2CMNA

A proximal arginine residue in the switching mechanism of the fixl oxygen sensor
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
117
structure length
117
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISAYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Proximal Arginine R206 Participates in Switching of the Bradyrhizobium Japonicum Fixl Oxygen Sensor
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Transferase
molecule keywords SENSOR PROTEIN FIXL
total genus 33
structure length 117
sequence length 117
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2cmnA00
1UWPX 3UB7A 4L9FA 4WN5A 2VEAA 3F1OA 4HQAA 5I5LA 4PKYA 3UB6A 1OTDA 1OT9A 1KOUA 1T19A 3LUQA 5J3WA 3UMEA 2WKRA 1T18A 1S4SA 1T1BA 4GHIA 1DP6A 3NOUC 4LPZA 2R78A 3IS2B 1TS0A 3UE6A 4HHDA 4I5SA 4KUOA 4EW7A 3BY8A 5F69A 2M1CA 3MFXA 3T50A 5HDCA 4HJ4A 5F68A 4EEUA 1XFNA 2PD8A 3F1OB 1XFQA 2PHYA 2V1AA 3BWLA 1P97A 3MXQA 4HJ6A 4HH3A 4HH2A 1S1YA 4R38A 3G6OA 4HNBA 4EXOA 3MQOA 3RTYA 5DJUA 1OTBA 1S66L 2I9VA 3LIEA 2A24A 4HJ3A 4HIAA 5HD5A 4B9OA 4L9EA 1DP8A 4E04A 1GSXA 2VV7A 2YKHA 1XJ3A 3LI8A 3EEHA 2BASA 1D7EA 3MQQA 3ZQ5A 2PYPA 4KQDA 3VE3A 4BBVA 5HWWA 1T1AA 2D02A 2V0UA 3LI9A 4M4XA 3SW1A 3H82B 4EESA 3LIAA 4KUKA 3C2WA 3EWKA 4JGRA 1LSXA 1N9NA 1LSWA 1LSVA 2HV1A 4LRYC 5EFWA 4XT2A 3UB8A 5HZHA 4GW9A 2JN7A 2KDKA 3GDIA 1JNUA 2PR5A 4WLAA 4HY8A 5J4EA 1OJGA 1X0OA 4H6JB 5A8BA 1P0ZA 5DKLA 5F6AA 4BBTA 2QJ7A 3NOPC 5G4YA 4LLOB 3P7NA 5IU1A 1XJ4A 4PKYG 3E4QA 1EW0A 4EETB 1G28A 4I38A 2K7SA 3F1NB 4WL9A 4R3AA 5HDDA 4HP4A 2J80A 4YWZA 1TS8A 5HSQA 2PD7A 4I3IA 2P7JA 4I39A 3KX0X 1F9IA 2KX6A 2QKPA 3C8CA 1OJ5A 2Z6CA 1D06A 1T1CA 1GSVA 4R70A 1VB6A 5HWTA 4H6JA 2V9AA 5F5YA 2QHKA 1OTIA 4HP9A 4JGPA 1DP9A 1UWNX 3K3DA 4R6LA 4WUJA 3RH8B 2L4RA 5AVEA 4HOIA 4EEPA 1MZUA 3ICYA 4GHIB 4MN6A 3ULFA 1DRMA 5HD3A 1ODVA 4XT2B 2V1BA 1NWZA 3UB9A 3IBRA 3B33A 4EERA 4I3JA 3CWFA 3K3CA 3LIDA 2W0NA 2ZOIA 3E4PA 4MN5A 4L9GA 4BBUA 4I3AA 3HJIA 5TBMB 4JGQA 5J7EA 2VV8A 3LIFA 2WKQA 3FG8A 4F3LB 1S67L 3LICA 2VV6A 3CAXA 3BY9A 3MR0A 5HWVA 3PYPA 3CLOA 2A24B 1GSWA 5AVFA 2JHEA 2OWHA 3A0VA 3LIBA 2CMNA 3LYXA 1OTEA 3H7WA 3UMDA 4NXBA 1OTAA 2OWJA 1N9LA 5IS1A 4NXEA 3F1PB 5TBMA 1UGUA 3HJKA 1LL8A 2V0WA 4DJ3A 4EQ1A 4GS9A 1OT6A 4HI4A 2OOLA 2VLGA 3H82A 3D72A 2Z6DA 3MJQA 5DJTA 5DKKA 2ZOHA 3IS2A 4LRZE 2EA9A 5KIZA 2L0WA 2YKFA 3PHYA 3OLOA 1LT0A 2INWA 2QJ5A 3NHQA 3FC7A 1N9OA 5HDSA 3H7WB 4NXFA 3VOLA 3F1PA 3H9WA 4K08A 2B02A 1F98A 4GS9B 1V9YA 1BYWA 3VE4A 1S1ZA 2D01A 2PYRA 4WF0A 4NXGA 2PDRA 3A0RA 4LRXC 5G4ZA 3NJAA 4DJ2A 4F3LA 2PR6A 2L1MA 2ZBBA 3E4OA 1XJ2A 3F1NA 4JGOA 1Y28A 3GECA 1TS7A 2H28A 1TS6A 1WA9A 1S4RA 1XJ6A 2GJ3A 2QWSA 3A0SA 3NOTC 2WKPA 1V9ZA 4GCZA 2W27A 4RQ9A
chains in the Genus database with same CATH superfamily
1UWPX 4FD8A 3SS3A 3R7WB 2R9WA 3C30A 4HHDA 3PAGA 2B18A 2G7UA 1XFNA 2K2NA 1XFQA 3E98A 1FSYA 1Y54A 1KE0A 3MBZA 2VK3A 2WAEA 1HZOA 3LI8A 4H8RA 2P9VA 1G6OA 4JLFA 4EESA 2P04A 4QY6A 1SKOB 4X55A 3IX3A 5TR7A 3HBRA 4S2MA 4HEFA 1OJGA 1X0OA 3N8RA 1K4FA 2W1TA 3S4XA 4R1GA 5DTSA 4KENB 4OOMA 4X1MA 2P7JA 1DJCA 1F9IA 5LBRA 4NG2A 3ITAA 4H6JA 4R6LA 4NETA 3QP6A 3IBRA 2ZOIA 4LFUA 3LIFA 3CAXA 3HUMA 5FQ9A 4GDBA 2Z2LB 3H7WA 2QZ6A 3D72A 3V50A 2V1ZA 1W7FA 5DJTA 3QP4A 2AVXA 1K0KA 4BD1A 1QMFA 5FQJA 1ES2A 1F98A 2O9CA 1G5UA 4II7A 1MXOA 1PWCA 3LR4A 2PU4A 4L9FA 4WN5A 3V39A 3HREA 1OTDA 2JCHA 1ZC2A 1NZOA 3UMEA 1EROA 5HAIA 4IUKA 1MWSA 3TJZC 4FUWA 5KSCA 5HD5A 4C6YA 4ARZB 1XKZA 2WZXA 2KOIA 3BQ8A 4IBXA 3LIAA 4KUKA 1N9NA 3EEAA 1S6RA 2EWVA 3O3VA 3IHAA 4GB7A 3HL9A 2QJ7A 3W2ZA 1K55C 1K56D 2H0TA 2OSUA 1ONGA 1GSVA 2FZ0A 3GQZA 2J3TD 1XX2A 3IH8A 4HOIA 4GHIB 3ZG8B 1BLPA 3K3CA 4WBGA 4YOFA 4NKPA 4I3AA 2OAP1 3LY3A 2DCFA 3IX4A 3UPNA 1W63M 1JTGA 2JHEA 4JXSA 3MXSA 1YLWA 4MCWA 4O01A 3T4TA 4P6ZS 1OT6A 1Z6FA 3LY4A 3IXBA 4UA9A 1LHYA 2ZM8A 2EA9A 3IWQA 2L0WA 3OLOA 3VOLA 3ZGAB 4PHTA 3NJAA 1IYQA 3BW6A 2PR6A 5FL3A 5FI7A 3RXWA 1FR6A 3FPWA 3TE8A 2VEAA 3OOVA 4PKYA 5GLAA 4C3QA 1Q2PA 2R78A 3IS2B 3QP1A 5E2GA 1FIKA 4EEUA 3WS2A 3D4FA 4D2OA 4HNBA 3MQOA 2Y2KA 2O0YA 4BENA 3VFHA 1GSXA 2GDNA 1IELA 3MQQA 2BASA 3LCEA 1VEUB 2W1TB 5J8XA 4Y3IA 2Y4AA 2RL3A 4S2KA 4LV1A 4KZ9A 3OCNA 4H6JB 2HP6A 4PM8A 1STZA 3LEZA 4B88A 5FASA 4WL9A 1A0KA 3CJMA 4LV0A 3UE1A 4HP9A 1YSQA 5CHJA 4X53A 3VMAA 4A5RA 1GA9A 1MC0A 4Y15A 1PIOA 3NDEA 3CWFA 4KQOA 4Y2FA 1YT4A 1HLUP 4IBRA 3FZCA 3JPUA 3BJNA 4WZ4A 5AQBA 2ZQ8A 4QJGA 1IYPA 3UMDA 3LEQA 2OWJA 4AFIA 4HI4A 2PBYA 3OZHA 4ETXA 3IXHA 3MMHA 1PI4A 2ZQDA 2ZQAA 4FH4A 3F1PA 3H9WA 4EUVA 3UE3A 2J9OA 1U60A 3HLEA 4KZAA 4EERA 1XGIA 5AVEA 4MNRA 1F2KA 4KQRA 1TS0A 3SS4A 3ZG9B 3OPRA 2P74A 2EX6A 4HJ4A 5FQQA 3Q07A 4E3KA 5KSHA 3MXQA 3F1OB 4HJ6A 4Y7PA 3RTYA 3KYEA 5DJUA 4P0MA 2PAVP 4HIAA 1YSPA 1DJAA 5GLCA 3W8KA 3H82B 4IVKA 1K55A 1K54A 5EFWA 4KZ7A 3BLSA 4OQGA 3HUNA 1JNUA 4DXBA 2O9BA 1TDLA 3GMWA 4ESPA 1XA7A 3SOIA 5CGSA 4DDYA 4P85A 3TOIA 1OJ5A 2WGIA 5CEBA 3ZVWA 4JKTA 3WS0A 2VJWA 1M6KA 1H8MA 3MF0A 1ODVA 3IXGA 5GLDA 1NZUA 3WRZA 4L9GA 3UNWA 2IA2A 2WKQA 4DRTA 4OKPA 2CC1A 3A0VA 3V3RA 2Y55A 4FTXA 3T4KA 3F1PB 4EQ1A 4Y5FA 3P98A 1XXMA 2JE5A 2GZAA 1KGFA 4R4RA 4IUHA 3UY6A 2I72A 2ZL1A 1BYWA 1H5XA 3MSHA 5L8MA 3D9YA 4OOYA 4PM7A 3EQUA 4GOGA 4HBTA 1PZOA 3UB6A 4QWOA 1T19A 5J3WA 4Y13A 4G3WA 1BULA 5JYOA 3BFEA 3EGXC 3HVFA 3MFXA 2M7UA 1K6RA 3G32A 3KSGA 3BWLA 2W3GA 2HP9A 4P6ZM 2JBFA 3T4SA 4B9OA 1JTDA 3PBOA 1XJ3A 3KO6A 4KQDA 2V0UA 4DE3A 4UQIM 2V2FF 2V8CA 1L0DA 4PM6A 3P01A 1E25A 1LI0A 3VP0A 3IF5A 3QP2A 4WLAA 3T4OA 2DRWA 3G34A 2XFTA 4E3JA 4NK3A 5HSQA 4HP4A 4X69A 1MY8A 4KZ8A 5L10A 1D06A 1BLCA 3CG5A 2J8YA 1WYCA 2LB5A 4WEKA 5HARA 1SZVA 1HVBA 4MN6A 1E3UD 4UA7A 5FAPA 3LIDA 5EOOA 1E4DA 3HUOA 2ZC5B 2G2UA 5EPHA 2HPBA 1TD5A 5L07A 3DWZA 5IS1A 5EVIA 2H10A 3OC2A 5TBMA 1UGUA 3MKFA 2Y2GA 1Y4OA 3DBAA 3WWXA 1ZG6A 3PHYA 2OLVA 3DWKA 3K2NA 1N9OA 5HDSA 3GRJA 1PRQA 3VE4A 1NRFA 3DW0A 4IEDA 4JGOA 4LCMA 4BL3A 2QWSA 4BL2A 3HJIA 3V67A 5FDSA 3F1OA 5M18A 1N4OA 1S4SA 1ACFA 2XDMA 4MLLA 2ZD8A 3DTMA 1IFQA 4K91A 5K5BA 4S2LA 3CITA 3HLDA 4Y0OA 1P97A 5F83A 1KGEA 1S1YA 2Y79A 2XR0A 4HJ3A 3L9KA 3ZFZA 5HWWA 3VE3A 1T1AA 4LENA 5EECA 3ZHHA 4JGRA 2E8JA 5EVIC 3NC8A 2W1RA 4MEZA 1SDEA 3NCKA 1AXBA 4WMCD 4EETB 2HJ9C 4MBKA 2KX6A 4RA7A 4ZJ3A 2WKIA 3WS4A 4MBHA 1VHMA 1K56A 5A93A 1FILA 1W79A 5TBMB 3PBSA 1FR1A 2Y2OA 3PR6A 2XROA 3MJQA 4P6BA 4YINA 4GN2A 5TJJA 1ESUA 1F5MA 1L0EA 4GZBA 2J3TC 1NLYA 1CEFA 4DJ2A 2IWCA 5GHXA 1BT5A 3QP5A 1L2SA 4IVIA 4FCFA 4QD4A 3OPLA 3AGEA 1YPRA 3NY4A 3Q7VB 3U4LP 3LUQA 5IT5A 3VOZA 1O07A 3BFGA 4GHIA 4S2JA 5FQMA 4OQHA 5DF9A 4CLCD 4KZ3A 4IHQA 4S2NA 4DKIA 2Y59A 3T1QB 2J3WA 4KQQA 2Y2QA 4EBNA 2A2LA 5E2HA 3QNCA 4XUZA 3GDIA 3O86A 1P0ZA 1NYMA 1BLSA 3L7HA 5D3OA 4PKYG 3LFVA 1PFLA 3A3IA 5FI2A 4Y17A 5E2EA 3N7WA 3MFDA 5HAPA 3OCLA 3ICYA 2WZZA 3OPHA 5CEDA 2W0NA 4ID4A 5F1GA 3LICA 2J7VA 3MR0A 5HWVA 1OMEA 5FQKA 4U3TA 2JKFA 3S7OA 1XA1A 3GV9A 3OBFA 2V0WA 2XSSA 2PU2A 3GTCA 5EUAA 2VGLM 1GHMA 1HD8A 5M19A 4MMNA 3PBQA 3C4PA 2PT7A 3A3JA 3KYZA 4DDSA 1IKGA 4OOLA 1TS7A 1WA9A 1XJ6A 4N92A 1OPXA 5CTNA 2VA0A 3VV4A 4S2OA 4PM5A 1KOUA 1K57C 5HL1A 2RCXA 5GHYA 2DMWA 3LR0A 3NOUC 1PW1A 1ZTUA 4OLGA 3N8LA 4B93A 3T1RA 3ZG7B 1CQAA 2EX2A 4CLCA 1CF0A 2UWXA 3N8SA 2FFYA 3ZQ5A 4ETZA 2A49A 3G2ZA 3CUEA 3B47A 3VP2A 2NUTC 5GHZA 4GW9A 1HTZA 3EGDC 2PR5A 1H0MA 1K25A 3EOIA 3LR3A 3MKEA 4LLOB 4DE2A 4GKUA 1XJ4A 2XFSA 3KSIA 2J80A 1FSWA 1T1CA 1BZAA 1E3UA 5F5YA 4JGPA 3IQAA 4EEPA 3IX8A 1MZUA 3ULFA 2ZC6B 1LL5A 1DRMA 3W4PA 4MN7A 3GVBA 3Q82A 4L0LA 5J7EA 5DF8A 3PYPA 3T1XA 1YLYA 2X01A 2ZM0A 1N9LA 4KZBA 3C5AA 3T12B 2X71A 2ZMAA 2H5SA 3UDFA 4OP8A 2JKRM 3R7WA 2PDRA 3HLCA 4GCZA 4RX3A 5EVIB 2HDUA 4S2NC 3UDXA 1JWVA 3A3EA 2HDSA 2H0YA 2Y91A 3BECA 5A92A 4ARZA 2PD8A 4R38A 2HF6A 1J9MA 3NBLA 4EXOA 5EOEA 1S66L 5A90A 1IKIA 3LGOA 4L9EA 1DP8A 2XD1A 3FV7A 3ISGA 5GL9A 1WYBA 4G3VA 3MZFA 2Y8HA 3CPTB 5AJGA 2W3EA 3IHBA 3G35A 2VGKA 3O88A 4G3KA 1LSVA 1TEMA 3KSFA 4XT2A 2BTFP 1KE3A 2EXBA 2KDKA 1YLPA 5FEGA 3WS5A 4JPMA 5DKLA 4DN0A 3MZDA 3NOPC 3E2KA 1S0WA 3E4QA 3R4KA 1G28A 5HDDA 3UO9A 4RX2A 4YWZA 1SKOA 4Q0JA 4ME4A 2ZQ9A 4ZAMA 1UWNX 1NWZA 4KZ4A 5EVID 1MWUA 1YLJA 4O7DA 2VV8A 2VV6A 5AVFA 1W8YA 3HLBA 1SDNA 5A91A 5TFQA 4P87A 5I94A 2GNXA 1SCWA 1ESIA 3M6HA 4LCLA 3M6BA 3P09A 2XH9A 3A3DA 5HAQA 3VSLA 1XPBA 4NEED 4X68A 5AQ7A 1CI9A 4R3BA 1MWRA 4F3LA 4Y0UA 4N9KA 2BLSA 3ZCZA 2XLNA 4HESA 4ZBEA 2VV7A 4E3MA 1OT9A 5CXWA 3PTEA 2ZC7A 1G68A 4LPZA 4LGWA 3CMZA 4WYYA 3UB5P 1XP4A 3NIAA 3FWLA 1YAXA 4CLCE 1P9WA 4UQIS 2V1AA 1BLHA 4HH2A 4N1XA 2I9VA 5EM1A 2VGLS 3JYIA 2YKHA 3ZG5A 3EEHA 5L09A 2Z2MB 3DTKA 4R0QA 1LSWA 3VP1A 4RYEA 3SH9A 3UB8A 4OLDA 2JN7A 4HY8A 2OAQ1 1NLZA 3WS1A 2C5WB 4BBTA 5F6AA 2HJEA 1W63Q 3O87A 3BM6A 1IYSA 1QMEA 2PD7A 4E3OA 4I39A 1BUEA 2WKEA 4DF6A 3SH8A 4WMCA 4S2IA 4OPQA 2XRNA 1RGZA 5KMWA 1IEMA 2A24B 2IWBA 4K0XA 1LL8A 4BJPA 1O7EA 5CHMA 5AQ9A 3W4OA 5DVAA 1W5DA 2XD5A 4X25A 4Q0IA 3BFDA 2QMIA 2XA7S 4GD8A 4X56A 4DE0A 2HDQA 4CLCB 2JKTI 1Y28A 3N4IA 4FOFA 2WGWA 1C3BA 3A0SA 4YNRA 1NXYA 2ZQ7A 4RQ9A 4FH2A 3UB7A 4R23A 3KSHA 1RGYA 1T18A 1K4EA 3WRTA 3UE6A 5FATA 2M1CA 5F68A 3CPTA 5FI6A 4ZTKA 1VEUA 2PHYA 4I5SA 2O99A 3CI6A 4WEJA 3IF6C 4ZJ1A 4N1HA 3BRMA 3VP4A 5DFXA 2WUQA 3PBNA 2PRFA 5E43A 4E6XA 3C2WA 2HV1A 2XGNA 4Q8IA 5HW3A 3TG9A 1FOFA 3BLMA 3JVVA 3GSGA 2W3DA 3V3SA 3UN7A 3PAEA 3E2LA 2HGVA 5CGXA 5EM0A 2K7SA 4X1LA 1TS8A 3NULA 3KX0X 2V20A 4R70A 5HL6A 5HWTA 1I2SA 4DXCA 1I5QA 1H3QA 4E3NA 1PW8A 2XF3A 1YMSA 4I3JA 3FYZA 1ES4A 1L0GA 4MN5A 3IH9A 3ITBA 1GHIA 1SHVA 3UDIA 1S67L 2HP5A 5CECA 4U0TA 3VFFA 3VP3A 5KZHA 3CLOA 3LIBA 2MJ6A 2CMNA 2XEPA 2JKRI 3SZTA 3N6IA 3Q1FA 4DJ3A 3G31A 2ZL1B 4PAUA 1LL9A 2Y2HA 1ALQA 4FSFA 2ZOHA 5CTMA 1CEGA 2WGWB 3HCYA 1L0FA 4GS9B 1ZHHB 4XUXA 2D01A 4BWIA 3F1NA 4OQIA 4BLMA 1TS6A 1S4RA 2W27A 5KIZA 5FQIA 2B5RA 4HQAA 3Q7ZA 1T1BA 4KUOA 4OQ0A 5HDCA 3OPPA 1K54C 3DAVA 4K0WA 3NI9A 3C38A 5FEFA 1BTLA 3E0YA 2XQZA 4BBVA 1WE4A 3SS5A 4LRYC 4ZRRA 4Q0HA 4EV4A 5EVLA 3IWOA 4GJ4A 2OLUA 5G4YA 3P7NA 1EW0A 1MPLA 2EWWA 3B3XA 2ZLYA 3IWIA 3C8CA 1ZG4A 3FKWA 4BD0A 3EQVA 1OTIA 2L4RA 1TDGA 4XT2B 2JKGA 4KZ5A 3DTIA 3MZEA 2E8IA 4BBUA 1KGGA 5L2FA 2O9AA 5DTKA 4JGQA 3NECA 4MDZA 4F94A 4F3LB 1VETA 4LV2A 4Z9QA 3FPVA 3I7JA 3RJUA 3PBRA 2FH5A 3LYXA 1OTEA 2OV5A 3VSKA 4NXEA 5HX9A 3HJKA 3ZG0A 4GS9A 4E3IA 4EBPA 4PMAA 1YLZA 3BEBA 5DKKA 1IYOA 2EX9A 2INWA 2QJ5A 5HPIA 1NRJA 3O5YA 1PZPA 2WYXA 3A0RA 4OONA 4HBUA 5CERA 3GECA 4OPRA 1NJ4A 5HPFA 2GJ3A 4E04A 4KG6A 3T4JA 5CGWA 5F82A 3G2YA 1V9ZA 2JKTM 3IF6A 1ERQA 4YFMA 2UV0E 3ZVTA 2WKHA 3BFCA 4DMZA 3BYDA 5BOHA 1RCJA 2Q0OA 4HH3A 3G4PA 3LIEA 3UE0A 5EVEA 1VQQA 2Y2MA 2XK1A 3C7VA 3CZDA 4EWFA 2A3UA 5G18A 4RVAA 3SW1A 2XA7M 4GLQA 1IOUA 2ACGA 5C5KA 4EU0A 5MC7A 4KG5A 3BFFA 3SH7A 2VGJA 2QKPA 3KYQA 1VM1A 5FAOA 1YLTA 4GD6A 1VB6A 1KDWA 2V9AA 4QY5A 2LB9A 3IBJA 1LI9A 1DP9A 2VZWA 2WAFA 1VETB 5JYPA 4CLCC 4ZDXA 2R9XA 2C6WB 5FDHA 4EBLA 3S7PA 5CX7A 2EXAA 1FCOA 1DY6A 3FG8A 3BY9A 1FCNA 4OPZA 1GSWA 3TW8A 2OWHA 3Q81A 4O0PA 4WELA 5CHUA 5TGFA 1SKFA 4O8GA 3T4QA 4MBFA 4LRZE 3PBTA 5EE8A 1ES5A 1BSGA 3HLWA 4WM9A 4C75A 1Q2QA 1YMXA 3NDGA 4QPRA 2PYRA 4LRXC 3AGFA 2L1MA 2ZBBA 2H28A 4M4XA 4JXVA 4Y0TA 3AGDA 1CK3A 1J3WA 4UEYA 1W8QA 1I2WA 3M2KA 2J9PA 2Q9NA 5IHVA 1DP6A 2Y2PA 1EWZA 3T50A 4UA6A 4B4ZA 4CJNA 1PYYA 4QU3A 2X02A 4D60A 3LR5A 1ES3A 2IWDA 1D7EA 2PYPA 2D02A 3EWKA 5FAQA 3HLGA 2ZJ9A 2WADA 2VKSA 4OP5A 1ERMA 5HFOA 2HZ5A 4OVDA 4JBFA 2KLIA 1PWGA 2HDRA 1JWZA 5IU1A 4QB8A 2ZMVA 4R3AA 2Q9MA 3M2JA 4OH0A 4M3KA 2QYBA 1GCEA 3RH8B 4GNUA 2V1BA 3UB9A 1NYYA 1PWDA 3E4PA 4DE1A 3RFBA 3A3FA 1JWPA 3PXPA 4OPYA 3JVUA 2Y2IA 2G2WA 3GR2A 4JF4A 2VLGA 3H82A 2YKFA 3RXXA 4X6TA 4Z1WA 1V9YA 4GDNA 4EUZA 1S1ZA 3LO7A 5G4ZA 4N9LA 1XJ2A 1EI5A 4WZ5C 3H7WB 2WKPA 2DNSA 2ZMFA 3D3OA 1H8ZA 1LLBA 3ZDJA 2WKRA 4R3JA 4PM9A 2EFXA 5F69A 3S1YA 1L3LA 3S7QA 5FSRA 3BQAA 1Z09A 3Q7VA 2K31A 1YM1A 2A24A 3T1SA 1ONHA 2P08A 3LI9A 1MBLA 3UPOA 1LSXA 5F1FA 3G30A 1FCMA 2P9VB 4ZJ2A 1H8YA 4BQMA 3ZYTA 4U0XA 2Y2NA 3B42A 4I38A 3HLFA 3S22A 4I3IA 1K38A 3C4OA 3QNBA 2Z6CA 3DTEA 4UHUA 5AQAA 3UPPA 1M40A 5HD3A 3MXRA 1ZKJA 1RP5A 2EFUA 3FKVA 4E6WA 2EX8A 3TSGA 1GA0A 1AWIA 1OTAA 4JXWA 1XGJA 2OOLA 2Z6DA 3IS2A 2ZQCA 5E2FA 1LT0A 4PPRA 3NHQA 3FC7A 2Y2LA 4NXFA 3U2AA 1K57A 4LV3A 4NXGA 3E4OA 3C7UA 5GLBA 5DF7A 1KDSA 3IT9A 5I5LA 2PBDP 4EW7A 1CJFA 3BY8A 1KVMA 3QHYA 4CQHA 3CUEC 5DFYA 1JVJA 3G6OA 2QPNA 5EV0A 4B4XA 1OTBA 4JF6A 1TF1A 1K6SA 5FA7A 3TRCA 2ZC3B 3IF6B 1TVFA 5DTTA 4KG2A 5HZHA 3QP8A 4E3LA 3W4QA 1GHPA 4S2PA 4EQIA 1G6AA 2ZC4B 5J4EA 3MQ0A 4QHCA 5A8BA 1DJBA 3V5MA 3ZNYA 3F1NB 2VX8A 4IJGA 2QHKA 5U47A 5M1AA 3K3DA 1MWTA 4WUJA 1MKMA 1P9RA 5CRFA 4BMWA 1MKIA 4UAAA 3B33A 2GX5A 1PI5A 2WGVA 3IXDA 4JF5A 4KZ6A 1CI8A 4R4SA 1KVLA 2B95A 4XXRA 3CHWP 2WK0A 1D1JA 4NXBA 2BG1A 2Y2JA 3S7NA 2NUPC 4WZ5A 2JC7A 2FFFB 1YKDA 2ZM2A 1PNEA 4K08A 2B02A 3T4LA 3MS6A 3ZNTA 1N9BA 1NY0A 2W3HA 4WF0A 2M7VA 2W3FA 1YQSA 2V8FA 1FQGA 1KE4A 3NOTC 3VOYA 4CPKA 4JXGA
chains in the Genus database with same CATH topology
1UWPX 2JKTM 3UB6A 3R7WB 1T19A 5J3WA 3C30A 4G3WA 4DMZA 4HHDA 3EGXC 3MFXA 2B18A 2G7UA 2M7UA 4ARZA 1XFNA 2K2NA 2PD8A 1XFQA 3KSGA 3BWLA 2W3GA 3E98A 4R38A 4HH3A 2HF6A 4P6ZM 4EXOA 1S66L 3LIEA 4B9OA 4L9EA 1DP8A 3T4SA 3PBOA 3LI8A 1XJ3A 3KO6A 4G3VA 1G6OA 4KQDA 2Y8HA 2V0UA 3SW1A 5AJGA 2XA7M 2W3EA 4EESA 2P04A 4GLQA 4UQIM 4G3KA 1LSVA 3KSFA 4XT2A 3P01A 1IOUA 2KDKA 5C5KA 4WLAA 4EU0A 3T4OA 1OJGA 1X0OA 5DKLA 4DN0A 5MC7A 3NOPC 2W1TA 3E4QA 3R4KA 1G28A 5HDDA 5HSQA 4OOMA 4HP4A 4YWZA 4Q0JA 4ME4A 2P7JA 1F9IA 2QKPA 3KYQA 5LBRA 1D06A 1VB6A 4H6JA 2V9AA 2LB9A 3IBJA 1DP9A 1UWNX 2LB5A 2VZWA 4R6LA 4WEKA 4MN6A 1NWZA 4CLCC 3IBRA 3LIDA 2ZOIA 3S7PA 5CX7A 2VV8A 3LIFA 3FG8A 2VV6A 3CAXA 3BY9A 1GSWA 3TW8A 5AVFA 1TD5A 2OWHA 3H7WA 4O0PA 5IS1A 4WELA 3OC2A 5TBMA 1UGUA 4O8GA 2GNXA 3D72A 3DBAA 5DJTA 3T4QA 4LRZE 3PBTA 3PHYA 4NEED 3K2NA 1N9OA 5HDSA 1F98A 4QPRA 3VE4A 2PYRA 2O9CA 4LRXC 4F3LA 2L1MA 2ZBBA 4II7A 4JGOA 2H28A 4M4XA 2QWSA 3LR4A 2VV7A 3HJIA 3V67A 4L9FA 4WN5A 3F1OA 4UEYA 1OTDA 1OT9A 3UMEA 1S4SA 1DP6A 4LPZA 3T50A 1IFQA 1YAXA 4CLCE 5K5BA 1P9WA 4UQIS 3CITA 4IUKA 2V1AA 1P97A 4HH2A 1S1YA 2Y79A 3TJZC 4HJ3A 2I9VA 3LR5A 5HD5A 2VGLS 2YKHA 3EEHA 1D7EA 2PYPA 3VE3A 4ARZB 5HWWA 1T1AA 2D02A 2KOIA 3BQ8A 3LIAA 4KUKA 3EWKA 4JGRA 1N9NA 1LSWA 3EEAA 3UB8A 2JN7A 2EWVA 2VKSA 4HY8A 2W1RA 2OAQ1 1NLZA 2KLIA 5F6AA 4BBTA 2QJ7A 2HJEA 1W63Q 5IU1A 3W2ZA 2ZMVA 4EETB 2HJ9C 4R3AA 2PD7A 4I39A 2KX6A 1GSVA 2FZ0A 2QYBA 2J3TD 3RH8B 4HOIA 4GHIB 2V1BA 3UB9A 1VHMA 3K3CA 3E4PA 4YOFA 4NKPA 4I3AA 5TBMB 2OAP1 2XRNA 3RFBA 3PBSA 1W63M 2A24B 2JHEA 4MCWA 3PXPA 4O01A 3T4TA 1LL8A 3JVUA 4P6ZS 1OT6A 4BJPA 2VLGA 3H82A 3PR6A 2XROA 3MJQA 2EA9A 1F5MA 2L0WA 2YKFA 4Q0IA 5TJJA 3OLOA 2J3TC 3VOLA 4Z1WA 2XA7S 1V9YA 1NLYA 1S1ZA 4PHTA 5G4ZA 3NJAA 4DJ2A 4CLCB 2JKTI 3BW6A 2PR6A 5FL3A 1XJ2A 1Y28A 4FOFA 3A0SA 4YNRA 3H7WB 2WKPA 4RQ9A 3UB7A 2ZMFA 3FPWA 3TE8A 2VEAA 3OOVA 3D3OA 4PKYA 3KSHA 3LUQA 5IT5A 2WKRA 1T18A 4GHIA 2R78A 3IS2B 3UE6A 5DF9A 5F69A 2M1CA 4CLCD 5F68A 3S7QA 3BQAA 4EEUA 2PHYA 4I5SA 4IHQA 2O99A 3CI6A 4WEJA 2K31A 4HNBA 3MQOA 2A24A 2O0YA 1GSXA 3MQQA 2BASA 2P08A 2J3WA 5DFXA 3LI9A 3PBNA 2W1TB 2A2LA 3C2WA 4Y3IA 4E04A 1LSXA 2HV1A 3GDIA 3JVVA 3OCNA 4H6JB 1P0ZA 2W3DA 1STZA 3ZYTA 4PKYG 2HGVA 3LFVA 3B42A 4I38A 2K7SA 4WL9A 1TS8A 4I3IA 3KX0X 2Z6CA 4R70A 5HL6A 5HWTA 4HP9A 1YSQA 3OCLA 1H3QA 3ICYA 5HD3A 1MC0A 4I3JA 3CWFA 4KQOA 4Y2FA 2W0NA 4MN5A 1S67L 3LICA 3BJNA 3MR0A 5HWVA 3CLOA 3LIBA 2MJ6A 2CMNA 3UMDA 2JKRI 3S7OA 1OTAA 2OWJA 4AFIA 3OBFA 4DJ3A 2V0WA 4PAUA 2XSSA 4HI4A 2OOLA 2Z6DA 4FSFA 4ETXA 2ZOHA 3IS2A 3MMHA 2VGLM 1LT0A 3HCYA 3NHQA 3FC7A 4NXFA 4MMNA 3F1PA 3H9WA 4GS9B 3PBQA 1ZHHB 3U2AA 2D01A 4EUVA 4NXGA 2PT7A 3KYZA 3UE3A 4BWIA 3E4OA 3F1NA 4OOLA 1TS7A 1TS6A 1WA9A 1S4RA 1XJ6A 4EERA 1OPXA 5AVEA 2W27A 5KIZA 2VA0A 3VV4A 5I5LA 4HQAA 1KOUA 1T1BA 2DMWA 3LR0A 3NOUC 1TS0A 4EW7A 4KUOA 3BY8A 1ZTUA 5HDCA 4HJ4A 5KSHA 4B93A 4CQHA 3MXQA 3CUEC 3F1OB 5DFYA 4HJ6A 3G6OA 4CLCA 3RTYA 5DJUA 1OTBA 3C38A 1TF1A 4HIAA 3TRCA 1YSPA 3E0YA 4BBVA 3ZQ5A 4ETZA 3H82B 3CUEA 3B47A 5EFWA 5HZHA 4LRYC 2NUTC 4ZRRA 4GW9A 3T4JA 3EGDC 1JNUA 2PR5A 4Q0HA 5J4EA 2O9BA 3MQ0A 3EOIA 5A8BA 3LR3A 4GJ4A 5G4YA 4LLOB 3P7NA 1XJ4A 1EW0A 2EWWA 3KSIA 3F1NB 2J80A 2VX8A 3C8CA 1OJ5A 1T1CA 4IJGA 3EQVA 5F5YA 2QHKA 1OTIA 4JGPA 2VJWA 3K3DA 4WUJA 2L4RA 1H8MA 1MKMA 4EEPA 1P9RA 1MZUA 3ULFA 1DRMA 3MF0A 4BMWA 1ODVA 4XT2B 3B33A 4MN7A 2GX5A 4BBUA 4L9GA 2O9AA 4L0LA 4JGQA 5J7EA 2IA2A 4MDZA 2WKQA 4F3LB 3PYPA 3FPVA 3A0VA 3PBRA 2FH5A 3LYXA 1OTEA 4NXBA 1N9LA 4NXEA 3F1PB 3T4KA 3HJKA 4EQ1A 4GS9A 4Y5FA 3S7NA 2NUPC 5DKKA 2GZAA 2INWA 2QJ5A 1YKDA 5HPIA 1NRJA 2B02A 4IUHA 4K08A 3T4LA 3O5YA 2JKRM 1BYWA 3R7WA 2W3HA 4WF0A 2M7VA 2PDRA 3A0RA 2W3FA 5L8MA 3GECA 5HPFA 3NOTC 2GJ3A 3EQUA 1V9ZA 4GCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWP X;  3UB7 A;  4L9F A;  4WN5 A;  2VEA A;  3F1O A;  4HQA A;  5I5L A;  4PKY A;  3UB6 A;  1OTD A;  1OT9 A;  1KOU A;  1T19 A;  3LUQ A;  5J3W A;  3UME A;  2WKR A;  1T18 A;  1S4S A;  1T1B A;  4GHI A;  1DP6 A;  3NOU C;  4LPZ A;  2R78 A;  3IS2 B;  1TS0 A;  3UE6 A;  4HHD A;  4I5S A;  4KUO A;  4EW7 A;  3BY8 A;  5F69 A;  2M1C A;  3MFX A;  3T50 A;  5HDC A;  4HJ4 A;  5F68 A;  4EEU A;  1XFN A;  2PD8 A;  3F1O B;  1XFQ A;  2PHY A;  2V1A A;  3BWL A;  1P97 A;  3MXQ A;  4HJ6 A;  4HH3 A;  4HH2 A;  1S1Y A;  4R38 A;  3G6O A;  4HNB A;  4EXO A;  3MQO A;  3RTY A;  5DJU A;  1OTB A;  1S66 L;  2I9V A;  3LIE A;  2A24 A;  4HJ3 A;  4HIA A;  5HD5 A;  4B9O A;  4L9E A;  1DP8 A;  4E04 A;  1GSX A;  2VV7 A;  2YKH A;  1XJ3 A;  3LI8 A;  3EEH A;  2BAS A;  1D7E A;  3MQQ A;  3ZQ5 A;  2PYP A;  4KQD A;  3VE3 A;  4BBV A;  5HWW A;  1T1A A;  2D02 A;  2V0U A;  3LI9 A;  4M4X A;  3SW1 A;  3H82 B;  4EES A;  3LIA A;  4KUK A;  3C2W A;  3EWK A;  4JGR A;  1LSX A;  1N9N A;  1LSW A;  1LSV A;  2HV1 A;  4LRY C;  5EFW A;  4XT2 A;  3UB8 A;  5HZH A;  4GW9 A;  2JN7 A;  2KDK A;  3GDI A;  1JNU A;  2PR5 A;  4WLA A;  4HY8 A;  5J4E A;  1OJG A;  1X0O A;  4H6J B;  5A8B A;  1P0Z A;  5DKL A;  5F6A A;  4BBT A;  2QJ7 A;  3NOP C;  5G4Y A;  4LLO B;  3P7N A;  5IU1 A;  1XJ4 A;  4PKY G;  3E4Q A;  1EW0 A;  4EET B;  1G28 A;  4I38 A;  2K7S A;  3F1N B;  4WL9 A;  4R3A A;  5HDD A;  4HP4 A;  2J80 A;  4YWZ A;  1TS8 A;  5HSQ A;  2PD7 A;  4I3I A;  2P7J A;  4I39 A;  3KX0 X;  1F9I A;  2KX6 A;  2QKP A;  3C8C A;  1OJ5 A;  2Z6C A;  1D06 A;  1T1C A;  1GSV A;  4R70 A;  1VB6 A;  5HWT A;  4H6J A;  2V9A A;  5F5Y A;  2QHK A;  1OTI A;  4HP9 A;  4JGP A;  1DP9 A;  1UWN X;  3K3D A;  4R6L A;  4WUJ A;  3RH8 B;  2L4R A;  5AVE A;  4HOI A;  4EEP A;  1MZU A;  3ICY A;  4GHI B;  4MN6 A;  3ULF A;  1DRM A;  5HD3 A;  1ODV A;  4XT2 B;  2V1B A;  1NWZ A;  3UB9 A;  3IBR A;  3B33 A;  4EER A;  4I3J A;  3CWF A;  3K3C A;  3LID A;  2W0N A;  2ZOI A;  3E4P A;  4MN5 A;  4L9G A;  4BBU A;  4I3A A;  3HJI A;  5TBM B;  4JGQ A;  5J7E A;  2VV8 A;  3LIF A;  2WKQ A;  3FG8 A;  4F3L B;  1S67 L;  3LIC A;  2VV6 A;  3CAX A;  3BY9 A;  3MR0 A;  5HWV A;  3PYP A;  3CLO A;  2A24 B;  1GSW A;  5AVF A;  2JHE A;  2OWH A;  3A0V A;  3LIB A;  2CMN A;  3LYX A;  1OTE A;  3H7W A;  3UMD A;  4NXB A;  1OTA A;  2OWJ A;  1N9L A;  5IS1 A;  4NXE A;  3F1P B;  5TBM A;  1UGU A;  3HJK A;  1LL8 A;  2V0W A;  4DJ3 A;  4EQ1 A;  4GS9 A;  1OT6 A;  4HI4 A;  2OOL A;  2VLG A;  3H82 A;  3D72 A;  2Z6D A;  3MJQ A;  5DJT A;  5DKK A;  2ZOH A;  3IS2 A;  4LRZ E;  2EA9 A;  5KIZ A;  2L0W A;  2YKF A;  3PHY A;  3OLO A;  1LT0 A;  2INW A;  2QJ5 A;  3NHQ A;  3FC7 A;  1N9O A;  5HDS A;  3H7W B;  4NXF A;  3VOL A;  3F1P A;  3H9W A;  4K08 A;  2B02 A;  1F98 A;  4GS9 B;  1V9Y A;  1BYW A;  3VE4 A;  1S1Z A;  2D01 A;  2PYR A;  4WF0 A;  4NXG A;  2PDR A;  3A0R A;  4LRX C;  5G4Z A;  3NJA A;  4DJ2 A;  4F3L A;  2PR6 A;  2L1M A;  2ZBB A;  3E4O A;  1XJ2 A;  3F1N A;  4JGO A;  1Y28 A;  3GEC A;  1TS7 A;  2H28 A;  1TS6 A;  1WA9 A;  1S4R A;  1XJ6 A;  2GJ3 A;  2QWS A;  3A0S A;  3NOT C;  2WKP A;  1V9Z A;  4GCZ A;  2W27 A;  4RQ9 A; 
#chains in the Genus database with same CATH topology
 1UWP X;  4FD8 A;  3SS3 A;  3R7W B;  2R9W A;  3C30 A;  4HHD A;  3PAG A;  2B18 A;  2G7U A;  1XFN A;  2K2N A;  1XFQ A;  3E98 A;  1FSY A;  1Y54 A;  1KE0 A;  3MBZ A;  2VK3 A;  2WAE A;  1HZO A;  3LI8 A;  4H8R A;  2P9V A;  1G6O A;  4JLF A;  4EES A;  2P04 A;  4QY6 A;  1SKO B;  4X55 A;  3IX3 A;  5TR7 A;  3HBR A;  4S2M A;  4HEF A;  1OJG A;  1X0O A;  3N8R A;  1K4F A;  2W1T A;  3S4X A;  4R1G A;  5DTS A;  4KEN B;  4OOM A;  4X1M A;  2P7J A;  1DJC A;  1F9I A;  5LBR A;  4NG2 A;  3ITA A;  4H6J A;  4R6L A;  4NET A;  3QP6 A;  3IBR A;  2ZOI A;  4LFU A;  3LIF A;  3CAX A;  3HUM A;  5FQ9 A;  4GDB A;  2Z2L B;  3H7W A;  2QZ6 A;  3D72 A;  3V50 A;  2V1Z A;  1W7F A;  5DJT A;  3QP4 A;  2AVX A;  1K0K A;  4BD1 A;  1QMF A;  5FQJ A;  1ES2 A;  1F98 A;  2O9C A;  1G5U A;  4II7 A;  1MXO A;  1PWC A;  3LR4 A;  2PU4 A;  4L9F A;  4WN5 A;  3V39 A;  3HRE A;  1OTD A;  2JCH A;  1ZC2 A;  1NZO A;  3UME A;  1ERO A;  5HAI A;  4IUK A;  1MWS A;  3TJZ C;  4FUW A;  5KSC A;  5HD5 A;  4C6Y A;  4ARZ B;  1XKZ A;  2WZX A;  2KOI A;  3BQ8 A;  4IBX A;  3LIA A;  4KUK A;  1N9N A;  3EEA A;  1S6R A;  2EWV A;  3O3V A;  3IHA A;  4GB7 A;  3HL9 A;  2QJ7 A;  3W2Z A;  1K55 C;  1K56 D;  2H0T A;  2OSU A;  1ONG A;  1GSV A;  2FZ0 A;  3GQZ A;  2J3T D;  1XX2 A;  3IH8 A;  4HOI A;  4GHI B;  3ZG8 B;  1BLP A;  3K3C A;  4WBG A;  4YOF A;  4NKP A;  4I3A A;  2OAP 1;  3LY3 A;  2DCF A;  3IX4 A;  3UPN A;  1W63 M;  1JTG A;  2JHE A;  4JXS A;  3MXS A;  1YLW A;  4MCW A;  4O01 A;  3T4T A;  4P6Z S;  1OT6 A;  1Z6F A;  3LY4 A;  3IXB A;  4UA9 A;  1LHY A;  2ZM8 A;  2EA9 A;  3IWQ A;  2L0W A;  3OLO A;  3VOL A;  3ZGA B;  4PHT A;  3NJA A;  1IYQ A;  3BW6 A;  2PR6 A;  5FL3 A;  5FI7 A;  3RXW A;  1FR6 A;  3FPW A;  3TE8 A;  2VEA A;  3OOV A;  4PKY A;  5GLA A;  4C3Q A;  1Q2P A;  2R78 A;  3IS2 B;  3QP1 A;  5E2G A;  1FIK A;  4EEU A;  3WS2 A;  3D4F A;  4D2O A;  4HNB A;  3MQO A;  2Y2K A;  2O0Y A;  4BEN A;  3VFH A;  1GSX A;  2GDN A;  1IEL A;  3MQQ A;  2BAS A;  3LCE A;  1VEU B;  2W1T B;  5J8X A;  4Y3I A;  2Y4A A;  2RL3 A;  4S2K A;  4LV1 A;  4KZ9 A;  3OCN A;  4H6J B;  2HP6 A;  4PM8 A;  1STZ A;  3LEZ A;  4B88 A;  5FAS A;  4WL9 A;  1A0K A;  3CJM A;  4LV0 A;  3UE1 A;  4HP9 A;  1YSQ A;  5CHJ A;  4X53 A;  3VMA A;  4A5R A;  1GA9 A;  1MC0 A;  4Y15 A;  1PIO A;  3NDE A;  3CWF A;  4KQO A;  4Y2F A;  1YT4 A;  1HLU P;  4IBR A;  3FZC A;  3JPU A;  3BJN A;  4WZ4 A;  5AQB A;  2ZQ8 A;  4QJG A;  1IYP A;  3UMD A;  3LEQ A;  2OWJ A;  4AFI A;  4HI4 A;  2PBY A;  3OZH A;  4ETX A;  3IXH A;  3MMH A;  1PI4 A;  2ZQD A;  2ZQA A;  4FH4 A;  3F1P A;  3H9W A;  4EUV A;  3UE3 A;  2J9O A;  1U60 A;  3HLE A;  4KZA A;  4EER A;  1XGI A;  5AVE A;  4MNR A;  1F2K A;  4KQR A;  1TS0 A;  3SS4 A;  3ZG9 B;  3OPR A;  2P74 A;  2EX6 A;  4HJ4 A;  5FQQ A;  3Q07 A;  4E3K A;  5KSH A;  3MXQ A;  3F1O B;  4HJ6 A;  4Y7P A;  3RTY A;  3KYE A;  5DJU A;  4P0M A;  2PAV P;  4HIA A;  1YSP A;  1DJA A;  5GLC A;  3W8K A;  3H82 B;  4IVK A;  1K55 A;  1K54 A;  5EFW A;  4KZ7 A;  3BLS A;  4OQG A;  3HUN A;  1JNU A;  4DXB A;  2O9B A;  1TDL A;  3GMW A;  4ESP A;  1XA7 A;  3SOI A;  5CGS A;  4DDY A;  4P85 A;  3TOI A;  1OJ5 A;  2WGI A;  5CEB A;  3ZVW A;  4JKT A;  3WS0 A;  2VJW A;  1M6K A;  1H8M A;  3MF0 A;  1ODV A;  3IXG A;  5GLD A;  1NZU A;  3WRZ A;  4L9G A;  3UNW A;  2IA2 A;  2WKQ A;  4DRT A;  4OKP A;  2CC1 A;  3A0V A;  3V3R A;  2Y55 A;  4FTX A;  3T4K A;  3F1P B;  4EQ1 A;  4Y5F A;  3P98 A;  1XXM A;  2JE5 A;  2GZA A;  1KGF A;  4R4R A;  4IUH A;  3UY6 A;  2I72 A;  2ZL1 A;  1BYW A;  1H5X A;  3MSH A;  5L8M A;  3D9Y A;  4OOY A;  4PM7 A;  3EQU A;  4GOG A;  4HBT A;  1PZO A;  3UB6 A;  4QWO A;  1T19 A;  5J3W A;  4Y13 A;  4G3W A;  1BUL A;  5JYO A;  3BFE A;  3EGX C;  3HVF A;  3MFX A;  2M7U A;  1K6R A;  3G32 A;  3KSG A;  3BWL A;  2W3G A;  2HP9 A;  4P6Z M;  2JBF A;  3T4S A;  4B9O A;  1JTD A;  3PBO A;  1XJ3 A;  3KO6 A;  4KQD A;  2V0U A;  4DE3 A;  4UQI M;  2V2F F;  2V8C A;  1L0D A;  4PM6 A;  3P01 A;  1E25 A;  1LI0 A;  3VP0 A;  3IF5 A;  3QP2 A;  4WLA A;  3T4O A;  2DRW A;  3G34 A;  2XFT A;  4E3J A;  4NK3 A;  5HSQ A;  4HP4 A;  4X69 A;  1MY8 A;  4KZ8 A;  5L10 A;  1D06 A;  1BLC A;  3CG5 A;  2J8Y A;  1WYC A;  2LB5 A;  4WEK A;  5HAR A;  1SZV A;  1HVB A;  4MN6 A;  1E3U D;  4UA7 A;  5FAP A;  3LID A;  5EOO A;  1E4D A;  3HUO A;  2ZC5 B;  2G2U A;  5EPH A;  2HPB A;  1TD5 A;  5L07 A;  3DWZ A;  5IS1 A;  5EVI A;  2H10 A;  3OC2 A;  5TBM A;  1UGU A;  3MKF A;  2Y2G A;  1Y4O A;  3DBA A;  3WWX A;  1ZG6 A;  3PHY A;  2OLV A;  3DWK A;  3K2N A;  1N9O A;  5HDS A;  3GRJ A;  1PRQ A;  3VE4 A;  1NRF A;  3DW0 A;  4IED A;  4JGO A;  4LCM A;  4BL3 A;  2QWS A;  4BL2 A;  3HJI A;  3V67 A;  5FDS A;  3F1O A;  5M18 A;  1N4O A;  1S4S A;  1ACF A;  2XDM A;  4MLL A;  2ZD8 A;  3DTM A;  1IFQ A;  4K91 A;  5K5B A;  4S2L A;  3CIT A;  3HLD A;  4Y0O A;  1P97 A;  5F83 A;  1KGE A;  1S1Y A;  2Y79 A;  2XR0 A;  4HJ3 A;  3L9K A;  3ZFZ A;  5HWW A;  3VE3 A;  1T1A A;  4LEN A;  5EEC A;  3ZHH A;  4JGR A;  2E8J A;  5EVI C;  3NC8 A;  2W1R A;  4MEZ A;  1SDE A;  3NCK A;  1AXB A;  4WMC D;  4EET B;  2HJ9 C;  4MBK A;  2KX6 A;  4RA7 A;  4ZJ3 A;  2WKI A;  3WS4 A;  4MBH A;  1VHM A;  1K56 A;  5A93 A;  1FIL A;  1W79 A;  5TBM B;  3PBS A;  1FR1 A;  2Y2O A;  3PR6 A;  2XRO A;  3MJQ A;  4P6B A;  4YIN A;  4GN2 A;  5TJJ A;  1ESU A;  1F5M A;  1L0E A;  4GZB A;  2J3T C;  1NLY A;  1CEF A;  4DJ2 A;  2IWC A;  5GHX A;  1BT5 A;  3QP5 A;  1L2S A;  4IVI A;  4FCF A;  4QD4 A;  3OPL A;  3AGE A;  1YPR A;  3NY4 A;  3Q7V B;  3U4L P;  3LUQ A;  5IT5 A;  3VOZ A;  1O07 A;  3BFG A;  4GHI A;  4S2J A;  5FQM A;  4OQH A;  5DF9 A;  4CLC D;  4KZ3 A;  4IHQ A;  4S2N A;  4DKI A;  2Y59 A;  3T1Q B;  2J3W A;  4KQQ A;  2Y2Q A;  4EBN A;  2A2L A;  5E2H A;  3QNC A;  4XUZ A;  3GDI A;  3O86 A;  1P0Z A;  1NYM A;  1BLS A;  3L7H A;  5D3O A;  4PKY G;  3LFV A;  1PFL A;  3A3I A;  5FI2 A;  4Y17 A;  5E2E A;  3N7W A;  3MFD A;  5HAP A;  3OCL A;  3ICY A;  2WZZ A;  3OPH A;  5CED A;  2W0N A;  4ID4 A;  5F1G A;  3LIC A;  2J7V A;  3MR0 A;  5HWV A;  1OME A;  5FQK A;  4U3T A;  2JKF A;  3S7O A;  1XA1 A;  3GV9 A;  3OBF A;  2V0W A;  2XSS A;  2PU2 A;  3GTC A;  5EUA A;  2VGL M;  1GHM A;  1HD8 A;  5M19 A;  4MMN A;  3PBQ A;  3C4P A;  2PT7 A;  3A3J A;  3KYZ A;  4DDS A;  1IKG A;  4OOL A;  1TS7 A;  1WA9 A;  1XJ6 A;  4N92 A;  1OPX A;  5CTN A;  2VA0 A;  3VV4 A;  4S2O A;  4PM5 A;  1KOU A;  1K57 C;  5HL1 A;  2RCX A;  5GHY A;  2DMW A;  3LR0 A;  3NOU C;  1PW1 A;  1ZTU A;  4OLG A;  3N8L A;  4B93 A;  3T1R A;  3ZG7 B;  1CQA A;  2EX2 A;  4CLC A;  1CF0 A;  2UWX A;  3N8S A;  2FFY A;  3ZQ5 A;  4ETZ A;  2A49 A;  3G2Z A;  3CUE A;  3B47 A;  3VP2 A;  2NUT C;  5GHZ A;  4GW9 A;  1HTZ A;  3EGD C;  2PR5 A;  1H0M A;  1K25 A;  3EOI A;  3LR3 A;  3MKE A;  4LLO B;  4DE2 A;  4GKU A;  1XJ4 A;  2XFS A;  3KSI A;  2J80 A;  1FSW A;  1T1C A;  1BZA A;  1E3U A;  5F5Y A;  4JGP A;  3IQA A;  4EEP A;  3IX8 A;  1MZU A;  3ULF A;  2ZC6 B;  1LL5 A;  1DRM A;  3W4P A;  4MN7 A;  3GVB A;  3Q82 A;  4L0L A;  5J7E A;  5DF8 A;  3PYP A;  3T1X A;  1YLY A;  2X01 A;  2ZM0 A;  1N9L A;  4KZB A;  3C5A A;  3T12 B;  2X71 A;  2ZMA A;  2H5S A;  3UDF A;  4OP8 A;  2JKR M;  3R7W A;  2PDR A;  3HLC A;  4GCZ A;  4RX3 A;  5EVI B;  2HDU A;  4S2N C;  3UDX A;  1JWV A;  3A3E A;  2HDS A;  2H0Y A;  2Y91 A;  3BEC A;  5A92 A;  4ARZ A;  2PD8 A;  4R38 A;  2HF6 A;  1J9M A;  3NBL A;  4EXO A;  5EOE A;  1S66 L;  5A90 A;  1IKI A;  3LGO A;  4L9E A;  1DP8 A;  2XD1 A;  3FV7 A;  3ISG A;  5GL9 A;  1WYB A;  4G3V A;  3MZF A;  2Y8H A;  3CPT B;  5AJG A;  2W3E A;  3IHB A;  3G35 A;  2VGK A;  3O88 A;  4G3K A;  1LSV A;  1TEM A;  3KSF A;  4XT2 A;  2BTF P;  1KE3 A;  2EXB A;  2KDK A;  1YLP A;  5FEG A;  3WS5 A;  4JPM A;  5DKL A;  4DN0 A;  3MZD A;  3NOP C;  3E2K A;  1S0W A;  3E4Q A;  3R4K A;  1G28 A;  5HDD A;  3UO9 A;  4RX2 A;  4YWZ A;  1SKO A;  4Q0J A;  4ME4 A;  2ZQ9 A;  4ZAM A;  1UWN X;  1NWZ A;  4KZ4 A;  5EVI D;  1MWU A;  1YLJ A;  4O7D A;  2VV8 A;  2VV6 A;  5AVF A;  1W8Y A;  3HLB A;  1SDN A;  5A91 A;  5TFQ A;  4P87 A;  5I94 A;  2GNX A;  1SCW A;  1ESI A;  3M6H A;  4LCL A;  3M6B A;  3P09 A;  2XH9 A;  3A3D A;  5HAQ A;  3VSL A;  1XPB A;  4NEE D;  4X68 A;  5AQ7 A;  1CI9 A;  4R3B A;  1MWR A;  4F3L A;  4Y0U A;  4N9K A;  2BLS A;  3ZCZ A;  2XLN A;  4HES A;  4ZBE A;  2VV7 A;  4E3M A;  1OT9 A;  5CXW A;  3PTE A;  2ZC7 A;  1G68 A;  4LPZ A;  4LGW A;  3CMZ A;  4WYY A;  3UB5 P;  1XP4 A;  3NIA A;  3FWL A;  1YAX A;  4CLC E;  1P9W A;  4UQI S;  2V1A A;  1BLH A;  4HH2 A;  4N1X A;  2I9V A;  5EM1 A;  2VGL S;  3JYI A;  2YKH A;  3ZG5 A;  3EEH A;  5L09 A;  2Z2M B;  3DTK A;  4R0Q A;  1LSW A;  3VP1 A;  4RYE A;  3SH9 A;  3UB8 A;  4OLD A;  2JN7 A;  4HY8 A;  2OAQ 1;  1NLZ A;  3WS1 A;  2C5W B;  4BBT A;  5F6A A;  2HJE A;  1W63 Q;  3O87 A;  3BM6 A;  1IYS A;  1QME A;  2PD7 A;  4E3O A;  4I39 A;  1BUE A;  2WKE A;  4DF6 A;  3SH8 A;  4WMC A;  4S2I A;  4OPQ A;  2XRN A;  1RGZ A;  5KMW A;  1IEM A;  2A24 B;  2IWB A;  4K0X A;  1LL8 A;  4BJP A;  1O7E A;  5CHM A;  5AQ9 A;  3W4O A;  5DVA A;  1W5D A;  2XD5 A;  4X25 A;  4Q0I A;  3BFD A;  2QMI A;  2XA7 S;  4GD8 A;  4X56 A;  4DE0 A;  2HDQ A;  4CLC B;  2JKT I;  1Y28 A;  3N4I A;  4FOF A;  2WGW A;  1C3B A;  3A0S A;  4YNR A;  1NXY A;  2ZQ7 A;  4RQ9 A;  4FH2 A;  3UB7 A;  4R23 A;  3KSH A;  1RGY A;  1T18 A;  1K4E A;  3WRT A;  3UE6 A;  5FAT A;  2M1C A;  5F68 A;  3CPT A;  5FI6 A;  4ZTK A;  1VEU A;  2PHY A;  4I5S A;  2O99 A;  3CI6 A;  4WEJ A;  3IF6 C;  4ZJ1 A;  4N1H A;  3BRM A;  3VP4 A;  5DFX A;  2WUQ A;  3PBN A;  2PRF A;  5E43 A;  4E6X A;  3C2W A;  2HV1 A;  2XGN A;  4Q8I A;  5HW3 A;  3TG9 A;  1FOF A;  3BLM A;  3JVV A;  3GSG A;  2W3D A;  3V3S A;  3UN7 A;  3PAE A;  3E2L A;  2HGV A;  5CGX A;  5EM0 A;  2K7S A;  4X1L A;  1TS8 A;  3NUL A;  3KX0 X;  2V20 A;  4R70 A;  5HL6 A;  5HWT A;  1I2S A;  4DXC A;  1I5Q A;  1H3Q A;  4E3N A;  1PW8 A;  2XF3 A;  1YMS A;  4I3J A;  3FYZ A;  1ES4 A;  1L0G A;  4MN5 A;  3IH9 A;  3ITB A;  1GHI A;  1SHV A;  3UDI A;  1S67 L;  2HP5 A;  5CEC A;  4U0T A;  3VFF A;  3VP3 A;  5KZH A;  3CLO A;  3LIB A;  2MJ6 A;  2CMN A;  2XEP A;  2JKR I;  3SZT A;  3N6I A;  3Q1F A;  4DJ3 A;  3G31 A;  2ZL1 B;  4PAU A;  1LL9 A;  2Y2H A;  1ALQ A;  4FSF A;  2ZOH A;  5CTM A;  1CEG A;  2WGW B;  3HCY A;  1L0F A;  4GS9 B;  1ZHH B;  4XUX A;  2D01 A;  4BWI A;  3F1N A;  4OQI A;  4BLM A;  1TS6 A;  1S4R A;  2W27 A;  5KIZ A;  5FQI A;  2B5R A;  4HQA A;  3Q7Z A;  1T1B A;  4KUO A;  4OQ0 A;  5HDC A;  3OPP A;  1K54 C;  3DAV A;  4K0W A;  3NI9 A;  3C38 A;  5FEF A;  1BTL A;  3E0Y A;  2XQZ A;  4BBV A;  1WE4 A;  3SS5 A;  4LRY C;  4ZRR A;  4Q0H A;  4EV4 A;  5EVL A;  3IWO A;  4GJ4 A;  2OLU A;  5G4Y A;  3P7N A;  1EW0 A;  1MPL A;  2EWW A;  3B3X A;  2ZLY A;  3IWI A;  3C8C A;  1ZG4 A;  3FKW A;  4BD0 A;  3EQV A;  1OTI A;  2L4R A;  1TDG A;  4XT2 B;  2JKG A;  4KZ5 A;  3DTI A;  3MZE A;  2E8I A;  4BBU A;  1KGG A;  5L2F A;  2O9A A;  5DTK A;  4JGQ A;  3NEC A;  4MDZ A;  4F94 A;  4F3L B;  1VET A;  4LV2 A;  4Z9Q A;  3FPV A;  3I7J A;  3RJU A;  3PBR A;  2FH5 A;  3LYX A;  1OTE A;  2OV5 A;  3VSK A;  4NXE A;  5HX9 A;  3HJK A;  3ZG0 A;  4GS9 A;  4E3I A;  4EBP A;  4PMA A;  1YLZ A;  3BEB A;  5DKK A;  1IYO A;  2EX9 A;  2INW A;  2QJ5 A;  5HPI A;  1NRJ A;  3O5Y A;  1PZP A;  2WYX A;  3A0R A;  4OON A;  4HBU A;  5CER A;  3GEC A;  4OPR A;  1NJ4 A;  5HPF A;  2GJ3 A;  4E04 A;  4KG6 A;  3T4J A;  5CGW A;  5F82 A;  3G2Y A;  1V9Z A;  2JKT M;  3IF6 A;  1ERQ A;  4YFM A;  2UV0 E;  3ZVT A;  2WKH A;  3BFC A;  4DMZ A;  3BYD A;  5BOH A;  1RCJ A;  2Q0O A;  4HH3 A;  3G4P A;  3LIE A;  3UE0 A;  5EVE A;  1VQQ A;  2Y2M A;  2XK1 A;  3C7V A;  3CZD A;  4EWF A;  2A3U A;  5G18 A;  4RVA A;  3SW1 A;  2XA7 M;  4GLQ A;  1IOU A;  2ACG A;  5C5K A;  4EU0 A;  5MC7 A;  4KG5 A;  3BFF A;  3SH7 A;  2VGJ A;  2QKP A;  3KYQ A;  1VM1 A;  5FAO A;  1YLT A;  4GD6 A;  1VB6 A;  1KDW A;  2V9A A;  4QY5 A;  2LB9 A;  3IBJ A;  1LI9 A;  1DP9 A;  2VZW A;  2WAF A;  1VET B;  5JYP A;  4CLC C;  4ZDX A;  2R9X A;  2C6W B;  5FDH A;  4EBL A;  3S7P A;  5CX7 A;  2EXA A;  1FCO A;  1DY6 A;  3FG8 A;  3BY9 A;  1FCN A;  4OPZ A;  1GSW A;  3TW8 A;  2OWH A;  3Q81 A;  4O0P A;  4WEL A;  5CHU A;  5TGF A;  1SKF A;  4O8G A;  3T4Q A;  4MBF A;  4LRZ E;  3PBT A;  5EE8 A;  1ES5 A;  1BSG A;  3HLW A;  4WM9 A;  4C75 A;  1Q2Q A;  1YMX A;  3NDG A;  4QPR A;  2PYR A;  4LRX C;  3AGF A;  2L1M A;  2ZBB A;  2H28 A;  4M4X A;  4JXV A;  4Y0T A;  3AGD A;  1CK3 A;  1J3W A;  4UEY A;  1W8Q A;  1I2W A;  3M2K A;  2J9P A;  2Q9N A;  5IHV A;  1DP6 A;  2Y2P A;  1EWZ A;  3T50 A;  4UA6 A;  4B4Z A;  4CJN A;  1PYY A;  4QU3 A;  2X02 A;  4D60 A;  3LR5 A;  1ES3 A;  2IWD A;  1D7E A;  2PYP A;  2D02 A;  3EWK A;  5FAQ A;  3HLG A;  2ZJ9 A;  2WAD A;  2VKS A;  4OP5 A;  1ERM A;  5HFO A;  2HZ5 A;  4OVD A;  4JBF A;  2KLI A;  1PWG A;  2HDR A;  1JWZ A;  5IU1 A;  4QB8 A;  2ZMV A;  4R3A A;  2Q9M A;  3M2J A;  4OH0 A;  4M3K A;  2QYB A;  1GCE A;  3RH8 B;  4GNU A;  2V1B A;  3UB9 A;  1NYY A;  1PWD A;  3E4P A;  4DE1 A;  3RFB A;  3A3F A;  1JWP A;  3PXP A;  4OPY A;  3JVU A;  2Y2I A;  2G2W A;  3GR2 A;  4JF4 A;  2VLG A;  3H82 A;  2YKF A;  3RXX A;  4X6T A;  4Z1W A;  1V9Y A;  4GDN A;  4EUZ A;  1S1Z A;  3LO7 A;  5G4Z A;  4N9L A;  1XJ2 A;  1EI5 A;  4WZ5 C;  3H7W B;  2WKP A;  2DNS A;  2ZMF A;  3D3O A;  1H8Z A;  1LLB A;  3ZDJ A;  2WKR A;  4R3J A;  4PM9 A;  2EFX A;  5F69 A;  3S1Y A;  1L3L A;  3S7Q A;  5FSR A;  3BQA A;  1Z09 A;  3Q7V A;  2K31 A;  1YM1 A;  2A24 A;  3T1S A;  1ONH A;  2P08 A;  3LI9 A;  1MBL A;  3UPO A;  1LSX A;  5F1F A;  3G30 A;  1FCM A;  2P9V B;  4ZJ2 A;  1H8Y A;  4BQM A;  3ZYT A;  4U0X A;  2Y2N A;  3B42 A;  4I38 A;  3HLF A;  3S22 A;  4I3I A;  1K38 A;  3C4O A;  3QNB A;  2Z6C A;  3DTE A;  4UHU A;  5AQA A;  3UPP A;  1M40 A;  5HD3 A;  3MXR A;  1ZKJ A;  1RP5 A;  2EFU A;  3FKV A;  4E6W A;  2EX8 A;  3TSG A;  1GA0 A;  1AWI A;  1OTA A;  4JXW A;  1XGJ A;  2OOL A;  2Z6D A;  3IS2 A;  2ZQC A;  5E2F A;  1LT0 A;  4PPR A;  3NHQ A;  3FC7 A;  2Y2L A;  4NXF A;  3U2A A;  1K57 A;  4LV3 A;  4NXG A;  3E4O A;  3C7U A;  5GLB A;  5DF7 A;  1KDS A;  3IT9 A;  5I5L A;  2PBD P;  4EW7 A;  1CJF A;  3BY8 A;  1KVM A;  3QHY A;  4CQH A;  3CUE C;  5DFY A;  1JVJ A;  3G6O A;  2QPN A;  5EV0 A;  4B4X A;  1OTB A;  4JF6 A;  1TF1 A;  1K6S A;  5FA7 A;  3TRC A;  2ZC3 B;  3IF6 B;  1TVF A;  5DTT A;  4KG2 A;  5HZH A;  3QP8 A;  4E3L A;  3W4Q A;  1GHP A;  4S2P A;  4EQI A;  1G6A A;  2ZC4 B;  5J4E A;  3MQ0 A;  4QHC A;  5A8B A;  1DJB A;  3V5M A;  3ZNY A;  3F1N B;  2VX8 A;  4IJG A;  2QHK A;  5U47 A;  5M1A A;  3K3D A;  1MWT A;  4WUJ A;  1MKM A;  1P9R A;  5CRF A;  4BMW A;  1MKI A;  4UAA A;  3B33 A;  2GX5 A;  1PI5 A;  2WGV A;  3IXD A;  4JF5 A;  4KZ6 A;  1CI8 A;  4R4S A;  1KVL A;  2B95 A;  4XXR A;  3CHW P;  2WK0 A;  1D1J A;  4NXB A;  2BG1 A;  2Y2J A;  3S7N A;  2NUP C;  4WZ5 A;  2JC7 A;  2FFF B;  1YKD A;  2ZM2 A;  1PNE A;  4K08 A;  2B02 A;  3T4L A;  3MS6 A;  3ZNT A;  1N9B A;  1NY0 A;  2W3H A;  4WF0 A;  2M7V A;  2W3F A;  1YQS A;  2V8F A;  1FQG A;  1KE4 A;  3NOT C;  3VOY A;  4CPK A;  4JXG A; 
#chains in the Genus database with same CATH homology
 1UWP X;  2JKT M;  3UB6 A;  3R7W B;  1T19 A;  5J3W A;  3C30 A;  4G3W A;  4DMZ A;  4HHD A;  3EGX C;  3MFX A;  2B18 A;  2G7U A;  2M7U A;  4ARZ A;  1XFN A;  2K2N A;  2PD8 A;  1XFQ A;  3KSG A;  3BWL A;  2W3G A;  3E98 A;  4R38 A;  4HH3 A;  2HF6 A;  4P6Z M;  4EXO A;  1S66 L;  3LIE A;  4B9O A;  4L9E A;  1DP8 A;  3T4S A;  3PBO A;  3LI8 A;  1XJ3 A;  3KO6 A;  4G3V A;  1G6O A;  4KQD A;  2Y8H A;  2V0U A;  3SW1 A;  5AJG A;  2XA7 M;  2W3E A;  4EES A;  2P04 A;  4GLQ A;  4UQI M;  4G3K A;  1LSV A;  3KSF A;  4XT2 A;  3P01 A;  1IOU A;  2KDK A;  5C5K A;  4WLA A;  4EU0 A;  3T4O A;  1OJG A;  1X0O A;  5DKL A;  4DN0 A;  5MC7 A;  3NOP C;  2W1T A;  3E4Q A;  3R4K A;  1G28 A;  5HDD A;  5HSQ A;  4OOM A;  4HP4 A;  4YWZ A;  4Q0J A;  4ME4 A;  2P7J A;  1F9I A;  2QKP A;  3KYQ A;  5LBR A;  1D06 A;  1VB6 A;  4H6J A;  2V9A A;  2LB9 A;  3IBJ A;  1DP9 A;  1UWN X;  2LB5 A;  2VZW A;  4R6L A;  4WEK A;  4MN6 A;  1NWZ A;  4CLC C;  3IBR A;  3LID A;  2ZOI A;  3S7P A;  5CX7 A;  2VV8 A;  3LIF A;  3FG8 A;  2VV6 A;  3CAX A;  3BY9 A;  1GSW A;  3TW8 A;  5AVF A;  1TD5 A;  2OWH A;  3H7W A;  4O0P A;  5IS1 A;  4WEL A;  3OC2 A;  5TBM A;  1UGU A;  4O8G A;  2GNX A;  3D72 A;  3DBA A;  5DJT A;  3T4Q A;  4LRZ E;  3PBT A;  3PHY A;  4NEE D;  3K2N A;  1N9O A;  5HDS A;  1F98 A;  4QPR A;  3VE4 A;  2PYR A;  2O9C A;  4LRX C;  4F3L A;  2L1M A;  2ZBB A;  4II7 A;  4JGO A;  2H28 A;  4M4X A;  2QWS A;  3LR4 A;  2VV7 A;  3HJI A;  3V67 A;  4L9F A;  4WN5 A;  3F1O A;  4UEY A;  1OTD A;  1OT9 A;  3UME A;  1S4S A;  1DP6 A;  4LPZ A;  3T50 A;  1IFQ A;  1YAX A;  4CLC E;  5K5B A;  1P9W A;  4UQI S;  3CIT A;  4IUK A;  2V1A A;  1P97 A;  4HH2 A;  1S1Y A;  2Y79 A;  3TJZ C;  4HJ3 A;  2I9V A;  3LR5 A;  5HD5 A;  2VGL S;  2YKH A;  3EEH A;  1D7E A;  2PYP A;  3VE3 A;  4ARZ B;  5HWW A;  1T1A A;  2D02 A;  2KOI A;  3BQ8 A;  3LIA A;  4KUK A;  3EWK A;  4JGR A;  1N9N A;  1LSW A;  3EEA A;  3UB8 A;  2JN7 A;  2EWV A;  2VKS A;  4HY8 A;  2W1R A;  2OAQ 1;  1NLZ A;  2KLI A;  5F6A A;  4BBT A;  2QJ7 A;  2HJE A;  1W63 Q;  5IU1 A;  3W2Z A;  2ZMV A;  4EET B;  2HJ9 C;  4R3A A;  2PD7 A;  4I39 A;  2KX6 A;  1GSV A;  2FZ0 A;  2QYB A;  2J3T D;  3RH8 B;  4HOI A;  4GHI B;  2V1B A;  3UB9 A;  1VHM A;  3K3C A;  3E4P A;  4YOF A;  4NKP A;  4I3A A;  5TBM B;  2OAP 1;  2XRN A;  3RFB A;  3PBS A;  1W63 M;  2A24 B;  2JHE A;  4MCW A;  3PXP A;  4O01 A;  3T4T A;  1LL8 A;  3JVU A;  4P6Z S;  1OT6 A;  4BJP A;  2VLG A;  3H82 A;  3PR6 A;  2XRO A;  3MJQ A;  2EA9 A;  1F5M A;  2L0W A;  2YKF A;  4Q0I A;  5TJJ A;  3OLO A;  2J3T C;  3VOL A;  4Z1W A;  2XA7 S;  1V9Y A;  1NLY A;  1S1Z A;  4PHT A;  5G4Z A;  3NJA A;  4DJ2 A;  4CLC B;  2JKT I;  3BW6 A;  2PR6 A;  5FL3 A;  1XJ2 A;  1Y28 A;  4FOF A;  3A0S A;  4YNR A;  3H7W B;  2WKP A;  4RQ9 A;  3UB7 A;  2ZMF A;  3FPW A;  3TE8 A;  2VEA A;  3OOV A;  3D3O A;  4PKY A;  3KSH A;  3LUQ A;  5IT5 A;  2WKR A;  1T18 A;  4GHI A;  2R78 A;  3IS2 B;  3UE6 A;  5DF9 A;  5F69 A;  2M1C A;  4CLC D;  5F68 A;  3S7Q A;  3BQA A;  4EEU A;  2PHY A;  4I5S A;  4IHQ A;  2O99 A;  3CI6 A;  4WEJ A;  2K31 A;  4HNB A;  3MQO A;  2A24 A;  2O0Y A;  1GSX A;  3MQQ A;  2BAS A;  2P08 A;  2J3W A;  5DFX A;  3LI9 A;  3PBN A;  2W1T B;  2A2L A;  3C2W A;  4Y3I A;  4E04 A;  1LSX A;  2HV1 A;  3GDI A;  3JVV A;  3OCN A;  4H6J B;  1P0Z A;  2W3D A;  1STZ A;  3ZYT A;  4PKY G;  2HGV A;  3LFV A;  3B42 A;  4I38 A;  2K7S A;  4WL9 A;  1TS8 A;  4I3I A;  3KX0 X;  2Z6C A;  4R70 A;  5HL6 A;  5HWT A;  4HP9 A;  1YSQ A;  3OCL A;  1H3Q A;  3ICY A;  5HD3 A;  1MC0 A;  4I3J A;  3CWF A;  4KQO A;  4Y2F A;  2W0N A;  4MN5 A;  1S67 L;  3LIC A;  3BJN A;  3MR0 A;  5HWV A;  3CLO A;  3LIB A;  2MJ6 A;  2CMN A;  3UMD A;  2JKR I;  3S7O A;  1OTA A;  2OWJ A;  4AFI A;  3OBF A;  4DJ3 A;  2V0W A;  4PAU A;  2XSS A;  4HI4 A;  2OOL A;  2Z6D A;  4FSF A;  4ETX A;  2ZOH A;  3IS2 A;  3MMH A;  2VGL M;  1LT0 A;  3HCY A;  3NHQ A;  3FC7 A;  4NXF A;  4MMN A;  3F1P A;  3H9W A;  4GS9 B;  3PBQ A;  1ZHH B;  3U2A A;  2D01 A;  4EUV A;  4NXG A;  2PT7 A;  3KYZ A;  3UE3 A;  4BWI A;  3E4O A;  3F1N A;  4OOL A;  1TS7 A;  1TS6 A;  1WA9 A;  1S4R A;  1XJ6 A;  4EER A;  1OPX A;  5AVE A;  2W27 A;  5KIZ A;  2VA0 A;  3VV4 A;  5I5L A;  4HQA A;  1KOU A;  1T1B A;  2DMW A;  3LR0 A;  3NOU C;  1TS0 A;  4EW7 A;  4KUO A;  3BY8 A;  1ZTU A;  5HDC A;  4HJ4 A;  5KSH A;  4B93 A;  4CQH A;  3MXQ A;  3CUE C;  3F1O B;  5DFY A;  4HJ6 A;  3G6O A;  4CLC A;  3RTY A;  5DJU A;  1OTB A;  3C38 A;  1TF1 A;  4HIA A;  3TRC A;  1YSP A;  3E0Y A;  4BBV A;  3ZQ5 A;  4ETZ A;  3H82 B;  3CUE A;  3B47 A;  5EFW A;  5HZH A;  4LRY C;  2NUT C;  4ZRR A;  4GW9 A;  3T4J A;  3EGD C;  1JNU A;  2PR5 A;  4Q0H A;  5J4E A;  2O9B A;  3MQ0 A;  3EOI A;  5A8B A;  3LR3 A;  4GJ4 A;  5G4Y A;  4LLO B;  3P7N A;  1XJ4 A;  1EW0 A;  2EWW A;  3KSI A;  3F1N B;  2J80 A;  2VX8 A;  3C8C A;  1OJ5 A;  1T1C A;  4IJG A;  3EQV A;  5F5Y A;  2QHK A;  1OTI A;  4JGP A;  2VJW A;  3K3D A;  4WUJ A;  2L4R A;  1H8M A;  1MKM A;  4EEP A;  1P9R A;  1MZU A;  3ULF A;  1DRM A;  3MF0 A;  4BMW A;  1ODV A;  4XT2 B;  3B33 A;  4MN7 A;  2GX5 A;  4BBU A;  4L9G A;  2O9A A;  4L0L A;  4JGQ A;  5J7E A;  2IA2 A;  4MDZ A;  2WKQ A;  4F3L B;  3PYP A;  3FPV A;  3A0V A;  3PBR A;  2FH5 A;  3LYX A;  1OTE A;  4NXB A;  1N9L A;  4NXE A;  3F1P B;  3T4K A;  3HJK A;  4EQ1 A;  4GS9 A;  4Y5F A;  3S7N A;  2NUP C;  5DKK A;  2GZA A;  2INW A;  2QJ5 A;  1YKD A;  5HPI A;  1NRJ A;  2B02 A;  4IUH A;  4K08 A;  3T4L A;  3O5Y A;  2JKR M;  1BYW A;  3R7W A;  2W3H A;  4WF0 A;  2M7V A;  2PDR A;  3A0R A;  2W3F A;  5L8M A;  3GEC A;  5HPF A;  3NOT C;  2GJ3 A;  3EQU A;  1V9Z A;  4GCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...