2V9AA

Structure of citrate-free periplasmic domain of sensor histidine kinase cita
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
105
Chain Sequence
TEERLHYQVGQRALIQAMQISAMPELVEAVQKRDLARIKALIDPMRSFSDATYITVGDASGQRLNAKSYVSVRKGSLGSSLRGKSPIQDATGKVIGIVSVGYTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SENSOR KINASE CITA
publication title A Ligand-Induced Switch in the Periplasmic Domain of Sensor Histidine Kinase Cita.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 21
structure length 105
sequence length 127
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2v9aA00
2KDKA 2VV8A 4I38A 4WN5A 5J4EA 5HZHA 5J3WA 5HDCA 1XJ3A 2A24A 4HY8A 4I5SA 1TS8A 5HD5A 4WLAA 1MZUA 4F3LA 1N9LA 2W27A 3F1OA 4HHDA 3E4OA 1OTAA 1XFNA 1UWNX 4LPZA 1LSWA 1S67L 2A24B 5AVFA 5J7EA 2OOLA 4B9OA 2PYPA 3LI8A 4F3LB 3F1OB 3BWLA 4H6JA 3PYPA 4HJ6A 3UE6A 1V9YA 2D01A 3MQOA 2EA9A 3MQQA 4LRXC 3LIDA 2I9VA 4MN6A 2PD8A 4H6JB 3ZQ5A 1ODVA 1XJ4A 4I3JA 1D7EA 3LIEA 1N9OA 2M1CA 5HDDA 3UB8A 5HSQA 1Y28A 1LT0A 4PKYG 3ULFA 1V9ZA 4E04A 5HWWA 1N9NA 2ZOHA 2L4RA 2QHKA 4LLOB 2WKQA 5DJUA 4WUJA 5F69A 4GW9A 4XT2A 3LIBA 1TS6A 1T1AA 1S1ZA 1OT6A 1TS0A 5F6AA 4NXGA 3D72A 3A0VA 3NHQA 2QWSA 2ZOIA 5IU1A 2B02A 1OJGA 2K7SA 4HI4A 1D06A 3NOUC 2H28A 3FC7A 1WA9A 1GSWA 2L0WA 3NOPC 2L1MA 3VOLA 2PDRA 5HDSA 1T19A 5I5LA 4I39A 4GCZA 2PYRA 1LSXA 4R70A 1S66L 1VB6A 5DKKA 4EESA 2INWA 4EEPA 3CLOA 3K3DA 3CWFA 3LYXA 5IS1A 1LSVA 4BBTA 4K08A 4KQDA 3T50A 2Z6CA 1TS7A 3MR0A 3LIFA 1GSXA 5HWTA 4LRZE 1OT9A 3HJKA 2D02A 4HIAA 5TBMA 2W0NA 4HH2A 1XJ2A 1F9IA 4MN5A 4R38A 4R3AA 3OLOA 5G4ZA 4DJ2A 3HJIA 3LICA 1S4SA 4WL9A 2V0UA 3C8CA 1T18A 2V1BA 2QJ5A 4HJ3A 1UGUA 1S1YA 1OTIA 1DP8A 1EW0A 5TBMB 4M4XA 4I3IA 1S4RA 3KX0X 1DP6A 3BY8A 1KOUA 1T1BA 3RH8B 2QJ7A 4EQ1A 3E4PA 3F1NA 2PR5A 3EWKA 2OWHA 4EW7A 2QKPA 2V1AA 3NOTC 4JGQA 1BYWA 4HP4A 2ZBBA 1G28A 5A8BA 1T1CA 2OWJA 3MJQA 2R78A 3F1NB 4GHIA 2V0WA 2BASA 3LIAA 3ICYA 4EEUA 2CMNA 4YWZA 1X0OA 2PR6A 3P7NA 4GHIB 3IS2A 1DRMA 4NXBA 4I3AA 4EXOA 4R6LA 3LUQA 4BBVA 4EETB 5F5YA 2VV6A 3IS2B 1XFQA 3B33A 4KUKA 4JGRA 3H7WA 1OJ5A 1JNUA 4HH3A 2V9AA 3A0RA 3C2WA 2KX6A 1UWPX 3E4QA 1NWZA 3F1PA 4NXFA 4HP9A 1OTEA 5F68A 3H7WB 3UB7A 2VEAA 3FG8A 5DKLA 3K3CA 3GDIA 4HQAA 4L9EA 5EFWA 4GS9A 4PKYA 4DJ3A 4JGPA 3F1PB 1DP9A 4HJ4A 1P97A 3MXQA 5DJTA 3PHYA 3UB9A 2VLGA 4RQ9A 2PD7A 3MFXA 3LI9A 4GS9B 5G4YA 2YKHA 3SW1A 4HOIA 3IBRA 3BY9A 2WKRA 1P0ZA 4WF0A 3UMEA 4NXEA 5HD3A 3NJAA 2YKFA 1LL8A 3G6OA 2J80A 3VE3A 4EERA 4JGOA 3CAXA 4KUOA 1F98A 3EEHA 1GSVA 3GECA 5HWVA 1OTDA 2GJ3A 3H82A 3A0SA 2PHYA 2WKPA 4L9FA 3H9WA 2JN7A 5KIZA 3UMDA 3UB6A 4HNBA 5AVEA 2HV1A 4LRYC 4BBUA 4L9GA 3VE4A 1XJ6A 2Z6DA 2JHEA 1OTBA 2P7JA 2VV7A 3RTYA 3H82B 4XT2B
chains in the Genus database with same CATH superfamily
2B5RA 5TR7A 1ESIA 3WS4A 4WZ4A 4WN5A 4DXBA 5J4EA 1IOUA 3EQUA 2Y4AA 5HDCA 1XA1A 2QMIA 3V39A 2ZM0A 3C4OA 2W27A 3F1OA 1F2KA 2J7VA 3IXDA 3BEBA 3VP4A 1ZTUA 5HFOA 1DJCA 4HHDA 3HLWA 1UWNX 4LPZA 1ES3A 3T4JA 1KE4A 2Y2OA 1S67L 4GN2A 5AVFA 1L0GA 1TDLA 2PYPA 4IVIA 1WYCA 2NUPC 3PYPA 4MNRA 1K55C 4GOGA 3S4XA 3D4FA 3BFDA 3G30A 1P9WA 1N9BA 4LRXC 2I9VA 5DTSA 2VGKA 1LLBA 4BWIA 2Y2IA 1E3UA 4UEYA 4PM5A 1ODVA 4I3JA 3E0YA 1L0DA 1D7EA 1NZUA 5GHYA 3UB8A 5HSQA 3NBLA 5LBRA 3KO6A 4M3KA 5DTTA 1GHIA 3NI9A 1PRQA 4E04A 2ZQ9A 1ESUA 2ZOHA 2L4RA 3Q7VA 3LO7A 4DE3A 1JWPA 4U0TA 4KZ8A 5FI7A 4HEFA 3W8KA 5F69A 2DCFA 4WYYA 1TS6A 3C7VA 1T1AA 5IT5A 3IH9A 1JWZA 2WAFA 1XXMA 1PIOA 3D72A 1K55A 2ZMVA 1J9MA 2HP9A 2QWSA 3UY6A 4KZ9A 2PT7A 1VEUB 3PBSA 4B93A 3DW0A 5GLAA 3FWLA 4PM8A 1WA9A 4E3MA 2L1MA 2PDRA 4OP5A 5HDSA 1VHMA 3NC8A 3MXSA 5K5BA 3MKEA 5DKKA 1ALQA 5DFXA 1NRJA 3IF5A 3LYXA 2J8YA 1H3QA 1BZAA 2A49A 4QU3A 5HARA 1LSVA 2IWCA 3HLFA 3VSLA 2WKIA 3A3IA 4KQDA 1TS7A 4DE2A 3MR0A 3ZYTA 3Q82A 3WS0A 1Y4OA 5EE8A 4RYEA 5E43A 3HJKA 5E2HA 4HIAA 3N7WA 4HH2A 2W3EA 1YLTA 4E6WA 5EOEA 3C8CA 4JF6A 1T18A 3IWOA 5FEFA 4EBLA 2V1BA 3A3FA 1OTIA 1EW0A 4CLCB 3OC2A 1CEFA 1Y54A 3DTIA 3EEAA 4UHUA 1DP6A 3D9YA 1M40A 2XD1A 5IHVA 1T1BA 4OQIA 5CX7A 1VM1A 3UPNA 2OWHA 1IKGA 2PRFA 5DF9A 2V1AA 4KZAA 4GZBA 1SKOB 1BYWA 3W2ZA 1ES5A 3IF6C 5EVID 3C4PA 1PI4A 4ZRRA 2EX9A 4L0LA 5CGWA 4DE0A 3F1NB 1JWVA 1HZOA 2RCXA 4GHIA 2BASA 3BECA 1KVLA 5TGFA 2XGNA 1HVBA 3N8SA 1S6RA 1A0KA 4S2NC 3LEZA 4LV0A 5FQ9A 3EOIA 5AJGA 3PBTA 4O7DA 4UQIS 2V8FA 3UPPA 4KQRA 2P74A 2V1ZA 3IS2A 5CGXA 1YKDA 2WYXA 1NY0A 1H8YA 4S2MA 5EVIC 3T12B 4ARZB 4MBKA 3LGOA 4YINA 4UA7A 4KG5A 2HJ9C 5FQQA 4X68A 4ZBEA 3KSGA 4X1MA 2IWDA 2X02A 2O9BA 4WBGA 3A0RA 4QY5A 1OMEA 1KGEA 5HAQA 3E4QA 5HL6A 1NWZA 1YQSA 3F1PA 4MBHA 3PAEA 5F68A 3HLGA 4XUZA 2VEAA 4CJNA 1M6KA 5DKLA 4WMCA 1SHVA 2QPNA 2W1TA 1BLPA 3KSHA 4XXRA 1LL5A 5EOOA 3LFVA 3T4LA 4DJ3A 4S2NA 4Q0IA 4OOYA 1VETB 4HJ4A 1H8MA 2K2NA 2CC1A 5EECA 3OZHA 1YLJA 3MFXA 1MKIA 2ZD8A 1ONGA 2HP5A 2GNXA 1D1JA 3C7UA 4FH2A 4DF6A 2OV5A 4PHTA 1TDGA 3HUMA 3VV4A 1PW8A 3GVBA 3N8RA 1LL8A 3ISGA 1PYYA 3NIAA 4WZ5C 3M6BA 1OPXA 2Y2KA 5F1FA 5EV0A 1FR6A 1OTDA 5EVLA 4JPMA 1F5MA 2H10A 2XF3A 4LV2A 2PHYA 2W3GA 2JN7A 2ZJ9A 5EPHA 2HV1A 2Q0OA 1QMEA 3ZVTA 4BBUA 2UWXA 4OKPA 4L9GA 1W63M 2R9WA 4E6XA 2FFFB 3BM6A 2VKSA 3OPRA 3C30A 2P7JA 4PPRA 1MC0A 3MMHA 4GKUA 4G3KA 2J3TC 4FOFA 4G3WA 3SS3A 2VJWA 3G32A 4KZ5A 5DVAA 1FOFA 1FCNA 5F83A 2JKTM 4EQIA 3OPPA 3KSFA 2A24A 4HY8A 4U0XA 3MKFA 3N6IA 4II7A 3TG9A 3G2ZA 4WLAA 2EFUA 4B4ZA 1BULA 3G2YA 4F3LA 4RX2A 2P04A 3VSKA 2HDRA 2ZQ8A 4CLCE 1FCOA 3E4OA 1OTAA 4YFMA 4Z1WA 4WZ5A 4DMZA 4OPQA 3DBAA 3VFFA 4ESPA 3LR4A 5HAIA 2OOLA 3JVVA 3CI6A 4N1XA 4B88A 3CPTB 4JXSA 1HTZA 4HJ6A 1KE3A 2ZC5B 4QJGA 5CERA 1BLHA 1GCEA 3E98A 3LIDA 3WS1A 1Z6FA 3OOVA 2PD8A 3C38A 5FEGA 4H6JB 3TW8A 5C5KA 1PNEA 5CHMA 2JKGA 1N9OA 5FAPA 5HDDA 4E3LA 3NY4A 5L09A 4PKYG 5CHJA 2VGLS 2V2FF 4LV3A 3VP3A 3IBJA 1K6SA 2GZAA 1E3UD 4P0MA 4Y5FA 1V9ZA 3RJUA 5HWWA 1G5UA 1IKIA 1N9NA 1IEMA 4BJPA 4Y3IA 4E3NA 3N4IA 1LHYA 3O5YA 3MZEA 3T4SA 2K31A 5DJUA 1K25A 1YMXA 2W3FA 1K4EA 4WUJA 5CXWA 4XT2A 4EUZA 2OAQ1 1S1ZA 1TS0A 2HDUA 3M2KA 1ZG6A 4NXGA 4MEZA 1RGZA 3NHQA 2HZ5A 1FR1A 3Q07A 3R4KA 5IU1A 2B02A 1OJGA 2K7SA 3NOUC 3ZFZA 4N1HA 1K56D 3FZCA 2H28A 2ZC4B 3LR3A 5DF8A 3FC7A 5DFYA 2HDQA 4OQGA 4MDZA 4ID4A 4LFUA 3NCKA 1YLWA 5L8MA 1PZOA 5GHZA 4LCLA 1W8YA 1ES4A 3PXPA 3GSGA 4I39A 2PYRA 1LSXA 1VB6A 5KMWA 2GX5A 2WGWB 5A91A 2INWA 1TEMA 4PM6A 3NDEA 4HESA 4S2PA 4K08A 4KZ7A 3T50A 2Z6CA 4IHQA 3FKVA 2XK1A 4Y2FA 3ZCZA 3QP8A 5CTMA 3QNCA 4GD8A 3P98A 2OSUA 5TBMA 1SDEA 4ETZA 3NECA 1XA7A 1F9IA 4Y15A 1L0EA 3FKWA 4Y7PA 4DJ2A 4P6ZM 4WL9A 2V0UA 2Y91A 3IF6B 2EXAA 3R7WA 5FQKA 2R9XA 2B95A 3RXXA 4KG2A 2BLSA 2Y59A 3GTCA 5FSRA 1DP8A 1W79A 4OPRA 3P01A 1JVJA 3Q1FA 4Y17A 3O88A 3PBRA 1S0WA 1S4RA 3BY8A 1YM1A 3ZNTA 3RH8B 1BLSA 2QJ7A 4EUVA 4EQ1A 3IHAA 1IELA 2PR5A 3E2KA 3EWKA 3L7HA 3KSIA 1GHPA 5EM0A 5E2GA 4JGQA 5L07A 4DDSA 4HP4A 5FI2A 1ZG4A 5EVIB 1T1CA 2GDNA 3B3XA 2Q9NA 2VGJA 1QMFA 2H0TA 2JC7A 2V0WA 1K56A 3Q7ZA 3MS6A 3W4PA 1ERQA 1FILA 4GLQA 3QP4A 4D60A 3LIAA 3ICYA 1N4OA 2JKFA 4IEDA 2CMNA 2QYBA 4EBPA 3HLDA 3BRMA 4F94A 2PR6A 3P7NA 2PBDP 2VX8A 2E8JA 2MJ6A 4NXBA 3GQZA 2O9CA 1XPBA 1MWUA 4LV1A 5F5YA 4EWFA 3ZNYA 5FA7A 2NUTC 2W1RA 1SKFA 5KZHA 1ERMA 1AXBA 2P9VB 3B33A 4OH0A 3UPOA 3H7WA 4LCMA 4K0XA 1OJ5A 4E3JA 3M6HA 1FCMA 1PFLA 1YLPA 2Y2JA 2V9AA 2KX6A 3BQAA 3IXHA 3FV7A 3GRJA 3T4QA 5F1GA 3DTEA 4OPZA 1GA0A 3FG8A 3VP0A 3DWKA 5GLDA 2ZL1B 1IYSA 4L9EA 3BLMA 4DRTA 5EFWA 4EBNA 2O9AA 1KGFA 3MXQA 5DJTA 3VFHA 4WMCD 3IX4A 1MPLA 3LI9A 3V50A 5HAPA 2VZWA 4GS9B 3NULA 4ZDXA 4OVDA 5G4YA 1H5XA 4R1GA 2YKHA 3RXWA 1LL9A 1BSGA 2J9OA 1K4FA 3PAGA 1P0ZA 4MBFA 3GV9A 5CRFA 3BLSA 1I5QA 4NXEA 5HD3A 3EGXC 2WZZA 2O0YA 3G6OA 3BW6A 2XROA 1EWZA 5L10A 4JGOA 3VE3A 3IWIA 1F98A 3EEHA 3WRZA 3MFDA 3S7QA 5A93A 3D3OA 3TOIA 1ZHHB 5E2EA 3DTMA 3QP5A 3H82A 4Y0TA 1IYQA 2I72A 3A0SA 4R3JA 4RA7A 5EM1A 5KIZA 2PAVP 5AVEA 2XD5A 1W63Q 4OLGA 4QY6A 2JHEA 1KE0A 4XT2B 1LI0A 2UV0E 2VV8A 1JTGA 4H8RA 3ZHHA 1DJAA 4IJGA 2ZMFA 5AQ7A 4A5RA 1TVFA 3HCYA 4NEED 5HZHA 5J8XA 5J3WA 3ITAA 4P85A 1XJ3A 2FFYA 4QPRA 1TS8A 5HD5A 3S7PA 3GR2A 1N9LA 2V8CA 1YMSA 4JLFA 4RX3A 2XDMA 1DY6A 4BL2A 1XFNA 5GHXA 1LSWA 2KOIA 1L3LA 3ZG8B 4B9OA 5DF7A 4N9KA 3LI8A 4KZBA 2Q9MA 3F1OB 3BWLA 3HREA 1EI5A 4S2IA 4U3TA 1AWIA 2XFSA 4P6BA 3P09A 2XA7M 3L9KA 3MSHA 1YAXA 1V9YA 2D01A 5I94A 2G2WA 3G4PA 5FQIA 3MQOA 2EA9A 4LGWA 4ETXA 4BD0A 3MQQA 2IA2A 3VOZA 4MN6A 3K2NA 1BTLA 4ME4A 2WGVA 1XJ4A 1FQGA 2Y2NA 2M1CA 1CQAA 4IUHA 1Y28A 3VP1A 4OQHA 3PBOA 1H8ZA 3HLCA 4Y13A 3JYIA 2J3TD 3IT9A 4QD4A 4FCFA 5FL3A 4GD6A 4C6YA 3T4KA 4R3BA 2WKQA 5U47A 4KQOA 4X1LA 4KZ6A 1VEUA 2X01A 5A90A 2J3WA 4BD1A 1PI5A 3HUNA 3Q81A 4DKIA 5BOHA 1OT6A 3Q7VB 5F6AA 4MCWA 1W8QA 1SZVA 1H0MA 1YLZA 2ZOIA 3JVUA 2AVXA 1D06A 1YPRA 2G2UA 3S1YA 3UE1A 3TSGA 3HLEA 1NZOA 2DMWA 2L0WA 4GNUA 2WZXA 3VOLA 1PWGA 3UDXA 1T19A 3G34A 2Y79A 3WWXA 5I5LA 3JPUA 2P08A 4GCZA 2B18A 4GJ4A 3IXBA 4R70A 1BUEA 5FATA 3BFGA 5M19A 2XH9A 4S2JA 1K57C 4NETA 4EEPA 4NK3A 3CLOA 3ZG7B 3CWFA 3HBRA 5EVEA 5TFQA 4BBTA 4JXGA 4X53A 3ZG0A 3LIFA 1GSXA 5AQAA 5HWTA 4LRZE 1OT9A 1IYOA 3EGDC 2D02A 4N92A 4UA6A 3OPLA 2ZMAA 1XJ2A 3FPVA 4WEKA 3OLOA 5G4ZA 2Z2MB 3HJIA 3LICA 1YSQA 4R4SA 2V20A 4HJ3A 2EWVA 1UGUA 1S1YA 3W4OA 4JF4A 1ES2A 1SKOA 5L2FA 2ZQCA 4M4XA 3G35A 3UE0A 1ONHA 1K54C 3VP2A 3O87A 1KOUA 4OP8A 5FAQA 5G18A 3F1NA 4JXVA 4O0PA 3QP2A 3OCLA 1CF0A 4OONA 1MBLA 3ITBA 3NOTC 1W5DA 1KDWA 1K57A 3V3SA 2PU2A 4UAAA 2JKTI 3A3DA 2XRNA 1WYBA 1XKZA 2EWWA 4OOLA 2H5SA 2HGVA 3U4LP 5CGSA 3V3RA 2HF6A 4YWZA 4ARZA 3WS5A 3SS5A 2HP6A 3UB5P 3FYZA 3SS4A 1NYYA 3N8LA 3UN7A 1X0OA 1ZC2A 5M1AA 4PAUA 3SH9A 4GHIB 4I3AA 4GDNA 1KVMA 1FSYA 5HL1A 2VV6A 5GL9A 4C75A 3AGDA 1K54A 4Q0HA 1L2SA 3IS2B 4NG2A 5HPFA 5FQMA 1XFQA 1BT5A 1HLUP 4KUKA 2DRWA 4JGRA 1TD5A 4O01A 3UDIA 5M18A 4IBRA 4JF5A 3CUEC 4HH3A 1I2WA 4S2OA 4QHCA 4D2OA 1UWPX 3RFBA 4C3QA 1GHMA 4GDBA 4IUKA 1VETA 4NXFA 4HP9A 3WS2A 4BQMA 2Y2MA 2J9PA 3UB7A 3B42A 3TRCA 4HQAA 4HBTA 5KSHA 3SH8A 4PKYA 1STZA 4UA9A 4JGPA 3F1PB 2Y55A 3IX8A 4Q0JA 1KGGA 2IWBA 3PHYA 1IFQA 4RQ9A 2PD7A 1TF1A 2W1TB 1BLCA 5MC7A 2OLVA 4ZJ1A 4MLLA 3KYZA 4X25A 4DE1A 4HOIA 3IBRA 3S22A 3T4TA 3HLBA 2Y2GA 1PWDA 1C3BA 4WF0A 3UMEA 3NJAA 2YKFA 4ZAMA 5GLBA 3BFEA 3PR6A 2J80A 1XP4A 2ZQDA 3CUEA 3CAXA 4KUOA 5FQJA 3IQAA 4FTXA 1SCWA 4UQIM 1L0FA 1RGYA 4R0QA 2GJ3A 4X69A 4KQQA 3IWQA 1WE4A 2Z2LB 1GA9A 3MQ0A 2JE5A 2WKPA 3AGEA 3MZFA 4PMAA 3H9WA 3VMAA 4S2KA 4LRYC 2ZLYA 4EU0A 1VQQA 5HX9A 3LEQA 1XJ6A 1MWRA 5EUAA 1OTBA 2Y8HA 4EV4A 5HW3A 4E3IA 3MF0A 3HL9A 3DAVA 2KDKA 4O8GA 1G6AA 4FUWA 4PM9A 4XUXA 4I38A 2VK3A 2W3HA 2JBFA 5FDSA 3TJZC 4JKTA 1CEGA 2HJEA 3M2JA 1K6RA 4I5SA 4Y0UA 2JKRM 3B47A 1MZUA 4JBFA 1MXOA 3CPTA 1NRFA 4IBXA 2Y2HA 3S7OA 1P9RA 2Y2LA 1NXYA 4WELA 2A24B 4FH4A 4N9LA 3UE3A 5J7EA 1Z09A 3FPWA 4F3LB 3T1SA 4H6JA 4OQ0A 2ZQAA 4PM7A 3UE6A 5A92A 1KDSA 2XSSA 3O3VA 4GB7A 2XEPA 3QHYA 4G3VA 3MZDA 5FAOA 3LY3A 3MBZA 3CMZA 5AQ9A 2WUQA 1J3WA 3ZQ5A 4E3OA 4P6ZS 3A3JA 4QWOA 3PTEA 3LIEA 1MY8A 3CITA 1LT0A 1HD8A 3O86A 1YLYA 3T4OA 4Z9QA 1YSPA 3HUOA 3ULFA 2H0YA 1XGIA 2M7UA 4BLMA 4HBUA 2QHKA 1JTDA 3KYQA 1SDNA 4LLOB 4BMWA 5TJJA 3NDGA 4YOFA 4GW9A 1O07A 3LIBA 2WKHA 3CZDA 4MN7A 5AQBA 2BG1A 3BFCA 1YT4A 5JYPA 3C5AA 2WGIA 3BFFA 4RVAA 2Y2PA 4X56A 2JKRI 2ZC6B 3A0VA 1PWCA 2Y2QA 4HI4A 2ZC3B 3IX3A 2JCHA 2WADA 3LY4A 2XR0A 3QNBA 2WGWA 3WRTA 2E8IA 2LB9A 2XFTA 1GSWA 1RCJA 1K38A 1Q2PA 3NOPC 2EX6A 2EX2A 4IVKA 5F82A 4BENA 3IH8A 1NJ4A 4CQHA 1S66L 4EESA 2QZ6A 2A2LA 4KZ3A 4FSFA 3BQ8A 2PBYA 3K3DA 3GMWA 5IS1A 1CK3A 1ACFA 3IF6A 2O99A 2C6WB 2W3DA 4DXCA 1NLZA 2W0NA 3ZVWA 5KSCA 4MN5A 4R38A 1XGJA 4R3AA 5GLCA 1S4SA 4AFIA 3KYEA 4P87A 4CLCD 1PZPA 2QJ5A 3T1RA 4ZTKA 2VGLM 5TBMB 5HPIA 2PU4A 2ZM8A 2RL3A 3W4QA 2ZC7A 3I7JA 4I3IA 3KX0X 5EVIA 3T1XA 1CI8A 3U2AA 3R7WB 1NYMA 5E2FA 3E4PA 4S2LA 3LR0A 1Q2QA 4EW7A 2QKPA 1PW1A 2ACGA 2M7VA 5FI6A 3AGFA 1O7EA 2ZBBA 1G28A 1FSWA 5A8BA 1ZKJA 2X71A 2OWJA 4CLCC 3MJQA 2R78A 3OBFA 4OLDA 4OPYA 3IHBA 4EEUA 2EXBA 3LCEA 4R4RA 2XLNA 1CI9A 1MKMA 3EQVA 3UDFA 2A3UA 2EX8A 1W7FA 5JYOA 1DRMA 2OLUA 2P9VA 2BTFP 3DTKA 4EXOA 1U60A 4K0WA 4R6LA 3LUQA 4BBVA 4EETB 2DNSA 3ZGAB 3CHWP 4NKPA 2XQZA 2KLIA 3QP1A 4MMNA 2FZ0A 1I2SA 5DTKA 4KZ4A 2WKEA 4X55A 3DWZA 2ZM2A 2FH5A 4R23A 5CTNA 4Y0OA 1JNUA 5CEDA 2ZL1A 2G7UA 3C2WA 3G31A 1K0KA 2OAP1 4WM9A 2ZQ7A 3UO9A 3MXRA 2C5WB 1G6OA 3CG5A 1MWTA 3A3EA 3UNWA 4K91A 1OTEA 4CLCA 5FASA 2LB5A 3H7WB 3ZG5A 3K3CA 1DJBA 3GDIA 3T1QB 4ZJ3A 4DDYA 4GS9A 4DN0A 3OCNA 1DP9A 3BYDA 1P97A 2EFXA 3V67A 4CPKA 5D3OA 3OPHA 4QB8A 3UB9A 2VLGA 1CJFA 2XA7S 4JXWA 1E25A 3SZTA 4E3KA 4Q8IA 3SW1A 4FD8A 3BY9A 2WKRA 4KG6A 2WK0A 5CECA 4OOMA 3E2LA 3SH7A 1EROA 1FIKA 3IXGA 2WAEA 3HVFA 1E4DA 4EERA 1LI9A 1MWSA 2VA0A 1GSVA 5CEBA 3GECA 5HWVA 3BJNA 3QP6A 3PBNA 3V5MA 4WEJA 4KENB 1RP5A 4LENA 5CHUA 3LR5A 4L9FA 2HPBA 4B4XA 3VOYA 4YNRA 3UMDA 3UB6A 4HNBA 2HDSA 4ZJ2A 3PBQA 3TE8A 1IYPA 3ZDJA 4BL3A 3CJMA 4X6TA 3VE4A 2Z6DA 3ZG9B 1NLYA 5FDHA 1G68A 1XX2A 3RTYA 2VV7A 3H82B 3S7NA 3SOIA
chains in the Genus database with same CATH topology
3MF0A 4G3KA 2KDKA 4O8GA 2VV8A 2J3TC 4FOFA 4G3WA 2VJWA 4I38A 4IJGA 4WN5A 2ZMFA 5J4EA 1IOUA 2W3HA 3HCYA 4NEED 5HZHA 3EQUA 5J3WA 2JKTM 5HDCA 3TJZC 2HJEA 1XJ3A 3KSFA 2A24A 4HY8A 4QPRA 4I5SA 4II7A 2JKRM 1TS8A 5HD5A 3S7PA 4WLAA 3B47A 1MZUA 4F3LA 1N9LA 2W27A 2P04A 3F1OA 1ZTUA 3S7OA 4HHDA 4CLCE 3E4OA 4Z1WA 1OTAA 1XFNA 1P9RA 1UWNX 4LPZA 1LSWA 4DMZA 2KOIA 3T4JA 3DBAA 4WELA 1S67L 2A24B 5AVFA 3UE3A 3LR4A 5J7EA 2OOLA 4B9OA 2PYPA 3FPWA 3JVVA 3LI8A 4F3LB 3F1OB 3CI6A 3BWLA 4H6JA 2NUPC 3PYPA 4HJ6A 3UE6A 2XA7M 1YAXA 1V9YA 2D01A 2XSSA 1P9WA 3MQOA 2EA9A 4ETXA 3MQQA 2IA2A 4LRXC 3E98A 3LIDA 4G3VA 2I9VA 4MN6A 3K2NA 3OOVA 2PD8A 3C38A 4H6JB 3TW8A 4BWIA 4ME4A 5C5KA 4UEYA 3ZQ5A 4P6ZS 1ODVA 1XJ4A 3E0YA 4I3JA 1D7EA 3LIEA 1N9OA 2M1CA 5HDDA 3CITA 3UB8A 5HSQA 4IUHA 1Y28A 1LT0A 4PKYG 2VGLS 5LBRA 3T4OA 3KO6A 3IBJA 2GZAA 3PBOA 1YSPA 3ULFA 4Y5FA 2M7UA 1V9ZA 4E04A 2J3TD 5HWWA 1N9NA 2ZOHA 2L4RA 2QHKA 5FL3A 4BJPA 3KYQA 4Y3IA 3T4KA 4LLOB 4BMWA 3O5YA 2WKQA 5TJJA 3T4SA 4KQOA 2K31A 4YOFA 5DJUA 2W3FA 4WUJA 5F69A 2J3WA 4GW9A 4XT2A 3LIBA 4MN7A 1TS6A 2OAQ1 1T1AA 5IT5A 1S1ZA 1OT6A 1TS0A 5F6AA 4MCWA 2JKRI 4NXGA 3D72A 3A0VA 2ZMVA 3NHQA 2QWSA 2ZOIA 3JVUA 3R4KA 5IU1A 2B02A 2PT7A 1OJGA 2K7SA 3PBSA 4HI4A 4B93A 1D06A 3NOUC 2H28A 3LR3A 3FC7A 5DFYA 4MDZA 1WA9A 2LB9A 1GSWA 2L0WA 2DMWA 3NOPC 5L8MA 2L1MA 3VOLA 2PDRA 5HDSA 1VHMA 1T19A 2Y79A 3PXPA 5I5LA 5K5BA 4I39A 2P08A 4GCZA 2B18A 4GJ4A 2PYRA 4CQHA 1LSXA 4R70A 1S66L 1VB6A 5DKKA 4EESA 2GX5A 2INWA 5DFXA 1NRJA 2A2LA 4EEPA 4FSFA 3BQ8A 3CLOA 3K3DA 3CWFA 3LYXA 1H3QA 5IS1A 1LSVA 4BBTA 4K08A 4KQDA 3T50A 2Z6CA 4IHQA 1TS7A 3MR0A 3ZYTA 4Y2FA 3LIFA 1GSXA 2O99A 5HWTA 4LRZE 1OT9A 3HJKA 2W3DA 3EGDC 2D02A 1NLZA 4HIAA 5TBMA 2W0NA 4HH2A 4ETZA 1XJ2A 1F9IA 2W3EA 3FPVA 4MN5A 4R38A 4WEKA 4R3AA 3OLOA 5G4ZA 4DJ2A 3HJIA 3LICA 1YSQA 4P6ZM 1S4SA 4WL9A 2V0UA 3C8CA 1T18A 3R7WA 4AFIA 2V1BA 4CLCD 2QJ5A 4HJ3A 2EWVA 1UGUA 1S1YA 1OTIA 2VGLM 1DP8A 1EW0A 5TBMB 4CLCB 3OC2A 3P01A 5HPIA 3EEAA 4M4XA 3PBRA 4I3IA 1S4RA 3KX0X 1DP6A 3BY8A 1KOUA 1T1BA 3RH8B 3U2AA 3R7WB 5CX7A 2QJ7A 4EUVA 4EQ1A 3E4PA 3F1NA 2PR5A 4O0PA 3EWKA 3LR0A 2OWHA 3KSIA 3OCLA 2QKPA 4EW7A 5DF9A 2V1AA 3NOTC 2M7VA 4JGQA 1BYWA 3W2ZA 4HP4A 2ZBBA 4ZRRA 1G28A 5A8BA 4L0LA 1T1CA 2OWJA 4CLCC 3MJQA 2R78A 3F1NB 3OBFA 2JKTI 4GHIA 2V0WA 2BASA 2XRNA 4GLQA 2EWWA 4OOLA 3LIAA 3ICYA 2HGVA 4EEUA 2CMNA 2HF6A 2QYBA 4YWZA 4ARZA 3EOIA 5AJGA 1MKMA 3PBTA 4UQIS 3EQVA 1X0OA 4PAUA 2PR6A 3P7NA 4GHIB 3IS2A 1DRMA 1YKDA 2VX8A 2MJ6A 4NXBA 4I3AA 2O9CA 4EXOA 4R6LA 3LUQA 4BBVA 4EETB 5F5YA 4ARZB 2VV6A 2NUTC 4NKPA 2W1RA 2KLIA 4MMNA 2HJ9C 2FZ0A 4Q0HA 3IS2B 5HPFA 1XFQA 3B33A 4KUKA 3KSGA 4JGRA 1TD5A 2FH5A 3H7WA 1OJ5A 4O01A 1JNUA 2O9BA 2G7UA 3CUEC 4HH3A 2V9AA 3A0RA 3C2WA 2KX6A 3BQAA 1UWPX 2OAP1 3RFBA 3E4QA 5HL6A 1NWZA 4IUKA 1G6OA 3F1PA 3T4QA 4NXFA 4HP9A 1OTEA 4CLCA 5F68A 2LB5A 3H7WB 3UB7A 2VEAA 3FG8A 5DKLA 3B42A 3K3CA 3GDIA 3TRCA 4HQAA 2W1TA 4L9EA 5KSHA 3KSHA 3LFVA 5EFWA 4GS9A 4PKYA 3T4LA 4DN0A 3OCNA 4DJ3A 1STZA 4Q0IA 4JGPA 3F1PB 1DP9A 2O9AA 4HJ4A 1P97A 1H8MA 3MXQA 3V67A 4Q0JA 5DJTA 2K2NA 3PHYA 1IFQA 3UB9A 2VLGA 4RQ9A 2PD7A 1TF1A 2W1TB 2XA7S 3MFXA 3LI9A 5MC7A 2VZWA 4GS9B 5G4YA 2GNXA 2YKHA 3KYZA 3SW1A 4HOIA 3IBRA 4PHTA 3BY9A 2WKRA 3T4TA 1P0ZA 4OOMA 3VV4A 4WF0A 3UMEA 4NXEA 5HD3A 3EGXC 3NJAA 2YKFA 1LL8A 2O0YA 3G6OA 3PR6A 3BW6A 2J80A 2XROA 1OPXA 3CUEA 4JGOA 3CAXA 3VE3A 4EERA 4KUOA 1F98A 4UQIM 2VA0A 3EEHA 1GSVA 3S7QA 3GECA 5HWVA 1OTDA 3D3OA 1ZHHB 3BJNA 3PBNA 4WEJA 2GJ3A 3H82A 1F5MA 3A0SA 2PHYA 3MQ0A 2W3GA 2WKPA 3LR5A 4L9FA 3H9WA 2JN7A 4YNRA 3UMDA 3UB6A 4HNBA 5KIZA 5AVEA 2HV1A 4LRYC 3PBQA 4EU0A 1W63Q 3TE8A 4BBUA 4L9GA 1W63M 3VE4A 1XJ6A 2Z6DA 1NLYA 2JHEA 2VKSA 1OTBA 2P7JA 2VV7A 3C30A 2Y8HA 3H82B 3RTYA 3S7NA 1MC0A 4XT2B 3MMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDK A;  2VV8 A;  4I38 A;  4WN5 A;  5J4E A;  5HZH A;  5J3W A;  5HDC A;  1XJ3 A;  2A24 A;  4HY8 A;  4I5S A;  1TS8 A;  5HD5 A;  4WLA A;  1MZU A;  4F3L A;  1N9L A;  2W27 A;  3F1O A;  4HHD A;  3E4O A;  1OTA A;  1XFN A;  1UWN X;  4LPZ A;  1LSW A;  1S67 L;  2A24 B;  5AVF A;  5J7E A;  2OOL A;  4B9O A;  2PYP A;  3LI8 A;  4F3L B;  3F1O B;  3BWL A;  4H6J A;  3PYP A;  4HJ6 A;  3UE6 A;  1V9Y A;  2D01 A;  3MQO A;  2EA9 A;  3MQQ A;  4LRX C;  3LID A;  2I9V A;  4MN6 A;  2PD8 A;  4H6J B;  3ZQ5 A;  1ODV A;  1XJ4 A;  4I3J A;  1D7E A;  3LIE A;  1N9O A;  2M1C A;  5HDD A;  3UB8 A;  5HSQ A;  1Y28 A;  1LT0 A;  4PKY G;  3ULF A;  1V9Z A;  4E04 A;  5HWW A;  1N9N A;  2ZOH A;  2L4R A;  2QHK A;  4LLO B;  2WKQ A;  5DJU A;  4WUJ A;  5F69 A;  4GW9 A;  4XT2 A;  3LIB A;  1TS6 A;  1T1A A;  1S1Z A;  1OT6 A;  1TS0 A;  5F6A A;  4NXG A;  3D72 A;  3A0V A;  3NHQ A;  2QWS A;  2ZOI A;  5IU1 A;  2B02 A;  1OJG A;  2K7S A;  4HI4 A;  1D06 A;  3NOU C;  2H28 A;  3FC7 A;  1WA9 A;  1GSW A;  2L0W A;  3NOP C;  2L1M A;  3VOL A;  2PDR A;  5HDS A;  1T19 A;  5I5L A;  4I39 A;  4GCZ A;  2PYR A;  1LSX A;  4R70 A;  1S66 L;  1VB6 A;  5DKK A;  4EES A;  2INW A;  4EEP A;  3CLO A;  3K3D A;  3CWF A;  3LYX A;  5IS1 A;  1LSV A;  4BBT A;  4K08 A;  4KQD A;  3T50 A;  2Z6C A;  1TS7 A;  3MR0 A;  3LIF A;  1GSX A;  5HWT A;  4LRZ E;  1OT9 A;  3HJK A;  2D02 A;  4HIA A;  5TBM A;  2W0N A;  4HH2 A;  1XJ2 A;  1F9I A;  4MN5 A;  4R38 A;  4R3A A;  3OLO A;  5G4Z A;  4DJ2 A;  3HJI A;  3LIC A;  1S4S A;  4WL9 A;  2V0U A;  3C8C A;  1T18 A;  2V1B A;  2QJ5 A;  4HJ3 A;  1UGU A;  1S1Y A;  1OTI A;  1DP8 A;  1EW0 A;  5TBM B;  4M4X A;  4I3I A;  1S4R A;  3KX0 X;  1DP6 A;  3BY8 A;  1KOU A;  1T1B A;  3RH8 B;  2QJ7 A;  4EQ1 A;  3E4P A;  3F1N A;  2PR5 A;  3EWK A;  2OWH A;  4EW7 A;  2QKP A;  2V1A A;  3NOT C;  4JGQ A;  1BYW A;  4HP4 A;  2ZBB A;  1G28 A;  5A8B A;  1T1C A;  2OWJ A;  3MJQ A;  2R78 A;  3F1N B;  4GHI A;  2V0W A;  2BAS A;  3LIA A;  3ICY A;  4EEU A;  2CMN A;  4YWZ A;  1X0O A;  2PR6 A;  3P7N A;  4GHI B;  3IS2 A;  1DRM A;  4NXB A;  4I3A A;  4EXO A;  4R6L A;  3LUQ A;  4BBV A;  4EET B;  5F5Y A;  2VV6 A;  3IS2 B;  1XFQ A;  3B33 A;  4KUK A;  4JGR A;  3H7W A;  1OJ5 A;  1JNU A;  4HH3 A;  2V9A A;  3A0R A;  3C2W A;  2KX6 A;  1UWP X;  3E4Q A;  1NWZ A;  3F1P A;  4NXF A;  4HP9 A;  1OTE A;  5F68 A;  3H7W B;  3UB7 A;  2VEA A;  3FG8 A;  5DKL A;  3K3C A;  3GDI A;  4HQA A;  4L9E A;  5EFW A;  4GS9 A;  4PKY A;  4DJ3 A;  4JGP A;  3F1P B;  1DP9 A;  4HJ4 A;  1P97 A;  3MXQ A;  5DJT A;  3PHY A;  3UB9 A;  2VLG A;  4RQ9 A;  2PD7 A;  3MFX A;  3LI9 A;  4GS9 B;  5G4Y A;  2YKH A;  3SW1 A;  4HOI A;  3IBR A;  3BY9 A;  2WKR A;  1P0Z A;  4WF0 A;  3UME A;  4NXE A;  5HD3 A;  3NJA A;  2YKF A;  1LL8 A;  3G6O A;  2J80 A;  3VE3 A;  4EER A;  4JGO A;  3CAX A;  4KUO A;  1F98 A;  3EEH A;  1GSV A;  3GEC A;  5HWV A;  1OTD A;  2GJ3 A;  3H82 A;  3A0S A;  2PHY A;  2WKP A;  4L9F A;  3H9W A;  2JN7 A;  5KIZ A;  3UMD A;  3UB6 A;  4HNB A;  5AVE A;  2HV1 A;  4LRY C;  4BBU A;  4L9G A;  3VE4 A;  1XJ6 A;  2Z6D A;  2JHE A;  1OTB A;  2P7J A;  2VV7 A;  3RTY A;  3H82 B;  4XT2 B; 
#chains in the Genus database with same CATH topology
 2B5R A;  5TR7 A;  1ESI A;  3WS4 A;  4WZ4 A;  4WN5 A;  4DXB A;  5J4E A;  1IOU A;  3EQU A;  2Y4A A;  5HDC A;  1XA1 A;  2QMI A;  3V39 A;  2ZM0 A;  3C4O A;  2W27 A;  3F1O A;  1F2K A;  2J7V A;  3IXD A;  3BEB A;  3VP4 A;  1ZTU A;  5HFO A;  1DJC A;  4HHD A;  3HLW A;  1UWN X;  4LPZ A;  1ES3 A;  3T4J A;  1KE4 A;  2Y2O A;  1S67 L;  4GN2 A;  5AVF A;  1L0G A;  1TDL A;  2PYP A;  4IVI A;  1WYC A;  2NUP C;  3PYP A;  4MNR A;  1K55 C;  4GOG A;  3S4X A;  3D4F A;  3BFD A;  3G30 A;  1P9W A;  1N9B A;  4LRX C;  2I9V A;  5DTS A;  2VGK A;  1LLB A;  4BWI A;  2Y2I A;  1E3U A;  4UEY A;  4PM5 A;  1ODV A;  4I3J A;  3E0Y A;  1L0D A;  1D7E A;  1NZU A;  5GHY A;  3UB8 A;  5HSQ A;  3NBL A;  5LBR A;  3KO6 A;  4M3K A;  5DTT A;  1GHI A;  3NI9 A;  1PRQ A;  4E04 A;  2ZQ9 A;  1ESU A;  2ZOH A;  2L4R A;  3Q7V A;  3LO7 A;  4DE3 A;  1JWP A;  4U0T A;  4KZ8 A;  5FI7 A;  4HEF A;  3W8K A;  5F69 A;  2DCF A;  4WYY A;  1TS6 A;  3C7V A;  1T1A A;  5IT5 A;  3IH9 A;  1JWZ A;  2WAF A;  1XXM A;  1PIO A;  3D72 A;  1K55 A;  2ZMV A;  1J9M A;  2HP9 A;  2QWS A;  3UY6 A;  4KZ9 A;  2PT7 A;  1VEU B;  3PBS A;  4B93 A;  3DW0 A;  5GLA A;  3FWL A;  4PM8 A;  1WA9 A;  4E3M A;  2L1M A;  2PDR A;  4OP5 A;  5HDS A;  1VHM A;  3NC8 A;  3MXS A;  5K5B A;  3MKE A;  5DKK A;  1ALQ A;  5DFX A;  1NRJ A;  3IF5 A;  3LYX A;  2J8Y A;  1H3Q A;  1BZA A;  2A49 A;  4QU3 A;  5HAR A;  1LSV A;  2IWC A;  3HLF A;  3VSL A;  2WKI A;  3A3I A;  4KQD A;  1TS7 A;  4DE2 A;  3MR0 A;  3ZYT A;  3Q82 A;  3WS0 A;  1Y4O A;  5EE8 A;  4RYE A;  5E43 A;  3HJK A;  5E2H A;  4HIA A;  3N7W A;  4HH2 A;  2W3E A;  1YLT A;  4E6W A;  5EOE A;  3C8C A;  4JF6 A;  1T18 A;  3IWO A;  5FEF A;  4EBL A;  2V1B A;  3A3F A;  1OTI A;  1EW0 A;  4CLC B;  3OC2 A;  1CEF A;  1Y54 A;  3DTI A;  3EEA A;  4UHU A;  1DP6 A;  3D9Y A;  1M40 A;  2XD1 A;  5IHV A;  1T1B A;  4OQI A;  5CX7 A;  1VM1 A;  3UPN A;  2OWH A;  1IKG A;  2PRF A;  5DF9 A;  2V1A A;  4KZA A;  4GZB A;  1SKO B;  1BYW A;  3W2Z A;  1ES5 A;  3IF6 C;  5EVI D;  3C4P A;  1PI4 A;  4ZRR A;  2EX9 A;  4L0L A;  5CGW A;  4DE0 A;  3F1N B;  1JWV A;  1HZO A;  2RCX A;  4GHI A;  2BAS A;  3BEC A;  1KVL A;  5TGF A;  2XGN A;  1HVB A;  3N8S A;  1S6R A;  1A0K A;  4S2N C;  3LEZ A;  4LV0 A;  5FQ9 A;  3EOI A;  5AJG A;  3PBT A;  4O7D A;  4UQI S;  2V8F A;  3UPP A;  4KQR A;  2P74 A;  2V1Z A;  3IS2 A;  5CGX A;  1YKD A;  2WYX A;  1NY0 A;  1H8Y A;  4S2M A;  5EVI C;  3T12 B;  4ARZ B;  4MBK A;  3LGO A;  4YIN A;  4UA7 A;  4KG5 A;  2HJ9 C;  5FQQ A;  4X68 A;  4ZBE A;  3KSG A;  4X1M A;  2IWD A;  2X02 A;  2O9B A;  4WBG A;  3A0R A;  4QY5 A;  1OME A;  1KGE A;  5HAQ A;  3E4Q A;  5HL6 A;  1NWZ A;  1YQS A;  3F1P A;  4MBH A;  3PAE A;  5F68 A;  3HLG A;  4XUZ A;  2VEA A;  4CJN A;  1M6K A;  5DKL A;  4WMC A;  1SHV A;  2QPN A;  2W1T A;  1BLP A;  3KSH A;  4XXR A;  1LL5 A;  5EOO A;  3LFV A;  3T4L A;  4DJ3 A;  4S2N A;  4Q0I A;  4OOY A;  1VET B;  4HJ4 A;  1H8M A;  2K2N A;  2CC1 A;  5EEC A;  3OZH A;  1YLJ A;  3MFX A;  1MKI A;  2ZD8 A;  1ONG A;  2HP5 A;  2GNX A;  1D1J A;  3C7U A;  4FH2 A;  4DF6 A;  2OV5 A;  4PHT A;  1TDG A;  3HUM A;  3VV4 A;  1PW8 A;  3GVB A;  3N8R A;  1LL8 A;  3ISG A;  1PYY A;  3NIA A;  4WZ5 C;  3M6B A;  1OPX A;  2Y2K A;  5F1F A;  5EV0 A;  1FR6 A;  1OTD A;  5EVL A;  4JPM A;  1F5M A;  2H10 A;  2XF3 A;  4LV2 A;  2PHY A;  2W3G A;  2JN7 A;  2ZJ9 A;  5EPH A;  2HV1 A;  2Q0O A;  1QME A;  3ZVT A;  4BBU A;  2UWX A;  4OKP A;  4L9G A;  1W63 M;  2R9W A;  4E6X A;  2FFF B;  3BM6 A;  2VKS A;  3OPR A;  3C30 A;  2P7J A;  4PPR A;  1MC0 A;  3MMH A;  4GKU A;  4G3K A;  2J3T C;  4FOF A;  4G3W A;  3SS3 A;  2VJW A;  3G32 A;  4KZ5 A;  5DVA A;  1FOF A;  1FCN A;  5F83 A;  2JKT M;  4EQI A;  3OPP A;  3KSF A;  2A24 A;  4HY8 A;  4U0X A;  3MKF A;  3N6I A;  4II7 A;  3TG9 A;  3G2Z A;  4WLA A;  2EFU A;  4B4Z A;  1BUL A;  3G2Y A;  4F3L A;  4RX2 A;  2P04 A;  3VSK A;  2HDR A;  2ZQ8 A;  4CLC E;  1FCO A;  3E4O A;  1OTA A;  4YFM A;  4Z1W A;  4WZ5 A;  4DMZ A;  4OPQ A;  3DBA A;  3VFF A;  4ESP A;  3LR4 A;  5HAI A;  2OOL A;  3JVV A;  3CI6 A;  4N1X A;  4B88 A;  3CPT B;  4JXS A;  1HTZ A;  4HJ6 A;  1KE3 A;  2ZC5 B;  4QJG A;  5CER A;  1BLH A;  1GCE A;  3E98 A;  3LID A;  3WS1 A;  1Z6F A;  3OOV A;  2PD8 A;  3C38 A;  5FEG A;  4H6J B;  3TW8 A;  5C5K A;  1PNE A;  5CHM A;  2JKG A;  1N9O A;  5FAP A;  5HDD A;  4E3L A;  3NY4 A;  5L09 A;  4PKY G;  5CHJ A;  2VGL S;  2V2F F;  4LV3 A;  3VP3 A;  3IBJ A;  1K6S A;  2GZA A;  1E3U D;  4P0M A;  4Y5F A;  1V9Z A;  3RJU A;  5HWW A;  1G5U A;  1IKI A;  1N9N A;  1IEM A;  4BJP A;  4Y3I A;  4E3N A;  3N4I A;  1LHY A;  3O5Y A;  3MZE A;  3T4S A;  2K31 A;  5DJU A;  1K25 A;  1YMX A;  2W3F A;  1K4E A;  4WUJ A;  5CXW A;  4XT2 A;  4EUZ A;  2OAQ 1;  1S1Z A;  1TS0 A;  2HDU A;  3M2K A;  1ZG6 A;  4NXG A;  4MEZ A;  1RGZ A;  3NHQ A;  2HZ5 A;  1FR1 A;  3Q07 A;  3R4K A;  5IU1 A;  2B02 A;  1OJG A;  2K7S A;  3NOU C;  3ZFZ A;  4N1H A;  1K56 D;  3FZC A;  2H28 A;  2ZC4 B;  3LR3 A;  5DF8 A;  3FC7 A;  5DFY A;  2HDQ A;  4OQG A;  4MDZ A;  4ID4 A;  4LFU A;  3NCK A;  1YLW A;  5L8M A;  1PZO A;  5GHZ A;  4LCL A;  1W8Y A;  1ES4 A;  3PXP A;  3GSG A;  4I39 A;  2PYR A;  1LSX A;  1VB6 A;  5KMW A;  2GX5 A;  2WGW B;  5A91 A;  2INW A;  1TEM A;  4PM6 A;  3NDE A;  4HES A;  4S2P A;  4K08 A;  4KZ7 A;  3T50 A;  2Z6C A;  4IHQ A;  3FKV A;  2XK1 A;  4Y2F A;  3ZCZ A;  3QP8 A;  5CTM A;  3QNC A;  4GD8 A;  3P98 A;  2OSU A;  5TBM A;  1SDE A;  4ETZ A;  3NEC A;  1XA7 A;  1F9I A;  4Y15 A;  1L0E A;  3FKW A;  4Y7P A;  4DJ2 A;  4P6Z M;  4WL9 A;  2V0U A;  2Y91 A;  3IF6 B;  2EXA A;  3R7W A;  5FQK A;  2R9X A;  2B95 A;  3RXX A;  4KG2 A;  2BLS A;  2Y59 A;  3GTC A;  5FSR A;  1DP8 A;  1W79 A;  4OPR A;  3P01 A;  1JVJ A;  3Q1F A;  4Y17 A;  3O88 A;  3PBR A;  1S0W A;  1S4R A;  3BY8 A;  1YM1 A;  3ZNT A;  3RH8 B;  1BLS A;  2QJ7 A;  4EUV A;  4EQ1 A;  3IHA A;  1IEL A;  2PR5 A;  3E2K A;  3EWK A;  3L7H A;  3KSI A;  1GHP A;  5EM0 A;  5E2G A;  4JGQ A;  5L07 A;  4DDS A;  4HP4 A;  5FI2 A;  1ZG4 A;  5EVI B;  1T1C A;  2GDN A;  3B3X A;  2Q9N A;  2VGJ A;  1QMF A;  2H0T A;  2JC7 A;  2V0W A;  1K56 A;  3Q7Z A;  3MS6 A;  3W4P A;  1ERQ A;  1FIL A;  4GLQ A;  3QP4 A;  4D60 A;  3LIA A;  3ICY A;  1N4O A;  2JKF A;  4IED A;  2CMN A;  2QYB A;  4EBP A;  3HLD A;  3BRM A;  4F94 A;  2PR6 A;  3P7N A;  2PBD P;  2VX8 A;  2E8J A;  2MJ6 A;  4NXB A;  3GQZ A;  2O9C A;  1XPB A;  1MWU A;  4LV1 A;  5F5Y A;  4EWF A;  3ZNY A;  5FA7 A;  2NUT C;  2W1R A;  1SKF A;  5KZH A;  1ERM A;  1AXB A;  2P9V B;  3B33 A;  4OH0 A;  3UPO A;  3H7W A;  4LCM A;  4K0X A;  1OJ5 A;  4E3J A;  3M6H A;  1FCM A;  1PFL A;  1YLP A;  2Y2J A;  2V9A A;  2KX6 A;  3BQA A;  3IXH A;  3FV7 A;  3GRJ A;  3T4Q A;  5F1G A;  3DTE A;  4OPZ A;  1GA0 A;  3FG8 A;  3VP0 A;  3DWK A;  5GLD A;  2ZL1 B;  1IYS A;  4L9E A;  3BLM A;  4DRT A;  5EFW A;  4EBN A;  2O9A A;  1KGF A;  3MXQ A;  5DJT A;  3VFH A;  4WMC D;  3IX4 A;  1MPL A;  3LI9 A;  3V50 A;  5HAP A;  2VZW A;  4GS9 B;  3NUL A;  4ZDX A;  4OVD A;  5G4Y A;  1H5X A;  4R1G A;  2YKH A;  3RXW A;  1LL9 A;  1BSG A;  2J9O A;  1K4F A;  3PAG A;  1P0Z A;  4MBF A;  3GV9 A;  5CRF A;  3BLS A;  1I5Q A;  4NXE A;  5HD3 A;  3EGX C;  2WZZ A;  2O0Y A;  3G6O A;  3BW6 A;  2XRO A;  1EWZ A;  5L10 A;  4JGO A;  3VE3 A;  3IWI A;  1F98 A;  3EEH A;  3WRZ A;  3MFD A;  3S7Q A;  5A93 A;  3D3O A;  3TOI A;  1ZHH B;  5E2E A;  3DTM A;  3QP5 A;  3H82 A;  4Y0T A;  1IYQ A;  2I72 A;  3A0S A;  4R3J A;  4RA7 A;  5EM1 A;  5KIZ A;  2PAV P;  5AVE A;  2XD5 A;  1W63 Q;  4OLG A;  4QY6 A;  2JHE A;  1KE0 A;  4XT2 B;  1LI0 A;  2UV0 E;  2VV8 A;  1JTG A;  4H8R A;  3ZHH A;  1DJA A;  4IJG A;  2ZMF A;  5AQ7 A;  4A5R A;  1TVF A;  3HCY A;  4NEE D;  5HZH A;  5J8X A;  5J3W A;  3ITA A;  4P85 A;  1XJ3 A;  2FFY A;  4QPR A;  1TS8 A;  5HD5 A;  3S7P A;  3GR2 A;  1N9L A;  2V8C A;  1YMS A;  4JLF A;  4RX3 A;  2XDM A;  1DY6 A;  4BL2 A;  1XFN A;  5GHX A;  1LSW A;  2KOI A;  1L3L A;  3ZG8 B;  4B9O A;  5DF7 A;  4N9K A;  3LI8 A;  4KZB A;  2Q9M A;  3F1O B;  3BWL A;  3HRE A;  1EI5 A;  4S2I A;  4U3T A;  1AWI A;  2XFS A;  4P6B A;  3P09 A;  2XA7 M;  3L9K A;  3MSH A;  1YAX A;  1V9Y A;  2D01 A;  5I94 A;  2G2W A;  3G4P A;  5FQI A;  3MQO A;  2EA9 A;  4LGW A;  4ETX A;  4BD0 A;  3MQQ A;  2IA2 A;  3VOZ A;  4MN6 A;  3K2N A;  1BTL A;  4ME4 A;  2WGV A;  1XJ4 A;  1FQG A;  2Y2N A;  2M1C A;  1CQA A;  4IUH A;  1Y28 A;  3VP1 A;  4OQH A;  3PBO A;  1H8Z A;  3HLC A;  4Y13 A;  3JYI A;  2J3T D;  3IT9 A;  4QD4 A;  4FCF A;  5FL3 A;  4GD6 A;  4C6Y A;  3T4K A;  4R3B A;  2WKQ A;  5U47 A;  4KQO A;  4X1L A;  4KZ6 A;  1VEU A;  2X01 A;  5A90 A;  2J3W A;  4BD1 A;  1PI5 A;  3HUN A;  3Q81 A;  4DKI A;  5BOH A;  1OT6 A;  3Q7V B;  5F6A A;  4MCW A;  1W8Q A;  1SZV A;  1H0M A;  1YLZ A;  2ZOI A;  3JVU A;  2AVX A;  1D06 A;  1YPR A;  2G2U A;  3S1Y A;  3UE1 A;  3TSG A;  3HLE A;  1NZO A;  2DMW A;  2L0W A;  4GNU A;  2WZX A;  3VOL A;  1PWG A;  3UDX A;  1T19 A;  3G34 A;  2Y79 A;  3WWX A;  5I5L A;  3JPU A;  2P08 A;  4GCZ A;  2B18 A;  4GJ4 A;  3IXB A;  4R70 A;  1BUE A;  5FAT A;  3BFG A;  5M19 A;  2XH9 A;  4S2J A;  1K57 C;  4NET A;  4EEP A;  4NK3 A;  3CLO A;  3ZG7 B;  3CWF A;  3HBR A;  5EVE A;  5TFQ A;  4BBT A;  4JXG A;  4X53 A;  3ZG0 A;  3LIF A;  1GSX A;  5AQA A;  5HWT A;  4LRZ E;  1OT9 A;  1IYO A;  3EGD C;  2D02 A;  4N92 A;  4UA6 A;  3OPL A;  2ZMA A;  1XJ2 A;  3FPV A;  4WEK A;  3OLO A;  5G4Z A;  2Z2M B;  3HJI A;  3LIC A;  1YSQ A;  4R4S A;  2V20 A;  4HJ3 A;  2EWV A;  1UGU A;  1S1Y A;  3W4O A;  4JF4 A;  1ES2 A;  1SKO A;  5L2F A;  2ZQC A;  4M4X A;  3G35 A;  3UE0 A;  1ONH A;  1K54 C;  3VP2 A;  3O87 A;  1KOU A;  4OP8 A;  5FAQ A;  5G18 A;  3F1N A;  4JXV A;  4O0P A;  3QP2 A;  3OCL A;  1CF0 A;  4OON A;  1MBL A;  3ITB A;  3NOT C;  1W5D A;  1KDW A;  1K57 A;  3V3S A;  2PU2 A;  4UAA A;  2JKT I;  3A3D A;  2XRN A;  1WYB A;  1XKZ A;  2EWW A;  4OOL A;  2H5S A;  2HGV A;  3U4L P;  5CGS A;  3V3R A;  2HF6 A;  4YWZ A;  4ARZ A;  3WS5 A;  3SS5 A;  2HP6 A;  3UB5 P;  3FYZ A;  3SS4 A;  1NYY A;  3N8L A;  3UN7 A;  1X0O A;  1ZC2 A;  5M1A A;  4PAU A;  3SH9 A;  4GHI B;  4I3A A;  4GDN A;  1KVM A;  1FSY A;  5HL1 A;  2VV6 A;  5GL9 A;  4C75 A;  3AGD A;  1K54 A;  4Q0H A;  1L2S A;  3IS2 B;  4NG2 A;  5HPF A;  5FQM A;  1XFQ A;  1BT5 A;  1HLU P;  4KUK A;  2DRW A;  4JGR A;  1TD5 A;  4O01 A;  3UDI A;  5M18 A;  4IBR A;  4JF5 A;  3CUE C;  4HH3 A;  1I2W A;  4S2O A;  4QHC A;  4D2O A;  1UWP X;  3RFB A;  4C3Q A;  1GHM A;  4GDB A;  4IUK A;  1VET A;  4NXF A;  4HP9 A;  3WS2 A;  4BQM A;  2Y2M A;  2J9P A;  3UB7 A;  3B42 A;  3TRC A;  4HQA A;  4HBT A;  5KSH A;  3SH8 A;  4PKY A;  1STZ A;  4UA9 A;  4JGP A;  3F1P B;  2Y55 A;  3IX8 A;  4Q0J A;  1KGG A;  2IWB A;  3PHY A;  1IFQ A;  4RQ9 A;  2PD7 A;  1TF1 A;  2W1T B;  1BLC A;  5MC7 A;  2OLV A;  4ZJ1 A;  4MLL A;  3KYZ A;  4X25 A;  4DE1 A;  4HOI A;  3IBR A;  3S22 A;  3T4T A;  3HLB A;  2Y2G A;  1PWD A;  1C3B A;  4WF0 A;  3UME A;  3NJA A;  2YKF A;  4ZAM A;  5GLB A;  3BFE A;  3PR6 A;  2J80 A;  1XP4 A;  2ZQD A;  3CUE A;  3CAX A;  4KUO A;  5FQJ A;  3IQA A;  4FTX A;  1SCW A;  4UQI M;  1L0F A;  1RGY A;  4R0Q A;  2GJ3 A;  4X69 A;  4KQQ A;  3IWQ A;  1WE4 A;  2Z2L B;  1GA9 A;  3MQ0 A;  2JE5 A;  2WKP A;  3AGE A;  3MZF A;  4PMA A;  3H9W A;  3VMA A;  4S2K A;  4LRY C;  2ZLY A;  4EU0 A;  1VQQ A;  5HX9 A;  3LEQ A;  1XJ6 A;  1MWR A;  5EUA A;  1OTB A;  2Y8H A;  4EV4 A;  5HW3 A;  4E3I A;  3MF0 A;  3HL9 A;  3DAV A;  2KDK A;  4O8G A;  1G6A A;  4FUW A;  4PM9 A;  4XUX A;  4I38 A;  2VK3 A;  2W3H A;  2JBF A;  5FDS A;  3TJZ C;  4JKT A;  1CEG A;  2HJE A;  3M2J A;  1K6R A;  4I5S A;  4Y0U A;  2JKR M;  3B47 A;  1MZU A;  4JBF A;  1MXO A;  3CPT A;  1NRF A;  4IBX A;  2Y2H A;  3S7O A;  1P9R A;  2Y2L A;  1NXY A;  4WEL A;  2A24 B;  4FH4 A;  4N9L A;  3UE3 A;  5J7E A;  1Z09 A;  3FPW A;  4F3L B;  3T1S A;  4H6J A;  4OQ0 A;  2ZQA A;  4PM7 A;  3UE6 A;  5A92 A;  1KDS A;  2XSS A;  3O3V A;  4GB7 A;  2XEP A;  3QHY A;  4G3V A;  3MZD A;  5FAO A;  3LY3 A;  3MBZ A;  3CMZ A;  5AQ9 A;  2WUQ A;  1J3W A;  3ZQ5 A;  4E3O A;  4P6Z S;  3A3J A;  4QWO A;  3PTE A;  3LIE A;  1MY8 A;  3CIT A;  1LT0 A;  1HD8 A;  3O86 A;  1YLY A;  3T4O A;  4Z9Q A;  1YSP A;  3HUO A;  3ULF A;  2H0Y A;  1XGI A;  2M7U A;  4BLM A;  4HBU A;  2QHK A;  1JTD A;  3KYQ A;  1SDN A;  4LLO B;  4BMW A;  5TJJ A;  3NDG A;  4YOF A;  4GW9 A;  1O07 A;  3LIB A;  2WKH A;  3CZD A;  4MN7 A;  5AQB A;  2BG1 A;  3BFC A;  1YT4 A;  5JYP A;  3C5A A;  2WGI A;  3BFF A;  4RVA A;  2Y2P A;  4X56 A;  2JKR I;  2ZC6 B;  3A0V A;  1PWC A;  2Y2Q A;  4HI4 A;  2ZC3 B;  3IX3 A;  2JCH A;  2WAD A;  3LY4 A;  2XR0 A;  3QNB A;  2WGW A;  3WRT A;  2E8I A;  2LB9 A;  2XFT A;  1GSW A;  1RCJ A;  1K38 A;  1Q2P A;  3NOP C;  2EX6 A;  2EX2 A;  4IVK A;  5F82 A;  4BEN A;  3IH8 A;  1NJ4 A;  4CQH A;  1S66 L;  4EES A;  2QZ6 A;  2A2L A;  4KZ3 A;  4FSF A;  3BQ8 A;  2PBY A;  3K3D A;  3GMW A;  5IS1 A;  1CK3 A;  1ACF A;  3IF6 A;  2O99 A;  2C6W B;  2W3D A;  4DXC A;  1NLZ A;  2W0N A;  3ZVW A;  5KSC A;  4MN5 A;  4R38 A;  1XGJ A;  4R3A A;  5GLC A;  1S4S A;  4AFI A;  3KYE A;  4P87 A;  4CLC D;  1PZP A;  2QJ5 A;  3T1R A;  4ZTK A;  2VGL M;  5TBM B;  5HPI A;  2PU4 A;  2ZM8 A;  2RL3 A;  3W4Q A;  2ZC7 A;  3I7J A;  4I3I A;  3KX0 X;  5EVI A;  3T1X A;  1CI8 A;  3U2A A;  3R7W B;  1NYM A;  5E2F A;  3E4P A;  4S2L A;  3LR0 A;  1Q2Q A;  4EW7 A;  2QKP A;  1PW1 A;  2ACG A;  2M7V A;  5FI6 A;  3AGF A;  1O7E A;  2ZBB A;  1G28 A;  1FSW A;  5A8B A;  1ZKJ A;  2X71 A;  2OWJ A;  4CLC C;  3MJQ A;  2R78 A;  3OBF A;  4OLD A;  4OPY A;  3IHB A;  4EEU A;  2EXB A;  3LCE A;  4R4R A;  2XLN A;  1CI9 A;  1MKM A;  3EQV A;  3UDF A;  2A3U A;  2EX8 A;  1W7F A;  5JYO A;  1DRM A;  2OLU A;  2P9V A;  2BTF P;  3DTK A;  4EXO A;  1U60 A;  4K0W A;  4R6L A;  3LUQ A;  4BBV A;  4EET B;  2DNS A;  3ZGA B;  3CHW P;  4NKP A;  2XQZ A;  2KLI A;  3QP1 A;  4MMN A;  2FZ0 A;  1I2S A;  5DTK A;  4KZ4 A;  2WKE A;  4X55 A;  3DWZ A;  2ZM2 A;  2FH5 A;  4R23 A;  5CTN A;  4Y0O A;  1JNU A;  5CED A;  2ZL1 A;  2G7U A;  3C2W A;  3G31 A;  1K0K A;  2OAP 1;  4WM9 A;  2ZQ7 A;  3UO9 A;  3MXR A;  2C5W B;  1G6O A;  3CG5 A;  1MWT A;  3A3E A;  3UNW A;  4K91 A;  1OTE A;  4CLC A;  5FAS A;  2LB5 A;  3H7W B;  3ZG5 A;  3K3C A;  1DJB A;  3GDI A;  3T1Q B;  4ZJ3 A;  4DDY A;  4GS9 A;  4DN0 A;  3OCN A;  1DP9 A;  3BYD A;  1P97 A;  2EFX A;  3V67 A;  4CPK A;  5D3O A;  3OPH A;  4QB8 A;  3UB9 A;  2VLG A;  1CJF A;  2XA7 S;  4JXW A;  1E25 A;  3SZT A;  4E3K A;  4Q8I A;  3SW1 A;  4FD8 A;  3BY9 A;  2WKR A;  4KG6 A;  2WK0 A;  5CEC A;  4OOM A;  3E2L A;  3SH7 A;  1ERO A;  1FIK A;  3IXG A;  2WAE A;  3HVF A;  1E4D A;  4EER A;  1LI9 A;  1MWS A;  2VA0 A;  1GSV A;  5CEB A;  3GEC A;  5HWV A;  3BJN A;  3QP6 A;  3PBN A;  3V5M A;  4WEJ A;  4KEN B;  1RP5 A;  4LEN A;  5CHU A;  3LR5 A;  4L9F A;  2HPB A;  4B4X A;  3VOY A;  4YNR A;  3UMD A;  3UB6 A;  4HNB A;  2HDS A;  4ZJ2 A;  3PBQ A;  3TE8 A;  1IYP A;  3ZDJ A;  4BL3 A;  3CJM A;  4X6T A;  3VE4 A;  2Z6D A;  3ZG9 B;  1NLY A;  5FDH A;  1G68 A;  1XX2 A;  3RTY A;  2VV7 A;  3H82 B;  3S7N A;  3SOI A; 
#chains in the Genus database with same CATH homology
 3MF0 A;  4G3K A;  2KDK A;  4O8G A;  2VV8 A;  2J3T C;  4FOF A;  4G3W A;  2VJW A;  4I38 A;  4IJG A;  4WN5 A;  2ZMF A;  5J4E A;  1IOU A;  2W3H A;  3HCY A;  4NEE D;  5HZH A;  3EQU A;  5J3W A;  2JKT M;  5HDC A;  3TJZ C;  2HJE A;  1XJ3 A;  3KSF A;  2A24 A;  4HY8 A;  4QPR A;  4I5S A;  4II7 A;  2JKR M;  1TS8 A;  5HD5 A;  3S7P A;  4WLA A;  3B47 A;  1MZU A;  4F3L A;  1N9L A;  2W27 A;  2P04 A;  3F1O A;  1ZTU A;  3S7O A;  4HHD A;  4CLC E;  3E4O A;  4Z1W A;  1OTA A;  1XFN A;  1P9R A;  1UWN X;  4LPZ A;  1LSW A;  4DMZ A;  2KOI A;  3T4J A;  3DBA A;  4WEL A;  1S67 L;  2A24 B;  5AVF A;  3UE3 A;  3LR4 A;  5J7E A;  2OOL A;  4B9O A;  2PYP A;  3FPW A;  3JVV A;  3LI8 A;  4F3L B;  3F1O B;  3CI6 A;  3BWL A;  4H6J A;  2NUP C;  3PYP A;  4HJ6 A;  3UE6 A;  2XA7 M;  1YAX A;  1V9Y A;  2D01 A;  2XSS A;  1P9W A;  3MQO A;  2EA9 A;  4ETX A;  3MQQ A;  2IA2 A;  4LRX C;  3E98 A;  3LID A;  4G3V A;  2I9V A;  4MN6 A;  3K2N A;  3OOV A;  2PD8 A;  3C38 A;  4H6J B;  3TW8 A;  4BWI A;  4ME4 A;  5C5K A;  4UEY A;  3ZQ5 A;  4P6Z S;  1ODV A;  1XJ4 A;  3E0Y A;  4I3J A;  1D7E A;  3LIE A;  1N9O A;  2M1C A;  5HDD A;  3CIT A;  3UB8 A;  5HSQ A;  4IUH A;  1Y28 A;  1LT0 A;  4PKY G;  2VGL S;  5LBR A;  3T4O A;  3KO6 A;  3IBJ A;  2GZA A;  3PBO A;  1YSP A;  3ULF A;  4Y5F A;  2M7U A;  1V9Z A;  4E04 A;  2J3T D;  5HWW A;  1N9N A;  2ZOH A;  2L4R A;  2QHK A;  5FL3 A;  4BJP A;  3KYQ A;  4Y3I A;  3T4K A;  4LLO B;  4BMW A;  3O5Y A;  2WKQ A;  5TJJ A;  3T4S A;  4KQO A;  2K31 A;  4YOF A;  5DJU A;  2W3F A;  4WUJ A;  5F69 A;  2J3W A;  4GW9 A;  4XT2 A;  3LIB A;  4MN7 A;  1TS6 A;  2OAQ 1;  1T1A A;  5IT5 A;  1S1Z A;  1OT6 A;  1TS0 A;  5F6A A;  4MCW A;  2JKR I;  4NXG A;  3D72 A;  3A0V A;  2ZMV A;  3NHQ A;  2QWS A;  2ZOI A;  3JVU A;  3R4K A;  5IU1 A;  2B02 A;  2PT7 A;  1OJG A;  2K7S A;  3PBS A;  4HI4 A;  4B93 A;  1D06 A;  3NOU C;  2H28 A;  3LR3 A;  3FC7 A;  5DFY A;  4MDZ A;  1WA9 A;  2LB9 A;  1GSW A;  2L0W A;  2DMW A;  3NOP C;  5L8M A;  2L1M A;  3VOL A;  2PDR A;  5HDS A;  1VHM A;  1T19 A;  2Y79 A;  3PXP A;  5I5L A;  5K5B A;  4I39 A;  2P08 A;  4GCZ A;  2B18 A;  4GJ4 A;  2PYR A;  4CQH A;  1LSX A;  4R70 A;  1S66 L;  1VB6 A;  5DKK A;  4EES A;  2GX5 A;  2INW A;  5DFX A;  1NRJ A;  2A2L A;  4EEP A;  4FSF A;  3BQ8 A;  3CLO A;  3K3D A;  3CWF A;  3LYX A;  1H3Q A;  5IS1 A;  1LSV A;  4BBT A;  4K08 A;  4KQD A;  3T50 A;  2Z6C A;  4IHQ A;  1TS7 A;  3MR0 A;  3ZYT A;  4Y2F A;  3LIF A;  1GSX A;  2O99 A;  5HWT A;  4LRZ E;  1OT9 A;  3HJK A;  2W3D A;  3EGD C;  2D02 A;  1NLZ A;  4HIA A;  5TBM A;  2W0N A;  4HH2 A;  4ETZ A;  1XJ2 A;  1F9I A;  2W3E A;  3FPV A;  4MN5 A;  4R38 A;  4WEK A;  4R3A A;  3OLO A;  5G4Z A;  4DJ2 A;  3HJI A;  3LIC A;  1YSQ A;  4P6Z M;  1S4S A;  4WL9 A;  2V0U A;  3C8C A;  1T18 A;  3R7W A;  4AFI A;  2V1B A;  4CLC D;  2QJ5 A;  4HJ3 A;  2EWV A;  1UGU A;  1S1Y A;  1OTI A;  2VGL M;  1DP8 A;  1EW0 A;  5TBM B;  4CLC B;  3OC2 A;  3P01 A;  5HPI A;  3EEA A;  4M4X A;  3PBR A;  4I3I A;  1S4R A;  3KX0 X;  1DP6 A;  3BY8 A;  1KOU A;  1T1B A;  3RH8 B;  3U2A A;  3R7W B;  5CX7 A;  2QJ7 A;  4EUV A;  4EQ1 A;  3E4P A;  3F1N A;  2PR5 A;  4O0P A;  3EWK A;  3LR0 A;  2OWH A;  3KSI A;  3OCL A;  2QKP A;  4EW7 A;  5DF9 A;  2V1A A;  3NOT C;  2M7V A;  4JGQ A;  1BYW A;  3W2Z A;  4HP4 A;  2ZBB A;  4ZRR A;  1G28 A;  5A8B A;  4L0L A;  1T1C A;  2OWJ A;  4CLC C;  3MJQ A;  2R78 A;  3F1N B;  3OBF A;  2JKT I;  4GHI A;  2V0W A;  2BAS A;  2XRN A;  4GLQ A;  2EWW A;  4OOL A;  3LIA A;  3ICY A;  2HGV A;  4EEU A;  2CMN A;  2HF6 A;  2QYB A;  4YWZ A;  4ARZ A;  3EOI A;  5AJG A;  1MKM A;  3PBT A;  4UQI S;  3EQV A;  1X0O A;  4PAU A;  2PR6 A;  3P7N A;  4GHI B;  3IS2 A;  1DRM A;  1YKD A;  2VX8 A;  2MJ6 A;  4NXB A;  4I3A A;  2O9C A;  4EXO A;  4R6L A;  3LUQ A;  4BBV A;  4EET B;  5F5Y A;  4ARZ B;  2VV6 A;  2NUT C;  4NKP A;  2W1R A;  2KLI A;  4MMN A;  2HJ9 C;  2FZ0 A;  4Q0H A;  3IS2 B;  5HPF A;  1XFQ A;  3B33 A;  4KUK A;  3KSG A;  4JGR A;  1TD5 A;  2FH5 A;  3H7W A;  1OJ5 A;  4O01 A;  1JNU A;  2O9B A;  2G7U A;  3CUE C;  4HH3 A;  2V9A A;  3A0R A;  3C2W A;  2KX6 A;  3BQA A;  1UWP X;  2OAP 1;  3RFB A;  3E4Q A;  5HL6 A;  1NWZ A;  4IUK A;  1G6O A;  3F1P A;  3T4Q A;  4NXF A;  4HP9 A;  1OTE A;  4CLC A;  5F68 A;  2LB5 A;  3H7W B;  3UB7 A;  2VEA A;  3FG8 A;  5DKL A;  3B42 A;  3K3C A;  3GDI A;  3TRC A;  4HQA A;  2W1T A;  4L9E A;  5KSH A;  3KSH A;  3LFV A;  5EFW A;  4GS9 A;  4PKY A;  3T4L A;  4DN0 A;  3OCN A;  4DJ3 A;  1STZ A;  4Q0I A;  4JGP A;  3F1P B;  1DP9 A;  2O9A A;  4HJ4 A;  1P97 A;  1H8M A;  3MXQ A;  3V67 A;  4Q0J A;  5DJT A;  2K2N A;  3PHY A;  1IFQ A;  3UB9 A;  2VLG A;  4RQ9 A;  2PD7 A;  1TF1 A;  2W1T B;  2XA7 S;  3MFX A;  3LI9 A;  5MC7 A;  2VZW A;  4GS9 B;  5G4Y A;  2GNX A;  2YKH A;  3KYZ A;  3SW1 A;  4HOI A;  3IBR A;  4PHT A;  3BY9 A;  2WKR A;  3T4T A;  1P0Z A;  4OOM A;  3VV4 A;  4WF0 A;  3UME A;  4NXE A;  5HD3 A;  3EGX C;  3NJA A;  2YKF A;  1LL8 A;  2O0Y A;  3G6O A;  3PR6 A;  3BW6 A;  2J80 A;  2XRO A;  1OPX A;  3CUE A;  4JGO A;  3CAX A;  3VE3 A;  4EER A;  4KUO A;  1F98 A;  4UQI M;  2VA0 A;  3EEH A;  1GSV A;  3S7Q A;  3GEC A;  5HWV A;  1OTD A;  3D3O A;  1ZHH B;  3BJN A;  3PBN A;  4WEJ A;  2GJ3 A;  3H82 A;  1F5M A;  3A0S A;  2PHY A;  3MQ0 A;  2W3G A;  2WKP A;  3LR5 A;  4L9F A;  3H9W A;  2JN7 A;  4YNR A;  3UMD A;  3UB6 A;  4HNB A;  5KIZ A;  5AVE A;  2HV1 A;  4LRY C;  3PBQ A;  4EU0 A;  1W63 Q;  3TE8 A;  4BBU A;  4L9G A;  1W63 M;  3VE4 A;  1XJ6 A;  2Z6D A;  1NLY A;  2JHE A;  2VKS A;  1OTB A;  2P7J A;  2VV7 A;  3C30 A;  2Y8H A;  3H82 B;  3RTY A;  3S7N A;  1MC0 A;  4XT2 B;  3MMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...