2V9AA

Structure of citrate-free periplasmic domain of sensor histidine kinase cita
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
105
Chain Sequence
TEERLHYQVGQRALIQAMQISAMPELVEAVQKRDLARIKALIDPMRSFSDATYITVGDASGQRLNAKSYVSVRKGSLGSSLRGKSPIQDATGKVIGIVSVGYTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENSOR KINASE CITA
publication title A Ligand-Induced Switch in the Periplasmic Domain of Sensor Histidine Kinase Cita.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transferase
total genus 21
structure length 105
sequence length 127
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2v9aA00
5G4YA 1LSXA 4HH2A 3VOLA 1TS0A 1MZUA 3LIBA 1OT9A 3HJIA 1DP8A 2Z6CA 4WUJA 2INWA 5I5LA 3B33A 1V9ZA 3VE4A 1VB6A 3UMEA 2P7JA 2J80A 2PDRA 3D72A 4GW9A 4YWZA 2V0UA 5F5YA 3UB8A 5G4ZA 1V9YA 4F3LA 2L4RA 3H7WB 4L9EA 1WA9A 3E4QA 4XT2A 2K7SA 4GS9B 3GDIA 4MN6A 2I9VA 4I3JA 5F68A 4B9OA 4HNBA 5HDDA 3F1NB 1GSWA 1OTIA 2L1MA 1JNUA 1XJ2A 3G6OA 2YKHA 3A0VA 2M1CA 4NXEA 2W27A 1D06A 4JGQA 3K3CA 1LT0A 3NHQA 2JN7A 3PYPA 2PR6A 3A0SA 4H6JB 5DKKA 4BBVA 4JGOA 2YKFA 2QHKA 3BWLA 1T18A 3VE3A 2Z6DA 4M4XA 5F69A 4EXOA 4GHIB 2GJ3A 3NOUC 5KIZA 3MXQA 5AVFA 1T19A 4R3AA 3F1OA 5IS1A 1P0ZA 2WKPA 4HI4A 5HZHA 3UB6A 1XJ3A 4HJ6A 5DJTA 3MQQA 3LI8A 2PR5A 1GSVA 3H82A 4WF0A 3LIAA 4E04A 4HQAA 3RTYA 3UB9A 4BBTA 1S1ZA 1XJ4A 3BY9A 2D02A 1OTAA 3F1PA 1T1BA 3IBRA 4HY8A 4HOIA 4L9GA 3E4OA 2L0WA 1DP6A 2QJ5A 1DRMA 3EWKA 5EFWA 1N9LA 1T1AA 2W0NA 3FC7A 4EEUA 3UB7A 4R38A 3CAXA 4I3IA 1DP9A 1Y28A 1KOUA 1TS7A 5A8BA 1XJ6A 2QWSA 1TS6A 4WL9A 1OJ5A 1ODVA 4HH3A 3SW1A 4NXFA 1X0OA 5TBMB 2OWJA 3IS2B 4JGRA 2A24B 4I39A 1OTEA 4JGPA 4KUOA 5DKLA 5J4EA 4EETB 4LPZA 3OLOA 3NOTC 1NWZA 2VEAA 1LL8A 1XFNA 3T50A 3LICA 1S67L 4HP9A 4EEPA 4RQ9A 2KDKA 3H7WA 3ICYA 3E4PA 3EEHA 1UWPX 4GS9A 4DJ2A 5AVEA 1UGUA 1N9OA 3HJKA 5IU1A 3F1NA 2R78A 2ZBBA 1OT6A 2PD7A 2PD8A 2PYRA 3NOPC 4NXBA 3UMDA 3LYXA 5HDCA 4R6LA 3LI9A 2V1AA 4I3AA 1GSXA 5HDSA 5J7EA 4HHDA 3H9WA 1TS8A 3LIEA 2V9AA 3RH8B 4H6JA 4NXGA 2ZOIA 2H28A 2VV8A 3ULFA 2JHEA 4GHIA 5HD5A 3C8CA 1F9IA 4EW7A 4KQDA 2OOLA 1F98A 1OTDA 2V0WA 3MJQA 1BYWA 4F3LB 4HP4A 4XT2B 4I38A 4HIAA 3MQOA 1G28A 2KX6A 2ZOHA 4LLOB 2QKPA 4EQ1A 2D01A 3LIFA 2OWHA 4GCZA 3C2WA 3P7NA 4WN5A 1S1YA 2VV7A 1EW0A 1S4SA 2WKQA 2BASA 4LRZE 3LUQA 3BY8A 4EESA 1D7EA 4K08A 3UE6A 3GECA 3KX0X 3MFXA 1S4RA 2HV1A 4EERA 2EA9A 4BBUA 4HJ4A 5DJUA 1S66L 5HWTA 5HD3A 3F1OB 1LSWA 2QJ7A 3ZQ5A 1P97A 4I5SA 4WLAA 5HWWA 5HWVA 4KUKA 1OTBA 4LRXC 5F6AA 3NJAA 1XFQA 5TBMA 2WKRA 3H82B 4HJ3A 2CMNA 1N9NA 3IS2A 2B02A 5J3WA 2PHYA 2A24A 2VV6A 5HSQA 3K3DA 1UWNX 4R70A 4PKYA 3F1PB 4DJ3A 2V1BA 1OJGA 2PYPA 2VLGA 3LIDA 3A0RA 4MN5A 3CWFA 3CLOA 3PHYA 4PKYG 1LSVA 3FG8A 3MR0A 4LRYC 1T1CA 4L9FA
chains in the Genus database with same CATH superfamily
5G4YA 4HH2A 3FYZA 3HLEA 3VOLA 1MZUA 2GX5A 1JWVA 2GNXA 5LBRA 3OPHA 1OT9A 2XEPA 1LL9A 1V9ZA 4E6WA 3IF6C 5CGXA 1K0KA 3D72A 2HDUA 1NRFA 4N92A 3VMAA 2V0UA 5G4ZA 1W63M 2W3FA 3TW8A 4CQHA 5EM1A 2JC7A 4XT2A 4U0XA 4O7DA 1IOUA 3K2NA 4G3VA 2HDQA 5GHYA 4ETZA 4X25A 1XA7A 2L1MA 4M3KA 2UWXA 3EGDC 3HLBA 4MMNA 4LCLA 2ZL1B 4NXEA 5FL3A 2W27A 3MKEA 4MDZA 5CTNA 1D06A 2OV5A 5AQAA 3IXHA 4P85A 2PR6A 2W3EA 5DF7A 4H6JB 1YM1A 3IXGA 2YKFA 1N9BA 4CLCC 3BWLA 4WZ5A 3NY4A 1N4OA 1T18A 3AGEA 3VE3A 1K6SA 4NK3A 2ZC3B 1FCNA 1DY6A 2ZQ9A 4ME4A 1P9WA 3RJUA 3MXQA 4R3AA 1P0ZA 4MN7A 2CC1A 1SKOB 3N8LA 3UNWA 1XJ3A 4R23A 4CPKA 3C38A 2XH9A 3TG9A 5EOEA 1YLWA 3LIAA 4KZ3A 3QP5A 3QHYA 5FQMA 3UE0A 3UB9A 1OMEA 4DXBA 2VJWA 4BBTA 4EBPA 2VGLM 1LI0A 5DF9A 3W4OA 3OPPA 1OTAA 3IX4A 1T1BA 3IBRA 2O9AA 5DFYA 1CEFA 3FKVA 4L9GA 4E3IA 3O86A 3ZVTA 2W1RA 1S0WA 3W8KA 3UB5P 4EUZA 3VOYA 3T4OA 3S1YA 3GVBA 4LV3A 4EEUA 1TF1A 1HLUP 3T12B 1TVFA 3S4XA 4I3IA 1DP9A 4OONA 2ZC6B 4N9LA 1QMEA 4BQMA 1W5DA 1IKIA 1OJ5A 4HH3A 3SW1A 3CUEC 4CLCD 1CEGA 3GR2A 3G30A 2OWJA 3IS2B 3PBSA 4JGRA 1KVLA 3ZGAB 2WGWA 5E2EA 5AQBA 4BMWA 3OLOA 2VEAA 3LICA 3OOVA 3VV4A 4HP9A 3UO9A 1NZOA 2KDKA 3H7WA 1XA1A 3Q1FA 2O9CA 3QNBA 3E4PA 4KENB 2KLIA 1SCWA 4QD4A 5A91A 4KZ7A 4GS9A 3IH9A 3D9YA 3M2KA 1UGUA 3O87A 5IU1A 3F1NA 2Y91A 2ZBBA 2PD7A 1K4EA 3V3RA 1G6OA 4EBLA 1KE4A 2BG1A 4R6LA 4R3JA 4LGWA 3LI9A 1M6KA 3N4IA 4S2NA 3DBAA 4I3AA 2VK3A 4OP8A 2IA2A 1VETA 1ES4A 5HL6A 1XKZA 3BJNA 2P9VA 3SZTA 4DE1A 4KZ8A 2EWVA 1JWZA 1G68A 4ETXA 2WKHA 2XK1A 2XR0A 4HBTA 4BD0A 1SDNA 5CHJA 1OTDA 2J8YA 2J3WA 2Y2OA 1K56D 4DE0A 2V0WA 4K0XA 1BYWA 4IVIA 5EVLA 3ZG9B 2BLSA 3MQOA 1MWRA 3IH8A 4GD6A 2D01A 4E3MA 2W1TB 4P6BA 2BTFP 3BEBA 4GCZA 4ZJ1A 2OLVA 2G2WA 3BLMA 2ACGA 2G2UA 1MXOA 4R4SA 1PI5A 3LUQA 4K91A 3UDFA 4WMCD 1KGFA 3UE6A 3LEQA 5A90A 3GECA 4GLQA 2DNSA 1S4RA 2WKEA 2EA9A 4HJ4A 4DN0A 1S66L 2HJ9C 4EWFA 3T4QA 1LSWA 1G5UA 1P97A 3T4JA 4E3OA 3U2AA 1IYQA 1O07A 4WLAA 4WZ4A 2HGVA 3SS5A 1VQQA 4Q0HA 4KZBA 5F6AA 3C7VA 3JVUA 5FAQA 1XFQA 5TBMA 3T4LA 3H82B 2IWDA 3T1RA 1NLYA 1N9NA 5E2FA 1KDSA 2B02A 4IBXA 2QYBA 4MEZA 1LL5A 5J3WA 3IHAA 3NULA 2A24A 4QPRA 3A3JA 1NRJA 3HLFA 1G6AA 5CEBA 1DJBA 3T1SA 4GDBA 2JKGA 2ZM8A 3Q7ZA 3F1PB 1K55A 3TSGA 4R1GA 3QP1A 2RL3A 1BLHA 2E8IA 1GA0A 4ARZA 3O5YA 3WS4A 4E6XA 3HREA 3RXXA 4BENA 1E25A 4G3KA 3EOIA 1BT5A 3IXDA 1YT4A 2XD1A 1GHPA 3NC8A 2W3GA 5EVIB 3LR3A 1ACFA 3HLCA 1NYMA 1FR6A 4DJ2A 3DTMA 2DRWA 3ZG5A 1ZG6A 2EWWA 2EXAA 3O88A 2JKTM 3LIBA 4N9KA 1DP8A 3VE4A 1TDLA 3UMEA 3UPOA 2P7JA 3VOZA 4GW9A 2XD5A 1PZPA 2ZM0A 1ES2A 3LY4A 2JKRM 4CLCA 5GLCA 3VP4A 4F3LA 3SH9A 1LI9A 1P9RA 5HAIA 5EM0A 5FI7A 3E4QA 3DTEA 3G4PA 4OOLA 2K7SA 5E43A 4L0LA 1YQSA 3VP3A 4HNBA 4S2IA 4FTXA 4X69A 1GSWA 1L0FA 1OTIA 1MWTA 2ZJ9A 4PM5A 5FQ9A 1JNUA 3IHBA 5HAQA 4WELA 2XDMA 1XJ2A 5M18A 4MLLA 5KSHA 4FD8A 1RCJA 3UY6A 1E4DA 3PYPA 1VEUB 4ZJ2A 4BBVA 4JGOA 3TOIA 2QHKA 5TR7A 3E2LA 5I94A 1MY8A 3G2YA 5CEDA 1DJCA 1XXMA 3MSHA 3QP6A 1BSGA 5DTTA 2J3TC 4S2JA 1I2WA 1YMSA 4AFIA 5KIZA 4DE3A 3DW0A 4II7A 5CX7A 5AVFA 3QP2A 3MXRA 3C30A 5L10A 2OSUA 1YLZA 4Y0TA 4S2MA 3BFDA 4HJ6A 4QY5A 2JKFA 3MQQA 4FSFA 4F94A 3LI8A 2PR5A 1FQGA 1FIKA 4Y0UA 4PAUA 3JYIA 2E8JA 1EI5A 4KQRA 3RTYA 2X01A 1JWPA 2XA7S 3QP8A 3L9KA 2D02A 3CUEA 2Y2KA 1ZHHB 1O7EA 4HY8A 3IQAA 2EFUA 3R7WB 4B4XA 2HDRA 1L2SA 3EWKA 2ZQ7A 5EFWA 4YFMA 4Q0JA 1T1AA 2PBDP 3NCKA 4B4ZA 3DWKA 1ERQA 3G35A 5GLDA 3VSLA 5HFOA 3CAXA 3FV7A 5HPIA 3KSFA 1Y28A 3V67A 3NDEA 1XGJA 3ZG0A 2QWSA 2W3DA 4BD1A 4WL9A 5FQJA 1X0OA 2XFSA 4Y17A 2K2NA 4ZDXA 1F5MA 2WZXA 2JKTI 5G18A 2J3TD 1Q2PA 1KDWA 4EETB 4LPZA 1KGEA 3UDXA 4C3QA 2KOIA 1BLPA 3NECA 4KZ5A 4OPRA 5CHUA 2PBYA 1S67L 1YSPA 4KZ9A 3WRTA 5U47A 1NXYA 1MPLA 3VP0A 5FATA 3EEHA 1UWPX 4WM9A 3NIAA 5AVEA 4KQOA 5CGSA 3HJKA 4GD8A 2R78A 3UPNA 5FDHA 3OZHA 3T1XA 4B93A 3Q07A 3B3XA 3NOPC 1PWGA 3UMDA 4ZTKA 1U60A 5HDCA 4B88A 5GL9A 3Q7VB 2V1AA 2EX8A 1GSXA 4HHDA 1TS8A 1K57C 3NBLA 4MBFA 4NXGA 2HP9A 5EVEA 4OPZA 1IFQA 4N1XA 3S7PA 2HF6A 3KSHA 1ONHA 2ZQDA 2EXBA 3UE3A 3ITBA 2JHEA 4LV0A 4GHIA 3E0YA 5HD5A 2J7VA 3C8CA 1K6RA 1YLYA 1F9IA 3WS1A 4EW7A 4KQDA 2EFXA 3G34A 4RX2A 4EQIA 4CJNA 2OOLA 3MJQA 3MZDA 5L2FA 4HP4A 4XT2B 4I38A 3LEZA 1PYYA 2PRFA 3A3IA 4UA7A 2Y8HA 3IWQA 5C5KA 1PZOA 1H8ZA 2QKPA 4EQ1A 4JKTA 5F82A 2FFYA 1VM1A 3C4PA 1S1YA 1H0MA 2VV7A 1EW0A 3OCNA 4GN2A 5EE8A 1I5QA 4OQHA 3IX3A 3DTIA 2X02A 5HAPA 1D7EA 3BFGA 1KE3A 4DRTA 2Y55A 2H0YA 1MKMA 1ZG4A 4R0QA 1A0KA 2M7VA 4O01A 2Q9MA 4S2KA 1FSYA 4WYYA 5HWTA 2ZLYA 1D1JA 4KZ4A 5DF8A 1K4FA 2PT7A 2QJ7A 3BLSA 3VFFA 4I5SA 4DDYA 5HWWA 4DF6A 3ZNTA 1OTBA 4XUXA 2P04A 2PU4A 3D3OA 4LV2A 2Y2GA 4MNRA 3E2KA 1ALQA 2CMNA 3VP1A 1YMXA 5FSRA 1J9MA 3CPTA 1LHYA 4NG2A 1HTZA 4X53A 3ITAA 5EPHA 5HSQA 1ZC2A 3IT9A 2AVXA 4QJGA 2Z2LB 1ESUA 4DJ3A 4OP5A 2XQZA 4KG2A 3PBOA 3W4PA 1SKFA 4FUWA 3WWXA 4DE2A 2Y2QA 4IBRA 2VLGA 3LIDA 2Y2NA 3A0RA 1W79A 5FEFA 1W63Q 1IYPA 2Y79A 5FI2A 4GJ4A 1PWCA 1KVMA 4CLCE 4PKYG 2LB5A 1IKGA 1W7FA 3SH7A 4JXWA 4IUKA 3MR0A 1BULA 4LRYC 3L7HA 3OPLA 1T1CA 1LSXA 1Q2QA 2V8FA 1TS0A 3IWOA 1C3BA 1MBLA 2MJ6A 5J8XA 3PBTA 4OQGA 3HJIA 1SZVA 2Z6CA 5I5LA 3B33A 2WGWB 3PTEA 4EUVA 1K38A 5F5YA 3UB8A 5EECA 4RYEA 5CXWA 5KMWA 2L4RA 3H7WB 5JYOA 4XUZA 1MKIA 1Z09A 2XGNA 2C6WB 3M6BA 2M7UA 3ZFZA 4GS9B 3GDIA 1JTGA 4MN6A 1BTLA 2I9VA 1CF0A 4I3JA 1I2SA 2Y2HA 4B9OA 5HDDA 3F1NB 3LR0A 1PFLA 4RVAA 4WEKA 4KG6A 5CECA 3MZFA 1RGYA 3CPTB 4FH4A 3G6OA 1YLTA 2M1CA 4X68A 3PBNA 3VP2A 4Y2FA 4JGQA 3K3CA 1LT0A 3IWIA 3NHQA 4G3WA 3WS2A 2JN7A 1VETB 1PNEA 3A0SA 5DKKA 2K31A 2IWCA 2P9VB 1AXBA 1EROA 2Z6DA 4M4XA 5HPFA 3HCYA 1Z6FA 4X56A 3OPRA 4EXOA 3SS3A 2R9WA 2GJ3A 3GSGA 1PRQA 5CRFA 2WAFA 2ZC5B 5AQ9A 4OKPA 3F1OA 2IWBA 3KSIA 2XROA 3PBRA 5GHXA 2WKPA 1S6RA 4HI4A 3EGXC 3UN7A 5HZHA 3UB6A 3DAVA 3IF6A 5DJTA 2VGLS 1GSVA 3TRCA 2FFFB 4WF0A 4WBGA 5E2HA 1H8MA 1JTDA 2J9PA 4HQAA 4YNRA 1EWZA 5F1FA 3S22A 4PM7A 4LENA 5KSCA 2QMIA 1GA9A 5TFQA 1ONGA 3BY9A 5E2GA 5M1AA 2XSSA 4S2LA 4P87A 3CZDA 4UA6A 4GB7A 5CHMA 4EBNA 3JPUA 3KO6A 3G2ZA 3E4OA 5BOHA 2L0WA 5JYPA 2QJ5A 5GHZA 1DRMA 4OLGA 4R4RA 4YOFA 4S2NC 1M40A 3LCEA 1N9LA 2W0NA 2A3UA 2P74A 4OOMA 3UB7A 3LR5A 4R38A 4PM6A 3EEAA 5CTMA 3ZVWA 3CG5A 2VA0A 1NZUA 5A8BA 1NY0A 4E3JA 3CHWP 3B42A 1TDGA 3A3FA 1ODVA 4NXFA 4HESA 1FCMA 2PU2A 5TBMB 5AJGA 4UHUA 3G31A 4GZBA 5EOOA 1E3UD 2A24B 3HLWA 1FOFA 4JGPA 5J4EA 3PAEA 1K57A 2ZMAA 3QNCA 3NOTC 1NWZA 1CJFA 4Z1WA 1LL8A 1XFNA 3IXBA 4KZ6A 4JF5A 4O8GA 3SH8A 2Y2MA 5L8MA 2V20A 3CMZA 3ICYA 5D3OA 5TJJA 5M19A 5EVIC 3CI6A 4ARZB 2ZMFA 1ESIA 4Y5FA 1MWUA 4OQ0A 1N9OA 4Y13A 4EV4A 4DXCA 2VGJA 2QPNA 4ID4A 4NXBA 1CI9A 3LYXA 2ZL1A 3ZNYA 2X71A 5J7EA 4DKIA 2O0YA 2VGKA 3H9WA 3RH8B 1SDEA 2P08A 4H6JA 2ZOIA 1GHMA 4RA7A 5L07A 3BQ8A 1K56A 3A3EA 2H28A 2VV8A 1TEMA 2B18A 3LR4A 2HDSA 3SS4A 2A2LA 3BECA 3N6IA 3Q81A 5F1GA 3TE8A 2JCHA 3W2ZA 4FCFA 3W4QA 4GKUA 1F98A 1AWIA 4CLCB 4XXRA 4F3LB 3D4FA 5HX9A 1SKOA 1WYCA 5MC7A 2WKIA 2WYXA 4FOFA 2KX6A 1CK3A 1GHIA 4NETA 1K55C 1HZOA 2EX6A 3CJMA 1GCEA 4UA9A 4WMCA 3C2WA 1FR1A 3E98A 1BLSA 1J3WA 4BL3A 3BW6A 1IYOA 2V8CA 3PBQA 3LFVA 2WKQA 2WK0A 4QU3A 2Y2LA 3BY8A 4EESA 5EVID 2LB9A 4PHTA 4ZAMA 3VFHA 4U0TA 4LCMA 2V2FF 3HVFA 3MFXA 2WUQA 1HVBA 4C75A 1FCOA 4EERA 2OLUA 2ZM2A 5DJUA 1H3QA 3B47A 5HARA 2JKRI 3ZQ5A 4Z9QA 2B5RA 2Y2IA 2GZAA 2WGIA 5HWVA 5CERA 3HBRA 3ISGA 4LRXC 2Q0OA 4HBUA 4R3BA 4YINA 3SOIA 3GRJA 4X1LA 2WKRA 3QP4A 1DJAA 4HJ3A 4GNUA 4PPRA 2GDNA 1BZAA 1JVJA 3IS2A 3MQ0A 4JPMA 3ZG8B 3C5AA 5EUAA 3MS6A 2RCXA 5TGFA 3HUNA 3M2JA 3MBZA 4OOYA 4R70A 2WAEA 1YPRA 2VKSA 4K0WA 2H0TA 4Y15A 1YLJA 1PWDA 3LY3A 5FQKA 2QZ6A 4PM8A 2V1BA 5DTKA 1LLBA 4GOGA 1ERMA 5FAPA 4MN5A 1L0DA 2O9BA 3I7JA 2H5SA 1SHVA 5L09A 1RGZA 3PHYA 4IJGA 3DWZA 4JF6A 1QMFA 3GMWA 1FSWA 5FQQA 4Y7PA 2XFTA 3BYDA 3MKFA 1BLCA 3BFCA 5FQIA 3WS5A 2V1ZA 2HP5A 4ZRRA 3S7OA 4LFUA 1WE4A 2H10A 3V5MA 1OPXA 4WUJA 2INWA 1L0GA 4C6YA 1VB6A 4BJPA 1K54C 1NYYA 3PXPA 2J80A 2PDRA 3S7QA 4YWZA 1KGGA 1H5XA 3Q82A 3BM6A 4A5RA 1V9YA 4Q0IA 4PM9A 4UQIM 4L9EA 1E3UA 1WA9A 5DFXA 5F68A 2JE5A 2VZWA 2HJEA 4UEYA 4NKPA 4BL2A 4QB8A 2ZC4B 1IYSA 3BFEA 5IT5A 4IUHA 2W1TA 3VSKA 3V39A 4S2PA 4Q8IA 2YKHA 3A0VA 1ES3A 4E3LA 3IX8A 1CQAA 3OBFA 1PI4A 3AGFA 2DCFA 3ZHHA 2DMWA 3EQVA 4ZJ3A 2JBFA 4E3NA 4DDSA 1VHMA 4OLDA 4N1HA 1W8QA 4MCWA 4PMAA 5F69A 1FILA 4KZAA 3R4KA 4GHIB 4IHQA 4D2OA 3NOUC 3JVVA 2ZC7A 2EX2A 1L0EA 3BFFA 1T19A 5IS1A 3MFDA 4U3TA 4X55A 5FDSA 1HD8A 4H8RA 4JXGA 3UPPA 3H82A 5HL1A 4D60A 4E04A 3AGDA 4WZ5C 3DTKA 2OAQ1 4EU0A 5EV0A 1IEMA 1S1ZA 1XJ4A 3N7WA 3EQUA 4JLFA 1CI8A 2A49A 3F1PA 3IF5A 4P0MA 4WEJA 4P6ZM 4HOIA 3CITA 4RX3A 2ZD8A 1DP6A 3UE1A 3WRZA 2XA7M 1ZKJA 2Y4AA 3FPVA 4GDNA 2XLNA 4JBFA 4OH0A 3P98A 3OCLA 3FC7A 4QHCA 3KYZA 3A3DA 2ZQ8A 5EVIA 1XPBA 1KOUA 1TS7A 3GTCA 3KYQA 5KZHA 3ZYTA 4S2OA 5FAOA 1XJ6A 2G7UA 1TS6A 2WGVA 3LO7A 3V3SA 4NEED 3WS0A 4QY6A 4BLMA 3MZEA 3BQAA 3GQZA 2OAP1 5FI6A 3HLDA 3P01A 4OQIA 4I39A 1ZTUA 2Y2JA 1OTEA 4KUOA 5DVAA 5DKLA 3OC2A 1PIOA 3HLGA 3T4KA 4DMZA 4MBHA 4X1MA 3T50A 1W8YA 3TJZC 4EEPA 4RQ9A 2HP6A 2XRNA 1XP4A 1XX2A 4E3KA 1ES5A 3FZCA 3FWLA 1WYBA 2UV0E 4O0PA 1YAXA 5FASA 1OT6A 2W3HA 2PD8A 4ESPA 2PYRA 5FEGA 5HDSA 2B95A 3FKWA 4UAAA 1VEUA 3LIEA 2V9AA 2VX8A 3BRMA 3HUMA 4QWOA 1IELA 2FZ0A 2C5WB 1H8YA 4OPQA 5A93A 3ULFA 1YKDA 2J9OA 1BUEA 4JF4A 4BWIA 3N8RA 1MC0A 1K25A 3P09A 1YSQA 3M6HA 4LV1A 4FH2A 5K5BA 2ZMVA 2FH5A 3NI9A 1YLPA 4HIAA 1L3LA 2ZQAA 3PAGA 1G28A 3ZG7B 5GLAA 3T1QB 2ZOHA 1PW1A 4LLOB 5HW3A 4MBKA 3KSGA 3T4SA 3T4TA 3LIFA 2OWHA 4UQIS 2EX9A 3P7NA 4WN5A 1MWSA 3RXWA 2NUTC 5FA7A 1S4SA 2BASA 3NDGA 4LRZE 2Z2MB 1XGIA 3N8SA 4X6TA 3R7WA 2WZZA 4K08A 2HZ5A 2ZQCA 3MMHA 3G32A 3GV9A 3KX0X 4JXVA 2HV1A 2Y59A 4BBUA 3ZDJA 2Y2PA 1NJ4A 3ZCZA 5HD3A 3F1OB 4ZBEA 3FPWA 2PAVP 4HEFA 5A92A 3UDIA 3IF6B 4KUKA 4IVKA 3KYEA 3NJAA 3U4LP 3C4OA 3MXSA 3PR6A 4KG5A 2XF3A 4OVDA 4Y0OA 1TD5A 1Y54A 2PHYA 2O99A 3O3VA 2HPBA 1Y4OA 3V50A 3LGOA 2VV6A 1RP5A 3K3DA 1UWNX 3HUOA 1STZA 4PKYA 5IHVA 2R9XA 4IEDA 5CGWA 3RFBA 3HL9A 5F83A 3MF0A 1KE0A 1NLZA 4JXSA 1OJGA 3C7UA 2PYPA 2I72A 1K54A 4OPYA 2Q9NA 3CWFA 3CLOA 1F2KA 4Y3IA 4P6ZS 4KQQA 3Q7VA 1LSVA 3IBJA 5GLBA 3S7NA 3FG8A 5DTSA 2WADA 1PW8A 5AQ7A 2NUPC 4L9FA
chains in the Genus database with same CATH topology
5G4YA 1LSXA 4HH2A 3VOLA 1TS0A 4ZRRA 3S7OA 1MZUA 2EWWA 2JKTM 2GX5A 2GNXA 2MJ6A 1OPXA 3LIBA 3PBTA 5LBRA 1OT9A 3HJIA 1DP8A 2Z6CA 4WUJA 2INWA 5I5LA 3B33A 1V9ZA 3VE4A 4EUVA 1VB6A 3UMEA 4BJPA 3PXPA 2P7JA 2J80A 2PDRA 3D72A 3S7QA 4GW9A 4YWZA 2V0UA 5F5YA 3UB8A 4CLCA 2JKRM 5G4ZA 1V9YA 1W63M 4Q0IA 4UQIM 2W3FA 4F3LA 2L4RA 3H7WB 4L9EA 1P9RA 3TW8A 2M7UA 1WA9A 4CQHA 3E4QA 4XT2A 4OOLA 2K7SA 4GS9B 3GDIA 4L0LA 4MN6A 2I9VA 1IOUA 4I3JA 5DFXA 5F68A 4B9OA 2VZWA 4HNBA 3K2NA 5HDDA 4G3VA 2HJEA 4ETZA 3F1NB 3LR0A 4UEYA 4NKPA 4WEKA 1GSWA 1OTIA 5IT5A 2L1MA 3EGDC 4IUHA 1JNUA 2W1TA 4MMNA 4WELA 1XJ2A 3G6OA 5KSHA 2YKHA 3A0VA 2M1CA 4NXEA 2W27A 4MDZA 5FL3A 3PBNA 3OBFA 4Y2FA 1D06A 4JGQA 3K3CA 1LT0A 2DMWA 3NHQA 4G3WA 2JN7A 3PYPA 2PR6A 2W3EA 3EQVA 3A0SA 4H6JB 5DKKA 2K31A 4BBVA 4JGOA 2YKFA 2QHKA 4CLCC 3BWLA 1VHMA 1T18A 2Z6DA 4M4XA 3VE3A 4MCWA 5F69A 3HCYA 5HPFA 4EXOA 3R4KA 4GHIB 4IHQA 2GJ3A 3NOUC 3JVVA 2J3TC 4ME4A 4AFIA 5KIZA 1P9WA 3MXQA 4II7A 5CX7A 5AVFA 1T19A 4R3AA 3F1OA 5IS1A 1P0ZA 4MN7A 3KSIA 2XROA 3PBRA 3C30A 2WKPA 4HI4A 3EGXC 5HZHA 3UB6A 1XJ3A 4HJ6A 5DJTA 2VGLS 3MQQA 4FSFA 3C38A 3LI8A 2PR5A 1GSVA 3H82A 3TRCA 4WF0A 3LIAA 4E04A 1H8MA 4PAUA 4HQAA 4YNRA 3RTYA 3UB9A 2OAQ1 2VJWA 4EU0A 4BBTA 2XA7S 1S1ZA 1XJ4A 2VGLM 3BY9A 5DF9A 2XSSA 2D02A 3EQUA 3CUEA 1OTAA 3F1PA 1ZHHB 4WEJA 1T1BA 4P6ZM 3IBRA 4HY8A 4HOIA 3CITA 2O9AA 5DFYA 4L9GA 3KO6A 3R7WB 3E4OA 2L0WA 1DP6A 2QJ5A 2XA7M 1DRMA 3EWKA 4YOFA 2W1RA 5EFWA 3FPVA 4Q0JA 1N9LA 1T1AA 2W0NA 4OOMA 3T4OA 3OCLA 3FC7A 4EEUA 1TF1A 3KYZA 3UB7A 3LR5A 4R38A 3CAXA 3EEAA 4I3IA 1DP9A 5HPIA 2VA0A 3KSFA 1Y28A 1KOUA 1TS7A 5A8BA 3KYQA 3ZYTA 3V67A 3B42A 1XJ6A 2QWSA 2W3DA 2G7UA 1TS6A 4WL9A 1OJ5A 1ODVA 4HH3A 3SW1A 4NXFA 1X0OA 4NEED 5TBMB 3CUEC 4CLCD 5AJGA 2K2NA 2OWJA 3BQAA 2OAP1 3IS2B 3PBSA 4JGRA 1F5MA 3P01A 2A24B 4I39A 2JKTI 1ZTUA 1OTEA 4JGPA 4KUOA 2J3TD 5DKLA 3OC2A 5J4EA 4EETB 4LPZA 4BMWA 3OLOA 3NOTC 1NWZA 3T4KA 2KOIA 4Z1WA 4DMZA 2VEAA 1LL8A 1XFNA 3T50A 3LICA 3OOVA 1S67L 4HP9A 3TJZC 3VV4A 4O8GA 4RQ9A 4EEPA 2KDKA 2XRNA 1YSPA 3H7WA 2O9CA 5L8MA 3ICYA 3E4PA 2KLIA 5TJJA 3EEHA 1UWPX 4GS9A 3CI6A 4ARZB 2ZMFA 4DJ2A 4Y5FA 4O0PA 5AVEA 4KQOA 1UGUA 1N9OA 1YAXA 3HJKA 5IU1A 3F1NA 2R78A 2ZBBA 1OT6A 4B93A 2W3HA 2PD7A 2PD8A 1G6OA 2PYRA 3NOPC 4NXBA 3UMDA 3LYXA 5HDCA 4R6LA 3LI9A 2V1AA 3DBAA 4I3AA 1GSXA 5HDSA 5J7EA 2O0YA 4HHDA 3H9WA 1TS8A 2IA2A 3LIEA 2V9AA 3RH8B 2P08A 2VX8A 4H6JA 4NXGA 2ZOIA 1IFQA 3S7PA 5HL6A 2HF6A 2FZ0A 3BJNA 3KSHA 3BQ8A 3UE3A 2H28A 2EWVA 2VV8A 3ULFA 2JHEA 1YKDA 2B18A 3LR4A 3E0YA 4GHIA 4BWIA 4ETXA 2A2LA 1MC0A 5HD5A 3C8CA 1F9IA 1YSQA 4EW7A 3TE8A 4KQDA 3W2ZA 5K5BA 2ZMVA 2OOLA 1F98A 1OTDA 2J3WA 4CLCB 2FH5A 2V0WA 3MJQA 1BYWA 4F3LB 4HP4A 4XT2B 5MC7A 4I38A 4HIAA 3MQOA 4FOFA 1G28A 2KX6A 2ZOHA 2Y8HA 4LLOB 5C5KA 3KSGA 3T4SA 3T4TA 2QKPA 4EQ1A 2D01A 3LIFA 2OWHA 2W1TB 4UQIS 4GCZA 3C2WA 3E98A 3P7NA 4WN5A 2NUTC 3BW6A 1S1YA 2VV7A 1EW0A 3OCNA 3PBQA 3LFVA 1S4SA 2WKQA 2BASA 4LRZE 3LUQA 3BY8A 3R7WA 4EESA 1D7EA 2LB9A 4PHTA 4K08A 1MKMA 3MMHA 3UE6A 3GECA 4GLQA 2M7VA 3KX0X 4O01A 3MFXA 1S4RA 2HV1A 4EERA 2EA9A 4BBUA 4HJ4A 4DN0A 5DJUA 1S66L 2HJ9C 5HWTA 1H3QA 3B47A 3T4QA 5HD3A 3F1OB 1LSWA 2PT7A 2JKRI 2QJ7A 3ZQ5A 1P97A 3FPWA 3T4JA 3U2AA 4I5SA 2GZAA 4WLAA 2HGVA 5HWWA 5HWVA 4KUKA 1OTBA 4Q0HA 4LRXC 2P04A 5F6AA 3NJAA 3JVUA 3D3OA 1XFQA 5TBMA 2WKRA 3H82B 3T4LA 4HJ3A 2CMNA 1NLYA 3PR6A 1N9NA 3MQ0A 3IS2A 2B02A 2QYBA 1TD5A 5J3WA 2PHYA 2A24A 2O99A 4QPRA 1NRJA 2VV6A 5HSQA 3K3DA 1UWNX 1STZA 4R70A 2VKSA 4PKYA 3F1PB 4DJ3A 3RFBA 2V1BA 3PBOA 3MF0A 4ARZA 3O5YA 1NLZA 1OJGA 2PYPA 2VLGA 3LIDA 3A0RA 4MN5A 2O9BA 4G3KA 3EOIA 3CWFA 1W63Q 3CLOA 2Y79A 3PHYA 4GJ4A 4Y3IA 4P6ZS 4IJGA 4CLCE 4PKYG 2W3GA 2LB5A 1LSVA 3IBJA 3LR3A 3S7NA 3FG8A 4IUKA 3MR0A 4LRYC 2NUPC 1T1CA 4L9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G4Y A;  1LSX A;  4HH2 A;  3VOL A;  1TS0 A;  1MZU A;  3LIB A;  1OT9 A;  3HJI A;  1DP8 A;  2Z6C A;  4WUJ A;  2INW A;  5I5L A;  3B33 A;  1V9Z A;  3VE4 A;  1VB6 A;  3UME A;  2P7J A;  2J80 A;  2PDR A;  3D72 A;  4GW9 A;  4YWZ A;  2V0U A;  5F5Y A;  3UB8 A;  5G4Z A;  1V9Y A;  4F3L A;  2L4R A;  3H7W B;  4L9E A;  1WA9 A;  3E4Q A;  4XT2 A;  2K7S A;  4GS9 B;  3GDI A;  4MN6 A;  2I9V A;  4I3J A;  5F68 A;  4B9O A;  4HNB A;  5HDD A;  3F1N B;  1GSW A;  1OTI A;  2L1M A;  1JNU A;  1XJ2 A;  3G6O A;  2YKH A;  3A0V A;  2M1C A;  4NXE A;  2W27 A;  1D06 A;  4JGQ A;  3K3C A;  1LT0 A;  3NHQ A;  2JN7 A;  3PYP A;  2PR6 A;  3A0S A;  4H6J B;  5DKK A;  4BBV A;  4JGO A;  2YKF A;  2QHK A;  3BWL A;  1T18 A;  3VE3 A;  2Z6D A;  4M4X A;  5F69 A;  4EXO A;  4GHI B;  2GJ3 A;  3NOU C;  5KIZ A;  3MXQ A;  5AVF A;  1T19 A;  4R3A A;  3F1O A;  5IS1 A;  1P0Z A;  2WKP A;  4HI4 A;  5HZH A;  3UB6 A;  1XJ3 A;  4HJ6 A;  5DJT A;  3MQQ A;  3LI8 A;  2PR5 A;  1GSV A;  3H82 A;  4WF0 A;  3LIA A;  4E04 A;  4HQA A;  3RTY A;  3UB9 A;  4BBT A;  1S1Z A;  1XJ4 A;  3BY9 A;  2D02 A;  1OTA A;  3F1P A;  1T1B A;  3IBR A;  4HY8 A;  4HOI A;  4L9G A;  3E4O A;  2L0W A;  1DP6 A;  2QJ5 A;  1DRM A;  3EWK A;  5EFW A;  1N9L A;  1T1A A;  2W0N A;  3FC7 A;  4EEU A;  3UB7 A;  4R38 A;  3CAX A;  4I3I A;  1DP9 A;  1Y28 A;  1KOU A;  1TS7 A;  5A8B A;  1XJ6 A;  2QWS A;  1TS6 A;  4WL9 A;  1OJ5 A;  1ODV A;  4HH3 A;  3SW1 A;  4NXF A;  1X0O A;  5TBM B;  2OWJ A;  3IS2 B;  4JGR A;  2A24 B;  4I39 A;  1OTE A;  4JGP A;  4KUO A;  5DKL A;  5J4E A;  4EET B;  4LPZ A;  3OLO A;  3NOT C;  1NWZ A;  2VEA A;  1LL8 A;  1XFN A;  3T50 A;  3LIC A;  1S67 L;  4HP9 A;  4EEP A;  4RQ9 A;  2KDK A;  3H7W A;  3ICY A;  3E4P A;  3EEH A;  1UWP X;  4GS9 A;  4DJ2 A;  5AVE A;  1UGU A;  1N9O A;  3HJK A;  5IU1 A;  3F1N A;  2R78 A;  2ZBB A;  1OT6 A;  2PD7 A;  2PD8 A;  2PYR A;  3NOP C;  4NXB A;  3UMD A;  3LYX A;  5HDC A;  4R6L A;  3LI9 A;  2V1A A;  4I3A A;  1GSX A;  5HDS A;  5J7E A;  4HHD A;  3H9W A;  1TS8 A;  3LIE A;  2V9A A;  3RH8 B;  4H6J A;  4NXG A;  2ZOI A;  2H28 A;  2VV8 A;  3ULF A;  2JHE A;  4GHI A;  5HD5 A;  3C8C A;  1F9I A;  4EW7 A;  4KQD A;  2OOL A;  1F98 A;  1OTD A;  2V0W A;  3MJQ A;  1BYW A;  4F3L B;  4HP4 A;  4XT2 B;  4I38 A;  4HIA A;  3MQO A;  1G28 A;  2KX6 A;  2ZOH A;  4LLO B;  2QKP A;  4EQ1 A;  2D01 A;  3LIF A;  2OWH A;  4GCZ A;  3C2W A;  3P7N A;  4WN5 A;  1S1Y A;  2VV7 A;  1EW0 A;  1S4S A;  2WKQ A;  2BAS A;  4LRZ E;  3LUQ A;  3BY8 A;  4EES A;  1D7E A;  4K08 A;  3UE6 A;  3GEC A;  3KX0 X;  3MFX A;  1S4R A;  2HV1 A;  4EER A;  2EA9 A;  4BBU A;  4HJ4 A;  5DJU A;  1S66 L;  5HWT A;  5HD3 A;  3F1O B;  1LSW A;  2QJ7 A;  3ZQ5 A;  1P97 A;  4I5S A;  4WLA A;  5HWW A;  5HWV A;  4KUK A;  1OTB A;  4LRX C;  5F6A A;  3NJA A;  1XFQ A;  5TBM A;  2WKR A;  3H82 B;  4HJ3 A;  2CMN A;  1N9N A;  3IS2 A;  2B02 A;  5J3W A;  2PHY A;  2A24 A;  2VV6 A;  5HSQ A;  3K3D A;  1UWN X;  4R70 A;  4PKY A;  3F1P B;  4DJ3 A;  2V1B A;  1OJG A;  2PYP A;  2VLG A;  3LID A;  3A0R A;  4MN5 A;  3CWF A;  3CLO A;  3PHY A;  4PKY G;  1LSV A;  3FG8 A;  3MR0 A;  4LRY C;  1T1C A;  4L9F A; 
#chains in the Genus database with same CATH topology
 5G4Y A;  4HH2 A;  3FYZ A;  3HLE A;  3VOL A;  1MZU A;  2GX5 A;  1JWV A;  2GNX A;  5LBR A;  3OPH A;  1OT9 A;  2XEP A;  1LL9 A;  1V9Z A;  4E6W A;  3IF6 C;  5CGX A;  1K0K A;  3D72 A;  2HDU A;  1NRF A;  4N92 A;  3VMA A;  2V0U A;  5G4Z A;  1W63 M;  2W3F A;  3TW8 A;  4CQH A;  5EM1 A;  2JC7 A;  4XT2 A;  4U0X A;  4O7D A;  1IOU A;  3K2N A;  4G3V A;  2HDQ A;  5GHY A;  4ETZ A;  4X25 A;  1XA7 A;  2L1M A;  4M3K A;  2UWX A;  3EGD C;  3HLB A;  4MMN A;  4LCL A;  2ZL1 B;  4NXE A;  5FL3 A;  2W27 A;  3MKE A;  4MDZ A;  5CTN A;  1D06 A;  2OV5 A;  5AQA A;  3IXH A;  4P85 A;  2PR6 A;  2W3E A;  5DF7 A;  4H6J B;  1YM1 A;  3IXG A;  2YKF A;  1N9B A;  4CLC C;  3BWL A;  4WZ5 A;  3NY4 A;  1N4O A;  1T18 A;  3AGE A;  3VE3 A;  1K6S A;  4NK3 A;  2ZC3 B;  1FCN A;  1DY6 A;  2ZQ9 A;  4ME4 A;  1P9W A;  3RJU A;  3MXQ A;  4R3A A;  1P0Z A;  4MN7 A;  2CC1 A;  1SKO B;  3N8L A;  3UNW A;  1XJ3 A;  4R23 A;  4CPK A;  3C38 A;  2XH9 A;  3TG9 A;  5EOE A;  1YLW A;  3LIA A;  4KZ3 A;  3QP5 A;  3QHY A;  5FQM A;  3UE0 A;  3UB9 A;  1OME A;  4DXB A;  2VJW A;  4BBT A;  4EBP A;  2VGL M;  1LI0 A;  5DF9 A;  3W4O A;  3OPP A;  1OTA A;  3IX4 A;  1T1B A;  3IBR A;  2O9A A;  5DFY A;  1CEF A;  3FKV A;  4L9G A;  4E3I A;  3O86 A;  3ZVT A;  2W1R A;  1S0W A;  3W8K A;  3UB5 P;  4EUZ A;  3VOY A;  3T4O A;  3S1Y A;  3GVB A;  4LV3 A;  4EEU A;  1TF1 A;  1HLU P;  3T12 B;  1TVF A;  3S4X A;  4I3I A;  1DP9 A;  4OON A;  2ZC6 B;  4N9L A;  1QME A;  4BQM A;  1W5D A;  1IKI A;  1OJ5 A;  4HH3 A;  3SW1 A;  3CUE C;  4CLC D;  1CEG A;  3GR2 A;  3G30 A;  2OWJ A;  3IS2 B;  3PBS A;  4JGR A;  1KVL A;  3ZGA B;  2WGW A;  5E2E A;  5AQB A;  4BMW A;  3OLO A;  2VEA A;  3LIC A;  3OOV A;  3VV4 A;  4HP9 A;  3UO9 A;  1NZO A;  2KDK A;  3H7W A;  1XA1 A;  3Q1F A;  2O9C A;  3QNB A;  3E4P A;  4KEN B;  2KLI A;  1SCW A;  4QD4 A;  5A91 A;  4KZ7 A;  4GS9 A;  3IH9 A;  3D9Y A;  3M2K A;  1UGU A;  3O87 A;  5IU1 A;  3F1N A;  2Y91 A;  2ZBB A;  2PD7 A;  1K4E A;  3V3R A;  1G6O A;  4EBL A;  1KE4 A;  2BG1 A;  4R6L A;  4R3J A;  4LGW A;  3LI9 A;  1M6K A;  3N4I A;  4S2N A;  3DBA A;  4I3A A;  2VK3 A;  4OP8 A;  2IA2 A;  1VET A;  1ES4 A;  5HL6 A;  1XKZ A;  3BJN A;  2P9V A;  3SZT A;  4DE1 A;  4KZ8 A;  2EWV A;  1JWZ A;  1G68 A;  4ETX A;  2WKH A;  2XK1 A;  2XR0 A;  4HBT A;  4BD0 A;  1SDN A;  5CHJ A;  1OTD A;  2J8Y A;  2J3W A;  2Y2O A;  1K56 D;  4DE0 A;  2V0W A;  4K0X A;  1BYW A;  4IVI A;  5EVL A;  3ZG9 B;  2BLS A;  3MQO A;  1MWR A;  3IH8 A;  4GD6 A;  2D01 A;  4E3M A;  2W1T B;  4P6B A;  2BTF P;  3BEB A;  4GCZ A;  4ZJ1 A;  2OLV A;  2G2W A;  3BLM A;  2ACG A;  2G2U A;  1MXO A;  4R4S A;  1PI5 A;  3LUQ A;  4K91 A;  3UDF A;  4WMC D;  1KGF A;  3UE6 A;  3LEQ A;  5A90 A;  3GEC A;  4GLQ A;  2DNS A;  1S4R A;  2WKE A;  2EA9 A;  4HJ4 A;  4DN0 A;  1S66 L;  2HJ9 C;  4EWF A;  3T4Q A;  1LSW A;  1G5U A;  1P97 A;  3T4J A;  4E3O A;  3U2A A;  1IYQ A;  1O07 A;  4WLA A;  4WZ4 A;  2HGV A;  3SS5 A;  1VQQ A;  4Q0H A;  4KZB A;  5F6A A;  3C7V A;  3JVU A;  5FAQ A;  1XFQ A;  5TBM A;  3T4L A;  3H82 B;  2IWD A;  3T1R A;  1NLY A;  1N9N A;  5E2F A;  1KDS A;  2B02 A;  4IBX A;  2QYB A;  4MEZ A;  1LL5 A;  5J3W A;  3IHA A;  3NUL A;  2A24 A;  4QPR A;  3A3J A;  1NRJ A;  3HLF A;  1G6A A;  5CEB A;  1DJB A;  3T1S A;  4GDB A;  2JKG A;  2ZM8 A;  3Q7Z A;  3F1P B;  1K55 A;  3TSG A;  4R1G A;  3QP1 A;  2RL3 A;  1BLH A;  2E8I A;  1GA0 A;  4ARZ A;  3O5Y A;  3WS4 A;  4E6X A;  3HRE A;  3RXX A;  4BEN A;  1E25 A;  4G3K A;  3EOI A;  1BT5 A;  3IXD A;  1YT4 A;  2XD1 A;  1GHP A;  3NC8 A;  2W3G A;  5EVI B;  3LR3 A;  1ACF A;  3HLC A;  1NYM A;  1FR6 A;  4DJ2 A;  3DTM A;  2DRW A;  3ZG5 A;  1ZG6 A;  2EWW A;  2EXA A;  3O88 A;  2JKT M;  3LIB A;  4N9K A;  1DP8 A;  3VE4 A;  1TDL A;  3UME A;  3UPO A;  2P7J A;  3VOZ A;  4GW9 A;  2XD5 A;  1PZP A;  2ZM0 A;  1ES2 A;  3LY4 A;  2JKR M;  4CLC A;  5GLC A;  3VP4 A;  4F3L A;  3SH9 A;  1LI9 A;  1P9R A;  5HAI A;  5EM0 A;  5FI7 A;  3E4Q A;  3DTE A;  3G4P A;  4OOL A;  2K7S A;  5E43 A;  4L0L A;  1YQS A;  3VP3 A;  4HNB A;  4S2I A;  4FTX A;  4X69 A;  1GSW A;  1L0F A;  1OTI A;  1MWT A;  2ZJ9 A;  4PM5 A;  5FQ9 A;  1JNU A;  3IHB A;  5HAQ A;  4WEL A;  2XDM A;  1XJ2 A;  5M18 A;  4MLL A;  5KSH A;  4FD8 A;  1RCJ A;  3UY6 A;  1E4D A;  3PYP A;  1VEU B;  4ZJ2 A;  4BBV A;  4JGO A;  3TOI A;  2QHK A;  5TR7 A;  3E2L A;  5I94 A;  1MY8 A;  3G2Y A;  5CED A;  1DJC A;  1XXM A;  3MSH A;  3QP6 A;  1BSG A;  5DTT A;  2J3T C;  4S2J A;  1I2W A;  1YMS A;  4AFI A;  5KIZ A;  4DE3 A;  3DW0 A;  4II7 A;  5CX7 A;  5AVF A;  3QP2 A;  3MXR A;  3C30 A;  5L10 A;  2OSU A;  1YLZ A;  4Y0T A;  4S2M A;  3BFD A;  4HJ6 A;  4QY5 A;  2JKF A;  3MQQ A;  4FSF A;  4F94 A;  3LI8 A;  2PR5 A;  1FQG A;  1FIK A;  4Y0U A;  4PAU A;  3JYI A;  2E8J A;  1EI5 A;  4KQR A;  3RTY A;  2X01 A;  1JWP A;  2XA7 S;  3QP8 A;  3L9K A;  2D02 A;  3CUE A;  2Y2K A;  1ZHH B;  1O7E A;  4HY8 A;  3IQA A;  2EFU A;  3R7W B;  4B4X A;  2HDR A;  1L2S A;  3EWK A;  2ZQ7 A;  5EFW A;  4YFM A;  4Q0J A;  1T1A A;  2PBD P;  3NCK A;  4B4Z A;  3DWK A;  1ERQ A;  3G35 A;  5GLD A;  3VSL A;  5HFO A;  3CAX A;  3FV7 A;  5HPI A;  3KSF A;  1Y28 A;  3V67 A;  3NDE A;  1XGJ A;  3ZG0 A;  2QWS A;  2W3D A;  4BD1 A;  4WL9 A;  5FQJ A;  1X0O A;  2XFS A;  4Y17 A;  2K2N A;  4ZDX A;  1F5M A;  2WZX A;  2JKT I;  5G18 A;  2J3T D;  1Q2P A;  1KDW A;  4EET B;  4LPZ A;  1KGE A;  3UDX A;  4C3Q A;  2KOI A;  1BLP A;  3NEC A;  4KZ5 A;  4OPR A;  5CHU A;  2PBY A;  1S67 L;  1YSP A;  4KZ9 A;  3WRT A;  5U47 A;  1NXY A;  1MPL A;  3VP0 A;  5FAT A;  3EEH A;  1UWP X;  4WM9 A;  3NIA A;  5AVE A;  4KQO A;  5CGS A;  3HJK A;  4GD8 A;  2R78 A;  3UPN A;  5FDH A;  3OZH A;  3T1X A;  4B93 A;  3Q07 A;  3B3X A;  3NOP C;  1PWG A;  3UMD A;  4ZTK A;  1U60 A;  5HDC A;  4B88 A;  5GL9 A;  3Q7V B;  2V1A A;  2EX8 A;  1GSX A;  4HHD A;  1TS8 A;  1K57 C;  3NBL A;  4MBF A;  4NXG A;  2HP9 A;  5EVE A;  4OPZ A;  1IFQ A;  4N1X A;  3S7P A;  2HF6 A;  3KSH A;  1ONH A;  2ZQD A;  2EXB A;  3UE3 A;  3ITB A;  2JHE A;  4LV0 A;  4GHI A;  3E0Y A;  5HD5 A;  2J7V A;  3C8C A;  1K6R A;  1YLY A;  1F9I A;  3WS1 A;  4EW7 A;  4KQD A;  2EFX A;  3G34 A;  4RX2 A;  4EQI A;  4CJN A;  2OOL A;  3MJQ A;  3MZD A;  5L2F A;  4HP4 A;  4XT2 B;  4I38 A;  3LEZ A;  1PYY A;  2PRF A;  3A3I A;  4UA7 A;  2Y8H A;  3IWQ A;  5C5K A;  1PZO A;  1H8Z A;  2QKP A;  4EQ1 A;  4JKT A;  5F82 A;  2FFY A;  1VM1 A;  3C4P A;  1S1Y A;  1H0M A;  2VV7 A;  1EW0 A;  3OCN A;  4GN2 A;  5EE8 A;  1I5Q A;  4OQH A;  3IX3 A;  3DTI A;  2X02 A;  5HAP A;  1D7E A;  3BFG A;  1KE3 A;  4DRT A;  2Y55 A;  2H0Y A;  1MKM A;  1ZG4 A;  4R0Q A;  1A0K A;  2M7V A;  4O01 A;  2Q9M A;  4S2K A;  1FSY A;  4WYY A;  5HWT A;  2ZLY A;  1D1J A;  4KZ4 A;  5DF8 A;  1K4F A;  2PT7 A;  2QJ7 A;  3BLS A;  3VFF A;  4I5S A;  4DDY A;  5HWW A;  4DF6 A;  3ZNT A;  1OTB A;  4XUX A;  2P04 A;  2PU4 A;  3D3O A;  4LV2 A;  2Y2G A;  4MNR A;  3E2K A;  1ALQ A;  2CMN A;  3VP1 A;  1YMX A;  5FSR A;  1J9M A;  3CPT A;  1LHY A;  4NG2 A;  1HTZ A;  4X53 A;  3ITA A;  5EPH A;  5HSQ A;  1ZC2 A;  3IT9 A;  2AVX A;  4QJG A;  2Z2L B;  1ESU A;  4DJ3 A;  4OP5 A;  2XQZ A;  4KG2 A;  3PBO A;  3W4P A;  1SKF A;  4FUW A;  3WWX A;  4DE2 A;  2Y2Q A;  4IBR A;  2VLG A;  3LID A;  2Y2N A;  3A0R A;  1W79 A;  5FEF A;  1W63 Q;  1IYP A;  2Y79 A;  5FI2 A;  4GJ4 A;  1PWC A;  1KVM A;  4CLC E;  4PKY G;  2LB5 A;  1IKG A;  1W7F A;  3SH7 A;  4JXW A;  4IUK A;  3MR0 A;  1BUL A;  4LRY C;  3L7H A;  3OPL A;  1T1C A;  1LSX A;  1Q2Q A;  2V8F A;  1TS0 A;  3IWO A;  1C3B A;  1MBL A;  2MJ6 A;  5J8X A;  3PBT A;  4OQG A;  3HJI A;  1SZV A;  2Z6C A;  5I5L A;  3B33 A;  2WGW B;  3PTE A;  4EUV A;  1K38 A;  5F5Y A;  3UB8 A;  5EEC A;  4RYE A;  5CXW A;  5KMW A;  2L4R A;  3H7W B;  5JYO A;  4XUZ A;  1MKI A;  1Z09 A;  2XGN A;  2C6W B;  3M6B A;  2M7U A;  3ZFZ A;  4GS9 B;  3GDI A;  1JTG A;  4MN6 A;  1BTL A;  2I9V A;  1CF0 A;  4I3J A;  1I2S A;  2Y2H A;  4B9O A;  5HDD A;  3F1N B;  3LR0 A;  1PFL A;  4RVA A;  4WEK A;  4KG6 A;  5CEC A;  3MZF A;  1RGY A;  3CPT B;  4FH4 A;  3G6O A;  1YLT A;  2M1C A;  4X68 A;  3PBN A;  3VP2 A;  4Y2F A;  4JGQ A;  3K3C A;  1LT0 A;  3IWI A;  3NHQ A;  4G3W A;  3WS2 A;  2JN7 A;  1VET B;  1PNE A;  3A0S A;  5DKK A;  2K31 A;  2IWC A;  2P9V B;  1AXB A;  1ERO A;  2Z6D A;  4M4X A;  5HPF A;  3HCY A;  1Z6F A;  4X56 A;  3OPR A;  4EXO A;  3SS3 A;  2R9W A;  2GJ3 A;  3GSG A;  1PRQ A;  5CRF A;  2WAF A;  2ZC5 B;  5AQ9 A;  4OKP A;  3F1O A;  2IWB A;  3KSI A;  2XRO A;  3PBR A;  5GHX A;  2WKP A;  1S6R A;  4HI4 A;  3EGX C;  3UN7 A;  5HZH A;  3UB6 A;  3DAV A;  3IF6 A;  5DJT A;  2VGL S;  1GSV A;  3TRC A;  2FFF B;  4WF0 A;  4WBG A;  5E2H A;  1H8M A;  1JTD A;  2J9P A;  4HQA A;  4YNR A;  1EWZ A;  5F1F A;  3S22 A;  4PM7 A;  4LEN A;  5KSC A;  2QMI A;  1GA9 A;  5TFQ A;  1ONG A;  3BY9 A;  5E2G A;  5M1A A;  2XSS A;  4S2L A;  4P87 A;  3CZD A;  4UA6 A;  4GB7 A;  5CHM A;  4EBN A;  3JPU A;  3KO6 A;  3G2Z A;  3E4O A;  5BOH A;  2L0W A;  5JYP A;  2QJ5 A;  5GHZ A;  1DRM A;  4OLG A;  4R4R A;  4YOF A;  4S2N C;  1M40 A;  3LCE A;  1N9L A;  2W0N A;  2A3U A;  2P74 A;  4OOM A;  3UB7 A;  3LR5 A;  4R38 A;  4PM6 A;  3EEA A;  5CTM A;  3ZVW A;  3CG5 A;  2VA0 A;  1NZU A;  5A8B A;  1NY0 A;  4E3J A;  3CHW P;  3B42 A;  1TDG A;  3A3F A;  1ODV A;  4NXF A;  4HES A;  1FCM A;  2PU2 A;  5TBM B;  5AJG A;  4UHU A;  3G31 A;  4GZB A;  5EOO A;  1E3U D;  2A24 B;  3HLW A;  1FOF A;  4JGP A;  5J4E A;  3PAE A;  1K57 A;  2ZMA A;  3QNC A;  3NOT C;  1NWZ A;  1CJF A;  4Z1W A;  1LL8 A;  1XFN A;  3IXB A;  4KZ6 A;  4JF5 A;  4O8G A;  3SH8 A;  2Y2M A;  5L8M A;  2V20 A;  3CMZ A;  3ICY A;  5D3O A;  5TJJ A;  5M19 A;  5EVI C;  3CI6 A;  4ARZ B;  2ZMF A;  1ESI A;  4Y5F A;  1MWU A;  4OQ0 A;  1N9O A;  4Y13 A;  4EV4 A;  4DXC A;  2VGJ A;  2QPN A;  4ID4 A;  4NXB A;  1CI9 A;  3LYX A;  2ZL1 A;  3ZNY A;  2X71 A;  5J7E A;  4DKI A;  2O0Y A;  2VGK A;  3H9W A;  3RH8 B;  1SDE A;  2P08 A;  4H6J A;  2ZOI A;  1GHM A;  4RA7 A;  5L07 A;  3BQ8 A;  1K56 A;  3A3E A;  2H28 A;  2VV8 A;  1TEM A;  2B18 A;  3LR4 A;  2HDS A;  3SS4 A;  2A2L A;  3BEC A;  3N6I A;  3Q81 A;  5F1G A;  3TE8 A;  2JCH A;  3W2Z A;  4FCF A;  3W4Q A;  4GKU A;  1F98 A;  1AWI A;  4CLC B;  4XXR A;  4F3L B;  3D4F A;  5HX9 A;  1SKO A;  1WYC A;  5MC7 A;  2WKI A;  2WYX A;  4FOF A;  2KX6 A;  1CK3 A;  1GHI A;  4NET A;  1K55 C;  1HZO A;  2EX6 A;  3CJM A;  1GCE A;  4UA9 A;  4WMC A;  3C2W A;  1FR1 A;  3E98 A;  1BLS A;  1J3W A;  4BL3 A;  3BW6 A;  1IYO A;  2V8C A;  3PBQ A;  3LFV A;  2WKQ A;  2WK0 A;  4QU3 A;  2Y2L A;  3BY8 A;  4EES A;  5EVI D;  2LB9 A;  4PHT A;  4ZAM A;  3VFH A;  4U0T A;  4LCM A;  2V2F F;  3HVF A;  3MFX A;  2WUQ A;  1HVB A;  4C75 A;  1FCO A;  4EER A;  2OLU A;  2ZM2 A;  5DJU A;  1H3Q A;  3B47 A;  5HAR A;  2JKR I;  3ZQ5 A;  4Z9Q A;  2B5R A;  2Y2I A;  2GZA A;  2WGI A;  5HWV A;  5CER A;  3HBR A;  3ISG A;  4LRX C;  2Q0O A;  4HBU A;  4R3B A;  4YIN A;  3SOI A;  3GRJ A;  4X1L A;  2WKR A;  3QP4 A;  1DJA A;  4HJ3 A;  4GNU A;  4PPR A;  2GDN A;  1BZA A;  1JVJ A;  3IS2 A;  3MQ0 A;  4JPM A;  3ZG8 B;  3C5A A;  5EUA A;  3MS6 A;  2RCX A;  5TGF A;  3HUN A;  3M2J A;  3MBZ A;  4OOY A;  4R70 A;  2WAE A;  1YPR A;  2VKS A;  4K0W A;  2H0T A;  4Y15 A;  1YLJ A;  1PWD A;  3LY3 A;  5FQK A;  2QZ6 A;  4PM8 A;  2V1B A;  5DTK A;  1LLB A;  4GOG A;  1ERM A;  5FAP A;  4MN5 A;  1L0D A;  2O9B A;  3I7J A;  2H5S A;  1SHV A;  5L09 A;  1RGZ A;  3PHY A;  4IJG A;  3DWZ A;  4JF6 A;  1QMF A;  3GMW A;  1FSW A;  5FQQ A;  4Y7P A;  2XFT A;  3BYD A;  3MKF A;  1BLC A;  3BFC A;  5FQI A;  3WS5 A;  2V1Z A;  2HP5 A;  4ZRR A;  3S7O A;  4LFU A;  1WE4 A;  2H10 A;  3V5M A;  1OPX A;  4WUJ A;  2INW A;  1L0G A;  4C6Y A;  1VB6 A;  4BJP A;  1K54 C;  1NYY A;  3PXP A;  2J80 A;  2PDR A;  3S7Q A;  4YWZ A;  1KGG A;  1H5X A;  3Q82 A;  3BM6 A;  4A5R A;  1V9Y A;  4Q0I A;  4PM9 A;  4UQI M;  4L9E A;  1E3U A;  1WA9 A;  5DFX A;  5F68 A;  2JE5 A;  2VZW A;  2HJE A;  4UEY A;  4NKP A;  4BL2 A;  4QB8 A;  2ZC4 B;  1IYS A;  3BFE A;  5IT5 A;  4IUH A;  2W1T A;  3VSK A;  3V39 A;  4S2P A;  4Q8I A;  2YKH A;  3A0V A;  1ES3 A;  4E3L A;  3IX8 A;  1CQA A;  3OBF A;  1PI4 A;  3AGF A;  2DCF A;  3ZHH A;  2DMW A;  3EQV A;  4ZJ3 A;  2JBF A;  4E3N A;  4DDS A;  1VHM A;  4OLD A;  4N1H A;  1W8Q A;  4MCW A;  4PMA A;  5F69 A;  1FIL A;  4KZA A;  3R4K A;  4GHI B;  4IHQ A;  4D2O A;  3NOU C;  3JVV A;  2ZC7 A;  2EX2 A;  1L0E A;  3BFF A;  1T19 A;  5IS1 A;  3MFD A;  4U3T A;  4X55 A;  5FDS A;  1HD8 A;  4H8R A;  4JXG A;  3UPP A;  3H82 A;  5HL1 A;  4D60 A;  4E04 A;  3AGD A;  4WZ5 C;  3DTK A;  2OAQ 1;  4EU0 A;  5EV0 A;  1IEM A;  1S1Z A;  1XJ4 A;  3N7W A;  3EQU A;  4JLF A;  1CI8 A;  2A49 A;  3F1P A;  3IF5 A;  4P0M A;  4WEJ A;  4P6Z M;  4HOI A;  3CIT A;  4RX3 A;  2ZD8 A;  1DP6 A;  3UE1 A;  3WRZ A;  2XA7 M;  1ZKJ A;  2Y4A A;  3FPV A;  4GDN A;  2XLN A;  4JBF A;  4OH0 A;  3P98 A;  3OCL A;  3FC7 A;  4QHC A;  3KYZ A;  3A3D A;  2ZQ8 A;  5EVI A;  1XPB A;  1KOU A;  1TS7 A;  3GTC A;  3KYQ A;  5KZH A;  3ZYT A;  4S2O A;  5FAO A;  1XJ6 A;  2G7U A;  1TS6 A;  2WGV A;  3LO7 A;  3V3S A;  4NEE D;  3WS0 A;  4QY6 A;  4BLM A;  3MZE A;  3BQA A;  3GQZ A;  2OAP 1;  5FI6 A;  3HLD A;  3P01 A;  4OQI A;  4I39 A;  1ZTU A;  2Y2J A;  1OTE A;  4KUO A;  5DVA A;  5DKL A;  3OC2 A;  1PIO A;  3HLG A;  3T4K A;  4DMZ A;  4MBH A;  4X1M A;  3T50 A;  1W8Y A;  3TJZ C;  4EEP A;  4RQ9 A;  2HP6 A;  2XRN A;  1XP4 A;  1XX2 A;  4E3K A;  1ES5 A;  3FZC A;  3FWL A;  1WYB A;  2UV0 E;  4O0P A;  1YAX A;  5FAS A;  1OT6 A;  2W3H A;  2PD8 A;  4ESP A;  2PYR A;  5FEG A;  5HDS A;  2B95 A;  3FKW A;  4UAA A;  1VEU A;  3LIE A;  2V9A A;  2VX8 A;  3BRM A;  3HUM A;  4QWO A;  1IEL A;  2FZ0 A;  2C5W B;  1H8Y A;  4OPQ A;  5A93 A;  3ULF A;  1YKD A;  2J9O A;  1BUE A;  4JF4 A;  4BWI A;  3N8R A;  1MC0 A;  1K25 A;  3P09 A;  1YSQ A;  3M6H A;  4LV1 A;  4FH2 A;  5K5B A;  2ZMV A;  2FH5 A;  3NI9 A;  1YLP A;  4HIA A;  1L3L A;  2ZQA A;  3PAG A;  1G28 A;  3ZG7 B;  5GLA A;  3T1Q B;  2ZOH A;  1PW1 A;  4LLO B;  5HW3 A;  4MBK A;  3KSG A;  3T4S A;  3T4T A;  3LIF A;  2OWH A;  4UQI S;  2EX9 A;  3P7N A;  4WN5 A;  1MWS A;  3RXW A;  2NUT C;  5FA7 A;  1S4S A;  2BAS A;  3NDG A;  4LRZ E;  2Z2M B;  1XGI A;  3N8S A;  4X6T A;  3R7W A;  2WZZ A;  4K08 A;  2HZ5 A;  2ZQC A;  3MMH A;  3G32 A;  3GV9 A;  3KX0 X;  4JXV A;  2HV1 A;  2Y59 A;  4BBU A;  3ZDJ A;  2Y2P A;  1NJ4 A;  3ZCZ A;  5HD3 A;  3F1O B;  4ZBE A;  3FPW A;  2PAV P;  4HEF A;  5A92 A;  3UDI A;  3IF6 B;  4KUK A;  4IVK A;  3KYE A;  3NJA A;  3U4L P;  3C4O A;  3MXS A;  3PR6 A;  4KG5 A;  2XF3 A;  4OVD A;  4Y0O A;  1TD5 A;  1Y54 A;  2PHY A;  2O99 A;  3O3V A;  2HPB A;  1Y4O A;  3V50 A;  3LGO A;  2VV6 A;  1RP5 A;  3K3D A;  1UWN X;  3HUO A;  1STZ A;  4PKY A;  5IHV A;  2R9X A;  4IED A;  5CGW A;  3RFB A;  3HL9 A;  5F83 A;  3MF0 A;  1KE0 A;  1NLZ A;  4JXS A;  1OJG A;  3C7U A;  2PYP A;  2I72 A;  1K54 A;  4OPY A;  2Q9N A;  3CWF A;  3CLO A;  1F2K A;  4Y3I A;  4P6Z S;  4KQQ A;  3Q7V A;  1LSV A;  3IBJ A;  5GLB A;  3S7N A;  3FG8 A;  5DTS A;  2WAD A;  1PW8 A;  5AQ7 A;  2NUP C;  4L9F A; 
#chains in the Genus database with same CATH homology
 5G4Y A;  1LSX A;  4HH2 A;  3VOL A;  1TS0 A;  4ZRR A;  3S7O A;  1MZU A;  2EWW A;  2JKT M;  2GX5 A;  2GNX A;  2MJ6 A;  1OPX A;  3LIB A;  3PBT A;  5LBR A;  1OT9 A;  3HJI A;  1DP8 A;  2Z6C A;  4WUJ A;  2INW A;  5I5L A;  3B33 A;  1V9Z A;  3VE4 A;  4EUV A;  1VB6 A;  3UME A;  4BJP A;  3PXP A;  2P7J A;  2J80 A;  2PDR A;  3D72 A;  3S7Q A;  4GW9 A;  4YWZ A;  2V0U A;  5F5Y A;  3UB8 A;  4CLC A;  2JKR M;  5G4Z A;  1V9Y A;  1W63 M;  4Q0I A;  4UQI M;  2W3F A;  4F3L A;  2L4R A;  3H7W B;  4L9E A;  1P9R A;  3TW8 A;  2M7U A;  1WA9 A;  4CQH A;  3E4Q A;  4XT2 A;  4OOL A;  2K7S A;  4GS9 B;  3GDI A;  4L0L A;  4MN6 A;  2I9V A;  1IOU A;  4I3J A;  5DFX A;  5F68 A;  4B9O A;  2VZW A;  4HNB A;  3K2N A;  5HDD A;  4G3V A;  2HJE A;  4ETZ A;  3F1N B;  3LR0 A;  4UEY A;  4NKP A;  4WEK A;  1GSW A;  1OTI A;  5IT5 A;  2L1M A;  3EGD C;  4IUH A;  1JNU A;  2W1T A;  4MMN A;  4WEL A;  1XJ2 A;  3G6O A;  5KSH A;  2YKH A;  3A0V A;  2M1C A;  4NXE A;  2W27 A;  4MDZ A;  5FL3 A;  3PBN A;  3OBF A;  4Y2F A;  1D06 A;  4JGQ A;  3K3C A;  1LT0 A;  2DMW A;  3NHQ A;  4G3W A;  2JN7 A;  3PYP A;  2PR6 A;  2W3E A;  3EQV A;  3A0S A;  4H6J B;  5DKK A;  2K31 A;  4BBV A;  4JGO A;  2YKF A;  2QHK A;  4CLC C;  3BWL A;  1VHM A;  1T18 A;  2Z6D A;  4M4X A;  3VE3 A;  4MCW A;  5F69 A;  3HCY A;  5HPF A;  4EXO A;  3R4K A;  4GHI B;  4IHQ A;  2GJ3 A;  3NOU C;  3JVV A;  2J3T C;  4ME4 A;  4AFI A;  5KIZ A;  1P9W A;  3MXQ A;  4II7 A;  5CX7 A;  5AVF A;  1T19 A;  4R3A A;  3F1O A;  5IS1 A;  1P0Z A;  4MN7 A;  3KSI A;  2XRO A;  3PBR A;  3C30 A;  2WKP A;  4HI4 A;  3EGX C;  5HZH A;  3UB6 A;  1XJ3 A;  4HJ6 A;  5DJT A;  2VGL S;  3MQQ A;  4FSF A;  3C38 A;  3LI8 A;  2PR5 A;  1GSV A;  3H82 A;  3TRC A;  4WF0 A;  3LIA A;  4E04 A;  1H8M A;  4PAU A;  4HQA A;  4YNR A;  3RTY A;  3UB9 A;  2OAQ 1;  2VJW A;  4EU0 A;  4BBT A;  2XA7 S;  1S1Z A;  1XJ4 A;  2VGL M;  3BY9 A;  5DF9 A;  2XSS A;  2D02 A;  3EQU A;  3CUE A;  1OTA A;  3F1P A;  1ZHH B;  4WEJ A;  1T1B A;  4P6Z M;  3IBR A;  4HY8 A;  4HOI A;  3CIT A;  2O9A A;  5DFY A;  4L9G A;  3KO6 A;  3R7W B;  3E4O A;  2L0W A;  1DP6 A;  2QJ5 A;  2XA7 M;  1DRM A;  3EWK A;  4YOF A;  2W1R A;  5EFW A;  3FPV A;  4Q0J A;  1N9L A;  1T1A A;  2W0N A;  4OOM A;  3T4O A;  3OCL A;  3FC7 A;  4EEU A;  1TF1 A;  3KYZ A;  3UB7 A;  3LR5 A;  4R38 A;  3CAX A;  3EEA A;  4I3I A;  1DP9 A;  5HPI A;  2VA0 A;  3KSF A;  1Y28 A;  1KOU A;  1TS7 A;  5A8B A;  3KYQ A;  3ZYT A;  3V67 A;  3B42 A;  1XJ6 A;  2QWS A;  2W3D A;  2G7U A;  1TS6 A;  4WL9 A;  1OJ5 A;  1ODV A;  4HH3 A;  3SW1 A;  4NXF A;  1X0O A;  4NEE D;  5TBM B;  3CUE C;  4CLC D;  5AJG A;  2K2N A;  2OWJ A;  3BQA A;  2OAP 1;  3IS2 B;  3PBS A;  4JGR A;  1F5M A;  3P01 A;  2A24 B;  4I39 A;  2JKT I;  1ZTU A;  1OTE A;  4JGP A;  4KUO A;  2J3T D;  5DKL A;  3OC2 A;  5J4E A;  4EET B;  4LPZ A;  4BMW A;  3OLO A;  3NOT C;  1NWZ A;  3T4K A;  2KOI A;  4Z1W A;  4DMZ A;  2VEA A;  1LL8 A;  1XFN A;  3T50 A;  3LIC A;  3OOV A;  1S67 L;  4HP9 A;  3TJZ C;  3VV4 A;  4O8G A;  4RQ9 A;  4EEP A;  2KDK A;  2XRN A;  1YSP A;  3H7W A;  2O9C A;  5L8M A;  3ICY A;  3E4P A;  2KLI A;  5TJJ A;  3EEH A;  1UWP X;  4GS9 A;  3CI6 A;  4ARZ B;  2ZMF A;  4DJ2 A;  4Y5F A;  4O0P A;  5AVE A;  4KQO A;  1UGU A;  1N9O A;  1YAX A;  3HJK A;  5IU1 A;  3F1N A;  2R78 A;  2ZBB A;  1OT6 A;  4B93 A;  2W3H A;  2PD7 A;  2PD8 A;  1G6O A;  2PYR A;  3NOP C;  4NXB A;  3UMD A;  3LYX A;  5HDC A;  4R6L A;  3LI9 A;  2V1A A;  3DBA A;  4I3A A;  1GSX A;  5HDS A;  5J7E A;  2O0Y A;  4HHD A;  3H9W A;  1TS8 A;  2IA2 A;  3LIE A;  2V9A A;  3RH8 B;  2P08 A;  2VX8 A;  4H6J A;  4NXG A;  2ZOI A;  1IFQ A;  3S7P A;  5HL6 A;  2HF6 A;  2FZ0 A;  3BJN A;  3KSH A;  3BQ8 A;  3UE3 A;  2H28 A;  2EWV A;  2VV8 A;  3ULF A;  2JHE A;  1YKD A;  2B18 A;  3LR4 A;  3E0Y A;  4GHI A;  4BWI A;  4ETX A;  2A2L A;  1MC0 A;  5HD5 A;  3C8C A;  1F9I A;  1YSQ A;  4EW7 A;  3TE8 A;  4KQD A;  3W2Z A;  5K5B A;  2ZMV A;  2OOL A;  1F98 A;  1OTD A;  2J3W A;  4CLC B;  2FH5 A;  2V0W A;  3MJQ A;  1BYW A;  4F3L B;  4HP4 A;  4XT2 B;  5MC7 A;  4I38 A;  4HIA A;  3MQO A;  4FOF A;  1G28 A;  2KX6 A;  2ZOH A;  2Y8H A;  4LLO B;  5C5K A;  3KSG A;  3T4S A;  3T4T A;  2QKP A;  4EQ1 A;  2D01 A;  3LIF A;  2OWH A;  2W1T B;  4UQI S;  4GCZ A;  3C2W A;  3E98 A;  3P7N A;  4WN5 A;  2NUT C;  3BW6 A;  1S1Y A;  2VV7 A;  1EW0 A;  3OCN A;  3PBQ A;  3LFV A;  1S4S A;  2WKQ A;  2BAS A;  4LRZ E;  3LUQ A;  3BY8 A;  3R7W A;  4EES A;  1D7E A;  2LB9 A;  4PHT A;  4K08 A;  1MKM A;  3MMH A;  3UE6 A;  3GEC A;  4GLQ A;  2M7V A;  3KX0 X;  4O01 A;  3MFX A;  1S4R A;  2HV1 A;  4EER A;  2EA9 A;  4BBU A;  4HJ4 A;  4DN0 A;  5DJU A;  1S66 L;  2HJ9 C;  5HWT A;  1H3Q A;  3B47 A;  3T4Q A;  5HD3 A;  3F1O B;  1LSW A;  2PT7 A;  2JKR I;  2QJ7 A;  3ZQ5 A;  1P97 A;  3FPW A;  3T4J A;  3U2A A;  4I5S A;  2GZA A;  4WLA A;  2HGV A;  5HWW A;  5HWV A;  4KUK A;  1OTB A;  4Q0H A;  4LRX C;  2P04 A;  5F6A A;  3NJA A;  3JVU A;  3D3O A;  1XFQ A;  5TBM A;  2WKR A;  3H82 B;  3T4L A;  4HJ3 A;  2CMN A;  1NLY A;  3PR6 A;  1N9N A;  3MQ0 A;  3IS2 A;  2B02 A;  2QYB A;  1TD5 A;  5J3W A;  2PHY A;  2A24 A;  2O99 A;  4QPR A;  1NRJ A;  2VV6 A;  5HSQ A;  3K3D A;  1UWN X;  1STZ A;  4R70 A;  2VKS A;  4PKY A;  3F1P B;  4DJ3 A;  3RFB A;  2V1B A;  3PBO A;  3MF0 A;  4ARZ A;  3O5Y A;  1NLZ A;  1OJG A;  2PYP A;  2VLG A;  3LID A;  3A0R A;  4MN5 A;  2O9B A;  4G3K A;  3EOI A;  3CWF A;  1W63 Q;  3CLO A;  2Y79 A;  3PHY A;  4GJ4 A;  4Y3I A;  4P6Z S;  4IJG A;  4CLC E;  4PKY G;  2W3G A;  2LB5 A;  1LSV A;  3IBJ A;  3LR3 A;  3S7N A;  3FG8 A;  4IUK A;  3MR0 A;  4LRY C;  2NUP C;  1T1C A;  4L9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...