3JVVA

Crystal structure of p. aeruginosa pilt with bound amp-pcp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
342
structure length
331
Chain Sequence
b'MDITELLAFSAKQGASDLHLSAGLPPMIRVDGDVRRINLPPLEHKQVHALIYDIMNDKQRKDFEEFLETDFSFEVPGVARFRVNAFNQNRGAGAVFRTIPSKVLTMEELGMGEVFKRVSDVPRGLVLVTGPTGSGKSTTLAAMLDYLNNTKYHHILTIEDPIEFVHESKKCLVNQREVHRDTLGFSEALRSALREDPDIILVGEMRDLETIRLALTAAETGHLVFGTLHTTSAAKTIDRVVDVFPAEEKAMVRSMLSESLQSVISQTLIKKRVAAHEIMIGTPAIRNLIREDKVAQMYSAIQTGGSLGMQTLDMCLKGSRENAREKAKIPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Twitching mobility protein
publication title P. aeruginosa PilT structures with and without nucleotide reveal a dynamic type IV pilus retraction motor.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Atp binding protein
total genus 109
structure length 331
sequence length 342
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3jvvA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3jvvA02
4Q4HA 2ZJZA 3CLVA 4AYXA 1ZC3A 1XEXB 1W46A 1ZCAA 2OILA 3A4MA 3I3SR 2PCJA 4HAXA 4JVLA 1FQKA 2D7DA 1D2EA 2EFEB 2QY9A 5ANRB 2IYQA 3RSLA 3UPUA 4BFSA 2JIZA 4EJSA 2EFDB 4IDPA 1LFDB 1JI0A 5B58C 3ZH9B 3TVTA 2W6IA 2YYZA 4LYJA 1N0UA 1IN7A 2IK8A 2JDIA 2JLQA 5DISB 1NJFA 2LWIA 4BQSA 2B6HA 1X8KA 2ZJ5A 3ADDA 4EIWA 1OFUX 1WCV1 4ITRC 2FE4A 3KB2A 2ZE5A 3KJEA 3PG5A 2W2TA 3W90A 2PLRA 3ZVLA 2C04A 3OAAD 3ND8A 3RABA 2F9MA 4BFTA 2WJIA 4Z54A 3K0CA 4AC9A 1R5OA 2JJ2A 5IDVA 4L8GA 2VQSA 5HZKA 4XVUA 1F2TB 4LPSA 5CYOA 4AKGA 5E7IA 1II9A 1E9RA 2GKSA 3O8RA 4PHGA 1NBMA 3R20A 5SZKB 1VYVA 2ZRCA 2WJJA 1TADA 4MRPA 1XEWX 1JEEA 2ZRAA 4UQOA 2BDTA 3CB4A 3P27A 3WMFA 2N1BA 5FUWA 4CEIA 4K46A 2REXB 1T3HA 4ZV4A 4LJ9A 1FMJA 1XXHB 3NBXX 3NBZC 1HQYE 3AGQA 1II8B 2ZYTX 3A1UA 3D31A 2X8AA 4ON9A 3NXSA 2BM0A 2R6DA 3KFVA 3GLHA 2QTFA 2FGKA 1NN1A 3QPUA 4BPBA 5F9FA 1E0JA 1YR9A 4OHWA 4TMVA 4S2EA 3W5JA 4DWJA 5IT5A 3Q85A 4P4UA 3AKCA 2ASEA 4Q9LA 3LV8A 4Q9KA 3K09C 3EX7C 4AKEA 1KNXA 1Y3AA 4EPTA 4PC2A 4OHVA 2AD1A 2JGNA 5KPJA 2GCOA 4C2TA 3ECCA 2P6UA 1KO8A 2ZE8A 4JLBA 1U0LA 4A0GA 3AF2A 2A5FA 4E07A 1XJCA 3HDTA 3K09A 2W00A 2ZS7A 4BECA 1GG2A 3RSOA 5F2EA 3TW8B 2QP9X 2FSHA 1CR0A 1E4YA 1MO5A 2CLSA 2Y8EA 1RRGA 5D3QA 3SBDA 2WWWA 3KUDA 5AUPB 1Z0DA 4A8JB 1F6BA 3UXMA 4GOKA 2J45A 4Q7JB 5A4JA 4C9BA 4BGDA 4AKHA 5J5CA 4Q1FA 5KTYA 2JLWA 3X2SA 1HE1C 2V3CC 1P2UA 1AZTA 2R9VA 2GEUA 3L2OB 3TH5A 2C8VA 3EA5A 4TL7A 4P3YA 2IUUA 3R9XA 2R8RA 1RRFA 3K0AB 1UFQA 4EFMA 1G3IA 1PZNA 3ZVRA 1YZQA 4UNRA 1DO0A 4LOAA 2AFHE 2NO6A 3HR8A 3PEVA 4B43A 1JB1A 3L8ZA 5B2ZA 4B33A 3W3AA 1E9CA 5DIFA 3KL4A 4FMCB 5L8VA 4BFYA 4QJ4A 1HE8B 4Q47A 3D6TB 1I2DA 4R9UC 3OIYA 3AVUA 3U3JA 2OT3B 4ZI3A 3QVUA 2NOAA 1UADA 5C4MA 4PR0A 2O0HA 2QMOA 3PFIA 1A2BA 2ODEA 3QENA 2XXAB 5IK2A 1AS0A 4QJ5A 1WA5A 3T1OA 5KUTA 5F3WB 5JZVA 3K9LA 4EFNA 1CEEA 4IJMA 2MSCB 3VR6A 2F1IA 1YE8A 2FZ4A 1XBTA 2R6CA 2O52A 4D26A 1ZNXA 1GTVA 1U2RA 4MRVA 3SJCA 1W5TA 1XB2A 3IHLA 4KO8A 2FN4A 2W58A 3KTAB 4JL8A 3B1XA 1H8HA 3MCAA 4C0SA 2X19A 2R2AA 1TQ2A 2CK3D 4MGKR 2VSXA 3C5HA 5J40A 5J4YA 1ZP6A 2XNDA 1KI6B 2ZUDA 2B8TA 4RSGA 1F2TA 2IXEA 3BIFA 5LB4A 4ZI2A 4HB4A 2GWHA 5AJXA 2GJKA 5DGXA 5BYKA 1A7JA 1LY1A 2NQ2C 4DCTA 4MA4A 4OI4A 1TNDA 2ECKA 2XJ4A 1PLLA 3LBIA 1F3OA 3S1AB 4GBMA 4QHYA 4TWZA 4D0NA 2Q3MA 2JJ2D 2CHGA 3SYLA 2YKGA 1ZINA 2VP2A 4GP6A 1E0SA 1DS6A 4LI0A 4PAQA 4G3XA 2K5UA 2YV5A 4Q4AA 4WA7A 2RB4A 1AJEA 2QQEA 1IOZA 4P32A 1OFIA 3OEHA 1II8A 1ANKA 1VYUA 2W0MA 3FPAA 4IFEA 1SXJC 4KBGA 1RRCA 5FTJA 4C2UA 2DFLA 1Z06A 4C0LA 5KDDA 2ZPTX 4Q1BA 1B0UA 4WZ6A 3K70C 4LZZA 1G5RA 1CBUA 3TVDA 2ZJOA 4P33A 2A5JA 2YOHA 1IY0A 1R0WA 5KDLA 3SYNA 3THYB 1QHGA 1U98A 2BEJA 4A9AA 2A9KA 1SXJA 4O2RA 5E7MA 3DDCA 2EFGA 1XJ0A 3MMPA 3SOPA 3IIJA 4G5GA 4A92A 3HWSA 1KKMA 3BFXA 2AWOA 4OQMA 3NH6A 1OHHA 3CPEA 5KHOC 4DCUA 3QVVA 3GQBA 1AGRA 1R4AA 4G5RA 3QXHA 3VR3A 4ARZA 1D9ZA 5LPNA 1X1RA 3LDAA 4IOKA 3IDQA 1JQJC 3U44A 1HV8A 4JLAA 4HI0E 4Q4JA 1N5KA 4KVGA 2XITA 3CR7A 1TMKA 3SE0A 5DO9A 1N6IA 1W4BA 2AK2A 3MAAC 2CHQA 1J70A 2XTNA 4PZYA 4B71A 3NVAA 1G291 4G01B 4E5UA 1GL9B 3LXXA 2QROA 2ZEJA 1GVNB 4MGZR 4PO9A 4B34A 1UM8A 2OCBA 3DOFA 3PUYA 1OLOA 1XTJA 1MABA 1GM5A 4IKEA 1GKUB 4DKXA 2WIBA 1ZYUA 3K0AA 4G5OA 5H68A 2H16A 2JLXA 2FOLA 2AR7A 5LD2C 1AZSC 2J0UB 2ZRHA 2HJVA 1FUUA 1X86B 3BH6A 1TU4A 4LYAA 1GAJA 5IRCD 1B23P 3TQFA 1E4VA 3ZQ6A 1KTVA 3MWKA 3O47A 3M1IA 3THOA 2QM7A 5EP2A 3MRSA 4MYCA 2C9YA 3I73A 2HLDA 1NVXQ 1JQLB 1V43A 1Z83A 4NCHA 3B1ZA 3QBTA 2I1VB 2WPDD 3ZJYA 1E94E 4Z8YA 4NYJR 2JLZA 1QVRA 5KU1A 5FTNA 2OAP1 3KXIA 2C9OA 1F2UA 1JEDA 2G6BA 5D3MA 5G53C 1PV4A 1DAEA 3K0FB 4LY6A 2A5YB 1AQUA 1MO4A 2HV8A 3B60A 1KMHB 3VKWA 1SKQA 2RH5A 3KX2A 1P72A 1HH4A 4V0MA 4M21A 3T1QA 2QTHA 4K8OA 2QPOA 3FE2A 1L7VC 3AQ4A 1KI4A 3I5XA 1VDZA 4R2IA 4YXWA 3GJXC 4TMXA 5DH9A 2G77B 3QJYA 5B57C 4LC0A 1TPZA 3P26A 4KJZA 2JASA 5G41A 3DOEA 1BIFA 1S2MA 4HSEA 1G7SA 1M7BA 5DI9A 1Q1BA 4RZ2A 4BLPA 2OLJA 3EXAA 1E98A 3BFVA 4WIAA 4ZO4A 3T1TA 2QMHA 2ZRIA 4FINA 4HLCA 2IT1A 5CM9C 2OE2A 3WXMA 4C0BA 2WAXA 1W0JA 3NIBA 4XWAA 2YINC 3AF1A 1G18A 5KPDA 3OIUA 1SVIA 4D25A 1G1MA 2KB0A 4WXPA 3T06B 4DEXA 1EWRA 1FL9A 2BM1A 4ZDWA 4TSFA 3BORA 2H1LA 3OFND 4KFRA 3W34A 3B9PA 1S3SA 2OFOA 5TDHA 1K6MA 3QSYA 2IS1A 4RKEA 1IAQA 1XEWY 4GOXA 5CB8A 2FFAA 4PSVA 3ZS8A 2FZLA 1NF3A 4QJ3A 2J5XA 1FNNA 3IILA 3OEHD 2OG2A 1T0JB 1QZXA 1WE2A 2NG1A 1NG9A 1W5SA 3VNUA 1AM4D 2HT1A 1E0AA 3AVYA 2HUPA 3EZ9A 3F5FA 3ND9A 1NP6A 3A4LA 4OL0A 5HKKD 2W2XA 4PZLA 3V4FA 2JA1A 2H7VA 1XJQA 4BE7B 5L3SB 2NZJA 2PCLA 1E0KA 1X3SA 2IHBA 4M53A 5KOYA 2CHVA 3EPLA 1LTQA 1ZD8A 2OXRA 5JSZA 2BCGY 3KKPA 1OHHD 4TLDA 2QRZA 2WJVA 2XAUA 5K8IA 1A5TA 4NONA 4RZ3A 1VCIA 4B44A 4DIDA 1FTSA 2ZS8A 3GCGA 3O8BA 1X8LA 4B2LA 4C7OA 5A0FA 5FL3A 1CJUC 3RYTC 4FCTA 3OE7D 2ZVQX 4Q19A 1QHSA 1UPTA 1P4SA 2VSOA 1XPOA 2ZI3A 3F3YA 4TZ0A 1E9AA 1G3RA 3W6NA 5TY0A 3EIQA 3SJZA 5GJBA 1Z3IX 2X2EA 2WWIA 2XZLA 1WBDA 1NLFA 4IVRA 1ZW6A 1Z6TA 4C0AC 1DARA 3QKRB 2OZEA 5TV2A 1QVAA 4KLZA 3KQNA 2QMEA 3L0SA 4ZKEA 4HUTA 1ZUHA 5EE0A 1G5PA 2J7PA 2XB4A 4B2IA 1NBME 1EG7A 2D06A 1NI3A 4HYYA 2ATVA 4IOJA 3OZXA 5EXXA 4BZXA 1GL7A 1I4TD 1KI2A 1OIWA 2ZJ2A 3WNDA 5F9HA 1RW4A 2YC4C 5LBIA 2IEZA 1IY2A 1J7KA 2BKUA 4GFDA 1JNYA 1UKVY 3RWMB 1XTIA 1VG8A 4ASUA 4Z51A 2BC9A 4ZDJA 4XWOA 1OXTA 4TLEA 2WTUA 2CL7X 1G21E 5JWHA 2RKOA 1AS2A 1WXQA 1DTSA 3VKGA 2B7BA 3GLHE 3QXJA 5EE1A 2FDCA 1NVUQ 1NKTA 5HPYB 1LS6A 3CZPA 2BBTA 3AUXA 1T8TA 2BOVA 5K8LA 4HAVA 4YLGA 4JKIA 4RZXA 121PA 4Z8XA 3LQRA 2WWYA 1Z5ZA 3T5DA 1P7CA 3RRNA 1ZRHA 4Q00A 3CZQA 1WBBA 1R7RA 1XTSA 1N2CE 2P5TB 4YXWD 2E87A 3FHTA 3AKYA 5AJYA 1C1YA 3AKEA 3NHBA 4LBVA 4Y0VA 1M6NA 4IDQA 5IHPA 1ZIPA 4JJKA 4JIMA 3WRXC 4D6PA 2Z83A 2IWHA 3PXGA 3FMOB 3EPHA 2G1JA 4LJ5A 1N6NA 3P4XA 3TGPA 4Q1EA 1U8ZA 2IBMA 1MKYA 3AVPA 2GBLC 2OV2A 821PA 2WWHA 2RGEA 4JVSB 4ERNA 1FW6A 2OBNA 3OESA 2QE7D 2DWQA 4RKFA 3ETLA 4MRSA 5FPSA 2ZYUX 3H86A 4KXFB 3H1TA 1OKKD 2V6JA 2GBLA 1G8FA 2WV9A 3KXKA 1FTNA 1OYWA 3GLFA 1Y63A 1D8TA 2NO0A 3LRPA 4BLQA 4MGYR 2ZAMA 1S1CA 4PPGA 4KVAA 2ZSBA 2O8BB 3EASA 3PUWA 3VMFA 4O2LA 5DI3A 1P5ZB 5ELXA 2RGGA 4IOLA 3PQCA 5CIWA 2H5EA 2ZYWX 3UATA 3K1JA 2RGXA 1XRJA 3Q3JB 4L4UA 1W4CA 1CS4C 3TIFA 2WWGA 3QOFA 3KZ1E 1EFHA 1NKSA 4GZLA 4RD2A 1S0UA 4UKDA 1DG1G 2GTPA 3BC1A 2H18A 4UNSA 2I3BA 1QHIA 1EXMA 3RRZA 5JEEA 5BYJA 1U9IC 2ZRBA 3FFAA 1P2VA 4WW0A 2IYUA 2VH5R 4AK9A 3SR0A 1E1QD 4CEIB 2ZI7A 1NVVQ 2GILA 2ZRNA 1IONA 4JSTA 5J47A 2J59A 5FTMA 3U3RA 3CRVA 3LO5A 1JPNA 1R5BA 2OUKA 2ZRLA 4DLWA 4PFSA 4ILEA 4HAZA 1U9IA 2WAYA 3ICQB 2ZRGA 4KITB 2Q3HA 3GLHB 3LVQE 1QG2A 5DHAA 3SEAA 4UNNA 2H92A 1NN3A 3DHWC 2I1QA 1U0HC 4DLUA 1E2MA 2IHYA 2ZANA 3RRYA 4D0LB 1RJ9A 1N6RA 1ZUIA 5SZJA 3CKLA 1OH7A 1IQPA 1FP7A 1DAHA 3LFUA 4KYUA 2P3SA 5KSZA 4PZZA 2C2HA 2OM2A 4MYUA 3DKVA 3MWYW 5HTKA 1TQ4A 3VHXA 2X77A 4PX9A 2JATA 1I4DD 2EW1A 1X1SA 2GCOB 621PA 2OBMA 3I72A 2GCPA 1E9SA 2VHUA 4G0NA 4I1OA 3CRQA 2QAJA 5DN6D 2RHMA 4RD1A 4ZCIA 4LK2A 4ZDKA 3Q5EA 4O0MA 4G5SA 4DSOA 2QT0A 4P4SA 3ZVMA 5SZIA 2JLSA 4LHWA 1YR8A 1SXJE 4WZAE 3WP0A 1CR4A 4H9GA 1P2SA 5HZHA 1DAIA 3AF3A 3IBGA 4RCYA 3TSZA 5GJCA 4A2QA 5AJWA 4TTRA 3RRMA 2GXUA 1W7AA 4PC7A 1IHUA 2L0XA 1UDWA 3FFBA 1XD9A 2EU8A 2VF7A 4Q5IA 1CTQA 2XOKA 4X8MA 4URYR 2FSIA 3EZFA 5E7JA 4BFUA 4C3ZA 1OW3B 1KO5A 1W44A 3VX3A 4C0HA 1JJVA 2DFKB 3ONWA 4FW9A 2CVHA 2QN6A 3N2IA 4NYJQ 3UANA 5AUNB 4NMMA 1WDTA 3CPJB 1H8EA 2XSZA 2QU8A 4UXJA 2AXPA 1OXUA 3LNCA 4Z1MD 2JLYA 3QXCA 2DWOA 5AR1A 3RS2A 1DAGA 1IXZA 4WAUA 4IVQA 3ASZA 1VECA 2HF8A 4BLTA 3Q9LA 4URXR 2IF0A 4AD8A 4R71A 2WOOA 4DCSA 4HLUC 4BRWA 2DB3A 3NDPA 1HT2E 4A15A 4C4PA 3SFZA 1Q3HA 1U81A 1NIPA 3KXLA 3VNVA 2VP6A 5FPYA 1PUIA 5FBWB 3CO5A 3U3KA 1G41A 4JL5A 3KDSE 1TUEA 4TL9A 4Q66C 2V4ZA 4B76A 2O8BA 5DSZA 2WWXA 4HLUA 3ZZTA 2FFQA 4DSNA 4NCIA 1W1WA 4WVFA 1NVWQ 3NEJA 4HB2A 2ZIAA 2ZVPX 1AS3A 2F43B 5FI0B 1YZTA 1HTWA 4DDWA 3TK1A 3THWB 1QBKC 2QM8A 1T91A 4D80A 1DOAA 3ZIAD 1ZM3A 3OIVA 4IDHA 3ZLJA 4OJKA 1BYIA 4MDEA 3GEIA 4QOSA 1W36C 1TTTA 1E1RA 1SHKA 2F7SA 4OKSA 2J46A 3RAPR 4F91B 4I4LA 2W2VA 3BBPA 3D3QA 3NG1A 1TUIA 2QPTA 4JYBA 3LLMA 1G3MA 2Q21A 1VIYA 3SJBA 3LX5A 4IOMA 4M1KA 4Q4AB 2CXXA 5G3YA 4V0ME 4Q21A 4RD0A 2F9LA 1GSIA 4FMCF 1ZU4A 3PENA 2GDJA 2VL7A 1H65A 4I1UA 1G3UA 4BLSA 1PJRA 3X1ZA 2GA8A 4US0R 1GRRA 1W0KA 1KYIA 1A1VA 3ZZUA 1X8JA 4BEBA 4II7A 3IPXA 4URUR 3AH8A 2PZFA 3MJHA 1Q57A 2QA5A 1KZ7B 2WZQA 2YWEA 3D8BA 4HLQB 3U4QA 4CIDA 2W0SA 4MKGA 3R8FA 4HZUA 1SXJB 4GPTA 1MO3A 4X8HA 1W2GA 3I32A 2LKCA 1KKLA 4QBHA 4QNMA 2ANBA 1T6NA 5AK0A 3KJHA 3K70B 1Z2CA 1FOEB 2IL1A 3SQWA 1KJZA 4ARZB 3U7GA 2V7QA 2O0JA 3L0PA 1E2PA 3CF2A 2CE7A 3PVSA 5JRZA 3U44B 1MO6A 3C8UA 4P0TA 2ZUBA 4QHSA 4D4KA 3RC3A 3IQWA 4QGAA 4Q4JB 3OHMA 2GJ8A 2QAGC 2XX3A 4LJ8A 1G16A 2J0VA 2ZRJA 5GADl 1S4QA 2Z0MA 2DFNA 3GP8A 1VG1A 3PITA 1AGPA 4NYMQ 5EQTA 4B3CA 3GPLA 3REFA 2QMUA 4HB3A 3F0TA 2VHTA 1W4RA 5JI2E 1RE0A 2FG5A 3FHCB 4JL6A 3TNFA 2NTYC 1WP9A 4M4SA 4N0EA 3NWJA 3W8RA 1F5NA 2A5DA 3ZDQA 1Q1ZA 3A1TA 1MABB 2F3RA 3E2IA 3SFVA 4A36A 2IC5A 3VR1A 3NBYC 2PMKA 4DUGA 5CIQA 4UXHA 3PUVA 3GEHA 4NHOA 2ODBA 5KSYA 3SS8A 2I4IA 4EAQA 3I8XA 2PEZA 4UNQA 5TMPA 3SHFA 4TMWA 3SNHA 3E1SA 2KSQA 5LDDC 4ZCLA 5FR2A 1L4UA 1OE0A 5LD2B 1LW7A 1QDEA 4XWKA 4RFVA 2RCNA 3RLFA 5EZ6B 1KAGA 3RS4A 1Q22A 3QEJA 1Z07A 4M2LA 4AY2A 2J9RA 4K81B 4F4JA 4B47A 3L0IB 3V4RA 1IN4A 5D3MB 1F2UB 2JIZD 2OFXA 2IS4A 3M4YA 1DAFA 1E3MA 3K9NA 2W6ID 3FDIA 3FGNA 5BN4A 2H57A 4IW3B 1ZIOA 2JDID 1NMYA 2VHJA 3WHLA 1EFRA 3RWOA 3MD0A 3CBQA 1YZNA 2F43A 3CNNA 3AF0A 3Q7QA 4TYNA 1BS1A 1T5LA 1GRQA 3THWA 1JXMA 4PC3A 3KFXA 2XGJA 1JR3A 1K5DA 4LWZA 1Z0FA 3O8CA 2UKDA 4GT1A 4OBEA 1TF7A 3GLIE 1QHNA 4KFTA 4FD2A 1J2JA 3SN6A 1TEVA 4A0RA 1E2NA 1EFTA 3W5IA 4C0JA 2ZE7A 1L2TA 5EUMA 4NYIR 4Y0AA 4ACAA 1EX6A 4Q9IA 3T5GA 2ZXUA 4B75A 1TF2A 1ETUA 1NBMD 4KODA 4DLVA 2OXCA 1CR1A 3GJ8A 4CEJB 3UIEA 2QQ0A 2QGNA 3PUZA 2XB2A 3PEYA 1CXZA 3BXZA 2O5VA 4D2IA 4EPXA 1UBGA 2ZU0C 3LBNA 1MT0A 1FNMA 2CNWA 2BJWA 3ZVNA 2WM9B 3H84A 1G3QA 5BXQC 2ZSEA 1DBSA 2FA9A 4A2WA 1U99A 3N2EA 1S8FA 4RY2A 1NG1A 2J7KA 1CRQA 4V03A 1D5CA 4S35A 4JYCA 4JLDA 4TYYA 3TMKA 3VAAA 4TT3A 1HURA 3AP3A 3CWQA 1OFTA 2WVJA 4HLDA 4U5XA 5BN5A 1E2IA 2J87A 4IVPA 3CW2A 4WOPA 3ZS9A 2G88A 4IRUB 2OBLA 2PH1A 1CLUA 3LD9A 3Q7PA 4KCGA 4Q7MB 5FUXA 4F93B 1BOFA 5BQ5A 1YZUA 2JEOA 2GXSA 3VR2A 3A1VA 5H8WA 2JJ1A 4BZQA 2ZM5A 5JSZB 1RRPA 3ADKA 2C96A 4NBSA 3A6PC 5G40A 1UEJA 1ZUNB 4HUQA 4N1AA 2WJYA 1OJLA 1GNRA 2XTZA 2QPAA 3ZQJA 1JXOA 1L4YA 1XZQA 2FH5B 1HYQA 4HATA 1NMXA 3GEEA 1SVKA 4LX0A 4C7OB 3GJ3A 4JLVA 3QF7A 3DZDA 3RHFA 1Z22A 1G20E 1KK2A 2DR3A 1KMQA 3GLFE 3T1VA 1M74A 3RNLA 1EFCA 1KHTA 4RZUA 1KI9A 4PC6A 5TARA 4LHXA 1RKBA 1VYTA 1NY6A 2YJTD 2KJQA 1CJKC 2NGRA 5DLQC 4L15A 3ZZ0A 5AWFC 2OCPA 2R6FA 2MSDB 1LV7A 4F7WA 5IF9A 4KHZA 4DUGD 4KSBA 4AIIA 3A4NA 3BH7A 2ZYVX 1E79A 1SKYE 3FKQA 4NPHA 3LX8A 4JJZA 2D2EA 1XMJA 1T8UA 1OF1A 3I8SA 1GKYA 1GKIA 1S3GA 3Q8XB 3R8CA 3SYKA 3UKDA 3GLIB 3X1YA 3GFOA 2N42A 3TE6A 3KQKA 5FPTA 2ZI5A 2A30A 3OEEA 2QENA 4E09A 2QP3A 3VTKA 1XMSA 1KO4A 4DSTA 2ZS9A 4TTPA 3VR5A 4TN1A 4DB2A 3GMTA 1YU9A 5IK2D 1A82A 1BO6A 1BMFA 4LDJA 4YMWA 4ABYA 3QPWA 3AEZA 3DPUA 1OH5A 3ZYCA 3ADBA 1ONBA 1SVOA 2ERYA 1LB1B 2W83A 2FU5C 2VP5A 1P2TA 2IYVA 2VIIA 3A1SA 4US2R 1HEIA 4A0HA 1Q1EA 3B78A 1H8HD 1E2HA 3IO3A 3TSOA 1N5LA 5DYIA 5FBRB 4M1MA 5F98A 1W48A 5J4LA 2V54A 3THXB 3Q5DA 8OHMA 1KY2A 2XTMA 2ZR7A 4KYIB 1NMZA 2XNDD 4Q9HA 1T3SA 1OXSC 4RD4A 5L3QA 4ZIRA 2ERXA 3RC8A 1GITA 1KDRA 4OQNA 4QL3A 1XDBA 3GFPA 1P6XA 3BRWD 3UK6A 2ZSFA 4M9XA 1DAMA 4CEJA 3MUFA 2F3TA 5FI1B 1CJMA 1KDTA 1G7RA 2NO7A 1KSJA 5FBLB 2ZREA 1DO2A 3RANA 4NCJA 3WYFA 2VP9A 1C4OA 1G64A 1VTKA 2WSSA 1F48A 1U90A 4CDGA 4XVRA 2YWGA 4Q48A 2VHCA 3DKPA 3MGCA 2ZI4A 4ZCMA 1E6CA 2GHIA 2O8EA 1E2FA 2A3RA 2PX0A 2WWFA 3GLFB 5SZHB 4DLZA 3TAHA 3IUYA 4W7SA 1GNQA 3VHLB 4M1SA 3LY5A 2EYQA 2GK6A 1BKDR 2YC2C 1G8GA 1SXJD 3P1JA 1E2QA 2B21A 4LGMA 2NO9A 5DI3B 3K70D 3M0EA 3SHWA 5DNYB 2A7QA 4NCKA 1F60A 4E22A 1VIAA 1AA9A 2GJAA 1P73A 4EDHA 4X8LA 4MDFA 4B3BA 2FSFA 3QI2A 2P6NA 2ORWA 2PT7A 2PLFA 3G82C 4LJAA 5FL7A 4CF7A 2J1LA 5C18A 4ACBA 4RD6A 2QSZA 1KOFA 2GNOA 1SVWA 2IYYA 1SKYB 2ZRMA 3I61A 4F92B 3D7MA 2YVUA 2QBYA 2IW3A 2HXSA 3L82B 2J0QA 2DBYA 2IYXA 3EZ6A 3U7HB 2MMCA 3EA0A 5K8TA 1E2EA 1E99A 1RC8A 1NRJB 3LBHA 1OB2A 4DBLC 1UBCA 1KSGA 1GILA 4DT1A 2IX3A 2PBRA 2PJRA 4DLSA 5TXGA 3NH9A 4PO8A 4QBIA 3VR4A 4A6PA 4FXPA 4GSYA 4F38A 2YWFA 1HQCA 1SGWA 2AN9A 3N5CA 2FPLA 4IXMA 1RJ9B 1QRAA 2C98A 2BEKA 4D4LA 5K8UA 3LAWA 1NLYA 3CF0A 4G5QA 3GLIA 3CRRA 2WIAA 5AJZA 5FBVB 1FP6A 1NIJA 4R7ZA 2RGAA 4CZ2A 4BFVA 1R0ZA 3L0OA 2O8DA 1O87A 3ZD7A 1MH1A 2EQBA 2F6RA 2HLDD 3OIWA 2VHQA 3HR7A 4CEHB 2ZSAA 2C78A 4PSAA 1VKJA 2B7CA 2R62A 2W6JA 4TYQA 4BLRA 5FUVA 3RVBA 2IXFA 4C0KA 1Z63A 3HP1A 3UWKA 4D0GA 2NMVA 4GRAA 2WSMA 4V0NA 4AWXA 1S1MA 2VYFA 4OK6A 5KNDA 4C30A 1M2OB 5FOTA 3LW7A 1XD2A 4JZKA 4P4SB 2V1UA 3CUEF 4H1UA 2Q9AA 2C77A 1P9NA 4V0OA 5FOUA 1OXXK 2FPKA 4FMDF 1N6HA 4MRRA 3QQ5A 3JVUA 3LVRE 3THXA 1G8PA 1TQDA 1ZD1A 2FMXA 3C41J 3HU1A 4PQFA 1JPJA 5C46F 4YONB 2AKYA 4NL4H 2AK3A 4DDUA 1RVDA 1EGAA 2Q9CA 4GMXA 2AD5A 1XPUA 2D62A 1M8PA 4LBYA 2OCAA 4TMZA 2B8WA 1A4RA 3R7WB 5EE9A 3RS3A 2RGNC 2HDNB 5JHHB 4BFWA 2GETA 4LRWA 2GCNA 1UF9A 4FI3C 3B5JA 2V1XA 1Z0IA 2GAOA 2R6AA 1OSNA 4NDZA 3QPVA 3A1WA 4LV5B 4FCVA 4V02A 1IM2A 2WKPA 4PXAA 2SHKA 3B1YA 4TLAA 2REOA 4TQ9A 1W0JD 3DM9B 2H8KA 3IPYA 1XTRA 4I99A 1OB5A 3OF5A 3H0KA 2ORVA 3CONA 5FUYA 4URVR 5H70A 4BASA 4ZDIA 4MITA 3NC1C 1Q12A 3FMIA 1T3LA 4DB4A 2IYLD 4R2HA 3NEYA 4IHQA 2OHFA 1UBFA 4TLCA 4TSFD 1OH6A 4CYMA 4H1VA 2BJVA 3U5ZB 4GZMA 4G1UC 3AVOA 1GFIA 1Q44A 4BLOA 4JLPA 4DDTA 5J4KA 4LJ4A 1X6VA 4R98A 1YR6A 4LHZA 2IYTA 2G83A 2ORIA 3OAAA 2GESA 3MSXA 4WBSA 5JECA 4NYIQ 2GF9A 2RGDA 3W8NA 3KQHA 1D2NA 2WKRA 3GD7A 4LJYA 3EZ2A 4OK5A 3ADCA 3AP1A 1R0YA 1II0A 2DCUA 5M04A 1VG9B 3EARA 4GNKA 1YKSA 2JAQA 5CK4A 3UG6A 2X1VA 1CJTC 5B64A 3WBKA 1G6HA 5TB5A 4B73A 2QZ4A 3UMSA 3AM1A 1GNPA 2WMOB 1XMVA 3A58B 1ESMA 1KI8A 2AWNA 1DELA 2VP4A 2WBLC 2VBCA 3BAFA 2AX4A 3CRMA 4DZZA 4IDOA 3TR5A 2CVFA 4GOJA 4QG7A 3K0EA 3A8TA 4OQXA 3BS4A 1W36B 2IYWA 1OT3A 1FZQA 2ZRKA 2O8CA 2BIFA 1SQ5A 4LC1A 5JLJA 2ZRFA 5B30A 1N6OA 2HT6A 1JR3E 4JBWA 3U4QB 2GXAA 1FFHA 5AUQA 4HZUB 3LLUA 2OCYC 4TQAA 1HUQA 1ZM9A 1MR3F 3L43A 5JBQA 4PHFA 4JT4A 2JJ8A 1P9RA 5J4VA 1UDXA 1VHTA 3MWJA 4YDHB 4KLNA 4PPQA 1OIXA 4FCWA 4KI0A 1DPFA 3QBVA 2CMKA 4CEHA 3TRFA 3KB1A 2IYSA 1KGDA 2J7PD 5EP4A 4PAOA 4AG5A 5EJEA 1ZJ6A 2UZIR 3KKNA 1GIAA 4TZ6A 4MUAA 5EE3A 4MYHA 4OYHA 5FFMA 3WMEA 2Z5FA 1WB9A 1UKZA 4OI0A 1KDOA 1N0WA 2WMNB 4CRWB 5C2JB 2NZ8A 4LUCA 4OHXA 1KK0A 1P3JA 3CH4B 4NE2A 3V00A 1T9HA 2AHOA 3ZGXA 4ASUD 2P5SA 4B2PA 1FX0B 2QAGB 2OLKA 2OO7A 4M9QA 4A0FA 3LA6A 4ZPXA 4B3GA 2CLCX 4JMPA 3CNLA 1UEIA 2WICA 4JVNA 4QBFA 4LV6A 3WBJA 5CB6A 3B82A 1TL7C 5E95A 2FNAA 1Q21A 3B8HA 3TR0A 3QF4A 3FOZA 4LJ7A 4QHTA 2VPPA 3R7WA 2EWWA 2ODNA 3I4LA 2CBZA 3P32A 1U8AA 3R9WA 1XU4A 1Q1QA 2CJWA 2HCBA 3KQUA 4Q03A 1KI1A 3PCRB 3HPQA 721PA 2YNMA 4P4TA 4PHTA 1G19A 3KJIA 4M22A 1NL3A 5EXPA 4B74A 3TSWA 3EIEA 3H4MA 1YRAA 2D74A 4EJSC 4YMTA 2GXQA 3CM0A 2P0EA 5EP3A 1M34E 1Z0KA 3A37A 4JBXA 4PAMA 421PA 4NU0A 3TUIC 3BWDD 4DDVA 3IEUA 3M6AA 2BCJQ 1TU3A 4L5BA 5EXTA 2NPIA 1OXVA 3KJGA 3REGA 4RCZA 3QXSA 3K9HA 2LCFA 2PT5A 3KKOA 3C5CA 4HZIA 4DLYA 2GEVA 1L8QA 3QXXA 4TYWA 2P65A 2CK3A 5KO2A 1XTKA 4WZBE 1RYHA 3K0CC 1XCGB 3FB4A 4HDOB 3BK7A 1GRNA 2J41A 3EW9A 4B48A 1QHXA 5JJKA 4ESVA 3EZ7A 4CGZA 2VLIA 4QXAA 2NIPA 2P67A 4YDSA 4NZYA 1FPMA 3B1WA 4XIGS 4EPVA 4PPFA 3HU3A 5AUOB 3NTUA 2C9CA 4FWIB 2ONKA 6Q21A 2AFIE 3PIRA 3RS5A 3FKSA 2PZGA 1EFUA 2GAAA 2QGZA 5GVSA 1W49A 5KYKA 1I4LD 2G9NA 3IHWA 3ASYA 1JAIA 1QHHA 1Z6YA 2IF2A 2ZJ8A 1OH8A 2ZI9A 4PQYA 5CLQA 4EPWA 1GZSA 4M9SA 4Q02A 4XSHA 1R5NA 2BKEA 5EE5B 3EIHA 1E2GA 3QKSA 5JS7A 4YC7A 4ZKDA 3QG1A 1YQTA 2TMKA 2ZTSA 2Z4RA 1XZPA 4XD7A 2G3YA 5FOXA 4TQUS 1AKEA 4QFMA 1P61B 3B6EA 3G5UA 3T61A 2GVDC 2HYIC 5E3HA 2KI5A 1VCNA 3F8TA 4C0QC 5JEDA 2PX3A 5CYPA 3W9YA 4NH0A 1YRBA 1CKEA 1O3YA 4D4JA 1XP8A 3I1FA 4JLNA 4OI1A 3U7FB 2BWJA 4L16A 4L9SA 3AVVA 3PJRA 2F1HA 4W9MC 4D4MA 2RMKA 3VU9A 1IN5A 1DG3A 4NTZA 3AV0B 4QGGA 3NKVA 1IJFA 4UJ3A 4EQ6B 3IEVA 5JI3E 1T0HB 4M8NE 2E1RA 2OESA 3EWAA 2F1RA 1XEFA 5HCIA 2FEMA 4HUQB 2ZJBA 4W5WA 1Z6AA 4YQFA 1FX0A 1BH2A 1KI7A 4A4DA 1PUJA 2QAGA 2QTVB 3DMDA 4W5JA 4AG6A 5JMTA 4Q1DA 4WXRA 4A2PA 4PSKA 3NBFA 2PMDA 3FHOA 3TJZA 4LYHA 2CCGA 4DJTA 2QRNA 1AKYA 3HYTA 3K53A 4EKDA 3SU8A 2WHXA 3SI7A 2A2ZA 4PC1A 1XFAA 1ELOA 5A5GA 1PLJA 5FOVA 3RDPA 2DHRA 3VQTA 4I81A 3VFDA 2Z6VA 2EVWX 2DFTA 2XOKD 2C95A 3JVVA 1D6JA 3SQXA 3JZMA 2FX3A 4DVGA 1IJEA 1IXSB 1TF5A 1V5WA 1US8B 3MLEA 3TBKA 2A78A 1VG0B 5P21A 1XEXA 1IN8A 2REBA 1JBKA 3GFTA 1H8ED 2XSZD 1LS1A 2WPDA 4J0QA 4OI2A 4DSUA 4B35A 2JLUA 5TVKA 1UAAA 3ICEA 3FVQA 4LV8B 1ZVQA 2E9SA 1NN0A 1EESA 3BB3A 2CEAA 5EXSA 4BFZA 1YHNA 3NC0C 1WMSA 4B3XA 4BFXA 4IEEA 2ZU6A 5JS8A 4RFSB 3AVXA 2GEDA 3QEOA 2CL6X 4V0KA 4QM7A 2GF0A 1E9FA 3IO5A 5FPKA 3U2QA 1Q20A 3UMRA 4AYWA 3C15C 1E32A 1KSFX 1W47A 5JJLA 2MMGA 5BWMA 1FQJA 3WNBA 1SHZA 1SVMA 1LF5A 5C1BA 5CDFE 3LW8A 1Z6XA 3AP2A 4X8OA 4QRHA 3AB3A 3FMFA 4OHZA 3AVQA 3CH5A 1IXRC 4YMSA 1OV4A 2QNRA 3KKQA 4MGIR 4E03A 5L3QB 3JZAA 4ZIRB 2BBOA 4CVNA 5JWRA 4PPNA 2DY1A 4O25A 4US1R 1IBRA 1HA3A 1KZGB 3Q72A 2BBSA 4I1VA 3GJ4A 5FOSA 2VSFA 3UWOA 1OIVA 3X1XA 1E1RD 3K9GA 2EWVA 2ZUCA 3IGFA 4IDNA 1G17A 2PL3A 3AF4A 3QG5A 3HYRA 3IKJA 3U3OA 4M1TA 1XF9A 1ZC4A 2V8OA 4TL8A 1XMIA 3FKSD 2JCSA 3OFNA 4QNRA 1JJ7A 2GJSA 1PLKA 1ODFA 1W36D 1XXHA 3SZRA 3K8YA 1KSHA 4O3MA 2O8EB 1W0KD 2Z4SA 2C99A 3B2EA 1G7CA 3CWZA 3DM5A 4FN5A 4JT2A 1KO1A 3QKTA 4Q1AA 4MKFA 2PJZA 1LVGA 2PZEA 2VP0A 4M9ZA 3CF6R 2GRJA 1HY3A 1DE0A 4XD7D 3SDZA 5HKKA 2J0SA 3PR1A 2ZAOA 2GZHA 2BVNA 4A82A 1NVVR 1IN6A 1TX4B 4EQ6A 5DE3A 1KAOA 4Q9JA 4LHVA 2YOFA 2VEDA 1T4GA 3WHKA 5KNCA 1YVDA 3V9PA 3W3ZB 4OJQA 1DAKA 1S9DA 2YZ2A 2V7QD 1FMLA 3B9QA 4PHHA 4GL2A 2UZ3A 3IIMA 2GK7A 2YHSA 2KBEA 2Q0HA 5EUQB 4A8JC 1CF4A 1R0XA 2QBYB 2G0TA 2KWIA 2QT1A 1J8YF 3GJ7A 2KBFA 2D7CA 3X1DA 1E96A 3OE7A 2R44A 1MRNA 3CPHA 4FWTA 4JS0A 5BW8A 3BB1A 4A8JA 1D2MA 5KSOA 2XZPA 1K8RA 3WY9A 4DT1B 4UXIA 5L3VA 5JHGB 4QKQA 2AXNA 1E9BA 3QUSA 5JCPA 3GLGE 3P20A 3EWSA 3W6OA 3E70C 5E4FA 4IXNA 3E5HA 5CLLA 3BERA 3BFKA 2FJUA 1JAHA 3GJ6A 3CX8A 1US8A 4KFUA 3BD9A 2N46A 2V55B 5HCNA 1NNEA 2G0NA 1CIPA 2D3WA 1AQYA 4AI6A 2ODWA 2EFCB 2VF8A 2ZRPA 5KSPA 4D81A 2O8DB 3AVTA 1N6KA 1P60A 2HEIA 2FGJA 2NPFA 3CNOA 2IUTA 4Q7LA 1KK1A 2QG6A 3UMFA 1W2HA 1LNZA 1ZCBA 521PA 1MRSA 1COWA 3PUXA 4RFSA 1Z29A 4Q18A 3WP1B 4AURA 5JFGA 1G9XA 3CRW1 1OFHA 4KBFA 4GI7A 2XXAA 1MOZA 3ZD6A 4JKYA 1KIMA 1VPLA 4KAXA 2DYKA 1XD2B 2ZJAA 4P31A 1JALA 1ZU5A 5UKDA 4BWYA 2OEPA 1UKEA 1VCOA 2RAPA 4UNPA 1SVLA 4F4CA 1YR7A 1EFRD 3KTAA 2J3EA 2EFHB 3R9IA 4ESHA 5JWOA 2ONJA 1UBEA 1OYYA 1ZNZA 1G8YA 4QGFA 2R6GA 3I62A 4M1YA 1YJ5A 2OFWA 4OQFA 4PQRA 4DXAA 4DIEA 1JR3D 1KI6A 2CL0X 4NCNA 2CLDX 4KU4A 1XCPA 2F55A 4CT4B 1DEKA 2FFBA 4HEJA 2RGCA 3X1WA 3SJAA 5CM8B 4PTLA 2R65A 3EC1A 3S1AA 2FEOA 2IWRA 1ZBDA 4BRUA 5L3RA 1DADA 4DLXA 5FTKA 1E2DA 1HT1E 3WMGA 3CX6A 4M1OA 4AKIA 2HCJB 2JLVA 1CRPA 4JVMA 3WRYC 2PEYA 2HXYA 4TMTA 4URZR 2BMJA 2QE7A 2QP4A 2AKAB 2ANCA 1NSFA 3BB4A 3C4JA 3L8YA 4CW7A 1OKKA 3PV0A 3VKHA 4MYTA 3T12A 2CNWD 3AGPA 1YZLA 2ZETA 3WYGA 3B7GA 3THYA 1SULA 4JLMA 1G6OA 2VA8A 4GP7A 1CP2A 1GL6A 3LXRA 4BEJA 3I5YA 4LCBA 4QBGB 1ZNYA 4Q4LA 3GLGB 1R6BX 5CK5A 2OSBA 4LBZA 5C4GB 3W6PA 2XJ9A 3RS7A 1N6LA 2BMDA 1XTQA 3EPKA 4XVQA 4TT3D 1R8QA 2ZJYA 4EFLA 4DC9A 2FWRA 4KFSA 4A1FA 5FTLA 1Z8FA 4HDQB 4JLKA 3QKUA 2FFHA 3WYAA 3WNCA 1NJGA 2ZROA 4MUBA 2CCJA 3FYHA 4B32A 2JJ1D 1U8YA 1XWIA 1BYUA 1Z0JA 5FH9A 4LHYA 1G4AE 2V9PA 4XTRA 1E1QA 2VTKA 2HF9A 3DMNA 1ZNWA 1RPZA 1AK2A 1RYFA 4IEIA 2O8CB 2RGBA 1VCMA 1S9HA 1WF3A 1KI3A 3QY0A 4U7DA 2BV3A 1IY1A 1CULC 1TEXA 3PEWA 3PEUA 2AL7A 4MKHA 2V6IA 1E9DA 4OK3A 4RVCA 2QSYA 1KJWA 1TAGA 4OQLA 3KUCA 1NN5A 2VRWA 4FIDA 4NP6A 4DCNA 4Q1CA 4OHYA 4NKRA 5CDFA 5CITA 1N6PA 2GVZC 2JLRA 5CJPA 2UVQA 1Z0AA 2J0UA 3FMPB 4NYMR 4QGHA 3VX4A 2ZSDA 2BBWA 4IFBA 3KKMA 5HE9A 1Q0UA 3CX7A 4LPKA 3C7KA 3U61B 1E2LA 2GZAA 1J90A 2O8FB 1EK0A 4DCVA 1T5IA 2NO1A 3TQCA 3KQLA 1CR2A 4RJLA 1GP2A 1J8MF 5FPHA 1E79D 1ESNA 2YWHA 3EC2A 1JR6A 2C03A 5BN3A 4DEYA 1U94A 2GZDA 4HAYA 2QL6A 1G7TA 1RFLA 2FV8A 5DN6A 3UG7A 3TUJC 4EPYA 1SVSA 3U60B 3OEED 5DHFA 2O0KA 4LYFA 4D82A 3BH0A 5KDOA 4BZPA 3GJ0A 3AUYA 3TAUA 3MFYA 5JRJA 3K0FA 3QIAA 3IBYA 1YZGA 2YOGA 4QC2A 1COWD 5GVRA 1KMHA 1NSTA 4FMBB 4YMUA 2IS2A 1N5IA 1YZKA 2WKQA 1BMFD 3QE0A 1XX6A 3CR8A 2ZI6A 1M1YE 1NY5A 3DVLA 2LKDA 1Z08A 3HU2A 5EZ5A 2ZRDA 2WOJA 2B92A 3QF4B 4DLTA 4HDCA 5G3ZA 1Z28A 4JLOA 2C5LA 3QNUA 4M0LA 1XPRA 2IXGA 2CJWB 2IYZA 1WQ1R 3B13B 1P62B 3GJ5A 2QUZA 4GMDA 5CJ2A 4MRNA 4Z1MA 2XZOA 1KDPA 4TLBA 1QF9A 2EYUA 1UKYA 2Q3FA 2WJHA 4MH0R 4AYTA 5FR1A 1UJ2A 2RGNA 4Q4HB 1A2KC 3IIKA 4V0LA 4HAUA 4HB0A 1ZM4A 3LQQA 1G5TA 4I1SA 5GJVC 3EPJA 2MSEB 3B1VA 4N3NA 4EPRA 5HE8A 1ZAKA 1KJYA 2IYRA 1MV5A 1GDDA 4N0DA 2KE5A 4EJSB 4KV9A 3BJIC 4M1WA 3BGWA 1E2JA 2WSSD 3DO6A 1ZM7A 4XOIA 4U02A 4LJ6A 1Z2AA 3GLGA 4QM6A 5GJWC 2BMEA 4L9WA 3MG9A 4MKIA 3C16C 1KNQA 1Z47A 1SZPA 1PVOA 3B85A 3DZ8A 4TMKA 5DYGA 2ATXA 1J99A 2D2FA 3IQXA 2DPXA 3U7EB 2P6RA 1ZMXA 1LF0A 3HJNA 3DEFA 1N25A 2VO1A 2QI9C 3TUZC 1GOTA 4EUNA 4TYPA 3U3MA 3ZIAA 2QEQA 2ZE6A 3I92A 4XSGA 1E2KA 5L3SA 1CU1A 2ZR9A 2HYDA 3LH5A 1R10A 3H2YA 3SC3A 3EAQA 4B6FA 1FUKA 3T15A 1AIPA 3NHAA 2P2LA 4HAWA 3P4YA 5FL7D 4DLRA 4B3DA 1VHLA 4DRZA 2IA5A 3DL0A 4JBYA 5HR5A 1XD8A 1RZ3A 3EG5A 1XCMA 2CDNA 1QHHB 2QORA 1M7HA 4UJ5A 4LSGA 1U0JA 4PO1A 4KSCA 5J4HA 1Z6GA 2H17A 3QKSB 1KK3A 2CCKA 3FTQA 4MQBA 4B3FX 3O8DA 1R8SA 2Q9BA 4U00A 4URWR 5FOWA 5JCZA 3T34A 4FMDB 5AJVB 1RIFA 3MJRA 2Z43A 4YMVA 5JJIA 3NDBB 3TW4A 4F4IA 1VMAA 1ZD9A 2BMFA 3TLXA 2HJGA 1M7GA 1P9WA 4JLJA 2O8FA 1QHYA 3QKRA 1R2QA 1W4AA 3U6BA 3T35A 2XNSA 5LB2A 1ZM2A 1KO7A 4PANA 3U6KA 1EWQA 1D9XA 2D4HA 4B6EA 1DVRA 3VU9B 3A36A 1P75A 2BHRA 1N0VC 3LWNA 1XNJA 4XH9B 3BOSA 1WRBA 1QG4A 4XJXA 2ZITA 5FBQB 2F1JA 4W5HA 4XTCS 2Q6TA 2A5GA 2W6JD 3HPRA 3FWYA 2FF7A 3AKDA 4POAA 4GDFA 1EX7A 2ZR0A 1AN0A 4A6XA 1Q3TA 1S96A 1TQ6A 4DHEA 2ZQ5A 2IEYA 3K0SA 1XXHE 3CIOA 1G4UR 1GWNA 3AVWA 4BUJA 1KY3A 3BE4A 4TL6A 1JECA 2IUSA 1C9KA 2G1KA 4JSYA 5H1YA 3SBEA 1G8HA 4Q01A 1E69A 2DWPA 2FSGA 4CT5A 2FPMA 3C14C 1N3BA 2WJGA 3G0HA 2OAQ1 5EP1A 2GJ9A 3N70A 4RD3A 2RHDA 4Q7KA 4TTQA 3RS0A 1N5JA 3J81k 2CE2X 5KNBA 4LBWA 1I2MA 1OPXA 1K5GA 221PA 2XEXA 3TKLA 2X2FA 3MWLA 1NLZA 1E9EA 1GUAA 1CJVC 2IS6A
chains in the Genus database with same CATH superfamily
1XNRB 4DNOA 2OILA 1XEXB 4OOEA 3CTMA 4YRBA 5HHTA 2A0XA 3BIOA 5JUWA 1MB9A 4CKCB 2C4KA 1EZZA 1LFDB 1MT3A 3RAEC 4R9RA 5DM1A 3SSMA 2CYCA 2P11A 3EYAA 3ZD8A 3O86A 3AG6A 4DMUB 3O4IA 3TAXA 2YRFA 3AT1A 5EHXA 1ADBA 2ZE5A 1U3UA 5C3UA 5ALWA 4RYLA 4Z54A 3P45A 3MUOA 2XOEA 5JD4A 2FSPA 1NBMA 3WMRA 1SU7A 1O8CA 5IF3A 1QF6A 3UT5B 1W1IA 3P27A 3JW8A 3PT5A 3EODA 4KMMA 3MELA 4O4HA 1HQYE 3ETDA 4K7JA 1STOA 4M7WA 5TMDA 4NBVA 1NN1A 3QZUA 1VXRA 3A2NA 1NP3A 1BOOA 4MUKA 3FI0A 5FHRA 1KNXA 1U28A 1XKQA 4YUVA 1LK0A 2XVZA 2C2YA 5A2GA 2Y2OA 4IWYA 2HPAA 4BECA 3G6KA 3TW8B 1KQNA 1SKAA 2WWWA 3I9V1 1RE1A 2QZ6A 4U7HA 5KTYA 1YOBA 5AVFA 5AHWA 4CIYA 4U2CA 1AZTA 4TL7A 2DBZA 4XZ3A 4GI5A 1PYYA 3JWGA 3FZYA 3A2MA 2NU6A 4B33A 3OECA 1YRHA 4UDYX 5KYYB 2J6IA 5DKKA 4X00A 3AZOA 4HQKA 2R8YA 5EKXA 1A2BA 3QENA 5F3WB 3KKLA 3IPAA 1AC5A 2R6CA 3R40A 4KO8A 3HRKA 3IURA 1V9LA 3HDQA 3TSCA 1RPJA 1ZP6A 2EG9A 5ILOA 2ZUDA 2WFLB 1XAIA 2FUG6 2GJKA 2NQ2C 3WGKA 4ECAA 5T6BA 1PFLA 3GPIA 2K5UA 4Z6KA 1EQAA 2Z2KA 2DFLA 1LJ8A 4KN8A 3M2PA 3EFOB 4IR7A 3IWOA 3CPTA 1R0WA 3O74A 1SXJA 5G0WA 2EFGA 1HTZA 2ZT7A 4ARZA 4HFJA 4WD3A 4L5IA 2ORYA 2JIPA 1H23A 4LCJA 2I33A 5L4SA 1P19A 4E5UA 2Z6CA 3WGUA 1QH1B 1SIBE 4Z7JA 3TNLA 1EAYA 2QLMA 5HJ7A 1KETA 3VJMA 4G5OA 4LYAA 1LPOA 4FC6A 2C9YA 3I73A 3DDZX 1YR3A 5KYUA 4RCVA 5DJUA 4FKZA 3IAXA 4RULA 3W3AD 2OAP1 3Q3IA 1U4OA 2G6BA 1F2UA 4QQFA 1PV4A 1Y7TA 5HWSA 1X7DA 4U9HS 2M6LA 2HH9A 1XDZA 3LPCA 1B41A 4M7RA 4IJVA 1VDZA 1GYPA 2DXIA 2OBFA 1M7BA 2BR3A 5I3ZA 1PVVA 3EULA 4QWOA 2JFBA 1ZSVA 1M2WA 3H11A 3BMCB 2HA0A 1S3SA 1MWRA 2NW6A 1UXJA 3GNTA 5ALKA 2ZSHA 3ESXA 4QA9A 1QPBA 3EVFA 1FFBA 1Q1GA 4FR2A 2Z3ZA 4E3IA 2WF7A 3HKCA 2J3DA 4BE7B 5L3SB 3KOOA 4P6ZM 1ZD8A 4OHBA 4RV9A 1DCFA 2FETA 3AL0C 4DIDA 3X1JA 3VPGA 4GZ6A 3JAMA 4C7OA 1O57A 3K9WA 4EO7A 2ZJ7A 1ENPA 2JCGA 4EZEA 3SJZA 2X2EA 3QKRB 1OI7A 5CFRA 2PQMA 3KQNA 3PU6A 4CPKA 2RH8A 2IYFA 4G0ZA 1GA0A 2DAPA 2VFAA 2XUJA 1KI2A 3U7QB 3PXAA 3E4CA 2ZJ4A 3NRBA 3RWMB 1FSSA 1K66A 1B1AA 4Z51A 2HIHA 4F3NA 3DBAA 3U39A 3LK6A 1G21E 4F2DA 2ECPA 2HFJA 4KAFA 3DLBA 3ZHVA 1N2GA 3PFKA 1P7CA 4R38A 4ND5A 4YUAA 4KG7A 1R7RA 3MZFA 1U5CA 2ZAYA 4Y0VA 2DNSA 3WRXC 2Z83A 3RHTA 2I4RA 3HADA 3NORA 2GBLC 4PTZA 1HNWB 3QQPA 3KQYA 3O5YA 3FTNA 1I5QA 1G20A 1Y63A 4BLQA 1RM4A 4YCAA 2FQXA 4EF4A 3WLSA 3IX4A 5TVGA 4E2WA 1EVZA 2VDNB 4TX1A 5BW4A 2YQ5A 3FFAA 1XU7A 1E1QD 2QJ7A 4HH1A 2GILA 3VYUB 2ZRLA 5K6RA 1BXRB 1Q84A 3ICQB 3H7IA 5DHAA 3O4VA 2VAWA 4UUMA 1JWAB 4XDZA 1ZUIA 2GAFA 2P3SA 3MNFA 1IYSA 4IIJA 2P9HA 4MBFA 4IMPA 5U9CA 2V0CA 4C0XA 2EW1A 4EO9A 2GCPA 4ZJYA 2QAJA 5DN6D 3F8SA 4AO8A 3MS4A 5FSRA 3C5VA 5BV8A 2RFLA 4C4OA 5F83A 1KE4A 3L0BA 2FZGA 3R9XB 4Q5IA 5E7JA 1L4HA 4FSDA 3M33A 4M0PA 4KR0A 1OAKA 5CEFA 4D8TA 2C7PA 3OTOB 1ES4A 3IAM6 3LGOA 4HLNA 4REMA 3ZG6A 4X24A 3F5SA 5FPYA 3QP9A 3V50A 4H7FA 2BISA 5DSZA 3BGIA 1MEEA 4MIOA 2WINI 2HQ1A 5HOQA 1J5PA 4X6YA 3BQMB 3V4OA 1ZHOA 2BMVA 3GEIA 4O8GA 3F6PA 4MARA 1L3LA 1JLLA 1N78A 3DOIA 4BNWA 5EKSA 1XAGA 2M7VA 3SJBA 1KVLA 8ABPA 4Q21A 1GSIA 1PTJC 1V8DA 2DLDA 3RU3A 1YDMA 4EBBA 4BEBA 3V6MA 3PUIA 5IN4A 4X8HA 1BXZA 4TWIA 5AK0A 3GQBB 4CLDA 2R7MA 5JRZA 4G0YA 1V16B 5CVTA 1GCEA 1DOHA 4K91A 4FEAA 3ZCVA 3QOXA 4YRSA 1MJNA 3TXXA 1RE0A 3TNFA 1TGYA 1Y1RA 3D6NB 5CB4B 1XKTA 3PUVA 3GQVA 4F5WA 4AZ3B 1U04A 5A5FA 3OU6A 1M76A 4F94A 3ND5A 1U7DA 3RLFA 3RS4A 3EUAA 4DMHA 2G07A 3BICA 3NEAA 1KEKA 4EUFA 3JQGA 1FRQA 4GS9B 2VDVE 4B8WA 2E49A 2F43A 4GBJA 4TRMA 2HC9A 3HSSA 2C3PA 3NYWA 3E7WA 4LWZA 3O8CA 4P86A 3R5HA 1LI0A 2IKQA 5FBZA 4QDTA 5HILA 4HNUA 3NIAA 4X90A 3H8WA 4B75A 1NBMD 1PWDA 4BDSA 3N3AC 1KRWA 1GPH1 3UT0A 3AM3A 4Z4EA 3PEYA 1JEQB 4U6QA 1YVUA 4QYXA 3WKAA 3GIDA 2YCLA 2QJ5A 1D5CA 3A3PA 4ATNA 1RP7A 4HXGA 3MTAA 1EX1A 1DZIA 3CW2A 5EMMA 3ICOA 2G88A 1DQNA 4Q7MB 2NUAA 2VPWA 4KL8S 1Y3CE 5DCYA 1T5OA 3HFSA 1ZRSA 5EPOA 1I7NA 2FH5B 3N8KA 1WDKA 2RHCA 2DR3A 3G79A 4F06A 5KMGB 2ZUSA 1EFCA 5TARA 4ISCA 1ZHFA 4X68A 4OLJA 1CJKC 3ZZ0A 4MJLA 4JX9A 3EQ8A 3LP8A 3AC0A 4YB8A 3UBMA 4DCGA 4CLCB 3EUEA 2CZQA 5DHPA 2WHPB 4FW8A 3VU0A 3HXQA 4ZXPA 4ZEXA 5GHYA 2IP1A 3GMWA 3GMTA 4MP8A 4OLHA 1B42A 2W83A 4C0WA 4GI1A 3S1LA 3B78A 4KGXA 4YRAA 2IE0A 3Q7SA 3DUFB 3ICYA 5LOVA 4KOAA 3K0KA 3WDKA 4I6JA 5GONF 4M9XA 2C4VA 4JJ6A 4LRTB 2QJRA 1PR9A 3RSZA 1B26A 1RLIA 2ZREA 1SRRA 3VYSB 1C4OA 2R68A 2XVAA 1QKKA 2YWGA 4MGEA 3RTGA 3UOWA 4MI1A 2PX0A 1LGYA 3DMRA 5E2HA 4RQAA 3TAHA 2AYXA 1GNQA 4NETA 4M1SA 5DU2A 3TLZA 4JBLA 3PHYA 1SXJD 3M1LA 2B21A 3Q6MA 5FAXA 3F1NB 1WCIA 4NCKA 2QD1A 4MRMB 2PTHA 4BU1A 4JGOA 4LNAA 2M32A 4NS4A 4UMEA 2PSFA 3F46A 3L82B 4KKVA 3QBEA 1RC8A 4FOPA 3RLIA 4DBLC 3TKAA 4HEHA 2WM3A 4QBIA 4XT2B 4W1SA 5LN1A 3N5CA 1U7TA 3CVVA 3Q3GE 3IMCA 5FBVB 3OBFA 4R7ZA 2O8DA 3ZOZA 2IHNA 2F6RA 2VHQA 5CX4A 1VKJA 1IU9A 2GPAA 4OKIA 4AMBA 4C0KA 4MAFA 2NMVA 3I0ZA 4JZKA 1TCBA 4UQIS 1OV6A 1ECFA 3VR5D 4YUWA 2DR2A 2PUTA 1G8PA 1NUPA 2PQ6A 2Q28A 3KTDA 4CF3A 3UXEA 1U1FA 1QZ3A 3PKJA 2CMHA 4ZVUA 2GEFA 4Z9YA 3IB3A 1ZWLA 1UF9A 4ARUA 1P8JA 2AMLA 4ZRNA 4PXAA 5L6LB 2H8KA 2YH2A 4WUJA 1VI5A 5IJZA 2B0JA 1UBFA 1ZHHB 4HS9A 3I1YA 3PL1A 4CYMA 2D6FA 3U2AA 5M1AA 3F1KA 4R98A 3CJQA 4F3TA 2XWSA 4XDGA 4WUTA 3A26A 5BMVF 3VBCA 3WBKA 5TB5A 1CRLA 4ETZA 3LUJA 1HR0B 3UPPA 1U3GA 4O0PA 4NESA 4IDOA 3PE4A 3TLGB 1W36B 3WK4A 1T4BA 1I33A 2H2HA 3B12A 4L2IA 5TEVA 3I09A 1H4VB 1LU9A 1ZJZA 3WMWA 1CERA 3TN7A 2JJ8A 1VHTA 4YDHB 3E2LA 4LFAB 2X3FA 4FCWA 4UDOA 3C2QA 3A4IA 1O4VA 1Z0UA 2G6TA 3H1BA 4R3AA 1T9KA 1E3UA 4LUCA 4JF5A 1P3JA 1RMYA 2WIGA 3KE9A 2OLKA 2CNOA 3MA0A 1OZGA 3QLUA 4QBFA 1W25A 3ZDEA 4MA0A 2ECFA 3VZRA 3LUFA 5EE8A 4DQ0A 4FYKA 4A16A 3I4LA 3UDIA 4Q03A 1LRJA 2VHVA 2G5PA 4M22A 1OTYA 2GXQA 4BTVA 5CDHA 2P0EA 1USGA 3I6QA 1TT5B 1NF2A 4COOA 2A9FA 5TBMA 3VZBA 2QVBA 4X61A 1OXVA 3KJGA 3DBRB 3IQHX 1Z5GA 4F60A 1O5IA 4NU6A 5F7XA 2RC6A 3AJ9A 3K0CC 2FI1A 3K6RA 1LK5A 5AW0A 5B4VA 2XWQA 1P7WA 2UYYA 4RGBA 2Z2YA 3SDSA 2NIPA 5AUOB 1YJAA 3CUVA 1EFUA 2GAAA 2QGZA 5GVSA 2PXAA 3CH6A 2FPXA 4R3NA 4AT1A 5KOIA 1YLYA 4D8YA 4LI3X 5IHVA 5FOXA 1TDJA 1NQ5A 3J7TA 1IFQA 3V80A 1KGEA 5BN5B 4L16A 5FQKA 3N4IA 1OTXA 2F1HA 2XIJA 4W9MC 1X80A 4NTZA 4UJ3A 1T0HB 1AKUA 4ENPA 3GHYA 3DMDA 3Q12A 5JXHA 1NW7A 2VCEA 5CX7A 1NVEA 2AC4A 4NEGA 3MJCA 3OJ0A 4YJ3F 2XOXA 1UKCA 3PDUA 1O0BA 4JLUA 1YL6A 1NZOA 4OPQA 2EVWX 2HSJA 2VJMA 1IJEA 3KQWA 2XKBA 1IC6A 4C4XA 2D1TA 1L4FA 3N86A 1E9FA 4IQGA 3P8ZA 4MHSA 4PAGA 2C4WA 4MYDA 4PYLA 4P4NA 3AWIA 1C3OA 2HWKA 1ACJA 2JFOA 2WSYB 4US1R 1KZGB 3C43A 1RP5A 1X0XA 3ZU5A 4JF6A 2PL3A 1DDOA 1PJSA 5A9TA 4OB8A 1ZC4A 5JD5A 2FCRA 5CG1A 1W6RA 4QNRA 4ALIA 5EM1A 4R3BA 1LVGA 1X77A 1BTOA 3O1IC 4NBLA 2Q27A 4BB6A 2O9BA 1SWVA 2PQ0A 2I9VA 5IAAA 2VPZA 5LZ9A 2DPGA 1SKUA 2J09A 4FWTA 3WY9A 2CKMA 3DFKA 2Y59A 4XYMA 4LJLA 5HQJA 4EUZA 1UMBA 4LYGA 3EJWA 4HYTA 2AEJA 2G0NA 2QG4A 2EFCB 2VF8A 5T41A 4LMRA 2G5GX 5ALSA 2DCMA 3WS5A 1X74A 1YD7A 521PA 1FLAA 4RFSA 4AURA 1RHJA 3ZDAA 1QKJA 4PM9A 3FD8A 3FCXA 4BMZA 3W5AA 1SVLA 2DPMA 2HNAA 2EFHB 3O90A 5BSEA 2FJPA 4YRIA 2E4YA 3A6JA 4V3CA 3UUEA 1NBEA 4AJ2A 4AJPA 4FUQA 2IWRA 3GNLA 2ZYIA 3CX6A 3GVXA 4DCPA 5JE8A 1PP4A 3O4RA 2BEWB 1IULA 4C06A 2QP4A 4X1LA 1U3CA 4MA5A 1OKKA 5A3JA 2BFCA 3LKZA 5E2BA 3OCNA 4L57A 1RJDA 1YGPA 3OM9A 2GN1A 2IUEA 4IUKA 1REQB 4XVQA 1K6SA 4HH4A 4W9NC 2ZROA 4EHKA 2ZSKA 1K92A 4ZT2A 1IRIA 3DMNA 1PI3A 3R09A 1PQUA 4GYYA 2CLFB 1TEXA 3WWEA 4MKHA 2FUKA 3FF1A 5HW3A 4FIDA 2WF8A 3ABZA 4K88A 4QGHA 4XEHA 5FLXA 4M87A 5GGYA 1T5IA 3KQLA 1OA0A 1W85A 3EOIA 2HPZA 4KQ6A 1ADYA 3FSJX 4JOBA 1WQ4A 2I80A 5LMCA 1SXGA 1S66L 3BZBA 4I50A 1KOUA 4PLVA 4A10A 4Q7QA 4BMYA 1ZI9A 3IOCA 3S1SA 1PZPA 2FN9A 1XT6A 3JQAB 5DTIA 2GTIA 3QNUA 2HLHA 4V3BA 2Y1KA 3E6AA 2QQFA 3MRVA 5DMHA 4AY5A 5D7BA 2AOXA 1A2KC 3EEBA 2B37A 3EIUA 3H82A 5GJVC 4JBHA 3IF6B 3L9WA 3STYA 3SYMA 4KV9A 4CQJA 1SZVA 5G4KB 1WAMA 4J49A 4M86A 5CAEB 3MG9A 1JHPA 3EA4A 3RFCA 1SUWA 5DWQA 3H4VA 4EUNA 3DWIA 3I0MA 2DGDA 4PCVA 2CMDA 1OLUA 4JROA 4D3ZA 3OQJA 1NXSA 4YRPA 4KWCA 2EFJA 5AVXA 1JB9A 1N1DA 4IINA 1KC1A 4ITVA 1MJGM 5JCZA 5FOWA 2BYTA 3IWQA 4FMDB 1RIFA 4ZAMA 3A27A 1QUFA 4HDSB 1MY8A 2NYAA 4DJ3A 3U6BA 5LB2A 2HDWA 1Z2EA 2HIGA 4B6EA 2AW3A 3VU9B 1Y3BE 4P7KA 3F3MA 4HGRA 4FKMA 1P4GA 2F1JA 2O0MA 4H7PA 2PKEA 5AIAA 3I01M 4F0JA 1AN0A 2JFNA 1Q3TA 1P1FA 1AVTA 2HHJA 2FP3A 4ZMRA 1E69A 5F21A 4PG8A 1FYEA 1YT5A 3C39A 3WISA 1HLUP 3ER9A 4RV5A 3WYBA 4Y18A 4BBVA 1NLMA 1I2MA 3GZNA 2X2FA 3CVJA 1VYHA 3EIWA 3RU7A 2ZJZA 1JMKC 5HS6A 1IWBB 1TMOA 5ANRB 3A0RB 4AN0A 3HCYA 4UAUA 4OHRA 2W6IA 2AUMA 3Q1KA 3C6BA 5DISB 4QHCA 4HGZA 4CIXA 2ZJ5A 4P82A 2FE4A 3KSRA 3IF5A 4YX9A 3KB2A 4D0SA 2QF7A 1E5TA 5EPUA 2DSNA 3G2MA 1O6FA 3W5CA 1URPA 1ZGCA 3CUTA 4E4YA 5ITWA 1K08A 1XGJA 1K9SA 1VYVA 4H6PA 1G42A 2BFWA 1EWZA 1XEWX 5M5BA 2FEWB 2WZZA 3NHMA 5DEIA 4F1KA 3D31A 2FEPA 2BGNA 3JD4A 4EM6A 2PXHA 1AKMA 3SC2B 5JY6A 3II6X 1YR9A 4ZYLA 1DINA 4Z7QB 2ASEA 2CBGA 4XVHA 2JZCA 3KO6A 2XLNA 2A5FA 1UPFA 1IEWA 3FRJA 1GZ5A 2RHBA 1E3UD 3RF6A 1DWUA 1UT6A 3SC4A 3UHJA 3KUDA 4X7MA 1Z0DA 2O8NA 4A8JB 4S1OA 1M10A 2IUUA 3DT6A 1NY0A 1ZA2A 3P2KA 3W5DA 4LPZA 3K0AB 4MW0A 3TDNA 2G70A 3MWEA 5ECYA 5B2ZA 3P2IA 4FZRA 4LTDA 2C8LA 3V34A 1XGKA 3CSDA 2X7HA 4R1GA 1N5DA 4DG8A 1UADA 1Z09A 1MQSA 3VPBA 1YE8A 2JFUA 1W5TA 3AMVA 1NI5A 3A3OA 2X9NA 2HPVA 3AL2A 1EP9A 1KI6B 5J2UF 5LLDA 3C7DB 5DGXA 4XUZA 4YJGB 3LBIA 1GD1O 1FYVA 3GRCA 5AJTA 3FLBA 1E0SA 3MJ4A 4PAQA 5IDQA 4Q4AA 4GCZA 4WA7A 1LSUA 4WI1A 3IDSA 4EBFA 1ESEA 5CFOA 1YZYA 5K3FA 3LYUA 4HVTA 3DTMA 5EWMB 3UMGA 1JBEA 4OHFA 3OOWA 3RSQA 4BAZA 4PGGA 2QUHA 4DCUA 3QXHA 4ESOA 4P38A 3BWCA 5CX1B 1BA2A 4KUKA 1W35A 4FMPA 1IAVA 4G01B 4G65A 3MOGA 1HLFA 4BQFA 2OCBA 4KH0A 1E1YA 1SIUA 3BLSA 1GM5A 4GOLD 2JLXA 1GU7A 1LL5A 1KTVA 2VJCA 4I3JA 3MRSA 3G7SA 2PBLA 1KYYA 4UE3S 1G5UA 3NJ4A 4U3JA 2G8NA 4NBTA 3KXIA 4YGXB 1P4HA 2G7UA 2HV8A 1UKAA 4EYEA 3VKWA 3O93A 1OLXA 4R2IA 3HXOA 5B57C 1JN0A 3QUBA 1A9XA 4HDRB 2A1TS 2IT1A 3I4CA 4J43A 3OIUA 3NHWA 4WXPA 1IMOA 2RJ3A 1X7HA 1FNDA 4XRRA 4KFRA 5TDHA 2IS1A 5CB8A 4RKWA 4BS9A 5I7HA 3VNUA 2VBIA 4WKNA 3F5FA 1JU9A 4FHDA 1CUCA 3DO8A 4WY2A 3GPDG 4JI8B 2OC4A 2PZKA 3GCGA 3W8EA 1CJUC 4FCTA 5DEOA 2PUGA 1P4SA 3SE7A 2VSOA 3ORYA 2NPOA 4JB3A 2Y92A 1AOXA 2Z2ZA 2WWIA 2BKLA 2BFNA 1RHUA 2ISQA 3S4YA 2NQ8A 3SS7X 2ATCA 1W9HA 2ZJ2A 1KPIA 3PX2A 2X1HA 3VHXB 4CT0A 4BU0A 4TTSA 2QVGA 1MHTA 1KXZA 4J75A 4RLFA 1QYCA 2I1LA 4JHLA 2AYYA 4F2WA 3OX2A 2RKOA 5BOHA 3KPVA 4I38A 1NVUQ 5DB4A 3HBMA 3MAGA 4JKIA 2YHAA 2WWYA 1CIJA 2EJCA 3FWKA 4OAOA 2RGUA 4AIRA 2P5TB 3H19A 3I64A 5AJYA 4H6JB 2ABWA 5AKIA 4RHYA 5KWEA 4BQNA 1U8ZA 4L27A 3SBXA 4JB0A 3NUZA 3RRXA 1RPAA 4AFNA 4GYKA 4UASA 5HTOA 1OKKD 1G8FA 3E81A 4JJ7A 4CMCA 1S1CA 3PUWA 2AHRA 3HZOA 2WMYA 4Q6BA 2GTPA 3WGYA 4AS3A 4FNMA 3QJGA 4UTNA 1UUFA 4YT5A 2ZL1A 3U3RA 1R5BA 4UTVA 1YRWA 1X1DA 4GM0A 3TMYA 2WAYA 3OO0A 1MIOB 1EU1A 2FOXA 3R4VA 3WLJA 2B99A 1U0HC 3QP2A 3I05A 1PT7A 3MS7A 2I34A 3ZHHA 3OE5A 3FTCA 3SX2A 2OV4A 1GKLA 1KR5A 1TQ4A 4UC0A 4N41A 3AHIA 3GRYA 3OQ6A 3I72A 4CUJA 2W4QA 4I1OA 2YX1A 4N39A 4RH1A 2PX2A 1CE8A 1SQ0A 1H22A 5A0TA 4RA7A 1VP9A 1XWWA 2LCQA 2IV7A 1YAJA 3AF3A 4KXWA 1SBIA 3ZHCA 4URYR 4BFUA 4OF4A 4NMMA 2DH6A 4WL0A 1IXZA 3SVLA 2GQ0A 1ULAA 4BNUA 4R71A 2B69A 1PD0A 1U81A 4BO0A 1PUIA 5CHYA 3HCDA 4FFSA 4B76A 3ZZTA 3ZG7B 4DSNA 4NBNA 4TV8F 1QZUA 1UANA 5JAOA 5JPDA 3DTVB 2Y1LA 2VWPA 1YCDA 4L6CA 3ABQB 1Z34A 2C4MA 3FY4A 4I4LA 5L51A 2W2VA 2CUZA 2NV2B 4MVJE 3GRPA 2CXXA 4V0ME 2R1VA 1TJ4A 3D6UA 3PENA 5EA2A 4WGFA 3DE1X 1MWTA 4CCAA 2QA5A 1NZDA 2W0SA 3G0DA 3Q88A 1MO3A 1CUGA 1LKZA 2FWBA 4YCMA 2G7ZA 2WIKA 3H0CA 4FQ7A 5AVYA 2GD2A 3GP8A 1VG1A 1SC1A 3REFA 4ZI5A 2Q4RA 1SCIA 1LRKA 2GJ3A 4RANA 4BEVA 4F45A 4DUGA 4RK5A 3UEOA 3JRXA 2BI8A 1Q7CA 3L7JA 3P2OA 2J9RA 3L0IB 4XQGA 3WRWA 1EX9A 1XLVA 5CGQB 2W6ID 1A9TA 1DBIA 4JEIA 3I45A 2UUOA 4UBLA 3RVJA 3AF0A 4IZIA 1Z35A 4P80A 1MEOA 4YPFA 3Q41A 1TF7A 4RKQA 1QF7A 4KFTA 3ZCQA 2EC5A 3V2IA 1J33A 4D8WA 5L8MA 5AVQA 4HJRA 1JXAA 3PBSA 4GEGA 3K0BA 3LDHA 4MR9A 3TRJA 2XTAA 3F67A 3LEQA 2VLGA 4J0EA 4CMGA 1DBSA 3ECSA 1KQFA 3KC2A 2BKXA 1PEAA 2JGIA 1D5WA 3N2EA 3JYIA 1YI1A 1I0ZA 1SCUA 3DL4A 4GX0A 5GLAA 3AP3A 3ABSB 5K7SA 2JJ1A 5D5PA 3ADKA 2HRZA 1NW5A 5C53B 2G67A 1JHYA 1SVKA 4TS3A 4BO1A 3ZR4B 2J5QA 1YSQA 1ZI8A 4M38A 1KHTA 1QFZA 4RZUA 3VSCA 3COPA 2KJQA 1NZJA 2YY7A 3ZBPA 3ANMA 4BHTA 3JWPA 5FEGA 1TIPA 3THRA 4AJOA 4KSBA 5H59A 3LX8A 2D2EA 3HJAA 3TE6A 4RMGA 3WG9A 1MVNA 1FCOA 3B48A 3UK0A 2CUKA 1MX3A 3QPWA 7ABPA 1OH5A 2QX6A 4WVLA 3L1KA 5TNXA 2AJBA 4WEQA 1Q1EA 4R0NA 3WLAA 5F98A 5IKEA 3E9NA 4WBNF 1YGYA 4ZQBA 2Y4OA 4F6LA 1KMIY 4ZIRA 3TQHA 1Z15A 3CLTD 2HSGA 3C1OA 1J23A 5TQJA 3I0NA 3QOWA 4EHAA 3AIOA 5ALUA 2TMDA 3OE4A 2YN4A 5CT4A 2BONA 4ZT5A 1DIBA 4MVJP 1PQWA 3GVHA 3KQVA 2P9JA 3QPCA 3IQFA 4NE9A 1ZUNA 4CF7A 2ORWA 2I2BA 2G25A 1E1NA 4P3KA 4NXNB 4G3KA 5K8TA 4PM7A 1OC2A 2ZXEA 3F9CA 3QNCA 1IG0A 4RVSA 5TT1A 1GILA 5I01A 2PXXA 3GPBA 2DRWA 3G88A 4K6KA 5JSQA 2FPLA 2F8SA 3TLCA 2BEKA 3MQFA 4RU1A 3NOTC 3V5MA 1HYEA 1UM9B 3T5TA 1S1YA 1GQQA 2EQBA 4AU1A 2W6JA 1TM5E 5D84A 2W6NA 2WDZA 2WEKA 4ARAA 4MBHA 1YA8A 1QXSA 1QIMA 1M2JA 5C31A 3IX8A 4PQFA 2TYSB 3QJ5A 2AK3A 4KQCA 4NL4H 4DDUA 3JAWA 2OCAA 3LQFA 2RBGA 3PNQA 2RGNC 3RODA 1HZJA 3URKA 2V1XA 1Z0IA 4NDZA 4XB1A 3AXSA 1FFXA 4BJ1A 5BUQA 4TQ9A 4HI4A 1GAWA 3DOHA 1OB5A 3LR4A 1EH5A 3NC1C 2A1UA 4CM8B 4ZCPA 1E64A 3AFIA 3M9WA 4DG5A 5C35A 5I5LA 4JLPA 4XFKA 1S4MA 2FEAA 5JECA 2RGDA 1LDYA 1JBQA 1N3LA 3STVA 3LUKA 1JT9A 5IANA 2WMOB 1KI8A 4A3SA 1I36A 3I9NA 2AX4A 4DQKA 1P45A 2NUTC 4HFMA 3A8TA 3M9XA 3GXBA 5B30A 2I2XB 4PLYA 2QD4A 3L43A 4IRMA 3CX4A 4KK3A 3KB1A 1R6DA 4PAOA 1GIAA 5IG2A 4IUBS 4OI0A 1M2OA 1NW8A 4Z4HA 2I6QA 4EFKA 4BNVA 3OSUA 3V00A 2GBGA 5AVOA 4GZ5A 3F9RA 1E3WB 2QAGB 4MI6A 3OZVA 4ZPXA 4WKBA 2X0NA 2G1UA 4GHIB 1ES5A 4GQIA 4IIVA 3TR0A 2VPPA 3C0KA 4P83A 3KQUA 3A32A 1N1EA 4PHTA 1YZHA 2B5OA 5IT4A 3T50A 5ESWA 1Z82A 2XI4A 5GV8A 2HP5A 3UHFA 3Q6NA 3IQGX 2WD8A 3UJ8A 4RCZA 2CHFA 2ZTHA 3RVSA 3FYUB 1IOLA 1E4EA 2FLWA 3RUEA 3MC1A 4KAJA 1PR4A 1H93A 4ZAYA 1Q6YA 3DVQX 2WNHA 4MWCA 3IS2B 4H1HA 5KSHA 3GEBA 3V8NA 5I6DA 3D02A 2KI5A 2WZBA 3W9YA 4GP9A 2C1EA 3D4IA 2ONCA 2J4CA 3G59A 4F2HA 3ENKA 3V1YA 1H3FA 2E1RA 3ND6A 3D4PA 2B0CA 2IH2A 3NKLA 1BSVA 1XLTA 1N2ZA 1UJCA 2YQZA 2X23A 1QYWA 3K53A 1R12A 4KYVA 3D7KA 4I1RA 1JVBA 1PLJA 1QIKA 2GR9A 3JZMA 4GOOD 5CTMA 1QLJA 2V7VA 1LS1A 4RW0A 1XTTA 3EIFA 2E9SA 1PE0A 1OZHA 1YHNA 1PFUA 1RQPA 4DG9A 1GPUA 2IPNA 4L8YA 3PD0A 1E32A 1KSFX 2NP6A 4PBRA 2BUBA 3R7LA 1CFJA 4PX3A 3AP2A 4DL9A 4M0EA 1UZUA 4KQFA 3KQTA 3UT6A 5EVJA 3AR3A 2I3ZA 2H1CA 2ZUCA 3RT7A 3IAHA 5FCDA 3G2PA 4TTVA 3HO1A 2V8OA 4ZYVA 1POXA 3JYOA 3UJBA 2DP4E 4O3MA 4J4BA 3HBJA 3LHDA 5LZ7A 4MNTA 2FWIA 1IN6A 1T36B 4EQ6A 5DE3A 1X7ZA 3P9YA 4IMRA 3Q8WA 5CYGA 3E03A 3IIMA 1CF4A 2KBFA 2AA3A 4ZYWA 2GD6A 4MP6A 3BB1A 2AG5A 1QS0B 4IUHA 4HVAA 1DI0A 3UJPA 3CR3C 1NW9B 3BFKA 4E5NA 3VOBA 2MINA 2B2XA 1B2RA 1AO0A 3BVPA 2NPFA 4Q7LA 5E0OA 3F90A 1QK3A 3NOUC 2XCQA 3GWGA 5CFZA 5BN3B 1XTZA 4Y0OA 4QDXA 3VSLA 2HQRA 4KAXA 3FB1A 2ZJAA 3PWZA 3AR9A 5ECGC 5C51B 1I6LA 1W30A 2X22A 2X0DA 4QGFA 3HGQA 4DLAA 4I5FA 3BTOA 3O73A 1Z26A 1FR1A 2FFBA 3PFFA 4OREX 1HT1E 4BVEA 2BR4A 3D6VA 1X9IA 4ZCTA 4RHCA 4GP7A 3NTRA 1YFJA 1UFVA 4QBGB 2WJ3A 5CK5A 1P1BA 4ZGGA 4ZICA 2PWYA 3EPKA 5LLSA 3IH9A 2W9XA 4F8YA 1Z8FA 1XA0A 3G7UA 2JJ1D 2YXPX 2V4MA 2XECA 1S9HA 1WF3A 3PEWA 2SCUA 2O9JA 1E9DA 1KJWA 2K31A 4NP6A 3LKDA 5K0FA 1Z0AA 3LCEA 1LJUA 4KZAA 1E2LA 4BE9A 3SM3A 4NBRA 3KR2A 1JX6A 3TUJC 4UEKA 1E89A 1EGHA 1VL6A 2FG6C 4BZPA 2HCRA 1J7JA 4G84A 3VI3B 1KMHA 1OJ7A 2W2KA 2OD2A 4IP0A 4PLHA 2B83A 5PGMA 3DVLA 6REQB 4WCFC 3FDZA 1YB6A 4HDCA 1NAHA 7GPBA 1Z28A 4KRGA 3N2ZB 1VE1A 1U8FO 4JI5B 3VE4A 3I5MA 3E3NA 3IUBA 5CJ2A 2Y1EA 4PIVA 3ZG8B 1X7XA 1Q19A 2VQ3A 3EPJA 3VHRA 5HE8A 3C7CB 4BMXA 3K92A 5FXMA 3DBHB 3H9GA 1A8PA 4JSRA 4GS5A 3L7DA 1MA0A 4LJ6A 3GLGA 2ETXA 2QD5A 3P7MA 2D2FA 4PFQA 5T64A 1ZMXA 5EHNA 1Y6ZA 4BGEA 2XGMA 2O54A 1ODJA 2QEQA 4D9IA 3P01A 1ZXLA 4KQXA 5CVUA 3A9UA 2TECE 2AI3A 4OHKA 1IZ8A 3LE8A 4PO1A 3JVDA 4G89A 5LDHA 2ZYAA 4MJXA 4DCMA 1UBJS 4EO4A 3NM6B 5H81A 1R2QA 1A9ZA 4C2BA 3RV3A 1MUUA 3O4FA 4AJ4A 1M6VA 4FB4A 2VHYA 4GPBA 2A5GA 2W6JD 2ZR0A 1NJ4A 1GLVA 3TB6A 3AVWA 2VBGA 2EJTA 4TL6A 4PXSA 4PGAA 2DWPA 2FSGA 1WYCA 2UZ4A 3L49A 5EXDA 2RI0A 2OZLA 4C4ZA 2JJQA 3ZLBA 1BWQA 2BPOA 4DCCA 4HAXA 1FQKA 5D85A 2IYQA 4S2JA 1EBBA 5C0OE 1TUBB 3UDXA 1GPBA 2M6RA 4R2JA 4XR4A 5TS3A 1IN7A 1NJFA 2TMYA 2B6HA 3FPEA 3MXSA 4TXMA 1RXVA 4K0WA 3HG7A 3RK4A 3ND8A 1RHKA 1U4SA 3MGKA 2XT9A 1J24A 5EYPA 3MQ4A 4MPRA 5ER6A 1JZSA 4Q0MA 1WUJS 1RT9A 5T67A 3U40A 1FMJA 3BA6A 1DKLA 3ABRB 1U28C 2FGKA 1J2YA 2X3UA 3N0VA 2BHTA 4DWJA 1FVHA 3EX7C 1Y3AA 5LP6B 5KPJA 4A0GA 2YUTA 1XJCA 2ET6A 2ZS7A 4DMGA 1Y3FE 1RQGA 4Q3CA 4W5RA 1VE3A 3KG2A 4DNPA 3D64A 2IPXA 3VDQA 5LIRA 3ODPA 2EGUA 2XCTB 2X7JA 1VKRA 4YFYA 3ZVRA 3IQIX 4PLTA 2VYCA 2W8ZA 4HBUA 4N5DA 4Q47A 4PKYA 2ODEA 2O7QA 4L5CA 1AS0A 3N2GA 2DFPA 4P6VF 5I8PA 4XLLA 3NANA 3KSIA 4D26A 3I3OA 4JL8A 2ORED 2X19A 1VKNA 2OK8A 4RSGA 1F2TA 3ZI0A 4HB4A 1A7JA 4MA4A 3DE4X 1K1EA 3RQIA 3ILYA 2O3UA 4DREA 4WOBA 3DMPA 1F0PA 1N33B 4DR6B 4LV3A 1SXJC 5CYFA 4V24A 4C0LA 1ORWA 3UK7A 1B0UA 2X5XA 5JCOA 3ZHYA 4EHHA 3Q1LA 3MRTA 3SYNA 3UNWA 5JNSA 4ZHQB 2H9IA 1W75A 4QECA 3JVIA 4EGQA 3BFXA 4OXIA 2RL3A 1ZD2P 3BBLA 1D9ZA 1T4MA 2WFAA 2BN4A 4CMIB 1GQRA 1CUYA 4B71A 3U1VA 3C74A 3FSEA 1A77A 2Z3WA 3S0JA 4MGZR 4W5OA 2QN1A 4TS1A 3DJYA 3F7TA 4P92A 1ZYUA 4O8CA 2HGZA 2H16A 2Z08A 1AZSC 3RR2A 3ASVA 1PZFA 1IK6A 3T7RA 2E55A 1N75A 2FG7C 1PZHA 1SBCA 5KWJA 3DOUA 5AM5A 1NVXQ 3D6HA 2R8ZA 5E9JA 2IPLA 3IEIA 2W3EA 3M4XA 1XDWA 3JQ8B 3W2TA 4HJ4A 6LDHA 1T35A 1LFAA 4TZKA 3FOEC 5JRDS 4PLWA 3PXEA 4I08A 1M1XB 4FFWA 1TPZA 3F6YA 4HSEA 4WIAA 3GB9A 1B16A 2V0GA 4DV2B 2I55A 1HE4A 2IELA 1FL9A 2F2TA 2BM1A 1C0EA 4FFLA 1RYNA 3LXMA 2FZLA 2NG1A 1QZXA 1LLQA 4BKOA 1H5QA 4GD6A 2IUFA 4PNHA 4LF5B 2RG1A 4EELA 4JUFA 5DNVA 1T25A 5JJBA 4OQDA 1CZRA 5HMMA 4GXNA 1QHSA 5KC9A 3QEMB 5TY0A 2XZLA 5I8ZA 1H3EA 2Z04A 2QMEA 1J2UA