2HZ5A

Crystal structure of human dynein light chain dnlc2a
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
87
Chain Sequence
EETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPYFLIVIQNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynein light chain 2A, cytoplasmic
publication title Crystal structure of human dynein light chain Dnlc2A: Structural insights into the interaction with IC74
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 19
structure length 87
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 2hz5A00
5EM0A 2V8FA 1CQAA 5EM1A 1FIKA 2BTFP 1SZVA 2V8CA 4ESPA 1F2KA 1SKOB 2PAVP 3KYEA 1Y4OA 4QWOA 1SKOA 2ZL1A 2PRFA 5FDSA 3D9YA 1D1JA 1FILA 3T1RA 3MSHA 3T1XA 1J3WA 3NULA 4D60A 1YPRA 3L9KA 4X25A 1VEUA 5FEFA 3L7HA 3LGOA 3MS6A 4X1LA 2ZL1B 1PRQA 2PBDP 3CPTA 1G5UA 1VETB 1PNEA 2JKFA 3UB5P 4FUWA 1VETA 1ACFA 3T1QB 2E8JA 5EVEA 1VEUB 2VK3A 4X1MA 3CPTB 3LEQA 5FEGA 1AWIA 1PFLA 1K0KA 5EV0A 2ACGA 3CHWP 2JKGA 3T1SA 1CF0A 1CJFA 3NECA 1A0KA 1Z09A 3U4LP 4FTXA 3T12B 3DAVA 2HZ5A 1HLUP 2B95A
chains in the Genus database with same CATH superfamily
2QJ7A 1E3UD 4GKUA 4KUOA 2XQZA 5A91A 3MKFA 4GCZA 3C30A 1ZG4A 3MQQA 4K0WA 4QWOA 2Y59A 4NG2A 4E3MA 4JPMA 3G34A 5FDSA 3ZHHA 4UA7A 1PYYA 3S7NA 4CPKA 5L10A 2XK1A 1JNUA 5DJUA 5HSQA 4LRXC 2PU2A 4H6JB 3UMEA 4Y3IA 5FA7A 2WKEA 5IU1A 1KE4A 3VP0A 2JC7A 5AVFA 3UB9A 1QMFA 3LYXA 4XT2B 1OJ5A 3E2LA 3A3FA 2ZD8A 3ISGA 4OP8A 2XR0A 4JBFA 1EI5A 4H8RA 1YLPA 1XXMA 3DTMA 4A5RA 5FAOA 4UQIM 4RQ9A 3CMZA 1SCWA 2GNXA 2INWA 3VFFA 3LCEA 3S22A 1K56A 1PFLA 2XDMA 2IWBA 5HWVA 1NLZA 5HZHA 1MKMA 1HTZA 3LR0A 1CJFA 1JWVA 1A0KA 4E6XA 4GD6A 4JXVA 4S2PA 4WMCA 3SW1A 3C5AA 3LICA 4S2KA 3JYIA 2VJWA 5E43A 1PI5A 3HL9A 4HBUA 2UWXA 3GSGA 4HIAA 3ITAA 1YAXA 2J8YA 3Q07A 4HJ3A 5DFXA 3GQZA 4GHIB 3R7WB 5JYOA 1GSWA 3GECA 5FAPA 2OWJA 1FQGA 3I7JA 3HREA 3G31A 1MPLA 1XA1A 4E6WA 2HDUA 4YWZA 4ZJ3A 1OTDA 2OAQ1 2PRFA 4S2OA 4IUKA 1BULA 1F9IA 2PT7A 3MSHA 4RX2A 2M7VA 1GCEA 4K91A 4N9KA 2OV5A 2HGVA 4LFUA 1CI9A 1CI8A 1MWTA 1FCNA 3SZTA 5F83A 1ONHA 3NBLA 4IJGA 3WWXA 5MC7A 4L0LA 4I38A 2Y2QA 4F3LB 2ZJ9A 3VP4A 3K2NA 5EVIC 4LRYC 1ES4A 5M1AA 3S7PA 2EX2A 3IXGA 4NK3A 2VZWA 2ZQDA 4B4XA 4R4SA 3OCNA 1K0KA 1BLHA 2HDRA 4E3IA 4HOIA 3G4PA 2ZBBA 3PBTA 3G2YA 2EA9A 3S4XA 4O7DA 1I2WA 2FZ0A 1YT4A 3VP1A 4ZJ1A 5HDSA 5I94A 3C2WA 5E2GA 4XUXA 1K25A 2B18A 2PYPA 2D01A 2V8FA 4NXBA 5F69A 2XGNA 2VX8A 1TS8A 4GHIA 1GA0A 1SZVA 2V8CA 3W4PA 2QKPA 3ZFZA 2W27A 3VE3A 4I39A 3T4TA 4HY8A 1M6KA 2KDKA 2VEAA 2WKIA 4S2NA 1BLPA 3CG5A 4R3BA 3PR6A 3MQOA 3UDFA 2W3FA 4EESA 4PM6A 5CTMA 1RCJA 4MBFA 3LIBA 5FSRA 3IH9A 1JTGA 3V3SA 3JVVA 4B9OA 1LLBA 5CHUA 4KZ8A 1H5XA 2G2UA 2ZM8A 4GOGA 4D2OA 4FSFA 3WS4A 1E3UA 4F3LA 1H0MA 1DY6A 4R38A 5I5LA 3PYPA 5J3WA 1L3LA 5E2HA 1NJ4A 1ZTUA 1N9LA 5EOOA 1F5MA 1KDWA 2O0YA 3CLOA 3DWZA 5LBRA 4EWFA 2X71A 4LGWA 3T1SA 3RFBA 4MN7A 3IXBA 1UWPX 1LT0A 4OQ0A 4FTXA 1YM1A 3EWKA 4PM8A 4R70A 1CK3A 1MBLA 1O7EA 4NEED 3Q7ZA 5EVID 2OAP1 4GW9A 3BFFA 4UHUA 3KO6A 3LFVA 3QP6A 3K3DA 3KSGA 4DMZA 2VGLS 2J7VA 2RL3A 4MDZA 1GA9A 3H82B 4HESA 2FFYA 2PD7A 3KX0X 3P09A 4OQHA 4MEZA 5TJJA 3M2JA 3HLGA 3VSKA 4DXCA 2ZC5B 4LCLA 2QZ6A 2A49A 4HJ6A 4D60A 3LIFA 2VLGA 1T1CA 1TEMA 2DCFA 2KLIA 1BYWA 4RA7A 2Q9NA 4IBXA 4JXSA 3IBJA 1STZA 3T4QA 5HWWA 4OOMA 1WYCA 3N8LA 5FQIA 1YLYA 4I3IA 1GHIA 3ZG5A 3DTEA 2V1BA 5C5KA 4WMCD 3H7WB 3UPPA 2Y2JA 2OOLA 4F94A 4RVAA 3SH8A 1S66L 3Q7VA 1YSQA 4MNRA 1P0ZA 1IFQA 3CITA 4QY5A 2ACGA 4L9EA 4JLFA 2DRWA 5BOHA 1XKZA 2G7UA 3O87A 1W63Q 5EUAA 1HVBA 4P6BA 1KDSA 3R4KA 3BY8A 1XJ6A 3EGDC 4OONA 4JXGA 1KVMA 4HH3A 4IBRA 2ZQ9A 2GZAA 2W0NA 1DRMA 4I3AA 1P97A 2W3HA 4DXBA 1YKDA 4QHCA 1GSVA 1K6RA 4XUZA 4L9FA 4P0MA 3BRMA 3HBRA 4I5SA 3H82A 4E3JA 4ZDXA 3N7WA 3CI6A 4BQMA 3MMHA 3D9YA 2M7UA 5KMWA 1QMEA 3A3EA 2Y2MA 5J8XA 1BZAA 2O9BA 2HPBA 3OPRA 2A24B 3L9KA 2Q9MA 3LGOA 5EVIB 5AVEA 2KX6A 1UGUA 2Y2PA 5D3OA 1ESIA 3BFEA 3ZVTA 2ZMFA 1VETB 4GDBA 4OLGA 2QWSA 3FWLA 1PIOA 2PBYA 3A3DA 4KZ6A 4JGPA 2W1RA 5FEGA 5J7EA 4KQRA 4QB8A 3ZG7B 1LI9A 3HJKA 3B33A 3CHWP 3HLFA 2R9WA 3WS2A 5L2FA 1C3BA 3U4LP 3V50A 4Y0TA 2BASA 4Y15A 5GHYA 1K54C 4JGRA 2PR5A 4KZAA 2HZ5A 2QHKA 1KGFA 5FQKA 2L0WA 3NOTC 3N6IA 1OT6A 5HX9A 2V1AA 4MN6A 1NY0A 1DP6A 5CGWA 3GMWA 1G68A 3PBNA 2HJ9C 4BWIA 5DF9A 5GLAA 3V39A 4WF0A 4KG2A 3MQ0A 4WZ4A 3C38A 3F1NA 2OLUA 1FILA 2V1ZA 3QP2A 3D72A 1YMSA 1BUEA 2ZOIA 2D02A 1ZHHB 1MWSA 1W8YA 1ODVA 1XX2A 2XFSA 2A24A 3NI9A 2O9CA 5FDHA 2XFTA 4EERA 5EVIA 3HUMA 3FZCA 3IX8A 5A90A 1W8QA 4X68A 4C75A 4R3JA 1XGIA 1VETA 3QP8A 1NZUA 1Z6FA 3VFHA 4CLCC 2QYBA 5KIZA 1PW8A 3LI8A 1Y28A 4X1MA 3T50A 4DN0A 3LIEA 3VMAA 3LI9A 5K5BA 3ZCZA 2O99A 2L1MA 3C4OA 4U3TA 4IVIA 5U47A 2JKGA 3G32A 4BLMA 3TOIA 2JKRM 3BW6A 5HL6A 3HJIA 3NECA 1OJGA 4DRTA 1U60A 2K2NA 2ZC6B 1XPBA 3UMDA 4S2LA 5G4ZA 2JBFA 5E2EA 1D06A 2LB9A 2XA7M 4DE2A 3T4LA 2Z6CA 5G4YA 2WKHA 3W4OA 4Q0JA 1FCMA 2XEPA 5IHVA 1KE0A 2W3EA 1TS0A 3MZFA 1NZOA 1I2SA 2VV8A 1K57A 2M1CA 3CWFA 2JKTI 1SKOB 3P98A 2EFXA 2YKHA 1N9OA 1HD8A 3GDIA 4BD1A 1YSPA 1SHVA 4OVDA 4EETB 2Y2KA 4GNUA 4FH4A 2HP6A 3FV7A 2WGWA 3VOYA 1PRQA 5JYPA 2XD1A 2B02A 5EFWA 4ETXA 3B42A 4MBKA 1G5UA 3NDGA 3CJMA 3D4FA 4ETZA 2JHEA 3FKWA 3SH7A 1IKGA 4EXOA 3O86A 4WEKA 5KSCA 3ZQ5A 4R3AA 2QMIA 5DKKA 3MJQA 5A8BA 4MLLA 1AWIA 4X55A 1OPXA 5CERA 3EEAA 3UB7A 3SS5A 3UY6A 4EBNA 5M19A 1EWZA 2VA0A 1YLWA 3DBAA 4L9GA 2Y2HA 4WEJA 4CLCD 3OPLA 3IT9A 4QJGA 3GRJA 5KZHA 3OZHA 4WBGA 3V67A 4Z9QA 1GHPA 3JPUA 1CQAA 3ZNYA 3IS2B 4EQ1A 3MFXA 1AXBA 1NWZA 4IUHA 1MXOA 4QU3A 4Z1WA 2C6WB 3W2ZA 5F6AA 1SKOA 5GLBA 1TVFA 5FATA 2ZL1A 3IXDA 1K6SA 1JWZA 1XGJA 3QP4A 1T18A 3C8CA 5HDDA 4DE1A 2HDSA 3LY4A 3B3XA 4Q0IA 1IYQA 3C4PA 2EWVA 4X1LA 4N1XA 2VV6A 4KENB 3ZGAB 3HLCA 3CPTA 4JKTA 3WRTA 5FI7A 2XLNA 3BQAA 3LO7A 4EUZA 1K57C 2ZLYA 3E0YA 3P7NA 3T1QB 2QPNA 4NXFA 3UDIA 2UV0E 4B93A 2Z6DA 4PKYA 1IYOA 4OH0A 1LSWA 2Y2OA 1Y54A 4I3JA 1KVLA 3FC7A 3DTKA 1BTLA 2J9PA 2XRNA 3M6BA 3F1PB 5FQ9A 4JF4A 3N8RA 1L0DA 1OTBA 3PAEA 1NLYA 2Z2MB 4HP9A 3BM6A 3T12B 4JF6A 5FQJA 3Q7VB 1KGEA 3ITBA 4XXRA 3IWIA 1H8ZA 3RXWA 5AQBA 4KZ9A 5CXWA 3IF5A 2Q0OA 3G35A 1S1ZA 4S2MA 5DVAA 3RJUA 1TDLA 3ZYTA 5EM1A 1I5QA 4MCWA 4ARZB 3MXRA 3IS2A 3ULFA 4ESPA 3EGXC 1ERQA 4EBLA 4KZBA 1S4RA 5IS1A 1PWGA 2ZQAA 2V9AA 4E3OA 2NUPC 2J3TC 4KQOA 4YINA 4P85A 3TE8A 1N9NA 1RGZA 2P9VA 1TDGA 4BBVA 1J3WA 5HPFA 3C7UA 3HLEA 1YPRA 4NXGA 2H0YA 2W1TB 4X69A 1V9YA 2JCHA 3E4PA 3NOUC 1YLTA 1OT9A 4N92A 4OKPA 4P6ZS 4CLCB 1T1BA 4LPZA 2WGVA 3FPWA 1LL5A 1TF1A 4EEUA 4MN5A 4BJPA 1ES3A 4CLCE 4DDSA 4M4XA 3W4QA 3ZG0A 2VKSA 3WS0A 2E8JA 3E4QA 3BLMA 1FR6A 2GX5A 1XP4A 3T4OA 2I72A 3LEQA 3Q82A 4GS9B 2PYRA 1JVJA 1TS7A 4RYEA 4BL2A 5FI2A 3BJNA 1K54A 3F1PA 1SDNA 1PZPA 2Y2LA 4C3QA 5DJTA 3TG9A 1XFNA 2WUQA 3HVFA 5L07A 4R23A 3OLOA 4DDYA 5EM0A 1NYYA 2P04A 2JE5A 5HPIA 4U0TA 2EX8A 4MBHA 2EWWA 1VB6A 5DF7A 4ARZA 1F2KA 2Y8HA 5HD5A 4WELA 1Y4OA 3E2KA 1JWPA 1H8YA 2XSSA 4R6LA 2WYXA 4FD8A 2Y79A 4M3KA 2H10A 3MXSA 3ZDJA 2EXAA 4HEFA 1E4DA 4OQGA 5AQAA 5F1GA 3BY9A 2W1TA 3IF6C 3H9WA 4CLCA 1T19A 3UO9A 5G18A 3F1NB 2PU4A 3MZEA 5HD3A 3TRCA 2V0WA 4K08A 2H28A 3T4JA 3V3RA 3BEBA 4FUWA 1ACFA 4HBTA 3F1OB 5E2FA 3VOZA 3U2AA 4EUVA 2J3TD 4JGOA 2ZOHA 3IHAA 4GN2A 4OOYA 2PR6A 4UQIS 4LLOB 3PTEA 1J9MA 4O8GA 2EX9A 4GS9A 3HLBA 3ZVWA 3FKVA 5J4EA 2L4RA 4Y2FA 1DJCA 1CF0A 5GL9A 1Z09A 4Y7PA 1XJ4A 3ICYA 2IWCA 3IX4A 3IWQA 1MWRA 2ZQ7A 2DMWA 5CGSA 1EROA 3FG8A 2VGLM 3BFGA 4IVKA 2LB5A 5CRFA 1V9ZA 2G2WA 1FIKA 3KYQA 1BLSA 2GDNA 1ERMA 4BBUA 4E3KA 2PAVP 2WGIA 3QHYA 4WYYA 3M6HA 5CHJA 1OMEA 1ZG6A 1O07A 3W8KA 2K7SA 3HUOA 1KE3A 4EU0A 4IEDA 5EVLA 1E25A 3K3CA 3Q81A 1KOUA 4GDNA 1YQSA 3QNCA 5FI6A 1K55A 5FASA 1X0OA 2WK0A 1WA9A 3A3IA 4IHQA 2Y4AA 1ES2A 2PBDP 4OPRA 3LY3A 4HJ4A 4ZJ2A 3MBZA 3NIAA 1P9RA 3CAXA 1MZUA 4HNBA 4KZ4A 4B4ZA 5F82A 4X6TA 1VM1A 2MJ6A 3BWLA 4Y0OA 3UB8A 2WGWB 3F1OA 2VK3A 2WKRA 3G6OA 5HDCA 4YFMA 4WLAA 1TS6A 3GVBA 4FH2A 2XD5A 3VP2A 2H0TA 3PBRA 2YKFA 1MWUA 2WADA 1LI0A 1ONGA 4DJ2A 2ZC4B 2HP5A 5L09A 5GLDA 5KSHA 3S1YA 4LV1A 2H5SA 5DF8A 1YLJA 2Z2LB 4C6YA 4UEYA 4E3LA 3SS3A 2DNSA 4PM9A 2VV7A 2EXBA 3B47A 4QY6A 3OCLA 1YLZA 3SH9A 3BECA 4X53A 3BFCA 5AQ9A 1WYBA 4AFIA 5F5YA 2WZXA 4X56A 3HLDA 4GLQA 4DKIA 3A0VA 4E3NA 3PBOA 2ZMAA 2CMNA 3RTYA 5CHMA 4EBPA 5HAPA 2JKTM 1N4OA 1L0EA 3RH8B 3OBFA 3NULA 3QP1A 4FOFA 1S0WA 1G6OA 1FR1A 1VEUA 2JKRI 2ZL1B 1MC0A 3NC8A 1ZKJA 4G3KA 2B5RA 3OC2A 3S7QA 5L8MA 1XJ2A 3OPPA 4DE0A 3IXHA 3TJZC 5EVEA 3KSHA 4UA6A 2HF6A 3MR0A 3CPTB 3BLSA 4G3WA 1XA7A 5EV0A 1IELA 3CZDA 1K55C 1SKFA 3HLWA 2BG1A 4KQQA 5CECA 3T4SA 2W3DA 1H8MA 2ZQCA 2P74A 4OPQA 1TD5A 4LRZE 4ID4A 3DW0A 3FYZA 5HW3A 3MZDA 3MKEA 5EE8A 4Q0HA 4ZAMA 4GZBA 5EOEA 3VP3A 2OLVA 3Q1FA 2EX6A 4LCMA 1JTDA 4HI4A 4ZRRA 1Q2PA 4NKPA 3BFDA 4BMWA 4KZ3A 4Q8IA 2BTFP 5HFOA 2P08A 4H6JA 3QNBA 3IX3A 3UE1A 1K4EA 4CQHA 5FQQA 4XT2A 4S2JA 1NRFA 1IYPA 3IF6B 1IYSA 3T1RA 3UNWA 1S4SA 3T1XA 5CTNA 4E04A 5GLCA 4NXEA 3WS1A 4MMNA 3HCYA 3L7HA 1DJBA 4OPZA 3A0SA 3M2KA 2Y91A 5HAQA 4P87A 1PNEA 2JKFA 1LL8A 2P9VB 1N9BA 2AVXA 1D7EA 1ESUA 4O01A 2OSUA 3NCKA 4PKYG 3P01A 1GHMA 4JGQA 3SOIA 4DF6A 2R78A 4ME4A 1FCOA 1IEMA 4Y5FA 5A92A 3HUNA 1IKIA 2HDQA 4DJ3A 4KZ7A 1VHMA 4YOFA 1ALQA 5HARA 3EOIA 2A2LA 3IQAA 2PHYA 1OTAA 1WE4A 2PD8A 1NYMA 2K31A 4KG5A 2J80A 5FAQA 4II7A 5CGXA 2XROA 5F68A 3R7WA 2RCXA 4GD8A 5GHZA 3DAVA 1RGYA 2OWHA 2O9AA 5HWTA 3IWOA 1HLUP 2FFFB 2HV1A 3KSFA 2WKQA 4WZ5A 4KG6A 1PI4A 3OOVA 3IBRA 4RX3A 3KYZA 4EV4A 3AGEA 3RXXA 3C7VA 3WRZA 1L0GA 2X02A 5IT5A 3UE0A 1L0FA 2XF3A 2V0UA 2BLSA 1DP8A 3G2ZA 1CEGA 1K4FA 3DTIA 1OTEA 3N4IA 3SS4A 1FSYA 4ZBEA 3IF6A 2E8IA 4N9LA 4CJNA 4EEPA 5FEFA 3PBSA 3EQUA 4R1GA 3E4OA 4KUKA 1RP5A 1NRJA 3OPHA 3IHBA 3JVUA 5GHXA 1PW1A 4Y17A 5DFYA 1ES5A 4R4RA 1CEFA 2GJ3A 4BENA 3MFDA 2FH5A 1F98A 4FCFA 4DE3A 1S1YA 2A3UA 4BL3A 1T1AA 3LUQA 3GV9A 2W3GA 2J9OA 3NDEA 1M40A 3NOPC 4K0XA 4LV3A 4Y0UA 1KGGA 3DWKA 4N1HA 4OP5A 3NHQA 3ZG8B 2R9XA 3A0RA 4PMAA 2WAEA 2P7JA 4U0XA 2B95A 1DJAA 3PBQA 3VSLA 2IA2A 3UDXA 1BT5A 2HJEA 2JN7A 5EPHA 3LR4A 3AGFA 3ZG9B 2IWDA 2XH9A 5M18A 1K56D 1YMXA 2QJ5A 2EFUA 2WZZA 3UN7A 5A93A 1HZOA 1FSWA 5DTTA 3ZNTA 1DP9A 4YNRA 3VE4A 3O5YA 4JXWA 1S67L 4PAUA 2ZMVA 5AQ7A 1Q2QA 4GB7A 4S2NC 3MF0A 4WZ5C 4X25A 3PAGA 1W63M 1NXYA 2C5WB 3CUEA 3MS6A 2V2FF 3UE6A 4LV0A 4PM7A 1LSVA 2VGJA 2ZM0A 2PDRA 3KSIA 4NETA 1LL9A 3E98A 3AGDA 4WUJA 3UB5P 2Y2NA 3FPVA 4EW7A 3UPNA 4UAAA 5HL1A 3LR5A 1SDEA 2ZQ8A 4OQIA 3A3JA 3LEZA 1XJ3A 1P9WA 3NY4A 1IOUA 1K38A 4WN5A 2ZC3B 4ZTKA 1PWCA 5TBMB 3MXQA 3PHYA 1W5DA 3GTCA 4JF5A 3EEHA 4LV2A 5TR7A 3EQVA 2WAFA 2CC1A 3GR2A 2Y2GA 1W7FA 3S7OA 2X01A 1BLCA 3NJAA 4O0PA 4WM9A 1MY8A 1H3QA 4QPRA 5CEDA 1ZC2A 5EECA 5FQMA 4GJ4A 5TGFA 5TFQA 1LHYA 3VOLA 3BYDA 4BD0A 1MKIA 3N8SA 3LIAA 4B88A 2XA7S 2I9VA 2WKPA 2VGKA 1L2SA 4BBTA 2Y2IA 3PXPA 5F1FA 4OPYA 5DKLA 4OOLA 3UB6A 3KYEA 3V5MA 5DTSA 4HHDA 5AJGA 4S2IA 4OLDA 5CEBA 1D1JA 5HAIA 3UE3A 4HH2A 1PZOA 2Y55A 3QP5A 3H7WA 4P6ZM 3T4KA 1OTIA 3IH8A 5CX7A 3VV4A 5FL3A 4UA9A 4WL9A 3G30A 2ZC7A 4HQAA 4PM5A 4EQIA 4Y13A 1XFQA 1VQQA 4PHTA 3WS5A 1VEUB 1BSGA 2NUTC 2V20A 1LSXA 1EW0A 4LENA 2KOIA 3LIDA 1G6AA 2HP9A 5TBMA 1S6RA 1UWNX 1GSXA 3UPOA 1W79A 2J3WA 3BQ8A 4HP4A 5DTKA 3CUEC 3TW8A 3O88A 4PPRA 4QD4A 3O3VA 3LR3A 1PWDA 3TSGA 2ZM2A 4KZ5A 1FOFA 4KQDA 4R0QA 4G3VA 3D3OA 1G28A
chains in the Genus database with same CATH topology
5EM0A 2V8FA 1CQAA 5EM1A 1FIKA 2BTFP 1SZVA 2V8CA 4ESPA 1F2KA 1SKOB 2PAVP 3KYEA 1Y4OA 4QWOA 1SKOA 2ZL1A 2PRFA 5FDSA 3D9YA 1D1JA 1FILA 3T1RA 3MSHA 3T1XA 1J3WA 3NULA 4D60A 1YPRA 3L9KA 4X25A 1VEUA 5FEFA 3L7HA 3LGOA 3MS6A 4X1LA 2ZL1B 1PRQA 2PBDP 3CPTA 1G5UA 1VETB 1PNEA 2JKFA 3UB5P 4FUWA 1VETA 1ACFA 3T1QB 2E8JA 5EVEA 1VEUB 2VK3A 4X1MA 3CPTB 3LEQA 5FEGA 1AWIA 1PFLA 1K0KA 5EV0A 2ACGA 3CHWP 2JKGA 3T1SA 1CF0A 1CJFA 3NECA 1A0KA 1Z09A 3U4LP 4FTXA 3T12B 3DAVA 2HZ5A 1HLUP 2B95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EM0 A;  2V8F A;  1CQA A;  5EM1 A;  1FIK A;  2BTF P;  1SZV A;  2V8C A;  4ESP A;  1F2K A;  1SKO B;  2PAV P;  3KYE A;  1Y4O A;  4QWO A;  1SKO A;  2ZL1 A;  2PRF A;  5FDS A;  3D9Y A;  1D1J A;  1FIL A;  3T1R A;  3MSH A;  3T1X A;  1J3W A;  3NUL A;  4D60 A;  1YPR A;  3L9K A;  4X25 A;  1VEU A;  5FEF A;  3L7H A;  3LGO A;  3MS6 A;  4X1L A;  2ZL1 B;  1PRQ A;  2PBD P;  3CPT A;  1G5U A;  1VET B;  1PNE A;  2JKF A;  3UB5 P;  4FUW A;  1VET A;  1ACF A;  3T1Q B;  2E8J A;  5EVE A;  1VEU B;  2VK3 A;  4X1M A;  3CPT B;  3LEQ A;  5FEG A;  1AWI A;  1PFL A;  1K0K A;  5EV0 A;  2ACG A;  3CHW P;  2JKG A;  3T1S A;  1CF0 A;  1CJF A;  3NEC A;  1A0K A;  1Z09 A;  3U4L P;  4FTX A;  3T12 B;  3DAV A;  2HZ5 A;  1HLU P;  2B95 A; 
#chains in the Genus database with same CATH topology
 2QJ7 A;  1E3U D;  4GKU A;  4KUO A;  2XQZ A;  5A91 A;  3MKF A;  4GCZ A;  3C30 A;  1ZG4 A;  3MQQ A;  4K0W A;  4QWO A;  2Y59 A;  4NG2 A;  4E3M A;  4JPM A;  3G34 A;  5FDS A;  3ZHH A;  4UA7 A;  1PYY A;  3S7N A;  4CPK A;  5L10 A;  2XK1 A;  1JNU A;  5DJU A;  5HSQ A;  4LRX C;  2PU2 A;  4H6J B;  3UME A;  4Y3I A;  5FA7 A;  2WKE A;  5IU1 A;  1KE4 A;  3VP0 A;  2JC7 A;  5AVF A;  3UB9 A;  1QMF A;  3LYX A;  4XT2 B;  1OJ5 A;  3E2L A;  3A3F A;  2ZD8 A;  3ISG A;  4OP8 A;  2XR0 A;  4JBF A;  1EI5 A;  4H8R A;  1YLP A;  1XXM A;  3DTM A;  4A5R A;  5FAO A;  4UQI M;  4RQ9 A;  3CMZ A;  1SCW A;  2GNX A;  2INW A;  3VFF A;  3LCE A;  3S22 A;  1K56 A;  1PFL A;  2XDM A;  2IWB A;  5HWV A;  1NLZ A;  5HZH A;  1MKM A;  1HTZ A;  3LR0 A;  1CJF A;  1JWV A;  1A0K A;  4E6X A;  4GD6 A;  4JXV A;  4S2P A;  4WMC A;  3SW1 A;  3C5A A;  3LIC A;  4S2K A;  3JYI A;  2VJW A;  5E43 A;  1PI5 A;  3HL9 A;  4HBU A;  2UWX A;  3GSG A;  4HIA A;  3ITA A;  1YAX A;  2J8Y A;  3Q07 A;  4HJ3 A;  5DFX A;  3GQZ A;  4GHI B;  3R7W B;  5JYO A;  1GSW A;  3GEC A;  5FAP A;  2OWJ A;  1FQG A;  3I7J A;  3HRE A;  3G31 A;  1MPL A;  1XA1 A;  4E6W A;  2HDU A;  4YWZ A;  4ZJ3 A;  1OTD A;  2OAQ 1;  2PRF A;  4S2O A;  4IUK A;  1BUL A;  1F9I A;  2PT7 A;  3MSH A;  4RX2 A;  2M7V A;  1GCE A;  4K91 A;  4N9K A;  2OV5 A;  2HGV A;  4LFU A;  1CI9 A;  1CI8 A;  1MWT A;  1FCN A;  3SZT A;  5F83 A;  1ONH A;  3NBL A;  4IJG A;  3WWX A;  5MC7 A;  4L0L A;  4I38 A;  2Y2Q A;  4F3L B;  2ZJ9 A;  3VP4 A;  3K2N A;  5EVI C;  4LRY C;  1ES4 A;  5M1A A;  3S7P A;  2EX2 A;  3IXG A;  4NK3 A;  2VZW A;  2ZQD A;  4B4X A;  4R4S A;  3OCN A;  1K0K A;  1BLH A;  2HDR A;  4E3I A;  4HOI A;  3G4P A;  2ZBB A;  3PBT A;  3G2Y A;  2EA9 A;  3S4X A;  4O7D A;  1I2W A;  2FZ0 A;  1YT4 A;  3VP1 A;  4ZJ1 A;  5HDS A;  5I94 A;  3C2W A;  5E2G A;  4XUX A;  1K25 A;  2B18 A;  2PYP A;  2D01 A;  2V8F A;  4NXB A;  5F69 A;  2XGN A;  2VX8 A;  1TS8 A;  4GHI A;  1GA0 A;  1SZV A;  2V8C A;  3W4P A;  2QKP A;  3ZFZ A;  2W27 A;  3VE3 A;  4I39 A;  3T4T A;  4HY8 A;  1M6K A;  2KDK A;  2VEA A;  2WKI A;  4S2N A;  1BLP A;  3CG5 A;  4R3B A;  3PR6 A;  3MQO A;  3UDF A;  2W3F A;  4EES A;  4PM6 A;  5CTM A;  1RCJ A;  4MBF A;  3LIB A;  5FSR A;  3IH9 A;  1JTG A;  3V3S A;  3JVV A;  4B9O A;  1LLB A;  5CHU A;  4KZ8 A;  1H5X A;  2G2U A;  2ZM8 A;  4GOG A;  4D2O A;  4FSF A;  3WS4 A;  1E3U A;  4F3L A;  1H0M A;  1DY6 A;  4R38 A;  5I5L A;  3PYP A;  5J3W A;  1L3L A;  5E2H A;  1NJ4 A;  1ZTU A;  1N9L A;  5EOO A;  1F5M A;  1KDW A;  2O0Y A;  3CLO A;  3DWZ A;  5LBR A;  4EWF A;  2X71 A;  4LGW A;  3T1S A;  3RFB A;  4MN7 A;  3IXB A;  1UWP X;  1LT0 A;  4OQ0 A;  4FTX A;  1YM1 A;  3EWK A;  4PM8 A;  4R70 A;  1CK3 A;  1MBL A;  1O7E A;  4NEE D;  3Q7Z A;  5EVI D;  2OAP 1;  4GW9 A;  3BFF A;  4UHU A;  3KO6 A;  3LFV A;  3QP6 A;  3K3D A;  3KSG A;  4DMZ A;  2VGL S;  2J7V A;  2RL3 A;  4MDZ A;  1GA9 A;  3H82 B;  4HES A;  2FFY A;  2PD7 A;  3KX0 X;  3P09 A;  4OQH A;  4MEZ A;  5TJJ A;  3M2J A;  3HLG A;  3VSK A;  4DXC A;  2ZC5 B;  4LCL A;  2QZ6 A;  2A49 A;  4HJ6 A;  4D60 A;  3LIF A;  2VLG A;  1T1C A;  1TEM A;  2DCF A;  2KLI A;  1BYW A;  4RA7 A;  2Q9N A;  4IBX A;  4JXS A;  3IBJ A;  1STZ A;  3T4Q A;  5HWW A;  4OOM A;  1WYC A;  3N8L A;  5FQI A;  1YLY A;  4I3I A;  1GHI A;  3ZG5 A;  3DTE A;  2V1B A;  5C5K A;  4WMC D;  3H7W B;  3UPP A;  2Y2J A;  2OOL A;  4F94 A;  4RVA A;  3SH8 A;  1S66 L;  3Q7V A;  1YSQ A;  4MNR A;  1P0Z A;  1IFQ A;  3CIT A;  4QY5 A;  2ACG A;  4L9E A;  4JLF A;  2DRW A;  5BOH A;  1XKZ A;  2G7U A;  3O87 A;  1W63 Q;  5EUA A;  1HVB A;  4P6B A;  1KDS A;  3R4K A;  3BY8 A;  1XJ6 A;  3EGD C;  4OON A;  4JXG A;  1KVM A;  4HH3 A;  4IBR A;  2ZQ9 A;  2GZA A;  2W0N A;  1DRM A;  4I3A A;  1P97 A;  2W3H A;  4DXB A;  1YKD A;  4QHC A;  1GSV A;  1K6R A;  4XUZ A;  4L9F A;  4P0M A;  3BRM A;  3HBR A;  4I5S A;  3H82 A;  4E3J A;  4ZDX A;  3N7W A;  3CI6 A;  4BQM A;  3MMH A;  3D9Y A;  2M7U A;  5KMW A;  1QME A;  3A3E A;  2Y2M A;  5J8X A;  1BZA A;  2O9B A;  2HPB A;  3OPR A;  2A24 B;  3L9K A;  2Q9M A;  3LGO A;  5EVI B;  5AVE A;  2KX6 A;  1UGU A;  2Y2P A;  5D3O A;  1ESI A;  3BFE A;  3ZVT A;  2ZMF A;  1VET B;  4GDB A;  4OLG A;  2QWS A;  3FWL A;  1PIO A;  2PBY A;  3A3D A;  4KZ6 A;  4JGP A;  2W1R A;  5FEG A;  5J7E A;  4KQR A;  4QB8 A;  3ZG7 B;  1LI9 A;  3HJK A;  3B33 A;  3CHW P;  3HLF A;  2R9W A;  3WS2 A;  5L2F A;  1C3B A;  3U4L P;  3V50 A;  4Y0T A;  2BAS A;  4Y15 A;  5GHY A;  1K54 C;  4JGR A;  2PR5 A;  4KZA A;  2HZ5 A;  2QHK A;  1KGF A;  5FQK A;  2L0W A;  3NOT C;  3N6I A;  1OT6 A;  5HX9 A;  2V1A A;  4MN6 A;  1NY0 A;  1DP6 A;  5CGW A;  3GMW A;  1G68 A;  3PBN A;  2HJ9 C;  4BWI A;  5DF9 A;  5GLA A;  3V39 A;  4WF0 A;  4KG2 A;  3MQ0 A;  4WZ4 A;  3C38 A;  3F1N A;  2OLU A;  1FIL A;  2V1Z A;  3QP2 A;  3D72 A;  1YMS A;  1BUE A;  2ZOI A;  2D02 A;  1ZHH B;  1MWS A;  1W8Y A;  1ODV A;  1XX2 A;  2XFS A;  2A24 A;  3NI9 A;  2O9C A;  5FDH A;  2XFT A;  4EER A;  5EVI A;  3HUM A;  3FZC A;  3IX8 A;  5A90 A;  1W8Q A;  4X68 A;  4C75 A;  4R3J A;  1XGI A;  1VET A;  3QP8 A;  1NZU A;  1Z6F A;  3VFH A;  4CLC C;  2QYB A;  5KIZ A;  1PW8 A;  3LI8 A;  1Y28 A;  4X1M A;  3T50 A;  4DN0 A;  3LIE A;  3VMA A;  3LI9 A;  5K5B A;  3ZCZ A;  2O99 A;  2L1M A;  3C4O A;  4U3T A;  4IVI A;  5U47 A;  2JKG A;  3G32 A;  4BLM A;  3TOI A;  2JKR M;  3BW6 A;  5HL6 A;  3HJI A;  3NEC A;  1OJG A;  4DRT A;  1U60 A;  2K2N A;  2ZC6 B;  1XPB A;  3UMD A;  4S2L A;  5G4Z A;  2JBF A;  5E2E A;  1D06 A;  2LB9 A;  2XA7 M;  4DE2 A;  3T4L A;  2Z6C A;  5G4Y A;  2WKH A;  3W4O A;  4Q0J A;  1FCM A;  2XEP A;  5IHV A;  1KE0 A;  2W3E A;  1TS0 A;  3MZF A;  1NZO A;  1I2S A;  2VV8 A;  1K57 A;  2M1C A;  3CWF A;  2JKT I;  1SKO B;  3P98 A;  2EFX A;  2YKH A;  1N9O A;  1HD8 A;  3GDI A;  4BD1 A;  1YSP A;  1SHV A;  4OVD A;  4EET B;  2Y2K A;  4GNU A;  4FH4 A;  2HP6 A;  3FV7 A;  2WGW A;  3VOY A;  1PRQ A;  5JYP A;  2XD1 A;  2B02 A;  5EFW A;  4ETX A;  3B42 A;  4MBK A;  1G5U A;  3NDG A;  3CJM A;  3D4F A;  4ETZ A;  2JHE A;  3FKW A;  3SH7 A;  1IKG A;  4EXO A;  3O86 A;  4WEK A;  5KSC A;  3ZQ5 A;  4R3A A;  2QMI A;  5DKK A;  3MJQ A;  5A8B A;  4MLL A;  1AWI A;  4X55 A;  1OPX A;  5CER A;  3EEA A;  3UB7 A;  3SS5 A;  3UY6 A;  4EBN A;  5M19 A;  1EWZ A;  2VA0 A;  1YLW A;  3DBA A;  4L9G A;  2Y2H A;  4WEJ A;  4CLC D;  3OPL A;  3IT9 A;  4QJG A;  3GRJ A;  5KZH A;  3OZH A;  4WBG A;  3V67 A;  4Z9Q A;  1GHP A;  3JPU A;  1CQA A;  3ZNY A;  3IS2 B;  4EQ1 A;  3MFX A;  1AXB A;  1NWZ A;  4IUH A;  1MXO A;  4QU3 A;  4Z1W A;  2C6W B;  3W2Z A;  5F6A A;  1SKO A;  5GLB A;  1TVF A;  5FAT A;  2ZL1 A;  3IXD A;  1K6S A;  1JWZ A;  1XGJ A;  3QP4 A;  1T18 A;  3C8C A;  5HDD A;  4DE1 A;  2HDS A;  3LY4 A;  3B3X A;  4Q0I A;  1IYQ A;  3C4P A;  2EWV A;  4X1L A;  4N1X A;  2VV6 A;  4KEN B;  3ZGA B;  3HLC A;  3CPT A;  4JKT A;  3WRT A;  5FI7 A;  2XLN A;  3BQA A;  3LO7 A;  4EUZ A;  1K57 C;  2ZLY A;  3E0Y A;  3P7N A;  3T1Q B;  2QPN A;  4NXF A;  3UDI A;  2UV0 E;  4B93 A;  2Z6D A;  4PKY A;  1IYO A;  4OH0 A;  1LSW A;  2Y2O A;  1Y54 A;  4I3J A;  1KVL A;  3FC7 A;  3DTK A;  1BTL A;  2J9P A;  2XRN A;  3M6B A;  3F1P B;  5FQ9 A;  4JF4 A;  3N8R A;  1L0D A;  1OTB A;  3PAE A;  1NLY A;  2Z2M B;  4HP9 A;  3BM6 A;  3T12 B;  4JF6 A;  5FQJ A;  3Q7V B;  1KGE A;  3ITB A;  4XXR A;  3IWI A;  1H8Z A;  3RXW A;  5AQB A;  4KZ9 A;  5CXW A;  3IF5 A;  2Q0O A;  3G35 A;  1S1Z A;  4S2M A;  5DVA A;  3RJU A;  1TDL A;  3ZYT A;  5EM1 A;  1I5Q A;  4MCW A;  4ARZ B;  3MXR A;  3IS2 A;  3ULF A;  4ESP A;  3EGX C;  1ERQ A;  4EBL A;  4KZB A;  1S4R A;  5IS1 A;  1PWG A;  2ZQA A;  2V9A A;  4E3O A;  2NUP C;  2J3T C;  4KQO A;  4YIN A;  4P85 A;  3TE8 A;  1N9N A;  1RGZ A;  2P9V A;  1TDG A;  4BBV A;  1J3W A;  5HPF A;  3C7U A;  3HLE A;  1YPR A;  4NXG A;  2H0Y A;  2W1T B;  4X69 A;  1V9Y A;  2JCH A;  3E4P A;  3NOU C;  1YLT A;  1OT9 A;  4N92 A;  4OKP A;  4P6Z S;  4CLC B;  1T1B A;  4LPZ A;  2WGV A;  3FPW A;  1LL5 A;  1TF1 A;  4EEU A;  4MN5 A;  4BJP A;  1ES3 A;  4CLC E;  4DDS A;  4M4X A;  3W4Q A;  3ZG0 A;  2VKS A;  3WS0 A;  2E8J A;  3E4Q A;  3BLM A;  1FR6 A;  2GX5 A;  1XP4 A;  3T4O A;  2I72 A;  3LEQ A;  3Q82 A;  4GS9 B;  2PYR A;  1JVJ A;  1TS7 A;  4RYE A;  4BL2 A;  5FI2 A;  3BJN A;  1K54 A;  3F1P A;  1SDN A;  1PZP A;  2Y2L A;  4C3Q A;  5DJT A;  3TG9 A;  1XFN A;  2WUQ A;  3HVF A;  5L07 A;  4R23 A;  3OLO A;  4DDY A;  5EM0 A;  1NYY A;  2P04 A;  2JE5 A;  5HPI A;  4U0T A;  2EX8 A;  4MBH A;  2EWW A;  1VB6 A;  5DF7 A;  4ARZ A;  1F2K A;  2Y8H A;  5HD5 A;  4WEL A;  1Y4O A;  3E2K A;  1JWP A;  1H8Y A;  2XSS A;  4R6L A;  2WYX A;  4FD8 A;  2Y79 A;  4M3K A;  2H10 A;  3MXS A;  3ZDJ A;  2EXA A;  4HEF A;  1E4D A;  4OQG A;  5AQA A;  5F1G A;  3BY9 A;  2W1T A;  3IF6 C;  3H9W A;  4CLC A;  1T19 A;  3UO9 A;  5G18 A;  3F1N B;  2PU4 A;  3MZE A;  5HD3 A;  3TRC A;  2V0W A;  4K08 A;  2H28 A;  3T4J A;  3V3R A;  3BEB A;  4FUW A;  1ACF A;  4HBT A;  3F1O B;  5E2F A;  3VOZ A;  3U2A A;  4EUV A;  2J3T D;  4JGO A;  2ZOH A;  3IHA A;  4GN2 A;  4OOY A;  2PR6 A;  4UQI S;  4LLO B;  3PTE A;  1J9M A;  4O8G A;  2EX9 A;  4GS9 A;  3HLB A;  3ZVW A;  3FKV A;  5J4E A;  2L4R A;  4Y2F A;  1DJC A;  1CF0 A;  5GL9 A;  1Z09 A;  4Y7P A;  1XJ4 A;  3ICY A;  2IWC A;  3IX4 A;  3IWQ A;  1MWR A;  2ZQ7 A;  2DMW A;  5CGS A;  1ERO A;  3FG8 A;  2VGL M;  3BFG A;  4IVK A;  2LB5 A;  5CRF A;  1V9Z A;  2G2W A;  1FIK A;  3KYQ A;  1BLS A;  2GDN A;  1ERM A;  4BBU A;  4E3K A;  2PAV P;  2WGI A;  3QHY A;  4WYY A;  3M6H A;  5CHJ A;  1OME A;  1ZG6 A;  1O07 A;  3W8K A;  2K7S A;  3HUO A;  1KE3 A;  4EU0 A;  4IED A;  5EVL A;  1E25 A;  3K3C A;  3Q81 A;  1KOU A;  4GDN A;  1YQS A;  3QNC A;  5FI6 A;  1K55 A;  5FAS A;  1X0O A;  2WK0 A;  1WA9 A;  3A3I A;  4IHQ A;  2Y4A A;  1ES2 A;  2PBD P;  4OPR A;  3LY3 A;  4HJ4 A;  4ZJ2 A;  3MBZ A;  3NIA A;  1P9R A;  3CAX A;  1MZU A;  4HNB A;  4KZ4 A;  4B4Z A;  5F82 A;  4X6T A;  1VM1 A;  2MJ6 A;  3BWL A;  4Y0O A;  3UB8 A;  2WGW B;  3F1O A;  2VK3 A;  2WKR A;  3G6O A;  5HDC A;  4YFM A;  4WLA A;  1TS6 A;  3GVB A;  4FH2 A;  2XD5 A;  3VP2 A;  2H0T A;  3PBR A;  2YKF A;  1MWU A;  2WAD A;  1LI0 A;  1ONG A;  4DJ2 A;  2ZC4 B;  2HP5 A;  5L09 A;  5GLD A;  5KSH A;  3S1Y A;  4LV1 A;  2H5S A;  5DF8 A;  1YLJ A;  2Z2L B;  4C6Y A;  4UEY A;  4E3L A;  3SS3 A;  2DNS A;  4PM9 A;  2VV7 A;  2EXB A;  3B47 A;  4QY6 A;  3OCL A;  1YLZ A;  3SH9 A;  3BEC A;  4X53 A;  3BFC A;  5AQ9 A;  1WYB A;  4AFI A;  5F5Y A;  2WZX A;  4X56 A;  3HLD A;  4GLQ A;  4DKI A;  3A0V A;  4E3N A;  3PBO A;  2ZMA A;  2CMN A;  3RTY A;  5CHM A;  4EBP A;  5HAP A;  2JKT M;  1N4O A;  1L0E A;  3RH8 B;  3OBF A;  3NUL A;  3QP1 A;  4FOF A;  1S0W A;  1G6O A;  1FR1 A;  1VEU A;  2JKR I;  2ZL1 B;  1MC0 A;  3NC8 A;  1ZKJ A;  4G3K A;  2B5R A;  3OC2 A;  3S7Q A;  5L8M A;  1XJ2 A;  3OPP A;  4DE0 A;  3IXH A;  3TJZ C;  5EVE A;  3KSH A;  4UA6 A;  2HF6 A;  3MR0 A;  3CPT B;  3BLS A;  4G3W A;  1XA7 A;  5EV0 A;  1IEL A;  3CZD A;  1K55 C;  1SKF A;  3HLW A;  2BG1 A;  4KQQ A;  5CEC A;  3T4S A;  2W3D A;  1H8M A;  2ZQC A;  2P74 A;  4OPQ A;  1TD5 A;  4LRZ E;  4ID4 A;  3DW0 A;  3FYZ A;  5HW3 A;  3MZD A;  3MKE A;  5EE8 A;  4Q0H A;  4ZAM A;  4GZB A;  5EOE A;  3VP3 A;  2OLV A;  3Q1F A;  2EX6 A;  4LCM A;  1JTD A;  4HI4 A;  4ZRR A;  1Q2P A;  4NKP A;  3BFD A;  4BMW A;  4KZ3 A;  4Q8I A;  2BTF P;  5HFO A;  2P08 A;  4H6J A;  3QNB A;  3IX3 A;  3UE1 A;  1K4E A;  4CQH A;  5FQQ A;  4XT2 A;  4S2J A;  1NRF A;  1IYP A;  3IF6 B;  1IYS A;  3T1R A;  3UNW A;  1S4S A;  3T1X A;  5CTN A;  4E04 A;  5GLC A;  4NXE A;  3WS1 A;  4MMN A;  3HCY A;  3L7H A;  1DJB A;  4OPZ A;  3A0S A;  3M2K A;  2Y91 A;  5HAQ A;  4P87 A;  1PNE A;  2JKF A;  1LL8 A;  2P9V B;  1N9B A;  2AVX A;  1D7E A;  1ESU A;  4O01 A;  2OSU A;  3NCK A;  4PKY G;  3P01 A;  1GHM A;  4JGQ A;  3SOI A;  4DF6 A;  2R78 A;  4ME4 A;  1FCO A;  1IEM A;  4Y5F A;  5A92 A;  3HUN A;  1IKI A;  2HDQ A;  4DJ3 A;  4KZ7 A;  1VHM A;  4YOF A;  1ALQ A;  5HAR A;  3EOI A;  2A2L A;  3IQA A;  2PHY A;  1OTA A;  1WE4 A;  2PD8 A;  1NYM A;  2K31 A;  4KG5 A;  2J80 A;  5FAQ A;  4II7 A;  5CGX A;  2XRO A;  5F68 A;  3R7W A;  2RCX A;  4GD8 A;  5GHZ A;  3DAV A;  1RGY A;  2OWH A;  2O9A A;  5HWT A;  3IWO A;  1HLU P;  2FFF B;  2HV1 A;  3KSF A;  2WKQ A;  4WZ5 A;  4KG6 A;  1PI4 A;  3OOV A;  3IBR A;  4RX3 A;  3KYZ A;  4EV4 A;  3AGE A;  3RXX A;  3C7V A;  3WRZ A;  1L0G A;  2X02 A;  5IT5 A;  3UE0 A;  1L0F A;  2XF3 A;  2V0U A;  2BLS A;  1DP8 A;  3G2Z A;  1CEG A;  1K4F A;  3DTI A;  1OTE A;  3N4I A;  3SS4 A;  1FSY A;  4ZBE A;  3IF6 A;  2E8I A;  4N9L A;  4CJN A;  4EEP A;  5FEF A;  3PBS A;  3EQU A;  4R1G A;  3E4O A;  4KUK A;  1RP5 A;  1NRJ A;  3OPH A;  3IHB A;  3JVU A;  5GHX A;  1PW1 A;  4Y17 A;  5DFY A;  1ES5 A;  4R4R A;  1CEF A;  2GJ3 A;  4BEN A;  3MFD A;  2FH5 A;  1F98 A;  4FCF A;  4DE3 A;  1S1Y A;  2A3U A;  4BL3 A;  1T1A A;  3LUQ A;  3GV9 A;  2W3G A;  2J9O A;  3NDE A;  1M40 A;  3NOP C;  4K0X A;  4LV3 A;  4Y0U A;  1KGG A;  3DWK A;  4N1H A;  4OP5 A;  3NHQ A;  3ZG8 B;  2R9X A;  3A0R A;  4PMA A;  2WAE A;  2P7J A;  4U0X A;  2B95 A;  1DJA A;  3PBQ A;  3VSL A;  2IA2 A;  3UDX A;  1BT5 A;  2HJE A;  2JN7 A;  5EPH A;  3LR4 A;  3AGF A;  3ZG9 B;  2IWD A;  2XH9 A;  5M18 A;  1K56 D;  1YMX A;  2QJ5 A;  2EFU A;  2WZZ A;  3UN7 A;  5A93 A;  1HZO A;  1FSW A;  5DTT A;  3ZNT A;  1DP9 A;  4YNR A;  3VE4 A;  3O5Y A;  4JXW A;  1S67 L;  4PAU A;  2ZMV A;  5AQ7 A;  1Q2Q A;  4GB7 A;  4S2N C;  3MF0 A;  4WZ5 C;  4X25 A;  3PAG A;  1W63 M;  1NXY A;  2C5W B;  3CUE A;  3MS6 A;  2V2F F;  3UE6 A;  4LV0 A;  4PM7 A;  1LSV A;  2VGJ A;  2ZM0 A;  2PDR A;  3KSI A;  4NET A;  1LL9 A;  3E98 A;  3AGD A;  4WUJ A;  3UB5 P;  2Y2N A;  3FPV A;  4EW7 A;  3UPN A;  4UAA A;  5HL1 A;  3LR5 A;  1SDE A;  2ZQ8 A;  4OQI A;  3A3J A;  3LEZ A;  1XJ3 A;  1P9W A;  3NY4 A;  1IOU A;  1K38 A;  4WN5 A;  2ZC3 B;  4ZTK A;  1PWC A;  5TBM B;  3MXQ A;  3PHY A;  1W5D A;  3GTC A;  4JF5 A;  3EEH A;  4LV2 A;  5TR7 A;  3EQV A;  2WAF A;  2CC1 A;  3GR2 A;  2Y2G A;  1W7F A;  3S7O A;  2X01 A;  1BLC A;  3NJA A;  4O0P A;  4WM9 A;  1MY8 A;  1H3Q A;  4QPR A;  5CED A;  1ZC2 A;  5EEC A;  5FQM A;  4GJ4 A;  5TGF A;  5TFQ A;  1LHY A;  3VOL A;  3BYD A;  4BD0 A;  1MKI A;  3N8S A;  3LIA A;  4B88 A;  2XA7 S;  2I9V A;  2WKP A;  2VGK A;  1L2S A;  4BBT A;  2Y2I A;  3PXP A;  5F1F A;  4OPY A;  5DKL A;  4OOL A;  3UB6 A;  3KYE A;  3V5M A;  5DTS A;  4HHD A;  5AJG A;  4S2I A;  4OLD A;  5CEB A;  1D1J A;  5HAI A;  3UE3 A;  4HH2 A;  1PZO A;  2Y55 A;  3QP5 A;  3H7W A;  4P6Z M;  3T4K A;  1OTI A;  3IH8 A;  5CX7 A;  3VV4 A;  5FL3 A;  4UA9 A;  4WL9 A;  3G30 A;  2ZC7 A;  4HQA A;  4PM5 A;  4EQI A;  4Y13 A;  1XFQ A;  1VQQ A;  4PHT A;  3WS5 A;  1VEU B;  1BSG A;  2NUT C;  2V20 A;  1LSX A;  1EW0 A;  4LEN A;  2KOI A;  3LID A;  1G6A A;  2HP9 A;  5TBM A;  1S6R A;  1UWN X;  1GSX A;  3UPO A;  1W79 A;  2J3W A;  3BQ8 A;  4HP4 A;  5DTK A;  3CUE C;  3TW8 A;  3O88 A;  4PPR A;  4QD4 A;  3O3V A;  3LR3 A;  1PWD A;  3TSG A;  2ZM2 A;  4KZ5 A;  1FOF A;  4KQD A;  4R0Q A;  4G3V A;  3D3O A;  1G28 A; 
#chains in the Genus database with same CATH homology
 5EM0 A;  2V8F A;  1CQA A;  5EM1 A;  1FIK A;  2BTF P;  1SZV A;  2V8C A;  4ESP A;  1F2K A;  1SKO B;  2PAV P;  3KYE A;  1Y4O A;  4QWO A;  1SKO A;  2ZL1 A;  2PRF A;  5FDS A;  3D9Y A;  1D1J A;  1FIL A;  3T1R A;  3MSH A;  3T1X A;  1J3W A;  3NUL A;  4D60 A;  1YPR A;  3L9K A;  4X25 A;  1VEU A;  5FEF A;  3L7H A;  3LGO A;  3MS6 A;  4X1L A;  2ZL1 B;  1PRQ A;  2PBD P;  3CPT A;  1G5U A;  1VET B;  1PNE A;  2JKF A;  3UB5 P;  4FUW A;  1VET A;  1ACF A;  3T1Q B;  2E8J A;  5EVE A;  1VEU B;  2VK3 A;  4X1M A;  3CPT B;  3LEQ A;  5FEG A;  1AWI A;  1PFL A;  1K0K A;  5EV0 A;  2ACG A;  3CHW P;  2JKG A;  3T1S A;  1CF0 A;  1CJF A;  3NEC A;  1A0K A;  1Z09 A;  3U4L P;  4FTX A;  3T12 B;  3DAV A;  2HZ5 A;  1HLU P;  2B95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...