2V9AA

Structure of citrate-free periplasmic domain of sensor histidine kinase cita
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
105
Chain Sequence
TEERLHYQVGQRALIQAMQISAMPELVEAVQKRDLARIKALIDPMRSFSDATYITVGDASGQRLNAKSYVSVRKGSLGSSLRGKSPIQDATGKVIGIVSVGYTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENSOR KINASE CITA
publication title A Ligand-Induced Switch in the Periplasmic Domain of Sensor Histidine Kinase Cita.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transferase
total genus 21
structure length 105
sequence length 127
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2v9aA00
5G4ZA 4I3IA 1TS8A 2VEAA 3T50A 4LRYC 5F6AA 4F3LA 4XT2B 5AVFA 1LT0A 1V9YA 4KUKA 2CMNA 2PR6A 3UB7A 5HWVA 1F98A 2ZOHA 5G4YA 4I5SA 4HJ4A 2BASA 4HNBA 4HH3A 3UMEA 1TS0A 1D7EA 4LLOB 5F69A 5J3WA 1T18A 3F1OB 5HDCA 2VV7A 1LSWA 4NXBA 4B9OA 4HJ3A 4JGRA 2D02A 2V9AA 4EESA 2R78A 3GDIA 4JGPA 4EXOA 4EEPA 2OOLA 2P7JA 1WA9A 2D01A 3LIBA 1XJ3A 4HI4A 3A0VA 3CLOA 1BYWA 3UE6A 3F1OA 4BBUA 2KDKA 3BY9A 3ICYA 3UB6A 4GW9A 4PKYG 1G28A 4HP9A 2PYPA 5IU1A 4EETB 3E4QA 3PHYA 1VB6A 4EW7A 4MN5A 5A8BA 2KX6A 3KX0X 5AVEA 1N9LA 3MQQA 1DP9A 1UWNX 3EWKA 2W0NA 2OWHA 4E04A 2A24B 5DJUA 3F1PB 3ZQ5A 5TBMA 4LRZE 3OLOA 4GCZA 5HDDA 1XJ4A 4PKYA 4R70A 2HV1A 2M1CA 4HOIA 4LPZA 2OWJA 3NOPC 4WL9A 3H7WA 5F68A 1EW0A 1P0ZA 1DP8A 1S66L 3NHQA 2WKQA 4GHIB 1LSVA 3K3CA 2QKPA 4WLAA 1F9IA 1OTEA 4NXGA 3E4OA 2A24A 4DJ3A 4NXFA 2Z6CA 4WUJA 1GSWA 4JGOA 4R3AA 4KQDA 4XT2A 3GECA 5HDSA 3SW1A 1UGUA 3FC7A 4L9EA 2YKHA 1T1AA 1DRMA 5EFWA 3LIEA 4WN5A 1S67L 3BY8A 4H6JB 4HY8A 3UB8A 2PDRA 2JN7A 1XFQA 5HZHA 3CWFA 3NOUC 2I9VA 3A0RA 1OJ5A 3LIAA 3UMDA 2VLGA 3IBRA 4M4XA 3LICA 1T1CA 2EA9A 4I38A 4I3JA 3VOLA 4HJ6A 1OT9A 3RTYA 1OJGA 1ODVA 2QWSA 1OTIA 3K3DA 3HJIA 3F1NB 5HSQA 4H6JA 4KUOA 1OTAA 2V1AA 3MR0A 2INWA 2PD8A 2V1BA 3LIFA 1XFNA 4R38A 2YKFA 1S4RA 5DKLA 2ZBBA 3MJQA 1T1BA 3BWLA 3IS2B 2PYRA 3ULFA 2H28A 5HWTA 5I5LA 2WKPA 4RQ9A 4HHDA 1TS7A 5HWWA 2GJ3A 2JHEA 1X0OA 1S1ZA 2B02A 1DP6A 3LI8A 1S4SA 5KIZA 1P97A 3F1PA 4L9FA 3MFXA 3LI9A 1XJ6A 2PR5A 4JGQA 3CAXA 2Z6DA 4WF0A 3E4PA 2PD7A 3IS2A 3C2WA 1XJ2A 5IS1A 4I3AA 2W27A 1MZUA 3MQOA 4EQ1A 5J7EA 3H9WA 4HH2A 1LL8A 4GHIA 1N9OA 2J80A 1GSXA 3UB9A 2L0WA 4HQAA 1GSVA 3H82B 2PHYA 4GS9B 3D72A 1KOUA 4HIAA 1OTBA 3B33A 4L9GA 4BBVA 3A0SA 5J4EA 1NWZA 4I39A 2V0WA 3HJKA 3LYXA 3NJAA 4BBTA 5HD3A 2QHKA 4K08A 3RH8B 3VE4A 4EERA 1TS6A 3G6OA 4LRXC 1JNUA 3PYPA 5TBMB 1N9NA 2QJ7A 3MXQA 3C8CA 3H82A 2QJ5A 1S1YA 4GS9A 5HD5A 1UWPX 3P7NA 1T19A 3H7WB 4F3LB 4YWZA 2V0UA 2VV8A 4NXEA 5F5YA 5DJTA 1LSXA 2WKRA 3VE3A 2L1MA 3FG8A 4MN6A 2L4RA 5DKKA 1OTDA 4R6LA 3LUQA 1D06A 1V9ZA 4HP4A 1Y28A 4EEUA 3LIDA 2K7SA 1OT6A 4DJ2A 2VV6A 3F1NA 3NOTC 3EEHA 2ZOIA
chains in the Genus database with same CATH superfamily
1I2WA 5G4ZA 4S2PA 4I3IA 4DXCA 2VEAA 2ACGA 4XT2B 1G6AA 3SH7A 3V3RA 2VKSA 2UWXA 4PAUA 1V9YA 3DAVA 3IBJA 1ZKJA 3T4LA 4IBXA 3UB7A 2W1TA 4E6XA 1Z09A 3FKWA 1SZVA 4HJ4A 3WRTA 3MQ0A 5DF9A 4HH3A 3UMEA 4KZAA 5F69A 1ACFA 3HLBA 5FEFA 1LI9A 5CHJA 5TFQA 4NXBA 4DRTA 5KSHA 3V39A 4B9OA 1BSGA 3V50A 3BFFA 3NY4A 4JGRA 4S2NC 4EESA 2XA7S 2R78A 2QPNA 1DJBA 2C6WB 3GTCA 4EEPA 1NYMA 3BFEA 2D01A 1ES3A 3RXXA 3PBTA 4GDNA 3CLOA 3MZDA 1BYWA 4K0WA 3OPHA 3UE6A 4EUVA 1IFQA 2KDKA 3WS5A 3UB6A 4E3IA 2EX2A 4OPYA 4DF6A 2PYPA 5G18A 4LV1A 5JYPA 1ES2A 3PHYA 3QP1A 1FCNA 3ZNTA 3MQQA 5IHVA 1DP9A 3EWKA 2W0NA 3QP8A 5L10A 1YMXA 3I7JA 3ZG0A 2DNSA 5TBMA 2XD5A 4GCZA 4X1LA 1XJ4A 4R70A 5CECA 4OLGA 2ZMFA 3E2LA 3W4PA 1W5DA 5HL1A 4KENB 3DW0A 4WL9A 3H7WA 5F1FA 3IF6C 3M2KA 2XEPA 4EBLA 1NJ4A 1DP8A 1S66L 5AQ9A 2WKQA 1SKOA 3SS3A 2EX8A 3N8LA 2WGVA 3K3CA 4K91A 2QKPA 2W1RA 5EVEA 2Y2IA 1PZOA 3E4OA 3BQ8A 2Z6CA 1FQGA 2EFXA 5FQQA 1NLZA 2JC7A 5I94A 4P6ZM 3R7WA 2W3DA 3GMWA 3WRZA 1VEUB 3ZVTA 4MNRA 4EQIA 4WMCD 3S22A 5CGSA 1IELA 1W63M 3Q1FA 2JKFA 4L9EA 2P9VB 3S7PA 2P04A 3CUEC 3EQVA 2OAQ1 3MKEA 4FSFA 1STZA 3BY8A 1F5MA 1TDGA 1M40A 2V2FF 5HAPA 1SDEA 4FH2A 1YQSA 3EEAA 1NZUA 4GJ4A 3NI9A 1L0EA 2Q0OA 1XGJA 4R3JA 3HUNA 3IBRA 1J9MA 3UE3A 1ONHA 1HLUP 4LENA 4R1GA 1TVFA 4I3JA 1NZOA 4O8GA 2ZQ9A 1RGZA 5AQ7A 4X6TA 3HUMA 2HDSA 3RTYA 3K3DA 3HJIA 4H6JA 1JWVA 4CJNA 1K0KA 1QMFA 5F83A 4B93A 3G32A 2WKEA 2PD8A 2O9AA 5L8MA 1LHYA 4ARZA 2Y2GA 1S4RA 4P6ZS 2PAVP 4JBFA 2VZWA 5FAPA 3CZDA 3LR5A 3DWKA 3BFCA 3IX3A 1FILA 4NETA 4RX2A 1K56A 4HHDA 3BFDA 5HWWA 2GJ3A 3KSIA 4K0XA 4YNRA 5EVID 5TR7A 1MWUA 2B02A 2KOIA 2H0YA 1DP6A 3HCYA 1S4SA 5E2GA 1P97A 3F1PA 4L9FA 1IKGA 3G2ZA 1ESUA 3NDGA 3IXDA 3QP4A 2A2LA 2J8YA 3IXBA 3SZTA 3FPVA 3GRJA 5EM1A 3NCKA 5KZHA 1MZUA 5L07A 2ZM2A 3PR6A 3S7QA 4GD6A 5FI7A 2J80A 3UB9A 5A90A 4WYYA 3U4LP 3VP3A 3HBRA 4GN2A 4HIAA 3B33A 2R9XA 1YLZA 1KVLA 3TRCA 4WEKA 1LLBA 3RFBA 3G30A 5EOEA 1BZAA 3FZCA 3IX4A 1NWZA 4Z9QA 2XROA 4GLQA 1C3BA 1WYCA 1IEMA 4JKTA 3HJKA 2ZL1B 1PWGA 3OPRA 3IHAA 4Y17A 3VV4A 3ZHHA 3RH8B 1LI0A 2NUTC 1TS6A 4LRXC 1K38A 2VGJA 1K54A 3C5AA 4IUHA 2Y2KA 4Q0JA 4QPRA 1TDLA 3VFHA 4IVIA 2HPBA 1OPXA 4F3LB 4BD0A 2VV8A 3JVVA 1KE0A 4KQOA 4OQ0A 5F5YA 5DJTA 5CTNA 4MBHA 3G4PA 1TEMA 2ZMAA 1OTDA 4R6LA 5MC7A 4BD1A 2EWWA 4S2MA 4PM7A 4FCFA 3FPWA 1FR1A 4ZRRA 1CF0A 2DMWA 3UPOA 2VV6A 3VFFA 1J3WA 1KE3A 3EEHA 3LEZA 3OZHA 1TS8A 3JVUA 4KZ9A 3T50A 3OCLA 5AVFA 3LY3A 3HLFA 1YLYA 5A91A 1IYSA 5DTTA 1LL9A 4Y7PA 4KUKA 3KYQA 3NDEA 4S2LA 2JE5A 1I5QA 3EGXC 3BFGA 3MBZA 1F98A 5E43A 5G4YA 2WKIA 1P9RA 2BASA 4S2KA 3NULA 2M7VA 1Q2PA 2OLVA 2ZM0A 3N6IA 3N4IA 5HDCA 4EUZA 4II7A 5AQAA 3MXRA 1LSWA 4C75A 1SCWA 2ZQCA 4PM8A 4OP8A 1H5XA 4KG2A 5HAIA 2QYBA 4RVAA 3GDIA 4CLCA 4JGPA 3HLGA 4EXOA 2Q9MA 2OOLA 2P7JA 5FAQA 4NG2A 3B3XA 4E3NA 4C3QA 3AGFA 4PHTA 3TE8A 2X71A 1K6RA 4LV2A 1GA9A 1PW1A 3B42A 3MZFA 1Z6FA 3HLCA 4WELA 2ZC3B 1FIKA 3TG9A 5GLAA 1PI4A 1MKMA 3FV7A 1RGYA 4JXVA 4EU0A 1IYOA 5A8BA 3S7OA 5AVEA 3KX0X 2PU4A 1YLJA 5FATA 1UWNX 1PWDA 4GDBA 2XK1A 2OWHA 1BUEA 2J3WA 3KO6A 5M18A 3TW8A 3ZQ5A 4XUXA 3OLOA 3BM6A 3O88A 4BWIA 2HV1A 4HOIA 2OWJA 1KE4A 4O7DA 3SH9A 1MY8A 1W8QA 2Y2JA 4KQRA 3UO9A 2FFYA 5L09A 3N8RA 3Q7VB 1P0ZA 3NHQA 2HP6A 4EV4A 1K56D 4D2OA 3A3JA 4P87A 3W4QA 5HAQA 3C30A 1OTEA 4DJ3A 5FSRA 4WUJA 1GSWA 3M6HA 4JGOA 3N8SA 4OH0A 2K31A 3T1QB 2B95A 4U0XA 2OV5A 2FZ0A 2ZQAA 4JXGA 2Q9NA 4U3TA 4WZ4A 1MBLA 1MXOA 2V8FA 2WAFA 2WUQA 1UGUA 1XX2A 2XQZA 1PRQA 4S2NA 4X69A 3SOIA 2WADA 1T1AA 1KVMA 4P6BA 2W3GA 3LIEA 3C4PA 4X68A 2HGVA 1XA1A 2PDRA 1XFQA 1BLCA 5HZHA 4FD8A 5HARA 3NOUC 3E2KA 1YPRA 3IXGA 3VP1A 3LGOA 2GNXA 3LIAA 2VGLM 4Z1WA 4HBUA 1VEUA 1T1CA 2WZZA 3PBNA 4HBTA 5FQKA 2ZLYA 5HW3A 1S0WA 4DMZA 1K4EA 2BLSA 4OP5A 4ZDXA 5EUAA 3WS0A 4PM6A 4RA7A 2XH9A 3F1NB 4GOGA 1W7FA 3MSHA 1BT5A 4F94A 1KGFA 4PM9A 3BECA 2IWBA 1IYPA 3MR0A 4E3MA 3UDFA 1XFNA 2EXBA 1CEGA 3M6BA 3UY6A 1CQAA 3D9YA 5DKLA 2WGWA 3KYZA 3ZG9B 3MJQA 2WYXA 3G35A 3C4OA 5BOHA 3IF6A 1CI9A 1H0MA 4WZ5C 4Y13A 2H28A 3UNWA 1ES4A 5I5LA 3WWXA 2ZC6B 4RQ9A 3HLEA 4WM9A 1TS7A 5A92A 5DVAA 1TD5A 5JYOA 4X53A 5F1GA 3D4FA 1S1ZA 3PBOA 4OQIA 1G68A 1BLHA 3MF0A 2CC1A 1ALQA 5KIZA 3CITA 5FASA 1ERQA 1K57C 4B4XA 5E2FA 2VGLS 4D60A 3E4PA 2PD7A 1GA0A 5IS1A 3MQOA 5J7EA 3CUEA 4MBKA 3Q81A 4GHIA 5AJGA 2A3UA 3VP0A 2L0WA 3T12B 2P74A 3LR3A 3H82B 2PHYA 1EI5A 4Q0IA 4GS9B 5F82A 2G2WA 5M19A 2EX9A 3G34A 1FSYA 2XLNA 2VA0A 4BBVA 1N4OA 2XR0A 4QHCA 4E3KA 2J3TC 4DE2A 5CRFA 4P0MA 2DCFA 4I39A 4GKUA 1O7EA 3IH9A 4CLCD 3VP2A 3A3EA 3PBRA 2GZAA 3UE0A 3HVFA 1FSWA 1BTLA 3UE1A 4QU3A 4ZTKA 4RX3A 2HJ9C 1MWTA 1YT4A 5TBMB 1N9NA 3MXQA 5CXWA 3EGDC 3E98A 3C8CA 1VQQA 5HD5A 1UWPX 3P7NA 3H7WB 2Y91A 3ITBA 4IBRA 1XPBA 1L0DA 4NXEA 3LEQA 2UV0E 3OBFA 1LSXA 3MS6A 1SKOB 1K6SA 1ESIA 2L4RA 2JKRM 3E0YA 3WS1A 1D06A 1V9ZA 2AVXA 2Y2LA 5FA7A 2QMIA 2A49A 2OSUA 1K55C 1GCEA 1XKZA 3BRMA 3CPTA 4DJ2A 4N1XA 3BQAA 3NOTC 1AXBA 4DXBA 3ZDJA 1PYYA 1E25A 5EOOA 3CHWP 3GSGA 4LRYC 5F6AA 4F3LA 4N92A 1GHPA 1A0KA 4X56A 2PR6A 4ZBEA 3OPLA 3NBLA 5HWVA 2ZOHA 4I5SA 1VETA 3GVBA 5FAOA 2PBDP 3C7VA 3P09A 3S1YA 1TS0A 3OCNA 5EV0A 3G31A 5J3WA 1DJAA 1T18A 1YSPA 1G6OA 3F1OB 5HX9A 2Y59A 4PM5A 3KSFA 3IX8A 1YSQA 2JCHA 4HESA 3RXWA 5CERA 4GZBA 1ZG6A 1XXMA 4HJ3A 2PRFA 3D3OA 4DDYA 5HL6A 2JKTI 1W8YA 3VOYA 3IHBA 4KZ5A 4DE1A 2HJEA 2W3HA 2V8CA 3UN7A 1WA9A 2O9BA 4R23A 4PPRA 3LIBA 1CJFA 3T4KA 3LR4A 4HI4A 1PZPA 3ZFZA 1EWZA 4E3OA 4FTXA 2Y2QA 1E3UA 2J9OA 3IQAA 3DTEA 3BY9A 2Y8HA 4RYEA 4KZ7A 4X25A 4OQHA 1ZHHB 2EX6A 4UA9A 4BL2A 2ZC5B 3E4QA 1NY0A 1ZG4A 4MN5A 3VOZA 2H10A 2KX6A 1N9LA 4OOLA 1K54C 4A5RA 3S7NA 4ZAMA 4QJGA 1F2KA 4E04A 2Y4AA 2A24B 2H5SA 2JKGA 3F1PB 3LO7A 3SS5A 5HDDA 3IWIA 4PKYA 2GDNA 2M1CA 5FQIA 5CEDA 4UA6A 4YFMA 3CG5A 4R3BA 4OPQA 4KZ6A 4PMAA 4QY6A 3OOVA 2EWVA 1FCMA 3KSGA 5EE8A 1LSVA 1HZOA 4M3KA 2J9PA 3VSLA 3UB5P 3JPUA 5CEBA 4LFUA 4WLAA 1L0GA 4NXGA 2E8IA 3ZVWA 1XP4A 4OPRA 4KZ8A 3O87A 4ME4A 1QMEA 5EECA 3PTEA 3V5MA 5KSCA 1ZC2A 3O3VA 3WS2A 2Y79A 4KQDA 3Q07A 4XT2A 3GECA 1DY6A 3MMHA 3SW1A 3P01A 5FDSA 3FC7A 2YKHA 1NRFA 2HZ5A 4YOFA 5DTKA 1Y4OA 4Q8IA 3UPPA 4KZ4A 4FOFA 4IVKA 4EWFA 3T4OA 3UB8A 1YLTA 2JN7A 3CWFA 4U0TA 4IJGA 3IXHA 3GQZA 3VSKA 5DFXA 1OJ5A 3Q82A 1PIOA 1ES5A 1KGEA 3UMDA 2VLGA 4M4XA 4OLDA 4CQHA 5FEGA 5FQ9A 3A3IA 3VOLA 4GD8A 2G2UA 4OOYA 4Y0OA 4BJPA 1OJGA 1YKDA 4Y3IA 1OTIA 3U2AA 4DDSA 2INWA 3ZNYA 3LIFA 2K2NA 2YKFA 1S6RA 4ZJ3A 4EBNA 5L2FA 4UQIM 2ZBBA 4KZ3A 3MZEA 4S2OA 3WS4A 2Y2MA 3DWZA 2ZM8A 3BWLA 2GX5A 3IS2B 3ULFA 2OLUA 2WKHA 2WKPA 4JF6A 4B88A 5GHZA 4BL3A 1CI8A 4OKPA 4QWOA 1X0OA 4Y15A 4QY5A 5EVIC 3A3DA 1FOFA 2XF3A 3LI8A 1Y54A 2V1ZA 2P08A 2XFTA 3T4JA 1SDNA 2O99A 4LV0A 4JF4A 3G2YA 4MDZA 2QZ6A 2PR5A 3T1RA 1SKFA 2VX8A 4BENA 2VJWA 1IYQA 2Z6DA 1KDWA 4CLCB 1XJ2A 1H3QA 4ESPA 2W27A 1RCJA 3H9WA 4OQGA 2EXAA 1LL8A 3O86A 1N9OA 1GSXA 2IWDA 3T4QA 4GB7A 5E2HA 5U47A 4HQAA 1PI5A 3NC8A 4Y5FA 3FWLA 3W2ZA 3D72A 2HP9A 1BLPA 3HLWA 4OOMA 3TSGA 3UDIA 4UQIS 4CLCE 5CHMA 3NIAA 3QP2A 2XD1A 1GHMA 3FYZA 3CJMA 3FKVA 3PAEA 3BEBA 4N9KA 1G5UA 2Z2LB 3NJAA 4BBTA 4S2JA 5HD3A 4QD4A 1BLSA 2P9VA 4EERA 3ZCZA 5KMWA 3S4XA 2HDRA 2NUPC 3TOIA 2Y2HA 1E3UD 2QJ7A 2I72A 4UEYA 2Y55A 3H82A 5EVIB 4GS9A 3KYEA 5FQJA 1T19A 4YWZA 2V0UA 3AGEA 1YLPA 3RJUA 3FG8A 2XDMA 4AFIA 4WZ5A 5HPFA 2JKRI 1W79A 5DKKA 2W1TB 3K2NA 2VK3A 4G3VA 3ZG7B 3IWOA 4HP4A 4LGWA 4OVDA 2IWCA 4JPMA 3VP4A 3DTKA 2K7SA 1H8ZA 2MJ6A 1OT6A 4MN7A 3B47A 3IWQA 4LV3A 5E2EA 3CMZA 4NEED 4OONA 5GHYA 2ZOIA 4IHQA 4KG5A 1K57A 1JWPA 1M6KA 5FDHA 1Q2QA 2J7VA 1D1JA 1YLWA 1LT0A 3PXPA 2CMNA 1E4DA 3W8KA 5CGXA 2B5RA 4G3KA 1K25A 1N9BA 4R0QA 4UAAA 4NK3A 5HFOA 2KLIA 3LR0A 2B18A 5EPHA 1HD8A 1L0FA 1PW8A 3O5YA 4HNBA 4QB8A 4H8RA 5GLDA 3GR2A 4Y2FA 4WEJA 1D7EA 1KDSA 2ZQ8A 3C38A 1HVBA 2G7UA 4LLOB 1I2SA 2ZMVA 1L2SA 4R4RA 1JVJA 5DTSA 3HREA 2IA2A 2EFUA 3HLDA 2VV7A 3IT9A 4L0LA 1H8YA 4DKIA 1GHIA 2D02A 2V9AA 4P85A 2WAEA 4MCWA 4MEZA 1H8MA 2HDQA 3PBQA 4LCMA 5C5KA 5A93A 4JLFA 2LB9A 2H0TA 2E8JA 1XJ3A 3A0VA 4NKPA 5K5BA 2C5WB 5DF7A 2WGWB 4E3LA 3R4KA 3F1OA 5FI2A 4BBUA 3IF6B 3T4TA 3ICYA 3ISGA 4GW9A 2XRNA 4PKYG 1G28A 4HP9A 2R9WA 3OC2A 5IU1A 4E6WA 5TGFA 4EETB 2DRWA 3VMAA 1VB6A 3QP5A 4EW7A 2ZL1A 1K55A 1ERMA 4ZJ2A 3OPPA 4DN0A 5DJUA 1PNEA 3LCEA 4LRZE 1RP5A 5FI6A 3DTMA 4LPZA 1P9WA 3BLMA 3NOPC 3R7WB 2M7UA 3DTIA 5GL9A 4DE0A 5F68A 2Y2NA 3M2JA 1EW0A 1XA7A 2ZD8A 3QHYA 2ZQ7A 1TF1A 1IKIA 3ZG5A 5J8XA 4GHIB 1O07A 2WGIA 3LY4A 2OAP1 4MBFA 5FL3A 4ETXA 4ID4A 1EROA 3A3FA 3KSHA 3MFDA 1F9IA 5FQMA 1YAXA 2A24A 1WE4A 4NXFA 3EQUA 1KGGA 3L9KA 4R3AA 4HEFA 4JXWA 4KQQA 4Y0UA 3V67A 2FFFB 1MKIA 2XFSA 5TJJA 5HDSA 4B4ZA 2XGNA 1ONGA 4O01A 4Q0HA 5LBRA 3QP6A 4BQMA 3QNCA 3HUOA 2ZQDA 3P98A 4XUZA 2W3EA 1DRMA 5EFWA 4WN5A 1CEFA 1S67L 4S2IA 4H6JB 4CPKA 4HY8A 1DJCA 1CK3A 1LL5A 2V20A 2I9VA 3UDXA 3A0RA 2X01A 4ARZB 4KG6A 1FR6A 3LICA 1NLYA 3N7WA 2EA9A 4I38A 4HJ6A 3C7UA 1OT9A 3IH8A 5EVLA 4G3WA 1ODVA 4KZBA 3CPTB 3T1XA 2QWSA 2ZJ9A 3AGDA 3PBSA 3SS4A 5HSQA 4KUOA 2HDUA 3ZG8B 1OTAA 2V1AA 2WZXA 5CHUA 2V1BA 3Q7ZA 4O0PA 3V3SA 1YM1A 4R38A 5CGWA 4BMWA 3T1SA 1NXYA 4ZJ1A 1YMSA 3BJNA 2XSSA 4Y0TA 4LCLA 1T1BA 3EOIA 1MPLA 2RCXA 2ZC7A 2PYRA 1VETB 5GLBA 5HWTA 3LFVA 4C6YA 2PU2A 2Y2OA 2JHEA 1VM1A 3JYIA 4N9LA 4N1HA 2WK0A 5DF8A 2HF6A 3TJZC 3MXSA 3PAGA 3HL9A 3MFXA 1MC0A 3LI9A 5CTMA 1SHVA 1XJ6A 3GV9A 4XXRA 4JGQA 3CAXA 4WF0A 1K4FA 3IS2A 3IF5A 3C2WA 3Q7VA 4WMCA 3MKFA 5DFYA 3L7HA 4I3AA 5D3OA 4IEDA 4X55A 4EQ1A 1ZTUA 3QNBA 2BG1A 2PBYA 1MWRA 4HH2A 4MMNA 3BW6A 1PWCA 4WBGA 1JWZA 4FUWA 1WYBA 3ITAA 4UHUA 1GSVA 2Z2MB 2LB5A 5M1AA 4FH4A 4R4SA 1KOUA 2X02A 1OTBA 2RL3A 1BULA 2J3TD 4X1MA 5GHXA 3ZGAB 2VGKA 4L9GA 2O9CA 2ZC4B 4YINA 3A0SA 5J4EA 3CI6A 1W63Q 1MWSA 1U60A 2PT7A 4E3JA 2JKTM 2V0WA 2Y2PA 2W3FA 3LYXA 4CLCC 5CX7A 1HTZA 2QHKA 4JXSA 4K08A 4ETZA 3VE4A 3G6OA 3BYDA 1NRJA 1JNUA 1JTGA 3PYPA 3BLSA 5EM0A 4UA7A 2O0YA 2QJ5A 1S1YA 4JF5A 2HP5A 3T4SA 5HPIA 3SH8A 1AWIA 4OPZA 5GLCA 1IOUA 4MLLA 3UPNA 1JTDA 2WKRA 3VE3A 2L1MA 1L3LA 4MN6A 4BLMA 3ZYTA 1NYYA 2FH5A 3LUQA 2XA7M 3NECA 1Y28A 4EEUA 3LIDA 4DE3A 3DBAA 1OMEA 2JBFA 1VHMA 5IT5A 5AQBA 4EBPA 3W4OA 2BTFP 1XGIA 4GNUA 4IUKA 3F1NA 1PFLA 5EVIA 1FCOA
chains in the Genus database with same CATH topology
5G4ZA 4I3IA 1TS8A 4IHQA 3JVUA 2VEAA 3T50A 4LRYC 3OCLA 5F6AA 4F3LA 4XT2B 5AVFA 2VKSA 4PAUA 1LT0A 1V9YA 3PXPA 3IBJA 4KUKA 2CMNA 3KYQA 3T4LA 2PR6A 3UB7A 4G3KA 2W1TA 3EGXC 5HWVA 2KLIA 1F98A 3LR0A 2ZOHA 5G4YA 4I5SA 2B18A 4HJ4A 3O5YA 1P9RA 2BASA 4HNBA 3MQ0A 5DF9A 4HH3A 3UMEA 4Y2FA 1TS0A 3OCNA 4WEJA 1D7EA 2M7VA 3C38A 2G7UA 4LLOB 2ZMVA 5F69A 5J3WA 2IA2A 1T18A 1YSPA 1G6OA 3F1OB 5HDCA 4II7A 2VV7A 3KSFA 1LSWA 4NXBA 5KSHA 4L0LA 1YSQA 4B9OA 4HJ3A 3D3OA 4JGRA 2D02A 2QYBA 2V9AA 4EESA 2XA7S 5HL6A 2JKTI 2R78A 3GDIA 4MCWA 4CLCA 1H8MA 4JGPA 3PBQA 2HJEA 4EXOA 4EEPA 5C5KA 2LB9A 2W3HA 2OOLA 2P7JA 1WA9A 2O9BA 2D01A 3LIBA 1XJ3A 3T4KA 3LR4A 4HI4A 3A0VA 4NKPA 3PBTA 5K5BA 3CLOA 1BYWA 4PHTA 3UE6A 4EUVA 3TE8A 1IFQA 3R4KA 3F1OA 3B42A 2KDKA 4BBUA 3BY9A 3T4TA 2Y8HA 3ICYA 4WELA 3UB6A 4GW9A 2XRNA 4PKYG 1G28A 4HP9A 3OC2A 2PYPA 5IU1A 1ZHHB 1MKMA 4EETB 3E4QA 1VB6A 3PHYA 4EU0A 4EW7A 4MN5A 5A8BA 3S7OA 2KX6A 3KX0X 5AVEA 1N9LA 4OOLA 3MQQA 1DP9A 1UWNX 3EWKA 2W0NA 3S7NA 2OWHA 4DN0A 4E04A 2A24B 2J3WA 3KO6A 5DJUA 3F1PB 3TW8A 3ZQ5A 5TBMA 4LRZE 3OLOA 4GCZA 5HDDA 1XJ4A 4BWIA 4PKYA 4R70A 2HV1A 2M1CA 2ZMFA 4HOIA 4LPZA 1P9WA 2OWJA 3NOPC 3R7WB 4WL9A 2M7UA 3H7WA 5F68A 1EW0A 1P0ZA 1DP8A 1S66L 3NHQA 1TF1A 2WKQA 3OOVA 2EWVA 4GHIB 3KSGA 1LSVA 2OAP1 3K3CA 5FL3A 4ETXA 2QKPA 2W1RA 4WLAA 3KSHA 3C30A 1F9IA 1OTEA 1YAXA 4NXGA 3E4OA 2A24A 4DJ3A 3BQ8A 4NXFA 2Z6CA 4WUJA 1GSWA 4JGOA 3EQUA 4ME4A 4R3AA 1NLZA 2K31A 4P6ZM 3R7WA 2W3DA 3V67A 2Y79A 4KQDA 2FZ0A 4XT2A 3GECA 5TJJA 5HDSA 3MMHA 3SW1A 1UGUA 3P01A 1W63M 4O01A 3FC7A 4L9EA 4Q0HA 5LBRA 3S7PA 2YKHA 2P04A 3CUEC 4YOFA 3EQVA 2OAQ1 1T1AA 2W3EA 1DRMA 2W3GA 5EFWA 3LIEA 4WN5A 4FSFA 1S67L 1STZA 2HGVA 3BY8A 1F5MA 4H6JB 4HY8A 4FOFA 3T4OA 3UB8A 2PDRA 2JN7A 1XFQA 3EEAA 5HZHA 3CWFA 4GJ4A 3NOUC 2I9VA 4IJGA 3A0RA 4ARZB 5DFXA 1OJ5A 2GNXA 3LIAA 3UMDA 2VGLM 4Z1WA 2VLGA 3IBRA 4M4XA 3UE3A 3LICA 4CQHA 1NLYA 1T1CA 3PBNA 2EA9A 4I38A 4I3JA 4O8GA 3VOLA 4HJ6A 1OT9A 3RTYA 4G3WA 4BJPA 4DMZA 1OJGA 1ODVA 1YKDA 4Y3IA 2QWSA 1OTIA 3K3DA 3PBSA 3HJIA 3F1NB 5HSQA 4H6JA 4KUOA 3U2AA 4B93A 1OTAA 2V1AA 3MR0A 2INWA 2PD8A 2V1BA 2O9AA 4O0PA 5L8MA 3LIFA 1XFNA 4R38A 4BMWA 4ARZA 2K2NA 2YKFA 1S4RA 5DKLA 4UQIM 2ZBBA 3KYZA 4P6ZS 3BJNA 3MJQA 2XSSA 1T1BA 3EOIA 2VZWA 3BWLA 2GX5A 2PYRA 3IS2B 3ULFA 2H28A 3LR5A 5HWTA 5I5LA 2WKPA 3LFVA 4RQ9A 4HHDA 1TS7A 5HWWA 1TD5A 2GJ3A 2JHEA 3KSIA 4YNRA 1X0OA 1S1ZA 3PBOA 2B02A 2KOIA 2HF6A 1DP6A 3LI8A 3TJZC 3MF0A 3HCYA 1S4SA 2P08A 5KIZA 3T4JA 1P97A 3CITA 3F1PA 4L9FA 2O99A 3MFXA 1MC0A 3LI9A 4MDZA 2VGLS 1XJ6A 2PR5A 4JGQA 2VX8A 2A2LA 2VJWA 3CAXA 2Z6DA 4WF0A 3E4PA 2PD7A 3IS2A 4CLCB 3FPVA 3C2WA 1XJ2A 1H3QA 5DFYA 5IS1A 4I3AA 2W27A 1MZUA 3MQOA 1ZTUA 4EQ1A 3CUEA 5J7EA 3H9WA 3PR6A 3S7QA 4HH2A 4MMNA 1LL8A 3BW6A 4GHIA 1N9OA 2J80A 1GSXA 5AJGA 3UB9A 3T4QA 2L0WA 4HQAA 1GSVA 3LR3A 3H82B 2PHYA 4Y5FA 3W2ZA 4Q0IA 2LB5A 4GS9B 3D72A 1KOUA 4HIAA 4OOMA 1OTBA 3B33A 3TRCA 2J3TD 4WEKA 4UQIS 3RFBA 4CLCE 4L9GA 2O9CA 2VA0A 4BBVA 3A0SA 5J4EA 2J3TC 3CI6A 1W63Q 1NWZA 2XROA 4I39A 2PT7A 2JKTM 2V0WA 4CLCD 2GZAA 3PBRA 4GLQA 2W3FA 3HJKA 3LYXA 3NJAA 5CX7A 4BBTA 4CLCC 5HD3A 3VV4A 2QHKA 2HJ9C 4K08A 4ETZA 3RH8B 3VE4A 4EERA 2NUTC 1TS6A 3G6OA 2NUPC 1NRJA 4LRXC 1JNUA 3PYPA 5TBMB 1N9NA 2QJ7A 3MXQA 3EGDC 4UEYA 3E98A 3C8CA 3H82A 2O0YA 2QJ5A 4IUHA 1S1YA 4GS9A 5HD5A 4Q0JA 4QPRA 3T4SA 1UWPX 5HPIA 3P7NA 1T19A 3H7WB 1IOUA 1OPXA 4F3LB 4YWZA 2V0UA 2VV8A 3JVVA 4KQOA 4NXEA 5F5YA 3OBFA 5DJTA 1LSXA 2WKRA 3VE3A 2L1MA 3FG8A 4MN6A 4AFIA 5HPFA 2JKRI 2JKRM 2L4RA 3E0YA 3ZYTA 5DKKA 1OTDA 2W1TB 3K2NA 4R6LA 2FH5A 3LUQA 4G3VA 5MC7A 1D06A 2EWWA 2XA7M 1V9ZA 4HP4A 1Y28A 4EEUA 3LIDA 2K7SA 3DBAA 1VHMA 5IT5A 2MJ6A 1OT6A 3FPWA 4MN7A 4ZRRA 3B47A 4DJ2A 2DMWA 2VV6A 3BQAA 4IUKA 3F1NA 3NOTC 3EEHA 4NEED 2ZOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G4Z A;  4I3I A;  1TS8 A;  2VEA A;  3T50 A;  4LRY C;  5F6A A;  4F3L A;  4XT2 B;  5AVF A;  1LT0 A;  1V9Y A;  4KUK A;  2CMN A;  2PR6 A;  3UB7 A;  5HWV A;  1F98 A;  2ZOH A;  5G4Y A;  4I5S A;  4HJ4 A;  2BAS A;  4HNB A;  4HH3 A;  3UME A;  1TS0 A;  1D7E A;  4LLO B;  5F69 A;  5J3W A;  1T18 A;  3F1O B;  5HDC A;  2VV7 A;  1LSW A;  4NXB A;  4B9O A;  4HJ3 A;  4JGR A;  2D02 A;  2V9A A;  4EES A;  2R78 A;  3GDI A;  4JGP A;  4EXO A;  4EEP A;  2OOL A;  2P7J A;  1WA9 A;  2D01 A;  3LIB A;  1XJ3 A;  4HI4 A;  3A0V A;  3CLO A;  1BYW A;  3UE6 A;  3F1O A;  4BBU A;  2KDK A;  3BY9 A;  3ICY A;  3UB6 A;  4GW9 A;  4PKY G;  1G28 A;  4HP9 A;  2PYP A;  5IU1 A;  4EET B;  3E4Q A;  3PHY A;  1VB6 A;  4EW7 A;  4MN5 A;  5A8B A;  2KX6 A;  3KX0 X;  5AVE A;  1N9L A;  3MQQ A;  1DP9 A;  1UWN X;  3EWK A;  2W0N A;  2OWH A;  4E04 A;  2A24 B;  5DJU A;  3F1P B;  3ZQ5 A;  5TBM A;  4LRZ E;  3OLO A;  4GCZ A;  5HDD A;  1XJ4 A;  4PKY A;  4R70 A;  2HV1 A;  2M1C A;  4HOI A;  4LPZ A;  2OWJ A;  3NOP C;  4WL9 A;  3H7W A;  5F68 A;  1EW0 A;  1P0Z A;  1DP8 A;  1S66 L;  3NHQ A;  2WKQ A;  4GHI B;  1LSV A;  3K3C A;  2QKP A;  4WLA A;  1F9I A;  1OTE A;  4NXG A;  3E4O A;  2A24 A;  4DJ3 A;  4NXF A;  2Z6C A;  4WUJ A;  1GSW A;  4JGO A;  4R3A A;  4KQD A;  4XT2 A;  3GEC A;  5HDS A;  3SW1 A;  1UGU A;  3FC7 A;  4L9E A;  2YKH A;  1T1A A;  1DRM A;  5EFW A;  3LIE A;  4WN5 A;  1S67 L;  3BY8 A;  4H6J B;  4HY8 A;  3UB8 A;  2PDR A;  2JN7 A;  1XFQ A;  5HZH A;  3CWF A;  3NOU C;  2I9V A;  3A0R A;  1OJ5 A;  3LIA A;  3UMD A;  2VLG A;  3IBR A;  4M4X A;  3LIC A;  1T1C A;  2EA9 A;  4I38 A;  4I3J A;  3VOL A;  4HJ6 A;  1OT9 A;  3RTY A;  1OJG A;  1ODV A;  2QWS A;  1OTI A;  3K3D A;  3HJI A;  3F1N B;  5HSQ A;  4H6J A;  4KUO A;  1OTA A;  2V1A A;  3MR0 A;  2INW A;  2PD8 A;  2V1B A;  3LIF A;  1XFN A;  4R38 A;  2YKF A;  1S4R A;  5DKL A;  2ZBB A;  3MJQ A;  1T1B A;  3BWL A;  3IS2 B;  2PYR A;  3ULF A;  2H28 A;  5HWT A;  5I5L A;  2WKP A;  4RQ9 A;  4HHD A;  1TS7 A;  5HWW A;  2GJ3 A;  2JHE A;  1X0O A;  1S1Z A;  2B02 A;  1DP6 A;  3LI8 A;  1S4S A;  5KIZ A;  1P97 A;  3F1P A;  4L9F A;  3MFX A;  3LI9 A;  1XJ6 A;  2PR5 A;  4JGQ A;  3CAX A;  2Z6D A;  4WF0 A;  3E4P A;  2PD7 A;  3IS2 A;  3C2W A;  1XJ2 A;  5IS1 A;  4I3A A;  2W27 A;  1MZU A;  3MQO A;  4EQ1 A;  5J7E A;  3H9W A;  4HH2 A;  1LL8 A;  4GHI A;  1N9O A;  2J80 A;  1GSX A;  3UB9 A;  2L0W A;  4HQA A;  1GSV A;  3H82 B;  2PHY A;  4GS9 B;  3D72 A;  1KOU A;  4HIA A;  1OTB A;  3B33 A;  4L9G A;  4BBV A;  3A0S A;  5J4E A;  1NWZ A;  4I39 A;  2V0W A;  3HJK A;  3LYX A;  3NJA A;  4BBT A;  5HD3 A;  2QHK A;  4K08 A;  3RH8 B;  3VE4 A;  4EER A;  1TS6 A;  3G6O A;  4LRX C;  1JNU A;  3PYP A;  5TBM B;  1N9N A;  2QJ7 A;  3MXQ A;  3C8C A;  3H82 A;  2QJ5 A;  1S1Y A;  4GS9 A;  5HD5 A;  1UWP X;  3P7N A;  1T19 A;  3H7W B;  4F3L B;  4YWZ A;  2V0U A;  2VV8 A;  4NXE A;  5F5Y A;  5DJT A;  1LSX A;  2WKR A;  3VE3 A;  2L1M A;  3FG8 A;  4MN6 A;  2L4R A;  5DKK A;  1OTD A;  4R6L A;  3LUQ A;  1D06 A;  1V9Z A;  4HP4 A;  1Y28 A;  4EEU A;  3LID A;  2K7S A;  1OT6 A;  4DJ2 A;  2VV6 A;  3F1N A;  3NOT C;  3EEH A;  2ZOI A; 
#chains in the Genus database with same CATH topology
 1I2W A;  5G4Z A;  4S2P A;  4I3I A;  4DXC A;  2VEA A;  2ACG A;  4XT2 B;  1G6A A;  3SH7 A;  3V3R A;  2VKS A;  2UWX A;  4PAU A;  1V9Y A;  3DAV A;  3IBJ A;  1ZKJ A;  3T4L A;  4IBX A;  3UB7 A;  2W1T A;  4E6X A;  1Z09 A;  3FKW A;  1SZV A;  4HJ4 A;  3WRT A;  3MQ0 A;  5DF9 A;  4HH3 A;  3UME A;  4KZA A;  5F69 A;  1ACF A;  3HLB A;  5FEF A;  1LI9 A;  5CHJ A;  5TFQ A;  4NXB A;  4DRT A;  5KSH A;  3V39 A;  4B9O A;  1BSG A;  3V50 A;  3BFF A;  3NY4 A;  4JGR A;  4S2N C;  4EES A;  2XA7 S;  2R78 A;  2QPN A;  1DJB A;  2C6W B;  3GTC A;  4EEP A;  1NYM A;  3BFE A;  2D01 A;  1ES3 A;  3RXX A;  3PBT A;  4GDN A;  3CLO A;  3MZD A;  1BYW A;  4K0W A;  3OPH A;  3UE6 A;  4EUV A;  1IFQ A;  2KDK A;  3WS5 A;  3UB6 A;  4E3I A;  2EX2 A;  4OPY A;  4DF6 A;  2PYP A;  5G18 A;  4LV1 A;  5JYP A;  1ES2 A;  3PHY A;  3QP1 A;  1FCN A;  3ZNT A;  3MQQ A;  5IHV A;  1DP9 A;  3EWK A;  2W0N A;  3QP8 A;  5L10 A;  1YMX A;  3I7J A;  3ZG0 A;  2DNS A;  5TBM A;  2XD5 A;  4GCZ A;  4X1L A;  1XJ4 A;  4R70 A;  5CEC A;  4OLG A;  2ZMF A;  3E2L A;  3W4P A;  1W5D A;  5HL1 A;  4KEN B;  3DW0 A;  4WL9 A;  3H7W A;  5F1F A;  3IF6 C;  3M2K A;  2XEP A;  4EBL A;  1NJ4 A;  1DP8 A;  1S66 L;  5AQ9 A;  2WKQ A;  1SKO A;  3SS3 A;  2EX8 A;  3N8L A;  2WGV A;  3K3C A;  4K91 A;  2QKP A;  2W1R A;  5EVE A;  2Y2I A;  1PZO A;  3E4O A;  3BQ8 A;  2Z6C A;  1FQG A;  2EFX A;  5FQQ A;  1NLZ A;  2JC7 A;  5I94 A;  4P6Z M;  3R7W A;  2W3D A;  3GMW A;  3WRZ A;  1VEU B;  3ZVT A;  4MNR A;  4EQI A;  4WMC D;  3S22 A;  5CGS A;  1IEL A;  1W63 M;  3Q1F A;  2JKF A;  4L9E A;  2P9V B;  3S7P A;  2P04 A;  3CUE C;  3EQV A;  2OAQ 1;  3MKE A;  4FSF A;  1STZ A;  3BY8 A;  1F5M A;  1TDG A;  1M40 A;  2V2F F;  5HAP A;  1SDE A;  4FH2 A;  1YQS A;  3EEA A;  1NZU A;  4GJ4 A;  3NI9 A;  1L0E A;  2Q0O A;  1XGJ A;  4R3J A;  3HUN A;  3IBR A;  1J9M A;  3UE3 A;  1ONH A;  1HLU P;  4LEN A;  4R1G A;  1TVF A;  4I3J A;  1NZO A;  4O8G A;  2ZQ9 A;  1RGZ A;  5AQ7 A;  4X6T A;  3HUM A;  2HDS A;  3RTY A;  3K3D A;  3HJI A;  4H6J A;  1JWV A;  4CJN A;  1K0K A;  1QMF A;  5F83 A;  4B93 A;  3G32 A;  2WKE A;  2PD8 A;  2O9A A;  5L8M A;  1LHY A;  4ARZ A;  2Y2G A;  1S4R A;  4P6Z S;  2PAV P;  4JBF A;  2VZW A;  5FAP A;  3CZD A;  3LR5 A;  3DWK A;  3BFC A;  3IX3 A;  1FIL A;  4NET A;  4RX2 A;  1K56 A;  4HHD A;  3BFD A;  5HWW A;  2GJ3 A;  3KSI A;  4K0X A;  4YNR A;  5EVI D;  5TR7 A;  1MWU A;  2B02 A;  2KOI A;  2H0Y A;  1DP6 A;  3HCY A;  1S4S A;  5E2G A;  1P97 A;  3F1P A;  4L9F A;  1IKG A;  3G2Z A;  1ESU A;  3NDG A;  3IXD A;  3QP4 A;  2A2L A;  2J8Y A;  3IXB A;  3SZT A;  3FPV A;  3GRJ A;  5EM1 A;  3NCK A;  5KZH A;  1MZU A;  5L07 A;  2ZM2 A;  3PR6 A;  3S7Q A;  4GD6 A;  5FI7 A;  2J80 A;  3UB9 A;  5A90 A;  4WYY A;  3U4L P;  3VP3 A;  3HBR A;  4GN2 A;  4HIA A;  3B33 A;  2R9X A;  1YLZ A;  1KVL A;  3TRC A;  4WEK A;  1LLB A;  3RFB A;  3G30 A;  5EOE A;  1BZA A;  3FZC A;  3IX4 A;  1NWZ A;  4Z9Q A;  2XRO A;  4GLQ A;  1C3B A;  1WYC A;  1IEM A;  4JKT A;  3HJK A;  2ZL1 B;  1PWG A;  3OPR A;  3IHA A;  4Y17 A;  3VV4 A;  3ZHH A;  3RH8 B;  1LI0 A;  2NUT C;  1TS6 A;  4LRX C;  1K38 A;  2VGJ A;  1K54 A;  3C5A A;  4IUH A;  2Y2K A;  4Q0J A;  4QPR A;  1TDL A;  3VFH A;  4IVI A;  2HPB A;  1OPX A;  4F3L B;  4BD0 A;  2VV8 A;  3JVV A;  1KE0 A;  4KQO A;  4OQ0 A;  5F5Y A;  5DJT A;  5CTN A;  4MBH A;  3G4P A;  1TEM A;  2ZMA A;  1OTD A;  4R6L A;  5MC7 A;  4BD1 A;  2EWW A;  4S2M A;  4PM7 A;  4FCF A;  3FPW A;  1FR1 A;  4ZRR A;  1CF0 A;  2DMW A;  3UPO A;  2VV6 A;  3VFF A;  1J3W A;  1KE3 A;  3EEH A;  3LEZ A;  3OZH A;  1TS8 A;  3JVU A;  4KZ9 A;  3T50 A;  3OCL A;  5AVF A;  3LY3 A;  3HLF A;  1YLY A;  5A91 A;  1IYS A;  5DTT A;  1LL9 A;  4Y7P A;  4KUK A;  3KYQ A;  3NDE A;  4S2L A;  2JE5 A;  1I5Q A;  3EGX C;  3BFG A;  3MBZ A;  1F98 A;  5E43 A;  5G4Y A;  2WKI A;  1P9R A;  2BAS A;  4S2K A;  3NUL A;  2M7V A;  1Q2P A;  2OLV A;  2ZM0 A;  3N6I A;  3N4I A;  5HDC A;  4EUZ A;  4II7 A;  5AQA A;  3MXR A;  1LSW A;  4C75 A;  1SCW A;  2ZQC A;  4PM8 A;  4OP8 A;  1H5X A;  4KG2 A;  5HAI A;  2QYB A;  4RVA A;  3GDI A;  4CLC A;  4JGP A;  3HLG A;  4EXO A;  2Q9M A;  2OOL A;  2P7J A;  5FAQ A;  4NG2 A;  3B3X A;  4E3N A;  4C3Q A;  3AGF A;  4PHT A;  3TE8 A;  2X71 A;  1K6R A;  4LV2 A;  1GA9 A;  1PW1 A;  3B42 A;  3MZF A;  1Z6F A;  3HLC A;  4WEL A;  2ZC3 B;  1FIK A;  3TG9 A;  5GLA A;  1PI4 A;  1MKM A;  3FV7 A;  1RGY A;  4JXV A;  4EU0 A;  1IYO A;  5A8B A;  3S7O A;  5AVE A;  3KX0 X;  2PU4 A;  1YLJ A;  5FAT A;  1UWN X;  1PWD A;  4GDB A;  2XK1 A;  2OWH A;  1BUE A;  2J3W A;  3KO6 A;  5M18 A;  3TW8 A;  3ZQ5 A;  4XUX A;  3OLO A;  3BM6 A;  3O88 A;  4BWI A;  2HV1 A;  4HOI A;  2OWJ A;  1KE4 A;  4O7D A;  3SH9 A;  1MY8 A;  1W8Q A;  2Y2J A;  4KQR A;  3UO9 A;  2FFY A;  5L09 A;  3N8R A;  3Q7V B;  1P0Z A;  3NHQ A;  2HP6 A;  4EV4 A;  1K56 D;  4D2O A;  3A3J A;  4P87 A;  3W4Q A;  5HAQ A;  3C30 A;  1OTE A;  4DJ3 A;  5FSR A;  4WUJ A;  1GSW A;  3M6H A;  4JGO A;  3N8S A;  4OH0 A;  2K31 A;  3T1Q B;  2B95 A;  4U0X A;  2OV5 A;  2FZ0 A;  2ZQA A;  4JXG A;  2Q9N A;  4U3T A;  4WZ4 A;  1MBL A;  1MXO A;  2V8F A;  2WAF A;  2WUQ A;  1UGU A;  1XX2 A;  2XQZ A;  1PRQ A;  4S2N A;  4X69 A;  3SOI A;  2WAD A;  1T1A A;  1KVM A;  4P6B A;  2W3G A;  3LIE A;  3C4P A;  4X68 A;  2HGV A;  1XA1 A;  2PDR A;  1XFQ A;  1BLC A;  5HZH A;  4FD8 A;  5HAR A;  3NOU C;  3E2K A;  1YPR A;  3IXG A;  3VP1 A;  3LGO A;  2GNX A;  3LIA A;  2VGL M;  4Z1W A;  4HBU A;  1VEU A;  1T1C A;  2WZZ A;  3PBN A;  4HBT A;  5FQK A;  2ZLY A;  5HW3 A;  1S0W A;  4DMZ A;  1K4E A;  2BLS A;  4OP5 A;  4ZDX A;  5EUA A;  3WS0 A;  4PM6 A;  4RA7 A;  2XH9 A;  3F1N B;  4GOG A;  1W7F A;  3MSH A;  1BT5 A;  4F94 A;  1KGF A;  4PM9 A;  3BEC A;  2IWB A;  1IYP A;  3MR0 A;  4E3M A;  3UDF A;  1XFN A;  2EXB A;  1CEG A;  3M6B A;  3UY6 A;  1CQA A;  3D9Y A;  5DKL A;  2WGW A;  3KYZ A;  3ZG9 B;  3MJQ A;  2WYX A;  3G35 A;  3C4O A;  5BOH A;  3IF6 A;  1CI9 A;  1H0M A;  4WZ5 C;  4Y13 A;  2H28 A;  3UNW A;  1ES4 A;  5I5L A;  3WWX A;  2ZC6 B;  4RQ9 A;  3HLE A;  4WM9 A;  1TS7 A;  5A92 A;  5DVA A;  1TD5 A;  5JYO A;  4X53 A;  5F1G A;  3D4F A;  1S1Z A;  3PBO A;  4OQI A;  1G68 A;  1BLH A;  3MF0 A;  2CC1 A;  1ALQ A;  5KIZ A;  3CIT A;  5FAS A;  1ERQ A;  1K57 C;  4B4X A;  5E2F A;  2VGL S;  4D60 A;  3E4P A;  2PD7 A;  1GA0 A;  5IS1 A;  3MQO A;  5J7E A;  3CUE A;  4MBK A;  3Q81 A;  4GHI A;  5AJG A;  2A3U A;  3VP0 A;  2L0W A;  3T12 B;  2P74 A;  3LR3 A;  3H82 B;  2PHY A;  1EI5 A;  4Q0I A;  4GS9 B;  5F82 A;  2G2W A;  5M19 A;  2EX9 A;  3G34 A;  1FSY A;  2XLN A;  2VA0 A;  4BBV A;  1N4O A;  2XR0 A;  4QHC A;  4E3K A;  2J3T C;  4DE2 A;  5CRF A;  4P0M A;  2DCF A;  4I39 A;  4GKU A;  1O7E A;  3IH9 A;  4CLC D;  3VP2 A;  3A3E A;  3PBR A;  2GZA A;  3UE0 A;  3HVF A;  1FSW A;  1BTL A;  3UE1 A;  4QU3 A;  4ZTK A;  4RX3 A;  2HJ9 C;  1MWT A;  1YT4 A;  5TBM B;  1N9N A;  3MXQ A;  5CXW A;  3EGD C;  3E98 A;  3C8C A;  1VQQ A;  5HD5 A;  1UWP X;  3P7N A;  3H7W B;  2Y91 A;  3ITB A;  4IBR A;  1XPB A;  1L0D A;  4NXE A;  3LEQ A;  2UV0 E;  3OBF A;  1LSX A;  3MS6 A;  1SKO B;  1K6S A;  1ESI A;  2L4R A;  2JKR M;  3E0Y A;  3WS1 A;  1D06 A;  1V9Z A;  2AVX A;  2Y2L A;  5FA7 A;  2QMI A;  2A49 A;  2OSU A;  1K55 C;  1GCE A;  1XKZ A;  3BRM A;  3CPT A;  4DJ2 A;  4N1X A;  3BQA A;  3NOT C;  1AXB A;  4DXB A;  3ZDJ A;  1PYY A;  1E25 A;  5EOO A;  3CHW P;  3GSG A;  4LRY C;  5F6A A;  4F3L A;  4N92 A;  1GHP A;  1A0K A;  4X56 A;  2PR6 A;  4ZBE A;  3OPL A;  3NBL A;  5HWV A;  2ZOH A;  4I5S A;  1VET A;  3GVB A;  5FAO A;  2PBD P;  3C7V A;  3P09 A;  3S1Y A;  1TS0 A;  3OCN A;  5EV0 A;  3G31 A;  5J3W A;  1DJA A;  1T18 A;  1YSP A;  1G6O A;  3F1O B;  5HX9 A;  2Y59 A;  4PM5 A;  3KSF A;  3IX8 A;  1YSQ A;  2JCH A;  4HES A;  3RXW A;  5CER A;  4GZB A;  1ZG6 A;  1XXM A;  4HJ3 A;  2PRF A;  3D3O A;  4DDY A;  5HL6 A;  2JKT I;  1W8Y A;  3VOY A;  3IHB A;  4KZ5 A;  4DE1 A;  2HJE A;  2W3H A;  2V8C A;  3UN7 A;  1WA9 A;  2O9B A;  4R23 A;  4PPR A;  3LIB A;  1CJF A;  3T4K A;  3LR4 A;  4HI4 A;  1PZP A;  3ZFZ A;  1EWZ A;  4E3O A;  4FTX A;  2Y2Q A;  1E3U A;  2J9O A;  3IQA A;  3DTE A;  3BY9 A;  2Y8H A;  4RYE A;  4KZ7 A;  4X25 A;  4OQH A;  1ZHH B;  2EX6 A;  4UA9 A;  4BL2 A;  2ZC5 B;  3E4Q A;  1NY0 A;  1ZG4 A;  4MN5 A;  3VOZ A;  2H10 A;  2KX6 A;  1N9L A;  4OOL A;  1K54 C;  4A5R A;  3S7N A;  4ZAM A;  4QJG A;  1F2K A;  4E04 A;  2Y4A A;  2A24 B;  2H5S A;  2JKG A;  3F1P B;  3LO7 A;  3SS5 A;  5HDD A;  3IWI A;  4PKY A;  2GDN A;  2M1C A;  5FQI A;  5CED A;  4UA6 A;  4YFM A;  3CG5 A;  4R3B A;  4OPQ A;  4KZ6 A;  4PMA A;  4QY6 A;  3OOV A;  2EWV A;  1FCM A;  3KSG A;  5EE8 A;  1LSV A;  1HZO A;  4M3K A;  2J9P A;  3VSL A;  3UB5 P;  3JPU A;  5CEB A;  4LFU A;  4WLA A;  1L0G A;  4NXG A;  2E8I A;  3ZVW A;  1XP4 A;  4OPR A;  4KZ8 A;  3O87 A;  4ME4 A;  1QME A;  5EEC A;  3PTE A;  3V5M A;  5KSC A;  1ZC2 A;  3O3V A;  3WS2 A;  2Y79 A;  4KQD A;  3Q07 A;  4XT2 A;  3GEC A;  1DY6 A;  3MMH A;  3SW1 A;  3P01 A;  5FDS A;  3FC7 A;  2YKH A;  1NRF A;  2HZ5 A;  4YOF A;  5DTK A;  1Y4O A;  4Q8I A;  3UPP A;  4KZ4 A;  4FOF A;  4IVK A;  4EWF A;  3T4O A;  3UB8 A;  1YLT A;  2JN7 A;  3CWF A;  4U0T A;  4IJG A;  3IXH A;  3GQZ A;  3VSK A;  5DFX A;  1OJ5 A;  3Q82 A;  1PIO A;  1ES5 A;  1KGE A;  3UMD A;  2VLG A;  4M4X A;  4OLD A;  4CQH A;  5FEG A;  5FQ9 A;  3A3I A;  3VOL A;  4GD8 A;  2G2U A;  4OOY A;  4Y0O A;  4BJP A;  1OJG A;  1YKD A;  4Y3I A;  1OTI A;  3U2A A;  4DDS A;  2INW A;  3ZNY A;  3LIF A;  2K2N A;  2YKF A;  1S6R A;  4ZJ3 A;  4EBN A;  5L2F A;  4UQI M;  2ZBB A;  4KZ3 A;  3MZE A;  4S2O A;  3WS4 A;  2Y2M A;  3DWZ A;  2ZM8 A;  3BWL A;  2GX5 A;  3IS2 B;  3ULF A;  2OLU A;  2WKH A;  2WKP A;  4JF6 A;  4B88 A;  5GHZ A;  4BL3 A;  1CI8 A;  4OKP A;  4QWO A;  1X0O A;  4Y15 A;  4QY5 A;  5EVI C;  3A3D A;  1FOF A;  2XF3 A;  3LI8 A;  1Y54 A;  2V1Z A;  2P08 A;  2XFT A;  3T4J A;  1SDN A;  2O99 A;  4LV0 A;  4JF4 A;  3G2Y A;  4MDZ A;  2QZ6 A;  2PR5 A;  3T1R A;  1SKF A;  2VX8 A;  4BEN A;  2VJW A;  1IYQ A;  2Z6D A;  1KDW A;  4CLC B;  1XJ2 A;  1H3Q A;  4ESP A;  2W27 A;  1RCJ A;  3H9W A;  4OQG A;  2EXA A;  1LL8 A;  3O86 A;  1N9O A;  1GSX A;  2IWD A;  3T4Q A;  4GB7 A;  5E2H A;  5U47 A;  4HQA A;  1PI5 A;  3NC8 A;  4Y5F A;  3FWL A;  3W2Z A;  3D72 A;  2HP9 A;  1BLP A;  3HLW A;  4OOM A;  3TSG A;  3UDI A;  4UQI S;  4CLC E;  5CHM A;  3NIA A;  3QP2 A;  2XD1 A;  1GHM A;  3FYZ A;  3CJM A;  3FKV A;  3PAE A;  3BEB A;  4N9K A;  1G5U A;  2Z2L B;  3NJA A;  4BBT A;  4S2J A;  5HD3 A;  4QD4 A;  1BLS A;  2P9V A;  4EER A;  3ZCZ A;  5KMW A;  3S4X A;  2HDR A;  2NUP C;  3TOI A;  2Y2H A;  1E3U D;  2QJ7 A;  2I72 A;  4UEY A;  2Y55 A;  3H82 A;  5EVI B;  4GS9 A;  3KYE A;  5FQJ A;  1T19 A;  4YWZ A;  2V0U A;  3AGE A;  1YLP A;  3RJU A;  3FG8 A;  2XDM A;  4AFI A;  4WZ5 A;  5HPF A;  2JKR I;  1W79 A;  5DKK A;  2W1T B;  3K2N A;  2VK3 A;  4G3V A;  3ZG7 B;  3IWO A;  4HP4 A;  4LGW A;  4OVD A;  2IWC A;  4JPM A;  3VP4 A;  3DTK A;  2K7S A;  1H8Z A;  2MJ6 A;  1OT6 A;  4MN7 A;  3B47 A;  3IWQ A;  4LV3 A;  5E2E A;  3CMZ A;  4NEE D;  4OON A;  5GHY A;  2ZOI A;  4IHQ A;  4KG5 A;  1K57 A;  1JWP A;  1M6K A;  5FDH A;  1Q2Q A;  2J7V A;  1D1J A;  1YLW A;  1LT0 A;  3PXP A;  2CMN A;  1E4D A;  3W8K A;  5CGX A;  2B5R A;  4G3K A;  1K25 A;  1N9B A;  4R0Q A;  4UAA A;  4NK3 A;  5HFO A;  2KLI A;  3LR0 A;  2B18 A;  5EPH A;  1HD8 A;  1L0F A;  1PW8 A;  3O5Y A;  4HNB A;  4QB8 A;  4H8R A;  5GLD A;  3GR2 A;  4Y2F A;  4WEJ A;  1D7E A;  1KDS A;  2ZQ8 A;  3C38 A;  1HVB A;  2G7U A;  4LLO B;  1I2S A;  2ZMV A;  1L2S A;  4R4R A;  1JVJ A;  5DTS A;  3HRE A;  2IA2 A;  2EFU A;  3HLD A;  2VV7 A;  3IT9 A;  4L0L A;  1H8Y A;  4DKI A;  1GHI A;  2D02 A;  2V9A A;  4P85 A;  2WAE A;  4MCW A;  4MEZ A;  1H8M A;  2HDQ A;  3PBQ A;  4LCM A;  5C5K A;  5A93 A;  4JLF A;  2LB9 A;  2H0T A;  2E8J A;  1XJ3 A;  3A0V A;  4NKP A;  5K5B A;  2C5W B;  5DF7 A;  2WGW B;  4E3L A;  3R4K A;  3F1O A;  5FI2 A;  4BBU A;  3IF6 B;  3T4T A;  3ICY A;  3ISG A;  4GW9 A;  2XRN A;  4PKY G;  1G28 A;  4HP9 A;  2R9W A;  3OC2 A;  5IU1 A;  4E6W A;  5TGF A;  4EET B;  2DRW A;  3VMA A;  1VB6 A;  3QP5 A;  4EW7 A;  2ZL1 A;  1K55 A;  1ERM A;  4ZJ2 A;  3OPP A;  4DN0 A;  5DJU A;  1PNE A;  3LCE A;  4LRZ E;  1RP5 A;  5FI6 A;  3DTM A;  4LPZ A;  1P9W A;  3BLM A;  3NOP C;  3R7W B;  2M7U A;  3DTI A;  5GL9 A;  4DE0 A;  5F68 A;  2Y2N A;  3M2J A;  1EW0 A;  1XA7 A;  2ZD8 A;  3QHY A;  2ZQ7 A;  1TF1 A;  1IKI A;  3ZG5 A;  5J8X A;  4GHI B;  1O07 A;  2WGI A;  3LY4 A;  2OAP 1;  4MBF A;  5FL3 A;  4ETX A;  4ID4 A;  1ERO A;  3A3F A;  3KSH A;  3MFD A;  1F9I A;  5FQM A;  1YAX A;  2A24 A;  1WE4 A;  4NXF A;  3EQU A;  1KGG A;  3L9K A;  4R3A A;  4HEF A;  4JXW A;  4KQQ A;  4Y0U A;  3V67 A;  2FFF B;  1MKI A;  2XFS A;  5TJJ A;  5HDS A;  4B4Z A;  2XGN A;  1ONG A;  4O01 A;  4Q0H A;  5LBR A;  3QP6 A;  4BQM A;  3QNC A;  3HUO A;  2ZQD A;  3P98 A;  4XUZ A;  2W3E A;  1DRM A;  5EFW A;  4WN5 A;  1CEF A;  1S67 L;  4S2I A;  4H6J B;  4CPK A;  4HY8 A;  1DJC A;  1CK3 A;  1LL5 A;  2V20 A;  2I9V A;  3UDX A;  3A0R A;  2X01 A;  4ARZ B;  4KG6 A;  1FR6 A;  3LIC A;  1NLY A;  3N7W A;  2EA9 A;  4I38 A;  4HJ6 A;  3C7U A;  1OT9 A;  3IH8 A;  5EVL A;  4G3W A;  1ODV A;  4KZB A;  3CPT B;  3T1X A;  2QWS A;  2ZJ9 A;  3AGD A;  3PBS A;  3SS4 A;  5HSQ A;  4KUO A;  2HDU A;  3ZG8 B;  1OTA A;  2V1A A;  2WZX A;  5CHU A;  2V1B A;  3Q7Z A;  4O0P A;  3V3S A;  1YM1 A;  4R38 A;  5CGW A;  4BMW A;  3T1S A;  1NXY A;  4ZJ1 A;  1YMS A;  3BJN A;  2XSS A;  4Y0T A;  4LCL A;  1T1B A;  3EOI A;  1MPL A;  2RCX A;  2ZC7 A;  2PYR A;  1VET B;  5GLB A;  5HWT A;  3LFV A;  4C6Y A;  2PU2 A;  2Y2O A;  2JHE A;  1VM1 A;  3JYI A;  4N9L A;  4N1H A;  2WK0 A;  5DF8 A;  2HF6 A;  3TJZ C;  3MXS A;  3PAG A;  3HL9 A;  3MFX A;  1MC0 A;  3LI9 A;  5CTM A;  1SHV A;  1XJ6 A;  3GV9 A;  4XXR A;  4JGQ A;  3CAX A;  4WF0 A;  1K4F A;  3IS2 A;  3IF5 A;  3C2W A;  3Q7V A;  4WMC A;  3MKF A;  5DFY A;  3L7H A;  4I3A A;  5D3O A;  4IED A;  4X55 A;  4EQ1 A;  1ZTU A;  3QNB A;  2BG1 A;  2PBY A;  1MWR A;  4HH2 A;  4MMN A;  3BW6 A;  1PWC A;  4WBG A;  1JWZ A;  4FUW A;  1WYB A;  3ITA A;  4UHU A;  1GSV A;  2Z2M B;  2LB5 A;  5M1A A;  4FH4 A;  4R4S A;  1KOU A;  2X02 A;  1OTB A;  2RL3 A;  1BUL A;  2J3T D;  4X1M A;  5GHX A;  3ZGA B;  2VGK A;  4L9G A;  2O9C A;  2ZC4 B;  4YIN A;  3A0S A;  5J4E A;  3CI6 A;  1W63 Q;  1MWS A;  1U60 A;  2PT7 A;  4E3J A;  2JKT M;  2V0W A;  2Y2P A;  2W3F A;  3LYX A;  4CLC C;  5CX7 A;  1HTZ A;  2QHK A;  4JXS A;  4K08 A;  4ETZ A;  3VE4 A;  3G6O A;  3BYD A;  1NRJ A;  1JNU A;  1JTG A;  3PYP A;  3BLS A;  5EM0 A;  4UA7 A;  2O0Y A;  2QJ5 A;  1S1Y A;  4JF5 A;  2HP5 A;  3T4S A;  5HPI A;  3SH8 A;  1AWI A;  4OPZ A;  5GLC A;  1IOU A;  4MLL A;  3UPN A;  1JTD A;  2WKR A;  3VE3 A;  2L1M A;  1L3L A;  4MN6 A;  4BLM A;  3ZYT A;  1NYY A;  2FH5 A;  3LUQ A;  2XA7 M;  3NEC A;  1Y28 A;  4EEU A;  3LID A;  4DE3 A;  3DBA A;  1OME A;  2JBF A;  1VHM A;  5IT5 A;  5AQB A;  4EBP A;  3W4O A;  2BTF P;  1XGI A;  4GNU A;  4IUK A;  3F1N A;  1PFL A;  5EVI A;  1FCO A; 
#chains in the Genus database with same CATH homology
 5G4Z A;  4I3I A;  1TS8 A;  4IHQ A;  3JVU A;  2VEA A;  3T50 A;  4LRY C;  3OCL A;  5F6A A;  4F3L A;  4XT2 B;  5AVF A;  2VKS A;  4PAU A;  1LT0 A;  1V9Y A;  3PXP A;  3IBJ A;  4KUK A;  2CMN A;  3KYQ A;  3T4L A;  2PR6 A;  3UB7 A;  4G3K A;  2W1T A;  3EGX C;  5HWV A;  2KLI A;  1F98 A;  3LR0 A;  2ZOH A;  5G4Y A;  4I5S A;  2B18 A;  4HJ4 A;  3O5Y A;  1P9R A;  2BAS A;  4HNB A;  3MQ0 A;  5DF9 A;  4HH3 A;  3UME A;  4Y2F A;  1TS0 A;  3OCN A;  4WEJ A;  1D7E A;  2M7V A;  3C38 A;  2G7U A;  4LLO B;  2ZMV A;  5F69 A;  5J3W A;  2IA2 A;  1T18 A;  1YSP A;  1G6O A;  3F1O B;  5HDC A;  4II7 A;  2VV7 A;  3KSF A;  1LSW A;  4NXB A;  5KSH A;  4L0L A;  1YSQ A;  4B9O A;  4HJ3 A;  3D3O A;  4JGR A;  2D02 A;  2QYB A;  2V9A A;  4EES A;  2XA7 S;  5HL6 A;  2JKT I;  2R78 A;  3GDI A;  4MCW A;  4CLC A;  1H8M A;  4JGP A;  3PBQ A;  2HJE A;  4EXO A;  4EEP A;  5C5K A;  2LB9 A;  2W3H A;  2OOL A;  2P7J A;  1WA9 A;  2O9B A;  2D01 A;  3LIB A;  1XJ3 A;  3T4K A;  3LR4 A;  4HI4 A;  3A0V A;  4NKP A;  3PBT A;  5K5B A;  3CLO A;  1BYW A;  4PHT A;  3UE6 A;  4EUV A;  3TE8 A;  1IFQ A;  3R4K A;  3F1O A;  3B42 A;  2KDK A;  4BBU A;  3BY9 A;  3T4T A;  2Y8H A;  3ICY A;  4WEL A;  3UB6 A;  4GW9 A;  2XRN A;  4PKY G;  1G28 A;  4HP9 A;  3OC2 A;  2PYP A;  5IU1 A;  1ZHH B;  1MKM A;  4EET B;  3E4Q A;  1VB6 A;  3PHY A;  4EU0 A;  4EW7 A;  4MN5 A;  5A8B A;  3S7O A;  2KX6 A;  3KX0 X;  5AVE A;  1N9L A;  4OOL A;  3MQQ A;  1DP9 A;  1UWN X;  3EWK A;  2W0N A;  3S7N A;  2OWH A;  4DN0 A;  4E04 A;  2A24 B;  2J3W A;  3KO6 A;  5DJU A;  3F1P B;  3TW8 A;  3ZQ5 A;  5TBM A;  4LRZ E;  3OLO A;  4GCZ A;  5HDD A;  1XJ4 A;  4BWI A;  4PKY A;  4R70 A;  2HV1 A;  2M1C A;  2ZMF A;  4HOI A;  4LPZ A;  1P9W A;  2OWJ A;  3NOP C;  3R7W B;  4WL9 A;  2M7U A;  3H7W A;  5F68 A;  1EW0 A;  1P0Z A;  1DP8 A;  1S66 L;  3NHQ A;  1TF1 A;  2WKQ A;  3OOV A;  2EWV A;  4GHI B;  3KSG A;  1LSV A;  2OAP 1;  3K3C A;  5FL3 A;  4ETX A;  2QKP A;  2W1R A;  4WLA A;  3KSH A;  3C30 A;  1F9I A;  1OTE A;  1YAX A;  4NXG A;  3E4O A;  2A24 A;  4DJ3 A;  3BQ8 A;  4NXF A;  2Z6C A;  4WUJ A;  1GSW A;  4JGO A;  3EQU A;  4ME4 A;  4R3A A;  1NLZ A;  2K31 A;  4P6Z M;  3R7W A;  2W3D A;  3V67 A;  2Y79 A;  4KQD A;  2FZ0 A;  4XT2 A;  3GEC A;  5TJJ A;  5HDS A;  3MMH A;  3SW1 A;  1UGU A;  3P01 A;  1W63 M;  4O01 A;  3FC7 A;  4L9E A;  4Q0H A;  5LBR A;  3S7P A;  2YKH A;  2P04 A;  3CUE C;  4YOF A;  3EQV A;  2OAQ 1;  1T1A A;  2W3E A;  1DRM A;  2W3G A;  5EFW A;  3LIE A;  4WN5 A;  4FSF A;  1S67 L;  1STZ A;  2HGV A;  3BY8 A;  1F5M A;  4H6J B;  4HY8 A;  4FOF A;  3T4O A;  3UB8 A;  2PDR A;  2JN7 A;  1XFQ A;  3EEA A;  5HZH A;  3CWF A;  4GJ4 A;  3NOU C;  2I9V A;  4IJG A;  3A0R A;  4ARZ B;  5DFX A;  1OJ5 A;  2GNX A;  3LIA A;  3UMD A;  2VGL M;  4Z1W A;  2VLG A;  3IBR A;  4M4X A;  3UE3 A;  3LIC A;  4CQH A;  1NLY A;  1T1C A;  3PBN A;  2EA9 A;  4I38 A;  4I3J A;  4O8G A;  3VOL A;  4HJ6 A;  1OT9 A;  3RTY A;  4G3W A;  4BJP A;  4DMZ A;  1OJG A;  1ODV A;  1YKD A;  4Y3I A;  2QWS A;  1OTI A;  3K3D A;  3PBS A;  3HJI A;  3F1N B;  5HSQ A;  4H6J A;  4KUO A;  3U2A A;  4B93 A;  1OTA A;  2V1A A;  3MR0 A;  2INW A;  2PD8 A;  2V1B A;  2O9A A;  4O0P A;  5L8M A;  3LIF A;  1XFN A;  4R38 A;  4BMW A;  4ARZ A;  2K2N A;  2YKF A;  1S4R A;  5DKL A;  4UQI M;  2ZBB A;  3KYZ A;  4P6Z S;  3BJN A;  3MJQ A;  2XSS A;  1T1B A;  3EOI A;  2VZW A;  3BWL A;  2GX5 A;  2PYR A;  3IS2 B;  3ULF A;  2H28 A;  3LR5 A;  5HWT A;  5I5L A;  2WKP A;  3LFV A;  4RQ9 A;  4HHD A;  1TS7 A;  5HWW A;  1TD5 A;  2GJ3 A;  2JHE A;  3KSI A;  4YNR A;  1X0O A;  1S1Z A;  3PBO A;  2B02 A;  2KOI A;  2HF6 A;  1DP6 A;  3LI8 A;  3TJZ C;  3MF0 A;  3HCY A;  1S4S A;  2P08 A;  5KIZ A;  3T4J A;  1P97 A;  3CIT A;  3F1P A;  4L9F A;  2O99 A;  3MFX A;  1MC0 A;  3LI9 A;  4MDZ A;  2VGL S;  1XJ6 A;  2PR5 A;  4JGQ A;  2VX8 A;  2A2L A;  2VJW A;  3CAX A;  2Z6D A;  4WF0 A;  3E4P A;  2PD7 A;  3IS2 A;  4CLC B;  3FPV A;  3C2W A;  1XJ2 A;  1H3Q A;  5DFY A;  5IS1 A;  4I3A A;  2W27 A;  1MZU A;  3MQO A;  1ZTU A;  4EQ1 A;  3CUE A;  5J7E A;  3H9W A;  3PR6 A;  3S7Q A;  4HH2 A;  4MMN A;  1LL8 A;  3BW6 A;  4GHI A;  1N9O A;  2J80 A;  1GSX A;  5AJG A;  3UB9 A;  3T4Q A;  2L0W A;  4HQA A;  1GSV A;  3LR3 A;  3H82 B;  2PHY A;  4Y5F A;  3W2Z A;  4Q0I A;  2LB5 A;  4GS9 B;  3D72 A;  1KOU A;  4HIA A;  4OOM A;  1OTB A;  3B33 A;  3TRC A;  2J3T D;  4WEK A;  4UQI S;  3RFB A;  4CLC E;  4L9G A;  2O9C A;  2VA0 A;  4BBV A;  3A0S A;  5J4E A;  2J3T C;  3CI6 A;  1W63 Q;  1NWZ A;  2XRO A;  4I39 A;  2PT7 A;  2JKT M;  2V0W A;  4CLC D;  2GZA A;  3PBR A;  4GLQ A;  2W3F A;  3HJK A;  3LYX A;  3NJA A;  5CX7 A;  4BBT A;  4CLC C;  5HD3 A;  3VV4 A;  2QHK A;  2HJ9 C;  4K08 A;  4ETZ A;  3RH8 B;  3VE4 A;  4EER A;  2NUT C;  1TS6 A;  3G6O A;  2NUP C;  1NRJ A;  4LRX C;  1JNU A;  3PYP A;  5TBM B;  1N9N A;  2QJ7 A;  3MXQ A;  3EGD C;  4UEY A;  3E98 A;  3C8C A;  3H82 A;  2O0Y A;  2QJ5 A;  4IUH A;  1S1Y A;  4GS9 A;  5HD5 A;  4Q0J A;  4QPR A;  3T4S A;  1UWP X;  5HPI A;  3P7N A;  1T19 A;  3H7W B;  1IOU A;  1OPX A;  4F3L B;  4YWZ A;  2V0U A;  2VV8 A;  3JVV A;  4KQO A;  4NXE A;  5F5Y A;  3OBF A;  5DJT A;  1LSX A;  2WKR A;  3VE3 A;  2L1M A;  3FG8 A;  4MN6 A;  4AFI A;  5HPF A;  2JKR I;  2JKR M;  2L4R A;  3E0Y A;  3ZYT A;  5DKK A;  1OTD A;  2W1T B;  3K2N A;  4R6L A;  2FH5 A;  3LUQ A;  4G3V A;  5MC7 A;  1D06 A;  2EWW A;  2XA7 M;  1V9Z A;  4HP4 A;  1Y28 A;  4EEU A;  3LID A;  2K7S A;  3DBA A;  1VHM A;  5IT5 A;  2MJ6 A;  1OT6 A;  3FPW A;  4MN7 A;  4ZRR A;  3B47 A;  4DJ2 A;  2DMW A;  2VV6 A;  3BQA A;  4IUK A;  3F1N A;  3NOT C;  3EEH A;  4NEE D;  2ZOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...