2CMNA

A proximal arginine residue in the switching mechanism of the fixl oxygen sensor
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
117
structure length
117
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISAYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Proximal Arginine R206 Participates in Switching of the Bradyrhizobium Japonicum Fixl Oxygen Sensor
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Transferase
molecule keywords SENSOR PROTEIN FIXL
total genus 33
structure length 117
sequence length 117
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2cmnA00
2VLGA 3FC7A 1OT6A 5AVEA 5HDCA 4EETB 2ZOIA 3NHQA 5HWVA 5HZHA 4WN5A 3LICA 3MQOA 4NXGA 1LSXA 3LI9A 1S4RA 3UB6A 4JGOA 5A8BA 5AVFA 1DP8A 1N9NA 4HHDA 1S67L 2D02A 4R70A 2H28A 1GSVA 4HOIA 1F9IA 2L4RA 2QJ5A 1MZUA 3H82B 3C2WA 3VE4A 1F98A 3MXQA 3E4PA 4BBVA 3UB7A 4KUOA 3EEHA 3SW1A 4H6JB 1EW0A 1TS8A 3ULFA 2PYRA 4HP4A 4KQDA 4LRZE 4EW7A 1V9ZA 3IS2A 3ZQ5A 3NJAA 4GHIA 4GS9B 1D7EA 4L9FA 2PD8A 5F68A 1N9LA 5DJUA 4WL9A 4XT2B 3UB8A 2VV8A 4LRXC 4HIAA 4RQ9A 1S1YA 1G28A 2VV7A 2YKFA 3CAXA 2A24A 1P97A 3ICYA 3IS2B 3PHYA 1TS6A 2V9AA 1OTDA 2QWSA 2V1BA 2OOLA 3LI8A 4EERA 5DKLA 1ODVA 3MR0A 3RTYA 3A0SA 3H82A 5G4ZA 3GECA 4HJ3A 4HQAA 5J3WA 3CLOA 5HD3A 3A0VA 2QHKA 4WF0A 3VOLA 1P0ZA 1TS7A 3NOPC 1OT9A 3HJIA 3LIEA 2INWA 3F1OA 4LPZA 4H6JA 3UMEA 2Z6DA 4DJ3A 5KIZA 4GS9A 3LIDA 4LLOB 3LYXA 4MN5A 5DJTA 2Z6CA 4BBUA 4GCZA 1LSWA 2CMNA 1XJ6A 4EXOA 1XFNA 3E4QA 5TBMB 1VB6A 1S4SA 2P7JA 3UE6A 5J7EA 4I3AA 1T1BA 3A0RA 3UMDA 1N9OA 1GSXA 1T1CA 1WA9A 3H7WB 2V1AA 4YWZA 4JGPA 2VV6A 1LL8A 3LIAA 1OJGA 4XT2A 5HDSA 5EFWA 1JNUA 1KOUA 2PR6A 3B33A 2I9VA 4GHIB 3UB9A 4PKYG 3VE3A 2ZBBA 4I3IA 5IU1A 4WLAA 4F3LB 1BYWA 4HY8A 2B02A 4PKYA 2BASA 2EA9A 2PR5A 1DP6A 4R6LA 5F5YA 4MN6A 5J4EA 3H7WA 3K3CA 4I39A 2KX6A 2HV1A 4LRYC 3BY8A 4HH2A 4NXEA 2GJ3A 2VEAA 3P7NA 5HD5A 3LUQA 1S1ZA 3FG8A 1NWZA 4NXBA 4R3AA 3OLOA 2M1CA 5F69A 1T1AA 3D72A 4R38A 2PYPA 1OTAA 1OTEA 4GW9A 2V0UA 2QJ7A 3F1OB 2D01A 2JHEA 3CWFA 3BWLA 2PHYA 2V0WA 2ZOHA 3F1NA 1XJ4A 3MFXA 3LIBA 3IBRA 4HH3A 4L9GA 1Y28A 1OTBA 2L0WA 4HJ4A 4HNBA 4KUKA 1T18A 1TS0A 2OWJA 4HI4A 4EEPA 4EESA 4E04A 4EEUA 4I5SA 2L1MA 2R78A 3H9WA 4F3LA 4HP9A 3MJQA 4DJ2A 2K7SA 2PDRA 4I3JA 2KDKA 2WKQA 3F1PB 3NOTC 2OWHA 2W0NA 4BBTA 4EQ1A 1DP9A 3GDIA 1UWNX 3NOUC 1LT0A 5HWTA 5F6AA 5I5LA 4JGQA 5HSQA 1GSWA 1XJ2A 5G4YA 3EWKA 1LSVA 5HWWA 3K3DA 5HDDA 3C8CA 5TBMA 2YKHA 4L9EA 1OJ5A 3PYPA 4HJ6A 1T19A 3MQQA 2J80A 2W27A 2JN7A 2QKPA 3BY9A 4WUJA 1UGUA 2PD7A 3LIFA 3HJKA 5IS1A 1UWPX 3T50A 2A24B 2WKRA 1X0OA 1XJ3A 3F1PA 5DKKA 2WKPA 4B9OA 1DRMA 1XFQA 3E4OA 4I38A 4JGRA 3F1NB 1V9YA 4M4XA 3G6OA 1OTIA 4NXFA 3RH8B 1D06A 4K08A 1S66L 3KX0X
chains in the Genus database with same CATH superfamily
2H0TA 1JTGA 4EETB 5HZHA 5FDSA 1G6AA 1MWSA 1K0KA 4DN0A 3UB5P 4E3JA 5EV0A 2OLUA 4Y0UA 1YLZA 3PAEA 4UQIS 1V9ZA 4ID4A 2HDSA 4KZ3A 4Z9QA 3MFDA 2GNXA 1K57C 2ZM8A 3KSHA 3PHYA 2V1BA 3LI8A 4HBUA 4B4ZA 5CECA 2XFSA 3LIEA 4GS9A 4LLOB 4X6TA 3A3IA 2HP6A 1JVJA 1IKGA 4R1GA 4KQOA 2HDRA 4EV4A 4S2NC 3FKVA 3UE3A 5EVEA 1YLYA 3IX4A 1BSGA 1DP6A 3K3CA 4GN2A 1L0GA 1DJBA 4WM9A 4ZRRA 1NWZA 2Y59A 5HAPA 3F1OB 4S2LA 1O7EA 4C75A 4HNBA 4DXBA 4BENA 3SZTA 4M3KA 4KZ9A 4QB8A 1H3QA 1CEGA 2EFUA 2HJ9C 3N8LA 2ZL1A 4EQIA 1TEMA 4JLFA 1E3UA 2PU2A 5CGSA 3CZDA 3O86A 3U4LP 1D06A 1NZOA 2CC1A 1E4DA 1W63Q 3Q81A 2HZ5A 1OT6A 3SS3A 3BFGA 4OPRA 3Q7ZA 3QNCA 1TD5A 1F9IA 3HUMA 2QPNA 3WRTA 1TS8A 3ULFA 3FYZA 1D7EA 4E3MA 3HLGA 4XT2B 3LEZA 3UB8A 1G28A 2OOLA 1FIKA 2NUTC 4E6WA 3P01A 3A0VA 2ZC4B 5M1AA 1LI9A 2PU4A 3OOVA 4H6JA 3LIDA 3ZVWA 2X01A 1ZHHB 4MCWA 2A3UA 2P7JA 1T1CA 1Q2QA 5EPHA 2Y91A 4X53A 3BFDA 5FI2A 3KO6A 3ITBA 4KENB 2WYXA 2W1RA 4ZDXA 3Q07A 2J3TD 4XXRA 1MC0A 3ZDJA 4I3JA 2JHEA 1CQAA 2ZQCA 1YKDA 2IWCA 1GHMA 3MKFA 2P9VA 3UN7A 3OCNA 4OKPA 4EBLA 4E3NA 3IXBA 2ZM0A 4JGQA 1XJ2A 3BEBA 4EUZA 2W3GA 1MWUA 1GA9A 4BD1A 5DVAA 4UQIM 4S2MA 1DRMA 4E3OA 4F94A 3KSFA 4ARZA 4M4XA 1EROA 1PZPA 3SOIA 2PAVP 3AGEA 4U0XA 1LSXA 2G2WA 5AVFA 1DP8A 1FCOA 2WKHA 2D02A 3ZNTA 1PW1A 2QJ5A 1YMXA 3UB7A 1EW0A 3MZDA 4RQ9A 3T1QB 3VP0A 1K57A 3QP6A 3O5YA 3PTEA 4RYEA 4EERA 2XDMA 2Y2IA 3OPPA 4QWOA 2QHKA 3A3FA 2WGVA 5FI6A 4K0XA 4GOGA 5KIZA 4DJ3A 2GZAA 1XJ6A 2ZMFA 1FOFA 4Q0IA 5FQMA 1GSXA 1KVMA 4FH2A 2I72A 2K2NA 4ZJ2A 3GR2A 3MXRA 5EVIB 1LLBA 4C3QA 2BLSA 3D3OA 4Y5FA 2ZMAA 2MJ6A 4F3LA 3WS2A 4WZ5C 3PR6A 5AQ9A 2M7VA 1PNEA 2KLIA 4P0MA 4MN7A 2JKTM 2B95A 3WS1A 5EVIC 4HP9A 1K55A 2KDKA 4ZBEA 4PPRA 3CITA 4S2KA 2Y2PA 3FV7A 3PBRA 1K25A 2WZXA 5E2GA 5L8MA 4IJGA 3AGDA 4PM7A 1VETB 1FILA 2HP5A 3V5MA 4B9OA 1ES2A 3C5AA 1I2SA 3CUEC 3QHYA 1JWZA 4DMZA 4N9KA 3VSLA 3IHBA 4JGOA 2JC7A 3WS0A 4R70A 1FQGA 2H28A 1CEFA 3OPHA 3W4OA 2VX8A 4BBVA 4HP4A 1GCEA 1C3BA 4GHIA 2OV5A 4BL2A 3CHWP 2PBYA 4WL9A 2VV8A 4HIAA 5A90A 3IWOA 4KQDA 3ZNYA 3ZG9B 5EUAA 4FH4A 1KE3A 1XXMA 3RJUA 1ODVA 2FFFB 2WAFA 3M2KA 4ARZB 5FEFA 3VOLA 3N8SA 3K2NA 3RXWA 3N6IA 1IELA 4NG2A 1XGIA 2Q0OA 2EXBA 1PWGA 2JCHA 4UEYA 5C5KA 4GD8A 3TOIA 3LY3A 4Y0TA 2EA9A 3SH7A 1K54A 2EFXA 5E2EA 1FCMA 3VFHA 2GJ3A 5EVLA 2P74A 1H8MA 4L0LA 4LGWA 3HCYA 3JVUA 3GSGA 1LHYA 1OTEA 3W8KA 5L07A 3A3JA 3MSHA 2ZQ9A 4YINA 2IA2A 4N1HA 5HARA 1L0EA 2K7SA 5GLBA 3O88A 2WUQA 2P04A 2WKQA 4KG5A 4C6YA 1UWNX 3FPWA 2O9BA 3JYIA 3PBTA 3EWKA 1Y54A 3K3DA 4JPMA 2Y2LA 3LEQA 2A24B 3TE8A 3BRMA 1OPXA 1OTIA 1YSPA 3P09A 3UE0A 5DF9A 3HLCA 3ZGAB 4GZBA 4E3LA 3VE4A 4EWFA 1NRJA 2ZLYA 2PBDP 1GA0A 3BLSA 5DFYA 5AJGA 3RTYA 2Y4AA 5KZHA 3CPTB 1P0ZA 2HPBA 2Z6DA 3UPNA 3E98A 3IWIA 1SHVA 3DAVA 3UE1A 3UE6A 3MZFA 4EBNA 1MWRA 3JVVA 5E2FA 3H7WB 1N9BA 4JGPA 2H5SA 2DCFA 3LIAA 4MLLA 3MBZA 3UB9A 3G35A 3CJMA 1J9MA 3BFCA 5IU1A 4MDZA 3S7PA 1F5MA 1BTLA 2ZQDA 1FSWA 2KX6A 2HV1A 1GHPA 1PRQA 3CPTA 3FG8A 3NC8A 2V0UA 2VZWA 1XJ4A 2OAP1 5EM0A 1FR6A 3CG5A 4EEUA 1P9WA 4Y13A 4BQMA 4EQ1A 5I5LA 3IF6C 1GSWA 2J8YA 3PBQA 1JWVA 1WE4A 4RX2A 1XX2A 2ZMVA 3E4OA 4I38A 4S2PA 2R9XA 3F1NB 4NXFA 2XEPA 3BFFA 4GD6A 5CHJA 5A8BA 4FOFA 4GDBA 4WYYA 4JKTA 3DTIA 2O99A 2J7VA 3LR3A 4OQGA 4S2OA 1SZVA 2WAEA 4FCFA 2YKFA 1P97A 2V9AA 3HUNA 5J3WA 4OQHA 3CLOA 1ERMA 4R3BA 5FQQA 2Y2HA 1OT9A 5IHVA 2Y55A 2DRWA 2XD1A 4ETZA 3W2ZA 2VV6A 1OJGA 3M6BA 2R9WA 4X1MA 1YAXA 5D3OA 4PKYG 1JTDA 1ZG4A 1FCNA 2V1ZA 4CLCB 4WELA 5F5YA 3SH9A 3P7NA 1MKMA 1S1ZA 4IUKA 4R3AA 2W1TB 3OLOA 1KGEA 4R23A 1OTAA 2V0WA 2ZOHA 3F1NA 3VE3A 3BM6A 1T18A 3PBNA 1YMSA 3EGDC 2VGLS 3H9WA 4CLCC 2NUPC 4UAAA 3GDIA 5F6AA 5HSQA 2LB5A 3BJNA 3OZHA 5EOOA 2UWXA 2EX2A 3GV9A 1UGUA 4WEKA 3N4IA 1PW8A 1WYCA 1H8ZA 3GRJA 2WKEA 4X55A 4UA9A 3OBFA 1HZOA 1NRFA 4OVDA 1CI8A 4P6BA 5CHUA 4LV0A 3T4LA 3Q7VA 3UB6A 4LV2A 3FPVA 3C2WA 1E3UD 3HLFA 3E4PA 1DJAA 3SW1A 4GB7A 4RX3A 3IX8A 5F68A 1LI0A 2M7UA 2A24A 3U2AA 1MWTA 1QMFA 3OPRA 3G32A 5U47A 3UO9A 2QYBA 1U60A 1WYBA 2ZQ8A 2ZC7A 4FTXA 1YT4A 1CK3A 1S4SA 1S0WA 2WK0A 5A91A 3FZCA 1Z09A 3L7HA 2XLNA 5M18A 3HLDA 4PHTA 3V3SA 3IH8A 5J4EA 2HDQA 3NI9A 1CF0A 1I5QA 3MKEA 5GHZA 3D4FA 5F69A 2D01A 2KOIA 3MFXA 4WMCA 3Q1FA 5A93A 1EWZA 1TS0A 3I7JA 3ISGA 4LENA 2EWWA 5CTMA 5A92A 1NLYA 3SS5A 4Y7PA 1A0KA 4IUHA 3TG9A 3LR0A 5HDDA 3TRCA 3VP1A 4HJ6A 3C4OA 1ONGA 4WUJA 1LL9A 4QHCA 2V20A 4P6ZM 4IVIA 2G2UA 1KVLA 3IX3A 4JXGA 4JGRA 3EQUA 3IF6A 4UA7A 4CLCA 3UPOA 4JBFA 3T12B 4GDNA 3V67A 5HX9A 4KZAA 2JBFA 4HEFA 4R0QA 1SDNA 3UDIA 2QMIA 3ZQ5A 5EE8A 5G4ZA 4BWIA 5HWWA 2QWSA 4O8GA 1YLJA 3T1XA 3GECA 1BZAA 2Y8HA 1G5UA 5GLCA 3HLBA 3GTCA 3VOZA 2DNSA 4I3AA 2GDNA 2V1AA 5GL9A 1JNUA 3WWXA 1Q2PA 3DTMA 4WLAA 2Y2MA 1K6SA 1XKZA 4HH2A 3PBSA 4II7A 3WS4A 2A2LA 3T4SA 4ZJ1A 3BYDA 4O0PA 2PYPA 4KZ8A 1QMEA 3ZYTA 3MF0A 3SS4A 4B88A 2ZQ7A 3HLWA 3RXXA 2VGJA 4BD0A 2LB9A 2XR0A 4IHQA 1F2KA 1YSQA 1LSVA 1NLZA 5CTNA 1OJ5A 1ONHA 4OLDA 2J80A 3V50A 1BLPA 2PD7A 1W5DA 4IEDA 5FSRA 3Q7VB 4OPYA 2Y79A 4LFUA 2OSUA 1ERQA 3DWKA 1ZKJA 2WGWA 2XSSA 3C4PA 1L0DA 1S4RA 5CGXA 5G18A 1ZG6A 1K56A 5BOHA 4G3KA 1G6OA 3T4JA 4FUWA 2VV7A 3IS2B 1BULA 4QJGA 5CX7A 5DKLA 4MBHA 4PMAA 1L3LA 4KZ5A 4DE1A 4K91A 4WF0A 1K55C 1TVFA 3IHAA 3E2KA 3HBRA 3M6HA 3HVFA 1KE4A 3IWQA 3PAGA 4JF4A 5FQJA 4PM8A 1IYQA 3UMDA 1JWPA 4YWZA 2FFYA 4JXWA 1KOUA 3B33A 3HLEA 4GHIB 2G7UA 5F83A 1KE0A 2XD5A 4E3KA 4U0TA 3UPPA 3KSGA 4WZ4A 3G2ZA 3TJZC 2ZC3B 5HPFA 3NDEA 5F82A 3VP4A 1ESUA 4MEZA 5F1GA 4PKYA 1IYSA 4E3IA 2O0YA 1IKIA 1I2WA 4MMNA 1YPRA 2JKGA 4KQQA 3QP2A 3G4PA 3IXHA 2ZM2A 2C6WB 3ZG0A 5HWTA 4EUVA 4OPQA 2RL3A 1YLPA 1ES5A 3ZG8B 3PYPA 5FATA 1SDEA 1E25A 2QKPA 3EQVA 3ZHHA 5AQAA 5DKKA 2WKPA 1NZUA 5LBRA 3P98A 3Q82A 4EU0A 3NULA 1M40A 4GNUA 3NBLA 2W3FA 4QD4A 2J3TC 3ZG5A 4CQHA 1GHIA 4S2NA 5AQ7A 3IS2A 4P6ZS 4LV1A 1BLSA 1MPLA 3HUOA 4OH0A 4LRXC 2XF3A 4H8RA 2AVXA 3CAXA 3M2JA 5AQBA 2JKTI 4OP5A 3N8RA 3A0SA 4YFMA 4HJ3A 3MS6A 5HD3A 5KSCA 4DDSA 2JE5A 1TS7A 1H5XA 1PI5A 3UMEA 3S7NA 5FASA 3T4QA 1D1JA 4Q8IA 1SKOB 3VMAA 2VA0A 3TW8A 2ZBBA 3T4TA 5KMWA 4R6LA 4X68A 1FSYA 1VEUA 2Y2OA 5DF8A 5E2HA 2VEAA 3LR4A 1IYPA 1EI5A 2Z2MB 1S6RA 3BFEA 5FAQA 5GLAA 2W3HA 3QNBA 3QP8A 2EX6A 1TDLA 4EESA 4KQRA 1PIOA 3GQZA 1STZA 4MBKA 2FZ0A 4ME4A 1BLCA 3F1PB 4EBPA 4MBFA 3NOUC 1LT0A 3G34A 2JKRI 2EX8A 3BQ8A 5MC7A 2JN7A 3PXPA 1UWPX 3DTKA 1VQQA 2WKRA 1P9RA 4WMCD 1PWDA 3IXDA 1N4OA 3VOYA 4K08A 3VSKA 5EVIA 2OAQ1 4CPKA 5HWVA 3KYEA 5TGFA 4WN5A 4PM9A 2O9CA 2JKFA 4IBRA 4D60A 1TF1A 4KUOA 5CERA 2PYRA 2V8CA 4LRZE 4L9FA 3BW6A 4CLCE 3BLMA 4AFIA 3H82A 4OOYA 1PI4A 4LV3A 3LGOA 5L09A 4O01A 3C7VA 2C5WB 4G3VA 4Y2FA 3SH8A 5FI7A 3IBJA 1MY8A 4I3IA 4HY8A 1W79A 2XGNA 1J3WA 4JF5A 4WBGA 4OLGA 3BY8A 4NXEA 1ZTUA 5FDHA 5EOEA 1ES3A 3TSGA 2QJ7A 4WZ5A 1KDSA 3LY4A 3OC2A 4L9GA 1YLWA 4DDYA 3OPLA 4E04A 3ITAA 3L9KA 4YOFA 1W8QA 5DTSA 3QP5A 3NOTC 3UDFA 3S22A 2XA7M 5G4YA 2HP9A 1L0FA 2WADA 4OOLA 4QY5A 2EWVA 4KZBA 5EECA 2DMWA 5I94A 3ZVTA 5HPIA 1IFQA 1IOUA 1IYOA 1S66L 3DBAA 3KX0X 1TDGA 1RGZA 5FAOA 5HDCA 2ZOIA 4K0WA 2E8IA 1S67L 4G3WA 4HOIA 4ZTKA 4LCMA 5M19A 4U3TA 3O3VA 3QP1A 3CMZA 3IF5A 5DJUA 3E2LA 1S1YA 5IS1A 5HW3A 1VETA 1OTDA 5J8XA 4QY6A 4N9LA 5HAQA 2W3DA 4R4SA 3S7OA 1SCWA 3HJIA 4DF6A 2X02A 3KSIA 2WGWB 4OQIA 1LSWA 2Y2GA 3LO7A 1HD8A 2Y2NA 3BECA 1PFLA 2PR6A 4BMWA 5CEDA 4F3LB 3C38A 4NETA 3KYZA 1YM1A 3MZEA 3RFBA 4LRYC 5HD5A 4X1LA 2M1CA 1T1AA 4CJNA 4GW9A 4Y17A 3W4QA 2PHYA 3LIBA 3IBRA 1Y28A 4HI4A 4OPZA 3MQ0A 2L1MA 4KG6A 3R7WA 4DJ2A 2W0NA 3T4OA 4Q0JA 4OOMA 1VEUB 4FD8A 3IT9A 2YKHA 4L9EA 4NEED 3EEAA 2O9AA 3GMWA 3UNWA 2H10A 1XPBA 1XJ3A 2Q9MA 1NYYA 3JPUA 5EM1A 1NXYA 4R4RA 3NHQA 4KZ6A 3LI9A 2HF6A 4GJ4A 4HHDA 3HREA 1XA7A 1OMEA 1K56D 2Q9NA 1SKOA 1Y4OA 2Z2LB 4DE3A 4X25A 3B42A 1AWIA 3NJAA 1MBLA 1DY6A 3A3EA 3S4XA 2J3WA 5CGWA 4UHUA 4N1XA 4CLCD 1KDWA 4ESPA 4HQAA 2EX9A 2RCXA 4RVAA 4XUZA 2WKIA 4ZJ3A 5HAIA 4MN5A 5DJTA 3LYXA 2Z6CA 5CXWA 4EXOA 1XFNA 2VKSA 5TBMB 1VB6A 3VV4A 5J7EA 5GHYA 4HESA 5HDSA 3NDGA 5EFWA 1ACFA 5TFQA 4LCLA 4S2JA 3W4PA 2FH5A 2BASA 2PR5A 5CRFA 1CI9A 4MN6A 4QU3A 4I39A 1LL5A 4JF6A 4R3JA 1NYMA 4A5RA 1H0MA 3LUQA 4NXBA 4DE2A 4R38A 3PBOA 3KYQA 5JYOA 1OTBA 4HJ4A 2OWJA 4N92A 2XH9A 1YLTA 3NCKA 4I5SA 5HFOA 4OONA 4DRTA 3G31A 2XRNA 4BLMA 4Y0OA 4OQ0A 1ES4A 5TBMA 2P9VB 3O87A 3HL9A 3V3RA 3C7UA 1XFQA 3S7QA 3DTEA 4PAUA 2GX5A 2VLGA 4HBTA 2XFTA 3D9YA 4NXGA 2Y2QA 3ZG7B 5JYPA 5F1FA 5GHXA 1MKIA 3H82B 1F98A 1MXOA 4PM5A 4ZAMA 4O7DA 5IT5A 4EW7A 1N9LA 2P08A 2XK1A 2V2FF 3A3DA 1TS6A 4XUXA 3C30A 1XA1A 4PM6A 3T1RA 2QZ6A 2INWA 4LPZA 1ZC2A 5L2FA 2ZD8A 4FSFA 2XQZA 2CMNA 4GCZA 3E4QA 2A49A 5KSHA 3CI6A 1K54C 3A0RA 3WS5A 4NKPA 4B93A 1BLHA 1LL8A 1ALQA 1NJ4A 1XP4A 4DXCA 2B02A 1Z6FA 5L10A 1H8YA 4UA6A 4DKIA 3G2YA 1O07A 1PWCA 3IQAA 1AXBA 2VK3A 3D72A 5FQIA 1PZOA 3CWFA 4GS9B 3UY6A 1HVBA 4HH3A 4BL3A 3OCLA 1W8YA 2L0WA 4P87A 2X71A 2ZC6B 4IVKA 3B47A 2R78A 2W1TA 3MJQA 2IWBA 1W63M 3IH9A 2HDUA 2J9OA 2EXAA 3LR5A 1ESIA 3WRZA 4IBXA 1RP5A 1T19A 3MQQA 5DTTA 3VP2A 1X0OA 2E8JA 4YNRA 4Z1WA 3G6OA 3RH8B 2HGVA 1DJCA 3MXSA 1FR1A 4E6XA 4P85A 1K4EA 3E0YA 3LICA 4KZ4A 3LCEA 3T1SA 2BTFP 3EEHA 2ACGA 3UDXA 1VHMA 3DW0A 5FL3A 3ICYA 5FEGA 3V39A 1BT5A 3GVBA 3B3XA 5CHMA 4KZ7A 1SKFA 2UV0E 1G68A 5HL6A 5FQ9A 1T1BA 4MNRA 1N9OA 1WA9A 2J9PA 3EGXC 4XT2A 4NK3A 3VP3A 4JXVA 4Q0HA 3LFVA 4S2IA 1BYWA 4GKUA 5TJJA 3MMHA 2ZJ9A 5DF7A 3DWZA 1K6RA 2XA7S 4Y15A 1IEMA 2HJEA 4H6JB 2W3EA 4B4XA 2V8FA 4EEPA 1VM1A 2H0YA 2VGKA 4WEJA 1CJFA 1NY0A 2PDRA 3QP4A 2Y2JA 1L2SA 2OWHA 3IXGA 4BBTA 2VJWA 5HL1A 5DTKA 5FA7A 2WZZA 3BY9A 5FAPA 4D2OA 3VFFA 2XROA 2ZQAA 1XGJA 2K31A 1V9YA 1KGFA 5TR7A 3CUEA 3FKWA 2JKRM 4Y3IA 3FC7A 5AVEA 1KGGA 1M6KA 3MQOA 5DFXA 3G30A 1N9NA 3S1YA 4JXSA 1GSVA 2L4RA 1MZUA 1RGYA 2IWDA 3MXQA 5GLDA 4X56A 2ZL1B 3BQAA 2PD8A 4DE0A 1HLUP 3FWLA 4QPRA 3MR0A 5EVID 3ZFZA 3R4KA 3NOPC 3F1OA 3N7WA 4BBUA 5E43A 1BUEA 2ZC5B 2OLVA 1W7FA 1YQSA 3ZCZA 2I9VA 1HTZA 4BJPA 2B18A 3H7WA 3NIAA 4OP8A 1K4FA 2Y2KA 3EOIA 4X69A 3AGFA 3BWLA 2PT7A 4KUKA 5K5BA 4GLQA 2B5RA 2BG1A 4ETXA 2PRFA 1DP9A 1K38A 4RA7A 3C8CA 1RCJA 3R7WB 2W27A 2WGIA 3LIFA 3HJKA 5FQKA 3T50A 3IF6B 3NY4A 5CEBA 3F1PA 3T4KA 1PYYA 3NECA 2VGLM 4KG2A
chains in the Genus database with same CATH topology
4EETB 2XSSA 5DF9A 3NHQA 5HZHA 3LI9A 1S4RA 2HF6A 4GJ4A 4HHDA 4DN0A 3VE4A 3B42A 1NRJA 4UQIS 1V9ZA 4G3KA 3NJAA 1G6OA 2GNXA 2J3WA 3T4JA 2VV7A 3KSHA 3PHYA 3IS2B 5DFYA 2V1BA 5AJGA 3LI8A 5CX7A 5DKLA 3RTYA 4CLCD 4HQAA 4WF0A 1P0ZA 3LIEA 2Z6DA 3E98A 4GS9A 4LLOB 4MN5A 3LYXA 5DJTA 2Z6CA 4EXOA 1XFNA 2VKSA 5TBMB 1VB6A 3UE6A 3VV4A 4KQOA 5J7EA 3UMDA 3JVVA 3H7WB 3UE3A 4YWZA 4JGPA 3LIAA 5HDSA 5EFWA 1KOUA 3B33A 4GHIB 3UB9A 2G7UA 5IU1A 4MDZA 3S7PA 3KSGA 1F5MA 2FH5A 2BASA 2PR5A 1DP6A 4MN6A 4I39A 3K3CA 2KX6A 2HV1A 3TJZC 5HPFA 4ZRRA 3LUQA 4NXBA 3FG8A 1NWZA 4R38A 2V0UA 3PBOA 3F1OB 2VZWA 4PKYA 1XJ4A 3KYQA 2O0YA 1OTBA 4HJ4A 4HNBA 2OWJA 2OAP1 4EEUA 1P9WA 4I5SA 4MMNA 1H3QA 2HJ9C 4EQ1A 2XRNA 5HWTA 5I5LA 4EUVA 1GSWA 5TBMA 3PYPA 3PBQA 2QKPA 3EQVA 5DKKA 2WKPA 2ZMVA 1XFQA 3S7QA 3E4OA 4I38A 3F1NB 4NXFA 1D06A 5LBRA 4PAUA 2GX5A 4EU0A 1W63Q 2VLGA 1OT6A 4NXGA 5A8BA 4FOFA 2W3FA 1TD5A 1F9IA 2J3TC 3H82B 1F98A 4CQHA 2O99A 1TS8A 3ULFA 5IT5A 3LR3A 4EW7A 3IS2A 4P6ZS 1D7EA 1N9LA 4XT2B 2P08A 3UB8A 4LRXC 1G28A 2YKFA 3CAXA 1P97A 1TS6A 2V9AA 2OOLA 3C30A 2JKTI 2NUTC 3A0SA 3P01A 4HJ3A 5J3WA 3CLOA 5HD3A 3A0VA 1TS7A 1OT9A 3OOVA 2INWA 4LPZA 4H6JA 3UMEA 3S7NA 3LIDA 4FSFA 3T4QA 4GCZA 1ZHHB 2CMNA 4MCWA 3E4QA 5KSHA 2P7JA 3CI6A 3A0RA 4ETZA 1T1CA 4NKPA 3W2ZA 4B93A 2VV6A 1LL8A 1OJGA 1YAXA 4PKYG 2VA0A 3TW8A 2ZBBA 4CLCB 4WELA 3T4TA 3KO6A 2B02A 4R6LA 5F5YA 2W1RA 2VEAA 3P7NA 1MKMA 3LR4A 1S1ZA 2J3TD 4IUKA 4R3AA 2W1TB 3OLOA 1MC0A 3D72A 1OTAA 4I3JA 2JHEA 3CWFA 4GS9B 2V0WA 2ZOHA 3F1NA 4HH3A 3VE3A 3OCLA 2L0WA 1T18A 2W3HA 3PBNA 1YKDA 4EESA 3B47A 3EGDC 2R78A 2VGLS 3H9WA 2W1TA 3OCNA 2NUPC 4CLCC 3MJQA 1STZA 2FZ0A 4ME4A 3F1PB 1W63M 3GDIA 3NOUC 1LT0A 5F6AA 4JGQA 5HSQA 2LB5A 1XJ2A 3BJNA 3LR5A 2JKRI 3BQ8A 2W3GA 1T19A 5MC7A 3MQQA 2JN7A 3PXPA 1UGUA 4WEKA 1UWPX 4UQIM 2WKRA 1X0OA 1P9RA 1DRMA 4YNRA 3KSFA 4ARZA 4Z1WA 4M4XA 3G6OA 3RH8B 2HGVA 4K08A 2OAQ1 3OBFA 5HWVA 3E0YA 4WN5A 3LICA 3T4LA 1LSXA 3UB6A 2O9CA 1DP8A 5AVFA 1TF1A 2D02A 3FPVA 2QJ5A 3C2WA 3E4PA 3UB7A 4KUOA 3EEHA 3SW1A 1EW0A 2PYRA 4LRZE 1VHMA 5F68A 4L9FA 5FL3A 4RQ9A 2M7UA 2A24A 3U2AA 3ICYA 3BW6A 3O5YA 4CLCE 4EERA 4AFIA 3H82A 2QHKA 2QYBA 5KIZA 4DJ3A 4O01A 2GZAA 1XJ6A 5HL6A 2ZMFA 1S4SA 4G3VA 4Y2FA 1T1BA 4Q0IA 1N9OA 1GSXA 1WA9A 3EGXC 3IBJA 2K2NA 4XT2A 4I3IA 4Q0HA 3LFVA 1BYWA 4HY8A 4PHTA 5TJJA 3MMHA 5J4EA 3D3OA 3BY8A 4NXEA 1ZTUA 2XA7S 4Y5FA 5F69A 2MJ6A 2HJEA 4F3LA 4H6JB 2QJ7A 2D01A 2KOIA 3OC2A 2W3EA 3PR6A 4L9GA 3MFXA 2M7VA 2KLIA 1TS0A 4MN7A 4EEPA 4E04A 2JKTM 4WEJA 2EWWA 4HP9A 4YOFA 1NLYA 2PDRA 2KDKA 3NOTC 3CITA 2OWHA 4BBTA 2VJWA 3PBRA 4IUHA 2XA7M 5G4YA 3LR0A 5HDDA 3TRCA 4HJ6A 4OOLA 5L8MA 2EWVA 3BY9A 4IJGA 4WUJA 2XROA 2DMWA 4P6ZM 4B9OA 5HPIA 1IFQA 4JGRA 2K31A 1V9YA 1IOUA 3EQUA 1S66L 3KX0X 3DBAA 3CUEA 3CUEC 2JKRM 4Y3IA 4CLCA 3FC7A 5AVEA 4DMZA 5HDCA 2ZOIA 3V67A 3MQOA 5DFXA 4JGOA 1N9NA 1S67L 4G3WA 4R70A 2H28A 1GSVA 4HOIA 2L4RA 1MZUA 2VX8A 4BBVA 3MXQA 4HP4A 3BQAA 3ZQ5A 4GHIA 2PD8A 5DJUA 4WL9A 2VV8A 4HIAA 5G4ZA 1S1YA 4KQDA 5IS1A 4QPRA 4BWIA 5HWWA 1OTDA 2QWSA 4O8GA 1ODVA 3MR0A 3GECA 2W3DA 3S7OA 3R4KA 4ARZB 3VOLA 2Y8HA 3NOPC 3HJIA 3F1OA 3KSIA 3K2NA 4BBUA 1LSWA 4I3AA 2V1AA 1JNUA 2PR6A 2I9VA 4BMWA 4WLAA 4UEYA 5C5KA 4F3LB 3C38A 4BJPA 3KYZA 2EA9A 2B18A 3H7WA 3RFBA 4LRYC 4HH2A 2GJ3A 3PBSA 5HD5A 4II7A 1H8MA 2A2LA 4L0LA 3EOIA 3T4SA 3HCYA 3JVUA 2M1CA 1T1AA 4O0PA 2PYPA 1OTEA 4GW9A 3BWLA 2PHYA 3ZYTA 3LIBA 3IBRA 2PT7A 3MF0A 1Y28A 4KUKA 5K5BA 4HI4A 2IA2A 4GLQA 3MQ0A 2L1MA 3R7WA 4DJ2A 2K7SA 4ETXA 2P04A 2WKQA 2LB9A 2W0NA 3T4OA 1DP9A 1UWNX 4Q0JA 3FPWA 2O9BA 4IHQA 3PBTA 1YSQA 3EWKA 1LSVA 4OOMA 1NLZA 3K3DA 3C8CA 2YKHA 4L9EA 1OJ5A 4NEED 3EEAA 3R7WB 2J80A 2W27A 2O9AA 2PD7A 3LIFA 3HJKA 3T50A 2A24B 3F1PA 3T4KA 1XJ3A 3TE8A 2Y79A 1OPXA 1OTIA 1YSPA 2VGLM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLG A;  3FC7 A;  1OT6 A;  5AVE A;  5HDC A;  4EET B;  2ZOI A;  3NHQ A;  5HWV A;  5HZH A;  4WN5 A;  3LIC A;  3MQO A;  4NXG A;  1LSX A;  3LI9 A;  1S4R A;  3UB6 A;  4JGO A;  5A8B A;  5AVF A;  1DP8 A;  1N9N A;  4HHD A;  1S67 L;  2D02 A;  4R70 A;  2H28 A;  1GSV A;  4HOI A;  1F9I A;  2L4R A;  2QJ5 A;  1MZU A;  3H82 B;  3C2W A;  3VE4 A;  1F98 A;  3MXQ A;  3E4P A;  4BBV A;  3UB7 A;  4KUO A;  3EEH A;  3SW1 A;  4H6J B;  1EW0 A;  1TS8 A;  3ULF A;  2PYR A;  4HP4 A;  4KQD A;  4LRZ E;  4EW7 A;  1V9Z A;  3IS2 A;  3ZQ5 A;  3NJA A;  4GHI A;  4GS9 B;  1D7E A;  4L9F A;  2PD8 A;  5F68 A;  1N9L A;  5DJU A;  4WL9 A;  4XT2 B;  3UB8 A;  2VV8 A;  4LRX C;  4HIA A;  4RQ9 A;  1S1Y A;  1G28 A;  2VV7 A;  2YKF A;  3CAX A;  2A24 A;  1P97 A;  3ICY A;  3IS2 B;  3PHY A;  1TS6 A;  2V9A A;  1OTD A;  2QWS A;  2V1B A;  2OOL A;  3LI8 A;  4EER A;  5DKL A;  1ODV A;  3MR0 A;  3RTY A;  3A0S A;  3H82 A;  5G4Z A;  3GEC A;  4HJ3 A;  4HQA A;  5J3W A;  3CLO A;  5HD3 A;  3A0V A;  2QHK A;  4WF0 A;  3VOL A;  1P0Z A;  1TS7 A;  3NOP C;  1OT9 A;  3HJI A;  3LIE A;  2INW A;  3F1O A;  4LPZ A;  4H6J A;  3UME A;  2Z6D A;  4DJ3 A;  5KIZ A;  4GS9 A;  3LID A;  4LLO B;  3LYX A;  4MN5 A;  5DJT A;  2Z6C A;  4BBU A;  4GCZ A;  1LSW A;  2CMN A;  1XJ6 A;  4EXO A;  1XFN A;  3E4Q A;  5TBM B;  1VB6 A;  1S4S A;  2P7J A;  3UE6 A;  5J7E A;  4I3A A;  1T1B A;  3A0R A;  3UMD A;  1N9O A;  1GSX A;  1T1C A;  1WA9 A;  3H7W B;  2V1A A;  4YWZ A;  4JGP A;  2VV6 A;  1LL8 A;  3LIA A;  1OJG A;  4XT2 A;  5HDS A;  5EFW A;  1JNU A;  1KOU A;  2PR6 A;  3B33 A;  2I9V A;  4GHI B;  3UB9 A;  4PKY G;  3VE3 A;  2ZBB A;  4I3I A;  5IU1 A;  4WLA A;  4F3L B;  1BYW A;  4HY8 A;  2B02 A;  4PKY A;  2BAS A;  2EA9 A;  2PR5 A;  1DP6 A;  4R6L A;  5F5Y A;  4MN6 A;  5J4E A;  3H7W A;  3K3C A;  4I39 A;  2KX6 A;  2HV1 A;  4LRY C;  3BY8 A;  4HH2 A;  4NXE A;  2GJ3 A;  2VEA A;  3P7N A;  5HD5 A;  3LUQ A;  1S1Z A;  3FG8 A;  1NWZ A;  4NXB A;  4R3A A;  3OLO A;  2M1C A;  5F69 A;  1T1A A;  3D72 A;  4R38 A;  2PYP A;  1OTA A;  1OTE A;  4GW9 A;  2V0U A;  2QJ7 A;  3F1O B;  2D01 A;  2JHE A;  3CWF A;  3BWL A;  2PHY A;  2V0W A;  2ZOH A;  3F1N A;  1XJ4 A;  3MFX A;  3LIB A;  3IBR A;  4HH3 A;  4L9G A;  1Y28 A;  1OTB A;  2L0W A;  4HJ4 A;  4HNB A;  4KUK A;  1T18 A;  1TS0 A;  2OWJ A;  4HI4 A;  4EEP A;  4EES A;  4E04 A;  4EEU A;  4I5S A;  2L1M A;  2R78 A;  3H9W A;  4F3L A;  4HP9 A;  3MJQ A;  4DJ2 A;  2K7S A;  2PDR A;  4I3J A;  2KDK A;  2WKQ A;  3F1P B;  3NOT C;  2OWH A;  2W0N A;  4BBT A;  4EQ1 A;  1DP9 A;  3GDI A;  1UWN X;  3NOU C;  1LT0 A;  5HWT A;  5F6A A;  5I5L A;  4JGQ A;  5HSQ A;  1GSW A;  1XJ2 A;  5G4Y A;  3EWK A;  1LSV A;  5HWW A;  3K3D A;  5HDD A;  3C8C A;  5TBM A;  2YKH A;  4L9E A;  1OJ5 A;  3PYP A;  4HJ6 A;  1T19 A;  3MQQ A;  2J80 A;  2W27 A;  2JN7 A;  2QKP A;  3BY9 A;  4WUJ A;  1UGU A;  2PD7 A;  3LIF A;  3HJK A;  5IS1 A;  1UWP X;  3T50 A;  2A24 B;  2WKR A;  1X0O A;  1XJ3 A;  3F1P A;  5DKK A;  2WKP A;  4B9O A;  1DRM A;  1XFQ A;  3E4O A;  4I38 A;  4JGR A;  3F1N B;  1V9Y A;  4M4X A;  3G6O A;  1OTI A;  4NXF A;  3RH8 B;  1D06 A;  4K08 A;  1S66 L;  3KX0 X; 
#chains in the Genus database with same CATH topology
 2H0T A;  1JTG A;  4EET B;  5HZH A;  5FDS A;  1G6A A;  1MWS A;  1K0K A;  4DN0 A;  3UB5 P;  4E3J A;  5EV0 A;  2OLU A;  4Y0U A;  1YLZ A;  3PAE A;  4UQI S;  1V9Z A;  4ID4 A;  2HDS A;  4KZ3 A;  4Z9Q A;  3MFD A;  2GNX A;  1K57 C;  2ZM8 A;  3KSH A;  3PHY A;  2V1B A;  3LI8 A;  4HBU A;  4B4Z A;  5CEC A;  2XFS A;  3LIE A;  4GS9 A;  4LLO B;  4X6T A;  3A3I A;  2HP6 A;  1JVJ A;  1IKG A;  4R1G A;  4KQO A;  2HDR A;  4EV4 A;  4S2N C;  3FKV A;  3UE3 A;  5EVE A;  1YLY A;  3IX4 A;  1BSG A;  1DP6 A;  3K3C A;  4GN2 A;  1L0G A;  1DJB A;  4WM9 A;  4ZRR A;  1NWZ A;  2Y59 A;  5HAP A;  3F1O B;  4S2L A;  1O7E A;  4C75 A;  4HNB A;  4DXB A;  4BEN A;  3SZT A;  4M3K A;  4KZ9 A;  4QB8 A;  1H3Q A;  1CEG A;  2EFU A;  2HJ9 C;  3N8L A;  2ZL1 A;  4EQI A;  1TEM A;  4JLF A;  1E3U A;  2PU2 A;  5CGS A;  3CZD A;  3O86 A;  3U4L P;  1D06 A;  1NZO A;  2CC1 A;  1E4D A;  1W63 Q;  3Q81 A;  2HZ5 A;  1OT6 A;  3SS3 A;  3BFG A;  4OPR A;  3Q7Z A;  3QNC A;  1TD5 A;  1F9I A;  3HUM A;  2QPN A;  3WRT A;  1TS8 A;  3ULF A;  3FYZ A;  1D7E A;  4E3M A;  3HLG A;  4XT2 B;  3LEZ A;  3UB8 A;  1G28 A;  2OOL A;  1FIK A;  2NUT C;  4E6W A;  3P01 A;  3A0V A;  2ZC4 B;  5M1A A;  1LI9 A;  2PU4 A;  3OOV A;  4H6J A;  3LID A;  3ZVW A;  2X01 A;  1ZHH B;  4MCW A;  2A3U A;  2P7J A;  1T1C A;  1Q2Q A;  5EPH A;  2Y91 A;  4X53 A;  3BFD A;  5FI2 A;  3KO6 A;  3ITB A;  4KEN B;  2WYX A;  2W1R A;  4ZDX A;  3Q07 A;  2J3T D;  4XXR A;  1MC0 A;  3ZDJ A;  4I3J A;  2JHE A;  1CQA A;  2ZQC A;  1YKD A;  2IWC A;  1GHM A;  3MKF A;  2P9V A;  3UN7 A;  3OCN A;  4OKP A;  4EBL A;  4E3N A;  3IXB A;  2ZM0 A;  4JGQ A;  1XJ2 A;  3BEB A;  4EUZ A;  2W3G A;  1MWU A;  1GA9 A;  4BD1 A;  5DVA A;  4UQI M;  4S2M A;  1DRM A;  4E3O A;  4F94 A;  3KSF A;  4ARZ A;  4M4X A;  1ERO A;  1PZP A;  3SOI A;  2PAV P;  3AGE A;  4U0X A;  1LSX A;  2G2W A;  5AVF A;  1DP8 A;  1FCO A;  2WKH A;  2D02 A;  3ZNT A;  1PW1 A;  2QJ5 A;  1YMX A;  3UB7 A;  1EW0 A;  3MZD A;  4RQ9 A;  3T1Q B;  3VP0 A;  1K57 A;  3QP6 A;  3O5Y A;  3PTE A;  4RYE A;  4EER A;  2XDM A;  2Y2I A;  3OPP A;  4QWO A;  2QHK A;  3A3F A;  2WGV A;  5FI6 A;  4K0X A;  4GOG A;  5KIZ A;  4DJ3 A;  2GZA A;  1XJ6 A;  2ZMF A;  1FOF A;  4Q0I A;  5FQM A;  1GSX A;  1KVM A;  4FH2 A;  2I72 A;  2K2N A;  4ZJ2 A;  3GR2 A;  3MXR A;  5EVI B;  1LLB A;  4C3Q A;  2BLS A;  3D3O A;  4Y5F A;  2ZMA A;  2MJ6 A;  4F3L A;  3WS2 A;  4WZ5 C;  3PR6 A;  5AQ9 A;  2M7V A;  1PNE A;  2KLI A;  4P0M A;  4MN7 A;  2JKT M;  2B95 A;  3WS1 A;  5EVI C;  4HP9 A;  1K55 A;  2KDK A;  4ZBE A;  4PPR A;  3CIT A;  4S2K A;  2Y2P A;  3FV7 A;  3PBR A;  1K25 A;  2WZX A;  5E2G A;  5L8M A;  4IJG A;  3AGD A;  4PM7 A;  1VET B;  1FIL A;  2HP5 A;  3V5M A;  4B9O A;  1ES2 A;  3C5A A;  1I2S A;  3CUE C;  3QHY A;  1JWZ A;  4DMZ A;  4N9K A;  3VSL A;  3IHB A;  4JGO A;  2JC7 A;  3WS0 A;  4R70 A;  1FQG A;  2H28 A;  1CEF A;  3OPH A;  3W4O A;  2VX8 A;  4BBV A;  4HP4 A;  1GCE A;  1C3B A;  4GHI A;  2OV5 A;  4BL2 A;  3CHW P;  2PBY A;  4WL9 A;  2VV8 A;  4HIA A;  5A90 A;  3IWO A;  4KQD A;  3ZNY A;  3ZG9 B;  5EUA A;  4FH4 A;  1KE3 A;  1XXM A;  3RJU A;  1ODV A;  2FFF B;  2WAF A;  3M2K A;  4ARZ B;  5FEF A;  3VOL A;  3N8S A;  3K2N A;  3RXW A;  3N6I A;  1IEL A;  4NG2 A;  1XGI A;  2Q0O A;  2EXB A;  1PWG A;  2JCH A;  4UEY A;  5C5K A;  4GD8 A;  3TOI A;  3LY3 A;  4Y0T A;  2EA9 A;  3SH7 A;  1K54 A;  2EFX A;  5E2E A;  1FCM A;  3VFH A;  2GJ3 A;  5EVL A;  2P74 A;  1H8M A;  4L0L A;  4LGW A;  3HCY A;  3JVU A;  3GSG A;  1LHY A;  1OTE A;  3W8K A;  5L07 A;  3A3J A;  3MSH A;  2ZQ9 A;  4YIN A;  2IA2 A;  4N1H A;  5HAR A;  1L0E A;  2K7S A;  5GLB A;  3O88 A;  2WUQ A;  2P04 A;  2WKQ A;  4KG5 A;  4C6Y A;  1UWN X;  3FPW A;  2O9B A;  3JYI A;  3PBT A;  3EWK A;  1Y54 A;  3K3D A;  4JPM A;  2Y2L A;  3LEQ A;  2A24 B;  3TE8 A;  3BRM A;  1OPX A;  1OTI A;  1YSP A;  3P09 A;  3UE0 A;  5DF9 A;  3HLC A;  3ZGA B;  4GZB A;  4E3L A;  3VE4 A;  4EWF A;  1NRJ A;  2ZLY A;  2PBD P;  1GA0 A;  3BLS A;  5DFY A;  5AJG A;  3RTY A;  2Y4A A;  5KZH A;  3CPT B;  1P0Z A;  2HPB A;  2Z6D A;  3UPN A;  3E98 A;  3IWI A;  1SHV A;  3DAV A;  3UE1 A;  3UE6 A;  3MZF A;  4EBN A;  1MWR A;  3JVV A;  5E2F A;  3H7W B;  1N9B A;  4JGP A;  2H5S A;  2DCF A;  3LIA A;  4MLL A;  3MBZ A;  3UB9 A;  3G35 A;  3CJM A;  1J9M A;  3BFC A;  5IU1 A;  4MDZ A;  3S7P A;  1F5M A;  1BTL A;  2ZQD A;  1FSW A;  2KX6 A;  2HV1 A;  1GHP A;  1PRQ A;  3CPT A;  3FG8 A;  3NC8 A;  2V0U A;  2VZW A;  1XJ4 A;  2OAP 1;  5EM0 A;  1FR6 A;  3CG5 A;  4EEU A;  1P9W A;  4Y13 A;  4BQM A;  4EQ1 A;  5I5L A;  3IF6 C;  1GSW A;  2J8Y A;  3PBQ A;  1JWV A;  1WE4 A;  4RX2 A;  1XX2 A;  2ZMV A;  3E4O A;  4I38 A;  4S2P A;  2R9X A;  3F1N B;  4NXF A;  2XEP A;  3BFF A;  4GD6 A;  5CHJ A;  5A8B A;  4FOF A;  4GDB A;  4WYY A;  4JKT A;  3DTI A;  2O99 A;  2J7V A;  3LR3 A;  4OQG A;  4S2O A;  1SZV A;  2WAE A;  4FCF A;  2YKF A;  1P97 A;  2V9A A;  3HUN A;  5J3W A;  4OQH A;  3CLO A;  1ERM A;  4R3B A;  5FQQ A;  2Y2H A;  1OT9 A;  5IHV A;  2Y55 A;  2DRW A;  2XD1 A;  4ETZ A;  3W2Z A;  2VV6 A;  1OJG A;  3M6B A;  2R9W A;  4X1M A;  1YAX A;  5D3O A;  4PKY G;  1JTD A;  1ZG4 A;  1FCN A;  2V1Z A;  4CLC B;  4WEL A;  5F5Y A;  3SH9 A;  3P7N A;  1MKM A;  1S1Z A;  4IUK A;  4R3A A;  2W1T B;  3OLO A;  1KGE A;  4R23 A;  1OTA A;  2V0W A;  2ZOH A;  3F1N A;  3VE3 A;  3BM6 A;  1T18 A;  3PBN A;  1YMS A;  3EGD C;  2VGL S;  3H9W A;  4CLC C;  2NUP C;  4UAA A;  3GDI A;  5F6A A;  5HSQ A;  2LB5 A;  3BJN A;  3OZH A;  5EOO A;  2UWX A;  2EX2 A;  3GV9 A;  1UGU A;  4WEK A;  3N4I A;  1PW8 A;  1WYC A;  1H8Z A;  3GRJ A;  2WKE A;  4X55 A;  4UA9 A;  3OBF A;  1HZO A;  1NRF A;  4OVD A;  1CI8 A;  4P6B A;  5CHU A;  4LV0 A;  3T4L A;  3Q7V A;  3UB6 A;  4LV2 A;  3FPV A;  3C2W A;  1E3U D;  3HLF A;  3E4P A;  1DJA A;  3SW1 A;  4GB7 A;  4RX3 A;  3IX8 A;  5F68 A;  1LI0 A;  2M7U A;  2A24 A;  3U2A A;  1MWT A;  1QMF A;  3OPR A;  3G32 A;  5U47 A;  3UO9 A;  2QYB A;  1U60 A;  1WYB A;  2ZQ8 A;  2ZC7 A;  4FTX A;  1YT4 A;  1CK3 A;  1S4S A;  1S0W A;  2WK0 A;  5A91 A;  3FZC A;  1Z09 A;  3L7H A;  2XLN A;  5M18 A;  3HLD A;  4PHT A;  3V3S A;  3IH8 A;  5J4E A;  2HDQ A;  3NI9 A;  1CF0 A;  1I5Q A;  3MKE A;  5GHZ A;  3D4F A;  5F69 A;  2D01 A;  2KOI A;  3MFX A;  4WMC A;  3Q1F A;  5A93 A;  1EWZ A;  1TS0 A;  3I7J A;  3ISG A;  4LEN A;  2EWW A;  5CTM A;  5A92 A;  1NLY A;  3SS5 A;  4Y7P A;  1A0K A;  4IUH A;  3TG9 A;  3LR0 A;  5HDD A;  3TRC A;  3VP1 A;  4HJ6 A;  3C4O A;  1ONG A;  4WUJ A;  1LL9 A;  4QHC A;  2V20 A;  4P6Z M;  4IVI A;  2G2U A;  1KVL A;  3IX3 A;  4JXG A;  4JGR A;  3EQU A;  3IF6 A;  4UA7 A;  4CLC A;  3UPO A;  4JBF A;  3T12 B;  4GDN A;  3V67 A;  5HX9 A;  4KZA A;  2JBF A;  4HEF A;  4R0Q A;  1SDN A;  3UDI A;  2QMI A;  3ZQ5 A;  5EE8 A;  5G4Z A;  4BWI A;  5HWW A;  2QWS A;  4O8G A;  1YLJ A;  3T1X A;  3GEC A;  1BZA A;  2Y8H A;  1G5U A;  5GLC A;  3HLB A;  3GTC A;  3VOZ A;  2DNS A;  4I3A A;  2GDN A;  2V1A A;  5GL9 A;  1JNU A;  3WWX A;  1Q2P A;  3DTM A;  4WLA A;  2Y2M A;  1K6S A;  1XKZ A;  4HH2 A;  3PBS A;  4II7 A;  3WS4 A;  2A2L A;  3T4S A;  4ZJ1 A;  3BYD A;  4O0P A;  2PYP A;  4KZ8 A;  1QME A;  3ZYT A;  3MF0 A;  3SS4 A;  4B88 A;  2ZQ7 A;  3HLW A;  3RXX A;  2VGJ A;  4BD0 A;  2LB9 A;  2XR0 A;  4IHQ A;  1F2K A;  1YSQ A;  1LSV A;  1NLZ A;  5CTN A;  1OJ5 A;  1ONH A;  4OLD A;  2J80 A;  3V50 A;  1BLP A;  2PD7 A;  1W5D A;  4IED A;  5FSR A;  3Q7V B;  4OPY A;  2Y79 A;  4LFU A;  2OSU A;  1ERQ A;  3DWK A;  1ZKJ A;  2WGW A;  2XSS A;  3C4P A;  1L0D A;  1S4R A;  5CGX A;  5G18 A;  1ZG6 A;  1K56 A;  5BOH A;  4G3K A;  1G6O A;  3T4J A;  4FUW A;  2VV7 A;  3IS2 B;  1BUL A;  4QJG A;  5CX7 A;  5DKL A;  4MBH A;  4PMA A;  1L3L A;  4KZ5 A;  4DE1 A;  4K91 A;  4WF0 A;  1K55 C;  1TVF A;  3IHA A;  3E2K A;  3HBR A;  3M6H A;  3HVF A;  1KE4 A;  3IWQ A;  3PAG A;  4JF4 A;  5FQJ A;  4PM8 A;  1IYQ A;  3UMD A;  1JWP A;  4YWZ A;  2FFY A;  4JXW A;  1KOU A;  3B33 A;  3HLE A;  4GHI B;  2G7U A;  5F83 A;  1KE0 A;  2XD5 A;  4E3K A;  4U0T A;  3UPP A;  3KSG A;  4WZ4 A;  3G2Z A;  3TJZ C;  2ZC3 B;  5HPF A;  3NDE A;  5F82 A;  3VP4 A;  1ESU A;  4MEZ A;  5F1G A;  4PKY A;  1IYS A;  4E3I A;  2O0Y A;  1IKI A;  1I2W A;  4MMN A;  1YPR A;  2JKG A;  4KQQ A;  3QP2 A;  3G4P A;  3IXH A;  2ZM2 A;  2C6W B;  3ZG0 A;  5HWT A;  4EUV A;  4OPQ A;  2RL3 A;  1YLP A;  1ES5 A;  3ZG8 B;  3PYP A;  5FAT A;  1SDE A;  1E25 A;  2QKP A;  3EQV A;  3ZHH A;  5AQA A;  5DKK A;  2WKP A;  1NZU A;  5LBR A;  3P98 A;  3Q82 A;  4EU0 A;  3NUL A;  1M40 A;  4GNU A;  3NBL A;  2W3F A;  4QD4 A;  2J3T C;  3ZG5 A;  4CQH A;  1GHI A;  4S2N A;  5AQ7 A;  3IS2 A;  4P6Z S;  4LV1 A;  1BLS A;  1MPL A;  3HUO A;  4OH0 A;  4LRX C;  2XF3 A;  4H8R A;  2AVX A;  3CAX A;  3M2J A;  5AQB A;  2JKT I;  4OP5 A;  3N8R A;  3A0S A;  4YFM A;  4HJ3 A;  3MS6 A;  5HD3 A;  5KSC A;  4DDS A;  2JE5 A;  1TS7 A;  1H5X A;  1PI5 A;  3UME A;  3S7N A;  5FAS A;  3T4Q A;  1D1J A;  4Q8I A;  1SKO B;  3VMA A;  2VA0 A;  3TW8 A;  2ZBB A;  3T4T A;  5KMW A;  4R6L A;  4X68 A;  1FSY A;  1VEU A;  2Y2O A;  5DF8 A;  5E2H A;  2VEA A;  3LR4 A;  1IYP A;  1EI5 A;  2Z2M B;  1S6R A;  3BFE A;  5FAQ A;  5GLA A;  2W3H A;  3QNB A;  3QP8 A;  2EX6 A;  1TDL A;  4EES A;  4KQR A;  1PIO A;  3GQZ A;  1STZ A;  4MBK A;  2FZ0 A;  4ME4 A;  1BLC A;  3F1P B;  4EBP A;  4MBF A;  3NOU C;  1LT0 A;  3G34 A;  2JKR I;  2EX8 A;  3BQ8 A;  5MC7 A;  2JN7 A;  3PXP A;  1UWP X;  3DTK A;  1VQQ A;  2WKR A;  1P9R A;  4WMC D;  1PWD A;  3IXD A;  1N4O A;  3VOY A;  4K08 A;  3VSK A;  5EVI A;  2OAQ 1;  4CPK A;  5HWV A;  3KYE A;  5TGF A;  4WN5 A;  4PM9 A;  2O9C A;  2JKF A;  4IBR A;  4D60 A;  1TF1 A;  4KUO A;  5CER A;  2PYR A;  2V8C A;  4LRZ E;  4L9F A;  3BW6 A;  4CLC E;  3BLM A;  4AFI A;  3H82 A;  4OOY A;  1PI4 A;  4LV3 A;  3LGO A;  5L09 A;  4O01 A;  3C7V A;  2C5W B;  4G3V A;  4Y2F A;  3SH8 A;  5FI7 A;  3IBJ A;  1MY8 A;  4I3I A;  4HY8 A;  1W79 A;  2XGN A;  1J3W A;  4JF5 A;  4WBG A;  4OLG A;  3BY8 A;  4NXE A;  1ZTU A;  5FDH A;  5EOE A;  1ES3 A;  3TSG A;  2QJ7 A;  4WZ5 A;  1KDS A;  3LY4 A;  3OC2 A;  4L9G A;  1YLW A;  4DDY A;  3OPL A;  4E04 A;  3ITA A;  3L9K A;  4YOF A;  1W8Q A;  5DTS A;  3QP5 A;  3NOT C;  3UDF A;  3S22 A;  2XA7 M;  5G4Y A;  2HP9 A;  1L0F A;  2WAD A;  4OOL A;  4QY5 A;  2EWV A;  4KZB A;  5EEC A;  2DMW A;  5I94 A;  3ZVT A;  5HPI A;  1IFQ A;  1IOU A;  1IYO A;  1S66 L;  3DBA A;  3KX0 X;  1TDG A;  1RGZ A;  5FAO A;  5HDC A;  2ZOI A;  4K0W A;  2E8I A;  1S67 L;  4G3W A;  4HOI A;  4ZTK A;  4LCM A;  5M19 A;  4U3T A;  3O3V A;  3QP1 A;  3CMZ A;  3IF5 A;  5DJU A;  3E2L A;  1S1Y A;  5IS1 A;  5HW3 A;  1VET A;  1OTD A;  5J8X A;  4QY6 A;  4N9L A;  5HAQ A;  2W3D A;  4R4S A;  3S7O A;  1SCW A;  3HJI A;  4DF6 A;  2X02 A;  3KSI A;  2WGW B;  4OQI A;  1LSW A;  2Y2G A;  3LO7 A;  1HD8 A;  2Y2N A;  3BEC A;  1PFL A;  2PR6 A;  4BMW A;  5CED A;  4F3L B;  3C38 A;  4NET A;  3KYZ A;  1YM1 A;  3MZE A;  3RFB A;  4LRY C;  5HD5 A;  4X1L A;  2M1C A;  1T1A A;  4CJN A;  4GW9 A;  4Y17 A;  3W4Q A;  2PHY A;  3LIB A;  3IBR A;  1Y28 A;  4HI4 A;  4OPZ A;  3MQ0 A;  2L1M A;  4KG6 A;  3R7W A;  4DJ2 A;  2W0N A;  3T4O A;  4Q0J A;  4OOM A;  1VEU B;  4FD8 A;  3IT9 A;  2YKH A;  4L9E A;  4NEE D;  3EEA A;  2O9A A;  3GMW A;  3UNW A;  2H10 A;  1XPB A;  1XJ3 A;  2Q9M A;  1NYY A;  3JPU A;  5EM1 A;  1NXY A;  4R4R A;  3NHQ A;  4KZ6 A;  3LI9 A;  2HF6 A;  4GJ4 A;  4HHD A;  3HRE A;  1XA7 A;  1OME A;  1K56 D;  2Q9N A;  1SKO A;  1Y4O A;  2Z2L B;  4DE3 A;  4X25 A;  3B42 A;  1AWI A;  3NJA A;  1MBL A;  1DY6 A;  3A3E A;  3S4X A;  2J3W A;  5CGW A;  4UHU A;  4N1X A;  4CLC D;  1KDW A;  4ESP A;  4HQA A;  2EX9 A;  2RCX A;  4RVA A;  4XUZ A;  2WKI A;  4ZJ3 A;  5HAI A;  4MN5 A;  5DJT A;  3LYX A;  2Z6C A;  5CXW A;  4EXO A;  1XFN A;  2VKS A;  5TBM B;  1VB6 A;  3VV4 A;  5J7E A;  5GHY A;  4HES A;  5HDS A;  3NDG A;  5EFW A;  1ACF A;  5TFQ A;  4LCL A;  4S2J A;  3W4P A;  2FH5 A;  2BAS A;  2PR5 A;  5CRF A;  1CI9 A;  4MN6 A;  4QU3 A;  4I39 A;  1LL5 A;  4JF6 A;  4R3J A;  1NYM A;  4A5R A;  1H0M A;  3LUQ A;  4NXB A;  4DE2 A;  4R38 A;  3PBO A;  3KYQ A;  5JYO A;  1OTB A;  4HJ4 A;  2OWJ A;  4N92 A;  2XH9 A;  1YLT A;  3NCK A;  4I5S A;  5HFO A;  4OON A;  4DRT A;  3G31 A;  2XRN A;  4BLM A;  4Y0O A;  4OQ0 A;  1ES4 A;  5TBM A;  2P9V B;  3O87 A;  3HL9 A;  3V3R A;  3C7U A;  1XFQ A;  3S7Q A;  3DTE A;  4PAU A;  2GX5 A;  2VLG A;  4HBT A;  2XFT A;  3D9Y A;  4NXG A;  2Y2Q A;  3ZG7 B;  5JYP A;  5F1F A;  5GHX A;  1MKI A;  3H82 B;  1F98 A;  1MXO A;  4PM5 A;  4ZAM A;  4O7D A;  5IT5 A;  4EW7 A;  1N9L A;  2P08 A;  2XK1 A;  2V2F F;  3A3D A;  1TS6 A;  4XUX A;  3C30 A;  1XA1 A;  4PM6 A;  3T1R A;  2QZ6 A;  2INW A;  4LPZ A;  1ZC2 A;  5L2F A;  2ZD8 A;  4FSF A;  2XQZ A;  2CMN A;  4GCZ A;  3E4Q A;  2A49 A;  5KSH A;  3CI6 A;  1K54 C;  3A0R A;  3WS5 A;  4NKP A;  4B93 A;  1BLH A;  1LL8 A;  1ALQ A;  1NJ4 A;  1XP4 A;  4DXC A;  2B02 A;  1Z6F A;  5L10 A;  1H8Y A;  4UA6 A;  4DKI A;  3G2Y A;  1O07 A;  1PWC A;  3IQA A;  1AXB A;  2VK3 A;  3D72 A;  5FQI A;  1PZO A;  3CWF A;  4GS9 B;  3UY6 A;  1HVB A;  4HH3 A;  4BL3 A;  3OCL A;  1W8Y A;  2L0W A;  4P87 A;  2X71 A;  2ZC6 B;  4IVK A;  3B47 A;  2R78 A;  2W1T A;  3MJQ A;  2IWB A;  1W63 M;  3IH9 A;  2HDU A;  2J9O A;  2EXA A;  3LR5 A;  1ESI A;  3WRZ A;  4IBX A;  1RP5 A;  1T19 A;  3MQQ A;  5DTT A;  3VP2 A;  1X0O A;  2E8J A;  4YNR A;  4Z1W A;  3G6O A;  3RH8 B;  2HGV A;  1DJC A;  3MXS A;  1FR1 A;  4E6X A;  4P85 A;  1K4E A;  3E0Y A;  3LIC A;  4KZ4 A;  3LCE A;  3T1S A;  2BTF P;  3EEH A;  2ACG A;  3UDX A;  1VHM A;  3DW0 A;  5FL3 A;  3ICY A;  5FEG A;  3V39 A;  1BT5 A;  3GVB A;  3B3X A;  5CHM A;  4KZ7 A;  1SKF A;  2UV0 E;  1G68 A;  5HL6 A;  5FQ9 A;  1T1B A;  4MNR A;  1N9O A;  1WA9 A;  2J9P A;  3EGX C;  4XT2 A;  4NK3 A;  3VP3 A;  4JXV A;  4Q0H A;  3LFV A;  4S2I A;  1BYW A;  4GKU A;  5TJJ A;  3MMH A;  2ZJ9 A;  5DF7 A;  3DWZ A;  1K6R A;  2XA7 S;  4Y15 A;  1IEM A;  2HJE A;  4H6J B;  2W3E A;  4B4X A;  2V8F A;  4EEP A;  1VM1 A;  2H0Y A;  2VGK A;  4WEJ A;  1CJF A;  1NY0 A;  2PDR A;  3QP4 A;  2Y2J A;  1L2S A;  2OWH A;  3IXG A;  4BBT A;  2VJW A;  5HL1 A;  5DTK A;  5FA7 A;  2WZZ A;  3BY9 A;  5FAP A;  4D2O A;  3VFF A;  2XRO A;  2ZQA A;  1XGJ A;  2K31 A;  1V9Y A;  1KGF A;  5TR7 A;  3CUE A;  3FKW A;  2JKR M;  4Y3I A;  3FC7 A;  5AVE A;  1KGG A;  1M6K A;  3MQO A;  5DFX A;  3G30 A;  1N9N A;  3S1Y A;  4JXS A;  1GSV A;  2L4R A;  1MZU A;  1RGY A;  2IWD A;  3MXQ A;  5GLD A;  4X56 A;  2ZL1 B;  3BQA A;  2PD8 A;  4DE0 A;  1HLU P;  3FWL A;  4QPR A;  3MR0 A;  5EVI D;  3ZFZ A;  3R4K A;  3NOP C;  3F1O A;  3N7W A;  4BBU A;  5E43 A;  1BUE A;  2ZC5 B;  2OLV A;  1W7F A;  1YQS A;  3ZCZ A;  2I9V A;  1HTZ A;  4BJP A;  2B18 A;  3H7W A;  3NIA A;  4OP8 A;  1K4F A;  2Y2K A;  3EOI A;  4X69 A;  3AGF A;  3BWL A;  2PT7 A;  4KUK A;  5K5B A;  4GLQ A;  2B5R A;  2BG1 A;  4ETX A;  2PRF A;  1DP9 A;  1K38 A;  4RA7 A;  3C8C A;  1RCJ A;  3R7W B;  2W27 A;  2WGI A;  3LIF A;  3HJK A;  5FQK A;  3T50 A;  3IF6 B;  3NY4 A;  5CEB A;  3F1P A;  3T4K A;  1PYY A;  3NEC A;  2VGL M;  4KG2 A; 
#chains in the Genus database with same CATH homology
 4EET B;  2XSS A;  5DF9 A;  3NHQ A;  5HZH A;  3LI9 A;  1S4R A;  2HF6 A;  4GJ4 A;  4HHD A;  4DN0 A;  3VE4 A;  3B42 A;  1NRJ A;  4UQI S;  1V9Z A;  4G3K A;  3NJA A;  1G6O A;  2GNX A;  2J3W A;  3T4J A;  2VV7 A;  3KSH A;  3PHY A;  3IS2 B;  5DFY A;  2V1B A;  5AJG A;  3LI8 A;  5CX7 A;  5DKL A;  3RTY A;  4CLC D;  4HQA A;  4WF0 A;  1P0Z A;  3LIE A;  2Z6D A;  3E98 A;  4GS9 A;  4LLO B;  4MN5 A;  3LYX A;  5DJT A;  2Z6C A;  4EXO A;  1XFN A;  2VKS A;  5TBM B;  1VB6 A;  3UE6 A;  3VV4 A;  4KQO A;  5J7E A;  3UMD A;  3JVV A;  3H7W B;  3UE3 A;  4YWZ A;  4JGP A;  3LIA A;  5HDS A;  5EFW A;  1KOU A;  3B33 A;  4GHI B;  3UB9 A;  2G7U A;  5IU1 A;  4MDZ A;  3S7P A;  3KSG A;  1F5M A;  2FH5 A;  2BAS A;  2PR5 A;  1DP6 A;  4MN6 A;  4I39 A;  3K3C A;  2KX6 A;  2HV1 A;  3TJZ C;  5HPF A;  4ZRR A;  3LUQ A;  4NXB A;  3FG8 A;  1NWZ A;  4R38 A;  2V0U A;  3PBO A;  3F1O B;  2VZW A;  4PKY A;  1XJ4 A;  3KYQ A;  2O0Y A;  1OTB A;  4HJ4 A;  4HNB A;  2OWJ A;  2OAP 1;  4EEU A;  1P9W A;  4I5S A;  4MMN A;  1H3Q A;  2HJ9 C;  4EQ1 A;  2XRN A;  5HWT A;  5I5L A;  4EUV A;  1GSW A;  5TBM A;  3PYP A;  3PBQ A;  2QKP A;  3EQV A;  5DKK A;  2WKP A;  2ZMV A;  1XFQ A;  3S7Q A;  3E4O A;  4I38 A;  3F1N B;  4NXF A;  1D06 A;  5LBR A;  4PAU A;  2GX5 A;  4EU0 A;  1W63 Q;  2VLG A;  1OT6 A;  4NXG A;  5A8B A;  4FOF A;  2W3F A;  1TD5 A;  1F9I A;  2J3T C;  3H82 B;  1F98 A;  4CQH A;  2O99 A;  1TS8 A;  3ULF A;  5IT5 A;  3LR3 A;  4EW7 A;  3IS2 A;  4P6Z S;  1D7E A;  1N9L A;  4XT2 B;  2P08 A;  3UB8 A;  4LRX C;  1G28 A;  2YKF A;  3CAX A;  1P97 A;  1TS6 A;  2V9A A;  2OOL A;  3C30 A;  2JKT I;  2NUT C;  3A0S A;  3P01 A;  4HJ3 A;  5J3W A;  3CLO A;  5HD3 A;  3A0V A;  1TS7 A;  1OT9 A;  3OOV A;  2INW A;  4LPZ A;  4H6J A;  3UME A;  3S7N A;  3LID A;  4FSF A;  3T4Q A;  4GCZ A;  1ZHH B;  2CMN A;  4MCW A;  3E4Q A;  5KSH A;  2P7J A;  3CI6 A;  3A0R A;  4ETZ A;  1T1C A;  4NKP A;  3W2Z A;  4B93 A;  2VV6 A;  1LL8 A;  1OJG A;  1YAX A;  4PKY G;  2VA0 A;  3TW8 A;  2ZBB A;  4CLC B;  4WEL A;  3T4T A;  3KO6 A;  2B02 A;  4R6L A;  5F5Y A;  2W1R A;  2VEA A;  3P7N A;  1MKM A;  3LR4 A;  1S1Z A;  2J3T D;  4IUK A;  4R3A A;  2W1T B;  3OLO A;  1MC0 A;  3D72 A;  1OTA A;  4I3J A;  2JHE A;  3CWF A;  4GS9 B;  2V0W A;  2ZOH A;  3F1N A;  4HH3 A;  3VE3 A;  3OCL A;  2L0W A;  1T18 A;  2W3H A;  3PBN A;  1YKD A;  4EES A;  3B47 A;  3EGD C;  2R78 A;  2VGL S;  3H9W A;  2W1T A;  3OCN A;  2NUP C;  4CLC C;  3MJQ A;  1STZ A;  2FZ0 A;  4ME4 A;  3F1P B;  1W63 M;  3GDI A;  3NOU C;  1LT0 A;  5F6A A;  4JGQ A;  5HSQ A;  2LB5 A;  1XJ2 A;  3BJN A;  3LR5 A;  2JKR I;  3BQ8 A;  2W3G A;  1T19 A;  5MC7 A;  3MQQ A;  2JN7 A;  3PXP A;  1UGU A;  4WEK A;  1UWP X;  4UQI M;  2WKR A;  1X0O A;  1P9R A;  1DRM A;  4YNR A;  3KSF A;  4ARZ A;  4Z1W A;  4M4X A;  3G6O A;  3RH8 B;  2HGV A;  4K08 A;  2OAQ 1;  3OBF A;  5HWV A;  3E0Y A;  4WN5 A;  3LIC A;  3T4L A;  1LSX A;  3UB6 A;  2O9C A;  1DP8 A;  5AVF A;  1TF1 A;  2D02 A;  3FPV A;  2QJ5 A;  3C2W A;  3E4P A;  3UB7 A;  4KUO A;  3EEH A;  3SW1 A;  1EW0 A;  2PYR A;  4LRZ E;  1VHM A;  5F68 A;  4L9F A;  5FL3 A;  4RQ9 A;  2M7U A;  2A24 A;  3U2A A;  3ICY A;  3BW6 A;  3O5Y A;  4CLC E;  4EER A;  4AFI A;  3H82 A;  2QHK A;  2QYB A;  5KIZ A;  4DJ3 A;  4O01 A;  2GZA A;  1XJ6 A;  5HL6 A;  2ZMF A;  1S4S A;  4G3V A;  4Y2F A;  1T1B A;  4Q0I A;  1N9O A;  1GSX A;  1WA9 A;  3EGX C;  3IBJ A;  2K2N A;  4XT2 A;  4I3I A;  4Q0H A;  3LFV A;  1BYW A;  4HY8 A;  4PHT A;  5TJJ A;  3MMH A;  5J4E A;  3D3O A;  3BY8 A;  4NXE A;  1ZTU A;  2XA7 S;  4Y5F A;  5F69 A;  2MJ6 A;  2HJE A;  4F3L A;  4H6J B;  2QJ7 A;  2D01 A;  2KOI A;  3OC2 A;  2W3E A;  3PR6 A;  4L9G A;  3MFX A;  2M7V A;  2KLI A;  1TS0 A;  4MN7 A;  4EEP A;  4E04 A;  2JKT M;  4WEJ A;  2EWW A;  4HP9 A;  4YOF A;  1NLY A;  2PDR A;  2KDK A;  3NOT C;  3CIT A;  2OWH A;  4BBT A;  2VJW A;  3PBR A;  4IUH A;  2XA7 M;  5G4Y A;  3LR0 A;  5HDD A;  3TRC A;  4HJ6 A;  4OOL A;  5L8M A;  2EWV A;  3BY9 A;  4IJG A;  4WUJ A;  2XRO A;  2DMW A;  4P6Z M;  4B9O A;  5HPI A;  1IFQ A;  4JGR A;  2K31 A;  1V9Y A;  1IOU A;  3EQU A;  1S66 L;  3KX0 X;  3DBA A;  3CUE A;  3CUE C;  2JKR M;  4Y3I A;  4CLC A;  3FC7 A;  5AVE A;  4DMZ A;  5HDC A;  2ZOI A;  3V67 A;  3MQO A;  5DFX A;  4JGO A;  1N9N A;  1S67 L;  4G3W A;  4R70 A;  2H28 A;  1GSV A;  4HOI A;  2L4R A;  1MZU A;  2VX8 A;  4BBV A;  3MXQ A;  4HP4 A;  3BQA A;  3ZQ5 A;  4GHI A;  2PD8 A;  5DJU A;  4WL9 A;  2VV8 A;  4HIA A;  5G4Z A;  1S1Y A;  4KQD A;  5IS1 A;  4QPR A;  4BWI A;  5HWW A;  1OTD A;  2QWS A;  4O8G A;  1ODV A;  3MR0 A;  3GEC A;  2W3D A;  3S7O A;  3R4K A;  4ARZ B;  3VOL A;  2Y8H A;  3NOP C;  3HJI A;  3F1O A;  3KSI A;  3K2N A;  4BBU A;  1LSW A;  4I3A A;  2V1A A;  1JNU A;  2PR6 A;  2I9V A;  4BMW A;  4WLA A;  4UEY A;  5C5K A;  4F3L B;  3C38 A;  4BJP A;  3KYZ A;  2EA9 A;  2B18 A;  3H7W A;  3RFB A;  4LRY C;  4HH2 A;  2GJ3 A;  3PBS A;  5HD5 A;  4II7 A;  1H8M A;  2A2L A;  4L0L A;  3EOI A;  3T4S A;  3HCY A;  3JVU A;  2M1C A;  1T1A A;  4O0P A;  2PYP A;  1OTE A;  4GW9 A;  3BWL A;  2PHY A;  3ZYT A;  3LIB A;  3IBR A;  2PT7 A;  3MF0 A;  1Y28 A;  4KUK A;  5K5B A;  4HI4 A;  2IA2 A;  4GLQ A;  3MQ0 A;  2L1M A;  3R7W A;  4DJ2 A;  2K7S A;  4ETX A;  2P04 A;  2WKQ A;  2LB9 A;  2W0N A;  3T4O A;  1DP9 A;  1UWN X;  4Q0J A;  3FPW A;  2O9B A;  4IHQ A;  3PBT A;  1YSQ A;  3EWK A;  1LSV A;  4OOM A;  1NLZ A;  3K3D A;  3C8C A;  2YKH A;  4L9E A;  1OJ5 A;  4NEE D;  3EEA A;  3R7W B;  2J80 A;  2W27 A;  2O9A A;  2PD7 A;  3LIF A;  3HJK A;  3T50 A;  2A24 B;  3F1P A;  3T4K A;  1XJ3 A;  3TE8 A;  2Y79 A;  1OPX A;  1OTI A;  1YSP A;  2VGL M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...