3JVVA

Crystal structure of p. aeruginosa pilt with bound amp-pcp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
342
structure length
331
Chain Sequence
MDITELLAFSAKQGASDLHLSAGLPPMIRVDGDVRRINLPPLEHKQVHALIYDIMNDKQRKDFEEFLETDFSFEVPGVARFRVNAFNQNRGAGAVFRTIPSKVLTMEELGMGEVFKRVSDVPRGLVLVTGPTGSGKSTTLAAMLDYLNNTKYHHILTIEDPIEFVHESKKCLVNQREVHRDTLGFSEALRSALREDPDIILVGEMRDLETIRLALTAAETGHLVFGTLHTTSAAKTIDRVVDVFPAEEKAMVRSMLSESLQSVISQTLIKKRVAAHEIMIGTPAIRNLIREDKVAQMYSAIQTGGSLGMQTLDMCLKGSRENAREKAKIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Twitching mobility protein
publication title P. aeruginosa PilT structures with and without nucleotide reveal a dynamic type IV pilus retraction motor.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Atp binding protein
total genus 109
structure length 331
sequence length 342
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3jvvA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3jvvA02
1Q3HA 2QTHA 2PEZA 2FEOA 2H92A 2OAP1 2IYTA 3NDPA 3U3MA 4BFTA 2AK2A 1G5PA 1R0ZA 2QMHA 5EP2A 4N0EA 3EPHA 3ZS8A 3N2IA 1KOFA 3RNLA 2HJGA 1T8TA 1OJLA 1TU3A 3UXMA 4HI0E 5TXGA 3GLIB 4PXAA 4LJ7A 3CB4A 1N25A 2FF7A 4E22A 3MFYA 4A8JA 1BYUA 2RGNC 1ANKA 4QNRA 2OXCA 4TL8A 3W34A 5CYPA 2ZXUA 4ABYA 2CCGA 2QORA 4PR0A 2EFCB 4FMBB 2KJQA 2RKOA 1X6VA 4S35A 1HYQA 2NIPA 2Z5FA 2ZE5A 4DHEA 4TN1A 3FKSA 3QKTA 1HA3A 1P2SA 3K9HA 4G5SA 4RKEA 1DTSA 4TQAA 1HH4A 3A1TA 1GRNA 4ON9A 2XJ9A 1N6PA 2OEPA 2WV9A 3I3SR 3GEEA 3B9QA 4LC0A 3VHLB 1M2OB 2OAQ1 4X8HA 3ECCA 4W7SA 4P4UA 4A2QA 3GLGB 3K0FA 2PZGA 1P9NA 4A82A 3JZAA 5KNBA 1X1SA 3B6EA 1P6XA 2ZI6A 3AH8A 3BOSA 1XD2A 3LRPA 5JCZA 5DNYB 5TV2A 2VO1A 3NKVA 3T1VA 4Q1FA 2RHMA 3NIBA 4QBHA 1OH5A 3K0AA 1IOZA 3Q5EA 5FPKA 1GDDA 3G0HA 4AG6A 2IW3A 3KJEA 4RZ2A 2IF0A 1P4SA 4BLQA 2REBA 1E2JA 4XOIA 3DHWC 2WWGA 1QDEA 4LDJA 1U8ZA 4G3XA 2IC5A 1VIAA 1T4GA 1FNNA 4EPWA 4HLUA 1S9DA 1NN5A 1Z06A 4WZAE 3FYHA 4MQBA 3FKSD 4CF7A 4C0KA 1CF4A 1S2MA 2WSSA 1TU4A 4UNPA 2JATA 1IY1A 4IVQA 1OH6A 4QGHA 3CM0A 2VA8A 1OKKA 3TSZA 1MT0A 3IO5A 2BOVA 4MRSA 4WW0A 3Q7QA 1F6BA 3TW4A 1Z6TA 1S8FA 1DAMA 2R8RA 1GSIA 4LBVA 3H2YA 1E9AA 4DBLC 2D2FA 4Q47A 1F2UA 2ZU0C 1E2GA 3OEEA 2IEYA 1XTSA 4YLGA 4MUAA 1VYUA 4XJXA 3PEWA 4Q1DA 5AJXA 4KJZA 5J4HA 1RPZA 1XCMA 4LBZA 4A2PA 4M9ZA 2QRNA 4JLMA 2J1LA 4NCIA 5FH9A 2ZI4A 5TB5A 5A5GA 1MO5A 1II8B 1XTKA 5CJPA 1OT3A 3CNLA 3SU8A 3NTUA 1Q57A 3AVWA 1W2GA 1E1RA 3QG1A 1Q1QA 5EE5B 3PCRB 3QXHA 3LA6A 2BKEA 3I92A 1SXJE 3GEHA 3HYTA 4TTRA 4V0ME 4BLRA 1OSNA 2TMKA 5CJ2A 1M7BA 3BH6A 4ITRC 2WAYA 2PZEA 3SI7A 4HZIA 2FEMA 2ZR0A 4PO1A 2WSSD 5LB4A 2YC4C 4KFUA 1AA9A 1TQ6A 1TQDA 5KDLA 5C2JB 4FCTA 3RSOA 5BW8A 1QHSA 1OKKD 1Q20A 2D62A 1G19A 2QSZA 4LHZA 4D2IA 2G77B 4NCKA 1E2HA 5BXQC 4L16A 521PA 5AUPB 4Q9LA 2BMDA 3BH0A 2RB4A 2FE4A 2ZRFA 5EE9A 2IWHA 3U7HB 4C0QC 2R62A 2FU5C 2G3YA 1P9WA 1OW3B 3OEED 5JCPA 4OI0A 2ZYUX 1OXSC 3I4LA 2CDNA 3EWAA 2E87A 4KHZA 2W2TA 3B1WA 1AS0A 2G0NA 3TAUA 2PJRA 1G41A 1YZTA 2RGDA 3TQFA 4P33A 4QBIA 2JJ8A 1S4QA 5IRCD 3R7WB 2D3WA 4P31A 1EXMA 3QKSA 4W5HA 1Z28A 5DN6A 4BGDA 1ZUIA 2MMCA 1G3QA 4RD6A 3TUIC 4D81A 2PT5A 3E1SA 1KMHA 1VG8A 4R98A 1KKLA 1E1RD 1Q1BA 3K09C 4OQMA 2P6RA 4QGAA 3AKYA 4NYIR 4DDVA 1GNQA 1L4YA 3GQBA 3TW8B 3CONA 4AC9A 1IJFA 4HAZA 1LB1B 4M1YA 1WDTA 1N5JA 4FMCB 5J40A 3KJHA 5L8VA 3U7GA 1T8UA 3AEZA 1R5BA 3TGPA 2PH1A 4HB3A 2LWIA 1IQPA 3BS4A 4GRAA 5F2EA 1ZP6A 2BJWA 5A4JA 2AWNA 1E9BA 4D26A 4MGIR 1SXJC 2EFHB 2DYKA 3MD0A 1NBMA 2JDIA 1XTIA 2QY9A 3EZ7A 2N42A 4KVAA 1J70A 4WIAA 2AX4A 3RWMB 4FMCF 2A78A 3DO6A 5CYOA 4XWAA 1IN8A 4MRNA 2FOLA 2VRWA 4CYMA 4TYPA 5F9FA 1CLUA 1UKZA 4GMDA 2WZQA 1G21E 2P5TB 1XTRA 1G5TA 1UBFA 2O8CA 2WMOB 1GKUB 5LD2C 4LJAA 1D8TA 3ADKA 4LSGA 1JECA 4EJSB 5E7MA 2VSOA 4AYTA 2FDCA 4G5OA 5DN6D 5JEEA 3CF0A 5JZVA 1E0KA 3MWJA 1G5RA 1NN0A 4LGMA 2FSHA 2CHVA 2WWFA 5AUNB 3W5IA 4KSBA 3P27A 5FPSA 2FNAA 4CEJA 2REOA 1NN1A 3GLIE 1KNXA 1UKYA 4C0JA 1TF7A 1SVSA 2CJWB 2JAQA 3JZMA 4PPGA 4M9XA 4M1KA 3ZGXA 1XJCA 2GA8A 3U6KA 2QAGC 4A1FA 3QEJA 1CR0A 1NVUQ 2UVQA 2ZE8A 3OIYA 2QT0A 4CEHA 1M34E 4W5WA 1KK1A 1XNJA 1NBMD 4ZKEA 2OV2A 4K8OA 2JDID 2YWHA 1QRAA 2ZANA 2IYSA 1NLYA 1NIJA 4JKYA 3TK1A 3B1YA 3B1VA 1N5KA 2B8WA 2WIAA 4B6FA 1GFIA 2J59A 3QEOA 3SFZA 4URYR 3GJ0A 5SZIA 2LCFA 2XOKA 3REGA 2X8AA 4UJ5A 4D0LB 3X1WA 2GF0A 4PHTA 1AS3A 1A1VA 3EXAA 4A36A 3TJZA 1VG9B 3VFDA 5HZHA 1TF2A 1AZTA 1YJ5A 4QKQA 2GHIA 4OBEA 4OQLA 4DSNA 2FSFA 621PA 4D25A 5DH9A 3TQCA 1T3HA 1ZD1A 3I8SA 1AS2A 4H1VA 2VHTA 3T35A 3LD9A 3H1TA 3EZ6A 2G6BA 3JVVA 4PPQA 1W4BA 1W4AA 4Q4HA 3RS5A 3SYLA 2C98A 2J7KA 1TUEA 1MRSA 1NY5A 3EAQA 4QFMA 5DO9A 4KV9A 3M4YA 2W6IA 4UXHA 4D4KA 2FSIA 1VYVA 4TWZA 1KAOA 1I4DD 2ZETA 1G8FA 2MMGA 2BBSA 3ZDQA 3FPAA 4ILEA 5KPDA 2PLFA 4NPHA 1RRPA 5L3SB 2ZVPX 3EA0A 1OXTA 1XJ0A 2NO0A 1E0SA 5L3QB 3K70D 1ZCAA 5FUVA 5H8WA 3PUYA 2RGBA 2XOKD 3AQ4A 2XXAB 1P2UA 2BHRA 2J0VA 3KX2A 3AP1A 1Y3AA 3HR7A 2WIBA 4B43A 2EFEB 5AJVB 1SQ5A 1X3SA 3CRW1 2W83A 2OBMA 2QZ4A 3CLVA 3PR1A 4OK5A 3SHFA 1BS1A 1Y63A 2R6AA 3KKOA 1UEIA 4PZYA 1KY3A 3DZDA 1GG2A 3BERA 4Q1AA 3EG5A 1LVGA 3UPUA 1NMZA 3NBZC 1YR9A 2GAAA 4NE2A 2N1BA 4DJTA 1O87A 4DLSA 1LFDB 1NSTA 1UAAA 4NH0A 3CIOA 3QI2A 3VQTA 3K0CC 1G3UA 1LS6A 5LBIA 5JMTA 3U6BA 2I3BA 2W6ID 2HCJB 4IOJA 4BECA 2GJ8A 4JLDA 1KJWA 2OFOA 1XCGB 3B85A 2PMKA 2WWYA 3UK6A 5HCNA 2BBOA 4Q66C 1DAHA 2ZRGA 4MDFA 3OEHA 4Q4AA 4NONA 3O8CA 1JXMA 2DWOA 4PHHA 3THOA 1RKBA 4LK2A 3KTAA 4F7WA 3VR1A 4U00A 4M1OA 4B71A 2VSFA 4IW3B 3WNBA 2AXPA 5JWOA 1Z3IX 4Q4JA 2ZUBA 3KXIA 3C5CA 4LX0A 5KNCA 3OESA 1EFUA 3JVUA 4KFTA 3R8FA 1IBRA 1N6RA 5K8UA 1IXZA 5GJCA 1GTVA 5A0FA 4BRWA 2BCGY 2ODWA 4AYXA 4HAXA 3B8HA 3IO3A 4B76A 1X86B 1RJ9B 4U02A 1GNRA 3KDSE 4IVPA 3QXXA 3CO5A 3LH5A 2ODNA 4RD4A 5AK0A 1YR7A 2WICA 1GM5A 4JL5A 3A4MA 4JT4A 5JI2E 3KQNA 1JAIA 1N0WA 2OILA 3X1DA 4LCBA 2ZSFA 3B78A 2Q3HA 1E2QA 5KOYA 5CLLA 2ZRLA 2FWRA 4LYAA 1G291 1Z6GA 3RYTC 2GNOA 1GL6A 3LBIA 1C1YA 3MUFA 3Q8XB 5CB6A 1X8JA 2PX3A 2ONJA 5EE1A 3QXSA 2ZREA 4XWOA 2GJSA 4NBSA 4JLPA 3T1OA 4BFVA 3THXA 3A58B 3UANA 5JSZB 3OEHD 3KB2A 4K46A 2W6JA 3IQXA 3HWSA 5KUTA 5FL3A 3A1WA 3SYNA 1GWNA 3DOFA 5JJIA 1DG3A 3NXSA 2F3TA 2F3RA 2C5LA 4XTRA 3GLFB 1DO0A 3A1UA 3RABA 4MYTA 1OXUA 1QVRA 1FOEB 3NC0C 4I1VA 4NCHA 1NP6A 1TEXA 3UKDA 4FCWA 3ZZUA 2O0JA 3VHXA 4LJ8A 4LJ9A 3U3KA 2DPXA 1ZM7A 2J41A 4G01B 4JL8A 4IHQA 4B3DA 4N3NA 3EPLA 4B6EA 1P62B 1HE8B 1QBKC 1KTVA 2ZYVX 1RW4A 1I4LD 4QRHA 4I1UA 3CRMA 4V0OA 3U4QA 1IN7A 1VCMA 1GP2A 1Z22A 2P67A 2VPPA 3AVYA 4F91B 1M8PA 2FGKA 4YMSA 3I5XA 3LVRE 1C4OA 4IXMA 2HJVA 4LV5B 1E9CA 2GK7A 1S3SA 4C7OB 1E79A 2ZRJA 3U3OA 1NVVR 5GJBA 4YQFA 1SVWA 2WSMA 1VCIA 3WP1B 2RGAA 2IYWA 2O5VA 2RGNA 2W6JD 3WNCA 2ZRKA 4HDQB 3PENA 1AN0A 1RRGA 1PZNA 4HDCA 4Z1MA 3UWKA 2ZRMA 1CS4C 1D9XA 4TLCA 4NHOA 4TZ6A 3R9XA 1Z83A 2J0UB 5FTNA 3P26A 2J87A 3UATA 3VKHA 3NH6A 2JLXA 1Q21A 1JR3E 3H84A 4KBGA 4Q21A 3VTKA 1NMXA 1ZINA 4AYWA 4PZLA 4PZZA 4LWZA 1QHXA 2NO9A 4C0SA 2P6NA 3I73A 3MWLA 4BFWA 5L3VA 3MWYW 5E95A 1TUIA 4JYCA 4D80A 2CEAA 3KXKA 4D0GA 1DADA 2ZRPA 4PSKA 3ADDA 4E09A 4AKGA 2OESA 4IVRA 4IDQA 4MGKR 5J4LA 2Q0HA 5FR2A 4DT1A 5F3WB 2OM2A 5KDDA 1UDXA 4EJSC 2QTVB 2CVFA 3CWQA 1BH2A 1E79D 2C77A 4RCZA 4C9BA 2D7DA 4DLZA 2JLSA 4TMXA 3CX6A 5JLJA 2QEQA 4FD2A 2XTZA 2H17A 1WBBA 5TDHA 1CRPA 3U2QA 2F43A 2GXAA 4LY6A 1NVXQ 4A8JB 3C4JA 1GAJA 4HSEA 4Z1MD 4DUGA 1ZM3A 1IXRC 2QTFA 1T5IA 3QSYA 1L8QA 3R8CA 4GOKA 1E6CA 4Q1CA 2QGNA 2X77A 4A4DA 3IEUA 1MOZA 3W3ZB 2ZJOA 3TAHA 5LPNA 1PUIA 2C04A 2GJ9A 5G3YA 1CJVC 2JA1A 3FOZA 3EIQA 4Q7LA 4YXWA 3R9WA 4ZDJA 4C0HA 3VR4A 4DCSA 1GVNB 1XD8A 4TLEA 4ZO4A 4ACBA 3LXRA 2PJZA 1ZD8A 4NDZA 4RZUA 5GVRA 3RRZA 4P0TA 1WF3A 1FL9A 4B74A 1IN4A 2CCKA 4EPXA 3PUXA 2IXFA 4XH9B 4UXIA 4EAQA 2QBYB 4BFZA 3IBYA 2YV5A 2GBLC 2A5DA 1AKEA 1A4RA 2OLKA 2WJGA 1NRJB 1N0UA 3C15C 1CJMA 1XPUA 4DSUA 5EUQB 2QE7A 3K0AB 3K9LA 4Q7MB 4ESVA 3IPXA 3MLEA 2EYUA 5UKDA 2CLSA 2BEJA 1XFAA 4ZPXA 3F5FA 3DM5A 5JWRA 1GKYA 2X1VA 4PC2A 5JEDA 1U90A 1RIFA 3RSLA 1U94A 3PEVA 3QF4B 4MRRA 3W8NA 1FX0A 1N2CE 3KKNA 4DUGD 4KI0A 3HYRA 1YZNA 4IKEA 4IEEA 1W7AA 3ICEA 5FTJA 1R4AA 1TQ2A 4L4UA 1XPOA 4JLBA 1LF0A 1MO3A 3A4NA 2WWWA 2XTMA 3GJ8A 4YXWD 2VP6A 4HYYA 1QHHB 1DEKA 1BIFA 1FTNA 2FV8A 3AF2A 2ZYTX 4A6XA 4YC7A 4AD8A 3AP2A 4Q9JA 1XZQA 4DLXA 4HZUB 2QMEA 3KZ1E 2XITA 2AD1A 4HEJA 1CJKC 2XNDA 4JJZA 4KYUA 1OXXK 1T5LA 2RH5A 4E03A 2NGRA 1T91A 2I4IA 3B7GA 5M04A 2MSEB 2QE7D 3LXXA 2ZYWX 1CKEA 5C18A 1Z6XA 4Q48A 3P4YA 4Z8XA 1IAQA 3EIHA 2KBFA 1AQUA 4NCNA 1UEJA 5JRJA 4LUCA 1HE1C 2V6IA 4G5QA 2CK3A 2J7PA 2V8OA 4OHWA 4TMZA 2ZR9A 1N5LA 2GDJA 4XVQA 5AJZA 1R0YA 1T0JB 2O8BB 4Q01A 2QP4A 4QM6A 4DKXA 1SHZA 1Z6YA 2ZJ8A 3LDAA 4G1UC 1E2FA 2V9PA 3HU3A 1TPZA 3GLHB 4BEJA 3WRYC 1N6OA 4M9SA 1E2LA 1E2EA 5FTLA 1RYFA 2EWVA 2D06A 3SE0A 5BN3A 1UM8A 3O8DA 1TNDA 4V0MA 2BV3A 1HT1E 1U98A 2IUSA 4CIDA 4XSHA 3L0SA 5HCIA 4PC3A 1FZQA 2O52A 4YMTA 2VF7A 4O2RA 1YKSA 4GL2A 1T6NA 2QAJA 3I5YA 4DCTA 4LBWA 2XNDD 4NCJA 5H70A 5G41A 3FTQA 4JVSB 2RGGA 4AY2A 3UMRA 3T15A 2XX3A 1G7RA 2OBNA 1OV4A 4B32A 1QF9A 1N3BA 4HAYA 5FTKA 4TMTA 3LVQE 2DB3A 3EARA 4IEIA 1YRBA 4WVFA 4PANA 3LBHA 1QVAA 2CNWA 2CHGA 4URWR 5BYKA 1Z5ZA 4C0BA 1VHLA 5AUOB 4XSGA 3FFAA 2AWOA 2CK3D 1EFTA 1TMKA 2J7PD 2ZI3A 1KO5A 4AKIA 1KMHB 3ETLA 2R44A 2NZ8A 4QGGA 721PA 3ZJYA 2GILA 4KFRA 2ZITA 4BASA 1MV5A 1EWQA 1YR8A 2WWHA 3Q3JB 1E9DA 2R6FA 1X8LA 4NYIQ 2JLRA 4HUQB 1EESA 1GL7A 1KZ7B 2XZOA 5HZKA 4KAXA 2QAGA 1ZM9A 2ZRDA 2IWRA 3U61B 3U60B 1SXJD 1IY0A 5E7IA 1N5IA 1GKIA 2IHYA 4JVNA 121PA 4JLJA 4JSYA 4TZ0A 2ZS7A 2EFDB 4DXAA 3GEIA 3HPRA 1H8EA 2Q9CA 4ERNA 4L15A 2ZEJA 1JI0A 2ZS8A 4R7ZA 2F1HA 1A2BA 1E2MA 4CGZA 4TQUS 2XTNA 5CDFE 5C46F 3KL4A 4Q19A 3WMGA 1OFIA 3K0EA 3K9NA 1EG7A 4IDPA 1EFHA 2VEDA 1OIXA 3DMNA 3I32A 1RYHA 4BZQA 1J2JA 2ECKA 4D4MA 1DPFA 2CNWD 3KFVA 4V0KA 3VR3A 4AURA 5TARA 4F92B 4O0MA 1M1YE 1E2NA 4ZIRA 1ZM2A 1ZIPA 4ASUD 3VU9A 1DE0A 4M2LA 2NOAA 1JEEA 3EW9A 1XP8A 3IILA 4GZLA 5EXSA 4QHSA 3SJCA 2VF8A 3THYA 2J0SA 4Q1EA 5EP1A 1OPXA 1KYIA 1KHTA 1P73A 1YRAA 4OQFA 5FPYA 1Z0JA 1SHKA 2FZ4A 4GP7A 2GCNA 4KU4A 4B33A 1M7GA 4MYUA 1V43A 2BBWA 4CEJB 3NWJA 3AF4A 2WWIA 4JBXA 4QM7A 2HUPA 2B6HA 1R8SA 2FSGA 2OSBA 3DKPA 3IBGA 3PUVA 1ZNXA 1D2EA 3REFA 3V00A 3AVXA 1CTQA 1XEXA 3QPWA 5JJLA 1OYYA 2ATXA 2FMXA 2WAXA 3P4XA 4CEHB 1HTWA 3ONWA 5DHAA 3CRQA 4EPRA 1AZSC 2VH5R 4P4SA 1R7RA 3SBDA 1H8ED 3QBTA 2RGEA 3R20A 2PCLA 1EWRA 1DARA 3ZVNA 3IPYA 1SULA 2JLWA 3QE0A 2Z83A 3VX3A 3R9IA 4FMDB 1KK3A 4QJ5A 4F4JA 3K70B 1MABA 4X8OA 2GCPA 3WHKA 3T1TA 1IJEA 2G88A 2J5XA 4PX9A 1KO1A 2B92A 2D74A 3KUCA 4PQFA 2OXRA 3NG1A 3CW2A 4C30A 1WMSA 2HDNB 4NKRA 4A15A 1K6MA 1Z0KA 3ZVLA 3GMTA 3QY0A 4PPFA 4CW7A 3ZD7A 2G1JA 3IHLA 4QGFA 4TLDA 4QL3A 5SZKB 4BRUA 2MSCB 4MGZR 4FMDF 2V1XA 1PLJA 4YMVA 1Z6AA 3PG5A 4ZI2A 1W49A 1S0UA 4B3GA 2O0HA 3L0OA 2ZQ5A 1ZVQA 3CBQA 4OK6A 1E9SA 4UNRA 4LPKA 4JSTA 2EYQA 5SZJA 3FB4A 3K0CA 3FMFA 4OQXA 1JEDA 1BMFA 3ZVRA 3A8TA 1NG9A 2HLDD 1KSJA 1G7SA 3K1JA 1LNZA 1VCOA 4F93B 1NJGA 1XBTA 3LLMA 5FL7A 4RZXA 1FMJA 4R71A 4E07A 3KQLA 2AKYA 1W0JA 1JXOA 5FOXA 3GCGA 2MSDB 4ESHA 4URUR 4DLUA 1X8KA 1RE0A 2EW1A 1J8MF 4JJKA 1WP9A 2ZM5A 3VR2A 1XXHB 2VHQA 1E0AA 1T3SA 2Z0MA 1CU1A 1T3LA 3IIMA 2ZJYA 1XD9A 1YZKA 3PIRA 4QOSA 4A6PA 5J4YA 3QXCA 1IHUA 2HF8A 5D3QA 4Q4LA 4UKDA 1J99A 1Z2CA 4AKHA 2GVDC 2GZAA 2RCNA 1XEWX 2GCOB 1AK2A 3EZ9A 3H0KA 4PHGA 4AWXA 1TEVA 1JJ7A 2VP4A 4ZCMA 5C1BA 1NKTA 3U7EB 1CEEA 1VG0B 1FQKA 1RC8A 1OF1A 3MGCA 3T06B 2YWFA 1ZBDA 2FFAA 1G3MA 4BLOA 1W1WA 2L0XA 1BMFD 3B13B 3CX8A 5HPYB 3ZLJA 2EQBA 1ZRHA 4ARZA 3RHFA 1E1QD 2RGCA 4JYBA 1G3IA 4M53A 3X1XA 1WBDA 5FL7D 1FNMA 1II8A 2W58A 2ZS9A 3GLHE 4PPNA 1W0JD 5LB2A 2P6UA 5G40A 2ZRAA 5HE8A 2WJJA 4Q4AB 5FFMA 3LV8A 1U0LA 2GEDA 3T1QA 3PUWA 1PVOA 4OHZA 4HLUC 2IYZA 4V0LA 3GLGE 3FGNA 1E0JA 5E4FA 2VYFA 3VNVA 3MCAA 1E32A 4IDHA 3W6OA 4PC7A 5DI3A 1U8AA 2YNMA 2I1QA 3CNNA 2F55A 1JPNA 2FA9A 4Q18A 2B7BA 2JLVA 3IHWA 2FPLA 4QBFA 3TR0A 3OIVA 3TBKA 4AKEA 1XF9A 3TSOA 4D6PA 5CIQA 1XRJA 2A5JA 3PEYA 1KJZA 3CPHA 1GILA 1Z0AA 1H65A 1U0HC 3SDZA 3E5HA 5EXTA 4FIDA 1Z0DA 2OG2A 3U3RA 2K5UA 2P0EA 1RRFA 3I61A 1SGWA 2PBRA 2BM0A 2Q3FA 4KYIB 3D8BA 2BBTA 4II7A 1JB1A 1D9ZA 5EJEA 3B1ZA 1DS6A 1E99A 2OZEA 2F7SA 3THXB 1HT2E 5IK2A 2R6DA 3SJZA 4TLAA 1XTJA 5IDVA 1F2TA 2VSXA 1P3JA 4OJQA 3KJIA 1KNQA 3N70A 5CK5A 2Z6VA 3CRRA 1I2DA 4YDHB 1NLFA 1XCPA 5JS8A 1A5TA 5KHOC 5KSPA 3K53A 5H1YA 3HR8A 4NMMA 6Q21A 3AVUA 2QQEA 3KQKA 2R6CA 4UJ3A 1W36B 1SKYB 1LF5A 3RS2A 4HATA 2VP2A 2C9YA 4OHYA 4DB2A 3AB3A 4X8LA 1Q44A 2IS1A 4AIIA 4MH0R 1E98A 2OHFA 2RHDA 3EIEA 2ZJ5A 2O8DB 1YZGA 2OFXA 1R10A 3RS7A 1JQLB 2OLJA 4B3FX 3QNUA 2GZHA 2LKCA 2QUZA 4EJSA 4DLYA 1KSGA 4B48A 4B3XA 3DDCA 3GJ5A 3SS8A 5FOSA 5L3RA 5B64A 2Y8EA 3W6NA 4QHTA 4RFSA 1XU4A 2H8KA 2REXB 2QG6A 3VMFA 5KSYA 1NVVQ 1J90A 2BJVA 2QROA 5IK2D 4RD0A 5EE0A 1Q22A 2C78A 3KQHA 3C7KA 1KI6B 2KB0A 1ZU5A 4B47A 1GITA 1G20E 3SZRA 2ZJ2A 1OFHA 1US8B 5F98A 4HB4A 4EPTA 1IY2A 1IONA 1AQYA 3RS4A 3GJ4A 3CR7A 4RJLA 2OO7A 3H86A 4LBYA 4B3BA 3BXZA 5EE3A 1AJEA 1G8PA 3U5ZB 1Z0IA 2CE7A 1XEFA 4KO8A 3VX4A 3DKVA 5FBQB 4DVGA 3AVPA 1N6NA 1E3MA 4PO9A 2AKAB 2YINC 3BBPA 2QN6A 3ZS9A 2CLCX 4ACAA 2ZRCA 3GJ6A 3RLFA 4LHWA 3QKRA 1JR3A 4GT1A 3SNHA 1L7VC 4EQ6A 3AVTA 1JALA 2KBEA 4H9GA 3GJ7A 1VDZA 1NI3A 3C16C 3LFUA 3P1JA 2IS6A 1DAGA 1EFCA 2C9OA 2ZJZA 3CNOA 3U7FB 1QZXA 4GSYA 4G5GA 2IBMA 3V4FA 3BJIC 3MMPA 2GXQA 5LDDC 3D31A 4TYQA 3ZD6A 1DELA 1II9A 3EA5A 2FN4A 2A3RA 3LLUA 3X1YA 3THWB 4QHYA 2R6GA 2Z4RA 3CWZA 2WKQA 2BMEA 4D82A 4ZDKA 1UFQA 5JJKA 1EGAA 3UIEA 4C4PA 1YZLA 2ZAMA 2A30A 2KI5A 3LBNA 3ZZTA 5KDOA 2X2EA 1KDRA 3W9YA 3WMFA 1XTQA 4LZZA 2ORWA 1GZSA 4PC1A 4BQSA 3O8RA 3K8YA 1NSFA 1GOTA 4B2IA 2G9NA 1XMSA 1U9IC 1P5ZB 4D0NA 3TR5A 2QL6A 3BFKA 4CT4B 2QGZA 2W0MA 4XWKA 1XXHE 2G1KA 2OCAA 2YOFA 4EUNA 2ERYA 4IXNA 5L3SA 1JR3D 1W2HA 4A0RA 5CM9C 2ZROA 5CK4A 1KGDA 2GJAA 4A0HA 2P3SA 3AVQA 5EP4A 3HP1A 2GF9A 4R2IA 4DWJA 5L3QA 1JR6A 1Z8FA 2QM7A 3W8RA 3OIWA 4TMWA 1V5WA 2BVNA 5B58C 3K70C 2Q9AA 2YWGA 3Q7PA 2ZTSA 4A2WA 3KB1A 4DZZA 1WRBA 1II0A 3AP3A 4M8NE 3C5HA 1I2MA 2ONKA 3LQQA 4M1SA 1P72A 3HU2A 3Q85A 2V6JA 2ZE6A 5ELXA 5JBQA 1HEIA 3EZFA 4LI0A 4HAUA 5BQ5A 2IL1A 1U0JA 1KSFX 2JLYA 4ZDIA 3IDQA 1PJRA 3F0TA 1YR6A 3NEYA 4CEIA 4TL6A 4DLWA 4GDFA 4L5BA 2EU8A 4KSCA 1CRQA 3W90A 3BGWA 2ZSDA 2JEOA 2VHJA 1E4VA 4GMXA 2WOJA 1VG1A 4H1UA 5DHFA 2H1LA 3BIFA 1Q0UA 3ZQJA 5DLQC 3RS0A 2OE2A 3DMDA 2JIZA 4I81A 4NYJR 4UNNA 5HKKA 2NTYC 1UF9A 3IKJA 3PFIA 2AN9A 2O8FB 4OI4A 1KO8A 2BCJQ 3H4MA 2CE2X 2AD5A 2IUTA 2PCJA 2D2EA 3ZYCA 2NO7A 2A2ZA 5AWFC 3RVBA 2IYYA 1R5OA 3X1ZA 3U44A 1E2PA 2W00A 1W5TA 1ZIOA 4KODA 3UMSA 2WMNB 2YZ2A 3P20A 1COWA 1XMJA 3EC2A 1GUAA 2ZI5A 2ZVQX 3CPJB 1FW6A 4WZBE 2IYUA 4B3CA 3GP8A 3PJRA 4B75A 5KTYA 1W4RA 2W2XA 3SJAA 4ZV4A 5DI9A 4O3MA 1CULC 2DHRA 1S1CA 2QSYA 3DEFA 2Q6TA 4DSOA 3AKDA 3K0SA 4BLTA 4I1OA 4BFSA 1L4UA 3GJXC 3ZVMA 1G64A 2AL7A 4KVGA 4NYMR 4TTQA 3FHTA 2QMUA 2E9SA 3PXGA 1A7JA 3ICQB 3C14C 4JT2A 1GIAA 3OAAA 3RRYA 5DYIA 4EFLA 1ODFA 2JIZD 4YMUA 5HKKD 2CLDX 2OCBA 1TTTA 1ZNWA 2QP3A 2EFGA 2WWXA 3S1AA 1G6OA 2C8VA 3L43A 2P5SA 4MUBA 4OI2A 2FPMA 2GEUA 1W0KA 3BD9A 4B35A 4Q9KA 1Q1EA 3AF0A 4JVLA 3TVTA 4ZDWA 1IN6A 1ZCBA 4TLBA 3KUDA 1TX4B 5CIWA 3K0FB 2QQ0A 4A0FA 1CIPA 2ZPTX 1L2TA 3LWNA 2W2VA 2ZSBA 1UADA 4EFNA 1ONBA 1UPTA 1SVMA 1SVIA 1XD2B 2FH5B 2OCPA 4LV8B 4OI1A 3TVDA 3VNUA 2ODBA 4MRVA 4TQ9A 1SKYE 3VKWA 1COWD 2C99A 3O8BA 2JLUA 5E3HA 2ANBA 2VHCA 2HXSA 1YQTA 2DFKB 1CBUA 1E2KA 3BFXA 1XEWY 4KXFB 1D2NA 3FDIA 3WNDA 3AV0B 3LY5A 3EC1A 3HU1A 2WKPA 1JJVA 1SVOA 4PFSA 3SHWA 3PVSA 2HEIA 1P2TA 1FQJA 4M22A 2H57A 4B34A 4BFUA 3FMIA 1E9EA 2EWWA 4HUTA 2XGJA 3Q9LA 1WQ1R 3LX5A 4O25A 1G16A 1QHIA 2V1UA 3UMFA 1R0XA 3I72A 1CJUC 5GJVC 3OAAD 1LV7A 4D4LA 4R9UC 2YOHA 2H18A 5DE3A 4IOLA 4CDGA 1Z47A 1NF3A 4C7OA 4CVNA 3E70C 3CUEF 2ZJAA 4P4TA 4B44A 3FWYA 1W0KD 3L82B 2QENA 4Z8YA 4HAWA 2J45A 4NZYA 5FPHA 5J47A 2C96A 1LTQA 1Q1ZA 3AGQA 1A82A 4FI3C 2KWIA 4DLRA 5F9HA 1Z07A 2JJ2A 2C9CA 4TL9A 2J0UA 2D7CA 1F2UB 2AXNA 4MITA 2B7CA 4ZCIA 1TADA 1D5CA 3OIUA 4EPYA 3VKGA 2N46A 5FBWB 1G3RA 2GVZC 3KFXA 3SEAA 5CDFA 4ZIRB 2R65A 2CL0X 1NN3A 4L9WA 5D3MA 1W36C 3MWKA 1CJTC 5CITA 3BFVA 4Z51A 3THYB 1WB9A 3K09A 4KFSA 1I4TD 3QIAA 5KSZA 3BE4A 4XVRA 2DFTA 4NU0A 4OJKA 2VBCA 4PQRA 4Q1BA 4IFBA 2PX0A 1XEXB 1OYWA 4R2HA 2XB2A 2KE5A 1SXJA 4MA4A 3T34A 1FUUA 4P4SB 4KLZA 4NTZA 3GLFE 1J7KA 5G53C 3IUYA 2QPOA 4EDHA 2JJ2D 1KO4A 1Z08A 8OHMA 5K8LA 3EASA 3AUYA 3G5UA 3EWSA 4Z54A 5IT5A 3AKEA 1T0HB 2HV8A 5B57C 1MABB 1UJ2A 4MKGA 4LHYA 4LHVA 4AK9A 4KITB 1M7HA 3TUJC 1R2QA 2R9VA 2QU8A 4WAUA 4N1AA 4F38A 3TUZC 1ZNZA 4PAQA 3J81k 1O3YA 2IA5A 3RRMA 3QKSB 4ASUA 4JKIA 1G18A 1T9HA 3FMOB 3L8ZA 4XTCS 4L9SA 2ZIAA 2QBYA 4DDUA 3CX7A 1E9FA 3AUXA 1ZM4A 4PSAA 4PAMA 2IYRA 1WA5A 1HY3A 1D2MA 2FFHA 3G82C 1IN5A 4J0QA 5FOTA 3U3JA 1ZC4A 2UZ3A 2O8EA 3A1VA 1JPJA 2ZRBA 2J46A 4GNKA 4HAVA 1UBEA 2P2LA 1E69A 1MR3F 3FHCB 1M74A 4BZXA 3QF4A 2V7QA 2F9LA 2XNSA 1ZAKA 2IYXA 2VL7A 4GFDA 3WYFA 1F3OA 1NJFA 1OB5A 4EPVA 1KIMA 4MYCA 1G4AE 4RKFA 1OXVA 4LYHA 2CVHA 3B2EA 3WRXC 1PV4A 4URZR 3D3QA 3MAAC 4I1SA 2W0SA 3RDPA 1G9XA 1CP2A 4M1TA 3BWDD 4KBFA 3CH4B 3CF6R 4TMKA 4WXRA 1G17A 2QPAA 5AJWA 2O8CB 1QHHA 4IDNA 2ZSEA 4JLOA 4QC2A 2YHSA 3GD7A 3CZQA 1ESNA 3OF5A 3CZPA 5CLQA 4EFMA 5FBRB 2WOOA 3NBFA 4HZUA 5HR5A 1KY2A 1XWIA 3BC1A 1KI2A 5CM8B 3QG5A 3RAPR 4I99A 1U99A 3GFPA 2QP9X 4RD2A 2IS2A 2F1RA 1EX7A 421PA 1LY1A 3TLXA 2ZI7A 2C2HA 5FOVA 2QT1A 4Q7JB 3SN6A 5K8IA 5FUXA 2XAUA 2GRJA 5FI0B 2IT1A 5FTMA 1K8RA 3UG7A 4HLQB 4QJ4A 1QG2A 3BORA 3LO5A 4NL4H 1W5SA 2NQ2C 5P21A 3SYKA 4ARZB 5KSOA 4FXPA 4O2LA 2ZAOA 3LNCA 2HLDA 1U8YA 4OHVA 3GLIA 2V7QD 5B2ZA 4NP6A 3T61A 4IFEA 4KLNA 4RVCA 821PA 2H7VA 4BWYA 1FP6A 3SQXA 2HT1A 5EP3A 2O8BA 4DIDA 2VQSA 2IF2A 3OHMA 3PUZA 2KSQA 2WJYA 1OB2A 3NBYC 2PLRA 3DOEA 5JRZA 1YVDA 3GLHA 1LW7A 1CR1A 1S1MA 1QG4A 2HCBA 2B8TA 2QMOA 3FVQA 1F48A 2C03A 2QA5A 4PAOA 1OFUX 2A5YB 3QXJA 5DI3B 2RAPA 1F5NA 4U5XA 3NVAA 1DBSA 4K81B 3BB3A 3TIFA 5KYKA 3GLGA 1JAHA 2CBZA 3WY9A 5JI3E 4TYNA 1OIVA 4RSGA 3D6TB 5BN4A 2DWQA 5DYGA 2OFWA 3KQUA 5ANRB 3ASZA 5EQTA 1P61B 1P2VA 1Z63A 3W5JA 1KDOA 5JECA 4Q7KA 1KSHA 1TF5A 2J9RA 5HTKA 3CH5A 4Q4HB 2HYIC 2NO1A 2CMKA 4TTPA 1W44A 3EX7C 5EXPA 2DR3A 1KKMA 2X2FA 1MRNA 2Z4SA 3M6AA 3PITA 3Q72A 2BKUA 2V55B 4WBSA 3RC8A 1FFHA 1E1QA 2ASEA 5GADl 1UBGA 1KDTA 1NY6A 3V4RA 4YONB 1B23P 1R5NA 4M9QA 2CHQA 4TYWA 1BO6A 1W48A 2A5FA 4A8JC 3SC3A 2IEZA 1ZU4A 1F2TB 3UG6A 5FUWA 3ADBA 1S96A 4HUQA 1DO2A 4OKSA 4YMWA 1JBKA 1J8YF 3RRNA 2IS4A 1UBCA 2CL6X 4A9AA 1ZNYA 3CPEA 2NMVA 1UDWA 2IYVA 4XD7A 3B5JA 2A5GA 4QNMA 1DAFA 1VTKA 2AFHE 2BC9A 1GRRA 4HDOB 3MSXA 2AFIE 5C4MA 3PEUA 3MJHA 3F3YA 3V9PA 3I62A 4G5RA 3WYAA 2YC2C 2PT7A 3OZXA 4DCUA 4WA7A 3HPQA 4Q9IA 1E2IA 3ASYA 5JFGA 4MRPA 4CZ2A 3I8XA 1GNPA 4W9MC 4BPBA 2GESA 3NDBB 4RD3A 1E9RA 5G3ZA 1NG1A 2F1IA 4TSFA 2G0TA 1BOFA 2YWEA 3RC3A 3ZQ6A 4DEYA 3W3AA 3WYGA 5HE9A 1KZGB 2ATVA 2XZPA 2IUUA 4RFSB 1NL3A 4JVMA 2FJUA 1WCV1 3T12A 4RCYA 4DEXA 2HF9A 1OHHA 2A7QA 4FN5A 1Q12A 3QKUA 3TMKA 2DY1A 3IIKA 1WE2A 3LW8A 2ZR7A 3KTAB 4UNSA 4YDSA 1DOAA 1U9IA 4DC9A 3VAAA 4XD7D 3BAFA 1A2KC 1XMIA 4Q4JB 4B73A 3D7MA 1XMVA 1TQ4A 3MJRA 4GZMA 1TL7C 3SBEA 3A37A 4C0LA 4JLNA 3PV0A 3Q5DA 3ZIAA 2ZRNA 3BRWD 3A36A 4QXAA 2NPFA 2RGXA 4RZ3A 3QKRB 1ZMXA 3KKQA 4M1WA 2JLZA 4A92A 4DRZA 1EX6A 1Z2AA 4EQ6B 1CR2A 1IM2A 3UWOA 4JS0A 3VR5A 3CKLA 4PO8A 1KI3A 3RWOA 4TSFD 1ZUHA 4DLTA 1DVRA 5JHGB 4DCVA 1YZUA 3R7WA 1NNEA 1P9RA 4Q00A 4I4LA 4ZKDA 2NPIA 3L2OB 4HB0A 4U7DA 2H16A 3QJYA 1OHHD 4JLVA 1BKDR 1DG1G 3EPKA 3NH9A 5EXXA 4B2PA 1KK2A 1RFLA 2OBLA 1NBME 3QENA 4IOMA 1G8GA 2AR7A 4AG5A 4LYJA 1D6JA 2ZSAA 3B60A 4BLPA 3DPUA 1F60A 5JSZA 1H8HA 2IXGA 3T5DA 4TMVA 5AUQA 1VCNA 4XIGS 1E4YA 4LV6A 3ZIAD 1DAIA 2X19A 4EIWA 3IEVA 4WXPA 3BH7A 4HLDA 3B9PA 1HURA 1RVDA 1ZC3A 2BMJA 2WJVA 3A4LA 1KI9A 4TT3A 5FOWA 2VTKA 1SZPA 4PC6A 2VP5A 3KKPA 3TE6A 3AVVA 3U4QB 1XXHA 2F6RA 3NHAA 3SR0A 1VIYA 2LKDA 5EZ5A 1XPRA 1QHGA 4JBWA 4OYHA 5EUMA 3QVUA 4KCGA 2ORIA 2Q3MA 2Q9BA 4BUJA 5TVKA 1NKSA 3ZH9B 5EZ6B 3TNFA 3BB1A 4GBMA 1WXQA 2GCOA 3P32A 4IJMA 2FGJA 2IYQA 4Q9HA 3KKMA 2JCSA 1NVWQ 1R0WA 2BWJA 5E7JA 4A0GA 2WVJA 5B30A 1G6HA 3NBXX 2ORVA 2QM8A 4JMPA 4RFVA 3AGPA 2FG5A 4S2EA 1G8HA 1Z29A 4JL6A 5BN5A 4M21A 4AI6A 3SOPA 1FPMA 2IHBA 1XZPA 4CEIB 3E2IA 3T5GA 2XSZA 4XVUA 2CJWA 3QF7A 3RANA 5FBLB 1XX6A 2V54A 4WOPA 4GI7A 1H8HD 2RMKA 3SQWA 1N6LA 1KO7A 4W5JA 3ADCA 1G4UR 3FE2A 2VP0A 2V4ZA 5DIFA 3TRFA 1DAKA 3LW7A 3NC1C 4URXR 4RY2A 2I1VB 3K9GA 4WZ6A 4V0NA 5IHPA 4Y0VA 3QQ5A 4RD1A 2Q21A 4D4JA 3LQRA 3C8UA 4BLSA 4NYJQ 2AK3A 2ERXA 4TT3D 2DFLA 3TKLA 2CXXA 2F1JA 1KDPA 3FMPB 2H5EA 2J3EA 1RZ3A 1X1RA 4GPTA 2BIFA 2GBLA 2QNRA 1HUQA 2AHOA 3U44B 2PL3A 1P7CA 1G7CA 3LAWA 3QUSA 4PTLA 4BFXA 2F9MA 4BE7B 4DT1B 1IXSB 4Q03A 4CT5A 2FPKA 2IXEA 1OE0A 2WM9B 4MGYR 2XB4A 2J0QA 1UKVY 3AM1A 1YE8A 4FINA 4URVR 5AR1A 3ND9A 1U2RA 2CL7X 3EZ2A 4MKFA 5FUYA 4UNQA 2XJ4A 4LYFA 3TSWA 2GWHA 2F43B 4PSVA 4L8GA 2JJ1A 1S9HA 4JZKA 1G1MA 2XSZD 3NEJA 5BYJA 1GRQA 4F4CA 4E5UA 1B0UA 2ZUDA 4M1MA 3DZ8A 4BEBA 1EK0A 4N0DA 4NYMQ 2A9KA 1SKQA 3QBVA 4V02A 2OCYC 1S3GA 1VHTA 2NG1A 1PLKA 1JNYA 5J4VA 1E94E 2ANCA 3S1AB 1Z0FA 2ZRHA 1BYIA 1R8QA 1P75A 3BK7A 3FKQA 4G0NA 1ZW6A 5DISB 1XDBA 2JASA 1QHYA 3AF3A 1AGRA 5J5CA 3OE7A 3N2EA 2UKDA 3TH5A 2IK8A 2D4HA 1C9KA 3N5CA 1NIPA 1OH7A 2XXAA 2XZLA 5TMPA 2BMFA 2ZU6A 2EVWX 2NO6A 4FWIB 3ZZ0A 1KI4A 1UKEA 1VYTA 2QI9C 1E96A 3L0PA 4JLKA 5H68A 1HV8A 2WJHA 3WBJA 5JHHB 2JJ1D 1FX0B 1ZJ6A 4LRWA 4PQYA 1KK0A 2WJIA 2UZIR 2VHUA 1YU9A 3OFNA 4Q5IA 4IRUB 2QPTA 3X2SA 2O8DA 2PMDA 1HQYE 3WMEA 2CCJA 4GOJA 4US1R 1W4CA 5DGXA 3L8YA 4HB2A 2PEYA 4FW9A 2BEKA 4LJYA 3EPJA 1AIPA 5C4GB 1AKYA 4EKDA 2JGNA 5FOUA 2GKSA 2GEVA 1PLLA 2PZFA 1LS1A 4X8MA 5GJWC 3RS3A 4DIEA 1MKYA 4HLCA 3FHOA 4MYHA 4C2TA 1ELOA 1MO6A 3WHLA 1KI6A 3M0EA 2ZJBA 4IDOA 3OE7D 3A1SA 4P3YA 3IGFA 1US8A 1KJYA 2O0KA 1ETUA 5J4KA 2WHXA 4P32A 3B82A 1N6KA 3SFVA 1XB2A 3I1FA 1ZUNB 2OUKA 2IX3A 2G83A 1DAEA 4C3ZA 1OH8A 1FP7A 1N6IA 3KJGA 2JLQA 3VR6A 1QHNA 5KU1A 1MO4A 4POAA 3AKCA 1P60A 1W36D 1CXZA 2YKGA 2ZE7A 2FZLA 5D3MB 1OIWA 4OQNA 1RJ9A 2B21A 2IYLD 1U81A 2GJKA 3OFND 4QJ3A 1RRCA 1TAGA 4JLAA 2ZUCA 3SJBA 2GTPA 2HXYA 3GPLA 3CF2A 1KAGA 1ZYUA 4B2LA 3MRSA 4OHXA 4M0LA 2YVUA 3C41J 4DDTA 3KXLA 1KI1A 1KMQA 1MH1A 3CRVA 1EFRA 4Y0AA 4BZPA 1SXJB 5FR1A 4DSTA 2ODEA 1FUKA 4GOXA 3THWA 2Z43A 3B1XA 4BFYA 4DLVA 4LC1A 1K5DA 1KI8A 3HDTA 2HYDA 2C95A 4OK3A 5TY0A 5BWMA 2BM1A 1XJQA 4MKHA 4DDWA 1K5GA 2P65A 4LOAA 1ZD9A 2NZJA 1PUJA 4TL7A 2VLIA 1E2DA 3W6PA 2HT6A 4DB4A 2DBYA 2GZDA 3LX8A 4MKIA 2DFNA 5IF9A 4ZI3A 3IIJA 5JWHA 5KNDA 3GLFA 2VIIA 3WXMA 1R6BX 4TYYA 3M1IA 1AGPA 5LD2B 5GVSA 2WTUA 221PA 3IQWA 2GAOA 2YJTD 3GFOA 1GL9B 3PQCA 4Q02A 2WPDA 5FI1B 3QPUA 4UXJA 4M4SA 4PHFA 4LJ6A 3F8TA 3GFTA 4LHXA 2DCUA 1NMYA 1W46A 2QRZA 3NHBA 1FTSA 4C0AC 1SVLA 3DVLA 4ZCLA 5SZHB 4DCNA 4FWTA 3QPVA 2ZI9A 1VKJA 1G7TA 1FMLA 4MDEA 3DL0A 1M6NA 3L0IB 2YOGA 2R2AA 2DWPA 5K8TA 3GJ3A 2ZRIA 2GETA 3CR8A 3HJNA 2QAGB 3QOFA 4UQOA 5FBVB 2O8EB 3WBKA 2XEXA 2WKRA 1EFRD 2FFBA 4QBGB 1G8YA 3AF1A 1Q3TA 5KPJA 1YZQA 3BB4A 4FCVA 1KI7A 3DM9B 3A6PC 5AJYA 2V3CC 2FFQA 4US2R 1OFTA 4QG7A 1VMAA 1N0VC 4OL0A 2GK6A 1W47A 3O47A 5FPTA 4C2UA 1YHNA 4JBYA 2YYZA 3AVOA 3QVVA 3WP0A 3FFBA 2E1RA 2FX3A 3MG9A 4V03A 2BDTA 1VECA 4LJ5A 1HQCA 4LJ4A 4CRWB 5DSZA 5JS7A 1ESMA 4F4IA 1OLOA 2OT3B 1SVKA 2WPDD 2VP9A 1VPLA 5CB8A 4IOKA 1CR4A 3VU9B 1JQJC 2GXUA 1N6HA 4JIMA 2O8FA 2GXSA 4GP6A 1NLZA 4US0R 3ND8A 1AM4D 2SHKA 5KO2A 4LPSA 2WBLC
chains in the Genus database with same CATH superfamily
3H7AA 2XUKA 5BR4A 2HJGA 5I4BA 1OJLA 3RB8A 5TXGA 4TKZA 2WF6A 3G6KA 1MC5A 5CECA 4RADA 2ZXUA 4MR9B 3V1TC 4YRMA 3F1NA 3FOEC 2Z5FA 1VP3A 1L5OA 2O1EA 2OL4A 1L4MA 2X0FA 5KWSA 4CMIA 4YPVA 2XYVA 4FGUA 4A82A 3GECA 1YO6A 3KOZA 2QR5A 1NUAA 2C8JA 4QY5A 4KQQA 5A9SB 2ZSUA 4BWFB 1GDDA 3CURA 2R86A 1P4SA 3CUEA 5FSRA 4C4RA 2XFTA 4GI2A 3PNPA 3C4OA 4UAGA 4XGIA 3E9EA 1H2WA 4ARBA 2VDLB 2COKA 4FE4A 4EB8A 5CJJA 5JQGB 5K6AC 1NXSA 1JHVA 2V7PA 1H69A 3SPXA 4JJGA 2I33A 4Z9FA 1V6CA 1C2YA 1N5MA 3VVBA 1U0EA 2P6PA 2K87A 4NNOA 5FH9A 1JHUA 5IN4A 4DXBA 5BSMA 1MO5A 1UL1X 2O7NA 3LA6A 3GEHA 4V0ME 3ZNNA 5AQ9A 1DCTA 4HZIA 2FEMA 1TQ6A 1XDUA 4U6SA 1SBNE 2VDNB 2CJYA 3RUDA 3F97A 1K27A 2OBXA 2J9OA 1UK6A 1IAVA 5L51A 3I4LA 2GFQA 4G0YA 3BYDA 4AJLA 2MMCA 2P91A 3RRJA 3T52A 5JXHA 1FDIA 3T7SA 4IHJB 3RSQA 4NYIR 1BFDA 4I5IA 4AC9A 4F94A 3UAVA 2CUTA 3OJEA 1TO1E 2CT8A 4RPKA 2OCXA 3I9V6 5AJTA 1SXJC 3FUTA 3TDNA 4G24A 3RBZA 3C5WP 4RF4A 1J8VA 1IWOA 3UMYA 1GPBA 3ZWNA 1Y9EA 2I65A 2CD9A 1C4WA 3QA9A 3IP9A 2V8FA 1MCZA 2QJ5A 2CHVA 4D8UA 1UKYA 1SVSA 4EG5A 2GO1A 1M73E 3DW3X 4UBKA 4W5WA 1QWSA 4MW6A 3BWBA 2JGDB 2GD2A 4FUQA 1NIJA 3RUCA 3SJUA 4MJXA 2XOKA 4IBXA 4XT2B 4XQEA 5KAMA 3OJWA 1HBJA 1K6RA 2RE8A 3FYCA 5FNZA 3SYLA 5U9CA 1MRSA 1NV8A 1DP4A 3EAQA 2ZW9A 2UUBB 2W3HA 1USWA 3ZDQA 1EGQA 3O8OB 1DEHA 1PZMA 2I4LA 3IT3A 3IP7A 3M8KA 3RU3A 3O3CA 3PUYA 4E3LA 3CX4A 5BT8A 4BLUA 1L4EA 2FK8A 1UEIA 1PT5A 1U7WA 3H5WA 1VL1A 4ECEA 2N1BA 3ZE8A 4MW7A 4KN9S 3H8WA 5LBIA 2W6ID 5A4KA 2B83A 4CM4A 1UBLS 1HYBA 3O5AA 3OF3A 4D74A 1KJWA 2DGDA 4MDFA 2DUNA 2XDWA 4F7WA 1JU3A 2ZJ9A 3A27A 3TZLA 4Y6OA 3ZHRA 4OQZA 1W19A 1MBLA 5I45A 4ZRNA 3DSRA 3KDSE 1OTAA 4JL5A 4RORA 1IY8A 1JAIA 2VYVD 5L3ZA 2V1ZA 3LHDA 1PF7E 1WMDA 2TRSB 3UV7A 4WEOA 4ALMA 5BO5A 1W88A 1Z38A 2ZT6A 1X8JA 4YAJA 1DIOB 4H8RA 1K25A 3F8SA 4R8MA 2F3TA 4QRIA 1K55A 1WWKA 4TQGA 4RFLA 4Z4CA 3DTNA 4ONEA 3U3KA 1ZM7A 2VDUE 4B6EA 2DQYA 4MQFA 2ZYVX 4I1UA 3OX3A 4P34A 1IC6A 2IU6A 2G7UA 1QF6A 2PLNA 4I1IA 4HNTA 4C7OB 3Q7TA 4ZU3A 1V0JA 1VCIA 1ORIA 3ER6A 1RRGA 1IHOA 5G0VA 1LGYA 4NU6A 4YIHA 3PX2A 3EMVA 1KQFA 4MUHA 1EVEA 3USCS 1TUIA 4EW6A 4PSKA 4KQGA 4M0FA 4PVCA 2JVJA 3PBOA 2OM2A 3V67A 2HJ9A 4LRYA 1K4KA 2CVQA 4DG8A 5L95A 2EHDA 3DMFA 2QEQA 2XTZA 5AOAA 4DUGA 1T6XA 2QTFA 1E6CA 3W3ZB 2LGJA 3UOWA 4IUDS 1VSBA 4NENB 4F7DA 1GVNB 4DILA 4BFCA 1F6DA 3DQZA 3V8QA 1Z13A 5D3KA 3H19A 3TDKA 1LZLA 3EY9A 3K0AB 4CN8A 2BEJA 4MCJA 3HZHA 2RC6A 2V3VA 2ZCVA 4G5FA 4CL0A 4D02A 1NVFA 4QFDA 2YY7A 5B6PA 1E3JA 3DT8A 3TD6A 1CC1S 2H54A 1MJGA 3B38A 3CSDA 1DDGA 3ZNYA 2JJYA 3AEYA 4KTVE 3O4IA 1OXXK 5J3JA 2YTZA 4ZA2A 1YC2A 1XALA 3IF5A 5GL9A 4XVQA 1X70A 1G4HA 1UBOS 5EGSA 2O8BB 3L6RA 3N05A 4MLCA 3DT9A 3OLOA 3GDIA 2D06A 5EWJB 3NDJA 2OG1A 3P9QA 2ACEA 1FRQA 2VF7A 3MYYA 2X9QA 4JVSB 4AY2A 4BKMA 1V5GA 3EQ9A 2XX3A 2RHGB 4B84A 3JSAA 1FTYA 1RLTA 5K9ZA 1V8OA 1EDBA 4UHKA 3DDNA 4HNQA 4EATA 4NF2A 2AJDA 2XGOA 1OOEA 2R5FA 4UEJA 2B98A 1IY0A 3HNOA 1T36B 3CXRA 5BYAA 4TZ0A 3D8UA 2DETA 3GEIA 3DOJA 1U9ZA 2ID7A 2PSFA 4EH1A 3RJ5A 2GKOA 2XTNA 1BCSB 3EQZA 3K0EA 2JBAA 2A92A 4MRMB 3GWZA 4D4MA 3IAAA 1O89A 2XDQB 1P7VA 2H9IA 3ZVTA 1NQ5A 5EP1A 3WB0A 2QTZA 3OVMA 2FZ4A 3DEJA 1TUBB 1ST2A 4QM7A 2HUPA 2W0NA 2OSBA 3QPWA 4TWIA 3AM3A 2WAXA 1U2PA 2FWJA 1H8MA 1YFZA 3DLAA 4P4SA 5ALJA 1J06A 4XFKA 4OSOA 5JADA 2DMWA 5D84A 1KL7A 5TPZA 2H9YA 1H1LB 5ABPA 3I4FA 2NUTC 3DF7A 2BM8A 2Z2ZA 3ZVLA 4CW7A 4EZIA 3ZH2A 3NBLA 2F17A 3ZYZA 1OXKB 3U7QA 1KEKA 1QHEA 2FR8A 1ULSA 3LHSA 4LJKA 3FLAA 1L5HB 4NETA 1HEYA 1QH9A 5KYVA 2FB9A 3CZMA 2IU0A 3TL6A 1DG9A 1P5HA 3SF8B 2EW1A 3OPMA 1T3SA 4MTLA 4KQIA 2DPYA 3WMRA 1C3JA 3TECE 2NXWA 4L8WB 1XEWX 4F3LA 1QV7A 2DU8A 3B7WA 2WGWB 3N2ZB 3LY4A 1HLUP 4NBRA 3ICPA 1YMUA 2E4AA 3S29A 1LRKA 1FFGA 4CDNA 1Z73A 1VJ1A 4M53A 3SAJA 5HIMA 1OGJA 5LB2A 3PIIA 4BVBA 4FCFA 2VUSA 3JARA 2W42A 3PUWA 4XUGB 1EFDN 4DCGA 2VYFA 2RHOA 4X66B 5DV9A 1V5FA 3OPQA 1A9QA 3AR5A 1QV9A 2QRKA 1KJ9A 5LKAA 4RIHA 1TAQA 1ESUA 1CEXA 4YRIA 1Y9JA 2K5UA 1ZEMA 4WECA 5ALWA 5EVID 4YWZA 3HBAA 5IK2A 1ZH4A 3CZ5A 5H02A 1DAOA 3D5TA 1NLFA 1DLIA 1Z62A 2J3LA 1GN8A 1UMBA 2XVAA 1O03A 1LF5A 4O2BB 2PSSA 3RJTA 1F17A 4N40A 4AJHA 1N2JA 4MH0R 3T7TA 3IHAA 2ZTVA 4GOGA 3PE3A 3SX0A 2WPNA 2VRCD 1ODTC 2QG6A 2ZYRA 1AQLA 2OB1A 1Q22A 5CB4F 1KI6B 1ZU5A 4J91A 5I9TA 4K08A 1KJIA 1AQYA 3WLIA 4D9KA 3BMNB 4AF6A 1C80A 4IIJF 1HX7A 1VDZA 5TBMA 2MTBA 3CNOA 1QH8B 1KDWA 4PFJA 3FFXA 3GRPA 4L95C 4N7BA 2H1SA 1QG6A 2CWDA 3CUWA 4ZICA 1SCIA 1QPGA 4JGBA 2K2NA 1CUHA 3OD1A 4YCLA 1FLAA 2I2DA 3G0IA 1U04A 1T5DX 1RYMA 4ND3A 3SBXA 4JYMA 4GBED 4DUPA 4ZRRA 2Z5VA 1H0RA 3OT1A 3L4BA 4PGMA 4EEUA 3HL0A 3DZHA 5KTOA 1B6TA 1RFGE 3EZFA 2HDQA 4GNUA 3OTQA 2ODAA 2X0JA 2FDXA 1SVNA 2CVOA 4S1PA 1ODIA 1A5SB 2QRLA 2H1LA 4XIJA 4D9EA 3D3WA 3FPVA 4F84A 5HKKA 1EM8A 2DKFA 4GLFA 2C84A 4BIIA 4RTMA 4DMRA 4NABA 1FC0A 2YV1A 3X1ZA 5ALVA 3MAGA 2WMNB 1PW7A 3I58A 1FDUA 2RIPA 1YOVA 4CCYB 3HNPA 4C5CA 1PDVA 5HP4A 1HNZB 1U2QA 1IU9A 5IU6A 1ODFA 1BKYA 1ZD3A 2QP3A 3S1AA 3MTBA 1G6OA 1KJQA 4MUBA 3IURA 3QP5A 2QQ0A 2YXNA 1XDGA 4MRVA 3T4JA 2VHCA 1YQTA 1CBUA 4KRYA 1W6RA 1BYWA 2PQ0A 5C35A 2Y4OA 3RHTA 4U7HA 2IUEA 4Q0IA 5DHTA 3NNSA 4RJTA 5EA2A 2XGJA 2BI8A 1WQ1R 5DWVA 4QYXA 2QJRA 1ZONA 2E49A 4D41A 2H18A 3EXFA 2Z2IA 5K5BA 1ZJ5A 5AKGA 5H81A 5FPHA 1LTQA 4WF0A 3G31A 3RT1A 2JGLA 4S3MA 4N4AA 3SEAA 2BY4A 3FTDA 5CXXA 4UM7A 4I6EA 2IUFA 4RTLA 2FWMX 4QIHA 1T8RA 3BE4A 4HQFA 4NU0A 4MUIA 4ZJZA 2DWCA 5G4KA 3G5TA 4G67A 1PJBA 3LC0A 3JWHA 5D5QA 3TOIA 3BA6A 5JSHA 4Z54A 4FQ7A 1UJ2A 1R2QA 2HJHA 3I4CA 3BUSA 4AMYA 1ZNZA 3FMOB 1DCMA 3QEKA 4YUVA 4HG2A 3ADOA 5BSKA 1P1RA 4NG5A 2KLIA 5H83A 4J3JA 1NZUA 5LQMA 4R3JA 3VJRA 2CF6A 4XUCA 3QK7A 4NZZA 2YJ3A 3V1NA 3SMVA 4BWVA 1K2WA 4YFVA 1SKOB 1T9ZA 1GR1A 3FZEA 1Z9BA 3JAKB 3CLRC 2VX8A 5BVHB 2GHTA 4ZC8A 2VJNA 3GFPA 3ZU6A 4OCZA 1EX7A 5FOVA 4Q7JB 4BL2A 1K8RA 3FOCA 4R3AA 1GTSA 1ZOSA 5EP3A 2VQSA 3OHMA 4WGFA 1LT0A 3JWJA 2HCBA 1F48A 2DHCA 4J1NA 5F2KA 1MDFA 3CW9A 1TYZA 4U5XA 5BQXA 1UDBA 4UQLA 1RQXA 2WYOA 1D1QA 5KWVA 1D8AA 4U3JB 5JECA 1ATZA 1KSHA 2WKEA 4PLGA 3H5TA 3UAGA 2ASEA 3WS1A 2NW6A 5LNK1 3CXUA 1Y37A 4MB6A 2IEZA 3F4BA 3EF1A 3GEBA 1J8YF 3CS3A 1ZNYA 4XCVA 3I2IA 3JQFA 4DCOA 1JQ3A 4EMBA 3PDWA 5CX1B 5IMSA 3IWIA 4UAAA 2WEKA 2H5IA 3RJZA 4CZ2A 3ZQ4A 4CDMA 3L93A 5KINB 3T3OA 3L1VA 3FZCA 3B3AA 4LY0A 2WGVA 2D5IA 5DJUA 4LQ4A 1Y5NA 3CT4A 3T12A 3DD1A 1XRRA 1B8UA 3JZFA 4OQPA 1V3UA 1GAEO 2XB9A 2B9EA 1A2KC 3DTEA 4X1MA 1TQ4A 3MJRA 4YRJA 1KP3A 3A36A 1MV8A 4A92A 3E23A 1TZBA 4F4HA 4E5NA 3K5WA 1DB3A 4FSHA 2NZVG 2X5XA 4MMYB 5LYYA 1T4DA 4LV2A 4JLSA 2XE6A 3DL7A 3NONA 3EPKA 4F85A 2CXQA 4DIBA 2O06A 2V8CA 2ZQ9A 1FY2A 3R23A 2MR6A 2PJDA 2PFKA 4I1PA 3ITKA 3CEHA 1RVDA 2X3UA 3PQFA 5FQ9A 1UOOA 3U62A 4NIMA 1QKJA 1KDVA 3AVVA 4R8KA 4H18A 1WYCA 5HKBA 5IKEA 2Q50A 1A9XA 4UA9A 3B1FA 5DSXA 4M21A 4AWAA 2XD1A 4CEIB 4H60A 3T5GA 1L7XA 3COSA 4QQKA 1NJ6A 5FBLB 5DTTA 4NJMB 4ZT4A 3KT6A 5DIFA 4BV8A 3LQRA 1E1DA 3ZQUA 1RZ3A 4B7AA 3ICYA 1F3LA 4AJ2A 1G0OA 4WKCA 1LPSA 1WMBA 4B4DA 3ND9A 1U2RA 4PSVA 3DBVO 1WCIB 3UENA 1QFYA 4Z3OA 3UMGA 3F5SA 4MWTA 6NULA 4RTSA 2VHWA 1Z39A 4HGYA 3G2LA 2XLCA 4KR3A 1KJNA 4EOGA 1OH7A 4DR6B 3T1XA 4EW7A 1NYYA 2Y2LA 1RYDA 4WRRA 1W1UA 4JH0A 3RS9A 5HDDA 1LL5A 4LDPA 2SBTA 3HYCA 3LTNC 1SKBA 4YREA 1ZJ6A 4O4IF 1X74A 2X9VA 4ZOEA 1W4CA 1ZPDA 3LGAA 1HNNA 4EKDA 4BZWA 4ZGGA 1HLDA 3ZUPA 1M1NA 2M2IA 1V4VA 3LT5A 4G0XA 1ETUA 3SZOA 1J2UA 1XB2A 3I1FA 3A3IA 3QUTA 1RZUA 3RVOA 3KJGA 4FBMA 6ABPA 3ZG7B 5FBZA 3RK4A 1QZ3A 3FDZB 4GIBA 3WLMA 2Q07A 4WE3A 2WJ6A 2QM0A 2NT4A 1SXJB 3U7JA 3QVGA 2BCEA 4WFQA 1KOUA 1ODLA 2Z43A 1DMSA 4CUJA 1XJQA 2Y4AA 4QQFA 2W3GA 2NZJA 4LOAA 3WRXA 2JAHA 3W6PA 4I50A 2HT6A 3X2EA 4Y1GA 2QPNA 2PNJA 5IF9A 2OXTA 2I2FA 3WXMA 3FNEA 2Q1XA 3PYLA 3IQWA 4ZT7A 3UCXA 1MIOB 1PZXA 3QVKA 4YRBA 1Q7BA 1ISGA 1NMYA 3N2NA 3NIFB 3LUGA 4DE0A 2P4HX 2WMDA 3QPVA 1OI4A 3PR2B 1G7TA 1IB0A 2YYYA 2ZRIA 2NLOA 3GGPA 4G1MB 4FLMA 1O54A 3DM9B 5JDCA 4IYJA 5FPTA 1V16A 3KUUA 4FSFA 4V03A 5HTOA 5CTAA 1LNQA 5T8KA 5KQRA 4F4IA 3ZZ1A 3RFVA 1B4DA 2O8FA 1OFUA 1OGYA 2VUHB 5KO2A 2OV3A 5BORA 2RKWA 2QTLA 4W8GA 3T4KA 4NE7A 2VZWA 4BL5A 4FHCA 2IYTA 5I47A 5J2TB 5C32A 1R0ZA 1T8TA 1TT7A 4LJ7A 2E82A 4DMUB 1DRWA 4TL8A 4FYKA 1V1MB 2R7NA 3H7IA 4A23A 3F7TA 4GF5A 4I4TB 4TN1A 3QKTA 4H3HB 3QLTA 5FA7A 2WV9A 3B9QA 2Y66A 2QQFA 4ZOQI 4DR7B 3OY7A 1YDWA 2O1XA 3Q5EA 2BYTA 2IW3A 2VWPA 3KE9A 1TKRA 1Y9DA 3LP6A 5BMVB 1GFZA 1QDEA 4HNUA 1Y8QA 2ZQAA 3FKSD 5ALUA 4ENPA 1WW2A 3W8FA 4CMAA 5TQVA 5GY7A 1PR4A 4K6OA 4NQZA 1HWYA 2PGLA 1MTOA 3MT0A 1X7HA 5K4GA 2AFIA 4KX3A 2A84A 4XJXA 5H4HA 4Y9DA 1MBZA 4AO6A 2R1VB 2ZI4A 3JQEA 3QW4B 1Q57A 4D3SA 1E1RA 3QG1A 2C00A 5H80A 2V7WA 2VTBB 3B8EA 4R1GA 1A76A 2ZR0A 3S2EA 4N0QA 2D0DA 1AA9A 3QYAA 3H2GA 3D7RA 3T1SA 3UJ6A 3UT5A 1ONSA 2O05A 1OKKD 2EW2A 4NCKA 4WOKA 521PA 4LNUA 2TS1A 2G3YA 3OEED 3HP4A 1L5NA 1YZTA 1S4QA 1W8DA 3V42A 5IJ9B 1TS7A 1XVUA 3BFCA 1KKLA 4RZSA 1V8ZA 3U7GA 1T8UA 4IL5A 4HB3A 1Z4QA 1IQPA 4GH5A 2OSUA 2QWSA 4WEQA 1KZHA 2VCYA 1M76A 1M5RA 1NBMA 3Q11A 4TTJA 2C88A 2QY9A 1J70A 4NG2A 1V7ZA 4X90A 3CWCA 3FVTA 1P8JA 1E1CB 1I14A 4L2IA 2O8CA 5E7MA 3S7NA 4XIFA 4XFJA 2B4TO 4AP9A 3KWLA 4WNYA 4FGWA 1M10A 1KZ6A 2XMPA 4YJHA 4M1KA 1NNSA 3FD8A 1S6YA 3PX3A 2GTHA 1MPTA 5GQSA 3HJFA 3TK1A 1YDMA 1Z2DA 3A9CA 3EDYA 3JAMA 1KGGA 3COZA 5LP6C 3T4XA 3KPYA 4ID9A 2VATA 4EBNA 4Y1EA 1SWVA 1CZKA 2Y1KA 5DH9A 3I8SA 1X42A 1I1NA 4ALLA 4DLKA 4OPRA 2G6BA 4QFMA 4Q9AA 2VPWA 1DJPA 1RKVA 5HPFA 1OXTA 2NO0A 3L05A 3CG0A 4LXUA 2JCGA 2PU7A 2A0WA 4J16C 2XXAB 2CNLA 4EO7A 1PV2A 4PFKA 2WIBA 2EZTA 2Z3VA 4WZ5A 5K20A 1ZOLA 4ID3A 3KZCA 1HTTA 3LIIA 5DBHX 5ERYA 4EYQA 2Z5GA 3GDWA 3OI7A 4L8FA 4EV4A 1XCGB 3JSXA 3REQA 1WZCA 3AF6A 4P7KA 3TLKA 2CYAA 2FY8A 4NONA 1GO2A 3G7UA 3LGXA 4U00A 2V9AA 1IM5A 1EUZA 4XYBA 1G2QA 2HSDA 2BGUA 4EBPA 4OREX 3HFGA 1WXFA 3LR4A 3AEUA 3D1LA 3ETDA 2IPAB 4HDMB 5J5AA 2ZRLA 4P87A 4KVFA 4ZC1A 3WFZA 1Y7LA 4E3NA 2HX1A 4FJ0A 3U13A 5JSZB 1XHEA 4Z0PA 1RTTA 3DMTC 3TEMA 4MZXA 3EVNA 1DO0A 3RABA 2VBGA 3OOWA 2O0JA 3DA8A 3HJAA 1RCTE 1KTVA 2BHNA 4IO0A 8ABPA 4WWHA 4LOHA 3PHIA 4MKZA 5HUJA 1M8PA 1ZAYA 3I5XA 3LVRE 3TOZA 3L7MA 4FYJA 4ER0A 1Y4SA 4ER7A 3U3OA 3WYCA 2HCFA 4X3CA 1NBWB 3W5AA 2FUG1 4HDCA 4NLLA 3UCFA 1D9XA 4TLCA 1CHDA 1CW2B 1JR3E 2NUTB 2DOKA 2Z3ZA 2O99A 3ECSA 2ZQYA 1H94A 1BW9A 5JT1A 3M3DA 5E1OA 4BBTA 3NWPA 4O29A 3T9EA 4DLZA 2JLSA 3CX6A 3HDHA 4G26A 3D3OA 1I2WA 3BX1A 4GXQA 1SEPA 3GDOA 2QGNA 5LXTF 1VC2A 1CJVC 4ZMSA 1RWWA 2AJTA 2E4UA 4KDEA 4J0EA 1Q16A 4AS1A 4H4DA 4CTOA 4RYDA 2P8JA 3R3XA 5F4BA 4HH2A 1Y3IA 3C15C 3NZEA 3V7WA 4TLMB 3IE1A 1G2OA 1D2RA 1N33B 2X1VA 4E3JA 2X0EA 1U94A 3INRA 3QF4B 4L22A 2AZTA 1PX0A 3KAPA 4LYEA 2X4LA 5FTJA 2ADMA 1TQ2A 1YB7A 3EVZA 4TVSA 2M1CA 3EUFA 3GJ8A 1TFUA 1R6UA 3R5KA 4OP1A 1D6MA 4JUFA 3NASA 3ZEIA 5IJ0A 4HFJA 2VCEA 1F12A 3UE3A 2XNKA 1YGPA 2ILTA 3HBJA 5DNDA 4A5RA 2MSEB 3AFHA 5C18A 5K05A 1PG0A 2PM8A 3JASA 3CAXA 3ZDAA 3BFEA 3SS7X 1XNHA 3PZRA 1K57C 3QP1A 4Q01A 1VZ2A 2ECQA 5F1PA 1CUEA 4D79A 5SYAA 1H4SA 2WB4A 2YQ5A 4HFRA 3D8SA 4MBFA 3ZCVA 3OTOB 1CUBA 3DOHA 4CMGA 2H7XA 3T15A 2HDHA 4ISCA 2UAGA 3IDSA 2H07A 3ER9A 1QVAA 3SK0A 3JRWA 3DTVB 4PW0A 3GH1A 3ZV4A 4CKBA 3K2BA 1PWDA 3IELA 2K7FA 3IS2A 4O08A 2OO3A 4AKSA 3CUKA 1EESA 1GL7A 1A72A 5C52B 4JVNA 3A3EA 4RGBA 5EY5B 4XDZA 3PVZA 3IT2A 4QY6A 4PEVA 4KN5A 4L50A 3JVEA 3CGGA 4FFBB 1DRKA 2CNWD 5TARA 4F92B 3U81A 3DEKA 5CX7A 4ASUD 1IM8A 3PR3A 1JEEA 3SJCA 5DGIA 2VF8A 4BKPA 5AW8A 3S4YA 3AIOA 3BFFA 4P81A 3IBGA 3L0BA 3LT0A 4JGPA 2QW0X 5BN1A 5FQNA 3ONWA 3IYLW 3DZCA 3E9YA 3R20A 1YBMA 1OWMA 2D1TA 1SK8A 4DR3B 3AUJB 5CHUA 5KZHA 3ZWQA 3L7LA 2OPBA 2B92A 1XL0A 2P9VB 2VTEA 5T6MA 3GUUA 4NKRA 1JHXA 3MXRA 4UUQA 2BL4A 2WILA 2XR1A 4CG0A 3C3JA 4YP7A 3ITBA 4KUKA 3UW1A 4QU9A 3HUNA 5B2FA 3DVAA 1QVVA 1U7UA 2QM3A 3CBQA 1NVDA 2QQ5A 1BZYA 1KSJA 2XK1A 3OTIA 2I7XA 4C75A 3AHGA 5EIBC 1EXDA 1QU2A 3AI1A 3K8OE 4MQMA 1DRVA 1JH9A 4FFRA 1IHUA 4AKHA 2GCOB 4XCQA 5C1BA 1RC8A 1FXSA 1TT5A 4W8OA 4BLOA 5JTUA 2VHYA 2UVPA 1ZRHA 2J4DA 1NX6A 1R00A 1L3LA 4R3UC 5K0LA 3MCWA 1GGNA 3JRNA 3QP2A 1T2EA 2E6UX 4KXXA 1N8KA 2VTVA 4DARA 3VNVA 3MCAA 4AKTA 4PC7A 2C1ZA 3WKBA 4YUYA 1UK8A 2B7BA 1LI7A 4O2AB 4HQNA 3OIVA 3ENWA 2H59A 1KJZA 1T4CB 2XFSA 1RRFA 3K7EA 4QXOA 1Y1KE 4C4XA 5BV8A 3FLEA 5EMNA 3ZHYA 4EGAA 5REQA 5JS8A 4GO1A 2YNMD 2Q0OA 1PR9A 2A0XA 3EGXB 4TKMA 5H0IA 2Y1FA 4HATA 1FFBA 3EXEB 6ADHA 5EWLA 2Z1NA 2GZHA 2LKCA 2ZULA 4MEAA 1K9VF 1P9LA 2G76A 4WJLA 5KYNA 4I2VA 1KKUA 2G28A 3AM5A 2HMUA 1WHTB 1J90A 2EGGA 3PC6A 2R87A 2Z9BA 3MQ2A 4HB4A 2YS7A 3TZ6A 1E64A 1IY2A 2PS1A 5EPEA 3EVCA 1NFFA 3QHPA 4OHCA 3PFWO 2BGJA 4UMDA 3HCCA 5A0TA 5FBQB 3AVPA 1N6NA 3CEAA 2YZGA 4ACAA 1U0TA 1I13A 1I33A 5FPQA 2R85A 2KBEA 1V6SA 2WAFA 1VI2A 2W1TA 3WISA 3FNGA 1UZLA 4ZARA 3EA5A 2P1RA 3UUWA 2OOSA 4OVKA 2P7JA 1CUDA 3WRZA 4OSPA 1NSFA 2B18A 4D6YA 4B2IA 1U9IC 2AC7A 1NW5A 4KX5A 1A4UA 2W0MA 2P2DA 1GQQA 5DF7A 5C31A 2FPPB 4J0JA 3K6RA 4E2WA 3KYZA 4TV9F 4A2WA 5KQGA 3C1TA 5M29A 4R9RA 1RLJA 3HU2A 4DTCA 1SUPA 2ZE6A 1C7QA 2R97A 4E5MA 2Z56A 3PJEA 4CQMB 1XK7A 3D3JA 4E6XA 3DWIA 3ROPA 1IZ8A 2VHJA 4BP3A 3AFOA 3KLBA 3SZGA 2X2OA 2OE2A 1KEVA 3WIUA 4WZAB 3FUUA 3TB6A 8LDHA 1OMEA 5ARDA 3KVOA 4MV4A 5CXQA 4KODA 3R0QA 3MZEA 2IXTA 1ZXLA 2BI4A 1ETHA 1KAMA 3GZTB 3GT4A 2G9QA 2PK3A 2VT6A 4WA8A 1PR0A 1JWZA 1PK7A 3K0SA 3GJXC 1NV9A 4YT8A 4NYMR 2QOEA 4G63A 5H7XA 5SICE 4O4HB 1ZNWA 3L43A 2P5SA 4OI2A 1X1BA 2F9FA 4Q9KA 4K05A 2X8BA 4BTVA 3E03A 3K0FB 5K99A 2K6GA 2ZSBA 1UADA 1UPTA 2N9UA 2VTDA 2J6BA 3O8BA 5D00A 5DBFA 4HBUA 3A0SA 1JJVA 1FQJA 3HGMA 3ZXXA 1E9EA 1RD4A 1ISMA 1LV7A 3IAM1 4XX0B 2QK4A 1YFJA 2HA2A 2QENA 2XUGA 4FYIA 3W79A 4NJOA 2D7CA 1F2UB 3IL2A 4CLCA 1U0OC 3QWIA 3H1AA 4R0NA 2A9JA 1NN3A 3NULA 5D3MA 4NXBA 3PKJA 4JJ8A 4OO3A 4G2NA 3MS6A 2WQ7A 2JCXA 2OKGA 1GLNA 5BOSB 3TTVA 2PX0A 2QRVB 3C3YA 3T34A 1QCZA 2HIMA 2FOXA 3JXEA 4NTZA 1Z4PX 3FLMA 2OVFA 3CUSA 4KAFA 5K8VA 3EWSA 5CAEA 4FR5A 3AKZA 2OCKA 1DT3A 1C3EA 1Z4IA 2DTDA 4L6AA 4N1AA 3IB6A 1PGPA 2ZLBA 3K6SB 5HQ3B 1G18A 1KZ4A 3L8ZA 3OQIB 4K8RB 4PSAA 1OTDA 4LZNA 1MUUA 2IYRA 2UZ3A 4R2WA 3SEQA 5AHXA 2P1DA 3D81A 3UPOA 1ZKMA 4GKJB 3TGLA 3L0DA 4GFDA 1NJFA 1F06A 1OXVA 2I6GA 3HNRA 1V7QA 3OQOA 4R3WA 4Y7PA 4KUOA 4X95A 1SDEA 1MAAA 1JEYB 4L75A 3A1EA 2C4TA 2YY5A 3GD7A 4LE1A 2B5VA 3K96A 5FBRB 1XWIA 2I29A 5CGXA 4I99A 1S7CA 4QJ4A 4ER5A 4UTNA 4JQYA 2JCBA 1IYPA 1YFLA 1Z4OA 4KW7A 4HDRB 1DNPA 3Q3VA 1XZDA 1SCUA 3PQDA 1GV0A 4ZYXA 3GLHA 2C03A 2QA5A 2M32A 5DI3B 2NUAA 3TIFA 3LIAA 1ZZGA 2O9BA 2FETA 2VDKB 1P2VA 2EJTA 4IFTA 4Q7KA 2H2GA 3O4VA 1WXHA 2NO1A 2PGNA 3P2MA 1HOTA 2H1RA 1MRNA 1X1AA 1E1QA 4LJSA 3T9CA 4HYEA 1B23P 2I7DA 3UB6A 4LZOA 4A8JC 2OVBA 1S96A 2XQKA 2IS4A 3WGKA 3CPEA 1G6Q1 4G86A 3B6JA 2ONZA 2W3DA 3G49A 4F11A 4YJ2A 1U7ZA 2PA0A 3AR4A 2QL7A 1U1EA 4MRPA 2QN1A 4FK8A 3AY7A 3LU1A 1NG1A 1HG0A 2RI6A 1BXZA 1EIZA 4D7AA 1JHRA 1UP4A 1IBMB 2WVAA 2G08A 1WE2A 4Q9DA 1U63A 3W5VA 2PU4A 5FATA 5FUMA 1AX9A 4QXAA 4X93A 4AUNA 1Q6YA 4RLFA 4BNZA 4DRZA 3LICA 2QXTA 2BLNA 3CKLA 4W82A 2GB4A 1UJCA 3LPDA 2AW5A 1NRWA 1NNEA 1F0KA 3A3DA 2Q5EA 2AJCA 1FTWA 3LI2A 3FVWA 2RH9B 1GQYA 5AVOA 2OLEA 4JLVA 2XROA 2GFIA 4PIMA 1Z68A 1RWMA 4PV7A 3DDOA 4WESA 4PYQA 1SELA 4FB4A 2XUPA 4YCMA 1T6ZA 1E4YA 3HUDA 3H9GA 1DAIA 3R3ZA 2NUBA 3LT2A 1ZC3A 3CIFA 1G8MA 4WBNF 4JI4B 3GPDG 3L77A 3NHAA 4CTJA 4Y2PA 1Y82A 4UVHA 4O5OA 2KX6A 3QVUA 4KCGA 2LZ0A 1WXQA 2G6TA 3P32A 3D2AA 2FN9A 3EMDA 2QJFA 4A0GA 1G6HA 1G8HA 3GA7A 4ERXA 2H4JA 2BAGA 1XZMA 4R81A 2OCGA 1SRQA 1JSRA 3R7AA 3LW7A 3P9YA 3MR0A 5ICFA 2AK3A 3DE6X 3NALA 3HKDA 4CPKA 2H28A 1FR1A 4FDAA 2V8BA 4QUAA 3M1LA 3MWDA 4DT1B 1PNOA 4N48A 4Y98A 1YS9A 2PX4A 4URVR 4BNDB 2Z58A 4EX7A 5DTJA 4XKJA 3A31A 4WZBA 4OQDA 3DZ8A 1SKQA 2WU3A 1VHTA 4EEXA 4CR8A 2JFVA 4H6JA 3JQ9A 2AV6A 5EIAA 3AF3A 1AGRA 3HJTA 1PFYA 1ZESA 3KC2A 4R68A 3PYXA 4H3VA 2LNDA 3E2MA 1SBHA 1QV6A 4C3UA 1S2LA 3STHA 1IBSA 1M8GA 5TRTA 3NY4A 3HVKA 3LCMA 1WZIA 1HV8A 1DC7A 3ID6C 3MQQA 3AETB 3GZNA 1YBVA 1AB5A 1SUWA 3PXXA 1AIPA 3LZ6A 3FCEA 3K2QA 3DXXA 1Q0QA 1DC3A 3SFVA 1O95A 2Y0EA 2FQQA 2KHZA 1EDDA 1RQ7A 4MK4A 3WGJA 1VI6A 4CFSA 2FLKA 3EH1A 4MIEA 4OLAA 4U9UA 3EGWA 3OTGA 1OWPA 1JV2B 2W4QA 4B2LA 3CE9A 3BD8A 4N92A 3DPIA 2VPZA 3CRVA 2WZXA 4Y0AA 2IKQA 4JQCA 1KQ3A 3VZBA 2BM1A 2P65A 4ZHSA 3G5MA 4NXEA 4AJEA 5B5SA 3FAZA 3P5BA 2XT6A 4TWAA 3PLAE 2XBUA 4OG2A 2HHJA 1QMFA 3QPUA 3KYBA 1JL3A 1QBGA 4AUMA 3O8LA 4NRDA 3VC1A 3NIAA 1ECJA 4BQQA 1V45E 2W6QA 3M83A 1G8YA 4C0WA 3JALA 2AX3A 1IH8A 1N75A 1T9DA 1VMAA 1UM9A 1O96A 1N0VC 3WB9A 1SCAA 3SQNA 3QMVA 2BDTA 5LP6B 3HZRA 4BVAA 4LQCA 4QB8A 3F3SA 4FZ5A 5LMUB 1QH0A 4UM9B 1BC5A 5TQ2A 3NDGA 4V0RA 1N6HA 3H83A 4GP6A 5JAMA 4IILA 3X44A 3CV3A 1EX1A 1JHPA 2R7MA 1ZLYA 4UHHA 1R4MB 3RNLA 1FVFA 4F96A 4QPRA 3RXXA 2YX1A 1C30B 4QFBA 2XUOA 2OXCA 4EENA 3VFFA 1TOAA 1DXOA 3K9HA 3OMXA 2O5RA 2I2WA 3UOAB 2HAEA 2ISSD 4II2A 4LF8B 2OAQ1 1HM5A 5KNBA 5JCZA 2VO1A 3D4NA 1HFWA 3D02A 4RA9B 2XCSB 4EG4A 3VOTA 1L5FA 4S2UA 1HGXA 3HXOA 4LDJA 2J30A 4W99A 1TM7E 4EPWA 4WZAE 2IV2X 4CF7A 5GLCA 3S8MA 4UNPA 3DFUA 4UBLA 3QXGA 1V9SA 2C8LA 4G8CA 3WGYA 2XXBA 1F6BA 4ZREA 1Z6TA 1MG0A 1FFDA 5F83A 4BN4A 2C4WA 4PXSA 2VT7A 4B3RB 4BN0A 2P08A 3VDNB 3D7LA 1J0EA 1MW9X 3OJLA 3WK9A 4EG8A 2EEZA 3DPSA 4AZWA 3WV4A 5L6MB 3DNFA 5E2AA 3VDRA 2Y91A 4QUGA 1AHIA 4YFMA 5TSDA 2ZQCA 2ZRFA 1OLSB 4IF4A 2E18A 4C7KA 3EFHA 3TAUA 2Z9DA 4CLOA 3IV9A 3OPYI 5IS1A 3KYJB 2VJPA 4RH0A 3N2KA 5FJJA 4QGAA 5C1OA 2VDJA 1N5JA 1YMSA 1XRQA 3H17A 4PZUA 2HMVA 2R6R1 5ICEA 4BNJA 4NOKA 1E9BA 4N9WA 3QJ5A 1A9ZA 5EIEA 3HKBB 1SCBA 1PFLA 3N6VA 2J0EA 3FBTA 4JGGA 1EUCB 3C85A 1XTRA 3HLBA 4W9NA 2O8VA 4D98A 1EE1A 3LLSA 5L8MA 4URHA 2NU9B 1F1JA 3HBRA 2R7AA 3BE6A 4KE6A 1KDSA 2O9CA 1KNXA 2F3QA 2CJWB 2VDRB 4IHAA 5DGTA 2ZE8A 4TUYB 4K8OA 2C83A 1JLLB 2G07A 1UXKA 3AHFA 2PQMA 4E13A 5IXYA 1UPCA 2MSWA 3E0XA 4ZQIA 4OAQA 4OHBA 3ABIA 1SBZA 4QREA 3ASVA 3UAOA 2ZLYA 5ALOA 4YWHA 4JC4A 2Y0BA 4PN3A 2CMHA 5EKXA 3B47A 4DV4B 3M4YA 3AHEA 4RLSA 1TZCA 1U2DA </