D6TB 1F6BA 5TXGA 3RRMA 2GJ8A 2RGXA 1R5OA 1S0UA 4JKIA 1QVRA 5GJVC 1YZLA 2FOLA 1Q12A 4HLCA 4U5XA 2WMNB 4JL6A 2IHYA 1IQPA 2PT5A 3CO5A 4NYIR 2R6DA 2A78A 2AK2A 4Q7MB 3MD0A 5FPYA 3RHFA 4DJTA 3V4FA 4O25A 4LX0A 2GXAA 2GESA 1OIVA 2IWRA 1N6LA 3DPUA 2AX4A 2C5LA 4EPVA 1PLJA 1P61B 3V9PA 5C1BA 1T91A 4D81A 2DFNA 3U60B 1ETUA 1WXQA 5JS7A 2J46A 3VFDA 3K8YA 3QPWA 5DYIA 2OBNA 4Q1CA 1SHKA 4HAYA 5J4YA 1XTQA 3R7WB 3T12A 1N6KA 5FUXA 1M2OB 5KPDA 4B47A 4JLBA 4GSYA 5LPNA 2O0JA 4OQNA 2KJQA 5FFMA 5AWFC 4M21A 2ZJOA 3M4YA 1HA3A 2O8EA 3BJIC 3S1AB 2ZRDA 5JSZA 4QJ3A 1DG3A 4GZMA 3LH5A 3N2IA 3WP1B 3NWJA 1SQ5A 4E09A 1D9XA 2YVUA 3EZ6A 1Z0FA 4EFMA 4C7OA 1QHHA 1GNPA 3KJGA 1MABB 1QF9A 4MRNA 2VSXA 3EG5A 1LW7A 1N3BA 5GADl 1N5JA 1XJQA 1PJRA 2ZR9A 3RANA 1P75A 2QAJA 1P72A 3TVDA 1XJCA 2IA5A 2BJVA 3GLHA 3PUWA 721PA 3NVAA 1SXJC 1TX4B 3TVTA 2V55B 4MDFA 1GIAA 5JBQA 1R4AA 1UDXA 3IKJA 3U3RA 4RCZA 4PZZA 1KI6A 3KB1A 1DS6A 1N0VC 2IYQA 1OV4A 1W7AA 2O8BB 2FV8A 1TPZA 3ND9A 4A6PA 1NKSA 2LKCA 3VTKA 621PA 2ZI5A 4LJ5A 3QKUA 3U7GA 2CCJA 3IDQA 2HJVA 2F9LA 3AQ4A 1QHYA 3Q85A 1RJ9A 4Q7JB 3TAUA 2J0VA 1NJGA 4K8OA 2N1BA 1ESNA 2ZJ5A 1XCGB 4PHGA 2V6JA 4RFSB 4CEHB 1E1RD 4UNPA 4L5BA 5AUQA 1G8GA 1P5ZB 2QMEA 2A5DA 4DVGA 1G9XA 4TQUS 3RAPR 1AS2A 1M74A 3CF6R 2C95A 2ZUDA 4TYNA 4IFBA 2GXUA 4JBYA 5K8LA 2G9NA 1D6JA 1E4VA 1EFHA 3BH0A 3SOPA 4CT5A 4S35A 3GJXC 2JGNA 3EWSA 1K5DA 1A1VA 1Q22A 1X8LA 2PMDA 2QPTA 2NTYC 5A4JA 1OXUA 1YKSA 1XMIA 4RZXA 1UJ2A 2W0SA 2OFOA 3GFTA 1KOFA 2I4IA 1IN5A 2IWHA 3SZRA 3KUDA 2FWRA 1JR3D 4FWIB 2RGCA 2DPXA 3PQCA 4XD7D 3PIRA 1EX7A 2YWEA 3K0FA 5TVKA 4KSCA 4AIIA 2PZEA 1FL9A 4OJQA 1ZD1A 5JEEA 1S4QA 3QG5A 5DISB 3B60A 2ZAMA 4II7A 3GPLA 3OEHD 4XVRA 5FTNA 3FMPB 1T6NA 1E2JA 1G7RA 1NVUQ 4CVNA 5FPHA 1N6IA 2XB4A 2HYIC 1XD9A 1X3SA 3OEEA 3A58B 1R8QA 1VMAA 1CR0A 2A30A 3T5GA 3WXMA 5JI2E 4TYPA 2BVNA 2IS1A 3ZZ0A 2R6CA 3AP2A 5IT5A 1KJYA 3FMOB 1TL7C 4JT2A 3K0AA 1T0JB 3TJZA 1G4UR 3AKYA 4KBFA 4BRWA 3WY9A 4G3XA 3WMEA 3WYFA 1CJMA 3KKQA 3CRW1 1VIAA 1RW4A 1FP7A 4HZUA 3I4LA 5GVRA 1G7CA 3PG5A 4ACBA 2VEDA 2HUPA 1HQCA 1XPRA 4GP7A 1HT1E 2H17A 1W48A 5EXTA 2JJ8A 3TLXA 5BWMA 4A0RA 4BFVA 3K70B 2ZYTX 4XWAA 2DY1A 2OHFA 1AM4D 4G5RA 3I61A 2BMJA 3T1VA 4FW9A 5D3MB 4CZ2A 3K0SA 2YINC 2WV9A 2A5YB 2BEKA 4NYMQ 3FOZA 4HUQB 5E7IA 5C4GB 2ZRCA 3LBHA 1P7CA 5JHHB 1SXJE 5L3SA 4NE2A 4O0MA 5AUPB 1OF1A 2CNWD 1M1YE 1KSHA 3E70C 1U8YA 3IIKA 2AFIE 1SKQA 4BLQA 4BFTA 5CITA 4AY2A 4QKQA 3CRMA 2HXSA 1HT2E 4AWXA 2OZEA 2WAXA 2AWNA 1KTVA 1YE8A 4JJKA 1FP6A 4NU0A 3SC3A 4EAQA 1LF0A 2WKQA 3CM0A 4CEJA 2RH5A 2XITA 4M1KA 3RS7A 3RS2A 4FXPA 2FFBA 5EE1A 2ANBA 1NP6A 1UEJA 5GJCA 2XOKD 1NN5A 3IBYA 4PFSA 5SZIA 4ASUD 2Q9BA 3K09A 4FMDF 4I1UA 2WJHA 3GLGB 4PAOA 4BLOA 3TSZA 2PEZA 4IVPA 4C2UA 2F9MA 3D7MA 4PAQA 3VU9B 4LBWA 1DAKA 3VR5A 1F48A 2E1RA 4GRAA 3NC0C 2AXPA 3UKDA 2VP0A 4F38A 4V0MA 3W3AA 1FFHA 3KQKA 4DCTA 3MG9A 5AJWA 4XVUA 3CRRA 3QKTA 5DI9A 2ORVA 3V00A 1NY6A 1AA9A 4UKDA 2ZU6A 2FPKA 1OB5A 1P9RA 2AFHE 1QRAA 4QJ4A 2ORWA 4A0GA 5EE9A 3SYNA 3CONA 2H92A 3IO3A 1XRJA 1NLZA 3K1JA 2CE7A 1E2KA 1KKLA 2D62A 3SBEA 2CLSA 4IFEA 3THXB 1ONBA 1SVIA 1T8UA 1VDZA 2HF9A 4HUTA 1FMJA 1W0KA 3GFOA 4RSGA 3UG7A 3SS8A 4GZLA 3WNBA 1E2MA 2IYTA 3QXXA 5FOWA 1Z22A 1ZIPA 1GWNA 4BECA 1V43A 1W2GA 4OL0A 1A5TA 1RRFA 4GDFA 3M6AA 4KO8A 1K6MA 4ESHA 1TADA 4XD7A 1TU3A 3LFUA 1KSFX 4HLUA 4NMMA 4LV6A 4OK5A 1OFTA 4QRHA 4BFSA 1Z0DA 1TUIA 1ZM3A 4BFZA 1Q3TA 2JIZA 2FA9A 5SZJA 2DWPA 4IEEA 3BFXA 1OYWA 3BS4A 1GOTA 4RKFA 5BXQC 2X1VA 5L8VA 1XB2A 5KTYA 1JEEA 1KJZA 3QVVA 1VCMA 3T1TA 2ZE6A 3B1ZA 2GCOB 3LRPA 4NYIQ 1P4SA 3CF2A 1BYUA 2ZR0A 1OFHA 1OFIA 3A1SA 3NKVA 4QHSA 1GZSA 1E96A 6Q21A 1Y3AA 1YU9A 4JLMA 4KITB 2EW1A 1IJEA 2C99A 2GKSA 2XJ9A 3OHMA 2XSZA 2QBYA 4DUGA 1IN7A 1E9EA 3MWLA 5IF9A 2PL3A 2VL7A 2RKOA 1E2QA 4GOJA 4XSGA 1G21E 1R5BA 3FDIA 1NSFA 2IS4A 1FPMA 2GVZC 2NQ2C 3R8CA 2QRNA 5BN5A 1XTSA 1W4CA 3LXXA 3BRWD 2BBOA 1K5GA 2VHQA 4F92B 1MO6A 3AVQA 2ZUBA 1Q0UA 3K0CC 4D2IA 2IX3A 5FTMA 2QTVB 1DO0A 3HPRA 1FUKA 4BLSA 4GI7A 4NH0A 2I1QA 4EPRA 2DYKA 3PJRA 1C1YA 2VP9A 3SHFA 3AVWA 1YR6A 3GJ4A 3AV0B 3B7GA 4GMXA 2WWGA 1YRAA 3NBZC 4URZR 1GKYA 1SVLA 3MSXA 2HT1A 3CLVA 3GJ7A 1UKZA 2CLCX 5KDLA 221PA 2CHQA 3UMRA 5IDVA 4Z54A 4LYJA 1E2FA 5TB5A 3I92A 3Q3JB 2IUSA 4MRPA 4ZI2A 3HWSA 2OUKA 3THWB 4AI6A 3ND8A 4HATA 1N5LA 3L0OA 1W36B 3LQRA 4RJLA 2GJ9A 5FI0B 2D3WA 1NMZA 1O3YA 1W49A 2PT7A 1X1SA 1FX0B 2ZEJA 5UKDA 1XF9A 5HZKA 3HP1A 2W0MA 3UMSA 4FWTA 4LZZA 4Q4HA 5C18A 4GNKA 1S1MA 1ZD9A 1Z28A 4MDEA 3FHOA 4JBWA 4B71A 1G291 1ZM2A 1NMXA 4JL8A 4IXNA 2YHSA 4EDHA 4PC7A 1UAAA 3JZMA 1G3RA 1EK0A 1S2MA 2IYVA 4RZ3A 1XPOA 1Z08A 2A5JA 4DSNA 3J81k 3M1IA 3L8ZA 1GAJA 4R2HA 1A2KC 4DT1A 4LUCA 4DCVA 4URXR 1D2MA 4PQYA 2VP5A 3KKNA 3L0PA 3EPJA 2ZSEA 2WJJA 2ZI9A 3BOSA 1E2NA 3O8DA 2WBLC 3ECCA 1ZC4A 3CR8A 4B2PA 2BJWA 1XEXB 1CRQA 1TNDA 2VF8A 2H5EA 2RGNA 2ERYA 3OIWA 4IW3B 4MRRA 1PUJA 1VG8A 4YXWA 2H1LA 5JZVA 2QMHA 4JT4A 2ODNA 1FTSA 1W4BA 1OFUX 3U3MA 3BB3A 4OQLA 1X1RA 4B75A 1XFAA 5E7JA 1OXSC 1XJ0A 3L2OB 2JJ2D 1U2RA 5SZHB 3B1WA 2W00A 1OHHD 2H57A 3OE7D 3A8TA 1WQ1R 2HEIA 4QOSA 4WW0A 1H8ED 1BMFA 3PENA 4WXRA 1C4OA 3GJ6A 4PSVA 3K9GA 1ZC3A 5EE0A 1IY0A 1VYVA 2GXQA 2QEQA 2IC5A 2PCJA 4V0KA 4M9QA 3AKCA 5EP2A 2GWHA 2ZXUA 2AKAB 3W9YA 4E5UA 2KE5A 2VSOA 4ZPXA 1AN0A 5K8IA 2BCGY 1N5IA 1XP8A 3PITA 3BBPA 2C9OA 5EQTA 3SFVA 4QJ5A 2CL0X 2FN4A 3SJCA 1RIFA 3AVYA 3SQXA 2ZJ2A 3K53A 3Q7PA 4CYMA 4PHTA 1SVWA 3VNVA 5CLQA 3NEYA 4UJ3A 2IUUA 2O0HA 4WXPA 1J8MF 3THOA 2B21A 2RGAA 4PPNA 1MT0A 1R0YA 3PVSA 4CRWB 2QRZA 2P67A 4WOPA 1ZUNB 4OHWA 3GEIA 3ZIAA 1SHZA 4TTRA 2QM8A 2XZPA 2ZRGA 4PC3A 2JJ1A 2REXB 1KSJA 3PEYA 4P4UA 2QQ0A 2FFAA 4CDGA 1FNMA 1US8A 4B3DA 4DKXA 1GRQA 3D8BA 2C8VA 1KY3A 5JCZA 1IBRA 2ZYWX 1KMHB 3F5FA 5FPSA 1P60A 2ZUCA 3QG1A 5FTKA 3U6KA 2DCUA 1OKKA 4OI4A 2JLRA 3EIHA 1KI8A 3IIJA 1K8RA 3LDAA 4PO1A 3VR1A 2OCYC 4B3FX 5K8TA 1OSNA 3C4JA 4IVRA 4YDHB 2QSZA 1WBDA 4CF7A 1IN6A 4PHHA 3U7HB 1ZM9A 5H68A 4P33A 1HUQA 3JZAA 5EJEA 1F2UB 2XNDD 3SI7A 2AWOA 2JLQA 3GLIE 1HE8B 4JJZA 3U4QB 1N6PA 4B34A 1OIXA 1G6OA 4MGYR 5DGXA 2O8CA 3GCGA 4YC7A 1PVOA 3WMFA 5KOYA 3MJRA 4UNSA 4V0OA 1EXMA 1OLOA 2G77B 3W6OA 2AL7A 3IEUA 5KNBA 3R20A 2ZI3A 3D31A 1FMLA 4ZDJA 3GLGE 4B76A 4S2EA 2GAOA 4O2RA 4GT1A 4PHFA 1LVGA 3W3ZB 4NCIA 4PPQA 1JR3E 3RSLA 4B3CA 3P4XA 4LRWA 3VHXA 5AUNB 1CP2A 1SXJA 2ZE5A 1Z2CA 2MSDB 3ZZTA 4NCHA 2G83A 3CH5A 2F7SA 3AP1A 4FMCB 4JYCA 4OI0A 1G7TA 1KI2A 3U61B 3ZJYA 2XTMA 4P4SB 2BCJQ 3SNHA 1WDTA 1PUIA 1ZCAA 2OCPA 5FUYA 4IXMA 1KO8A 1OPXA 1W36C 3UWKA 3QKSA 5JJKA 2Z83A 3THYA 1Z6GA 2V54A 3Q8XB 3GLFB 4OK6A 2A3RA 4RD3A 2DR3A 2ATXA 1NIPA 3ADCA 4C0AC 2D2FA 1SZPA 1Z5ZA 2J59A 2IYSA 4LYHA 2Q3MA 2OSBA 3T06B 2JLUA 1KNXA 1NVXQ 4AKEA 1GL9B 4UJ5A 2OFXA 1W44A 4QGGA 1GILA 3VR3A 2BM0A 1TEXA 2IW3A 1CF4A 4BWYA 4JLVA 1KNQA 3QE0A 4PPFA 5FPKA 3GEHA 1KHTA 2BBTA 1JQJC 4RD6A 3FE2A 1A82A 4IOMA 4EUNA 1JECA 4Z8YA 1KO4A 4AD8A 5F98A 4PSAA 1HEIA 3FKSD 2HV8A 4R71A 4JVSB 3ICQB 1KK0A 3EZ2A 2ZIAA 1R7RA 5B64A 3LW7A 3PFIA 4IHQA 1NBMD 2GA8A 1Z6XA 5HZHA 1YHNA 2D06A 2QA5A 2NMVA 4KYIB 1CJKC 4EPTA 5ELXA 4DC9A 1RVDA 521PA 1NLFA 3IPXA 3U44B 3SQWA 1RRGA 3VKGA 2J7KA 2QE7D 1E2LA 1VHLA 2HT6A 1AS0A 2IF2A 5J4VA 4IDNA 1E0JA 1S8FA 4CW7A 5K8UA 4DSUA 3O8BA 1U81A 2IYZA 2ZJZA 2QUZA 1Q57A 2ECKA 3NXSA 4AKHA 2F43A 5EZ6B 1WMSA 2ZRBA 4WAUA 5JECA 1E0KA 1XX6A 3QEOA 3ADKA 3VX4A 3X1WA 4PO8A 5JLJA 2WSSD 3WBJA 4N0DA 2G88A 3CR7A 3JVUA 2ZYUX 2Z6VA 4G01B 3CRVA 1KSGA 3IO5A 5BYJA 1XDBA 1ZVQA 2FF7A 5JSZB 4IVQA 1I4DD 4HB0A 2IXFA 1W46A 1CEEA 4C7OB 1QHHB 4AYWA 4FI3C 1G1MA 1J2JA 2GXSA 3AKEA 3QQ5A 4QBGB 4M4SA 2B7CA 4M0LA 1JALA 2QTHA 3AEZA 2JASA 4MRSA 3IEVA 3QI2A 1HV8A 1WP9A 1UADA 4C0JA 4G0NA 3GLHB 4PANA 4RKEA 2GF9A 1U0HC 1DADA 2O8DA 3EASA 4M1OA 5G40A 3WP0A 1UKEA 5L3QA 2WPDD 4LI0A 2NO1A 3ZGXA 2G1KA 1UPTA 2WM9B 1KI6B 1E79A 5AJYA 4BLPA 3REFA 2GZAA 5CLLA 1N25A 2NGRA 4I4LA 1Z0JA 2OXRA 2XNDA 1NY5A 121PA 2QQEA 2GEDA 4A8JA 1R2QA 2YV5A 3HU1A 3U5ZB 2VHUA 1RJ9B 4RD4A 4BUJA 3NG1A 4TMZA 2R8RA 3B1XA 3K70D 3ETLA 4TL8A 2V8OA 3VR4A 1E2IA 3AF3A 4BGDA 4XWOA 4LBYA 4QGAA 4TSFD 2QAGC 2W6JD 3L82B 4Q4AA 1JQLB 2CL6X 1FUUA 1TF2A 4LJAA 1XMJA 4A2PA 5HKKD 4DCNA 4PQFA 2BDTA 3B1YA 1NLYA 1IXZA 2XX3A 1LB1B 1XEWX 4HAZA 5FTJA 2JCSA 3X1YA 4AKGA 1SKYE 1U8ZA 4QL3A 1NF3A 3MWYW 1II8B 3QF4A 2IXEA 2OT3B 2RGEA 4LBZA 4QGFA 4GOXA 1XEWY 2QP4A 2J1LA 4PXAA 3PUZA 3IILA 4X8LA 3MRSA 3K0FB 4DLRA 2CMKA 3IHLA 2D7DA 2ZRLA 4U00A 2H7VA 3H2YA 3JVVA 3FFBA 4ILEA 2ERXA 2ZU0C 3I3SR 4DLSA 4EJSA 1LTQA 1G20E 1OE0A 5LB4A 2D2EA 2H16A 2HLDA 3GEEA 1UFQA 3A1VA 3I73A 2NPIA 3LD9A 4KLNA 5E4FA 3K0AB 4NYJQ 5CB6A 5JHGB 2Z0MA 3PV0A 4PC2A 1W0JA 2V7QA 3CPEA 2YYZA 3KXKA 4PC6A 1JPJA 1WF3A 1Z63A 3A6PC 3EIQA 3X2SA 4HZUB 4Z51A 5J4LA 5EE5B 3I5YA 5BQ5A 4NPHA 3LAWA 3TQFA 5CM8B 5H70A 1E9DA 4LYAA 4NL4H 1JJ7A 4TL7A 3Q72A 2J0UA 2OESA 3ZVRA 4B6EA 2OBLA 4D4LA 1FW6A 2EWVA 3KZ1E 4F7WA 5LD2C 1EX6A 1R10A 2ZR7A 1TQ6A 2NO7A 1WE2A 3TBKA 3T15A 2AN9A 4N1AA 4MYUA 4NCNA 3NBFA 5SZKB 4KHZA 3O47A 2VHTA 3BD9A 5DI3A 2NZ8A 3HR7A 5L3SB 1AS3A 2VP2A 1ZUIA 2DWOA 2F3RA 2NO9A 4L9SA 2FNAA 2QP9X 3L8YA 5EXXA 4FCVA 3DVLA 4URUR 1DAMA 3EPHA 2R2AA 3CWQA 3AGQA 5E95A 4IDHA 1OB2A 2ODBA 4I99A 3X1ZA 1NG9A 1YRBA 2F3TA 2ORIA 3KB2A 4M8NE 4F4IA 1P2UA 3EPKA 4QBHA 3KJHA 1F3OA 3OZXA 4H1UA 1RZ3A 5AJVB 5GJWC 4D0LB 4CEJB 3KKPA 4LHZA 1HYQA 4KFRA 4DEXA 2IS6A 3FMIA 1CR4A 3TIFA 2J7PD 1G8YA 5L3RA 2RGGA 4LJ4A 1J90A 4HAWA 3UWOA 1GKUB 2IEYA 5HCNA 1KK1A 4PO9A 1XPUA 2J45A 3FPAA 1CRPA 4XTRA 1AKYA 1J70A 2V9PA 5FOSA 1I2DA 4Y0AA 2WPDA 2YZ2A 3K0CA 3U2QA 3U3JA 3SJZA 4AURA 2ZE8A 3AUXA 1WB9A 1G16A 1JXMA 1KI3A 4G5SA 1MO5A 2EFEB 4MA4A 4KVGA 3P4YA 3UPUA 2QM7A 4Q66C 3CH4B 4MITA 1Z8FA 3IUYA 1X86B 2BKUA 5KSZA 2WICA 4BEJA 2R62A 2C77A 1ZNXA 5JWRA 1VG0B 3TW4A 1XU4A 4ZDIA 1Z0AA 2P5SA 4PX9A 3RDPA 4IKEA 3U7FB 1DELA 1KYIA 2CK3D 3Q9LA 4JLNA 1DAEA 2O8FA 2D7CA 4LPKA 1EESA 3DM5A 2YC4C 5CIQA 1COWD 4JVLA 1YR7A 3A1WA 3VX3A 4XWKA 2BIFA 4TSFA 3LBNA 2W6JA 3MLEA 1NJFA 2FFHA 4W7SA 3MJHA 4JSTA 2VSFA 2WKPA 1NNEA 1SULA 4JVNA 2RAPA 5C46F 3U7EB 3E1SA 5EZ5A 4GMDA 1OYYA 1E1RA 3X1DA 3DEFA 3IIMA 2ZRHA 1F2TA 2IYRA 4RVCA 3TSOA 3GLIA 1Q1ZA 3I1FA 1ODFA 3G5UA 1S9HA 3GQBA 4US0R 3ZZUA 3CPHA 2ODEA 1ZM4A 4P3YA 2BMDA 1LF5A 1W36D 3CZPA 4MKHA 5IK2D 4IOLA 3IQWA 2E9SA 4WA7A 4HAVA 5JRJA 4ABYA 3NBXX 1N0UA 2WJGA 3GLGA 1IN8A 4HI0E 1CJUC 2WJIA 2GNOA 2A9KA 1P3JA 3K9LA 2FU5C 1E98A 1GDDA 1JR3A 2OE2A 1HE1C 4TLBA 5CYOA 2XB2A 4ZV4A 4LK2A 4LPSA 1T3SA 3VNUA 1L8QA 1GKIA 3A1TA 4MUBA 2A7QA 4DSTA 3OEHA 1U98A 1S1CA 1KJWA 2QBYB 1UF9A 4DWJA 1S96A 4FMCF 1XXHE 2FZ4A 3W5IA 3DMNA 1P62B 1KKMA 4KAXA 1IM2A 2PJRA 5G53C 2ZRJA 1AKEA 2GEVA 4TLAA 4KFSA 1CULC 4JLJA 1X6VA 3UANA 2Q9AA 3UIEA 3TGPA 5CK5A 1TUEA 3LY5A 3AUYA 3AVPA 5KNCA 2JLWA 4MH0R 4OI2A 3EXAA 2REOA 2WJVA 1OJLA 2RHMA 1DARA 4D4JA 4EQ6A 1GUAA 2DBYA 2XNSA 3PEUA 4BLRA 2QMUA 2GJKA 4ZDWA 2ZSBA 4G5QA 2Q0HA 4YQFA 1W4RA 4E22A 1IHUA 1P2TA 4Q4JB 2WWFA 2W58A 5B57C 1U90A 2NIPA 1E1QD 2EFDB 1QHXA 1E9CA 2N42A 1D8TA 1ZBDA 4LWZA 5EE3A 3W8RA 1EWQA 4LJ6A 3ZLJA 5JI3E 5JWHA 2Q3FA 1YZTA 2X77A 3LLUA 1TMKA 5DE3A 3OFND 3P27A 4JS0A 3W6PA 3QXCA 2X2EA 3R9XA 2IXGA 3KTAA 4IDQA 2B8TA 3MMPA 3O8RA 2IEZA 2J9RA 3UXMA 3NDBB 2PMKA 2R6FA 1GG2A 3TR5A 3Q5EA 1JAIA 1T3HA 2GCOA 2J7PA 3EZFA 3MFYA 4OQXA 3SJBA 1NI3A 2HYDA 2CNWA 2RHDA 2QT1A 1DPFA 1QG2A 2KWIA 4JIMA 1N6HA 3SU8A 4YMWA 4Q4HB 1MV5A 5DIFA 1N6OA 3K70C 2H18A 1HH4A 3AGPA 3ADDA 3ZS9A 3QPVA 4FCTA 1S9DA 3CF0A 2GHIA 3I5XA 4Q1DA 1KK3A 1ZNZA 1I2MA 2NOAA 4LDJA 3ZDQA 2XOKA 4ASUA 3FVQA 3HR8A 4JZKA 2IT1A 4DLUA 5DO9A 2VO1A 1VG9B 2ZI4A 5TMPA 5DYGA 4DT1B 1U0JA 2HXYA 1AQUA 1M8PA 2OAP1 2YWGA 3HYTA 5KSOA 1QHSA 3CRQA 2ATVA 4GP6A 4C0QC 1ZMXA 4UNQA 3DKVA 4Z1MD 2P65A 1X8KA 4ZIRB 5JFGA 2WOJA 2FFQA 1NVVR 4B2LA 3LVRE 4LJYA 4JMPA 4CEIA 1CKEA 1G7SA 4AG5A 1DO2A 4EPWA 2JDID 4KYUA 3C16C 3FHCB 3QIAA 3T34A 1W5TA 3I62A 2ZVQX 2ZS7A 1TAGA 2B6HA 1NBME 2CVHA 4LOAA 4BRUA 3RNLA 2Q21A 1I4LD 2VIIA 3P26A 1RKBA 2G0TA 2W2TA 5DHFA 2FEOA 5HCIA 4IDOA 4W5WA 3CX7A 3RWOA 3KQLA 3LQQA 1IOZA 4ACAA 3V4RA 2WKRA 4GPTA 3T61A 2OFWA 4TLCA 2XGJA 5IK2A 4Q9KA 1E9SA 1NN1A 4OI1A 2CHGA 3B6EA 3OIVA 1X8JA 2Q3HA 1HY3A 2WWXA 4OHVA 2MMGA 4IJMA 2OV2A 3RS0A 2LKDA 1M7GA 5FOVA 4DB2A 3B8HA 4BEBA 3B5JA 4C3ZA 2OBMA 1U8AA 5IHPA 4XTCS 4A2QA 4ESVA 5F9FA 3FFAA 4M2LA 1RC8A 2JATA 4JLDA 1EFRD 3AVXA 2VH5R 3A1UA 5KUTA 4HLUC 1FQJA 5CJPA 2CEAA 2ZI7A 4HLDA 2GZHA 4V02A 4JVMA 3KQNA 2X8AA 3CNNA 5GJBA 3KL4A 5CYPA 2JLVA 1Z83A 4WVFA 2EYQA 3B1VA 3QKRB 2PJZA 5HR5A 4HDOB 1E2EA 1Z06A 4UXIA 4A0FA 3WNDA 2R6GA 5KHOC 3E2IA 3CX6A 4QBIA 3SBDA 3I72A 2W2XA 1CS4C 1TQDA 1US8B 1Z2AA 1YZGA 1UKVY 1EFUA 4UXJA 3PUXA 2GK7A 4Q18A 3RS5A 2ZRKA 3QXHA 3TW8B 5FUWA 3SJAA 4C0KA 5HPYB 4NHOA 1XMSA 2J5XA 5KU1A 4M53A 1SVMA 4DIDA 2FMXA 4QNMA 3QBVA 3D3QA 4M1TA 3IQXA 4PC1A 3SEAA 3L0SA 2PCLA 2MSEB 2G3YA 4B6FA 5LDDC 1E1QA 1G5RA 2OM2A 2FSIA 5DN6D 4Y0VA 4D25A 3TMKA 2ZJAA 4DLXA 3NH6A 2G6BA 2GEUA 1GFIA 2IK8A 3OFNA 3KX2A 5FBQB 5FBVB 2O8CB 1KO7A 4V03A 2ZRAA 2JLXA 2B92A 5AK0A 4TT3D 3SYKA 2YKGA 1XTRA 3P1JA 1IN4A 4RD1A 2YOFA 5L3VA 1NVWQ 3TUJC 2V1UA 5B58C 4XIGS 1OH6A 1L4YA 4RY2A 4X8MA 1ZP6A 1G8FA 1XTIA 1ZNYA 1XD2A 2BM1A 4L9WA 3TQCA 3PUVA 2WTUA 2D74A 2BKEA 3ZVLA 2ZS9A 1ANKA 1ZNWA 1TQ2A 1YZKA 1ZUHA 1OH8A 1UBGA 2BBWA 2WAYA 1TTTA 4TYWA 4L8GA 3T1QA 1SXJB 4ERNA 4M22A 2A5GA 1XNJA 4B3BA 3R8FA 3VKHA 1II9A 1KI7A 1G5PA 2C03A 4P32A 2XZLA 2OXCA 4D80A 5EP1A 4NYMR 4CIDA 3ZD6A 1GL7A 1Z29A 4OJKA 2NPFA 5GVSA 1N2CE 2FPMA 1NIJA 2LCFA 2Z5FA 3H0KA 3QKSB 4QM6A 3SR0A 4HB2A 4MGIR 3W8NA 4B35A 3THYB 2XAUA 4C0SA 4W5HA 1O87A 5JCPA 1Z3IX 1JBKA 4Q1AA 1T8TA 1MRNA 4YMTA 2R9VA 3K9HA 2VYFA 3FWYA 3AVTA 2Z43A 4CGZA 1LNZA 2C04A 1T5LA 2MSCB 1Z0KA 4Q48A 3FTQA 3F0TA 2W2VA 1A2BA 1PZNA 2BOVA 2QSYA 4TN1A 1E32A 5BN3A 2QAGA 2CCGA 3P32A 4D26A 2NO0A 4U02A 4ARZA 1KZ7B 4H9GA 3BH6A 3LWNA 2QPOA 1WA5A 4BFUA 2CJWA 4DHEA 3Q5DA 1RYFA 4G5GA 2WIBA 3BFKA 4PPGA 4RZ2A 5FL7D 2Z4RA 1B23P 3NTUA 3EIEA 5J47A 3PEWA 3C41J 4TMTA 1BH2A 1XZPA 4Q1FA 4YMSA 2FEMA 4Q9IA 2P5TB 3DOEA 4XJXA 4Q4LA 1ZW6A 1AGPA 4PSKA 3AH8A 4Q19A 1T0HB 4BASA 2G1JA 2ZREA 4M1YA 4ZCIA 5KO2A 4C30A 5FUVA 3ZVMA 821PA 1SVOA 5AJZA 3W5JA 5EXSA 3AVOA 4DDVA 1G64A 1XBTA 3WHKA 3RRYA 2O52A 1G5TA 2J41A 3L0IB 3L43A 2GAAA 1W5SA 1DAFA 1DAIA 2GBLC 2CXXA 2JJ2A 2WWWA 1ZU5A 1D9ZA 2ZSAA 4MGKR 5LBIA 2F43B 1C9KA 1OHHA 1Y63A 5KPJA 3IBGA 5J40A 3ICEA 1E6CA 1FQKA 3OE7A 4YLGA 4N0EA 3OESA 1BOFA 1H8EA 3CNLA 3LX5A 3EX7C 4IDPA 2Y8EA 3VHLB 4A2WA 4BFXA 3LV8A 4AYXA 2GETA 4LSGA 2AXNA 3MWJA 5KDDA 3EZ9A 1J8YF 5AUOB 1G6HA 1U9IC 1RRPA 5EP3A 4DDWA 4O3MA 1EGAA 4G5OA 1DE0A 2IYUA 3A36A 3OEED 1GVNB 2QENA 4LV5B 4TMXA 1KY2A 1RRCA 4HZIA 4LHVA 4Q21A 1KIMA 2P2LA 2QGNA 2VF7A 2O8EB 3AF2A 2XXAA 2F1HA 3GJ0A 4FINA 1E3MA 2O8DB 5KDOA 2ZAOA 2ZE7A 2QORA 4P31A 2QG6A 5L3QB 1IY2A 3QY0A 4AC9A 1OH5A 3RRNA 5DH9A 3H84A 3BC1A 4HLQB 3LVQE 5FR2A 2LWIA 2WWYA 2PBRA 3TH5A 5F9HA 5DN6A 1VCOA 2PLRA 4NDZA 3I32A 1XXHA 1Q1BA 4A0HA 3CUEF 3RYTC 2KBFA 4NTZA 3W6NA 1G19A 3T1OA 3LO5A 4JLOA 4A8JB 1AJEA 3OIUA 3BB4A 1OT3A 5DHAA 3EC1A 1E9FA 3GJ8A 3U44A 1ESMA 1W47A 4UQOA 4XH9B 4TT3A 2XEXA 5A0FA 2C96A 1CXZA 1N6NA 5HE8A 2AKYA 3EC2A 2HCBA 2J3EA 2GK6A 3G0HA 5A5GA 3DKPA 5HE9A 1TU4A 2RCNA 4YMVA 3PR1A 3NIBA 4DIEA 4HB3A 1E99A 1Q20A 1R6BX 1QG4A 1P6XA 4Q4AB 1DAGA 1F60A 4PR0A 3EWAA 3T5DA 2N46A 2Z4SA 2AR7A 4J0QA 4B33A 2BWJA 2R44A 4LHYA 4L15A 2F55A 2R6AA 4DLVA 4IOJA 4TZ6A 2BEJA 4Z8XA 2QPAA 2IUTA 3DOFA 4M9SA 2ONJA 1CBUA 1HQYE 1HURA 4YDSA 4DLWA 1F5NA 3QF4B 1NG1A 4O2LA 3C5CA 3R7WA 3TE6A 3UG6A 2RB4A 5F2EA 2VHJA 4D4MA 3PCRB 1NVVQ 1IONA 4TLEA 5DNYB 1E9AA 1U0LA 4P4TA 4G1UC 3AVVA 3S1AA 1AZTA 2NO6A 2QL6A 4B73A 1L7VC 2PLFA 1CU1A 2PZGA 5FOXA 1MH1A 3DHWC 1T9HA 1ZM7A 1G17A 2PX3A 3Q7QA 2ZM5A 4EJSB 4C0HA 1P9NA 1I4TD 4DZZA 5FR1A 2DFKB 3DL0A 4ZKEA 4R98A 3U3OA 2FG5A 2X2FA 1MABA 1LS6A 1UDWA 3CWZA 3KKOA 4KFTA 3QF7A 3AKDA 2UVQA 2GCNA 3WNCA 3CIOA 3VKWA 1QZXA 4ZKDA 5FL7A 1CR2A 4ZCLA 1KI9A 1BIFA 2GRJA 3QOFA 3WMGA 4W9MC 3TK1A 5B30A 3GD7A 4A4DA 3IGFA 1KMQA 4EPXA 3BE4A 2YOGA 5FOUA 5CDFE 4LC0A 1DAHA 4ZDKA 1NL3A 3KJEA 3EPLA 1XTJA 3KFXA 3GJ5A 4NCKA 3RABA 4A9AA 1KAOA 1YQTA 3KDSE 1MRSA 3BB1A 3AVUA 2O8BA 4L4UA 4KVAA 3DM9B 4V0NA 1W0KD 3FGNA 2WIAA 2J0UB 1JJVA 4JKYA 2ZVPX 3TNFA 4US2R 4OQMA 2FJUA 3SDZA 1GM5A 4F91B 1UEIA 3FKSA 2C9CA 1T4GA 4RFSA 2BBSA 3W90A 1EFTA 4CEHA 1OXVA 3SHWA 1NN3A 1DTSA 4N3NA 2Q9CA 4UNRA 3MUFA 2CDNA 1II8A 1NBMA 2GZDA 5DI3B 3ASYA 4Q00A 4B32A 3C5HA 2ZRFA 3GP8A 4MQBA 2FSGA 4KFUA 5IRCD 3QSYA 5FBLB 1JR6A 2J87A 3FYHA 3I8XA 1H8HD 1UBCA 3UK6A 1ZINA 2QE7A 2DHRA 4WIAA 4BQSA 3TUZC 1E4YA 2JIZD 4ZI3A 1OW3B 2QP3A 1DEKA 5JJIA 2A2ZA 1VECA 4DLZA 4A15A 421PA 1ZAKA 2ODWA 4JLKA 5EUMA 4EFLA 5TY0A 5KSYA 2OG2A 4K81B 1IJFA 1G4AE 4YMUA 2B8WA 3AP3A 4URYR 3CPJB 2WSSA 4LGMA 2OO7A 2CL7X 2VBCA 2FPLA 4XOIA 5FPTA 4BE7B 2REBA 2K5UA 2JLZA 2FE4A 4DB4A 1FTNA 4QHYA 2ZQ5A 3B9QA 1JEDA 4NBSA 4BFWA 1E0SA 1NKTA 3VAAA 4GL2A 1N5KA 2CHVA 1YZUA 2XSZD 4B44A 4DUGD 5CM9C 3QXJA 2SHKA 4D82A 3EARA 2OEPA 2UZIR 3P20A 1Z47A 1XEFA 3RC3A 1AQYA 1BKDR 3IHWA 1G18A 4LHWA 4PTLA 1QHGA 4KXFB 1KO1A 4MKIA 3A37A 1J99A 2BMEA 3NDPA 3PEVA 4W5JA 4MRVA 4NONA 1PV4A 2WOOA 4B2IA 3U6BA 3FKQA 3WRYC 1Z0IA 4NP6A 3BK7A 4WZBE 1R0ZA 1RE0A 2O8FB 1G41A 2PEYA 3CW2A 4DCSA 1ZYUA 5EUQB 3NBYC 1KK2A 5TV2A 3KUCA 3X1XA 4R9UC 2QU8A 4K46A 4RD0A 3M0EA 3HYRA 2QT0A 1GRNA 1KDTA 5AJXA 4A8JC 2JAQA 4FN5A 3LX8A 3QENA 1JI0A 5ANRB 4MYTA 3W34A 1GRRA 2ZITA 1D2NA 1M34E 1LV7A 1F2TB 1D5CA 3QJYA 3GLIB 3BIFA 4LY6A 4LJ8A 5D3MA 4D4KA 1E9RA 3LXRA 2HF8A 2QMOA 1DVRA 4Q9LA 3ZD7A 4HUQA 1Z07A 4F4CA 3LBIA 4TQ9A 1W2HA
chains in the Genus database with same CATH superfamily
1V2GA 1ZK3A 3PQ4A 2H5LA 2GHTA 1YU6A 4JC4A 1PU2A 3SKXA 3EZGA 4FMBB 1WKCA 3U0BA 3UO8B 5BYKA 3NHBA 2AJ8A 3JWJA 2POQX 2GHRA 1J23A 3C2WA 1NJ6A 4H7KA 1PR2A 2LUOA 1U1GA 2BFWA 1RXSA 3HLFA 3BMQB 3JYOA 1GZ4A 2NAFA 4HNHA 5H8WA 2G7UA 4KZ6A 1ZGBA 2JFWA 3THXA 4MVWA 1PDVA 5DP2A 4C5BA 1KO5A 1GAWA 5AKYA 3INGA 2XRYA 1BMFD 4GNUA 2CB0A 4HDQB 1YZNA 5ITSA 5BW6B 3VMFA 3E9YA 1ZK0A 3ISJA 3N9IA 3KVNA 4OM7A 2C2HA 5AOVA 4Q7KA 2HCJB 3AEUA 4H59A 4P6BA 1T5IA 3A4MA 2Y1FA 1YC2A 4AP6A 2AHOA 5JAMA 1RWOA 3JQ9C 1JSZA 5E6SA 3WGHA 5EKDA 3E81A 5BQ3A 3E9EA 3VR2A 3DMFA 1XGIA 1Y1PA 2R65A 1SUWA 2ISCA 3TB4A 2H4YA 2B6NA 1FTQA 3LOQA 3DE1X 4OLJA 4EKYA 3JATB 1P2SA 4PEVA 2IPMA 3KFVA 4YPFA 2WNSA 1C7IA 4OEHA 4KUOA 4NX2A 2P8JA 3UENA 4X90A 4HSEA 3R0VA 5A3QA 4R7ZA 1R1DA 2AIRA 3PC4A 3HXOA 1W63M 1YBMA 5DIZA 4C5AA 4MI1A 2OORC 5G0VA 2AGVA 3ANLA 3V1UA 1XCPA 4BMVA 3JQQA 1CEQA 2YXBA 4Q03A 1PLKA 1OTEA 3TSWA 3GVPA 1CR1A 4YJFB 5BNIA 2PZJA 1VLZA 2DFVA 3EXFB 1L4FA 1W96A 3GMWA 5JYPA 4P80A 2FPOA 4PZUA 3LFHA 3MIIA 4F86A 3PHCA 4D9HA 2JGDB 1WXWA 2XUOA 3DNFA 5EESA 4FD2A 4JLPA 3DE4X 3AM3A 4HEA6 4J7AA 2YCBA 4DZTA 1MJNA 3LR5A 2EIHA 4DQ0A 1IDOA 4FWBA 1EJ2A 3AO0B 2BRUC 2GM5A 4Q3BA 4ID3A 3EDQA 3ZWCA 1NNUA 1YHYA 4CFZA 3FROA 3MKFA 3RVBA 4RVDA 3ZQJA 4WEQA 2FMKA 3EG9B 1BROA 1GLVA 3OZVA 2BV3A 4O1HA 3IXQA 3SZOA 4IILA 5LQDA 3AJ9A 4J0KA 4FYKA 3KQMA 2HDNB 4P81A 4U9UA 3MGBA 2ZJ0A 2Z9DA 1FP4A 5KI6A 5FOQA 3W5AA 3LEQA 3HEBA 2VPYA 3RAEC 1C4KA 4IEIA 1UBEA 2FP4A 1ZI8A 3NB0A 5FI5A 5F5LA 1KEUA 4AFIA 5TDHA 1XZJA 3DA8A 4OFBA 2Y0CA 3IR5A 4OYYA 4OQFA 1YMQA 2GCGA 3DDOA 3Q12A 3PXCX 1T5OA 2P2DA 5IVDA 1FIUA 2PYIA 2PYDA 2W1RA 3SLGA 4KQ1A 1P1JA 3OOHA 2D0DA 2WF5A 3KZOA 3I1JA 3B2EA 2XJ4A 2EX8A 4TL9A 5A7FA 2IYYA 1L5VA 3NECA 3GAZA 1PWEA 4PONA 5FBRB 1OXTA 4O01A 1KI1A 5K45A 2GJ8A 3MBKA 2L2QA 1IQ0A 4F96A 2N75A 3QP5A 2J6CA 5EM1A 2WMNB 1F3LA 1IQPA 3F46A 5JYBA 2AEJA 3AG6A 1T9DA 3RUAA 4BP8A 4MI6A 4H18A 1T91A 3LFTA 3D6UA 3S7PA 3FSGD 2M7UA 8GPBA 4YP5A 2QU7A 3R3ZA 3K9FC 2IE0A 1XYYA 1ZHHA 4JQSA 3WRYA 4IEDA 4FFLA 4CG3A 1KE1A 4Z49A 1H1LB 1IQRA 1U31A 1P72A 4EFDA 3M70A 1P2GA 2IA5A 4ERXA 5EMMA 2B82A 4K0WA 4XVCA 4MMYB 4V0RA 5BR8B 1N1MA 3QEKA 2MDTA 1BS9A 5DT2A 2F9LA 2BYTA 1RJ9A 2N1BA 3SD7A 2QD4A 4UNPA 2XUGA 3DEYX 2XKJE 2H9AA 5TVGA 3O4RA 4WN9B 1A77A 3WHIA 2ZYDA 4TYNA 2PKQP 1D4OA 4BLUA 1RAEA 2HQBA 3MKEA 1X8LA 4EKIA 2WAAA 4JYAB 4YJ3B 1FRQA 1RP7A 4D46A 1MIOA 3WADA 4XD7D 3GGGA 4UMFA 2YWEA 2W7TA 5TVKA 2JIRA 3UXHA 3QWIA 1Q7RA 3GPLA 1G7RA 3T5GA 4R5HA 1NPYA 3AP2A 3AYXB 4JT2A 4JI4B 5EM0A 5IP5A 5BSMA 1EA7A 3BRQA 1F6DA 1SKOB 3W2EA 4U3JA 1SBQA 2HUPA 3FYUB 5KMGB 3H0EA 2YHUA 3FSGA 3T1VA 1K7YA 3FG9A 4K6MA 3WC4A 4HUQB 4NBKA 2ZRCA 3KXDA 3RUHA 2SECE 4JC5A 5AUPB 1M1ZA 1FP2A 3E70C 2GEJA 3JALA 1NTRA 1MRZA 3VKUA 1QO9A 2E1PA 3EB9A 2XITA 3IIIA 3T41A 5ES4B 2XOKD 3HUMA 3UB4A 4PAOA 4CLCB 3BXOA 4KE6A 4IVPA 2H28A 3PNPA 4ALMA 1Z4MA 3NCHA 4H17A 3I9V1 3AOEA 4DWVA 4LF8B 1NQUA 3U3DA 3PPXA 4JLWA 5A2GA 4B3RB 1NY6A 1OB5A 2XCLA 3HCCA 3M2TA 1JHAA 4PLVA 2QTWB 4M3NA 3ENZA 1ZUD1 1XRSB 1FMJA 3RGWS 3LUQA 5ILQA 3IAXA 4RULA 5FOWA 4ZXFA 4XUDA 3P2YA 1X1DA 1V43A 3G0OA 4K9DA 1U1IA 1SBYA 3WK4A 3PQ5A 5GM1A 4XD7A 3LBYA 4LV6A 4BFSA 1F14A 2UYGA 1PT9A 3D64A 4UMEA 5L6MB 3BDVA 3N59A 4IEEA 1U2GC 1XO1A 4JEMA 2H2DA 3BGOS 2ZE6A 2O19A 3B5EA 3KTFA 4JLMA 4Z7QB 3H2JA 2LP4Y 3VHQA 1NRIA 2FG7C 2VJLA 1OLUA 1NYYA 3L8GA 2NQ2C 4TWRA 2QRNA 5DXFA 3JYPA 1Y98A 3PJDA 3AHCA 4F92B 2A49A 2PZKA 4F06A 4BEWA 2QTMA 4Y30A 1NVFA 1AH2A 4QYIA 1YZHA 4ZTUB 5MHTA 2Z30A 1WDWB 1UKZA 5KDLA 3E22A 1A2QA 1YLYA 3GLVA 3Q3JB 1Z5PA 4DN0A 5EZYA 3H9UA 3V8QA 3H2GA 2XD5A 1B3BA 1MX1A 1ZD9A 2ZUUA 2PRFA 1G291 4Q3OA 3TLEA 2XFTA 3SZTA 1A0KA 1WEKA 4PC7A 3LTEA 2IHJA 3J81k 3FFWA 1D2AA 3DLTA 3KL2A 2OZKA 4URXR 2V0NA 2WJJA 1WXGA 1IOUA 2VF8A 2RGNA 2DRWA 2ZM0A 3N58A 1OFUX 4O02B 1X1RA 4KXYA 5JH7F 1N33B 1V8FA 1JB9A 3GTCA 3G13A 4FHGA 2Y2PA 4D92A 4J0CA 1G5QA 1NMEA 4R01A 5BSFA 2XCSB 2FPRA 5ED0A 1MC8A 2QUKA 2GWHA 2I8LA 1ADFA 3PC7A 5EQTA 4AMYA 1POWA 3SJCA 4CYMA 2I3ZA 3MYRA 4PG8A 1MT0A 3JU3A 1R0YA 2H9IA 2ACGA 3QYFA 1XCJA 4ZT3A 1GN9A 3RRXA 1US8A 3K5PA 5JCZA 1IXYA 1KMHB 1Q0ZA 4P35A 1T6BY 2JLRA 4YJ2B 3SAJA 1P4JA 4E3WA 3E2LA 4BQRA 2PGJA 3QFFA 1OASA 4JU9A 3LJKA 4K2HA 2EXBA 4JNKA 4MR8A 2DFPA 1OLOA 2AL7A 2V74B 1VI6A 4D98A 5AJUA 4O2RA 3TZCA 1Z2CA 2MSDB 1KEZA 2G83A 4CV3A 4JYCA 2CVZA 3RC7A 3Q7SA 1I4OA 1NC1A 5EHQA 5HUQA 4KGDA 4YRSA 5CTJA 3THYA 1WD7A 3G6WA 1DEHA 3EDCA 2BI4A 2Q3MA 4KFCA 4AKEA 1F12A 4N40A 3V2HA 1Y7LA 4KZ7A 3N7TA 4BTVA 1KHTA 2R87A 2WU1A 4EG0A 1S8NA 1Z88A 4CMCA 1VEUB 2O5RA 4E94A 3EZ2A 1R7RA 1NVTA 4J4TA 3ODGA 4GWLA 3O7WA 3FKWA 3U44B 1RRGA 1WTCA 1E2LA 2CJFA 4QTTB 4KWCA 1DRJA 2F43A 1HDYA 5A9RA 3HN2A 4IQ4A 3X1WA 3G0CA 1JIVA 3FVTA 5A9TA 4GM4A 1MT3A 1SIWA 5CAEB 3MTEA 5F3RA 5J23A 1FX1A 5TEVA 5FLKA 1YLPA 1MBLA 1UKEA 2EWMA 2WPDD 2VP3A 4HYEA 2JN7A 4I4LA 1R15A 2ETXA 2H0RA 3C7CB 1T6YA 4KKVA 1D4FA 4L1KA 2WQ6A 1LTHR 1P5HA 4YRAA 4W99A 3D6VA 1BXGB 4QQFA 1UBLS 4EA7A 3K6SB 1O89A 1XMJA 4D0RA 2MSNA 4Q1VA 1EP9A 2Q1SA 4YCCA 3H8WA 1JKIA 1PF7E 3ESXA 4QGFA 1TKAA 2AQHA 4X8LA 2EQAA 4ZVSA 3QW4B 2JFHA 1UFKA 5FLXA 1KQ3A 4MI3A 3GRJA 2RJNA 2J5BA 2H16A 2HLDA 2AV6A 4L51A 3UE3A 1QIIA 1MB3A 4HI4A 2QWSA 4ZAYA 5CBPB 4FHCA 3ENWA 1WF3A 2HNKA 3Q4GA 3IBTA 3TG2A 2CBGA 2RJ3A 3LAWA 4DYDA 1T18A 5CM8B 4ER7A 1E9DA 4MVJG 2V3VA 1MCZA 2OBLA 2Y8HA 3V55A 3EDMA 4BVKA 2O0MA 1W4LA 4R6XA 1L4LA 3TXYA 1NG9A 1RSZA 3WL7A 2VLBA 1JQDA 1E89A 2KPOA 4Q9DA 2PTHA 5HJEA 4NARA 2WPDA 2DBZA 1J1IA 1CUUA 4YAEA 1EI9A 5B36A 1G16A 1KI3A 2QM7A 2JFQA 4ARCA 3ZJ5A 5ALMA 2WICA 1VG0B 2J3WA 4NENB 4GKKB 3R6GA 1A27A 3L84A 4R2WA 2Q2NA 2D7CA 1EFDN 3V8MA 1QFXA 1RP1A 4ZVMA 5K4HA 1O95A 3WJAA 3ONNA 1NLUA 3DFFA 4P3YA 4N7JA 4YS6A 1Q91A 4L2IA 2I33A 2O2SA 5LJLA 4JSRA 2NTJA 3K6JA 4TLBA 2IVFA 3FRHA 3P9YA 3IS3A 1T3SA 3BD6A 4FLMA 4XGIA 2BFBA 5EQJB 2H1FA 4BKQA 1JTGA 4XD2A 1L4NA 2FI1A 4ZCQA 4D4JA 1IVSA 4KQWA 3S70A 4X44A 1HORA 1BCRB 4LENA 2PN1A 1UWCA 3DVAB 3IOYA 2Q3EA 3W2FA 3ZWBA 1Z15A 4RS3A 1WSDA 3ENQA 4LWZA 4JXKA 4LJ6A 2QL7A 2AG1A 1JEQB 1TMKA 2C2OA 4JGBA 3SHVA 3IHBA 2IXGA 2AB0A 2R5WA 1WUTA 4HN4B 2R4QA 3ADDA 1TVEA 1VGQA 4BJ3A 1T5SA 3QPVA 1E4OA 3X44A 2P30A 4M6WA 3FVQA 4JZKA 3L79A 4Y15A 2QZ6A 2G28A 1U0GA 3RKRA 1MHTA 5ICFA 1D0VA 4RFLA 4GRIA 1UZLA 5E4YA 1VRCA 1DO8A 1SURA 5BW5A 5KCZA 1NBME 1I33A 2W2TA 1ZRMA 2JC3A 3EIOA 4W5WA 2PSDA 2XB6A 5KTKA 1RBMA 1TK2A 1X38A 3ITEA 3G2MA 5EJIA 4CM8A 4Q0IA 2CMNA 4AF7A 3G49A 5DTRA 3TPCA 1XL1A 3A3PA 4UPVA 3K2BA 4HLUC 1Q3KA 4JI0B 3RS9A 2X8AA 4BO5A 1AD2A 3B1VA 3QKRB 1KEVA 3E8XA 4BLVA 1P31A 4F45A 3PQ8A 2GPJA 5CNJA 1L7AA 4QOGA 3K1AA 4BTLA 1PQWA 4DM7A 4JB3A 2GRAA 4QNMA 3TNJA 3D3QA 3GLUA 2J0EA 5DF8A 4RIGA 4KGXA 3G59A 3NH6A 5DLEA 4UTZA 3PC8A 5IKMA 1KVUA 5LJIA 3I5UA 3LPLA 4TT3D 4EY4A 3VYVA 3R40A 5F5NA 2D00A 3RAGA 1OH6A 5K3OA 3SCZA 4L9WA 2ZS9A 2BBWA 2WAYA 1FY2A 4XQCA 3ZY6A 4C4OA 3URMA 1GHTA 3R8FA 2H5JA 4EGCB 2FW9A 5C9ZA 4NXNB 1TD1A 4ID9A 1C14A 2V0CA 3AVTA 1KRHA 1XQVA 2HO4A 1N92A 4HS4A 1E32A 3STTA 2R66A 3FCUB 1PWXA 4YRPA 5J47A 3PWZA 3TOIA 5EMHA 4YMSA 4QICA 3AH8A 4F85A 3LY3A 1SCUA 2CLLB 4YWJA 4YRIA 4AJ1A 3VC1A 5H9VA 2Q4TA 1TKRA 3A4IA 1DAFA 2G6TA 4IG9A 2P1DA 3IQFA 3OE4A 1W19A 2OD9A 3V8NA 4XEHA 4L6AA 3VP1A 7AT1A 1YUBA 4O5AA 3T7EA 1O2DA 2FSVA 5KZMB 3IT0A 3MC1A 3LP5A 2PUGA 3TR6A 1KIMA 2PNFA 5GPBA 4MW9A 3QBEA 4HLQB 1GNLA 1NDHA 1OYVA 4OV6B 2VJNA 3H3XA 1WF6A 4C4SA 4TT3A 5DMHA 4U2FA 2I4NA 3NIBA 5LDHA 3EWAA 1DKQA 4LHYA 2F55A 2R6AA 1ORWA 3PL1A 1AK1A 4QTZA 1MVLA 2IZ6A 1NG1A 2YWBA 5A5EA 2NXNA 2Z8YM 4D4MA 5E3JA 1IONA 5G4YA 2J3TC 1ZM7A 4YK7A 3KHKA 3W0LB 1XNQB 1WDLA 3K7EA 1UDWA 1V25A 4KFTA 4GMFA 4R1NA 2E4VA 5EIHA 4L0MA 5C8DA 4HV4A 3H04A 4A4DA 3ZU5A 4EPXA 4MTCA 4KVAA 4OLHA 1KIAA 3NOTC 3IF6C 4US2R 1S8AA 1T4GA 3HCFA 4AZ0B 5HXAA 3MT7A 4IJVA 1WXIA 3IVMA 4EI7A 1UBCA 4AN1A 4ZI3A 2XCRB 1DEKA 3HHPA 1O1YA 2V5UA 5KSYA 3CZAA 2CDRA 2BUAA 1A9RA 3DEHA 2OQIA 1LU9A 3GLRA 3LC1O 1N5KA 2XSZD 4B44A 1ZX1A 1M66A 2EHDA 1FFEA 2WD9A 3RUFA 3WLJA 1CD5A 5EFZA 2YZNA 5KKNB 4F1WA 4PZPA 4CODB 4AF6A 3SSNA 1Z4OA 4WZBE 1F5MA 2H2HA 3M6UA 1DPGA 1U8UA 2ZUSA 3X1XA 4R9UC 5LKAA 3L6EA 4XLTA 1GRRA 3F98A 3BTUA 3RT9A 2X5KO 1QAOA 2VJPA 3LXRA 3R41A 2GD2A 1R8YA 2I76A 4PM7A 3FUWA 5KYKA 5HKKA 3GI1A 3CVJA 1YQXA 3EVFA 4WLAA 1W0CA 3JPYA 2JHFA 1V3QE 4P0TA 2VHCA 3BXZA 3ND7A 4OHMA 1KVLA 5IULC 3RFXA 1VLMA 1X1QA 2BLNA 4E3ZA 3RS4A 3UK7A 4IUYA 3N5CA 2OCLA 2DXIA 4QEZA 3EAQA 4CKBB 2QMYA 2BEUA 2LV8A 3BGWA 2L0XA 3Q6IA 1EUZA 2JKVA 1YIAA 4BVJA 3PIDA 3G2LA 1QX4A 4CTKA 2VRCA 2XRMA 4G1VA 3BORA 1GNQA 2QJ5A 1OZGA 2Y1LA 5CHEA 3UJHA 2GN2A 4QU3A 2HQ1A 2DETA 1EWRA 1FJ2A 1J07A 4M1MA 2YVQA 4POAA 1PWGA 1XZAA 3TAHA 1CP3A 4X8OA 1TYCA 4LQCA 3B13B 4IAOA 3L1KA 4FHZA 4EQ1A 3MAAC 4E14A 5H16A 1G5HA 1V1RB 3ZIAD 4Q02A 3FSJX 3PWTA 1NRFA 3LYHA 2GYVA 1E7WA 1W5DA 5CDTA 3M33A 3GEDA 2GN6A 2FZKA 2F17A 3UF0A 2WG0A 4II2A 4A92A 3HJCA 4TZ0A 5CRFA 2VDWB 1L1EA 2LGJA 4LSZA 4MYRA 2VOEA 3IR7A 1NJ5A 2IHNA 3EWKA 5LA6A 3TTTA 1OMOA 3OCJA 3QOXA 2FSFA 1R0WA 2BSXA 4IJWA 1YS2X 1I0ZA 3HCDA 1EHYA 5BRNA 4AL4A 1ZSVA 4LRQA 4GIBA 4JA0A 1TTPB 2WE7A 3OZDA 3DLCA 3TPZA 1AGRA 3WX0A 4Q01A 3OOSA 3KUKA 5ALFA 3ITAA 1GUYA 2IHBA 3LPDA 4L6CA 1MPLA 3N2EA 1U5AA 4RENA 3N0RA 2P1RA 1MR3F 3PUIA 3UBTA 4RE6A 2LVBA 4M0UA 2W11A 5JUWA 3U81A 1VBMA 1GPDG 4NR0A 5DTJA 2QTCA 3BICA 4NV3A 1WXXA 4CV2A 3OCLA 2GJ4A 2B4RO 4ZYVA 4QPDA 3QU2A 1AQJA 4QODA 3VBCA 3ME5A 3LR4A 4LHXA 5P21A 3C74A 3VYWA 3IXHA 1ZGGA 2RG7A 3W5HA 5KYWB 2G76A 2FPGA 1HDRA 4XCVA 4C3VA 1WRBA 3L6RA 1UZNA 3BDAA 4L0QA 4JLAA 2CMGA 3P2IA 3E82A 4KODA 2G25A 5IEBA 1WY7A 4TMKA 3C1AA 1W52X 3DTMA 2TRSB 1VI2A 1YDHA 4OKSA 4B7ZA 4YO8A 3Q2KA 2ZB8A 1E79D 3DDZX 1E4EB 1FYXA 1RVV1 3WR5A 1LBHA 3P2JA 3M4NA 4TTPA 1JHRA 1EGMB 2ZSFA 5I47A 4DJJA 2WVJA 3TTWA 1QGOA 2X5OA 4RVUA 4HBUA 4KIFA 2H4WA 2IGTA 1CUJA 5KREA 1YB2A 3M2JA 2XBMA 3ZQ6A 1M2WA 4E07A 4D43A 3H9EO 2F59A 5IW8A 4GBMA 1NWZA 4WZ6A 1UXJA 4KENB 2OGZA 2W93A 3DZDA 2VDQB 3K8ZA 5J4KA 2ZANA 2Z2YA 2DQ4A 4ZAGA 3ZCVA 4QAQA 3B82A 1RAIA 1ALQA 2VLIA 5EMKA 4G3WA 3MYYA 3UE6A 1WV0A 5FAXA 3K4HA 4XYGA 2WYUA 1NUHA 3DEJA 1JDPA 1ARZA 3OZGA 4FFDA 3H5AA 1EFPB 2GXAA 4O0PA 2GESA 3H4TA 1OIVA 4XGNA 9ABPA 4RVNA 1QKJA 4H4EA 3V9PA 5C1BA 3C24A 1Z8HA 4JR0A 4LMRA 2WFLA 4UUNA 4J1TC 1JVBA 1J5EB 1QIHA 4OPMA 4JLBA 5LPNA 2DLNA 4OQNA 1YRLA 2ZJOA 3DO8A 2O8EA 4HMPA 2C2GA 3KBOA 1G2PA 3ROKA 4F3NA 3AFIA 3BTVA 1K88A 4L7VA 4PQGA 4BB0A 1OCEA 2ZR9A 4OHPA 3REQB 4IBRA 1EDOA 4E33A 4CCYA 1RXIA 2BE9A 2QF7A 2PQ0A 1J9ZA 1ZKMA 4ZZ2A 1TM4E 3L8FA 1Z5VA 4JFAA 4MYSA 3DUWA 3U7GA 3AQ4A 3VHRA 1ZR4A 3TAUA 2H1OA 3CE6A 2AHRA 5B2FA 2QM0A 4F3KA 1P5ZB 4PZ9A 2A5DA 5B1EA 5LLSA 1U0TA 2G1PA 5GINE 1E4VA 4MTLA 1G42A 4S35A 4G09A 3GRFA 2CVQA 2LPMA 2WU8A 3LHFA 1KC3A 5E4JA 3CF4G 2PD6A 1CUHA 1YSPA 3QG5A 3H82B 2A14A 4V3CA 5K20A 2DG2A 5DGHA 4OH1A 2QYBA 2FZ5A 1IOVA 4EZEA 2QX8A 4ZU1X 3JPUA 1XGJA 1GQQA 2ABWA 4O08A 4OREX 3WISA 1BLPA 3MTDA 5HL6A 4BFVA 3DHYA 5IAGA 3EEYA 4CZ2A 2CLFB 4CETA 1U28C 4NYMQ 4FZ5A 1W7FA 1S2IA 2XYPA 1Q1GA 3R7NA 1YE8A 1LHYA 3MWDB 2ILVA 3MOIA 5BT9A 1C1DA 4FXPA 5GJCA 4Z6KA 4PFSA 2Q9BA 3K09A 2ZWIA 1NM5C 4PG7A 1A8IA 4I39A 4JX9A 2ECFA 4A16A 3ZWPA 2E1RA 1P0PA 3ECSA 2RI1A 4I5FA 4XXHA 3TINA 3SYNA 3D7NA 3VGPA 1LLBA 2B4TO 3IO3A 3K1JA 1W9MA 4FR0A 3QVMA 5DZSA 4I9UA 1OAOC 4AICA 4I55A 3QITA 4ND7A 4DAEA 2PIDA 1F06A 1ZM3A 4JQZA 5K3EA 2VLGA 1FDIA 2CFIA 1J2YA 5KKCA 2H0QA 1OYWA 2X1VA 1XB2A 4ARIA 4HNGA 1JNUA 3VPAA 2HDSA 3F96A 1OFHA 4QHSA 5B3JC 1NW8A 3AIOA 1FSGA 2LB5A 2W2OA 4GOJA 4PVCA 4CF3A 1QO0A 4RY9A 1E8MA 5E2AA 1Q0UA 2QTVB 3S2UA 2I7XA 1KERA 1UR5A 1ZN7A 5HX7A 1YR6A 1AQNA 1XQ6A 4BKUA 1K9SA 2D02A 2CHQA 3LBAA 1YPRA 2Y6UA 4DDMA 5AH0A 2VOJA 2OUKA 4X97A 3THWB 3BFFA 2DKFA 3QTBA 4HATA 2MYTA 2R79A 4EI2A 3SXUA 2EATA 1XQ1A 4MV6A 3CKMA 2NSHA 1E7RA 4BQOA 3GN1A 1UPBA 3JV7A 3AERB 3P9RA 1BA3A 4MDEA 3Q10A 2WGVA 3NIAA 2JFZA 4U3TA 2YWJA 5AK5A 1B43A 4B3HA 1MZPA 2IZZA 1R88A 2R8ZA 2VJCA 3GJSA 5SY4A 4Y2UA 2IE8A 3O8DA 4TTSA 3CR8A 2GN4A 1BHO1 1XEXB 1TD5A 3ZX4A 2H5EA 3B8EA 2QMHA 3KYEA 3BB3A 4W5TA 4KMOA 3QEBZ 1X7WB 1YQGA 1M83A 3PCXA 3OE7D 3N76A 2C5EA 4QOSA 3EZLA 1H8ED 3PENA 1P81A 4LV2A 3ROXA 3W9YA 1V96A 4I4TA 5G18A 1XP8A 10MHA 1MEJA 4JD5A 4I4NA 1FXUA 2YMQA 1ZISA 2Q62A 1LBEA 5HARA 2WHPB 3ET5A 4CRWB 2P67A 4FGJA 3RRFA 3GDWA 3E5RA 5FWXB 1M2VB 2PVPA 1IAVA 4EA8A 4EQZA 3DMTC 2ZYWX 4CNQA 3RKUA 5FTKA 2F1OA 4MEAA 1YULA 3SHOA 3G1UA 1GTZA 1YQUA 1OSNA 4NZPA 4DCJA 3ZV4A 1F2UB 1MOQA 3T7IA 4YC7A 3G2ZA 1XALA 2QTAA 4ZMSA 2YWRA 1DMSA 5CA0F 4IFIA 1WM1A 4BVEA 3D31A 1QP4A 7MDHA 3W3ZB 3WS0A 1JWVA 1IUKA 4FGZA 1A9OA 2F7SA 3DWKA 1EIZA 2OCPA 4K9RA 5DHSA 3WSTA 2KLBA 1YBVA 3QKSA 2X9QA 2Z83A 4MB6A 3ZGOA 4Q9AA 2A3RA 3GNLA 4FYYA 4KQCA 5MGNA 1KZ4A 4YX9A 2PZMA 1XTTA 3OCWA 3DD1A 1SUEA 3RFVA 1BDIA 4RD6A 3OF2A 4D9GA 5CVCA 2QUHA 1RRKA 4KZ8A 5AOCA 1ZKDA 3HY4A 3RCBA 1XTUA 2EKLA 3UAVA 2JAXA 1H2ZA 1S8FA 5DM70 1JTFA 4DSUA 3Q98A 3P0FA 2ECKA 5DU2A 4J9UE 2XROA 4MWTA 4PO8A 4PR3A 1MZVA 1DRUA 3OIGA 2WINI 1E3UD 1I4DD 1QH9A 3DLPX 2DTDA 1JLKA 1ZICA 1CEEA 4FZRA 5F5XA 3BWCA 1L5SA 1JALA 3QFHA 4EUVA 3UEOA 3FIUA 4ZTKA 5L07A 1CF0A 3FBWA 2I0FA 3H2IA 4HHEA 3O4IA 2VHUA 3FTPA 4V1CB 4PW0A 3K70D 4ZPJA 4TL8A 4FBMA 1AT1A 3WNQA 2H1IA 2QAGC 4JHXA 2A1UA 1KVQA 1IZ0A 1XEWX 3ILHA 2C9ZA 2OCXA 4RIIA 1TIKA 1NWCA 3ELYA 4ZQIA 5FI3A 4BWGA 3I3SR 1BJTA 1G20E 1UPXA 3ZXSA 3WAJA 4DUPA 3HCAA 5CB6A 1UBJS 3FSRA 1W0JA 2C0QA 4PHCA 3CC8A 4LFUA 1I7SB 1BU5A 5FQJA 2I1LA 4WKOA 5EE5B 3GVCA 1X2BA 2C5SA 2HBQA 3AEKA 4BVHA 3NJRA 2J0UA 1YJXA 1TQ6A 3TBKA 4HFMA 3CX4A 4X1KA 4J6FA 1AS3A 2YFYA 4C4RA 4DQUA 1DAMA 1KQFA 4QQRA 3TN7A 1UBRS 1ZI9A 4B3SB 5AVOA 3X1ZA 2ORIA 1D1QA 3RVRA 3UOWA 4H1UA 2YN2A 1ZGCA 2BHSA 3ZCSA 1JEJA 4DUZB 1I36A 1UBSB 5IZ4A 5LL6P 1HLFA 3ML1A 1AKYA 5J2UF 3HSSA 5KSZA 3VR2D 3COYA 1IWOA 2C7PA 1MQ8B 2WKHA 4RSRA 1BX3A 2YC4C 5SY6A 3OPRA 2G04A 4W7SA 5LZ8A 3H9BA 4TMYA 3KT0A 4LZAA 2ZTMA 5EZ5A 3BRCA 5AICA 1P6QA 3ZCTA 3DEFA 4U0XA 1F2TA 4EG3A 4QUAA 5KZHA 2TECE 3O5AA 2PUVA 2NACA 4LFAB 2Z6DA 2QKYA 4C07A 1ISIA 4MEJA 3NHRA 1OROA 5THXA 3RUEA 2UYQA 4ZVVA 3IOBA 2OYSA 4QYWA 4PRZA 1FU7A 1RHMA 2B1GA 3A1TA 3PUKA 5A71A 2A7QA 3NWPA 3JD0A 1UF9A 2IWBA 5JFOA 5TJHA 3LUPA 1KKMA 2OM6A 4GMHA 4Y1EA 4N8EA 4RA6B 1TUEA 3PRKE 3P4UA 1ZCFA 1HDXA 3PEUA 4QUIA 3E5MA 2Q0HA 3TW0A 1HEUA 5JNSA 1L4HA 1AHIA 4MLZA 3AR7A 5H0IA 2EFDB 5AVKA 3QMPA 3QWBA 3R9XA 3ZW8A 4AJIA 1FEZA 4YMIA 1MLDA 5JPCA 3MUOA 4UHFA 2ID7A 4R16A 1N6HA 2I22A 3K70C 4HQAA 4MS1B 2AUMA 4Q1DA 5G1PA 1JAYA 3H7IA 3R74A 4DLUA 4QARA 1W85B 2A0YA 4X65B 3SF8B 3O90A 3GPDG 1OUMA 4JUBA 3MW8A 1BCSA 3I4FA 1IC6A 4ZIRB 4XLLA 4LPZA 3NP7A 2MJ6A 3USCS 2Z1MA 4XZ3A 2CC2A 4OTZA 3UMMA 1DBQA 2OP1A 1PR0A 4JGOA 4RXMA 4G67A 1HY3A 5K01A 4FGWA 2K7ZA 5K3AA 4ENWA 3IMGA 3U9TA 5IJZA 4RACA 4M2LA 5JARA 2WGWA 2Y0BA 3KKLA 4BLWA 5HOQA 4DTCA 1MENA 5P8WA 4E6EA 1NE2A 3QELA 1K8YB 2PJZA 3R7DA 4HDOB 1R6UA 1X9GA 3RROA 2NXEA 2R6GA 1FYWA 2O9CA 2HMSA 2W2XA 3RAJA 3L7NA 5K3BA 4LC9A 4P5PA 3RS5A 1SIBE 5JXIA 2XXBA 3SJAA 3IP3A 4UULA 4M53A 4RH3A 4WACA 3JQ8B 1N9OA 3RSGA 1DBIA 4GWGA 4EJ2A 2FPWA 4RV5A 2X58A 1XTRA 4AP9A 5C8VA 1KYQA 3SZMA 1G8FA 4UARA 5HW0A 2GAFA 4E3IA 4FC6A 3M83A 4LQLA 2P62A 4YUZA 3D1LA 4AS3A 1YUMA 5E6UA 3E4OA 3T4EA 4CMKA 1R9NA 3SGLA 2IPAB 2GSWA 4X1YB 4CGZA 3JRXA 1WW8A 3SIWA 2QUIA 4G4JA 3PXXA 4JENA 5DTMA 3ABQB 1FFXB 4MB2A 3DVRX 1TK3A 4EVIA 1Y82A 2VQDA 4X95A 1OQAA 4WK4B 1CQAA 1T0HB 5IC4A 4A23A 2DFDA 3ZVMA 5AJZA 3Q7VA 3GCZA 1XBTA 1G5TA 3PBQA 2WPNA 1DMRA 3J80A 4LYDA 1KEWA 2NTNA 4RK7A 3F2IA 1VA4A 1HDOA 3OLZA 1IL0A 1EDZA 3HYLA 3N2YA 1Q6YA 2HEGA 1GVNB 4ESOA 4AXXA 4LV5B 3KIPA 5K99A 3EUEA 2IJGX 2J6IA 4U2EA 5KDOA 4G0VA 3QY0A 3HJAA 1K7XB 1PG5A 3O8OA 2HPBA 3TH5A 4JBFA 1Z0UA 1PRYA 3KO6A 4HGZA 5JWOA 4NTZA 2ILTA 4D6XA 1AJEA 4OH0A 5JMWA 4WNAA 1NJ1A 5A0FA 4MQ4A 2HCBA 3W05A 4AKTA 5AKJA 2XUIA 1YZFA 3ELBA 1U65A 1YA6A 1WBJB 3EPPA 3K3CA 1ITZA 5D01A 4PM4A 4RQUA 4GS9B 2FDRA 2IUTA 4KR0A 4Z0PA 4V3BA 3HLYA 1VSBA 3IPCA 2D0PB 4AROA 1CFJA 3KZXA 4B73A 1CU1A 5H4HA 3T52A 3IC5A 5EZYF 3VPCA 4OQDA 5F83A 4FONA 3TK1A 4WEOA 2HY7A 3HKEB 4D8YA 2JGIA 3KFXA 4H31A 4CDMA 1HO3A 3AZQA 5G0WA 3F6RA 1YQTA 3HH8A 1C8BA 2E5FA 4MJ7A 2FJUA 1UMCB 3W9BA 3FPVA 1X9HA 4F8JA 4OBWA 5AI9A 5HD5A 1RZUA 3WJ7A 1WHSA 2GZDA 4PGAA 2CXRA 3FPKA 4CM5A 1L5ZA 3LGXA 4R40A 5K3FA 1OTAA 2BFFB 2ODWA 5JQGA 4WXEA 2B8WA 2D5CA 3F6PA 5DEIA 1PFUA 2REBA 3NULA 2K5UA 4JITA 1Q14A 2ZQ5A 3HEAA 1I9CA 3CNQS 3JQ7A 2RBEA 4B31A 3VYTB 4KXFB 2XWPA 2OPHA 4JH0A 2NZXA 3FMGA 1D7OA 3WRYC 4NP6A 4C08A 4G1EB 3EMKA 1L5NA 1ZYUA 4KQIA 3IMCA 2H0AA 2DE0X 2QN7A 5DCUA 3HYRA 3U09A 3IA2A 4LZPA 1O8CA 1JI0A 4J0HA 4JEIA 3MTIA 3GHYA 1Z4LA 4MMZB 4F4CA 4ARVA 5LIPA 3HE3A 3CT4A 5COBA 5JR3A 3UNWA 5B3KA 1AKNA 3SFZA 1EUCA 3SKYA 3OTOB 3PA6A 2JGAA 4OHXA 1OA0A 4KQ2A 1CEXA 2LZ0A 8OHMA 2DERA 2AQ8A 2TMKA 2GTHA 3W4IA 4OK3A 3V34A 2P1ZA 2JAUA 1S2NA 2FHPA 3FYDA 2QR5A 4KSBA 4C4YA 1A96A 4OQYA 3HV2A 4URVR 4OLBA 5BYAA 5BSEA 1ZVKA 3UATA 4FUWA 5L7WA 4PQRA 4QG3A 2GDJA 4Y6GB 3BF8A 3LBFA 4KG7A 1SDNA 2AZ4A 3BILA 4HJ6A 1XZLA 3ACDA 3KBBA 4RY8A 2J3MA 4C6SA 1BYIA 3ZGVA 4KI0A 2FWJA 1J8VA 1NBIA 1P73A 2OCAA 1NOIA 3BQNB 2FWMX 5C7IO 4DEYA 1DAOA 2J08A 1VG1A 4Z9YA 3B3XA 3F1KA 4S24A 2CE2X 5IZCA 4QLAA 1JVJA 3F1LA 2D8AA 3WDKA 1YFKA 1TIBA 1G3QA 1OLSB 4BC1A 2G8NA 1U2SA 1VMIA 4I3AA 4YROA 1PD0A 3EIUA 4HZGA 1A4RA 2XZOA 3L4BA 1M8FA 1E0AA 2C59A 1Y9AA 5AW8A 3AOEC 4QOIA 5C4MA 4HB4A 1Q77A 1RWBA 1RCUA 1QGED 2A0KA 3NEAA 3KKMA 2ASEA 4NE9A 2FFRA 4RMJA 1QVWA 4O4IB 4ER0A 5E7MA 4TM7A 3OVMA 1EK5A 4MUAA 1XF1A 3GRCA 4RK1A 5C80A 5JAUA 3VR6D 4G0XA 2H31A 1R9GA 1JE0A 2IZ0A 1D6MA 5DF9A 4HP9A 4RZSA 4NYJR 3CEMA 1S02A 1H0SA 2ZTSA 5BOVA 3S28A 3KEMA 5KNDA 1IBLB 1CY4A 2VRBA 2AVXA 3NRJA 4DDUA 4X20A 4QWMA 1SU6A 3PXGA 1MDFA 5KNBH 1TRKA 3PI6A 1JHPA 2J9FB 1HQKA 1WBBA 3GIWA 5BMVA 3VGJA 5BN4A 1X1AA 4MGZR 2YJZA 1ZGHA 1WVIA 4PFKA 2RMKA 4XB2A 3R7AA 1RQXA 4KG5A 2AH5A 5LB2A 3SVLA 2GVDC 3I04M 2G4CA 1EE1A 3C3BA 4TKMA