3JVVA

Crystal structure of p. aeruginosa pilt with bound amp-pcp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
342
structure length
331
Chain Sequence
MDITELLAFSAKQGASDLHLSAGLPPMIRVDGDVRRINLPPLEHKQVHALIYDIMNDKQRKDFEEFLETDFSFEVPGVARFRVNAFNQNRGAGAVFRTIPSKVLTMEELGMGEVFKRVSDVPRGLVLVTGPTGSGKSTTLAAMLDYLNNTKYHHILTIEDPIEFVHESKKCLVNQREVHRDTLGFSEALRSALREDPDIILVGEMRDLETIRLALTAAETGHLVFGTLHTTSAAKTIDRVVDVFPAEEKAMVRSMLSESLQSVISQTLIKKRVAAHEIMIGTPAIRNLIREDKVAQMYSAIQTGGSLGMQTLDMCLKGSRENAREKAKIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Twitching mobility protein
publication title P. aeruginosa PilT structures with and without nucleotide reveal a dynamic type IV pilus retraction motor.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Atp binding protein
total genus 109
structure length 331
sequence length 342
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3jvvA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3jvvA02
2WBLC 4MRVA 3GLIB 1CEEA 2WAXA 3ZZTA 2QNRA 2IXEA 1FUKA 1F5NA 3KJGA 2QRZA 4LYHA 3AVUA 3VNUA 1JNYA 2QSZA 4G3XA 3WNBA 4BLSA 5CJ2A 4S2EA 5FTKA 1G7RA 3AKYA 4IOJA 3SYNA 3QKTA 4NBSA 3T1OA 5DHFA 2F3RA 5EUMA 5C4MA 2XGJA 4HI0E 1LW7A 3RC8A 4FI3C 4LHYA 2EW1A 3HU1A 4HDOB 4UJ3A 4DT1A 2GJKA 3W90A 1W0JA 2JLSA 4ILEA 3RRNA 4XVRA 4CVNA 4HAZA 2Q6TA 3BFXA 3EG5A 5DI3A 3IHLA 1H8HA 1ODFA 3WY9A 3AUYA 5TMPA 4EJSB 1M2OB 1L8QA 3DKPA 1FW6A 4IJMA 4B73A 4D80A 4ZI2A 4M1WA 2V55B 1T5LA 4MYUA 1E96A 3TW4A 1N0UA 4PANA 4OKSA 2X1VA 2IX3A 4YMTA 2EQBA 1Q12A 2VSXA 4JYBA 4NYMQ 2WWFA 4Q9JA 3DZDA 5F3WB 4BWYA 1R7RA 4Q1CA 4H9GA 4LX0A 1V43A 2AL7A 1JR3E 4V0MA 3TQFA 1XPOA 2FNAA 2C78A 4HLCA 4MA4A 3VX3A 1DVRA 3M6AA 2GAOA 3BBPA 1EXMA 2K5UA 5JEEA 3NDPA 1SVKA 3VR1A 3AF0A 1AGPA 1G1MA 1Z28A 5JWOA 1F6BA 3E2IA 3AP1A 3PUVA 4NYJQ 3F8TA 3LD9A 1KSJA 3U4QB 4C7OB 1XTJA 5KSOA 2ZRKA 4Q02A 4NYIR 1XJCA 5FL7A 1GUAA 3PCRB 3KQHA 1FMJA 1S0UA 1E0SA 4IDNA 4KBGA 4URZR 5J4YA 2HT1A 3TAUA 4LC1A 1JALA 4LJ8A 3H86A 4U7DA 3IIKA 1MOZA 4FXPA 1KMQA 2H57A 3ADKA 4QRHA 4TLDA 3EPKA 1BKDR 4KO8A 4Q1DA 3PUZA 3CRW1 1NVVQ 3CX6A 3IQXA 4PHTA 1FQKA 2ZUBA 4R2IA 1WP9A 4QJ5A 5FFMA 4MYHA 1LNZA 3SNHA 4GZLA 2QPAA 3B1ZA 5IK2D 2C5LA 3ZVNA 1U99A 2J0QA 1CLUA 5CB8A 4NMMA 4YDSA 3CW2A 3LO5A 2YKGA 3AF1A 1N6LA 1FP7A 2PMKA 2W6ID 4B6EA 2GJ9A 2W83A 1JAIA 2RGDA 2V54A 3PITA 2R6DA 2VYFA 1MV5A 2GCNA 1WQ1R 3Q85A 1P2VA 3IHWA 4KLNA 3R9XA 2ZI4A 4NCKA 1G7TA 3LVRE 4RFSA 4ARZA 4ZI3A 1LB1B 2WV9A 5HR5A 4JL5A 1ZW6A 4I1SA 2IT1A 2GESA 2UKDA 1E94E 1BYUA 1SVIA 3DMNA 3KX2A 2RHDA 1AKYA 1Q3HA 3D3QA 3PEVA 4GPTA 4NONA 3VR6A 5EE0A 1DPFA 2I1QA 3EPLA 3S1AA 2QL6A 4FMDB 4B74A 2LCFA 721PA 4DDUA 1KIMA 1AS2A 1PLKA 3FHCB 2WJIA 3VAAA 3W34A 4TSFD 1NNEA 3HWSA 5D3MB 1G8YA 4A82A 3CLVA 4CZ2A 1G21E 1OXUA 3U3MA 4A0HA 4DLZA 2IYWA 1J8MF 4EJSA 4DLWA 2DPXA 1XTQA 1GL7A 2D06A 1VIYA 3UKDA 4EPXA 5FUVA 5HZKA 1W49A 3WNCA 2ZJ5A 4D4LA 4HB4A 1F2UA 2QPTA 4HAUA 3K8YA 4JLJA 3CNOA 3U2QA 1B0UA 1N6PA 2YC4C 1JECA 4MRPA 1XTSA 2X2FA 2D7CA 2XNDA 2ZTSA 4G1UC 4HZIA 1ZVQA 4IVPA 4NCNA 3RS0A 2X19A 5LB4A 2EFDB 4Z1MA 4EPYA 3FMFA 4GZMA 5SZIA 4O3MA 1NLZA 1G8GA 3CKLA 3PJRA 3GEIA 1E9BA 2A30A 3U4QA 4C7OA 1XD8A 2AK2A 4C3ZA 5FL3A 4Q19A 2IXFA 5HE8A 1ZU4A 2FPKA 4KITB 5EJEA 5ANRB 1YKSA 2QRNA 3QXHA 1VHLA 2LWIA 2BKUA 3TLXA 4S35A 4A2WA 5DN6A 2IYZA 3NHAA 5GVRA 2XXAA 4TZ6A 4W7SA 5CM9C 3X1XA 4NCJA 3F0TA 3M1IA 3EARA 4LY6A 2GJSA 2F1JA 3I3SR 3EWSA 2IS6A 1F48A 2QMHA 1ZUHA 4F91B 4PSVA 2FPMA 1E2EA 2LKCA 5KDDA 2ZE6A 1G3MA 3NBFA 2FGKA 3LH5A 2ZR7A 4LCBA 5HZHA 2OSBA 3W6PA 1KMHB 1TAGA 5CLLA 2WJHA 1AZSC 2P6NA 1T8TA 1A2KC 2OESA 4WZ6A 3OFNA 4CEIB 4DCUA 4GOXA 4BRWA 5DO9A 1KI4A 3T1TA 3O8RA 1U8YA 3T5DA 2OO7A 4Q18A 3GFPA 4DVGA 4O0MA 3WBKA 5L3VA 1IOZA 1P60A 1CJUC 3LLUA 4LC0A 3BH6A 1WF3A 1G17A 1Y3AA 1YRAA 3QXJA 1ZBDA 3U6BA 1IN8A 5EP1A 3RC3A 2R8RA 1OXVA 3FVQA 2ZE5A 1US8B 2VBCA 4IW3B 4U02A 5AWFC 1XF9A 3RRYA 1D5CA 2XJ9A 3CPJB 1Q57A 3I62A 4OK5A 4UNPA 1MKYA 3RS2A 1XXHE 1W7AA 1M1YE 4QXAA 5L3QA 4C0QC 5D3MA 1RVDA 1N5IA 4PO1A 3ZLJA 1OB5A 2C2HA 4DRZA 4NCHA 4DZZA 1CU1A 3GJ8A 4TTQA 3TR5A 4URUR 5B58C 4QL3A 3Q5DA 1PV4A 2DWPA 1H8ED 1OIXA 2HV8A 2WWGA 3PG5A 5FUYA 3OE7D 4MUAA 4Q00A 1P72A 2N42A 3RLFA 5A4JA 1J99A 1RE0A 4TLAA 3VU9A 1ZD8A 2RGEA 1KAOA 1OIWA 2PZFA 4B6FA 1L2TA 1WDTA 1QF9A 2ZYWX 3PUWA 1UAAA 1E2FA 4BZQA 1HQYE 3QF7A 4FCWA 4IOLA 2XEXA 2CVHA 2FV8A 3SHWA 3DM9B 1EGAA 4L5BA 1NL3A 2VRWA 2YWFA 2RGAA 5LPNA 3OZXA 4DLRA 2ZXUA 2V6IA 2X77A 1OW3B 121PA 4UXIA 2NQ2C 4V0LA 4PPGA 1UBFA 3GD7A 3GJ5A 4D0NA 2CHVA 3NH9A 1ZYUA 3DHWC 4FINA 3GJXC 1GL9B 5SZHB 1IXZA 1LF0A 3CO5A 4MGKR 3L82B 4WZAE 3SI7A 2W6JD 4KU4A 3GLHA 5H68A 4IHQA 5BYJA 3G82C 5L3RA 1JEDA 1G8FA 4DCTA 4TYPA 1QHNA 2A5YB 4PXAA 4LBWA 3TR0A 2VPPA 1OXSC 3KKQA 2JJ8A 4YDHB 1XD9A 5A5GA 5LD2B 2PZGA 2JLZA 2BM1A 1DO0A 1Z08A 5HPYB 2WJGA 5FUWA 3QE0A 2ZYVX 4BE7B 4EPVA 3CBQA 5JWRA 5KSZA 5AJWA 2WM9B 3NVAA 3R8FA 1KI3A 3KTAB 5FBVB 2HYIC 3OAAA 1Z6GA 4C2TA 1FL9A 3LX8A 2J3EA 3SU8A 4PFSA 5JECA 4I1UA 1R5OA 4TLBA 3GJ6A 1E0AA 1PLJA 3KFVA 4K46A 2VSFA 2EU8A 2DWOA 1ZUIA 2REOA 3AV0B 4O2RA 2P0EA 2O8FA 4D6PA 1JAHA 5IDVA 1P2TA 2ZI3A 1KMHA 1ZIPA 2EFEB 1UADA 4TMTA 2EFGA 4EJSC 1DG1G 5CDFA 5F2EA 1IQPA 4QOSA 4TMXA 2ZRCA 1N25A 3H84A 3RWMB 4D0LB 4PTLA 2OLKA 2MMGA 1DAEA 4B35A 4L9SA 1T3LA 3BWDD 1KI6B 1SXJD 4Z8XA 3GFTA 3QXXA 4B2LA 3CX7A 4IOMA 1ESMA 3QG5A 4L16A 1OH6A 1YZUA 2V1XA 1Q1ZA 3VR5A 3NWJA 1CULC 2F43A 1SHKA 3K9LA 2IF2A 4NE2A 1US8A 4V0NA 5EE1A 1SQ5A 2GK7A 2JLYA 1KZ7B 4DLTA 4TTRA 5L8VA 3KQUA 1E9RA 2F9MA 1WMSA 1W36D 1Z0IA 3EASA 5EXTA 4CYMA 3I32A 4QG7A 3V9PA 2EVWX 2G0TA 3GQBA 4KSBA 4LRWA 3BFVA 1FNMA 3O47A 1COWD 3TRFA 1T4GA 1Z0JA 2AKYA 2ODBA 4LYJA 4BFYA 1XRJA 1FFHA 2IHBA 1NVWQ 1X6VA 5EZ5A 3K0CC 5M04A 1YHNA 1JBKA 1W0KD 2ZS7A 2ZYTX 5CJPA 2ASEA 4MQBA 4B76A 2QU8A 1M7GA 4KJZA 4B32A 2FF7A 3JVUA 4TT3D 3A58B 3KXKA 2VP6A 2O8BB 1W4AA 2H1LA 2HCJB 1I4DD 1CJMA 1E2HA 1G5PA 3B85A 3G5UA 3T34A 1N6OA 3D8BA 3BFKA 3RRMA 2O8EB 4JLKA 2ZRIA 2DY1A 3VKGA 3EW9A 3I61A 4FCTA 3DO6A 5J47A 4DLUA 4XOIA 1NSFA 2D62A 3LQRA 2IUUA 1NIPA 4BLQA 4GFDA 3B7GA 3QVVA 2BJVA 1D8TA 2MSEB 1AIPA 4A0RA 2VA8A 3I73A 1KKLA 2AX4A 1N5LA 1RKBA 1TPZA 3L8ZA 3ZZUA 5B64A 3GMTA 4M1KA 1AN0A 3I4LA 4KAXA 3SBDA 4CGZA 1AQUA 4I1VA 1KI7A 4ESVA 5AJXA 5KSPA 1U0HC 2VQSA 3KKNA 3UXMA 5JSZB 1L7VC 5JI2E 1KK0A 3EZ2A 5JWHA 3KTAA 4ZCIA 3PEYA 4AIIA 5JBQA 2IYQA 4US1R 4JT4A 4AG5A 4XSHA 4DUGA 4JLOA 5GJVC 2GK6A 2FPLA 3GEHA 4KFSA 1UM8A 2HYDA 2OAQ1 2QTFA 1OHHD 2ZRGA 2PJRA 3ND8A 1FQJA 3TUJC 4YMWA 2FA9A 4PZZA 3WP1B 1KDTA 3THOA 2AHOA 1TQ4A 2FMXA 2G1KA 3IIJA 2J87A 2W2VA 4ZCMA 1N5KA 2BBWA 4G01B 4GSYA 3AVTA 2W00A 4JVNA 1KDRA 4PX9A 5E4FA 2JCSA 4DC9A 1HT2E 2WIBA 2R6GA 4CEJB 5AR1A 3KXIA 3OEEA 4M1TA 1GZSA 3AF2A 4IXNA 4X8OA 2PCLA 4XWOA 4V0ME 2ZRBA 3SJCA 4AY2A 5TARA 3EIHA 1BS1A 3BIFA 1NBMA 2PEYA 2NO7A 3RANA 3NEYA 2FSGA 4B75A 3BH7A 1T6NA 2DHRA 3KQNA 2A5FA 3BH0A 3NBYC 1T91A 2NO9A 4GT1A 3GEEA 1KK1A 1KY3A 4Y0AA 5B30A 1FUUA 2TMKA 2DB3A 1UEIA 1Z0AA 2NO0A 2JAQA 2QP3A 2JJ2A 1GTVA 1EFHA 3MJRA 1XEFA 3WBJA 4B3GA 3AVPA 2CJWA 4ZCLA 2HLDA 2O0HA 2ODWA 5JCPA 2IWRA 3HR7A 4PHFA 2HXSA 2YJTD 2ORVA 2AFHE 4L8GA 2CE7A 3RS4A 3ZD7A 2NPFA 4PR0A 1ZM4A 2ZR0A 4A6XA 3W8NA 1KNXA 1X3SA 1XDBA 1P2SA 4RZXA 1QHIA 5DSZA 2IEYA 4LWZA 1ESNA 1T8UA 2C96A 2O8BA 1YZLA 2BBSA 4PPNA 4Q01A 4ZDKA 4UKDA 3T5GA 1NIJA 4HDQB 5JCZA 3H2YA 2O8EA 1Z5ZA 2CL6X 4HLUA 3CB4A 2VF7A 4GP6A 2ZANA 5FOXA 5J5CA 4RZ2A 1NRJB 1OFTA 4TMVA 2IF0A 1G6OA 2GZHA 2J7PD 2WSMA 2C9OA 3FMPB 3IBGA 4A6PA 1N3BA 2G3YA 2QORA 4JBYA 3I8SA 4M2LA 5FUXA 4CDGA 4DUGD 3AVWA 821PA 3NIBA 4B47A 2WSSD 1XEWX 4PSKA 5DNYB 3KUDA 3CRRA 4RD4A 5CB6A 1F3OA 5JSZA 1CBUA 3FFBA 2J41A 4TYQA 3Q7PA 3E5HA 1T5IA 1TEVA 3QVUA 3FKSD 1A7JA 4QGGA 3AEZA 4Q1BA 4EUNA 1AM4D 2ZAMA 1R10A 4BUJA 3B78A 4D81A 1VYVA 4HB3A 3CR8A 4LYFA 3PV0A 4IVQA 4BZXA 1EFCA 3UPUA 4HAXA 1TL7C 2FFHA 5F9HA 2J7KA 2P6RA 3ZQJA 2ZVQX 3AF4A 4HAVA 2NTYC 2RGNA 3R7WA 4RD1A 4RVCA 2XB4A 4UNNA 1KHTA 1N6NA 2JDID 4OL0A 2GTPA 2OBNA 3SE0A 1II8B 1W48A 2DR3A 4ZKEA 3ZVMA 3KB2A 2PX0A 3F5FA 2HLDD 3LNCA 2JLQA 4KFRA 3MWLA 4RCZA 2VIIA 4KYIB 5E95A 5K8TA 2P67A 1DADA 2QT1A 2W2TA 3IQWA 4GNKA 3UMRA 4ZKDA 4OBEA 4AKGA 1XTRA 3SJAA 1Z8FA 4AD8A 4XSGA 2JIZD 1FPMA 2B7CA 3A37A 1YZNA 2YWGA 2ANCA 4QBGB 3DKVA 3NTUA 1I2MA 5EXXA 1E9AA 3REGA 2BVNA 1GP2A 1GG2A 3BRWD 4ARZB 5IK2A 4DB2A 1N6HA 2ZQ5A 2NO6A 1T3HA 1NN5A 2BEKA 4PO8A 5LD2C 2XSZD 2FFQA 2IBMA 4I99A 2W6IA 4JL8A 1N5JA 1HQCA 2QP4A 1LFDB 1OPXA 3S1AB 1E69A 2G77B 4XJXA 1GL6A 3O8BA 3WYAA 5DGXA 4NPHA 4M4SA 1NLFA 3OESA 4LBYA 3VX4A 1N0WA 3M4YA 5KNBA 2IXGA 2A78A 1XMIA 2F1HA 2GJ8A 5BN4A 4O2LA 5FPYA 2OFWA 1GFIA 2J5XA 2PZEA 3ZVRA 1W1WA 4GP7A 1JJVA 4BFXA 5IRCD 5G3YA 3KQLA 1G6HA 2PCJA 5HCIA 4L15A 2ANBA 1KI8A 1MRNA 2C03A 1U8ZA 4TSFA 4B43A 3VMFA 1E9FA 1F2UB 2BMDA 3ZJYA 5KU1A 4HAYA 2NOAA 2ZI7A 2BEJA 4P4TA 1NG9A 4NL4H 2B6HA 3U3RA 3IILA 2BV3A 5SZKB 4MRNA 2WWXA 2PLFA 4TTPA 4X8MA 1X8JA 4EAQA 2GF9A 4B3BA 3AVVA 3LAWA 2OCYC 1GKYA 3ZDQA 1KJZA 4LK2A 2ODNA 1IXSB 2ZJBA 5TXGA 1PUJA 1SVWA 2RGBA 1U81A 5CM8B 4D26A 1DAIA 1P62B 4QM6A 3HYTA 1PZNA 4BEBA 4G5RA 1HUQA 3KL4A 2REBA 3P27A 4EKDA 3HYRA 2HEIA 4DHEA 2A7QA 4RCYA 2XXAB 2FEOA 2CCJA 1CKEA 4HDCA 1JXOA 5H1YA 2OG2A 1OXXK 1II8A 2FDCA 1UBGA 3NC1C 4I81A 3LY5A 1J90A 3NG1A 1GOTA 4GI7A 3IDQA 1E9DA 3O8DA 4OI1A 4PZYA 4PHHA 3HPQA 2VL7A 3GLHE 4DLXA 1UKVY 5JS8A 3GLFB 5EZ6B 4WIAA 4TMWA 4OQLA 4GOKA 2J1LA 1CJKC 2GHIA 3ADDA 3LQQA 4GRAA 3CRQA 4OJKA 1Q1BA 3EZ6A 5LBIA 4M9SA 3IBYA 1WB9A 4TYYA 1JQLB 1A4RA 1DAHA 1ZINA 1OV4A 3EIQA 1IN5A 4Q9LA 4RZ3A 3P26A 1OKKD 5J4HA 2DFLA 4HATA 4OI0A 2RCNA 3QXSA 2V3CC 4Q4LA 4YXWD 3VR4A 1YJ5A 2KE5A 2R2AA 1Z83A 3L2OB 2ONJA 1X8KA 4D4KA 1S8FA 3LXXA 3CWZA 2ZE7A 3U5ZB 4UNRA 3MWJA 2O8DA 3BB4A 3JZMA 1GVNB 2B8TA 1TQ6A 2OCAA 1U2RA 1E0JA 4N3NA 4C0KA 4DWJA 4F4JA 2C9YA 1SXJB 2PMDA 3KKPA 5L3QB 1EX6A 3AB3A 1X1SA 2OE2A 4HEJA 5CDFE 2VEDA 2ZSFA 3OIWA 4IEIA 5BWMA 2KWIA 3R8CA 3L0IB 2O0JA 4MGYR 1Q1QA 4BLPA 3VU9B 1P7CA 3AUXA 2RGNC 4Q1AA 3MSXA 3K0EA 5EE5B 1UBEA 3BB3A 4LHVA 5E3HA 1JR6A 4AG6A 5TY0A 1W36B 2PEZA 1XCPA 3GJ4A 4JLDA 1VMAA 5J40A 1YRBA 4QGHA 2G6BA 4LJ5A 3KUCA 5BN5A 2FGJA 2RKOA 2IYTA 2OXRA 1H8EA 3AP2A 3LW7A 3QKUA 3PIRA 1W5SA 1DO2A 3OE7A 3QUSA 3AH8A 1K8RA 1CR4A 1A5TA 1YR8A 3B60A 3GJ3A 1WRBA 4R9UC 5G40A 4LOAA 4P4SB 2ZJOA 3L0SA 2ZI6A 4LV6A 3TE6A 4C4PA 3QF4B 1WCV1 1QHHB 2ZUCA 4M9QA 2C04A 2QAJA 3OEHD 4C0JA 2D3WA 4JSYA 4FMBB 3C16C 4DSTA 3GLHB 3PFIA 1QVAA 3QIAA 1ELOA 1ZM7A 2C8VA 3UK6A 4FWIB 3SFZA 3N70A 3DOEA 4C0LA 5K8IA 4HB0A 3BJIC 3TUZC 4B71A 1G8HA 1VDZA 3WP0A 2RH5A 2RMKA 3VTKA 3PEUA 2FOLA 4ITRC 3HDTA 3X1WA 4KYUA 3K70D 1ZM9A 4RZUA 1E99A 1UBCA 2B7BA 1EWQA 4EPTA 5FR2A 1PJRA 1EK0A 1SKYB 2O5VA 1R2QA 2W6JA 2NPIA 2DFKB 4TQ9A 2O8CB 4Q03A 3CUEF 5JHHB 3ASZA 1GM5A 5KYKA 2CLDX 2OZEA 2ZUDA 2GETA 2ORIA 3TIFA 1NY6A 2DBYA 4OQFA 1LV7A 4XD7A 2F6RA 5KTYA 1IXRC 1JPNA 1KTVA 2OM2A 3MCAA 4I4LA 1E2GA 4HUQA 4OQXA 5AJZA 4LJYA 4LPSA 5FI0B 3GLFA 2O8FB 2YHSA 1OH7A 2QMEA 5CYPA 2BWJA 3BGWA 3BOSA 2VP2A 5FBLB 4MGIR 4D0GA 1VPLA 1H65A 4PC6A 3UWKA 1FMLA 3HJNA 1Z0KA 3QEOA 2CLCX 3FWYA 3K0FA 2OBLA 1XB2A 4ZO4A 2RGXA 2L0XA 2MSDB 2GCPA 1I2DA 2F3TA 1XEXA 4LZZA 1DBSA 4OI2A 4RKFA 1E2DA 1M7HA 1RZ3A 4OK6A 2KI5A 3CNNA 4Q7JB 2CXXA 3FMIA 5KOYA 2F43B 5AK0A 4FWTA 4MGZR 1G3UA 3E70C 4R98A 1P75A 2IYXA 4C0BA 1OFUX 1WBBA 1M7BA 1MRSA 4BFWA 3U6KA 2ZU0C 3HR8A 4JLBA 4PQYA 1KO7A 1SXJA 4MKGA 2IYVA 2F9LA 2Q9AA 1R0YA 4BPBA 1IY1A 1ZD1A 4NYIQ 1WA5A 5GJCA 2ZVPX 4DCSA 1ZCBA 3A6PC 3A1VA 3CPHA 3SN6A 1KI1A 2AXNA 4C0AC 1YVDA 4HLQB 1A2BA 1XEWY 1HA3A 2J9RA 3W5IA 1G5RA 3TGPA 3ND9A 1NBME 4CT4B 5F9FA 1G4UR 2Z43A 4Z54A 4W5JA 4XTRA 3SYLA 5TVKA 5IT5A 1CR1A 5HTKA 1NJGA 2GBLA 2H92A 3X1ZA 1R5NA 5D3QA 2QSYA 2YNMA 1XMJA 4AYWA 2J0SA 1ZP6A 2I4IA 3DL0A 4V03A 1K5DA 4FMDF 3ZH9B 4XTCS 2BMFA 3RRZA 2RGCA 2P65A 2P2LA 2A5DA 4XVQA 1COWA 2MMCA 4JS0A 3ZZ0A 3FMOB 3FHTA 1Z63A 2JGNA 4LHWA 1D6JA 1XCGB 3FDIA 4P4SA 3RDPA 1E9SA 1BMFD 3NKVA 1W0KA 3QF4A 1G5TA 1QHHA 2VLIA 2G88A 4B3DA 1N6KA 4EPRA 4IFEA 1R8SA 4TT3A 2ONKA 4C0HA 2GXQA 3U3JA 4B34A 4EQ6B 1Q22A 1QDEA 4OHVA 2DCUA 4F4CA 2H7VA 3SBEA 1ZC4A 4PAQA 1E1QD 3RAPR 1IJFA 5CITA 1Z6TA 2CK3A 4BLOA 5E7IA 4ZPXA 2H17A 3Q7QA 4XD7D 3FKQA 1FOEB 2C77A 1P6XA 4MKFA 3K09A 2XTNA 1TU3A 3DDCA 3W6NA 3WYGA 4BFSA 2ATXA 4M22A 1KDOA 3AVQA 1G7SA 2GKSA 1AJEA 5AUOB 4BLTA 3OHMA 4TMKA 3LBIA 1RRFA 4TMZA 1CRPA 2O8CA 1LS6A 1TF5A 3X1YA 3REFA 4II7A 1XPUA 2GCOB 1IM2A 2GXSA 3A4LA 2XZOA 2XOKD 5G41A 1VCOA 1SVLA 2AD1A 3SS8A 4F93B 1GNPA 5JJKA 2RGGA 2GXUA 1ZU5A 2OHFA 3Q3JB 4RD3A 4Q7LA 3W5JA 1HEIA 2QP9X 3KB1A 1KGDA 2FJUA 3C14C 4W5HA 2HF9A 3VR2A 2QM8A 3N5CA 1T0HB 1OHHA 5DLQC 221PA 3QKRB 5TV2A 2Q3FA 2ZJ8A 3BS4A 5K8LA 1HY3A 2BCJQ 3NXSA 1XBTA 3TVTA 3UG6A 3ONWA 1FP6A 5BXQC 2BMEA 2CVFA 2KB0A 2FZ4A 4Y0VA 4DBLC 4M9ZA 1QBKC 4JMPA 1NKSA 2WKPA 3SZRA 4Q21A 2ZJAA 3W3AA 5A0FA 1GILA 3MRSA 4JLAA 2ZM5A 2AFIE 1ANKA 4LUCA 2FWRA 3U7EB 2WKRA 5CYOA 1X8LA 4WW0A 3THYB 3CIOA 2QQ0A 2Q9BA 5B57C 1Z07A 3RWOA 4DDWA 3QI2A 5C2JB 3TVDA 1C1YA 1ZNZA 2FSIA 2IEZA 2J0UB 1I4TD 1JR3D 2CJWB 3U7HB 5FI1B 3B9QA 2WVJA 2ZS8A 3PR1A 4X8LA 1F60A 2ZROA 4JIMA 1KSHA 2ORWA 2WOOA 2FU5C 2UZ3A 1FZQA 4DIEA 2BBOA 3GFOA 3P20A 5DE3A 4TL8A 3DM5A 4OJQA 4C0SA 2AN9A 4IRUB 1ZIOA 1I4LD 1W46A 4LV8B 1W44A 2BCGY 4RD2A 3SJZA 4GBMA 1FX0B 2OCPA 4LV5B 2V7QD 3EAQA 4FMCF 4P32A 4F7WA 1FTSA 2JLUA 3AVYA 1CR0A 1E9EA 1JEEA 2HF8A 2JASA 1G19A 2V4ZA 1UKEA 2ZSEA 4JBWA 1U94A 2GVDC 1DEKA 2CK3D 3OIUA 1EWRA 4LPKA 1VCMA 2D2FA 1L4UA 2GA8A 4IKEA 5EP3A 4FIDA 1J7KA 2QTHA 3CH4B 4WZBE 2ZEJA 1D2MA 4ON9A 4JKYA 2NO1A 4UXJA 1O3YA 4WA7A 3MMPA 4B33A 1E2QA 3EZFA 2E87A 3QEJA 2H5EA 3ECCA 4EQ6A 1KJYA 2HT6A 2WWHA 2PJZA 4OQNA 5TDHA 5CLQA 3NEJA 4DDTA 2YV5A 1D9ZA 2JATA 4MRRA 2IYRA 3KKOA 2W2XA 5FPSA 4NDZA 4D25A 5KPJA 3ZS8A 1G41A 1R4AA 2GRJA 3RSOA 4XVUA 2AWOA 2J7PA 2JEOA 1ZJ6A 2VHUA 3IGFA 4IVRA 4AI6A 3BB1A 1YZTA 4TLCA 4M21A 1WE2A 2A5JA 2GJAA 4DLVA 2GCOA 3A1TA 1PLLA 2Q9CA 2JA1A 5JLJA 2WSSA 2YINC 1SXJC 1G9XA 1RPZA 3QKSA 4LJ9A 3HPRA 4PC2A 2Q3HA 1A82A 1ZUNB 2CCKA 3SFVA 1KK2A 4X8HA 1W5TA 1IN7A 4Q47A 4B48A 4BQSA 2G9NA 3R7WB 3FKSA 2C98A 3VHXA 1SKQA 4DB4A 2QI9C 3QKRA 5FOSA 1AZTA 2GBLC 5AUPB 2CMKA 4R71A 3LX5A 1W4RA 5FPKA 1YZGA 2FH5B 1HV8A 3A1UA 1AQYA 4URWR 2XITA 4M1OA 4A1FA 2XZPA 3CRVA 5ELXA 2R6CA 1Q44A 3OIYA 3AQ4A 4QHTA 2O0KA 5FBRB 2FFAA 1MO6A 3PEWA 2QMOA 3GLGB 2BOVA 4KHZA 4TN1A 2OLJA 3HP1A 4G5QA 1VECA 4NCIA 5EP2A 1SVMA 4ZIRA 2JDIA 3THYA 1UJ2A 3EC2A 4G5OA 1RRCA 1BYIA 4ACBA 3BC1A 4M8NE 1R8QA 2VHTA 2C95A 2J0UA 2HDNB 2IC5A 2R62A 1U0JA 2D74A 2OFXA 5J4KA 1A1VA 4IXMA 4LSGA 2ZPTX 3A36A 5EP4A 5HE9A 2UVQA 2JLXA 4AWXA 1HYQA 2PX3A 1IN4A 3P32A 1DARA 1GRNA 1MR3F 1G3QA 3K09C 1E1RD 2ZRFA 2JIZA 1LTQA 3EA0A 1MO3A 4QBIA 1CR2A 4MKIA 2QAGB 1ZRHA 3AVOA 1ZM2A 1FX0A 3LFUA 5KHOC 3TKLA 4B2PA 1KKMA 2OV2A 1Q1EA 2AXPA 4F92B 3BXZA 1RW4A 4R2HA 4HAWA 1XZQA 2XSZA 2EWWA 3TSZA 2X8AA 5FTLA 4F4IA 3AVXA 1KSGA 2HUPA 1AA9A 3ICEA 4YMVA 3SR0A 4Q66C 5GVSA 4A0GA 2KBFA 2VP0A 4OHYA 4ABYA 4LBVA 3K9NA 2P5TB 3L43A 3AGPA 4GMXA 5BN3A 1AK2A 1G8PA 1W4BA 4PAOA 5KDOA 1IN6A 1ZD9A 2OEPA 2QUZA 3THWB 1SZPA 4ZDWA 1G16A 1NN3A 4G5SA 2VO1A 1E2NA 2QGNA 3BD9A 3GCGA 4JSTA 4P31A 2IUTA 1HE8B 3CZQA 1P3JA 1P5ZB 2ZYUX 1KO5A 4HUTA 3B82A 3QBVA 2DFNA 3TMKA 5KNDA 4K81B 4DKXA 4XIGS 5EE9A 4BFZA 4P33A 3UG7A 4QNMA 3C7KA 2BBTA 2XJ4A 1ZC3A 3MJHA 4OK3A 3EX7C 3QPVA 1SVSA 5KSYA 1GNRA 3ZIAD 4URXR 4NKRA 2ATVA 2FG5A 1EESA 1NLYA 3T12A 421PA 1NN0A 4WBSA 3PQCA 1VG1A 1J8YF 2QPOA 1QG2A 4CRWB 3DEFA 1DAFA 2Q21A 4A92A 4IDHA 3SQXA 4JVLA 5JMTA 1U9IA 2W58A 4CIDA 4KVAA 5CIQA 2DWQA 5HKKD 3KQKA 2ZAOA 2ZIAA 4KFUA 1LVGA 3NDBB 5C4GB 2GEVA 3UANA 1XTIA 1Z0DA 1AS3A 4LYAA 4WAUA 3U3OA 3MGCA 4E09A 4XWKA 2IS1A 3U44B 2WPDD 3KFXA 1S4QA 3WHKA 1MO5A 5FBWB 4K8OA 3CWQA 1MH1A 1Q21A 1N0VC 3RNLA 3FYHA 1G4AE 3DOFA 4KFTA 4UQOA 1UF9A 4ESHA 2HXYA 2YOGA 3R9WA 2YYZA 1AGRA 2FEMA 2ZI9A 4FW9A 2F7SA 4Q1FA 3K70B 3WRYC 2QZ4A 3GLGA 3Q5EA 4QBHA 4ASUD 1CJTC 3K9GA 2CBZA 1XU4A 3MD0A 3N2IA 4A15A 3CONA 1Z29A 2C9CA 5J4LA 621PA 3AF3A 4CF7A 4PQRA 3R9IA 2QBYA 4V0KA 3SC3A 3I92A 5BW8A 4YC7A 4MRSA 3AKEA 1CJVC 2HJVA 2JJ1D 1TQ2A 1UFQA 2OT3B 2OXCA 5G53C 4BZPA 2HJGA 3AM1A 4HYYA 5FTNA 2ZITA 3IO5A 1UDXA 2WJJA 1Z6XA 3SDZA 2GXAA 1SULA 3VKHA 4J0QA 3H1TA 2VHCA 3NHBA 3MAAC 3QJYA 4KBFA 1U90A 4BRUA 5L3SA 4QBFA 1RRGA 1OJLA 2QAGA 2VP5A 3EZ9A 4R7ZA 3WMFA 5AUNB 3B2EA 2O8DB 1OKKA 1NG1A 3GJ0A 3QXCA 4IDOA 3GLFE 1OYYA 1KNQA 4Q48A 4QHYA 2YWEA 2J59A 1Z0FA 3UMSA 2CHQA 4YXWA 3WYFA 2G0NA 1E2LA 5CK5A 2GZAA 3QENA 3BAFA 1ZAKA 1TUIA 1E4YA 3TUIC 1G291 1KI2A 5GJBA 4N0DA 4OHXA 1G7CA 1RYHA 1DAMA 3T1QA 4L4UA 3QPUA 3JVVA 1NMZA 2GNOA 2QENA 1F2TA 4CW7A 1EG7A 3LRPA 3THWA 2QG6A 4FN5A 4C9BA 3UWOA 2WHXA 4KSCA 1AKEA 1JXMA 2F1IA 1ZNXA 4EPWA 3O8CA 1E2PA 3AGQA 3MG9A 1EFRD 1P9NA 5KDLA 4A9AA 3TK1A 4EFMA 1KK3A 4RD0A 3AKDA 1HURA 1SXJE 4IDQA 2XNSA 4DLSA 4P3YA 1EFUA 2IYYA 2QM7A 3U61B 1GSIA 1Z6YA 2RHMA 1CS4C 4NP6A 4P4UA 3ZVLA 2QA5A 2VHJA 4GL2A 2CNWA 2ZU6A 2NG1A 2QT0A 3B9PA 5B2ZA 4UJ5A 3EIEA 5DH9A 1XD2A 1E6CA 5JI3E 1KI9A 3L0OA 3C4JA 3A4MA 2CL0X 1QRAA 5UKDA 2XTZA 1VYTA 2VF8A 3OEHA 1BO6A 4Q1EA 2WAYA 4JLNA 1IY2A 4RJLA 3ICQB 1PUIA 3DVLA 1G3RA 4C30A 3KDSE 1MABA 3U44A 2A2ZA 3A4NA 3LXRA 3BK7A 4JZKA 4EFNA 2WKQA 2EYUA 1XJ0A 3R20A 4E22A 1ZMXA 4HUQB 4PO9A 4ZDJA 1XMVA 4HLUC 3PVSA 3TNFA 2ZSAA 3KJIA 2QE7D 4M1YA 2VP9A 1OIVA 5BQ5A 4YQFA 2GILA 3H0KA 4MKHA 3PUXA 4TQAA 2VTKA 2NMVA 1DTSA 3K0FB 4M53A 5DISB 1XNJA 1N6IA 3WNDA 1SKYE 2RB4A 1HT1E 4KCGA 5FOUA 5JJLA 1XEXB 4PC7A 2NGRA 2V8OA 4RSGA 1NMYA 3EWAA 4HZUB 3B1YA 4NHOA 3LBHA 3VR3A 1R0XA 3NH6A 1KSFX 1W4CA 2KSQA 4HLDA 1HE1C 3NBXX 4Q4AB 2EFHB 1DS6A 2ERXA 3TJZA 2ZRDA 5JJIA 1YU9A 1Q0UA 2ZETA 4LJ4A 4PPQA 4TZ0A 4UNSA 1OFIA 5H8WA 2P3SA 2BIFA 2PH1A 4G5GA 3VKWA 4GMDA 2BMJA 1DAGA 2G1JA 5C46F 1X86B 1GKIA 2MSCB 1RJ9B 5KPDA 1SHZA 1S2MA 1P2UA 1NP6A 2IA5A 3EPJA 3UIEA 4US2R 5KO2A 3RVBA 4AYXA 3GLIA 4JLPA 2QN6A 1NSTA 1FTNA 1W0JD 1U9IC 3FE2A 1H8HD 2V9PA 2WOJA 3CNLA 5P21A 1KO1A 3M0EA 3CM0A 1M34E 3WMEA 4JLVA 1P9WA 1Z2CA 4UXHA 2ECKA 2CNWD 2PT7A 3T35A 4U00A 1KAGA 5JRZA 1R5BA 3G0HA 1ZM3A 1EX7A 2JLVA 3KXLA 2WIAA 4TLEA 5EUQB 2IWHA 4KODA 4A4DA 1U8AA 2OBMA 2CEAA 1JI0A 2BDTA 2YOHA 1CXZA 1M74A 3EPHA 4JJKA 4DSUA 1VG8A 1JPJA 4JKIA 2OCBA 5LDDC 4A2PA 4F38A 4BFTA 2CL7X 2WWWA 2YWHA 8OHMA 1DELA 1Z2AA 2FSFA 1TQDA 1C4OA 2GF0A 1IBRA 3TAHA 4CEHB 2OFOA 3KZ1E 2I1VB 1XP8A 4OHZA 1E32A 2OAP1 2GZDA 3Q72A 4DIDA 1BMFA 2NZ8A 1P61B 2R9VA 5C18A 2ZRNA 4QJ3A 5FL7D 4LHXA 2GVZC 1Z3IX 3ADCA 2KJQA 4A8JB 2ZJYA 1KO4A 1FNNA 5FTJA 3B1XA 4PPFA 3W9YA 2QAGC 1E1QA 3T1VA 2CE2X 4B3CA 1B23P 4EDHA 2WJYA 2V6JA 2R65A 3MFYA 4WXRA 2B8WA 3OF5A 2HCBA 3T06B 2D7DA 2F55A 1N6RA 3CR7A 3OIVA 1G64A 4M9XA 2QMUA 1D2NA 1L4YA 5JZVA 4AYTA 2ZRMA 1N2CE 3Q8XB 3K0CA 3RS5A 1BOFA 1G3IA 1E79A 4KV9A 5FR1A 1E2JA 4MUBA 1LF5A 3MWYW 5FBQB 2N46A 2XOKA 3IO3A 5JEDA 1G18A 4KVGA 1VKJA 2DFTA 1X1RA 2FSHA 4HZUA 3I8XA 1Q3TA 3LW8A 4V02A 3CF2A 3U7GA 3IPYA 1NF3A 3QBTA 2WJVA 1IONA 4Q4AA 3TSOA 4DLYA 2N1BA 1II9A 2REXB 4DCNA 4KI0A 1E0KA 2ODEA 2ZRAA 3FPAA 4L9WA 1DG3A 4Q9IA 2P6UA 1QHGA 1Q20A 3BE4A 4I1OA 4BECA 1RJ9A 2CHGA 3SEAA 4Q9HA 5H70A 3PUYA 1GRQA 4V0OA 5HCNA 3CX8A 3V00A 4RFVA 1NY5A 1KOFA 1RYFA 4DSOA 4XWAA 1R0WA 5DI9A 1XTKA 2Q0HA 2Z4RA 4LHZA 4A36A 4E07A 4FMCB 5DIFA 3CF0A 2IYLD 4PC3A 1KJWA 3FFAA 1JR3A 3SQWA 3A8TA 2Z83A 1GIAA 4NU0A 5F98A 1OE0A 5J4VA 2BM0A 3QSYA 3K53A 4YMUA 3W6OA 1S1MA 4EIWA 4QM7A 4FD2A 2ZRPA 3K70C 3C5CA 3UATA 4POAA 2IYUA 2ZR9A 2BHRA 2XNDD 3CRMA 3RS7A 4DEXA 2VHQA 4Q7KA 2J0VA 1DE0A 1K6MA 3B13B 4ZV4A 2V7QA 4DCVA 1S3GA 3QQ5A 2GWHA 4WOPA 1ZNWA 5FOWA 2VP4A 4OQMA 5DYIA 4GOJA 4Z1MD 3MUFA 4H1UA 3PENA 3NC0C 4CEHA 4M1SA 3EC1A 5EQTA 2VH5R 1IHUA 1C9KA 1E2IA 2YC2C 1KYIA 5DYGA 2QGZA 2GEDA 1MO4A 2JLRA 3K0SA 4PZLA 2R44A 1P4SA 3QG1A 3RSLA 2QQEA 4A8JA 4N1AA 2YZ2A 3DPUA 4BGDA 4PC1A 5IHPA 4G0NA 1UKZA 5DN6D 5JHGB 4P0TA 3J81k 4Q9KA 1TU4A 1VYUA 4JYCA 3LVQE 1E79D 1D9XA 4AK9A 2ZJ2A 4C2UA 1S96A 1W47A 2NZJA 3X2SA 3B8HA 3QKSB 1WXQA 5CIWA 2AKAB 2XAUA 4KXFB 4E5UA 5FTMA 1IJEA 3VNVA 2H8KA 1HTWA 1TTTA 3MWKA 3JZAA 4TL9A 1RC8A 3TQCA 3TSWA 3ASYA 4D2IA 1TMKA 3FB4A 1VTKA 2AK3A 4PAMA 4LBZA 1NI3A 4JLMA 4AKEA 1RFLA 4H1VA 1HH4A 3ETLA 3OFND 3THXB 3EZ7A 3H4MA 1KO8A 3B6EA 1BIFA 5JRJA 3I5XA 1WBDA 2ZE8A 2QTVB 3QPWA 4D82A 3EA5A 4BLRA 1IY0A 5FPTA 4N0EA 4Q4HB 1XXHB 2WWIA 5K8UA 2D2EA 4IFBA 1OH8A 4ZIRB 4AKHA 1OF1A 4CEIA 1R0ZA 2ZSBA 3F3YA 2CDNA 1NKTA 2EWVA 1TF7A 4ACAA 3I5YA 3SHFA 2P5SA 4D4MA 4DSNA 3IEVA 2Y8EA 2ZRHA 3IEUA 1K5GA 2R6FA 4IOKA 4JVSB 2PBRA 1W2GA 1S9DA 1JJ7A 4IEEA 4LJ7A 1JQJC 3Q9LA 4MYCA 4BEJA 1ONBA 5FH9A 1II0A 4TL7A 1G20E 2B92A 3C15C 3GLGE 5KUTA 2Z0MA 3DMDA 4PSAA 4JJZA 3VFDA 3SJBA 4Q5IA 3SOPA 3T61A 1QZXA 2ZJZA 2ZRLA 3LLMA 3SYKA 2H18A 3FHOA 2A9KA 4QJ4A 1E1RA 2XTMA 3QOFA 2PT5A 3NBZC 2CCGA 2XB2A 3FOZA 1YR6A 2AWNA 4AKIA 4YONB 3K1JA 2Z4SA 1XPRA 3LA6A 4E03A 3C41J 2H16A 2BC9A 3C5HA 4LJ6A 4AURA 1P73A 4QHSA 1VIAA 4HSEA 1UKYA 3AP3A 4OHWA 4NTZA 5KNCA 1AS0A 1M8PA 3K0AB 2E9SA 1SGWA 3ZGXA 1W2HA 3FTQA 3DZ8A 4Q7MB 4DDVA 1E2MA 4O25A 1TNDA 5G3ZA 3CF6R 3BERA 3VHLB 2I3BA 1KY2A 1VG0B 4W5WA 3LDAA 2ERYA 1LS1A 1GITA 2E1RA 5EE3A 3MLEA 4M1MA 4U5XA 2G83A 1CRQA 3OAAD 2R6AA 1NVUQ 1TF2A 1QHYA 4WXPA 1KDPA 5E7MA 2YOFA 5FOVA 1U0LA 5EXSA 3KJEA 2WZQA 2EYQA 1J70A 3LBNA 4A0FA 3ADBA 3N2EA 4LDJA 1XX6A 4B3XA 1E9CA 2BKEA 2FFBA 4MITA 1E2KA 2QEQA 4M0LA 3ZIAA 5C1BA 4MYTA 3V4FA 2PLRA 2C99A 1OSNA 3W8RA 4QGAA 3IIMA 2KBEA 1W36C 1J2JA 3THXA 2GAAA 2D4HA 4PHGA 5E7JA 1NMXA 2IS4A 1GRRA 1GWNA 4LGMA 2GEUA 1NN1A 3FGNA 3ZS9A 1EFTA 4URYR 3ZYCA 4BASA 3GJ7A 4Q4HA 3WMGA 5FOTA 2X2EA 5BYKA 1GDDA 1YR7A 1OT3A 1Z6AA 1M6NA 5HKKA 1XXHA 1VHTA 3ZQ6A 1LY1A 4DJTA 1VCNA 2IHYA 2ZS9A 3D7MA 1OLOA 2WPDA 4YMSA 4LJAA 2QBYB 4MDFA 2A5GA 1SVOA 2FE4A 2J45A 1E4VA 2OILA 3B1VA 4Q4JB 1VG9B 3RYTC 3ZD6A 4D4JA 3I1FA 4NYMR 521PA 1KI6A 1OH5A 1S3SA 1RRPA 3HU3A 4URVR 1BH2A 4W9MC 2LKDA 1CP2A 3U3KA 1OYWA 4ASUA 1P9RA 3TW8B 3VQTA 2FN4A 2ZREA 2QY9A 2ZI5A 4JBXA 3IUYA 4B2IA 5GJWC 1OXTA 4A8JC 3RABA 3P1JA 5L3SB 1OFHA 4Z8YA 1KZGB 3PXGA 4GDFA 2XX3A 1XZPA 1UDWA 2J46A 2JJ1A 4NYJR 3LV8A 4OYHA 4RD6A 1NJFA 1MT0A 4BFVA 1R6BX 4EFLA 4Z51A 4BFUA 4TYWA 1CTQA 3C8UA 3P4XA 2F1RA 2OUKA 2IW3A 1NVXQ 1Z47A 4TWZA 4DEYA 4NH0A 3UMFA 1GKUB 3WRXC 4MDEA 2Z5FA 2IK8A 3X1DA 3V4RA 5JFGA 1E3MA 2Q3MA 1F2TB 1TUEA 3BORA 3LWNA 3E1SA 4TYNA 2O52A 3A1SA 3T15A 2DYKA 4IDPA 2WICA 1NVVR 4XH9B 3WXMA 1VCIA 2XZLA 3K0AA 4LI0A 4DT1B 4MH0R 2IYSA 2WMNB 3U7FB 3L8YA 5IF9A 1DOAA 3CPEA 3WHLA 2IUSA 3RS3A 4CT5A 2IS2A 5DI3B 2FX3A 1QHSA 4OI4A 4ZDIA 1V5WA 1XWIA 3QY0A 1XMSA 3GLIE 1ZNYA 3KKMA 1QVRA 4KLZA 5AJVB 1TADA 3KJHA 1YR9A 2B21A 1EFRA 4QFMA 4DXAA 3GP8A 3IPXA 1ETUA 1XD2B 4NZYA 4QNRA 1D2EA 5DHAA 2QROA 3TBKA 1T9HA 1DAKA 1TX4B 1CIPA 1QHXA 2AD5A 5GADl 2V1UA 1GAJA 1YE8A 2GDJA 3P4YA 4PQFA 5EXPA 3RHFA 4AC9A 2WTUA 2IL1A 1XJQA 1RIFA 1IAQA 1UEJA 2ZSDA 3QNUA 2BJWA 2SHKA 1T3SA 1MABB 2JLWA 5AUQA 5FPHA 3W3ZB 1GNQA 3OEED 4TL6A 4YLGA 1YZKA 1T0JB 1QG4A 3L0PA 2WWYA 1E98A 3A1WA 1NBMD 4FCVA 4QC2A 4QGFA 3D31A 1Y63A 2A3RA 2Z6VA 2VSOA 5CK4A 2NIPA 1Z22A 3B5JA 1XFAA 3U60B 4JL6A 4TQUS 2FZLA 1PVOA 4CEJA 1UPTA 3CZPA 3D6TB 1XCMA 1O87A 4Q4JA 2WMOB 1CF4A 1JB1A 2JJ2D 1Z06A 3EXAA 5AJYA 2W0SA 2CLSA 5JS7A 1OB2A 2AR7A 2QE7A 4JVMA 5SZJA 3IKJA 2EFCB 3K9HA 2PL3A 1S9HA 5LB2A 4B3FX 4RY2A 5TB5A 3CH5A 2RAPA 2W0MA 2UZIR 4US0R 3GPLA 3AKCA 1YZQA 4UNQA 1U98A 2ZRJA 1YQTA 1S1CA 3B1WA 4A2QA 4QKQA 1TEXA 4WVFA 4RFSB 4HB2A 6Q21A 3TH5A 4ERNA 3HU2A 4JT2A 1ZCAA 2YVUA 3I72A 4B44A 4RKEA
chains in the Genus database with same CATH superfamily
2WBLC 4D96A 1YIDA 4C4TA 3KJGA 2FRDC 1SCUA 2P9JA 1GU7A 4IH1A 4ZYWA 3IXBA 1XIVA 3CQ9A 3GEBA 2PBLA 4YRTA 5I94A 4HAZA 2BI7A 2Q6TA 5DI3A 4F9GA 3RFTA 2O9BA 3DTVD 1PNRA 3JD1A 4M1WA 1NXWA 1T5LA 1KVRA 2IX3A 2FFJA 1Q12A 2C4KA 1JR3E 5FADA 4JB2A 3TQFA 4BTLA 4YUAA 3WSTA 1Z7EA 1AHPA 1STOA 3E2IA 4ZTKA 4JYPA 4DPLA 5D6OA 1PK9A 2VT3A 1U7HA 2CDAA 4Q02A 5J4YA 1GPWB 4OLAA 1MAWA 4LC1A 4G8DA 1JALA 1PGNA 4PRKA 4QRHA 2IZ7A 4CCYB 4E21A 3S99A 3VUEA 4B4OA 2BEWA 2QD3A 2GA9A 4HNQA 3ZVNA 2QYBA 2ID4A 3VPXA 3TI9A 7YASA 2IPMA 1ES3A 1V8FA 5A9TA 3R4CA 1G7TA 3V3KA 1JQDA 2D6FA 1SXGA 3ZXIA 1YULA 1C0KA 1TA9A 3BRSA 1UDRA 5EE0A 4IQ8A 2HA0A 4QQKA 3AILA 1U0RA 4RA9B 1JFVA 1EWYA 3CZRA 1DGQA 3FNHA 1WXEA 4QOJA 1GL7A 2JFWA 3GZTB 3I04M 4MP8A 2Q27A 4GM0A 3GY0A 3U2QA 4JXGA 4H7JA 4LCEA 2QR3A 4JGPA 4QTUB 4FOSA 1PV1A 5LP6A 3G6KA 1KOJA 5KWVA 2A30A 5IJ0B 1WXHA 2J9PA 1AWIA 2LWIA 3GIDA 1P2BA 5DN6A 2IYZA 4R3WA 5CM9C 4ZODA 1X7YB 3F0TA 3M1IA 3DTYA 4G3VA 4YRKA 5A04A 4LZLA 4WL9A 2BMAA 4RPKA 2FCRA 1E2EA 1JTGA 2C6WB 3NBFA 3NU1A 4Z5XA 1VJDA 2JZNA 3GRPA 3BMCA 2FW0A 4WZ6A 1D4AA 4GOXA 3JYHA 3I0ZA 4NZMA 4DVGA 2OQ2A 4Q18A 3OZHA 1CUSA 1TK2A 4ME6A 5DWVA 1KGGA 1G17A 2IHVA 3QXJA 3BKWA 4J91A 5LIPA 2ZYIA 4TT8A 3OFJA 3DDNA 5F4ZA 5E7QA 4UBIA 4AZ3A 1G5FA 3DC2A 4UNPA 3CW8X 1N5IA 3ZTYA 1RR6A 3GVPA 3MUEA 5FUYA 3HWX1 4DBVO 3C7AA 2X9GA 3IP3A 2RGEA 2OG1A 2ZYWX 1AZLA 5IKPA 3ADPA 2B95A 1ML4A 2EDCA 4ID4A 4RTPA 1XCOA 1PZPA 4OP8A 2XV1A 4M9CA 3NH9A 1KYTA 1M8GA 5BYJA 1FVOA 4PXAA 4LBWA 1OXSC 3CWCA 3QE0A 2O2EA 1DDOA 4Y2HA 1KI3A 1F20A 2J3EA 3T7TA 5D84A 1GGNA 1L4GA 5CRFA 1GR0A 1NMSA 2GN8A 4A5SA 2K6GA 2VYND 4QVKA 3OU6A 2PUWA 3SZOA 4WBGA 1CQIA 1JSZA 1MFZA 2OLEA 4JI2B 3RWMB 3A4IA 2GT1A 3FVRA 5DTSA 2WUQA 5TE9A 3QTLA 3K6KA 3IOEA 1QQTA 2JW5A 4L16A 2OD2A 1OH6A 3NWJA 4IH9A 1AKWA 1BRTA 1CD5A 2GK7A 3DWIA 3J7TA 3GDOA 2Y1GA 4OATA 4DY4A 5KNDH 2V7GA 1EAMA 4FR5A 1M2JA 1O9HA 4RF2A 5A0VA 4P3PA 2J3TC 4KZKA 1H4VB 3G8CA 4WCVA 4BMZA 3U13A 2VP6A 2X23A 1YBAA 5LN1A 3RRMA 2HOQA 1MVLA 4P92A 1T3ZA 1ZISA 1DWUA 3NT5A 3RYHB 4YYZA 1D8TA 4MS1B 3I4LA 3SBDA 4R0NA 1N2JA 5AM2A 4ESVA 1PQ4A 3HY3A 2XECA 3IT0A 5JG7A 2YICA 4K8RB 2ZRGA 4X93A 1SUBA 2PJRA 2JRCA 1H2XA 4WEKA 3TG8A 3DLAA 5LYJB 4PX9A 4CFSA 4QWOA 1QH8B 5TQ0A 3OEEA 2HJ9C 1CUDA 2DHRA 4N9QA 2O2IA 5IWCA 3NR2A 4CQHA 3GEEA 4BX9A 1TD1A 4PEVA 2E82A 3NKLA 4P3OA 4GM4A 2PBYA 3ECSA 3FYUB 3CUWA 4TV9F 4B3GA 2NQTA 1KEPA 2J8YA 2JKZA 3RSSA 3ZD7A 1UDCA 4PBTA 2E4AA 3PUJA 1R0BA 1CNFA 1QHIA 3V4SA 3T5GA 1WSAA 2VJDA 5AKKA 5TR9A 1JVNA 2CLFB 2VF7A 5I9IA 1L5OA 2O6LA 2XMQA 2CYCA 4RV4A 4OMUA 2VUTA 3IAAA 1W52X 4D56A 1JG6A 5IUKC 1MNQA 5C3UA 2XDAA 1O1YA 2R8YA 1TEVA 3DOOA 3IB6A 4WBXC 3PIDA 3OSZA 2ZAMA 3HABA 4AP9A 4G26A 5FP0A 2HCTA 4HXGA 3HLCA 1J9MA 2WV7A 4TKUB 5TPWB 3VJRA 2J7KA 1PJ2A 3AJ9A 2MHCA 5BV2P 2XVAA 2B82A 4MJ3A 1IE3A 4IL5A 1N6NA 3C3MA 3Q8MA 4E4RA 3AGEA 3ZXUB 4EX6A 1II8B 4LRQA 4ZKDA 4OEHA 3PNKA 4L4ZA 5IC5A 3EEAA 2YWGA 4NATA 3IMGA 3TZKA 4BV9A 5F83A 2OORC 3IP5A 4W5RA 1JPVA 5AK4A 4DCMA 5EHIA 3MXOA 3L7JA 3O8BA 1RQNA 4NPHA 4UU8A 2WK1A 2I54A 3BXHA 3MTIA 2OFWA 2J5XA 3IKTA 2HF6A 2B8JA 5JBIA 2HEGA 3B1KA 4OPMA 2PDRA 1E9FA 1USUA 4HAYA 4MIKA 2ZI7A 3SXUA 2BEJA 5FAOA 4O1MA 1E3UA 2SBTA 2WAEA 2FW6A 4MWBA 2A58A 1ZSNA 4I3IA 1EMDA 1BZYA 2ZJBA 4HYQA 4NJOA 4I9GA 1QXSA 3UAVA 2CUNA 3LDUA 1WU7A 4EU0A 5G4KB 4BVJA 1TIKA 3NBAA 1KZYC 1NC1A 3LQKA 5AKXA 1L5FA 5ICFA 2W27A 1S4RA 1TD9A 1CB0A 2P11A 2ZJ0A 1QE0A 2ZOIA 4GXRA 4B79A 1ECGA 1FDVA 3EXG1 2ZK7A 3FCXA 3FYSA 3S8MA 4OJKA 4I3GA 4HJ6A 1JQLB 1V9ZA 3UMVA 3RADC 2VCYA 4QE3A 1HSZA 4NXEA 1VA4A 3GH1A 1NQTA 4EHHA 3CS3A 5FQ9A 2YVQA 2I6SA 3Q98A 4DM4A 1GR1A 3VVMA 1E0JA 3HL9A 5CDFE 1NWCA 1Y9EA 3FG9A 1AKMA 3DOUA 2IY7A 4OQDA 1DJNA 5CUQA 4AG6A 1KY4A 2CVZA 3GJ4A 2PKWA 1QYDA 2BHLA 3AINA 1NR1A 1GYPA 4X6UA 3ZCUA 3E2LA 4C4PA 2ZUCA 3VISA 3EH2A 2D3WA 3IAS6 4FD3A 3W05A 1AHNA 4HF7A 1P0QA 2A0FA 4FWIB 3N70A 5DTKA 5EPHA 4HB0A 4IXWA 2RH5A 1YS6A 4Q3KA 3IVCA 1VETA 3ZE2B 4OMFG 4H3HB 4CM8A 2DPGA 4XD7A 4JK3A 1E2GA 2G4CA 5LQNA 4LJYA 3W1EA 1ZPDA 4BBJA 3FD8A 1OJ5A 1MAHA 1B2RA 1XB2A 5IASA 1I2WA 4X41A 3V80A 3QV1A 1PJTA 3T7AA 4BD0A 5KSCA 3WE7A 1XC7A 1IDN1 5CMLA 3TGPA 3ND9A 4W5JA 4DLPA 4JC8A 3UUWA 4IINA 2JGNA 1QHHA 1J1UA 1J33A 2H5JA 2ONKA 1TO1E 3U3JA 4B34A 2W6ZA 2H17A 4YO8A 3U48A 2UYQA 3WYGA 3BQ8A 4QX6A 1E8DA 4TMKA 5AVTA 1CRPA 4R8KA 4FJ1A 4GVXA 4IQGA 5CYGA 4MUNA 1VCOA 4RIEA 3HYLA 3JYQA 3OZFA 5ICMA 5BMVF 1VRVA 3VR2A 1GQRA 1L4HA 5CNJA 2H06A 5KVQA 3VHXB 1J23A 4NENB 1MF7A 1L5MA 2Y4AA 1XBTA 5FAKA 3VO8A 5BXYA 1LDYA 2FZ4A 3QEMB 2AA3A 4D3XA 1NKSA 1WZNA 5F51A 2HX1A 1E8NA 5D5QA 1YBMA 1B43A 4KG7A 2HCFA 3QI2A 1BLHA 2FSIA 3GPDG 4MVJD 4JIMA 4HH3A 3R3SA 4HQKA 2JN7A 1Y8CA 2BBOA 2LIPA 4BB5A 4XYLA 2E2WA 4BY9E 4RD2A 1FX0B 2YZGA 2JASA 2PAAA 1QMEA 2ZUSA 4LPKA 4PHCA 3R5HA 4G0PA 3AJDA 4JKYA 4UXJA 5EJFA 2ZC4B 1O3YA 3A11A 3N1UA 3AR9A 2D7JA 1VLJA 3EOBI 1GYQA 1FP1D 2JATA 3A25A 2RHJA 3IGFA 4TLMB 3BB1A 1O8CA 3KO6A 1XTUA 2D2VA 1SKOB 4U7PB 1UMDB 2WSSA 3IR5A 1NZJA 1BGXT 2QLLA 1LJUA 5CB0A 4RTNA 3VP1A 3ROKA 1XN1A 1Y54A 5AUPB 1HV8A 4URWR 4IIVA 4A1FA 3MINB 1KPGA 3QWAA 1Q7GA 3OIYA 3LP8A 2QMOA 4TN1A 1SVMA 2BFDB 3FWZA 4G1VA 4ZYTA 2GBPA 2OFXA 1WUHS 4UMEA 1IZYA 4B9AA 4DMRA 2PX3A 3P32A 3OWOA 4OHPA 2R6R1 2JIZA 5I9TA 4TXHA 4QBIA 4ER7A 4ICIA 5A06A 2PG3A 4IUKA 2YYSA 5J8XA 4OFZA 3IVXA 2ZQDA 4ZANA 2AF4C 1L4KA 5DF8A 3SR0A 2ZVDA 4LE2A 3A26A 3I6ZA 3P9CA 4LBVA 3T5PA 1FYVA 2A1UB 5LOVF 1OT6A 2OEPA 4ZDWA 2D59A 4CF3A 2MYPA 4KKVA 1V5IA 3WQHA 5DCLA 4HTAA 3AF6A 3CT4A 3EXG2 3IHTA 4E5YA 3K5HA 2OYRA 1BSGA 1I14A 1QG2A 4CMHA 3DEFA 3G2MA 2DWQA 4DQ0A 5E0OA 2FUNB 4M98A 2VGLS 3GZNA 1MO5A 1R12A 5ILOA 2ZI9A 2Q5FA 1OT5A 2ZTLA 1WUKS 4A15A 3D64A 3W06A 2GEFA 4HN9A 4JF6A 2OT3B 1WW3A 3ND6A 3HH8A 3P9NA 4KREA 3STWA 2VJNA 1PR4A 4HGNA 4NXNB 2YUTA 1Q0TA 1XLUA 2C1EA 2GZAA 3GJQA 4REMA 4LTDA 4OHXA 3H4IA 1N36B 4N7JA 2OV1A 5I48A 1FF9A 2H0QA 2NO5A 2QG6A 4E5SA 4CQLA 1AKEA 1RIIA 3WBBA 5KDLA 4C6RA 1XKLA 1O9BA 2ATCA 2XNSA 3COVA 1G38A 3U61B 3LTEA 3P7MA 3LPLA 2NG1A 2PGDA 3QVTA 1FDRA 2VATA 3EQ6A 3VPCA 3DUWA 3RKSA 3AFMA 3UC9A 4HI4A 2MR5A 2P68A 3E9RA 3BK7A 1P1RA 3UDFA 3CF4G 1QQAA 1MJGM 4OP3A 4JXZA 4EEXA 3DWEX 2WK0A 1QNFA 1AMUA 4FN4A 2X2OA 3FYTA 3JYOA 4YT4A 1ADFA 2J6BA 5C8VA 4M53A 4DDHA 3ROMA 4LTMA 1N2SA 1XEXB 4P4LA 3KUKA 1R0XA 5EGNA 2X9NA 4QFDA 3O9ZA 4DLLA 2PRFA 3VKHA 4UNSA 4EYEA 4YCJA 4LF9B 4QDXA 5BT9A 1JLMA 2JFBA 4O1HA 5ERXA 2H1IA 1MB0A 2YRXA 3P9KA 1X7ZA 4BYMA 2Q5IA 1X1QA 1FQWA 2OHGA 4CIWA 3O95A 1FSGA 5L7TA 4UXHA 2YVLA 3G0HA 1EP3B 4G56A 4CM7A 3NJAA 5T8KA 3FGZA 3JQBC 5K3DA 1AN9A 2O4CA 1Z2AA 3CG0A 2CT8A 1SBNE 5A6VA 2R9VA 1P61B 2Q5LA 5TF4A 2IIVA 2H11A 1CUVA 5E9WA 2D1FA 3HCFA 2JPDA 4B3CA 1R50A 4F3RA 1CSEE 2R65A 3N7WA 3E82A 3MFYA 1I2CA 4IZHA 1T0UA 1A9RA 2G80A 3EZGA 2GUGA 3WTBA 2ZRMA 2FN9A 3RS5A 4QTXA 1E79A 2FE1A 5FBQB 2XOEA 5K3OA 1R37A 4WCDA 4BLMA 5HW0A 3K5IA 3HDQA 2HREA 1E3IA 4NR0A 2WTEA 1NF3A 2WJVA 4RHXA 2BFFA 1QHGA 3E5NA 3DBAA 4F2GA 3CX8A 3V00A 1ZD4A 2IPNA 3B5EA 1ISGA 2C92A 5L6LB 3EVDA 1YGYA 2AW5A 4DV3B 4KYVA 5F98A 1RZVA 1EYZA 5JADA 3K31A 2V7QA 5JPDA 4GOJA 1RPTA 2GEDA 5EZYA 1CVLA 1JNUA 3DYBA 2ZR8A 3PJFA 3MXRA 1UAGA 2B1RA 5FI3A 1VPEA 2XKBA 5HWVA 2LCIA 4Y2GA 5FTMA 2HBZA 5E4YA 1XRSB 2UAGA 1KVTA 2XA2A 4AKEA 4HWOA 5KYXA 5C53B 4Y1GA 1IY0A 4CQMA 2X7JA 1KEUA 1CY2A 1MPTA 1XXHB 4G85A 3P9XA 1V37A 1UJ4A 2Y6UA 3GK3A 1UKCA 3BN3A 2ZSBA 3RC1A 1NKTA 1H3EA 1EI9A 4IOKA 3ZDBA 5BSEA 2R6FA 4BIIA 1JFFB 2X58A 2W6MA 3WLMA 5B7QA 1WHTA 4LJ7A 3HS3A 1KEWA 1JQJC 1WAMA 3MRVA 5I9SA 1V3QE 5LBTA 5E43A 2VPTA 2PFKA 3CVYA 2ZAYA 5F1OA 4CMKA 4MICA 4F9FA 2JFGA 1YR6A 2M7UA 1VI6A 5AHWA 1P73A 2DQ4A 2OVFA 3C8CA 5ARDA 4ROSA 1UZAA 1F17A 5CFRA 2HTEA 5FTWA 3D7RA 2QUAA 2QTGA 1E2MA 1D1TA 4O25A 5FQJA 1ZC2A 3TTWA 1YAJA 2C84A 3LHSA 3HJBA 2R6AA 1QHYA 2ZL1A 4M0DA 3FKWA 1E4EB 2XQJA 1Q95A 5F33A 1AKQA 1E9CA 3UICA 4EB0A 4MYTA 4QDUA 1H69A 3IIMA 2KBEA 2D4HA 4LGMA 1L8XA 1JEAA 5EIBD 3Q3EA 1OXKB 1S2NA 3EXHB 4YRAA 1XHLA 4MDFA 1CUZA 3PI7A 1UBLS 1G0NA 4FYPA 3I1FA 3ID6C 3OMXA 5E8JA 4CUZA 4OHCA 3EIXA 1D03A 4JBXA 1E7SA 2WF8A 3RABA 5KS2A 1SZJG 3RF6A 3UMJA 2R86A 1LPBB 4FPXA 4M4XA 4WZAA 3HFJA 3P4XA 4EK9A 3V1YA 1GA4A 2L69A 4CL3A 4A1OA 1Z47A 4RUKA 5EFZA 3U3XA 1L7QA 1E5LA 3RO7A 1KORA 3KHUA 4DT1B 2RGRA 2NUPC 4Y5FA 5DGDA 4CIXA 3HDGA 4ITVA 3CEMA 5HF9A 1T35A 3FNEA 2Y4NA 3F7TA 2DUWA 1E77A 3HO8A 3LLVA 3P9SA 3CIFA 1TX4B 3ESYA 1E5DA 3CLUD 4PRYA 2C8LA 1V0JA 3EGDC 3MBKA 1T0JB 4BJ6A 3F3MA 2QQ5A 1OX5A 5IAKA 2E4YA 4AAYA 1DT5A 3EXAA 4NU8X 1DQRA 3R5TA 3RASA 2JIPA 5LB2A 2Q1UA 2W0MA 4LGCA 2IU0A 4RF3A 2JHPA 4B17A 3WLKX 3I72A 4UM7A 3E8MA 4P86A 1UWCA 1DOZA 4M9UA 4EJMA 4GW9A 4LDQA 3QU9A 4HX9A 2GS9A 1K4KA 3D43A 1OLSB 1FDIA 1O94C 4D80A 4UUOA 2GBIA 3R0IA 1E96A 1J09A 4ZGBA 1PSWA 2D4AA 2YTZA 4R6LA 1Z7BA 5JR3A 3LT0A 3TZEA 1J8FA 2ZJ4A 3QVGA 4GDBA 4H9GA 4XLLA 4BNLA 4F5EA 4LCJA 4ZT3A 3O31A 3M6AA 4C6TA 1BXKA 1J22A 3AF0A 1G1MA 3W77A 1XTJA 1GSWA 2W0NA 5I7AA 4QYTA 5IYZB 3A4VA 2AFHA 3EG9B 3CX6A 1S0WA 1JX6A 1E6LA 1HDOA 3KDAA 4B6EA 2RGDA 2V54A 4IUBS 3RRFA 3ESBA 3LXUX 1MDBA 4KRXA 3SM3A 4E3IA 4J0HA 4BWVA 1I5OA 1TW2A 3D3QA 3O8OB 1M0TA 2WJIA 3PFCA 4IIXA 4XB6B 5D3MB 5BRJA 4EMTA 1G21E 1J8QA 5PGMA 3M1YA 4DLZA 1F4LA 3PNMA 2WNIA 3RK1A 2X0RA 3MZDA 4BKMA 4WZ5C 3VZBA 4HB4A 3NDJA 3QWHA 4C04A 1U0FA 3PXBA 2ZTSA 4ONEA 4O4HB 2QPLA 3HA3A 1E9BA 3ZI4A 1XD8A 1SM4A 1IZ9A 1LSXA 1PVVA 4HIAA 4TZ6A 1EFAA 4JOCA 4RF5A 2GBCA 4I5FA 2AGVA 2COUA 3WGNA 3OQPA 5KDDA 2ZE6A 1G3MA 4I3FA 1OTAA 1Z75A 2W2KB 3K9WA 5FQQA 3FLMA 2WJHA 4H8RA 3FNQA 3OFNA 5D86A 1YAXA 5DO9A 3O8RA 1YZ3A 4PG4A 5DW3A 1Y9ZA 3C6QA 3FNGA 1ZBDA 4AS1A 1PGPA 2R8RA 3DFUA 4B46A 4BBZA 1Z0SA 4UUBA 2ZSIA 4RA9A 3IF5A 2I72A 3ZWVA 3BXXA 2UVDA 3CE9A 3RH8B 4WXMA 3NANA 5BOSB 2N42A 4YI5A 1JFSA 1KAOA 4JXSA 5JNWA 1DKPA 1QF9A 3A6JA 4E15A 2ZPAA 5AOCA 2CVHA 4PICA 2PPLA 2BHTA 5LPNA 2FQXA 2WW8A 3CVXA 4L7VA 4ZEWA 1TJPB 2VYVA 5G0WA 1NBAA 5IJ0A 1XD9A 3HKDA 5HPYB 4L0QA 5AJWA 1MCZA 1SELA 1X7YA 3Q07A 3E84A 2JBHA 2Q5JA 5FWAA 1A95A 4OBBA 1H4SA 1X0XA 1DX6A 3AU9A 1ZA1A 5JCXA 1SXIA 4JGBA 4G8JA 4D6PA 2EFEB 4U4AA 1F51E 1HFJA 4EJSC 4YO7A 5F2EA 4UHJA 1T3LA 1X9IA 1J2YA 1IHPA 3K9LA 5DBGA 5KREA 1MV8A 3R6LA 1M5TA 3IERA 1XLVA 4GG1A 3C3XA 3V42A 3TRFA 3WS7A 4F1KA 3B3AA 3FOBA 1W0KD 5CJPA 3GLSA 5B1SA 4BNGA 3TXAA 3WRYA 2O8EB 3O4HA 5IS1A 3LM8A 1G2PA 1U9CA 1YI1A 1NUAA 3E9QA 3Q3GE 3F46A 3LQ4A 1B26A 3ZK9A 4KAXA 3STVA 4RETA 3KKNA 5CEBA 3BSFA 3KG2A 3T52A 4PLZA 4QELA 1OTBA 3G0GA 4E88A 2JCSA 5A4AA 4DEVA 4IXNA 4NJEA 1Q0PA 1NE2A 3SJCA 1HNNA 4DBZA 1A71A 3SOZA 4QDTA 4RORA 2NO0A 4OQGA 3TIIA 3Q10A 2AMVA 4GI1A 4XR4A 3M7IA 1KH3A 2PO5A 3WOHA 4F84A 1XTBA 1X3SA 3OEWA 1P5JA 2VK1A 4O4IB 1LXCA 3KLOA 4ZDKA 3U49A 1Z5ZA 4JUCA 1SG6A 3K4QA 4HRAA 4B5KA 3R23A 3QP8A 4IPTA 3FMPB 1A8QA 4MS1A 2PKYX 3UMMA 1T36B 3Q7PA 1LRKA 2CLLB 1EP2B 4EGCB 1DI0A 1XPBA 5CM2Z 3L7IA 4BVKA 4YCCA 3B78A 4D81A 1A9QA 3DZKA 4KZAA 5G18A 5LYJA 4X54A 1D1JA 4S1PA 3K6RA 1YS7A 4OL0A 3BE5A 5K0CA 4MP6A 1IWBB 4ZKEA 3P2EA 4GEGA 3ANYB 4XCXA 3F7OA 1DADA 1K56A 1N7IA 3IQWA 2XTAA 2GARA 4EHNA 2YYYA 1I2MA 5HARA 2FAXA 2I78A 1UK9A 1WVGA 2QP4A 1ES9A 1G8KA 2QN1A 1DEHA 1EBBA 3G9TA 1DBIA 1U0EA 3ZTWA 2PAVP 3VX4A 3ER6A 4JF4A 3I42A 2ZIXB 4QUIA 5DM0A 3ZVWA 4YV1A 4OQIA 2D8MA 4QSMA 5TJ9A 4GMKA 3GUZA 2BHNA 3CXUA 1DQZA 3CNEA 2OM6A 3PAEA 4HOYA 3FSJX 1RAGA 1E6MA 3L0BA 3N8HA 5D2CA 2DR0A 1PU2A 3TG9A 4FFRA 5TPWA 1UPUA 4WK4B 5EIWA 4FE3A 2BDEA 4RCYA 4AJ2A 1T1JA 5LU8A 3WKDA 1ZICA 4RDCA 1P91A 1UJMA 1II8A 5DVAA 5LYYA 4OI1A 5IXSA 1FXWA 1DB3A 1UOQA 5CA1F 4IAOA 1A4RA 2G17A 5HGJA 2ZM2A 1QLHA 3ZLTA 4YXWD 4LFBB 2UYOA 1Z83A 4MLDA 2XNCA 4QTYA 5AW3A 3LXXA 3OQMA 4GR5A 2HO4A 3NEPX 1FQGA 3EYAA 1U2RA 2TRSB 5AW7A 3DDWA 2OE2A 3WYDA 2ZSFA 4IEIA 2PUHA 2VEAA 4F8JA 1A5AB 1G6Q1 4WI1A 1S8OA 2NU6B 4HESA 3K0EA 5REQA 4MTLA 3ZN2A 4ZAZA 4LJ5A 4E32A 3LW7A 4P38A 1W5SA 1ACFA 4R9UC 3GJ3A 1L5HB 4RELA 3U40A 2QAJA 3M4NA 1MJGA 2GGSA 2PMCA 4B8YA 1DRVA 1SXPA 3DYVA 3DSRA 3DOEA 5K8IA 4S1OA 4XIFA 4X9XA 5HG0A 5G4KA 3BGVA 3LX6A 1UBCA 2FVYA 4G3WA 2O5VA 2AS0A 2G4LA 4OUDB 4FFPA 3OX4A 2G8NA 2LTAA 4FFBB 4MMNA 1T1SA 5FFFA 5KMWA 3RUIA 2EL9A 4FHGA 2PH3A 3U3DA 4C88A 5B6IA 1I10A 2H4WA 4YBRA 3CNQS 5BWLA 4MHTA 1JDBB 5IS2A 3VJMA 1E89A 5LUAA 2BM9A 1I2DA 4HQ0A 1ADYA 6LDHA 3C5WP 5KOYA 2WJWA 4WJKB 4FWTA 4Q39A 1I2BA 1K3TA 3RAEC 4WK0B 1OFUX 1YE3A 3M3HA 1M7BA 5EIOA 2PYDA 1XXMA 3A9CA 2IYVA 3A6PC 3NVKI 1E7WA 5CHUA 4BVAA 1YVDA 4UAGA 3MJQA 3VDQA 2OV8A 3OU7A 1DLJA 1FFYA 2ODAA 2BMFA 3I83A 2P65A 3WOVA 3FHTA 3M5PA 5CXQA 1ZSVA 2XRYA 1U0GA 5F68A 3RAPR 1N2CB 1TW3A 1VM1A 3M4JA 2CBXA 3AW8A 4ND4A 3HRHA 4R38A 2A1TS 1EFKA 1RRFA 4P5PA 1TF5A 2PRZA 4BNVA 3ZPXA 4LDZA 3EF0A 2AD1A 1J9ZA 3K05A 3GHYA 3GT0A 3I05A 3TQOA 3D0KA 1KYXA 1EJ0A 1AH2A 5HD3A 3QFHA 2CVOA 2RK3A 3F9IA 3A9WA 3I34X 2QN2A 5TV2A 5K8LA 1Y1QA 3ZE7A 3H5VA 3A05A 4M9ZA 2X4DA 3FUUA 4RTKA 4ZOLF 5IPFA 2PUVA 4M99A 4UD2A 3RWOA 5C2JB 3TVDA 2IEZA 2YNMD 4F46A 4KG6A 4DV0B 4J1QA 2PGLA 3OBIA 3I12A 1W44A 1KBQA 2B94A 3UV7A 1WJGA 4XYMA 2H9YA 4BYGA 2ZSEA 1WEHA 3I9MA 1TJYA 3T7CA 5BVGA 2C61A 3SF8B 4NZNA 4KQDA 1J4AA 3KPWA 1OBOA 3HZOA 4B8ZA 2FEKA 1T2NA 1OI2A 1GPNA 2AFIB 2XW6A 2PSHA 2FETA 1W93A 3EUWA 2VXBA 2GJ3A 3ORRA 3L1HA 3VHXA 2Y05A 1WKVA 3AONB 4BMVA 4R71A 2Q4DA 3TCXB 4YAGA 3HJGA 3QEMA 3WL3A 4AN1A 3AHEA 3PEWA 3GLGB 4Y30A 1QJCA 1VECA 4FGLA 1UJ2A 5DNCA 1BYIA 3VZDA 2VHTA 3LYHA 3V4PB 4IXMA 2JHGA 4RZSA 1TJNA 2VX8A 4OCZA 4R8VA 1M0WA 1KP3A 1S6RA 2QAGB 4JJ8A 1X80A 1FX0A 2HGSA 1Q1EA 3H1FA 1BAPA 4E3LA 1W34A 2HA5A 2BW0A 5FQMA 1QQ5A 3SLGA 4GLBA 1TAHA 2H48A 5LQSA 1U4OA 4C7KA 2GKOA 3CZDA 1M1NB 2NLOA 4BFZA 3MJHA 4OK3A 5IBRA 1NBEA 1SKOA 4PIMA 4V1CI 5KEIA 3T1HB 3MKFA 3PQCA 4CRWB 4JASB 4N7RA 3SGLA 4CIDA 3IA7A 4N5DA 3ZHCA 1ATZA 1AS3A 3H1BA 3MINA 1UF9A 4EQ1A 3JSXA 1T9ZA 4BTVA 1MFPA 5M18A 2C9CA 2E0IA 4E2XA 3LCUA 4A6EA 4QJGA 2OVBA 4BO2A 2VGKA 2GXAA 4QXPA 2A7XA 5C8YA 3IVRA 4GLOA 3EZ9A 3TTUA 1USVA 1U7ZA 1KZ1A 2I7DA 5K7SA 4KR2A 2I76A 4HLNA 1MHTA 1QPGA 4KQXA 3JQ9C 2A1UA 2O50A 2FMFA 3LRPA 2V3VA 1GTSA 1I0IA 4EPWA 3MG9A 4JJEA 5AIBA 4LZAA 5A9RA 4HEQA 1HURA 2IYYA 4B1FA 4MRMA 3WZ2A 1TVKB 2CNWA 4L9AA 4R2LA 1YF3A 1ID8A 1IQUA 4KUKA 3GQVA 5EHXA 3RIYA 3W0LB 1ZR2A 2Y0PA 5GTDA 3SSOA 3GJTA 4J0DA 3DVLA 1G3RA 5GZ3A 2P9TA 1SUFA 2J5BA 1ADGA 3A4NA 3OTOB 1V5EA 3GJZA 3EDYA 4G4GA 4TWRA 2HMYB 4NBLA 1YZVA 4UU0A 3OFSA 5DZSA 1H85A 1PW7A 1GN9A 2AJBA 2NM0A 4MUYA 3NKFA 1J2UA 2NZYA 5GY7A 3O3MB 3WJAA 3OM9A 1DOHA 5D7NA 3FUWA 2IU4A 4RXUA 1W4CA 4FR0A 4CLCB 3C3AA 1P1KA 4PPQA 3VKWA 5JAUA 1P2UA 4JHLA 3FZGA 4L9FA 3EOAI 2VT2A 3GF4A 3R2JA 1VKHA 2GPWA 1KFKB 3VOSA 2IPXA 1QIMA 3NBUA 4DV6B 1D6NA 3OCXA 3N8SA 3R44A 5CHYA 2D5BA 5DN9A 3BWYA 1JPJA 4F38A 3B70A 4AP5A 4ZZIA 2BUCA 3NJ8A 3X2EA 2PL9A 4X97A 5G4LA 1BVRA 1IVYA 3E98A 1N5MA 3CUEA 1QOZA 4PBRA 3GL9A 4Q7EA 1T25A 5H4GA 4NZOA 3RODA 1RBZA 2L2QA 3AXSA 4YCSA 4TSKA 5IABA 4CR6A 4W6ZA 2CY0A 3OIVA 4BB0A 3R7NA 2Z5VA 1L4YA 4NBRA 4RTJA 4POOA 3GRUA 1LF5A 3RJUA 2N46A 3E53A 3HUFA 5I4KA 4ETMA 4X69A 1E3QA 5DP1A 3PGKA 3HVKA 4KE9A 3LWBA 4OFWA 1WE4A 2CD7A 2Y79A 3FI0A 2SECE 2WGIA 2YJ6A 1LI4A 4MAFA 1N3LA 3SEQA 5T4HA 4GGMX 1YJAA 3SHVA 3CF0A 1VE9A 3UCEA 1OE0A 3H9BA 1TF1A 2EARA 2JKTM 3E3NA 1Y8AA 3HCEA 1O9GA 2BHRA 2KLHA 3AR2A 1VE3A 1ZNWA 2YIJA 1TC1A 5DVZA 2VH5R 1XL0A 5BSTA 4BNDA 3ANMA 1VL6A 3F78A 2B5RA 2N3ZA 5A62A 1ZJ4A 2KYRA 2JCXA 4YPFA 1XTZA 3BFJA 4E5UA 5B3AA 4K08A 5G1OA 2JI7A 5KKNB 3MWKA 1QTRA 2DQSA 4LFAB 3V39A 2AK3A 3LEQA 4EQIA 1GZ5A 1Z33A 4NCAA 4W4TA 1WCWA 4Q3NA 1E7RA 4P6VF 2QVYX 5K8UA 3SYMA 2ADOA 4MQEA 3C3WA 5K0TA 4OYRA 4P5DA 2P5SA 3IEVA 2QRGA 2PBRA 3V50A 5AVFA 1I6LA 1Z56C 1PGJA 2XUGA 1FSWA 4TL7A 4UDOA 3VFDA 4LWOA 2A9KA 1FLDA 4RJJA 1A5ZA 2Y8HA 3BE8A 3B38A 2JZOA 3RSHA 3DEZA 3PTAA 1BJRE 4LJ6A 1Y4ZA 4H3SA 4J6FA 5FA8A 4OHWA 3GVIA 1M8PA 1SUPA 1P6QA 1OWOA 1W2HA 3IX3A 4OLGA 3CF6R 2GK3A 5AOVA 1K4FA 4YCAA 5EE3A 3UOGA 5TF0A 1Y8QA 2EYQA 4W9NA 4XDGA 1OBFO 3FAKA 1XX6A 3K7EA 10MHA 4M1ZA 4RK1A 5E6RA 3KALA 4UBKA 3UHJA 2C99A 3C7VA 4Z4HA 1PX0A 1NMXA 2IS4A 2GEUA 2VNSA 1EFTA 3GAMA 4Y2JA 1Z16A 5AVYA 1XXHA 1M1YA 3V3RA 3D6UA 4O01A 3SH8A 4YQZA 1VMEA 2J45A 2QRLA 5KNBH 1GTMA 2P0YA 3OCCA 4LX8A 4EY3A 2HRZA 1DIBA 1SEVA 1QO9A 4K6GA 4Z4FA 3P1JA 4R1TA 4PM8A 2V20A 2JFYA 3PQ3A 2FHSA 4LXHA 2YN0A 1G5HA 3A2MA 4EGSA 1NJFA 1J39A 3ONDA 1EDOA 2F1RA 1Y3DE 3BCHA 2ET6A 3V7YA 1K86A 4C76A 2ZTVA 2WICA 5F3DA 1X7XB 1BH6A 1RS0A 4LS3A 2PV0A 3HLGA 2ZLBA 1DCFA 3NAGA 2YIDA 1XMSA 4QPDA 1PNVA 1FCNA 1NVFA 1E4EA 4NZYA 2C4HA 5CX7A 2AVXA 3KT8A 3T50A 2YY7A 4WNCA 3QHQA 3O3VA 3VR6H 3QLVA 4GXQA 1D5WA 3EXHA 3B5JA 3QH4A 3HBMA 2FZLA 1P97A 4IV8A 1UJ6A 1XCMA 2Q45A 1UZUA 5I7RA 4W5OA 2HBYA 5H80A 3L7DA 1JDPA 2WWVD 2RAPA 3UKOA 3GPLA 3WLPA 1XZKA 3FIJA 2VDJA 4JT2A 1P4HA 4RKEA 3AX6A 2QNRA 2WGWB 1RI2A 2I3AA 4DXDA 4Q05A 5A3VA 3MOIA 5A3RA 3T1OA 3QY9A 1MG5A 3EVEA 4LHYA 1ONNA 4DT1A 4FEEA 5TJJA 4C1BA 1H2BA 1M0EA 4YAKA 1RNLA 2Y2NA 1E66A 3TEFA 1VFNA 2YJNA 2HIMA 2WWFA 4Q9JA 5AXBA 1QFYA 4LX0A 3DLBA 4NQZA 4KQOA 1Y6FA 2P9ZA 5BW5A 1CYDA 3EY9A 1IZ8A 2XQKA 3DO5A 3ZGZA 2XBMA 1RHJA 2OBBA 4BQQA 5CEFA 2GOYA 4R1QA 1LD3A 4G8CA 1P5RA 1CNEA 2NSDA 1BKDR 2CV2A 3MGBA 3PUZA 1O95D 4WE3A 3KWJA 3RRBA 2C29D 3N0RA 1JAIA 3O3NB 1C9YA 3H9CA 2B02A 1K6EA 2XDQA 4DARA 4INAA 2FJ0A 5A7FA 4CN8A 4LRXC 4J0GA 1Q16A 4R68A 5TMEA 1NDQA 5FDHA 2Y1CA 3IMKA 1H1DA 1XQ9A 1DEOA 4AJ9A 1THMA 2O9JA 4A0HA 3PFNA 5C81A 2D5LA 3MILA 5JQGF 4L4YA 5NULA 3K8YA 4V38A 3T4TA 1N6PA 1YH3A 4FSDA 1TAQA 4A0SA 4IVPA 3HBJA 3KQWA 3ZV4A 4A8PA 4ZI7F 2PGNA 1Z7YA 1RYYA 4HWGA 2KHZA 4UE2A 1YUNA 1EUZA 4LYGA 5IYZA 3I2FA 4BGUA 1I9GA 1Z9BA 1NRXA 1KJNA 3UAYA 3FNIA 2B0JA 1HL3A 4YUYA 2IS6A 4AY3A 3BFGA 3LL4A 1AKUA 1Z26A 1ULUA 1RM3A 3JQGB 4GI3A 1HQKA 2E21A 4NFHA 4J6EA 3OCZA 3A1CA 4EZBA 3NBKA 5BVHB 3E15A 4RVFA 3HACA 4Y9SA 3D6FA 4HWRA 1UGUA 3LLUA 3GBVA 1Y3AA 3IXLA 4N5MA 1U31A 3RSQA 4MPJA 2IYNA 2R96A 4IW3B 4U02A 1HKUA 2NNLD 3O8OA 3RRYA 2OO3A 3N8LA 3O3CA 4HNHA 1VJ1A 2V7UA 2XB6A 2VQFB </