2CMNA

A proximal arginine residue in the switching mechanism of the fixl oxygen sensor
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
117
structure length
117
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISAYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SENSOR PROTEIN FIXL
publication title A Proximal Arginine R206 Participates in Switching of the Bradyrhizobium Japonicum Fixl Oxygen Sensor
pubmed doi rcsb
source organism Bradyrhizobium japonicum
molecule tags Transferase
total genus 33
structure length 117
sequence length 117
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2cmnA00
1OTDA 4LLOB 4E04A 1GSWA 5F69A 3MQQA 3D72A 2WKPA 1V9YA 3H82B 3P7NA 2H28A 4EW7A 3E4OA 1XJ6A 5DKLA 3MQOA 4GCZA 3UB6A 2D02A 1MZUA 4EQ1A 3A0SA 3UB9A 4L9GA 2INWA 1OTBA 4WN5A 5HDDA 1DRMA 3LI8A 5TBMB 2QHKA 1OT9A 3ICYA 4HP9A 5F5YA 3IS2B 3E4QA 4EEUA 4HH2A 4XT2B 1OJ5A 1S66L 3F1OA 1DP8A 3H7WA 4GS9B 2CMNA 4HP4A 5DJUA 3VOLA 2VLGA 2OWHA 2QWSA 2KDKA 1F9IA 3BY8A 1D7EA 4PKYA 5HWTA 4NXBA 4EESA 3CWFA 1N9LA 1WA9A 2P7JA 1DP6A 3K3CA 3CAXA 3SW1A 1XJ3A 4K08A 3F1PB 3BY9A 2OOLA 4PKYG 1XJ4A 4GHIB 5HWWA 4I38A 2A24B 2GJ3A 4I3JA 3KX0X 2PR5A 3K3DA 4KQDA 2V9AA 3LIEA 1T1AA 2ZBBA 2L4RA 4JGRA 3LIDA 4MN6A 5HD5A 1N9OA 1XFQA 4R3AA 4DJ2A 3LI9A 1S4RA 2PD7A 3PHYA 2W27A 4JGPA 1XJ2A 3ZQ5A 4BBUA 4WF0A 1N9NA 1TS0A 4WLAA 4KUKA 3NJAA 2PHYA 1OTIA 3F1NA 1D06A 1UGUA 3NOTC 3EEHA 5TBMA 3LIBA 3A0RA 1P97A 4L9EA 2PD8A 5EFWA 5I5LA 5G4ZA 4HH3A 1EW0A 1T1BA 2JHEA 3PYPA 5IU1A 4DJ3A 4I5SA 1X0OA 3B33A 4M4XA 4RQ9A 4F3LB 5AVFA 3LUQA 1T1CA 1OTAA 1LSXA 4EEPA 4NXFA 3RTYA 5HZHA 2L1MA 2J80A 3G6OA 3EWKA 4HHDA 4B9OA 1GSXA 2QJ5A 1TS8A 5HWVA 5IS1A 5KIZA 3FG8A 1F98A 3UMEA 4R38A 2HV1A 3LIAA 5J4EA 2R78A 3HJKA 1Y28A 1BYWA 4EETB 3RH8B 1KOUA 4WL9A 3F1OB 3H7WB 2ZOIA 4I39A 1DP9A 1LSVA 2VEAA 4H6JA 4R6LA 1V9ZA 2M1CA 2PDRA 3MJQA 1UWNX 2JN7A 4HOIA 2VV7A 1G28A 2KX6A 3NOPC 2V0UA 2BASA 3ULFA 3CLOA 4WUJA 4MN5A 3LYXA 4I3IA 4L9FA 1ODVA 5HDSA 3E4PA 4BBVA 3H82A 3GECA 2I9VA 4JGQA 5J7EA 2V1AA 4YWZA 3UB7A 1UWPX 3NOUC 1XFNA 3VE3A 5DJTA 2PYPA 5J3WA 3VE4A 1P0ZA 5HDCA 1S1YA 3IS2A 1OT6A 3UE6A 4HI4A 2K7SA 4XT2A 3FC7A 3NHQA 3OLOA 2L0WA 3H9WA 3MR0A 3LICA 3MXQA 4GS9A 3LIFA 4KUOA 2YKHA 2WKQA 2B02A 1TS6A 1S4SA 3F1NB 2ZOHA 4GW9A 1VB6A 5F68A 3A0VA 2VV6A 5F6AA 2PYRA 1T19A 5HSQA 5HD3A 4BBTA 3F1PA 4EERA 4HQAA 4GHIA 4HJ4A 2EA9A 3UMDA 3HJIA 5G4YA 1S1ZA 1LL8A 3BWLA 4JGOA 2A24A 4NXGA 4HNBA 4HY8A 4EXOA 4HJ6A 1LT0A 3T50A 2W0NA 2Z6CA 2D01A 4I3AA 1GSVA 2PR6A 1TS7A 4LRZE 3C8CA 2V1BA 4R70A 2V0WA 2WKRA 4HJ3A 3GDIA 5A8BA 1T18A 4HIAA 1S67L 4LRXC 1OTEA 2OWJA 3C2WA 1JNUA 5DKKA 5AVEA 3IBRA 4F3LA 3UB8A 2YKFA 4NXEA 1OJGA 3MFXA 1NWZA 2VV8A 4H6JB 2Z6DA 2QJ7A 1LSWA 4LPZA 4LRYC 2QKPA
chains in the Genus database with same CATH superfamily
4DDSA 4LLOB 4E04A 4X56A 1P9WA 3T4SA 3S7NA 3MQQA 1SCWA 1BT5A 3IHBA 2H28A 5FQIA 3WRZA 1MKIA 4FUWA 3B47A 2Y2JA 4GCZA 3UB6A 4ESPA 2D02A 1RCJA 4ZRRA 3A0SA 2Z2LB 3TOIA 4JF5A 3ZVWA 2QHKA 2V1ZA 4GKUA 3WS2A 3E4QA 5GHZA 3QP5A 4OOLA 1OJ5A 1S66L 3IX3A 3LEQA 5CECA 2EX2A 1DP8A 4MLLA 2HDRA 2JKTM 3Q1FA 3ZNYA 2GNXA 1ONGA 2CMNA 4HP4A 4ID4A 5CRFA 3VOLA 1XKZA 4JLFA 2W3HA 4GDNA 2QWSA 3V3RA 3LEZA 1D7EA 5HWTA 2AVXA 4EESA 4BL3A 2IWBA 1N9LA 2P9VA 2P08A 2P7JA 3V5MA 2IWDA 2HZ5A 4FH2A 1XJ3A 2J9PA 3F1PB 2I72A 2Y55A 4PKYG 2B95A 4P85A 4UAAA 5HWWA 4I38A 2Y2NA 3ZYTA 5FAOA 2JKRI 3OPHA 4I3JA 4IVKA 2WGIA 2PR5A 1RP5A 5JYPA 1F2KA 1W7FA 2V9AA 5GHYA 5TFQA 1T1AA 2L4RA 4MN6A 1U60A 1XFQA 4R3AA 3S1YA 1YLTA 3KSHA 4ZJ1A 3LI9A 4LCLA 4JGPA 3AGEA 4BBUA 1N9NA 1TS0A 2DRWA 2PHYA 1ZC2A 4QJGA 1D06A 3WRTA 1UGUA 5GHXA 1H8YA 1K57A 1A0KA 3DBAA 2WK0A 3A0RA 1P97A 1CEFA 2ZQ7A 4OH0A 5I5LA 1G5UA 1P9RA 2JKRM 1EW0A 4DE1A 3T4QA 4U0TA 1NRFA 4I5SA 2WAFA 4QHCA 2O9AA 1HD8A 4S2PA 4DE0A 1BLPA 4QD4A 4M4XA 1YSQA 2EX6A 4F3LB 1MXOA 1NXYA 4JF4A 2Y2MA 4Y3IA 5EE8A 4FSFA 3GTCA 3LR3A 3QNCA 5L07A 1NYYA 4NXFA 3W2ZA 1GHMA 2XSSA 3VP2A 2QJ5A 5AQ9A 4P6ZS 4X69A 4K0XA 1DJCA 1J9MA 1NYMA 5IHVA 5FSRA 2X71A 3BQ8A 3FG8A 1YQSA 3O3VA 4R38A 1WE4A 3PBQA 5FQKA 3S4XA 3HUNA 2HV1A 4OPQA 1VM1A 4WZ4A 3LIAA 3NBLA 1LL9A 1IKIA 3OOVA 2Y2HA 4IJGA 3HLDA 4EETB 4KG6A 1L0FA 3PXPA 1K54A 2VGLS 2O99A 4WL9A 3OPLA 3H7WB 2ZOIA 4JBFA 1BSGA 2PU2A 4H6JA 1V9ZA 1KE3A 2ZC4B 3MJQA 4OQGA 2J7VA 4UQIM 3KSIA 2UV0E 3ZNTA 2XROA 2KOIA 3ITBA 3ULFA 4A5RA 3LY3A 4MN5A 5I94A 5HDSA 3G2YA 3GECA 3IBJA 4KZ7A 3NIAA 3UY6A 1L0EA 2I9VA 3T12B 5J7EA 3PBNA 4YWZA 3UB7A 5HAQA 4S2OA 3U4LP 5DFYA 3VFHA 5EUAA 4Z9QA 4P87A 3VE3A 4QPRA 2VGKA 3CHWP 3EGDC 3VP1A 4BL2A 3GRJA 3VE4A 1SHVA 3IS2A 4R4SA 1FILA 3HLEA 2ZM8A 3UE3A 2E8IA 4XT2A 1L2SA 1XGJA 3H9WA 3IWQA 3ZFZA 3ITAA 3CITA 4GS9A 4KUOA 4MMNA 4Y15A 2YKHA 3L9KA 5A92A 3JYIA 2WYXA 2Q9MA 4CLCA 2G2WA 2C6WB 3PBSA 4EWFA 3F1NB 4HBUA 4GW9A 1VB6A 3WS1A 1JVJA 2P74A 2PYRA 3LFVA 1FSYA 5HSQA 1TF1A 2H0YA 2WZZA 3N8RA 4GHIA 4HJ4A 1K55C 5TR7A 3E2KA 4S2LA 5EVIC 3P09A 4KZ6A 4NXGA 1KVLA 2HP9A 1LT0A 5M18A 2Z6CA 1ES2A 1ALQA 2OAQ1 3G4PA 4WMCD 3Q7ZA 2ZC7A 4UA9A 3LR4A 2O0YA 5AJGA 3MF0A 1OPXA 2ZM2A 3MS6A 1GA9A 1KGEA 1CI8A 2WKRA 2ZL1B 3ZG9B 2HJ9C 3GDIA 5EM1A 3NCKA 1LL5A 4HIAA 1NRJA 4LRXC 1HVBA 4CJNA 1I2SA 4WYYA 5GLBA 1TDGA 4LFUA 1K4FA 3MZFA 1OTEA 1Q2QA 3CJMA 3MXRA 2XA7M 3BECA 1BUEA 4RYEA 5BOHA 3M2KA 3N4IA 3D3OA 4GN2A 3WS0A 3GSGA 2QJ7A 1LSWA 1MKMA 2V8FA 4LPZA 4LRYC 4CLCD 3PBRA 3JPUA 3QP4A 1H8MA 3HUMA 2EWVA 4ZAMA 3D72A 3HUOA 3H82B 4L0LA 2B5RA 1XJ6A 5DKLA 1RGYA 4XXRA 1MZUA 2BLSA 4S2NA 4L9GA 4DMZA 1YAXA 1OTBA 4WN5A 3LY4A 5EPHA 4PPRA 1PZOA 1FIKA 3QP1A 1MY8A 1CEGA 3UDXA 1XA7A 4KZ9A 3O87A 1G6AA 1KDWA 1YMSA 4C6YA 4EEUA 3G35A 3ZG7B 2X01A 2BTFP 3IH9A 1RGZA 3HLFA 1IYQA 2ZC6B 1MWUA 5AQBA 1W63M 4DXBA 3AGDA 3W4PA 3BRMA 2HP5A 4IUKA 3HL9A 3MXSA 3BY8A 2W3DA 3A3JA 1PWDA 2W1TA 3CUEA 2EFXA 2C5WB 3CWFA 4FOFA 3A3FA 1IKGA 1ERMA 4G3KA 3CAXA 1PYYA 3BY9A 1Z6FA 2OOLA 3OZHA 5DF7A 4N9KA 4R4RA 1XJ4A 1FCOA 3T4LA 2R9WA 3G30A 3T1XA 2A24B 1PIOA 2PBDP 3C7UA 4MBKA 2GJ3A 1K57C 4BWIA 4EBNA 3MZEA 4KQDA 5IT5A 2J8YA 2X02A 3LIDA 5HD5A 3HVFA 1KE0A 4U0XA 2PD7A 1KGGA 2W27A 2HDQA 1GHIA 1XJ2A 3ZQ5A 3NDGA 4ETZA 4YOFA 2Y91A 4KUKA 3IXGA 1YLWA 3SZTA 4X53A 3EEHA 3LIBA 1YLPA 5CHJA 4QU3A 4EQIA 1PI5A 5F1GA 2XRNA 1J3WA 4G3WA 4OLGA 4PM8A 3C4OA 4HH3A 4KZ3A 3U2AA 1OMEA 5KZHA 4D2OA 4PHTA 3LO7A 4OKPA 1X0OA 4KG2A 3N8SA 2Y2IA 2ZD8A 5DTKA 3A3EA 1IYOA 3GVBA 5DTSA 1JWPA 1SZVA 2QZ6A 3IF5A 4B88A 4DE2A 1IFQA 1OTAA 1LSXA 4EEPA 1K54C 2L1MA 4B4ZA 4Y7PA 1WYBA 1GA0A 1GSXA 2FZ0A 5FAPA 4NG2A 1S6RA 4Y13A 5KIZA 5EVID 5G18A 2J3TC 4GOGA 1ESUA 5J4EA 3HJKA 1BYWA 5D3OA 1KOUA 1HLUP 2XQZA 3ZG0A 5FI2A 2Z2MB 4JXWA 2ZMVA 3KSGA 3F1OB 4EBPA 1KDSA 2RCXA 1DP9A 3OCLA 4U3TA 4ARZA 1H8ZA 2HF6A 2M1CA 5KSHA 3FYZA 1UWNX 3DTMA 3D4FA 1ZTUA 1SKOA 4MDZA 3BEBA 3HREA 1DJAA 2EWWA 3UE1A 4WUJA 3LYXA 1ODVA 4OOYA 1MBLA 3PAEA 4JGQA 2OSUA 2V1AA 3ZGAB 3IF6B 4UA7A 5L09A 3NOUC 5GLCA 2ZQ8A 3C30A 5DJTA 4CLCC 5EVEA 1NZUA 3MKEA 3E2LA 5HDCA 4BD0A 4GLQA 2WKIA 3UDFA 3OC2A 3UE6A 3IX4A 2ZM0A 3FC7A 3OLOA 2QYBA 5M19A 3C38A 3MR0A 3LICA 1ZKJA 2XD5A 3LIFA 2Y2PA 4OOMA 3NC8A 3HLGA 5KSCA 1TS6A 1S4SA 4LENA 3O5YA 5GL9A 3MKFA 4HEFA 1H5XA 2WADA 5FL3A 3BFGA 3N7WA 2A2LA 4IBRA 1T19A 4QY6A 5EOEA 4BBTA 3F1PA 4EERA 5A91A 3UMDA 3C4PA 2OLUA 5LBRA 1LL8A 3BWLA 4JGOA 1D1JA 3VP3A 2ACGA 2GX5A 3FV7A 4KQQA 1K38A 3O88A 1VQQA 5CHUA 4Y2FA 2XLNA 4HJ6A 2XH9A 4H8RA 3UNWA 3WWXA 2D01A 3LCEA 1CI9A 3IF6A 4N9LA 2PRFA 3TSGA 4OPRA 2OLVA 3C8CA 2V1BA 4R3BA 4R70A 4Q0IA 1W8QA 4Y0TA 4WZ5A 2V0WA 5MC7A 1W63Q 5FI6A 5A8BA 2W3FA 1T18A 2XA7S 5HFOA 5FQJA 4PM6A 1PFLA 4OLDA 1PZPA 3W8KA 4BQMA 2OWJA 2LB9A 2FH5A 5AVEA 3BLSA 3V67A 3IBRA 1MWSA 4F3LA 2QMIA 4M3KA 4NXEA 4PM7A 1OJGA 3CPTB 4JPMA 4ZJ2A 4S2NC 1EI5A 1Q2PA 5L10A 3UPPA 5HW3A 2HDUA 3BM6A 3V3SA 3GQZA 1L3LA 3HCYA 1KGFA 3EOIA 1OTDA 2ZQDA 4GJ4A 4IBXA 2Y59A 2Y2QA 5F69A 1SDEA 4BENA 4JF6A 4WEJA 3PR6A 3I7JA 4BLMA 4EW7A 1EROA 3E4OA 3BW6A 4BD1A 4N1HA 5CGWA 3MQOA 4O8GA 5FAQA 3UB9A 5HAIA 5EV0A 2INWA 4MCWA 1JWZA 3IX8A 5TBMB 3K2NA 3S7QA 2XD1A 3KSFA 3ICYA 5F5YA 4Y0UA 2W3EA 3CUEC 5HARA 1CQAA 3SH9A 4CQHA 1NY0A 3H7WA 2GZAA 3MZDA 3DTIA 3IXDA 4YFMA 3P01A 3UDIA 2ZJ9A 5DJUA 4QB8A 4OQHA 2VLGA 2HGVA 4DN0A 2OWHA 2J3TD 1F9IA 2KDKA 1YLJA 1ZG4A 4NXBA 5CTMA 1WA9A 1K6SA 5F1FA 1FCMA 1DP6A 1XPBA 2XR0A 3VP0A 5CEDA 2WAEA 5F82A 1ACFA 4MBFA 4BMWA 3S7OA 2JCHA 2HJEA 3DWKA 4JXGA 2XDMA 3TG9A 3KX0X 3K3DA 5E2HA 5HX9A 4ZBEA 2FFYA 3R7WB 4HESA 4DE3A 4N92A 4Y17A 4JGRA 5FEGA 3SS4A 2MJ6A 3V50A 1O7EA 4XUXA 4ZTKA 3CG5A 4C3QA 2WKEA 4JKTA 4X1LA 1SKFA 4WLAA 2O9CA 5HL6A 3NJAA 3O86A 1BLSA 5EVIB 3F1NA 3SH7A 3R4KA 4LV3A 3NOTC 5K5BA 4OQ0A 5GLAA 2EXBA 4JXSA 4B93A 2HDSA 1XP4A 5TBMA 3PTEA 1TVFA 4L9EA 5HAPA 1MWTA 3UB5P 2P04A 4OP5A 5EFWA 4E3IA 5G4ZA 3HLCA 4O0PA 1ERQA 3IWOA 4E3OA 5IU1A 1PNEA 4FH4A 2Y2KA 2OV5A 3B33A 2M7VA 1VEUB 3IH8A 2WGWB 1VETB 4RQ9A 2VZWA 1MWRA 3BFEA 1K6RA 5E2FA 5AVFA 3SH8A 4ETXA 2A3UA 1GHPA 3LUQA 1T1CA 1KE4A 3BFDA 3TJZC 3L7HA 3RTYA 2EX8A 2ZC5B 1W8YA 1PI4A 3VV4A 4GD8A 1ESIA 4IUHA 4BJPA 4F94A 3EWKA 4DF6A 4B4XA 4B9OA 4RA7A 4KZ5A 5DVAA 4WM9A 4S2KA 2HPBA 3EQVA 4XUZA 3QP6A 5FDSA 3G31A 1FCNA 1AXBA 4ME4A 3ZHHA 4PM9A 2ZL1A 2Y2OA 4DRTA 2IWCA 5DF9A 2VK3A 3B42A 2R78A 3A3DA 2ZQ9A 1ES5A 2WKHA 4EBLA 3C5AA 3WS4A 3MQ0A 3WS5A 4OONA 1M40A 1TD5A 3Q7VB 4I39A 5EM0A 2VEAA 1YPRA 2PDRA 3BLMA 2JN7A 1FQGA 1BTLA 4E3JA 4WELA 1CJFA 4S2MA 1PRQA 2VV7A 1G28A 3ZG8B 5M1AA 2B18A 2KX6A 3EQUA 3NOPC 3ZDJA 2WZXA 4KZ4A 2WUQA 2BASA 4UEYA 3CLOA 3BFCA 3E4PA 2Q9NA 4BBVA 3H82A 2P9VB 3T4KA 1WYCA 4KQRA 3DW0A 1BLCA 5E2EA 4GZBA 4LV1A 2GDNA 2H10A 3P98A 3D9YA 3FWLA 4K91A 2PAVP 4LGWA 4S2IA 4E3MA 3RXXA 4P0MA 2ZC3B 4PMAA 4LCMA 3ISGA 3CMZA 3MSHA 4X6TA 3ZG5A 2K7SA 3NHQA 2L0WA 1Z09A 5FA7A 1O07A 4JXVA 3TRCA 3GMWA 3Q07A 3RJUA 4K0WA 3PBOA 2A49A 3NULA 1XXMA 3B3XA 3FKWA 3G32A 4GNUA 1NJ4A 2J9OA 3IXHA 2JKFA 1Y4OA 5FI7A 1AWIA 3FZCA 2VV6A 3NY4A 2VGJA 5HD3A 4MBHA 4HQAA 2OAP1 3IF6C 3HJIA 5HL1A 3DWZA 1S1ZA 5J8XA 3Q7VA 2WGVA 3PBTA 2A24A 4WZ5C 3M6BA 1H3QA 2XGNA 4HY8A 4EXOA 2M7UA 1FSWA 3T50A 1NZOA 2BG1A 2H0TA 4UQIS 4Q0HA 3OCNA 1K56A 5EOOA 4HBTA 2PR6A 4C75A 3Q81A 1TS7A 1E25A 4E3LA 5CX7A 1MC0A 4LRZE 4G3VA 2KLIA 4HJ3A 3KO6A 2JC7A 2E8JA 1Y54A 1K0KA 1KVMA 1F5MA 1QMFA 2Y2LA 4EUZA 1N4OA 4PAUA 3VP4A 5FASA 3C2WA 1JNUA 5DKKA 1DJBA 5E43A 3FPWA 3UB8A 2YKFA 1LHYA 1NWZA 2VV8A 5L2FA 1CF0A 2CC1A 4H6JB 5KMWA 4X55A 3UN7A 2W1RA 4X25A 1FR6A 1JWVA 4EV4A 3Q82A 1YMXA 4NKPA 3M2JA 2K31A 4CLCE 1GSWA 2G2UA 4LV2A 5CXWA 2WKPA 1V9YA 3T1QB 3CI6A 3P7NA 1TEMA 3NECA 1H0MA 2FFFB 1I2WA 4EQ1A 4YNRA 4QWOA 3DAVA 5HDDA 1DRMA 3LI8A 1OT9A 2R9XA 4HP9A 2DMWA 3IS2B 4UA6A 2ZMAA 3T4TA 4HH2A 4XT2B 4IEDA 5CGSA 3F1OA 5DFXA 3NDEA 2V20A 4GS9B 3V39A 2Y2GA 3T4OA 1K56D 3E98A 3VOYA 5DF8A 1G68A 3W4QA 1IYPA 3MBZA 1NLZA 4CLCB 2XFSA 4R3JA 5U47A 4PKYA 3RXWA 1L0GA 3K3CA 3SW1A 5C5KA 4K08A 3IHAA 3C7VA 4PM5A 4KZBA 2Y8HA 4GHIB 1W5DA 4AFIA 3EEAA 1L0DA 1E4DA 4OQIA 2XK1A 4LV0A 5HPFA 3OPPA 1XGIA 3AGFA 4WEKA 4YINA 5TGFA 3OBFA 1YLYA 3ZCZA 2RL3A 3VSLA 1N9BA 4R23A 3QP8A 4MEZA 1VHMA 3CZDA 3LIEA 3M6HA 4FD8A 2ZBBA 4NEED 3G2ZA 1N9OA 4WMCA 3UPNA 4KZ8A 4DJ2A 2O9BA 3IWIA 3TW8A 1S4RA 3PHYA 4RVAA 2IA2A 3LR0A 4NETA 5F83A 1NLYA 4RX3A 3LGOA 1JTDA 4WF0A 4IHQA 4E6WA 1OTIA 3HLWA 4R0QA 1IYSA 4KZAA 3T1SA 5FATA 3KYEA 4GD6A 3SS5A 5FQQA 3PAGA 5FQ9A 1G6OA 2PD8A 4O7DA 1IOUA 1T1BA 2JHEA 2VA0A 3PYPA 4DJ3A 4KENB 4X68A 1PWGA 3FPVA 4II7A 1HZOA 2ZLYA 3VSKA 3BQAA 3IT9A 3A3IA 2Y4AA 3FKVA 4KG5A 2JKGA 1E3UA 4MN7A 1YLZA 3DTKA 5CGXA 4NK3A 2V2FF 5HZHA 2J80A 1IELA 3G6OA 4HHDA 2EXAA 1TS8A 5L8MA 5HWVA 3HLBA 4QY5A 5IS1A 1K4EA 3JVVA 1F98A 3UMEA 3SS3A 4P6ZM 2QPNA 1Y28A 1LLBA 2XFTA 3RH8B 1ES4A 5CEBA 3LR5A 2PU4A 4O01A 1YKDA 4ZJ3A 4OVDA 3VOZA 3DTEA 3G34A 4GB7A 2NUPC 2EFUA 1I5QA 3CPTA 1STZA 1FR1A 3N6IA 4WBGA 1LSVA 4R6LA 2VGLM 5FDHA 1QMEA 4EU0A 5FQMA 5EECA 1CK3A 5A90A 2NUTC 4HOIA 4S2JA 3IQAA 1ZHHB 2V0UA 2VJWA 1HTZA 5A93A 2W1TB 4E3KA 1YM1A 2HP6A 5HPIA 4I3IA 4L9FA 2Y79A 2JE5A 3S22A 1JTGA 1FOFA 1UWPX 1XFNA 4FCFA 2VKSA 3T1RA 2ZQAA 2PYPA 4D60A 1IEMA 3GR2A 5J3WA 4Y0OA 1P0ZA 1S1YA 1OT6A 1DY6A 3MFDA 4HI4A 4Q0JA 2XF3A 3OPRA 5JYOA 1LI9A 5CTNA 1C3BA 3VMAA 3MXQA 1XA1A 3GV9A 1E3UD 1PW1A 5TJJA 2WKQA 2DCFA 2B02A 4DXCA 4RX2A 4R1GA 4GDBA 5E2GA 2ZOHA 3W4OA 3MMHA 4OPZA 5CHMA 5F68A 3ZVTA 3A0VA 3QHYA 5F6AA 5AQ7A 4ZDXA 3VFFA 1YT4A 1EWZA 2XEPA 1PWCA 1W79A 1SDNA 3KYZA 2EA9A 2G7UA 3EGXC 3KYQA 1YSPA 5G4YA 2J3WA 5EVLA 3S7PA 2EX9A 1S0WA 4N1XA 3HBRA 2V8CA 1K25A 2JBFA 4UHUA 3JVUA 4HNBA 4IVIA 5CERA 3UPOA 3R7WA 2DNSA 3BJNA 4MNRA 2W0NA 1ES3A 2PT7A 5FEFA 2UWXA 4I3AA 1GSVA 4CPKA 4X1MA 3BFFA 4EUVA 2Q0OA 3SOIA 1K55A 4DKIA 3BYDA 4KQOA 5EVIA 4Q8IA 3IXBA 3UE0A 3T4JA 4OPYA 2K2NA 2LB5A 3UO9A 3N8LA 5DTTA 4E6XA 4E3NA 3QNBA 3TE8A 3E0YA 5AQAA 5GLDA 2ZMFA 1S67L 3RFBA 1PW8A 4P6BA 1LI0A 1M6KA 3NI9A 2VX8A 4OP8A 1VEUA 2H5SA 1ZG6A 1VETA 2WGWA 1BULA 4Z1WA 2W3GA 3MFXA 4ARZB 2PBYA 2ZQCA 4FTXA 2Z6DA 4Y5FA 1BLHA 1BZAA 1MPLA 3QP2A 1XX2A 4DDYA 1GCEA 2QKPA 1SKOB 2JKTI 1ONHA 1TDLA
chains in the Genus database with same CATH topology
3EOIA 4CLCD 1OTDA 3PBRA 4LLOB 4E04A 1P9WA 4GJ4A 4NKPA 2K31A 3T4SA 1GSWA 1H8MA 4CLCE 3S7NA 5F69A 2EWVA 3MQQA 3D72A 2WKPA 1V9YA 3H82B 3CI6A 4WEJA 3P7NA 4L0LA 2H28A 3PR6A 4EW7A 3E4OA 1XJ6A 3BW6A 5DKLA 3B47A 3MQOA 4GCZA 4O8GA 3UB6A 2D02A 1MZUA 4EQ1A 4ZRRA 3A0SA 3UB9A 4L9GA 4DMZA 1YAXA 2INWA 1OTBA 4WN5A 4MCWA 4YNRA 5HDDA 1DRMA 3LI8A 5TBMB 3K2NA 2QHKA 1OT9A 3S7QA 3KSFA 3ICYA 4HP9A 5F5YA 2DMWA 3IS2B 2W3EA 3CUEC 3E4QA 4EEUA 3T4TA 4HH2A 4XT2B 4CQHA 4OOLA 1OJ5A 1S66L 3F1OA 5DFXA 1DP8A 3H7WA 2GZAA 2JKTM 4GS9B 3P01A 3T4OA 3E98A 2GNXA 2CMNA 1W63M 4HP4A 5DJUA 3VOLA 2VLGA 2HGVA 2W3HA 2OWHA 1NLZA 4DN0A 4IUKA 4CLCB 2QWSA 2J3TD 1F9IA 2KDKA 3BY8A 2W3DA 1D7EA 2W1TA 4PKYA 5HWTA 4NXBA 3CUEA 4EESA 3CWFA 1N9LA 1WA9A 2P08A 2P7JA 4FOFA 1DP6A 3K3CA 4G3KA 3CAXA 3SW1A 1XJ3A 5C5KA 4K08A 3F1PB 3BY9A 2OOLA 4PKYG 3S7OA 4BMWA 2Y8HA 1XJ4A 4GHIB 3T4LA 4AFIA 2HJEA 3EEAA 5HWWA 4I38A 2A24B 5HPFA 3ZYTA 4WEKA 2GJ3A 2JKRI 4I3JA 3OBFA 3KX0X 4BWIA 2PR5A 3K3DA 4KQDA 1VHMA 2V9AA 3LIEA 3R7WB 5IT5A 1T1AA 2ZBBA 2L4RA 4NEED 4JGRA 3LIDA 4MN6A 5HD5A 1N9OA 2MJ6A 1XFQA 4R3AA 3KSHA 4DJ2A 2O9BA 3TW8A 3LI9A 1S4RA 2PD7A 3PHYA 2IA2A 3LR0A 2W27A 4JGPA 1NLYA 1XJ2A 3ZQ5A 4BBUA 4ETZA 4WF0A 4YOFA 1N9NA 1TS0A 4IHQA 2O9CA 4KUKA 3NJAA 4WLAA 2PHYA 5HL6A 1OTIA 3F1NA 1D06A 1UGUA 3R4KA 3NOTC 5K5BA 3DBAA 4B93A 3EEHA 5TBMA 3LIBA 3A0RA 1P97A 4L9EA 1G6OA 2PD8A 2P04A 5EFWA 2XRNA 5I5LA 4G3WA 5G4ZA 1P9RA 1IOUA 4HH3A 2JKRM 1EW0A 4O0PA 1T1BA 3U2AA 2JHEA 2VA0A 3T4QA 3PYPA 5IU1A 4DJ3A 4PHTA 4I5SA 1X0OA 2O9AA 3B33A 2M7VA 4M4XA 4RQ9A 3FPVA 1YSQA 4F3LB 4II7A 2VZWA 3BQAA 5AVFA 4ETXA 3LUQA 1T1CA 4Y3IA 3TJZC 4FSFA 1IFQA 1OTAA 3LR3A 1LSXA 4EEPA 4NXFA 4MN7A 3RTYA 3W2ZA 5HZHA 2L1MA 3VV4A 2J80A 4IUHA 2XSSA 3G6OA 4BJPA 3EWKA 4HHDA 4B9OA 1GSXA 2FZ0A 2QJ5A 1TS8A 4P6ZS 5L8MA 3EQVA 5HWVA 5IS1A 4ME4A 5KIZA 3BQ8A 3FG8A 3JVVA 1F98A 3UMEA 4R38A 2J3TC 3PBQA 2HV1A 4P6ZM 3LIAA 5DF9A 3B42A 5J4EA 2R78A 3OOVA 4IJGA 3HJKA 1Y28A 1BYWA 4EETB 3RH8B 3LR5A 1KOUA 4O01A 1YKDA 3PXPA 2VGLS 2O99A 4WL9A 3MQ0A 2ZMVA 3KSGA 3F1OB 1TD5A 2NUPC 3H7WB 2ZOIA 4I39A 1STZA 1DP9A 3OCLA 4ARZA 1LSVA 2VEAA 2HF6A 4H6JA 4R6LA 2VGLM 1V9ZA 2M1CA 2PDRA 5KSHA 3MJQA 1UWNX 4EU0A 2JN7A 4UQIM 1ZTUA 3KSIA 4WELA 2NUTC 4HOIA 2VV7A 4MDZA 1G28A 1ZHHB 2B18A 2KX6A 3EQUA 3NOPC 2XROA 2V0UA 2VJWA 2KOIA 2BASA 4UEYA 3ULFA 2EWWA 2W1TB 3CLOA 5HPIA 4WUJA 4MN5A 3LYXA 4I3IA 4L9FA 1ODVA 5HDSA 3E4PA 2Y79A 4BBVA 3H82A 3GECA 3IBJA 3T4KA 2I9VA 4JGQA 5J7EA 3PBNA 2V1AA 4YWZA 3UB7A 5DFYA 1UWPX 3NOUC 1XFNA 3VE3A 2VKSA 4QPRA 3C30A 3EGDC 5DJTA 4CLCC 2PYPA 5J3WA 3VE4A 1P0ZA 5HDCA 1S1YA 3IS2A 1OT6A 4GLQA 3OC2A 3UE6A 4HI4A 4Q0JA 3UE3A 2K7SA 4XT2A 3FC7A 3NHQA 3OLOA 2L0WA 3H9WA 2QYBA 3C38A 3TRCA 3MR0A 3LICA 3MXQA 3CITA 4GS9A 3LIFA 4KUOA 4MMNA 3PBOA 2YKHA 5TJJA 2WKQA 4OOMA 2B02A 4CLCA 1TS6A 1S4SA 3PBSA 3F1NB 3O5YA 2ZOHA 5FL3A 3MMHA 4GW9A 1VB6A 5F68A 3A0VA 2VV6A 2A2LA 5F6AA 2PYRA 3LFVA 1T19A 5HSQA 1TF1A 5HD3A 4BBTA 3F1PA 4EERA 4HQAA 2OAP1 4GHIA 3KYZA 2EA9A 2G7UA 3EGXC 3KYQA 4HJ4A 1YSPA 3UMDA 3HJIA 5G4YA 2J3WA 1S1ZA 5LBRA 3S7PA 1LL8A 3BWLA 3PBTA 4JGOA 2A24A 2GX5A 4NXGA 3JVUA 4HNBA 4Y2FA 1H3QA 4HY8A 4EXOA 4HJ6A 2M7UA 3R7WA 3BJNA 1LT0A 3T50A 2W0NA 2Z6CA 2PT7A 4UQIS 4Q0HA 3OCNA 2D01A 2OAQ1 4I3AA 1GSVA 2PR6A 4EUVA 1TS7A 2O0YA 3LR4A 5AJGA 3MF0A 4KQOA 1OPXA 5CX7A 1MC0A 4LRZE 4G3VA 3T4JA 3C8CA 2V1BA 4R70A 4Q0IA 2KLIA 2V0WA 2WKRA 5MC7A 4HJ3A 3KO6A 2K2NA 2LB5A 1W63Q 2HJ9C 3GDIA 5A8BA 2W3FA 1T18A 3TE8A 3E0YA 2XA7S 1F5MA 4HIAA 1NRJA 1S67L 2ZMFA 4LRXC 3RFBA 4PAUA 1OTEA 2OWJA 2LB9A 3C2WA 2FH5A 1JNUA 5DKKA 5AVEA 2XA7M 2VX8A 3V67A 3IBRA 3FPWA 4F3LA 3UB8A 2YKFA 4NXEA 1OJGA 4Z1WA 2W3GA 3MFXA 1NWZA 2VV8A 3D3OA 4ARZB 4H6JB 2Z6DA 4Y5FA 2QJ7A 2W1RA 1LSWA 1MKMA 4LPZA 4LRYC 2QKPA 2JKTI 3HCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTD A;  4LLO B;  4E04 A;  1GSW A;  5F69 A;  3MQQ A;  3D72 A;  2WKP A;  1V9Y A;  3H82 B;  3P7N A;  2H28 A;  4EW7 A;  3E4O A;  1XJ6 A;  5DKL A;  3MQO A;  4GCZ A;  3UB6 A;  2D02 A;  1MZU A;  4EQ1 A;  3A0S A;  3UB9 A;  4L9G A;  2INW A;  1OTB A;  4WN5 A;  5HDD A;  1DRM A;  3LI8 A;  5TBM B;  2QHK A;  1OT9 A;  3ICY A;  4HP9 A;  5F5Y A;  3IS2 B;  3E4Q A;  4EEU A;  4HH2 A;  4XT2 B;  1OJ5 A;  1S66 L;  3F1O A;  1DP8 A;  3H7W A;  4GS9 B;  2CMN A;  4HP4 A;  5DJU A;  3VOL A;  2VLG A;  2OWH A;  2QWS A;  2KDK A;  1F9I A;  3BY8 A;  1D7E A;  4PKY A;  5HWT A;  4NXB A;  4EES A;  3CWF A;  1N9L A;  1WA9 A;  2P7J A;  1DP6 A;  3K3C A;  3CAX A;  3SW1 A;  1XJ3 A;  4K08 A;  3F1P B;  3BY9 A;  2OOL A;  4PKY G;  1XJ4 A;  4GHI B;  5HWW A;  4I38 A;  2A24 B;  2GJ3 A;  4I3J A;  3KX0 X;  2PR5 A;  3K3D A;  4KQD A;  2V9A A;  3LIE A;  1T1A A;  2ZBB A;  2L4R A;  4JGR A;  3LID A;  4MN6 A;  5HD5 A;  1N9O A;  1XFQ A;  4R3A A;  4DJ2 A;  3LI9 A;  1S4R A;  2PD7 A;  3PHY A;  2W27 A;  4JGP A;  1XJ2 A;  3ZQ5 A;  4BBU A;  4WF0 A;  1N9N A;  1TS0 A;  4WLA A;  4KUK A;  3NJA A;  2PHY A;  1OTI A;  3F1N A;  1D06 A;  1UGU A;  3NOT C;  3EEH A;  5TBM A;  3LIB A;  3A0R A;  1P97 A;  4L9E A;  2PD8 A;  5EFW A;  5I5L A;  5G4Z A;  4HH3 A;  1EW0 A;  1T1B A;  2JHE A;  3PYP A;  5IU1 A;  4DJ3 A;  4I5S A;  1X0O A;  3B33 A;  4M4X A;  4RQ9 A;  4F3L B;  5AVF A;  3LUQ A;  1T1C A;  1OTA A;  1LSX A;  4EEP A;  4NXF A;  3RTY A;  5HZH A;  2L1M A;  2J80 A;  3G6O A;  3EWK A;  4HHD A;  4B9O A;  1GSX A;  2QJ5 A;  1TS8 A;  5HWV A;  5IS1 A;  5KIZ A;  3FG8 A;  1F98 A;  3UME A;  4R38 A;  2HV1 A;  3LIA A;  5J4E A;  2R78 A;  3HJK A;  1Y28 A;  1BYW A;  4EET B;  3RH8 B;  1KOU A;  4WL9 A;  3F1O B;  3H7W B;  2ZOI A;  4I39 A;  1DP9 A;  1LSV A;  2VEA A;  4H6J A;  4R6L A;  1V9Z A;  2M1C A;  2PDR A;  3MJQ A;  1UWN X;  2JN7 A;  4HOI A;  2VV7 A;  1G28 A;  2KX6 A;  3NOP C;  2V0U A;  2BAS A;  3ULF A;  3CLO A;  4WUJ A;  4MN5 A;  3LYX A;  4I3I A;  4L9F A;  1ODV A;  5HDS A;  3E4P A;  4BBV A;  3H82 A;  3GEC A;  2I9V A;  4JGQ A;  5J7E A;  2V1A A;  4YWZ A;  3UB7 A;  1UWP X;  3NOU C;  1XFN A;  3VE3 A;  5DJT A;  2PYP A;  5J3W A;  3VE4 A;  1P0Z A;  5HDC A;  1S1Y A;  3IS2 A;  1OT6 A;  3UE6 A;  4HI4 A;  2K7S A;  4XT2 A;  3FC7 A;  3NHQ A;  3OLO A;  2L0W A;  3H9W A;  3MR0 A;  3LIC A;  3MXQ A;  4GS9 A;  3LIF A;  4KUO A;  2YKH A;  2WKQ A;  2B02 A;  1TS6 A;  1S4S A;  3F1N B;  2ZOH A;  4GW9 A;  1VB6 A;  5F68 A;  3A0V A;  2VV6 A;  5F6A A;  2PYR A;  1T19 A;  5HSQ A;  5HD3 A;  4BBT A;  3F1P A;  4EER A;  4HQA A;  4GHI A;  4HJ4 A;  2EA9 A;  3UMD A;  3HJI A;  5G4Y A;  1S1Z A;  1LL8 A;  3BWL A;  4JGO A;  2A24 A;  4NXG A;  4HNB A;  4HY8 A;  4EXO A;  4HJ6 A;  1LT0 A;  3T50 A;  2W0N A;  2Z6C A;  2D01 A;  4I3A A;  1GSV A;  2PR6 A;  1TS7 A;  4LRZ E;  3C8C A;  2V1B A;  4R70 A;  2V0W A;  2WKR A;  4HJ3 A;  3GDI A;  5A8B A;  1T18 A;  4HIA A;  1S67 L;  4LRX C;  1OTE A;  2OWJ A;  3C2W A;  1JNU A;  5DKK A;  5AVE A;  3IBR A;  4F3L A;  3UB8 A;  2YKF A;  4NXE A;  1OJG A;  3MFX A;  1NWZ A;  2VV8 A;  4H6J B;  2Z6D A;  2QJ7 A;  1LSW A;  4LPZ A;  4LRY C;  2QKP A; 
#chains in the Genus database with same CATH topology
 4DDS A;  4LLO B;  4E04 A;  4X56 A;  1P9W A;  3T4S A;  3S7N A;  3MQQ A;  1SCW A;  1BT5 A;  3IHB A;  2H28 A;  5FQI A;  3WRZ A;  1MKI A;  4FUW A;  3B47 A;  2Y2J A;  4GCZ A;  3UB6 A;  4ESP A;  2D02 A;  1RCJ A;  4ZRR A;  3A0S A;  2Z2L B;  3TOI A;  4JF5 A;  3ZVW A;  2QHK A;  2V1Z A;  4GKU A;  3WS2 A;  3E4Q A;  5GHZ A;  3QP5 A;  4OOL A;  1OJ5 A;  1S66 L;  3IX3 A;  3LEQ A;  5CEC A;  2EX2 A;  1DP8 A;  4MLL A;  2HDR A;  2JKT M;  3Q1F A;  3ZNY A;  2GNX A;  1ONG A;  2CMN A;  4HP4 A;  4ID4 A;  5CRF A;  3VOL A;  1XKZ A;  4JLF A;  2W3H A;  4GDN A;  2QWS A;  3V3R A;  3LEZ A;  1D7E A;  5HWT A;  2AVX A;  4EES A;  4BL3 A;  2IWB A;  1N9L A;  2P9V A;  2P08 A;  2P7J A;  3V5M A;  2IWD A;  2HZ5 A;  4FH2 A;  1XJ3 A;  2J9P A;  3F1P B;  2I72 A;  2Y55 A;  4PKY G;  2B95 A;  4P85 A;  4UAA A;  5HWW A;  4I38 A;  2Y2N A;  3ZYT A;  5FAO A;  2JKR I;  3OPH A;  4I3J A;  4IVK A;  2WGI A;  2PR5 A;  1RP5 A;  5JYP A;  1F2K A;  1W7F A;  2V9A A;  5GHY A;  5TFQ A;  1T1A A;  2L4R A;  4MN6 A;  1U60 A;  1XFQ A;  4R3A A;  3S1Y A;  1YLT A;  3KSH A;  4ZJ1 A;  3LI9 A;  4LCL A;  4JGP A;  3AGE A;  4BBU A;  1N9N A;  1TS0 A;  2DRW A;  2PHY A;  1ZC2 A;  4QJG A;  1D06 A;  3WRT A;  1UGU A;  5GHX A;  1H8Y A;  1K57 A;  1A0K A;  3DBA A;  2WK0 A;  3A0R A;  1P97 A;  1CEF A;  2ZQ7 A;  4OH0 A;  5I5L A;  1G5U A;  1P9R A;  2JKR M;  1EW0 A;  4DE1 A;  3T4Q A;  4U0T A;  1NRF A;  4I5S A;  2WAF A;  4QHC A;  2O9A A;  1HD8 A;  4S2P A;  4DE0 A;  1BLP A;  4QD4 A;  4M4X A;  1YSQ A;  2EX6 A;  4F3L B;  1MXO A;  1NXY A;  4JF4 A;  2Y2M A;  4Y3I A;  5EE8 A;  4FSF A;  3GTC A;  3LR3 A;  3QNC A;  5L07 A;  1NYY A;  4NXF A;  3W2Z A;  1GHM A;  2XSS A;  3VP2 A;  2QJ5 A;  5AQ9 A;  4P6Z S;  4X69 A;  4K0X A;  1DJC A;  1J9M A;  1NYM A;  5IHV A;  5FSR A;  2X71 A;  3BQ8 A;  3FG8 A;  1YQS A;  3O3V A;  4R38 A;  1WE4 A;  3PBQ A;  5FQK A;  3S4X A;  3HUN A;  2HV1 A;  4OPQ A;  1VM1 A;  4WZ4 A;  3LIA A;  3NBL A;  1LL9 A;  1IKI A;  3OOV A;  2Y2H A;  4IJG A;  3HLD A;  4EET B;  4KG6 A;  1L0F A;  3PXP A;  1K54 A;  2VGL S;  2O99 A;  4WL9 A;  3OPL A;  3H7W B;  2ZOI A;  4JBF A;  1BSG A;  2PU2 A;  4H6J A;  1V9Z A;  1KE3 A;  2ZC4 B;  3MJQ A;  4OQG A;  2J7V A;  4UQI M;  3KSI A;  2UV0 E;  3ZNT A;  2XRO A;  2KOI A;  3ITB A;  3ULF A;  4A5R A;  3LY3 A;  4MN5 A;  5I94 A;  5HDS A;  3G2Y A;  3GEC A;  3IBJ A;  4KZ7 A;  3NIA A;  3UY6 A;  1L0E A;  2I9V A;  3T12 B;  5J7E A;  3PBN A;  4YWZ A;  3UB7 A;  5HAQ A;  4S2O A;  3U4L P;  5DFY A;  3VFH A;  5EUA A;  4Z9Q A;  4P87 A;  3VE3 A;  4QPR A;  2VGK A;  3CHW P;  3EGD C;  3VP1 A;  4BL2 A;  3GRJ A;  3VE4 A;  1SHV A;  3IS2 A;  4R4S A;  1FIL A;  3HLE A;  2ZM8 A;  3UE3 A;  2E8I A;  4XT2 A;  1L2S A;  1XGJ A;  3H9W A;  3IWQ A;  3ZFZ A;  3ITA A;  3CIT A;  4GS9 A;  4KUO A;  4MMN A;  4Y15 A;  2YKH A;  3L9K A;  5A92 A;  3JYI A;  2WYX A;  2Q9M A;  4CLC A;  2G2W A;  2C6W B;  3PBS A;  4EWF A;  3F1N B;  4HBU A;  4GW9 A;  1VB6 A;  3WS1 A;  1JVJ A;  2P74 A;  2PYR A;  3LFV A;  1FSY A;  5HSQ A;  1TF1 A;  2H0Y A;  2WZZ A;  3N8R A;  4GHI A;  4HJ4 A;  1K55 C;  5TR7 A;  3E2K A;  4S2L A;  5EVI C;  3P09 A;  4KZ6 A;  4NXG A;  1KVL A;  2HP9 A;  1LT0 A;  5M18 A;  2Z6C A;  1ES2 A;  1ALQ A;  2OAQ 1;  3G4P A;  4WMC D;  3Q7Z A;  2ZC7 A;  4UA9 A;  3LR4 A;  2O0Y A;  5AJG A;  3MF0 A;  1OPX A;  2ZM2 A;  3MS6 A;  1GA9 A;  1KGE A;  1CI8 A;  2WKR A;  2ZL1 B;  3ZG9 B;  2HJ9 C;  3GDI A;  5EM1 A;  3NCK A;  1LL5 A;  4HIA A;  1NRJ A;  4LRX C;  1HVB A;  4CJN A;  1I2S A;  4WYY A;  5GLB A;  1TDG A;  4LFU A;  1K4F A;  3MZF A;  1OTE A;  1Q2Q A;  3CJM A;  3MXR A;  2XA7 M;  3BEC A;  1BUE A;  4RYE A;  5BOH A;  3M2K A;  3N4I A;  3D3O A;  4GN2 A;  3WS0 A;  3GSG A;  2QJ7 A;  1LSW A;  1MKM A;  2V8F A;  4LPZ A;  4LRY C;  4CLC D;  3PBR A;  3JPU A;  3QP4 A;  1H8M A;  3HUM A;  2EWV A;  4ZAM A;  3D72 A;  3HUO A;  3H82 B;  4L0L A;  2B5R A;  1XJ6 A;  5DKL A;  1RGY A;  4XXR A;  1MZU A;  2BLS A;  4S2N A;  4L9G A;  4DMZ A;  1YAX A;  1OTB A;  4WN5 A;  3LY4 A;  5EPH A;  4PPR A;  1PZO A;  1FIK A;  3QP1 A;  1MY8 A;  1CEG A;  3UDX A;  1XA7 A;  4KZ9 A;  3O87 A;  1G6A A;  1KDW A;  1YMS A;  4C6Y A;  4EEU A;  3G35 A;  3ZG7 B;  2X01 A;  2BTF P;  3IH9 A;  1RGZ A;  3HLF A;  1IYQ A;  2ZC6 B;  1MWU A;  5AQB A;  1W63 M;  4DXB A;  3AGD A;  3W4P A;  3BRM A;  2HP5 A;  4IUK A;  3HL9 A;  3MXS A;  3BY8 A;  2W3D A;  3A3J A;  1PWD A;  2W1T A;  3CUE A;  2EFX A;  2C5W B;  3CWF A;  4FOF A;  3A3F A;  1IKG A;  1ERM A;  4G3K A;  3CAX A;  1PYY A;  3BY9 A;  1Z6F A;  2OOL A;  3OZH A;  5DF7 A;  4N9K A;  4R4R A;  1XJ4 A;  1FCO A;  3T4L A;  2R9W A;  3G30 A;  3T1X A;  2A24 B;  1PIO A;  2PBD P;  3C7U A;  4MBK A;  2GJ3 A;  1K57 C;  4BWI A;  4EBN A;  3MZE A;  4KQD A;  5IT5 A;  2J8Y A;  2X02 A;  3LID A;  5HD5 A;  3HVF A;  1KE0 A;  4U0X A;  2PD7 A;  1KGG A;  2W27 A;  2HDQ A;  1GHI A;  1XJ2 A;  3ZQ5 A;  3NDG A;  4ETZ A;  4YOF A;  2Y91 A;  4KUK A;  3IXG A;  1YLW A;  3SZT A;  4X53 A;  3EEH A;  3LIB A;  1YLP A;  5CHJ A;  4QU3 A;  4EQI A;  1PI5 A;  5F1G A;  2XRN A;  1J3W A;  4G3W A;  4OLG A;  4PM8 A;  3C4O A;  4HH3 A;  4KZ3 A;  3U2A A;  1OME A;  5KZH A;  4D2O A;  4PHT A;  3LO7 A;  4OKP A;  1X0O A;  4KG2 A;  3N8S A;  2Y2I A;  2ZD8 A;  5DTK A;  3A3E A;  1IYO A;  3GVB A;  5DTS A;  1JWP A;  1SZV A;  2QZ6 A;  3IF5 A;  4B88 A;  4DE2 A;  1IFQ A;  1OTA A;  1LSX A;  4EEP A;  1K54 C;  2L1M A;  4B4Z A;  4Y7P A;  1WYB A;  1GA0 A;  1GSX A;  2FZ0 A;  5FAP A;  4NG2 A;  1S6R A;  4Y13 A;  5KIZ A;  5EVI D;  5G18 A;  2J3T C;  4GOG A;  1ESU A;  5J4E A;  3HJK A;  1BYW A;  5D3O A;  1KOU A;  1HLU P;  2XQZ A;  3ZG0 A;  5FI2 A;  2Z2M B;  4JXW A;  2ZMV A;  3KSG A;  3F1O B;  4EBP A;  1KDS A;  2RCX A;  1DP9 A;  3OCL A;  4U3T A;  4ARZ A;  1H8Z A;  2HF6 A;  2M1C A;  5KSH A;  3FYZ A;  1UWN X;  3DTM A;  3D4F A;  1ZTU A;  1SKO A;  4MDZ A;  3BEB A;  3HRE A;  1DJA A;  2EWW A;  3UE1 A;  4WUJ A;  3LYX A;  1ODV A;  4OOY A;  1MBL A;  3PAE A;  4JGQ A;  2OSU A;  2V1A A;  3ZGA B;  3IF6 B;  4UA7 A;  5L09 A;  3NOU C;  5GLC A;  2ZQ8 A;  3C30 A;  5DJT A;  4CLC C;  5EVE A;  1NZU A;  3MKE A;  3E2L A;  5HDC A;  4BD0 A;  4GLQ A;  2WKI A;  3UDF A;  3OC2 A;  3UE6 A;  3IX4 A;  2ZM0 A;  3FC7 A;  3OLO A;  2QYB A;  5M19 A;  3C38 A;  3MR0 A;  3LIC A;  1ZKJ A;  2XD5 A;  3LIF A;  2Y2P A;  4OOM A;  3NC8 A;  3HLG A;  5KSC A;  1TS6 A;  1S4S A;  4LEN A;  3O5Y A;  5GL9 A;  3MKF A;  4HEF A;  1H5X A;  2WAD A;  5FL3 A;  3BFG A;  3N7W A;  2A2L A;  4IBR A;  1T19 A;  4QY6 A;  5EOE A;  4BBT A;  3F1P A;  4EER A;  5A91 A;  3UMD A;  3C4P A;  2OLU A;  5LBR A;  1LL8 A;  3BWL A;  4JGO A;  1D1J A;  3VP3 A;  2ACG A;  2GX5 A;  3FV7 A;  4KQQ A;  1K38 A;  3O88 A;  1VQQ A;  5CHU A;  4Y2F A;  2XLN A;  4HJ6 A;  2XH9 A;  4H8R A;  3UNW A;  3WWX A;  2D01 A;  3LCE A;  1CI9 A;  3IF6 A;  4N9L A;  2PRF A;  3TSG A;  4OPR A;  2OLV A;  3C8C A;  2V1B A;  4R3B A;  4R70 A;  4Q0I A;  1W8Q A;  4Y0T A;  4WZ5 A;  2V0W A;  5MC7 A;  1W63 Q;  5FI6 A;  5A8B A;  2W3F A;  1T18 A;  2XA7 S;  5HFO A;  5FQJ A;  4PM6 A;  1PFL A;  4OLD A;  1PZP A;  3W8K A;  4BQM A;  2OWJ A;  2LB9 A;  2FH5 A;  5AVE A;  3BLS A;  3V67 A;  3IBR A;  1MWS A;  4F3L A;  2QMI A;  4M3K A;  4NXE A;  4PM7 A;  1OJG A;  3CPT B;  4JPM A;  4ZJ2 A;  4S2N C;  1EI5 A;  1Q2P A;  5L10 A;  3UPP A;  5HW3 A;  2HDU A;  3BM6 A;  3V3S A;  3GQZ A;  1L3L A;  3HCY A;  1KGF A;  3EOI A;  1OTD A;  2ZQD A;  4GJ4 A;  4IBX A;  2Y59 A;  2Y2Q A;  5F69 A;  1SDE A;  4BEN A;  4JF6 A;  4WEJ A;  3PR6 A;  3I7J A;  4BLM A;  4EW7 A;  1ERO A;  3E4O A;  3BW6 A;  4BD1 A;  4N1H A;  5CGW A;  3MQO A;  4O8G A;  5FAQ A;  3UB9 A;  5HAI A;  5EV0 A;  2INW A;  4MCW A;  1JWZ A;  3IX8 A;  5TBM B;  3K2N A;  3S7Q A;  2XD1 A;  3KSF A;  3ICY A;  5F5Y A;  4Y0U A;  2W3E A;  3CUE C;  5HAR A;  1CQA A;  3SH9 A;  4CQH A;  1NY0 A;  3H7W A;  2GZA A;  3MZD A;  3DTI A;  3IXD A;  4YFM A;  3P01 A;  3UDI A;  2ZJ9 A;  5DJU A;  4QB8 A;  4OQH A;  2VLG A;  2HGV A;  4DN0 A;  2OWH A;  2J3T D;  1F9I A;  2KDK A;  1YLJ A;  1ZG4 A;  4NXB A;  5CTM A;  1WA9 A;  1K6S A;  5F1F A;  1FCM A;  1DP6 A;  1XPB A;  2XR0 A;  3VP0 A;  5CED A;  2WAE A;  5F82 A;  1ACF A;  4MBF A;  4BMW A;  3S7O A;  2JCH A;  2HJE A;  3DWK A;  4JXG A;  2XDM A;  3TG9 A;  3KX0 X;  3K3D A;  5E2H A;  5HX9 A;  4ZBE A;  2FFY A;  3R7W B;  4HES A;  4DE3 A;  4N92 A;  4Y17 A;  4JGR A;  5FEG A;  3SS4 A;  2MJ6 A;  3V50 A;  1O7E A;  4XUX A;  4ZTK A;  3CG5 A;  4C3Q A;  2WKE A;  4JKT A;  4X1L A;  1SKF A;  4WLA A;  2O9C A;  5HL6 A;  3NJA A;  3O86 A;  1BLS A;  5EVI B;  3F1N A;  3SH7 A;  3R4K A;  4LV3 A;  3NOT C;  5K5B A;  4OQ0 A;  5GLA A;  2EXB A;  4JXS A;  4B93 A;  2HDS A;  1XP4 A;  5TBM A;  3PTE A;  1TVF A;  4L9E A;  5HAP A;  1MWT A;  3UB5 P;  2P04 A;  4OP5 A;  5EFW A;  4E3I A;  5G4Z A;  3HLC A;  4O0P A;  1ERQ A;  3IWO A;  4E3O A;  5IU1 A;  1PNE A;  4FH4 A;  2Y2K A;  2OV5 A;  3B33 A;  2M7V A;  1VEU B;  3IH8 A;  2WGW B;  1VET B;  4RQ9 A;  2VZW A;  1MWR A;  3BFE A;  1K6R A;  5E2F A;  5AVF A;  3SH8 A;  4ETX A;  2A3U A;  1GHP A;  3LUQ A;  1T1C A;  1KE4 A;  3BFD A;  3TJZ C;  3L7H A;  3RTY A;  2EX8 A;  2ZC5 B;  1W8Y A;  1PI4 A;  3VV4 A;  4GD8 A;  1ESI A;  4IUH A;  4BJP A;  4F94 A;  3EWK A;  4DF6 A;  4B4X A;  4B9O A;  4RA7 A;  4KZ5 A;  5DVA A;  4WM9 A;  4S2K A;  2HPB A;  3EQV A;  4XUZ A;  3QP6 A;  5FDS A;  3G31 A;  1FCN A;  1AXB A;  4ME4 A;  3ZHH A;  4PM9 A;  2ZL1 A;  2Y2O A;  4DRT A;  2IWC A;  5DF9 A;  2VK3 A;  3B42 A;  2R78 A;  3A3D A;  2ZQ9 A;  1ES5 A;  2WKH A;  4EBL A;  3C5A A;  3WS4 A;  3MQ0 A;  3WS5 A;  4OON A;  1M40 A;  1TD5 A;  3Q7V B;  4I39 A;  5EM0 A;  2VEA A;  1YPR A;  2PDR A;  3BLM A;  2JN7 A;  1FQG A;  1BTL A;  4E3J A;  4WEL A;  1CJF A;  4S2M A;  1PRQ A;  2VV7 A;  1G28 A;  3ZG8 B;  5M1A A;  2B18 A;  2KX6 A;  3EQU A;  3NOP C;  3ZDJ A;  2WZX A;  4KZ4 A;  2WUQ A;  2BAS A;  4UEY A;  3CLO A;  3BFC A;  3E4P A;  2Q9N A;  4BBV A;  3H82 A;  2P9V B;  3T4K A;  1WYC A;  4KQR A;  3DW0 A;  1BLC A;  5E2E A;  4GZB A;  4LV1 A;  2GDN A;  2H10 A;  3P98 A;  3D9Y A;  3FWL A;  4K91 A;  2PAV P;  4LGW A;  4S2I A;  4E3M A;  3RXX A;  4P0M A;  2ZC3 B;  4PMA A;  4LCM A;  3ISG A;  3CMZ A;  3MSH A;  4X6T A;  3ZG5 A;  2K7S A;  3NHQ A;  2L0W A;  1Z09 A;  5FA7 A;  1O07 A;  4JXV A;  3TRC A;  3GMW A;  3Q07 A;  3RJU A;  4K0W A;  3PBO A;  2A49 A;  3NUL A;  1XXM A;  3B3X A;  3FKW A;  3G32 A;  4GNU A;  1NJ4 A;  2J9O A;  3IXH A;  2JKF A;  1Y4O A;  5FI7 A;  1AWI A;  3FZC A;  2VV6 A;  3NY4 A;  2VGJ A;  5HD3 A;  4MBH A;  4HQA A;  2OAP 1;  3IF6 C;  3HJI A;  5HL1 A;  3DWZ A;  1S1Z A;  5J8X A;  3Q7V A;  2WGV A;  3PBT A;  2A24 A;  4WZ5 C;  3M6B A;  1H3Q A;  2XGN A;  4HY8 A;  4EXO A;  2M7U A;  1FSW A;  3T50 A;  1NZO A;  2BG1 A;  2H0T A;  4UQI S;  4Q0H A;  3OCN A;  1K56 A;  5EOO A;  4HBT A;  2PR6 A;  4C75 A;  3Q81 A;  1TS7 A;  1E25 A;  4E3L A;  5CX7 A;  1MC0 A;  4LRZ E;  4G3V A;  2KLI A;  4HJ3 A;  3KO6 A;  2JC7 A;  2E8J A;  1Y54 A;  1K0K A;  1KVM A;  1F5M A;  1QMF A;  2Y2L A;  4EUZ A;  1N4O A;  4PAU A;  3VP4 A;  5FAS A;  3C2W A;  1JNU A;  5DKK A;  1DJB A;  5E43 A;  3FPW A;  3UB8 A;  2YKF A;  1LHY A;  1NWZ A;  2VV8 A;  5L2F A;  1CF0 A;  2CC1 A;  4H6J B;  5KMW A;  4X55 A;  3UN7 A;  2W1R A;  4X25 A;  1FR6 A;  1JWV A;  4EV4 A;  3Q82 A;  1YMX A;  4NKP A;  3M2J A;  2K31 A;  4CLC E;  1GSW A;  2G2U A;  4LV2 A;  5CXW A;  2WKP A;  1V9Y A;  3T1Q B;  3CI6 A;  3P7N A;  1TEM A;  3NEC A;  1H0M A;  2FFF B;  1I2W A;  4EQ1 A;  4YNR A;  4QWO A;  3DAV A;  5HDD A;  1DRM A;  3LI8 A;  1OT9 A;  2R9X A;  4HP9 A;  2DMW A;  3IS2 B;  4UA6 A;  2ZMA A;  3T4T A;  4HH2 A;  4XT2 B;  4IED A;  5CGS A;  3F1O A;  5DFX A;  3NDE A;  2V20 A;  4GS9 B;  3V39 A;  2Y2G A;  3T4O A;  1K56 D;  3E98 A;  3VOY A;  5DF8 A;  1G68 A;  3W4Q A;  1IYP A;  3MBZ A;  1NLZ A;  4CLC B;  2XFS A;  4R3J A;  5U47 A;  4PKY A;  3RXW A;  1L0G A;  3K3C A;  3SW1 A;  5C5K A;  4K08 A;  3IHA A;  3C7V A;  4PM5 A;  4KZB A;  2Y8H A;  4GHI B;  1W5D A;  4AFI A;  3EEA A;  1L0D A;  1E4D A;  4OQI A;  2XK1 A;  4LV0 A;  5HPF A;  3OPP A;  1XGI A;  3AGF A;  4WEK A;  4YIN A;  5TGF A;  3OBF A;  1YLY A;  3ZCZ A;  2RL3 A;  3VSL A;  1N9B A;  4R23 A;  3QP8 A;  4MEZ A;  1VHM A;  3CZD A;  3LIE A;  3M6H A;  4FD8 A;  2ZBB A;  4NEE D;  3G2Z A;  1N9O A;  4WMC A;  3UPN A;  4KZ8 A;  4DJ2 A;  2O9B A;  3IWI A;  3TW8 A;  1S4R A;  3PHY A;  4RVA A;  2IA2 A;  3LR0 A;  4NET A;  5F83 A;  1NLY A;  4RX3 A;  3LGO A;  1JTD A;  4WF0 A;  4IHQ A;  4E6W A;  1OTI A;  3HLW A;  4R0Q A;  1IYS A;  4KZA A;  3T1S A;  5FAT A;  3KYE A;  4GD6 A;  3SS5 A;  5FQQ A;  3PAG A;  5FQ9 A;  1G6O A;  2PD8 A;  4O7D A;  1IOU A;  1T1B A;  2JHE A;  2VA0 A;  3PYP A;  4DJ3 A;  4KEN B;  4X68 A;  1PWG A;  3FPV A;  4II7 A;  1HZO A;  2ZLY A;  3VSK A;  3BQA A;  3IT9 A;  3A3I A;  2Y4A A;  3FKV A;  4KG5 A;  2JKG A;  1E3U A;  4MN7 A;  1YLZ A;  3DTK A;  5CGX A;  4NK3 A;  2V2F F;  5HZH A;  2J80 A;  1IEL A;  3G6O A;  4HHD A;  2EXA A;  1TS8 A;  5L8M A;  5HWV A;  3HLB A;  4QY5 A;  5IS1 A;  1K4E A;  3JVV A;  1F98 A;  3UME A;  3SS3 A;  4P6Z M;  2QPN A;  1Y28 A;  1LLB A;  2XFT A;  3RH8 B;  1ES4 A;  5CEB A;  3LR5 A;  2PU4 A;  4O01 A;  1YKD A;  4ZJ3 A;  4OVD A;  3VOZ A;  3DTE A;  3G34 A;  4GB7 A;  2NUP C;  2EFU A;  1I5Q A;  3CPT A;  1STZ A;  1FR1 A;  3N6I A;  4WBG A;  1LSV A;  4R6L A;  2VGL M;  5FDH A;  1QME A;  4EU0 A;  5FQM A;  5EEC A;  1CK3 A;  5A90 A;  2NUT C;  4HOI A;  4S2J A;  3IQA A;  1ZHH B;  2V0U A;  2VJW A;  1HTZ A;  5A93 A;  2W1T B;  4E3K A;  1YM1 A;  2HP6 A;  5HPI A;  4I3I A;  4L9F A;  2Y79 A;  2JE5 A;  3S22 A;  1JTG A;  1FOF A;  1UWP X;  1XFN A;  4FCF A;  2VKS A;  3T1R A;  2ZQA A;  2PYP A;  4D60 A;  1IEM A;  3GR2 A;  5J3W A;  4Y0O A;  1P0Z A;  1S1Y A;  1OT6 A;  1DY6 A;  3MFD A;  4HI4 A;  4Q0J A;  2XF3 A;  3OPR A;  5JYO A;  1LI9 A;  5CTN A;  1C3B A;  3VMA A;  3MXQ A;  1XA1 A;  3GV9 A;  1E3U D;  1PW1 A;  5TJJ A;  2WKQ A;  2DCF A;  2B02 A;  4DXC A;  4RX2 A;  4R1G A;  4GDB A;  5E2G A;  2ZOH A;  3W4O A;  3MMH A;  4OPZ A;  5CHM A;  5F68 A;  3ZVT A;  3A0V A;  3QHY A;  5F6A A;  5AQ7 A;  4ZDX A;  3VFF A;  1YT4 A;  1EWZ A;  2XEP A;  1PWC A;  1W79 A;  1SDN A;  3KYZ A;  2EA9 A;  2G7U A;  3EGX C;  3KYQ A;  1YSP A;  5G4Y A;  2J3W A;  5EVL A;  3S7P A;  2EX9 A;  1S0W A;  4N1X A;  3HBR A;  2V8C A;  1K25 A;  2JBF A;  4UHU A;  3JVU A;  4HNB A;  4IVI A;  5CER A;  3UPO A;  3R7W A;  2DNS A;  3BJN A;  4MNR A;  2W0N A;  1ES3 A;  2PT7 A;  5FEF A;  2UWX A;  4I3A A;  1GSV A;  4CPK A;  4X1M A;  3BFF A;  4EUV A;  2Q0O A;  3SOI A;  1K55 A;  4DKI A;  3BYD A;  4KQO A;  5EVI A;  4Q8I A;  3IXB A;  3UE0 A;  3T4J A;  4OPY A;  2K2N A;  2LB5 A;  3UO9 A;  3N8L A;  5DTT A;  4E6X A;  4E3N A;  3QNB A;  3TE8 A;  3E0Y A;  5AQA A;  5GLD A;  2ZMF A;  1S67 L;  3RFB A;  1PW8 A;  4P6B A;  1LI0 A;  1M6K A;  3NI9 A;  2VX8 A;  4OP8 A;  1VEU A;  2H5S A;  1ZG6 A;  1VET A;  2WGW A;  1BUL A;  4Z1W A;  2W3G A;  3MFX A;  4ARZ B;  2PBY A;  2ZQC A;  4FTX A;  2Z6D A;  4Y5F A;  1BLH A;  1BZA A;  1MPL A;  3QP2 A;  1XX2 A;  4DDY A;  1GCE A;  2QKP A;  1SKO B;  2JKT I;  1ONH A;  1TDL A; 
#chains in the Genus database with same CATH homology
 3EOI A;  4CLC D;  1OTD A;  3PBR A;  4LLO B;  4E04 A;  1P9W A;  4GJ4 A;  4NKP A;  2K31 A;  3T4S A;  1GSW A;  1H8M A;  4CLC E;  3S7N A;  5F69 A;  2EWV A;  3MQQ A;  3D72 A;  2WKP A;  1V9Y A;  3H82 B;  3CI6 A;  4WEJ A;  3P7N A;  4L0L A;  2H28 A;  3PR6 A;  4EW7 A;  3E4O A;  1XJ6 A;  3BW6 A;  5DKL A;  3B47 A;  3MQO A;  4GCZ A;  4O8G A;  3UB6 A;  2D02 A;  1MZU A;  4EQ1 A;  4ZRR A;  3A0S A;  3UB9 A;  4L9G A;  4DMZ A;  1YAX A;  2INW A;  1OTB A;  4WN5 A;  4MCW A;  4YNR A;  5HDD A;  1DRM A;  3LI8 A;  5TBM B;  3K2N A;  2QHK A;  1OT9 A;  3S7Q A;  3KSF A;  3ICY A;  4HP9 A;  5F5Y A;  2DMW A;  3IS2 B;  2W3E A;  3CUE C;  3E4Q A;  4EEU A;  3T4T A;  4HH2 A;  4XT2 B;  4CQH A;  4OOL A;  1OJ5 A;  1S66 L;  3F1O A;  5DFX A;  1DP8 A;  3H7W A;  2GZA A;  2JKT M;  4GS9 B;  3P01 A;  3T4O A;  3E98 A;  2GNX A;  2CMN A;  1W63 M;  4HP4 A;  5DJU A;  3VOL A;  2VLG A;  2HGV A;  2W3H A;  2OWH A;  1NLZ A;  4DN0 A;  4IUK A;  4CLC B;  2QWS A;  2J3T D;  1F9I A;  2KDK A;  3BY8 A;  2W3D A;  1D7E A;  2W1T A;  4PKY A;  5HWT A;  4NXB A;  3CUE A;  4EES A;  3CWF A;  1N9L A;  1WA9 A;  2P08 A;  2P7J A;  4FOF A;  1DP6 A;  3K3C A;  4G3K A;  3CAX A;  3SW1 A;  1XJ3 A;  5C5K A;  4K08 A;  3F1P B;  3BY9 A;  2OOL A;  4PKY G;  3S7O A;  4BMW A;  2Y8H A;  1XJ4 A;  4GHI B;  3T4L A;  4AFI A;  2HJE A;  3EEA A;  5HWW A;  4I38 A;  2A24 B;  5HPF A;  3ZYT A;  4WEK A;  2GJ3 A;  2JKR I;  4I3J A;  3OBF A;  3KX0 X;  4BWI A;  2PR5 A;  3K3D A;  4KQD A;  1VHM A;  2V9A A;  3LIE A;  3R7W B;  5IT5 A;  1T1A A;  2ZBB A;  2L4R A;  4NEE D;  4JGR A;  3LID A;  4MN6 A;  5HD5 A;  1N9O A;  2MJ6 A;  1XFQ A;  4R3A A;  3KSH A;  4DJ2 A;  2O9B A;  3TW8 A;  3LI9 A;  1S4R A;  2PD7 A;  3PHY A;  2IA2 A;  3LR0 A;  2W27 A;  4JGP A;  1NLY A;  1XJ2 A;  3ZQ5 A;  4BBU A;  4ETZ A;  4WF0 A;  4YOF A;  1N9N A;  1TS0 A;  4IHQ A;  2O9C A;  4KUK A;  3NJA A;  4WLA A;  2PHY A;  5HL6 A;  1OTI A;  3F1N A;  1D06 A;  1UGU A;  3R4K A;  3NOT C;  5K5B A;  3DBA A;  4B93 A;  3EEH A;  5TBM A;  3LIB A;  3A0R A;  1P97 A;  4L9E A;  1G6O A;  2PD8 A;  2P04 A;  5EFW A;  2XRN A;  5I5L A;  4G3W A;  5G4Z A;  1P9R A;  1IOU A;  4HH3 A;  2JKR M;  1EW0 A;  4O0P A;  1T1B A;  3U2A A;  2JHE A;  2VA0 A;  3T4Q A;  3PYP A;  5IU1 A;  4DJ3 A;  4PHT A;  4I5S A;  1X0O A;  2O9A A;  3B33 A;  2M7V A;  4M4X A;  4RQ9 A;  3FPV A;  1YSQ A;  4F3L B;  4II7 A;  2VZW A;  3BQA A;  5AVF A;  4ETX A;  3LUQ A;  1T1C A;  4Y3I A;  3TJZ C;  4FSF A;  1IFQ A;  1OTA A;  3LR3 A;  1LSX A;  4EEP A;  4NXF A;  4MN7 A;  3RTY A;  3W2Z A;  5HZH A;  2L1M A;  3VV4 A;  2J80 A;  4IUH A;  2XSS A;  3G6O A;  4BJP A;  3EWK A;  4HHD A;  4B9O A;  1GSX A;  2FZ0 A;  2QJ5 A;  1TS8 A;  4P6Z S;  5L8M A;  3EQV A;  5HWV A;  5IS1 A;  4ME4 A;  5KIZ A;  3BQ8 A;  3FG8 A;  3JVV A;  1F98 A;  3UME A;  4R38 A;  2J3T C;  3PBQ A;  2HV1 A;  4P6Z M;  3LIA A;  5DF9 A;  3B42 A;  5J4E A;  2R78 A;  3OOV A;  4IJG A;  3HJK A;  1Y28 A;  1BYW A;  4EET B;  3RH8 B;  3LR5 A;  1KOU A;  4O01 A;  1YKD A;  3PXP A;  2VGL S;  2O99 A;  4WL9 A;  3MQ0 A;  2ZMV A;  3KSG A;  3F1O B;  1TD5 A;  2NUP C;  3H7W B;  2ZOI A;  4I39 A;  1STZ A;  1DP9 A;  3OCL A;  4ARZ A;  1LSV A;  2VEA A;  2HF6 A;  4H6J A;  4R6L A;  2VGL M;  1V9Z A;  2M1C A;  2PDR A;  5KSH A;  3MJQ A;  1UWN X;  4EU0 A;  2JN7 A;  4UQI M;  1ZTU A;  3KSI A;  4WEL A;  2NUT C;  4HOI A;  2VV7 A;  4MDZ A;  1G28 A;  1ZHH B;  2B18 A;  2KX6 A;  3EQU A;  3NOP C;  2XRO A;  2V0U A;  2VJW A;  2KOI A;  2BAS A;  4UEY A;  3ULF A;  2EWW A;  2W1T B;  3CLO A;  5HPI A;  4WUJ A;  4MN5 A;  3LYX A;  4I3I A;  4L9F A;  1ODV A;  5HDS A;  3E4P A;  2Y79 A;  4BBV A;  3H82 A;  3GEC A;  3IBJ A;  3T4K A;  2I9V A;  4JGQ A;  5J7E A;  3PBN A;  2V1A A;  4YWZ A;  3UB7 A;  5DFY A;  1UWP X;  3NOU C;  1XFN A;  3VE3 A;  2VKS A;  4QPR A;  3C30 A;  3EGD C;  5DJT A;  4CLC C;  2PYP A;  5J3W A;  3VE4 A;  1P0Z A;  5HDC A;  1S1Y A;  3IS2 A;  1OT6 A;  4GLQ A;  3OC2 A;  3UE6 A;  4HI4 A;  4Q0J A;  3UE3 A;  2K7S A;  4XT2 A;  3FC7 A;  3NHQ A;  3OLO A;  2L0W A;  3H9W A;  2QYB A;  3C38 A;  3TRC A;  3MR0 A;  3LIC A;  3MXQ A;  3CIT A;  4GS9 A;  3LIF A;  4KUO A;  4MMN A;  3PBO A;  2YKH A;  5TJJ A;  2WKQ A;  4OOM A;  2B02 A;  4CLC A;  1TS6 A;  1S4S A;  3PBS A;  3F1N B;  3O5Y A;  2ZOH A;  5FL3 A;  3MMH A;  4GW9 A;  1VB6 A;  5F68 A;  3A0V A;  2VV6 A;  2A2L A;  5F6A A;  2PYR A;  3LFV A;  1T19 A;  5HSQ A;  1TF1 A;  5HD3 A;  4BBT A;  3F1P A;  4EER A;  4HQA A;  2OAP 1;  4GHI A;  3KYZ A;  2EA9 A;  2G7U A;  3EGX C;  3KYQ A;  4HJ4 A;  1YSP A;  3UMD A;  3HJI A;  5G4Y A;  2J3W A;  1S1Z A;  5LBR A;  3S7P A;  1LL8 A;  3BWL A;  3PBT A;  4JGO A;  2A24 A;  2GX5 A;  4NXG A;  3JVU A;  4HNB A;  4Y2F A;  1H3Q A;  4HY8 A;  4EXO A;  4HJ6 A;  2M7U A;  3R7W A;  3BJN A;  1LT0 A;  3T50 A;  2W0N A;  2Z6C A;  2PT7 A;  4UQI S;  4Q0H A;  3OCN A;  2D01 A;  2OAQ 1;  4I3A A;  1GSV A;  2PR6 A;  4EUV A;  1TS7 A;  2O0Y A;  3LR4 A;  5AJG A;  3MF0 A;  4KQO A;  1OPX A;  5CX7 A;  1MC0 A;  4LRZ E;  4G3V A;  3T4J A;  3C8C A;  2V1B A;  4R70 A;  4Q0I A;  2KLI A;  2V0W A;  2WKR A;  5MC7 A;  4HJ3 A;  3KO6 A;  2K2N A;  2LB5 A;  1W63 Q;  2HJ9 C;  3GDI A;  5A8B A;  2W3F A;  1T18 A;  3TE8 A;  3E0Y A;  2XA7 S;  1F5M A;  4HIA A;  1NRJ A;  1S67 L;  2ZMF A;  4LRX C;  3RFB A;  4PAU A;  1OTE A;  2OWJ A;  2LB9 A;  3C2W A;  2FH5 A;  1JNU A;  5DKK A;  5AVE A;  2XA7 M;  2VX8 A;  3V67 A;  3IBR A;  3FPW A;  4F3L A;  3UB8 A;  2YKF A;  4NXE A;  1OJG A;  4Z1W A;  2W3G A;  3MFX A;  1NWZ A;  2VV8 A;  3D3O A;  4ARZ B;  4H6J B;  2Z6D A;  4Y5F A;  2QJ7 A;  2W1R A;  1LSW A;  1MKM A;  4LPZ A;  4LRY C;  2QKP A;  2JKT I;  3HCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...