2CMNA

A proximal arginine residue in the switching mechanism of the fixl oxygen sensor
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
117
structure length
117
Chain Sequence
DAMIVIDGHGIIQLFSTAAERLFGWSELEAIGQNVNILMPEPDRSRHDSYISAYRTTSDPHIIGIGRIVTGKRRDGTTFPMHLSIGEMQSGGEPYFTGFVRDLTEHQQTQARLQELQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords SENSOR PROTEIN FIXL
publication title A Proximal Arginine R206 Participates in Switching of the Bradyrhizobium Japonicum Fixl Oxygen Sensor
pubmed doi rcsb
source organism Bradyrhizobium japonicum
total genus 33
structure length 117
sequence length 117
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2cmnA00
1XJ2A 1OTIA 2L0WA 3SW1A 2QJ5A 1T1CA 3MJQA 2HV1A 2W27A 4HP4A 2QKPA 5HD3A 3E4OA 3F1OA 5DJUA 3VE4A 4B9OA 1XJ3A 3H9WA 5AVEA 3UB6A 4I3AA 4R6LA 1LSVA 3LYXA 4LPZA 4HQAA 3UB9A 2L1MA 3GDIA 5AVFA 5TBMB 1TS7A 1S4SA 2BASA 2WKPA 2V9AA 2R78A 1N9OA 2KDKA 3PYPA 3LICA 5I5LA 1S67L 4NXBA 4L9EA 3IS2A 2WKRA 3A0VA 3MQOA 4WLAA 3MQQA 4HOIA 3NJAA 4HIAA 4F3LA 3LIAA 3F1OB 2VV6A 3LIDA 4NXEA 2OWHA 4R3AA 1N9NA 4LRXC 1F9IA 1S4RA 4I38A 3B33A 5IS1A 3A0SA 3BY8A 1T19A 1V9YA 1OJGA 2D01A 5J7EA 4I5SA 4LRYC 3CWFA 2PR5A 5DJTA 3IS2B 1X0OA 4JGPA 2ZBBA 3H7WA 3K3DA 4F3LB 1UWPX 1XJ6A 1S1YA 1WA9A 5J3WA 4GHIA 5HZHA 1N9LA 2Z6CA 2I9VA 1GSXA 3NOUC 1Y28A 2H28A 4R70A 2OWJA 1VB6A 3VOLA 4HH2A 1T18A 3UB7A 2JN7A 3C8CA 4EQ1A 1OT9A 5F69A 3UB8A 1XFQA 2J80A 3H7WB 2V0UA 2VEAA 5HSQA 4WUJA 4GHIB 3G6OA 4HH3A 2VLGA 3GECA 3LUQA 2Z6DA 1DRMA 4EERA 3HJKA 4E04A 4K08A 5HWVA 2M1CA 2EA9A 3LIFA 3CAXA 3PHYA 3NOPC 1NWZA 2B02A 4GS9A 4JGRA 1F98A 3MXQA 4L9GA 3ICYA 1EW0A 4NXGA 3BY9A 4PKYA 4KUOA 5F6AA 5IU1A 1LSXA 2PDRA 4KQDA 1DP9A 3CLOA 1XJ4A 1P97A 1GSVA 2OOLA 3IBRA 4I3JA 4KUKA 2YKHA 4LRZE 3T50A 3RH8B 4GS9B 2V1AA 4JGQA 5HDDA 1TS8A 4JGOA 5HWWA 1OTAA 5A8BA 2PYRA 5F5YA 4XT2A 3ULFA 3HJIA 3A0RA 4HI4A 1XFNA 4HJ3A 4BBUA 4GW9A 3UMEA 5G4ZA 2QJ7A 3H82A 1ODVA 4HNBA 2PYPA 1P0ZA 4MN5A 4WN5A 4EW7A 3UE6A 2INWA 2YKFA 3LIEA 1UWNX 3E4PA 3MR0A 1G28A 4HJ4A 5HDSA 1MZUA 4EESA 1V9ZA 2PD7A 1OTEA 4I39A 3D72A 1JNUA 5HDCA 4XT2B 3F1NA 4L9FA 2PD8A 1BYWA 1OJ5A 1T1AA 2QHKA 4HY8A 4YWZA 1OTBA 3FC7A 4EEPA 3NHQA 4R38A 3LI9A 5DKKA 2PR6A 5J4EA 3C2WA 3FG8A 2VV7A 1S66L 4M4XA 4WF0A 4HJ6A 2V0WA 5EFWA 2WKQA 1UGUA 4EXOA 3K3CA 5DKLA 4DJ3A 3P7NA 3F1NB 3ZQ5A 2L4RA 3LIBA 2V1BA 4HHDA 4BBTA 1DP8A 2P7JA 3VE3A 4LLOB 1LT0A 5HWTA 4EEUA 2ZOHA 2K7SA 1LSWA 3F1PA 4MN6A 1TS6A 2A24A 2W0NA 4BBVA 3EEHA 1GSWA 2JHEA 1DP6A 1OT6A 1D7EA 1S1ZA 3EWKA 5G4YA 2GJ3A 5HD5A 2VV8A 4PKYG 4WL9A 4NXFA 3BWLA 4H6JA 3KX0X 1T1BA 2KX6A 4HP9A 1LL8A 5KIZA 1KOUA 3F1PB 2A24B 1OTDA 4DJ2A 4EETB 5F68A 3MFXA 4I3IA 3UMDA 3NOTC 3OLOA 2CMNA 2PHYA 2D02A 2ZOIA 5TBMA 3LI8A 2QWSA 4GCZA 1D06A 3E4QA 1TS0A 4H6JB 4RQ9A 3H82B 3RTYA
chains in the Genus database with same CATH superfamily
1XJ2A 3MBZA 2PBYA 4DMZA 1A0KA 3DTIA 3LY4A 5L2FA 5HD3A 3F1OA 1ES2A 1XJ3A 5HAQA 5AVEA 3UB6A 4I3AA 3IQAA 5EECA 1IFQA 3FPVA 1LSVA 4P6ZS 3IBJA 5KSCA 3G4PA 5AVFA 3U4LP 3TE8A 2RCXA 3UN7A 3LGOA 2V9AA 1TDGA 5EOEA 2KDKA 3S1YA 2Y55A 3JYIA 4S2OA 3LICA 5I5LA 5HL1A 1K38A 4XUZA 3FKVA 4OPQA 3IS2A 1F5MA 3A0VA 1W5DA 3MQQA 4HOIA 4HIAA 3PTEA 5FEGA 1J3WA 1XA7A 2WGVA 5FI7A 2WK0A 5TR7A 1CI8A 4S2MA 4X69A 4ARZA 3VP1A 2XSSA 4LRXC 4OOYA 1F9IA 3QNCA 3EGXC 1LI9A 5IS1A 1Y54A 1E3UA 1L3LA 1V9YA 4JXVA 5J7EA 1BLHA 3CWFA 1W63M 5FQMA 2XK1A 1YLWA 3QP2A 1RCJA 4B4XA 3H7WA 4RA7A 2J8YA 3G34A 1XJ6A 1GCEA 3HUOA 1S1YA 4EQIA 3BFFA 5J3WA 5L10A 4KZ8A 4KG6A 4YINA 2I9VA 5EE8A 4HEFA 3BLSA 2H28A 5CHUA 1IYSA 3QHYA 4EU0A 2VGLS 4LENA 5IHVA 2GDNA 5AJGA 5EVLA 5CHJA 1T18A 1YKDA 3VMAA 3UB7A 4EQ1A 4GDBA 3NULA 5EM1A 1XFQA 4ME4A 2HDQA 5A92A 2V0UA 4R3JA 2VEAA 3LR0A 4JXSA 5E2GA 1PFLA 3AGFA 3QP8A 5HSQA 2W3GA 4WUJA 1MWTA 4R4SA 3G6OA 4LV3A 2WKIA 1HTZA 4BL2A 3ISGA 2JC7A 3CG5A 4E3MA 4EERA 3UY6A 2FFYA 3O3VA 4BD1A 2M7VA 2HDSA 4K08A 4GN2A 2VJWA 4PPRA 4PAUA 3LIFA 5DF7A 1IKGA 4KZAA 1Z6FA 1PI5A 1PIOA 1IELA 2ZQ9A 2ZM8A 3PAGA 1F98A 3MXQA 3ICYA 5U47A 4Y7PA 4OONA 1EW0A 4NXGA 3BY9A 4PKYA 4WMCD 3AGDA 3WS0A 2Q9NA 3CZDA 5CXWA 5IU1A 2V2FF 4GZBA 2PDRA 1ZTUA 2W1TA 4OH0A 3QNBA 4WZ5C 3C4OA 4KZ7A 1G6OA 1VHMA 1NYMA 1P97A 4X53A 4DXBA 2R9XA 3IF6C 2YKHA 3Q07A 4LRZE 5GL9A 3ZYTA 3WWXA 4MBKA 3DTEA 3T50A 2HDUA 3M2JA 2IWCA 4M3KA 1K54C 4JGOA 5F5YA 3WRTA 3N6IA 1YPRA 1XPBA 3DWZA 4HJ3A 1SKOA 4JF4A 1KE4A 2OAP1 3LR4A 2O0YA 1NXYA 5G4ZA 3H82A 3VOZA 2PYPA 1HD8A 3SOIA 3UE6A 3T4QA 2YKFA 1HVBA 4N1HA 4OQHA 3QP4A 3T4KA 3E4PA 3MR0A 3A3IA 2WGWB 3BQ8A 4EESA 2PD7A 2LB9A 4CJNA 4PM6A 2EX2A 5HFOA 2G2UA 4BL3A 1JWVA 2WKHA 4NK3A 2PD8A 5FAOA 2ZC4B 1T1AA 1BUEA 4IEDA 1DJBA 3PAEA 5FQQA 3FC7A 2QYBA 4EEPA 5TJJA 3NHQA 4EWFA 4N9LA 3V50A 1KE3A 3FG8A 1S66L 4DN0A 4M4XA 5I94A 4HJ6A 1YLJA 3UPPA 4QU3A 3T4OA 4CLCA 2VZWA 3LFVA 1YSQA 2Q9MA 3O88A 3F1NB 1K0KA 1MXOA 1VETA 3PXPA 3R7WA 4RVAA 4ZJ1A 3FV7A 4HHDA 4BBTA 3B47A 2A3UA 1ES3A 4LLOB 1VM1A 3ZG5A 2UV0E 1L0GA 1BSGA 5HWTA 3RXWA 4EEUA 3W4OA 3F1PA 3MSHA 1MPLA 1JTDA 2Y2NA 3SS5A 2QMIA 3EEHA 1GSWA 1MWRA 5DFYA 4Q8IA 1S1ZA 1YLPA 1H3QA 1NLYA 5DTSA 3BRMA 5FQJA 4GDNA 3KSHA 5HARA 4NXFA 4H6JA 3IXBA 3ZG7B 3KX0X 4MN7A 4HP9A 5BOHA 4PM7A 5KMWA 5DTTA 4OLDA 1OTDA 3B3XA 3WS5A 3OZHA 4I3IA 5GHYA 2IWBA 5DF9A 3C4PA 4FH2A 4R0QA 2D02A 2VA0A 4BQMA 1QMEA 1BTLA 4ZBEA 2V20A 4GCZA 4E3JA 3GRJA 4GD8A 4DRTA 2C5WB 3CJMA 1IKIA 3E4QA 3H82B 1K25A 5D3OA 2L0WA 2HGVA 1T1CA 5FQKA 4JLFA 4DE2A 3Q82A 2JKTI 5EM0A 2HV1A 4IJGA 5F1GA 4OQGA 3HLGA 4RX3A 2W27A 2GX5A 5HPIA 2XA7S 1IYOA 3LO7A 2HP5A 4MLLA 1AXBA 1E4DA 4IUKA 4N9KA 4LPZA 2JKRI 4ETZA 2NUTC 2L1MA 3GDIA 5TBMB 5L07A 2BASA 1G68A 4FH4A 2R78A 3PYPA 4JXWA 3Q81A 4FD8A 1E25A 1K56D 3NCKA 2H5SA 4LCMA 3IX3A 4X55A 4L9EA 2WKRA 2XD1A 3OCNA 3DBAA 4MBFA 1NRJA 3E2LA 2PBDP 3LIAA 1RGZA 1E3UD 2VV6A 3R4KA 4YNRA 2OWHA 4R3AA 3VP2A 4X68A 2WZXA 3KSIA 5KZHA 1FR1A 4QPRA 1I5QA 1S4RA 2JBFA 2Y2PA 2OLUA 4QWOA 2VGKA 3NDEA 3A0SA 1OJGA 5E2HA 2D01A 2ZM2A 4UEYA 2PR5A 3W2ZA 1OPXA 1F2KA 4IBXA 5FSRA 1CK3A 3OPHA 5CGWA 4CLCE 4F3LB 1L0EA 2HDRA 1UWPX 2XGNA 3T1QB 2VKSA 1PWDA 3KYQA 4BWIA 4JF5A 2H0YA 2Z6CA 3LCEA 5FQ9A 1ESIA 5E43A 1Y28A 4R70A 2WYXA 1VB6A 3IXHA 4UA6A 2Y2GA 5CTMA 2FFFB 4X25A 4S2NA 2MJ6A 1P9RA 1OT9A 4OOLA 1SDEA 1PWCA 2J80A 4UQIS 1U60A 1YQSA 3ZG8B 4E3OA 1KDSA 1ONGA 2EX6A 3SS4A 3DTMA 3V3SA 3LR3A 3JVVA 3E2KA 1FCMA 2B95A 4GHIB 1PW1A 4LV2A 2K2NA 5FAPA 3ZGAB 1DRMA 1XX2A 2GNXA 1Y4OA 4GD6A 3HJKA 4IHQA 3ZVWA 2HJ9C 2M1CA 4R3BA 2EA9A 3CAXA 4KQQA 3NOPC 1QMFA 5EVIB 3CITA 1NWZA 2B02A 3L7HA 4Y15A 5EPHA 3DTKA 1PWGA 4KZ5A 3A3EA 1YT4A 1IYPA 3P01A 4G3KA 4KENB 4HBUA 4KUOA 2ZMFA 1LSXA 4X6TA 5HW3A 1DP9A 5M18A 1SCWA 1XJ4A 4KZ4A 4GJ4A 3IF5A 4IVIA 3S22A 1PRQA 3N8RA 1G5UA 5GLCA 2PU4A 1GA9A 2J3WA 2XA7M 4I3JA 4KUKA 2WGWA 5IT5A 4QY6A 4JGQA 1JVJA 1MKMA 3ULFA 3A3DA 1K6SA 3BEBA 4GLQA 1N9BA 1ALQA 1NZUA 2LB5A 1Z09A 2ZL1B 4MN5A 1EI5A 5FATA 4N1XA 3O87A 3S4XA 5TGFA 4Z1WA 5CECA 1G28A 5HDSA 3NI9A 1MZUA 4B93A 1V9ZA 3C5AA 4UAAA 1GA0A 4ZTKA 4R23A 3UDXA 3CHWP 1JNUA 5HDCA 3F1NA 4L9FA 3CMZA 1L0DA 5FAQA 5CHMA 1KGEA 3M6HA 5AQ7A 5EV0A 4LCLA 4CLCD 2P9VB 2Z2MB 4B88A 3PBQA 1BLCA 4Y0UA 2PR6A 4KG5A 4G3VA 3IXDA 5CX7A 2VV7A 2DMWA 4BD0A 5C5KA 5EFWA 2HP9A 4FUWA 3UO9A 1I2SA 3ITAA 3OPRA 4Y2FA 3RJUA 3BYDA 1I2WA 4DJ3A 3IH9A 3IHAA 3P7NA 2L4RA 4HBTA 2V1BA 3T4TA 2WGIA 2P7JA 3VE3A 3G35A 1K4FA 1CEFA 4UQIM 4RYEA 4P0MA 1W63Q 2ZOHA 3S7PA 1GHPA 1LSWA 2P08A 4S2JA 1ACFA 4BBVA 4OP5A 1LL5A 3ITBA 4YFMA 4P6ZM 5FA7A 4CLCC 3IWQA 1YLZA 4Q0IA 1VEUB 3MKEA 4EBLA 4II7A 5HD5A 3VSLA 4U3TA 4WBGA 3BWLA 4BENA 1STZA 4ETXA 3KYEA 3SZTA 2B5RA 5L8MA 3G31A 3G2ZA 2KX6A 4JPMA 3NBLA 3MZFA 1ES5A 2A24B 3G30A 3V5MA 3NY4A 4EETB 3NECA 5F68A 3PBSA 3UMDA 1FR6A 2QZ6A 2KLIA 2ZD8A 4WELA 4Y3IA 2ZOIA 4NKPA 5TBMA 5FEFA 3LI8A 5CTNA 1D06A 4PM5A 3NC8A 3CI6A 4RQ9A 3UE3A 4DKIA 3SW1A 2QJ5A 3HUMA 3WS2A 5FQIA 3MJQA 1HLUP 2NUPC 2HZ5A 2J7VA 2Y91A 4MCWA 3P98A 5GHZA 3HVFA 4HP4A 3E4OA 3I7JA 3VE4A 3HCYA 3H9WA 5EOOA 2JKGA 3UB9A 3T1XA 3UPOA 1TS7A 3Q7VB 2WKPA 2XD5A 2VGLM 3CPTB 3G32A 1N9OA 1W7FA 3EEAA 2J9PA 1MBLA 1XP4A 4NXBA 1TEMA 3FPWA 3VV4A 4ZJ3A 3ZFZA 2ZQAA 3S7OA 4WLAA 1XKZA 3NJAA 4F3LA 4IBRA 3VFFA 1MWUA 4IVKA 2VK3A 4UHUA 3C38A 4F94A 4DE1A 4G3WA 3MZDA 5HAPA 3TOIA 1LL9A 1N9NA 2HF6A 3E0YA 3B33A 3T12B 4U0TA 3BY8A 3Q7ZA 3JVUA 3WRZA 1L2SA 4I5SA 3UDIA 1XXMA 3BJNA 3TJZC 1JWZA 3G2YA 4JGPA 1K55A 3IHBA 4OOMA 2ZBBA 5FI2A 1TF1A 3V67A 4WEJA 2VGJA 5F83A 2Y59A 4K0WA 1WA9A 1FQGA 3KSFA 2I72A 4GHIA 5HZHA 2Y8HA 1EWZA 1N9LA 2O9BA 4H8RA 4EBPA 3GMWA 4JKTA 2ZLYA 4GB7A 4XUXA 2X71A 4S2LA 1KGFA 2VX8A 3VOYA 5MC7A 2ZJ9A 4A5RA 4OLGA 2JN7A 3C8CA 2XLNA 5EVIA 5JYPA 3T4JA 5E2FA 3UNWA 1WE4A 4WYYA 4E6XA 3PR6A 3IX4A 5M1AA 1Q2QA 2XEPA 2CC1A 3FWLA 2A49A 5A90A 4HH3A 2VLGA 4KZ6A 1EROA 3GECA 3LUQA 4E3KA 3N8LA 2ZQDA 1NLZA 3IX8A 2ZMAA 4QY5A 1BULA 4OPYA 5J8XA 1BT5A 4BJPA 1KVLA 4S2NC 3S7NA 4QD4A 2ACGA 5L09A 3ZNYA 4DDYA 1VQQA 1ES4A 1SKFA 4JGRA 3SH9A 1ZKJA 4L9GA 4Y17A 3FKWA 4Y0TA 2GZAA 5GLDA 3OC2A 2ZC7A 4GOGA 4LGWA 4DE3A 3FYZA 5F6AA 1YAXA 3SH7A 4IUHA 1ERMA 2W3HA 1O07A 4S2IA 3LEZA 2ZL1A 1YLYA 3MXSA 1GSVA 3WS1A 4MEZA 4YOFA 3T4LA 3IF6B 4U0XA 2OOLA 2W3FA 2W1RA 1H5XA 3RH8B 3Q1FA 1M40A 2E8IA 4GS9B 2V1AA 1KVMA 5HWWA 4E3LA 1HZOA 5DTKA 4BLMA 1PYYA 2JKTM 3UMEA 2QJ7A 1ODVA 3MFDA 1SHVA 2P9VA 4EW7A 1LLBA 1SZVA 2INWA 4X1LA 4PMAA 1MKIA 3LIEA 5FL3A 3MKFA 2OSUA 4FSFA 2JKRM 1K57A 1UWNX 1XGJA 2XF3A 4N92A 1FCOA 1W79A 3NIAA 3MQ0A 3D72A 3A3JA 4XT2B 5GLBA 3PBRA 4OPZA 2IA2A 1KGGA 2QHKA 2QPNA 2OAQ1 1NYYA 2V8CA 1OTBA 4WZ4A 4MBHA 1K4EA 4EV4A 4E6WA 2Y2OA 2H10A 3M6BA 5HL6A 3LI9A 5J4EA 3BFCA 4JBFA 3C2WA 3LEQA 3AGEA 3D9YA 1DY6A 4DE0A 3VP0A 3GVBA 4MMNA 2BLSA 2V0WA 3W8KA 3OPPA 1MWSA 2WKQA 5CGSA 1WYBA 3C30A 4EXOA 1VEUA 4EUVA 3UB5P 3QP6A 3ZQ5A 4HESA 3LIBA 4Z9QA 3GV9A 5FDSA 4C3QA 1NRFA 3BM6A 2P74A 3QP5A 3TW8A 2ZQ7A 3DW0A 2DCFA 2XFTA 3V3RA 4JXGA 2ZC3B 1IYQA 2K7SA 1TS6A 2A24A 1OMEA 2W0NA 4WEKA 3MF0A 5HX9A 4K91A 1FIKA 2X01A 1K56A 1OT6A 1D7EA 5A93A 2DRWA 4GNUA 3C7UA 1JWPA 3B42A 2VV8A 4PKYG 3CUEA 2Y2QA 2Y79A 4C75A 2HPBA 2Y2JA 2WKEA 4PM9A 2J9OA 1Q2PA 1DJCA 1T1BA 3LR5A 5KIZA 1H8MA 3EQUA 2K31A 3MFXA 3D3OA 4OKPA 3OLOA 1PNEA 2PHYA 1IOUA 3T1SA 1WYCA 3UPNA 1CF0A 5GHXA 3Q7VA 3CPTA 1TS0A 1AWIA 3V39A 3N4IA 3VSKA 2EWVA 1OTIA 4KZ3A 4BMWA 1SDNA 2Y2KA 1NY0A 4Q0HA 1J9MA 5FI6A 2QKPA 1ONHA 3OBFA 5DJUA 5AQ9A 4B9OA 5CERA 1DJAA 1K6RA 4OQIA 4R6LA 4FOFA 3LYXA 2OV5A 4HQAA 4R4RA 4ZDXA 1ERQA 3PBOA 3VP3A 1S4SA 4NG2A 1PZPA 1YSPA 1RP5A 4OVDA 3VFHA 2EXBA 3HREA 2XDMA 2J3TD 2WZZA 2O9AA 4P6BA 1S67L 2AVXA 2FH5A 4NETA 3ZVTA 5M19A 3MQOA 2PAVP 4E3NA 1MC0A 1KE0A 3MMHA 3IT9A 3PBNA 3MS6A 3F1OB 4NEED 2R9WA 3DAVA 3IWIA 2JCHA 3LIDA 1IEMA 3WS4A 2ZMVA 4NXEA 1N4OA 1ESUA 4EBNA 4K0XA 1S6RA 2JKFA 4I38A 1ZC2A 2ZM0A 5F82A 1GHIA 1T19A 2B18A 4O01A 3HL9A 4PHTA 3TSGA 4LRYC 5AQBA 2Y2IA 3LY3A 5A91A 3EQVA 1YMXA 4ESPA 4RX2A 5DJTA 1YM1A 2EFUA 2WAEA 2EXAA 3GQZA 3IS2B 1X0OA 4PM8A 4Y0OA 4S2PA 5CEBA 5AQAA 2Y4AA 3SS3A 1H0MA 3K3DA 1TDLA 4MDZA 3N7WA 1BLSA 4LFUA 2J3TC 3NDGA 2EWWA 5JYOA 5DVAA 4P87A 2EX9A 4XXRA 2BTFP 4ARZB 3U2AA 1XGIA 3K2NA 5EVID 3S7QA 3HUNA 1GSXA 3NOUC 4S2KA 3VP4A 2OWJA 2C6WB 3MXRA 4FCFA 1CQAA 4D2OA 3VOLA 2O9CA 1G6AA 4KQOA 4AFIA 2E8JA 4HH2A 4QJGA 3HLWA 3UB8A 5F69A 2M7UA 1K55C 3H7WB 3RFBA 5KSHA 3N8SA 5F1FA 2W3EA 1TD5A 3O86A 4EUZA 4WZ5A 5TFQA 3SH8A 2ZC5B 4KZ9A 1FSWA 3O5YA 4UA7A 5CRFA 2Z6DA 4LV0A 2KOIA 3HLEA 4WM9A 4DF6A 1S0WA 4E04A 3IF6A 4OQ0A 3KO6A 3W4QA 5HWVA 1D1JA 4L0LA 3HLDA 4KZBA 3PHYA 4E3IA 4ZJ2A 4GS9A 1K54A 5EVIC 2PRFA 3GSGA 1L0FA 3EGDC 3EOIA 2H0TA 1W8YA 1FCNA 3PBTA 4DXCA 4KQDA 4C6YA 1H8YA 1BZAA 3CLOA 2XH9A 1ZG6A 1W8QA 5HAIA 5DF8A 3IH8A 3RXXA 4WMCA 3HLFA 1BLPA 4O7DA 3IBRA 1JTGA 3ZG0A 1RGYA 2HJEA 5FASA 5G18A 4QB8A 3IWOA 4KG2A 5HDDA 1TS8A 1ZHHB 3UE1A 1OTAA 2PT7A 2PU2A 2PYRA 2BG1A 5A8BA 4XT2A 3KSGA 3HJIA 3A0RA 4HI4A 1XFNA 5K5BA 4OP8A 4BBUA 2A2LA 4GW9A 2XROA 1H8ZA 3UE0A 2WAFA 1CEGA 1TVFA 2EFXA 2W1TB 4B4ZA 4DDSA 2WUQA 4HNBA 5HPFA 1P0ZA 4WN5A 3IXGA 3C7VA 2G2WA 4P85A 5CEDA 3BQAA 3P09A 4HJ4A 4MNRA 1OTEA 4I39A 2WADA 3T4SA 5FDHA 3ZHHA 3M2KA 1SKOB 1BYWA 1OJ5A 1NJ4A 3KYZA 3L9KA 2HP6A 1YLTA 4HY8A 3DWKA 1O7EA 2Q0OA 4YWZA 1CI9A 2DNSA 1FSYA 5CGXA 4R38A 1LHYA 5DKKA 5EUAA 2P04A 1P9WA 2XFSA 4JF6A 4CPKA 3JPUA 3OPLA 4WF0A 2FZ0A 3D4FA 2Y2HA 3TRCA 1K57C 3GR2A 2JE5A 4CQHA 2O99A 3W4PA 3ZCZA 3A3FA 1UGUA 2ZQCA 3K3CA 2V8FA 5DKLA 1C3BA 2V1ZA 2Y2LA 2XRNA 2Z2LB 4QHCA 1DP8A 1ZG4A 2X02A 3BECA 4Q0JA 3ZG9B 1CJFA 4KQRA 1LT0A 4ZAMA 1KDWA 3BFEA 4LV1A 1GHMA 4MN6A 1PW8A 1YMSA 4Y13A 3MZEA 3QP1A 1XA1A 2JHEA 3OOVA 1DP6A 3BFGA 2ZC6B 4CLCB 3GTCA 3T1RA 4ID4A 2EX8A 3FZCA 2ZQ8A 5E2EA 2RL3A 3EWKA 4UA9A 5G4YA 2GJ3A 4OPRA 3TG9A 1VETB 4FTXA 1LI0A 3ZNTA 3HBRA 3R7WB 4O8GA 3HLBA 4WL9A 2W3DA 2XQZA 4D60A 1FOFA 1PI4A 4ZRRA 4X56A 1FILA 3UDFA 1LL8A 1MY8A 3ZDJA 4GKUA 4Y5FA 2XR0A 1NZOA 1PZOA 4X1MA 1KOUA 2OLVA 3F1PB 3OCLA 5GLAA 4DJ2A 3BW6A 4R1GA 2G7UA 3NOTC 5EVEA 5LBRA 3BFDA 2IWDA 2CMNA 2Y2MA 1M6KA 2QWSA 3HLCA 3E98A 3CUEC 4O0PA 5DFXA 3BLMA 4H6JB 2UWXA 3RTYA
chains in the Genus database with same CATH topology
1XJ2A 1OTIA 2L0WA 3SW1A 2HGVA 2QJ5A 4BMWA 1T1CA 3MJQA 4DMZA 2NUPC 2JKTI 2HV1A 4IJGA 4MCWA 4Q0HA 2W27A 2GX5A 4HP4A 2QKPA 5HD3A 3E4OA 5HPIA 3F1OA 3OBFA 5DJUA 3VE4A 2XA7S 4B9OA 3HCYA 1XJ3A 3H9WA 5AVEA 3UB6A 4I3AA 1IFQA 4R6LA 4FOFA 3FPVA 1LSVA 4IUKA 3LYXA 4LPZA 4HQAA 4P6ZS 3UB9A 2JKRI 3IBJA 2NUTC 4ETZA 2L1MA 3GDIA 5AVFA 3PBOA 5TBMB 3TE8A 1TS7A 1S4SA 2BASA 2WKPA 2V9AA 2VGLM 1YSPA 2R78A 1N9OA 2KDKA 3EEAA 3PYPA 2J3TD 2O9AA 3LICA 5I5LA 1S67L 4NXBA 2FH5A 3FPWA 3VV4A 4L9EA 3IS2A 2WKRA 1F5MA 3A0VA 3MQOA 3OCNA 4WLAA 3S7OA 3DBAA 1MC0A 3MQQA 1NRJA 4HOIA 3MMHA 3NJAA 4HIAA 4F3LA 3LIAA 3PBNA 3F1OB 4NEED 2VV6A 3R4KA 3LIDA 4YNRA 2ZMVA 4NXEA 3C38A 2OWHA 4R3AA 4G3WA 4ARZA 3KSIA 1N9NA 2XSSA 4LRXC 2HF6A 1F9IA 4QPRA 3E0YA 1S4RA 4I38A 3EGXC 3B33A 5IS1A 3A0SA 3BY8A 1T19A 4O01A 2B18A 1V9YA 3JVUA 1OJGA 4PHTA 2D01A 5J7EA 4I5SA 4LRYC 4UEYA 3CWFA 1W63M 2PR5A 3EQVA 5DJTA 3W2ZA 3BJNA 3TJZC 3IS2B 1X0OA 4JGPA 1OPXA 4OOMA 2ZBBA 1TF1A 3H7WA 3V67A 4WEJA 3K3DA 4CLCE 4F3LB 1UWPX 1XJ6A 4MDZA 1S1YA 2J3TC 1WA9A 2VKSA 5J3WA 2EWWA 3KSFA 3KYQA 4GHIA 4BWIA 5HZHA 2Y8HA 4ARZB 3U2AA 1N9LA 2Z6CA 3K2NA 2I9VA 3S7QA 2O9BA 1GSXA 3NOUC 1Y28A 2H28A 4R70A 2OWJA 1VB6A 3VOLA 2O9CA 4KQOA 4AFIA 4EU0A 2VGLS 5AJGA 4HH2A 2VX8A 5MC7A 2MJ6A 1T18A 1YKDA 1P9RA 2JN7A 3C8CA 3UB7A 4EQ1A 1OT9A 5F69A 4OOLA 3UB8A 3T4JA 1XFQA 2J80A 4ME4A 4UQIS 2M7UA 3H7WB 3PR6A 2V0UA 3RFBA 2VEAA 5KSHA 3LR0A 3LR3A 2W3EA 3JVVA 5HSQA 1TD5A 2W3GA 4WUJA 4GHIB 3G6OA 2K2NA 4HH3A 2VLGA 3GECA 3O5YA 3LUQA 2Z6DA 1DRMA 2KOIA 4EERA 2GNXA 1NLZA 3HJKA 2M7VA 4E04A 4IHQA 4K08A 3KO6A 5HWVA 2HJ9C 2VJWA 2M1CA 4PAUA 4BJPA 2EA9A 3LIFA 4L0LA 3CAXA 3PHYA 3NOPC 3S7NA 3CITA 1NWZA 2B02A 4GS9A 4JGRA 1F98A 3MXQA 4L9GA 3ICYA 2GZAA 3EGDC 1EW0A 3OC2A 3BY9A 4NXGA 3EOIA 4PKYA 3P01A 4G3KA 4KUOA 5F6AA 1YAXA 3PBTA 5IU1A 2ZMFA 1LSXA 2PDRA 1ZTUA 2W1TA 4IUHA 4KQDA 2W3HA 1DP9A 1G6OA 1VHMA 3CLOA 1XJ4A 1P97A 4GJ4A 1GSVA 4YOFA 3T4LA 2J3WA 2XA7M 2OOLA 3IBRA 4I3JA 2W3FA 4KUKA 2YKHA 2W1RA 4LRZE 3ZYTA 2HJEA 3T50A 3RH8B 5IT5A 4GS9B 2V1AA 4JGQA 5HDDA 1TS8A 1ZHHB 4JGOA 1OTAA 2PT7A 5A8BA 2PYRA 5HWWA 5F5YA 1MKMA 4XT2A 3KSGA 3ULFA 3HJIA 3A0RA 4HI4A 1XFNA 4HJ3A 5K5BA 4GLQA 4BBUA 2OAP1 3LR4A 2O0YA 2A2LA 4GW9A 2XROA 2JKTM 3UMEA 5G4ZA 2W1TB 2QJ7A 3H82A 2LB5A 1ODVA 4HNBA 2PYPA 1P0ZA 4MN5A 5HPFA 4WN5A 4EW7A 3UE6A 3T4QA 2INWA 2YKFA 3LIEA 5FL3A 4FSFA 2JKRM 1UWNX 3BQAA 3T4KA 3E4PA 4Z1WA 3MR0A 1G28A 4HJ4A 3BQ8A 5HDSA 1MZUA 4EESA 4B93A 1V9ZA 2PD7A 1OTEA 3MQ0A 2LB9A 4I39A 3D72A 1JNUA 5HDCA 4XT2B 3T4SA 3PBRA 3F1NA 4L9FA 2IA2A 2PD8A 1BYWA 1OJ5A 3KYZA 1T1AA 2QHKA 4HY8A 2OAQ1 4YWZA 1OTBA 3FC7A 2QYBA 4EEPA 5TJJA 4CLCD 3PBQA 3NHQA 4R38A 5HL6A 3LI9A 5DKKA 2P04A 2PR6A 1P9WA 5J4EA 4G3VA 5CX7A 3C2WA 3FG8A 2VV7A 1S66L 4DN0A 4M4XA 2DMWA 4WF0A 2FZ0A 4MMNA 5C5KA 4HJ6A 3TRCA 2V0WA 5EFWA 3T4OA 4CLCA 4CQHA 2O99A 2VZWA 3LFVA 2WKQA 4Y2FA 1YSQA 3C30A 1UGUA 4EXOA 3K3CA 5DKLA 4EUVA 4DJ3A 3P7NA 3F1NB 3ZQ5A 2L4RA 3LIBA 2XRNA 3PXPA 2V1BA 3R7WA 4HHDA 4BBTA 3B47A 3T4TA 1DP8A 2P7JA 3VE3A 4LLOB 3TW8A 4Q0JA 1LT0A 4UQIM 5HWTA 1W63Q 4EEUA 2ZOHA 3S7PA 2K7SA 1LSWA 2P08A 3F1PA 4MN6A 1TS6A 2A24A 2W0NA 4WEKA 4BBVA 3EEHA 3MF0A 1GSWA 5DFYA 2JHEA 3OOVA 1DP6A 4CLCB 4P6ZM 1OT6A 1D7EA 4CLCC 1S1ZA 4Q0IA 3EWKA 5G4YA 2GJ3A 1H3QA 1NLYA 4II7A 5HD5A 3B42A 3R7WB 2VV8A 4O8GA 4PKYG 3CUEA 3KSHA 2Y79A 4WL9A 2W3DA 4NXFA 3BWLA 4H6JA 1STZA 4ETXA 4ZRRA 5L8MA 3KX0X 1T1BA 2KX6A 3LR5A 4HP9A 4MN7A 1LL8A 4Y5FA 5KIZA 1KOUA 1H8MA 3F1PB 3OCLA 2A24B 3EQUA 2K31A 1OTDA 4DJ2A 3BW6A 4EETB 5F68A 3MFXA 3PBSA 4I3IA 3UMDA 3D3OA 2G7UA 3NOTC 5LBRA 3OLOA 5DF9A 2CMNA 2KLIA 2PHYA 2D02A 4WELA 1IOUA 4Y3IA 2ZOIA 4NKPA 2VA0A 5TBMA 3LI8A 2QWSA 4GCZA 3E98A 1D06A 3CUEC 3E4QA 1TS0A 4O0PA 5DFXA 4H6JB 3CI6A 3H82B 4RQ9A 3RTYA 3UE3A 2EWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XJ2 A;  1OTI A;  2L0W A;  3SW1 A;  2QJ5 A;  1T1C A;  3MJQ A;  2HV1 A;  2W27 A;  4HP4 A;  2QKP A;  5HD3 A;  3E4O A;  3F1O A;  5DJU A;  3VE4 A;  4B9O A;  1XJ3 A;  3H9W A;  5AVE A;  3UB6 A;  4I3A A;  4R6L A;  1LSV A;  3LYX A;  4LPZ A;  4HQA A;  3UB9 A;  2L1M A;  3GDI A;  5AVF A;  5TBM B;  1TS7 A;  1S4S A;  2BAS A;  2WKP A;  2V9A A;  2R78 A;  1N9O A;  2KDK A;  3PYP A;  3LIC A;  5I5L A;  1S67 L;  4NXB A;  4L9E A;  3IS2 A;  2WKR A;  3A0V A;  3MQO A;  4WLA A;  3MQQ A;  4HOI A;  3NJA A;  4HIA A;  4F3L A;  3LIA A;  3F1O B;  2VV6 A;  3LID A;  4NXE A;  2OWH A;  4R3A A;  1N9N A;  4LRX C;  1F9I A;  1S4R A;  4I38 A;  3B33 A;  5IS1 A;  3A0S A;  3BY8 A;  1T19 A;  1V9Y A;  1OJG A;  2D01 A;  5J7E A;  4I5S A;  4LRY C;  3CWF A;  2PR5 A;  5DJT A;  3IS2 B;  1X0O A;  4JGP A;  2ZBB A;  3H7W A;  3K3D A;  4F3L B;  1UWP X;  1XJ6 A;  1S1Y A;  1WA9 A;  5J3W A;  4GHI A;  5HZH A;  1N9L A;  2Z6C A;  2I9V A;  1GSX A;  3NOU C;  1Y28 A;  2H28 A;  4R70 A;  2OWJ A;  1VB6 A;  3VOL A;  4HH2 A;  1T18 A;  3UB7 A;  2JN7 A;  3C8C A;  4EQ1 A;  1OT9 A;  5F69 A;  3UB8 A;  1XFQ A;  2J80 A;  3H7W B;  2V0U A;  2VEA A;  5HSQ A;  4WUJ A;  4GHI B;  3G6O A;  4HH3 A;  2VLG A;  3GEC A;  3LUQ A;  2Z6D A;  1DRM A;  4EER A;  3HJK A;  4E04 A;  4K08 A;  5HWV A;  2M1C A;  2EA9 A;  3LIF A;  3CAX A;  3PHY A;  3NOP C;  1NWZ A;  2B02 A;  4GS9 A;  4JGR A;  1F98 A;  3MXQ A;  4L9G A;  3ICY A;  1EW0 A;  4NXG A;  3BY9 A;  4PKY A;  4KUO A;  5F6A A;  5IU1 A;  1LSX A;  2PDR A;  4KQD A;  1DP9 A;  3CLO A;  1XJ4 A;  1P97 A;  1GSV A;  2OOL A;  3IBR A;  4I3J A;  4KUK A;  2YKH A;  4LRZ E;  3T50 A;  3RH8 B;  4GS9 B;  2V1A A;  4JGQ A;  5HDD A;  1TS8 A;  4JGO A;  5HWW A;  1OTA A;  5A8B A;  2PYR A;  5F5Y A;  4XT2 A;  3ULF A;  3HJI A;  3A0R A;  4HI4 A;  1XFN A;  4HJ3 A;  4BBU A;  4GW9 A;  3UME A;  5G4Z A;  2QJ7 A;  3H82 A;  1ODV A;  4HNB A;  2PYP A;  1P0Z A;  4MN5 A;  4WN5 A;  4EW7 A;  3UE6 A;  2INW A;  2YKF A;  3LIE A;  1UWN X;  3E4P A;  3MR0 A;  1G28 A;  4HJ4 A;  5HDS A;  1MZU A;  4EES A;  1V9Z A;  2PD7 A;  1OTE A;  4I39 A;  3D72 A;  1JNU A;  5HDC A;  4XT2 B;  3F1N A;  4L9F A;  2PD8 A;  1BYW A;  1OJ5 A;  1T1A A;  2QHK A;  4HY8 A;  4YWZ A;  1OTB A;  3FC7 A;  4EEP A;  3NHQ A;  4R38 A;  3LI9 A;  5DKK A;  2PR6 A;  5J4E A;  3C2W A;  3FG8 A;  2VV7 A;  1S66 L;  4M4X A;  4WF0 A;  4HJ6 A;  2V0W A;  5EFW A;  2WKQ A;  1UGU A;  4EXO A;  3K3C A;  5DKL A;  4DJ3 A;  3P7N A;  3F1N B;  3ZQ5 A;  2L4R A;  3LIB A;  2V1B A;  4HHD A;  4BBT A;  1DP8 A;  2P7J A;  3VE3 A;  4LLO B;  1LT0 A;  5HWT A;  4EEU A;  2ZOH A;  2K7S A;  1LSW A;  3F1P A;  4MN6 A;  1TS6 A;  2A24 A;  2W0N A;  4BBV A;  3EEH A;  1GSW A;  2JHE A;  1DP6 A;  1OT6 A;  1D7E A;  1S1Z A;  3EWK A;  5G4Y A;  2GJ3 A;  5HD5 A;  2VV8 A;  4PKY G;  4WL9 A;  4NXF A;  3BWL A;  4H6J A;  3KX0 X;  1T1B A;  2KX6 A;  4HP9 A;  1LL8 A;  5KIZ A;  1KOU A;  3F1P B;  2A24 B;  1OTD A;  4DJ2 A;  4EET B;  5F68 A;  3MFX A;  4I3I A;  3UMD A;  3NOT C;  3OLO A;  2CMN A;  2PHY A;  2D02 A;  2ZOI A;  5TBM A;  3LI8 A;  2QWS A;  4GCZ A;  1D06 A;  3E4Q A;  1TS0 A;  4H6J B;  4RQ9 A;  3H82 B;  3RTY A; 
#chains in the Genus database with same CATH topology
 1XJ2 A;  3MBZ A;  2PBY A;  4DMZ A;  1A0K A;  3DTI A;  3LY4 A;  5L2F A;  5HD3 A;  3F1O A;  1ES2 A;  1XJ3 A;  5HAQ A;  5AVE A;  3UB6 A;  4I3A A;  3IQA A;  5EEC A;  1IFQ A;  3FPV A;  1LSV A;  4P6Z S;  3IBJ A;  5KSC A;  3G4P A;  5AVF A;  3U4L P;  3TE8 A;  2RCX A;  3UN7 A;  3LGO A;  2V9A A;  1TDG A;  5EOE A;  2KDK A;  3S1Y A;  2Y55 A;  3JYI A;  4S2O A;  3LIC A;  5I5L A;  5HL1 A;  1K38 A;  4XUZ A;  3FKV A;  4OPQ A;  3IS2 A;  1F5M A;  3A0V A;  1W5D A;  3MQQ A;  4HOI A;  4HIA A;  3PTE A;  5FEG A;  1J3W A;  1XA7 A;  2WGV A;  5FI7 A;  2WK0 A;  5TR7 A;  1CI8 A;  4S2M A;  4X69 A;  4ARZ A;  3VP1 A;  2XSS A;  4LRX C;  4OOY A;  1F9I A;  3QNC A;  3EGX C;  1LI9 A;  5IS1 A;  1Y54 A;  1E3U A;  1L3L A;  1V9Y A;  4JXV A;  5J7E A;  1BLH A;  3CWF A;  1W63 M;  5FQM A;  2XK1 A;  1YLW A;  3QP2 A;  1RCJ A;  4B4X A;  3H7W A;  4RA7 A;  2J8Y A;  3G34 A;  1XJ6 A;  1GCE A;  3HUO A;  1S1Y A;  4EQI A;  3BFF A;  5J3W A;  5L10 A;  4KZ8 A;  4KG6 A;  4YIN A;  2I9V A;  5EE8 A;  4HEF A;  3BLS A;  2H28 A;  5CHU A;  1IYS A;  3QHY A;  4EU0 A;  2VGL S;  4LEN A;  5IHV A;  2GDN A;  5AJG A;  5EVL A;  5CHJ A;  1T18 A;  1YKD A;  3VMA A;  3UB7 A;  4EQ1 A;  4GDB A;  3NUL A;  5EM1 A;  1XFQ A;  4ME4 A;  2HDQ A;  5A92 A;  2V0U A;  4R3J A;  2VEA A;  3LR0 A;  4JXS A;  5E2G A;  1PFL A;  3AGF A;  3QP8 A;  5HSQ A;  2W3G A;  4WUJ A;  1MWT A;  4R4S A;  3G6O A;  4LV3 A;  2WKI A;  1HTZ A;  4BL2 A;  3ISG A;  2JC7 A;  3CG5 A;  4E3M A;  4EER A;  3UY6 A;  2FFY A;  3O3V A;  4BD1 A;  2M7V A;  2HDS A;  4K08 A;  4GN2 A;  2VJW A;  4PPR A;  4PAU A;  3LIF A;  5DF7 A;  1IKG A;  4KZA A;  1Z6F A;  1PI5 A;  1PIO A;  1IEL A;  2ZQ9 A;  2ZM8 A;  3PAG A;  1F98 A;  3MXQ A;  3ICY A;  5U47 A;  4Y7P A;  4OON A;  1EW0 A;  4NXG A;  3BY9 A;  4PKY A;  4WMC D;  3AGD A;  3WS0 A;  2Q9N A;  3CZD A;  5CXW A;  5IU1 A;  2V2F F;  4GZB A;  2PDR A;  1ZTU A;  2W1T A;  4OH0 A;  3QNB A;  4WZ5 C;  3C4O A;  4KZ7 A;  1G6O A;  1VHM A;  1NYM A;  1P97 A;  4X53 A;  4DXB A;  2R9X A;  3IF6 C;  2YKH A;  3Q07 A;  4LRZ E;  5GL9 A;  3ZYT A;  3WWX A;  4MBK A;  3DTE A;  3T50 A;  2HDU A;  3M2J A;  2IWC A;  4M3K A;  1K54 C;  4JGO A;  5F5Y A;  3WRT A;  3N6I A;  1YPR A;  1XPB A;  3DWZ A;  4HJ3 A;  1SKO A;  4JF4 A;  1KE4 A;  2OAP 1;  3LR4 A;  2O0Y A;  1NXY A;  5G4Z A;  3H82 A;  3VOZ A;  2PYP A;  1HD8 A;  3SOI A;  3UE6 A;  3T4Q A;  2YKF A;  1HVB A;  4N1H A;  4OQH A;  3QP4 A;  3T4K A;  3E4P A;  3MR0 A;  3A3I A;  2WGW B;  3BQ8 A;  4EES A;  2PD7 A;  2LB9 A;  4CJN A;  4PM6 A;  2EX2 A;  5HFO A;  2G2U A;  4BL3 A;  1JWV A;  2WKH A;  4NK3 A;  2PD8 A;  5FAO A;  2ZC4 B;  1T1A A;  1BUE A;  4IED A;  1DJB A;  3PAE A;  5FQQ A;  3FC7 A;  2QYB A;  4EEP A;  5TJJ A;  3NHQ A;  4EWF A;  4N9L A;  3V50 A;  1KE3 A;  3FG8 A;  1S66 L;  4DN0 A;  4M4X A;  5I94 A;  4HJ6 A;  1YLJ A;  3UPP A;  4QU3 A;  3T4O A;  4CLC A;  2VZW A;  3LFV A;  1YSQ A;  2Q9M A;  3O88 A;  3F1N B;  1K0K A;  1MXO A;  1VET A;  3PXP A;  3R7W A;  4RVA A;  4ZJ1 A;  3FV7 A;  4HHD A;  4BBT A;  3B47 A;  2A3U A;  1ES3 A;  4LLO B;  1VM1 A;  3ZG5 A;  2UV0 E;  1L0G A;  1BSG A;  5HWT A;  3RXW A;  4EEU A;  3W4O A;  3F1P A;  3MSH A;  1MPL A;  1JTD A;  2Y2N A;  3SS5 A;  2QMI A;  3EEH A;  1GSW A;  1MWR A;  5DFY A;  4Q8I A;  1S1Z A;  1YLP A;  1H3Q A;  1NLY A;  5DTS A;  3BRM A;  5FQJ A;  4GDN A;  3KSH A;  5HAR A;  4NXF A;  4H6J A;  3IXB A;  3ZG7 B;  3KX0 X;  4MN7 A;  4HP9 A;  5BOH A;  4PM7 A;  5KMW A;  5DTT A;  4OLD A;  1OTD A;  3B3X A;  3WS5 A;  3OZH A;  4I3I A;  5GHY A;  2IWB A;  5DF9 A;  3C4P A;  4FH2 A;  4R0Q A;  2D02 A;  2VA0 A;  4BQM A;  1QME A;  1BTL A;  4ZBE A;  2V20 A;  4GCZ A;  4E3J A;  3GRJ A;  4GD8 A;  4DRT A;  2C5W B;  3CJM A;  1IKI A;  3E4Q A;  3H82 B;  1K25 A;  5D3O A;  2L0W A;  2HGV A;  1T1C A;  5FQK A;  4JLF A;  4DE2 A;  3Q82 A;  2JKT I;  5EM0 A;  2HV1 A;  4IJG A;  5F1G A;  4OQG A;  3HLG A;  4RX3 A;  2W27 A;  2GX5 A;  5HPI A;  2XA7 S;  1IYO A;  3LO7 A;  2HP5 A;  4MLL A;  1AXB A;  1E4D A;  4IUK A;  4N9K A;  4LPZ A;  2JKR I;  4ETZ A;  2NUT C;  2L1M A;  3GDI A;  5TBM B;  5L07 A;  2BAS A;  1G68 A;  4FH4 A;  2R78 A;  3PYP A;  4JXW A;  3Q81 A;  4FD8 A;  1E25 A;  1K56 D;  3NCK A;  2H5S A;  4LCM A;  3IX3 A;  4X55 A;  4L9E A;  2WKR A;  2XD1 A;  3OCN A;  3DBA A;  4MBF A;  1NRJ A;  3E2L A;  2PBD P;  3LIA A;  1RGZ A;  1E3U D;  2VV6 A;  3R4K A;  4YNR A;  2OWH A;  4R3A A;  3VP2 A;  4X68 A;  2WZX A;  3KSI A;  5KZH A;  1FR1 A;  4QPR A;  1I5Q A;  1S4R A;  2JBF A;  2Y2P A;  2OLU A;  4QWO A;  2VGK A;  3NDE A;  3A0S A;  1OJG A;  5E2H A;  2D01 A;  2ZM2 A;  4UEY A;  2PR5 A;  3W2Z A;  1OPX A;  1F2K A;  4IBX A;  5FSR A;  1CK3 A;  3OPH A;  5CGW A;  4CLC E;  4F3L B;  1L0E A;  2HDR A;  1UWP X;  2XGN A;  3T1Q B;  2VKS A;  1PWD A;  3KYQ A;  4BWI A;  4JF5 A;  2H0Y A;  2Z6C A;  3LCE A;  5FQ9 A;  1ESI A;  5E43 A;  1Y28 A;  4R70 A;  2WYX A;  1VB6 A;  3IXH A;  4UA6 A;  2Y2G A;  5CTM A;  2FFF B;  4X25 A;  4S2N A;  2MJ6 A;  1P9R A;  1OT9 A;  4OOL A;  1SDE A;  1PWC A;  2J80 A;  4UQI S;  1U60 A;  1YQS A;  3ZG8 B;  4E3O A;  1KDS A;  1ONG A;  2EX6 A;  3SS4 A;  3DTM A;  3V3S A;  3LR3 A;  3JVV A;  3E2K A;  1FCM A;  2B95 A;  4GHI B;  1PW1 A;  4LV2 A;  2K2N A;  5FAP A;  3ZGA B;  1DRM A;  1XX2 A;  2GNX A;  1Y4O A;  4GD6 A;  3HJK A;  4IHQ A;  3ZVW A;  2HJ9 C;  2M1C A;  4R3B A;  2EA9 A;  3CAX A;  4KQQ A;  3NOP C;  1QMF A;  5EVI B;  3CIT A;  1NWZ A;  2B02 A;  3L7H A;  4Y15 A;  5EPH A;  3DTK A;  1PWG A;  4KZ5 A;  3A3E A;  1YT4 A;  1IYP A;  3P01 A;  4G3K A;  4KEN B;  4HBU A;  4KUO A;  2ZMF A;  1LSX A;  4X6T A;  5HW3 A;  1DP9 A;  5M18 A;  1SCW A;  1XJ4 A;  4KZ4 A;  4GJ4 A;  3IF5 A;  4IVI A;  3S22 A;  1PRQ A;  3N8R A;  1G5U A;  5GLC A;  2PU4 A;  1GA9 A;  2J3W A;  2XA7 M;  4I3J A;  4KUK A;  2WGW A;  5IT5 A;  4QY6 A;  4JGQ A;  1JVJ A;  1MKM A;  3ULF A;  3A3D A;  1K6S A;  3BEB A;  4GLQ A;  1N9B A;  1ALQ A;  1NZU A;  2LB5 A;  1Z09 A;  2ZL1 B;  4MN5 A;  1EI5 A;  5FAT A;  4N1X A;  3O87 A;  3S4X A;  5TGF A;  4Z1W A;  5CEC A;  1G28 A;  5HDS A;  3NI9 A;  1MZU A;  4B93 A;  1V9Z A;  3C5A A;  4UAA A;  1GA0 A;  4ZTK A;  4R23 A;  3UDX A;  3CHW P;  1JNU A;  5HDC A;  3F1N A;  4L9F A;  3CMZ A;  1L0D A;  5FAQ A;  5CHM A;  1KGE A;  3M6H A;  5AQ7 A;  5EV0 A;  4LCL A;  4CLC D;  2P9V B;  2Z2M B;  4B88 A;  3PBQ A;  1BLC A;  4Y0U A;  2PR6 A;  4KG5 A;  4G3V A;  3IXD A;  5CX7 A;  2VV7 A;  2DMW A;  4BD0 A;  5C5K A;  5EFW A;  2HP9 A;  4FUW A;  3UO9 A;  1I2S A;  3ITA A;  3OPR A;  4Y2F A;  3RJU A;  3BYD A;  1I2W A;  4DJ3 A;  3IH9 A;  3IHA A;  3P7N A;  2L4R A;  4HBT A;  2V1B A;  3T4T A;  2WGI A;  2P7J A;  3VE3 A;  3G35 A;  1K4F A;  1CEF A;  4UQI M;  4RYE A;  4P0M A;  1W63 Q;  2ZOH A;  3S7P A;  1GHP A;  1LSW A;  2P08 A;  4S2J A;  1ACF A;  4BBV A;  4OP5 A;  1LL5 A;  3ITB A;  4YFM A;  4P6Z M;  5FA7 A;  4CLC C;  3IWQ A;  1YLZ A;  4Q0I A;  1VEU B;  3MKE A;  4EBL A;  4II7 A;  5HD5 A;  3VSL A;  4U3T A;  4WBG A;  3BWL A;  4BEN A;  1STZ A;  4ETX A;  3KYE A;  3SZT A;  2B5R A;  5L8M A;  3G31 A;  3G2Z A;  2KX6 A;  4JPM A;  3NBL A;  3MZF A;  1ES5 A;  2A24 B;  3G30 A;  3V5M A;  3NY4 A;  4EET B;  3NEC A;  5F68 A;  3PBS A;  3UMD A;  1FR6 A;  2QZ6 A;  2KLI A;  2ZD8 A;  4WEL A;  4Y3I A;  2ZOI A;  4NKP A;  5TBM A;  5FEF A;  3LI8 A;  5CTN A;  1D06 A;  4PM5 A;  3NC8 A;  3CI6 A;  4RQ9 A;  3UE3 A;  4DKI A;  3SW1 A;  2QJ5 A;  3HUM A;  3WS2 A;  5FQI A;  3MJQ A;  1HLU P;  2NUP C;  2HZ5 A;  2J7V A;  2Y91 A;  4MCW A;  3P98 A;  5GHZ A;  3HVF A;  4HP4 A;  3E4O A;  3I7J A;  3VE4 A;  3HCY A;  3H9W A;  5EOO A;  2JKG A;  3UB9 A;  3T1X A;  3UPO A;  1TS7 A;  3Q7V B;  2WKP A;  2XD5 A;  2VGL M;  3CPT B;  3G32 A;  1N9O A;  1W7F A;  3EEA A;  2J9P A;  1MBL A;  1XP4 A;  4NXB A;  1TEM A;  3FPW A;  3VV4 A;  4ZJ3 A;  3ZFZ A;  2ZQA A;  3S7O A;  4WLA A;  1XKZ A;  3NJA A;  4F3L A;  4IBR A;  3VFF A;  1MWU A;  4IVK A;  2VK3 A;  4UHU A;  3C38 A;  4F94 A;  4DE1 A;  4G3W A;  3MZD A;  5HAP A;  3TOI A;  1LL9 A;  1N9N A;  2HF6 A;  3E0Y A;  3B33 A;  3T12 B;  4U0T A;  3BY8 A;  3Q7Z A;  3JVU A;  3WRZ A;  1L2S A;  4I5S A;  3UDI A;  1XXM A;  3BJN A;  3TJZ C;  1JWZ A;  3G2Y A;  4JGP A;  1K55 A;  3IHB A;  4OOM A;  2ZBB A;  5FI2 A;  1TF1 A;  3V67 A;  4WEJ A;  2VGJ A;  5F83 A;  2Y59 A;  4K0W A;  1WA9 A;  1FQG A;  3KSF A;  2I72 A;  4GHI A;  5HZH A;  2Y8H A;  1EWZ A;  1N9L A;  2O9B A;  4H8R A;  4EBP A;  3GMW A;  4JKT A;  2ZLY A;  4GB7 A;  4XUX A;  2X71 A;  4S2L A;  1KGF A;  2VX8 A;  3VOY A;  5MC7 A;  2ZJ9 A;  4A5R A;  4OLG A;  2JN7 A;  3C8C A;  2XLN A;  5EVI A;  5JYP A;  3T4J A;  5E2F A;  3UNW A;  1WE4 A;  4WYY A;  4E6X A;  3PR6 A;  3IX4 A;  5M1A A;  1Q2Q A;  2XEP A;  2CC1 A;  3FWL A;  2A49 A;  5A90 A;  4HH3 A;  2VLG A;  4KZ6 A;  1ERO A;  3GEC A;  3LUQ A;  4E3K A;  3N8L A;  2ZQD A;  1NLZ A;  3IX8 A;  2ZMA A;  4QY5 A;  1BUL A;  4OPY A;  5J8X A;  1BT5 A;  4BJP A;  1KVL A;  4S2N C;  3S7N A;  4QD4 A;  2ACG A;  5L09 A;  3ZNY A;  4DDY A;  1VQQ A;  1ES4 A;  1SKF A;  4JGR A;  3SH9 A;  1ZKJ A;  4L9G A;  4Y17 A;  3FKW A;  4Y0T A;  2GZA A;  5GLD A;  3OC2 A;  2ZC7 A;  4GOG A;  4LGW A;  4DE3 A;  3FYZ A;  5F6A A;  1YAX A;  3SH7 A;  4IUH A;  1ERM A;  2W3H A;  1O07 A;  4S2I A;  3LEZ A;  2ZL1 A;  1YLY A;  3MXS A;  1GSV A;  3WS1 A;  4MEZ A;  4YOF A;  3T4L A;  3IF6 B;  4U0X A;  2OOL A;  2W3F A;  2W1R A;  1H5X A;  3RH8 B;  3Q1F A;  1M40 A;  2E8I A;  4GS9 B;  2V1A A;  1KVM A;  5HWW A;  4E3L A;  1HZO A;  5DTK A;  4BLM A;  1PYY A;  2JKT M;  3UME A;  2QJ7 A;  1ODV A;  3MFD A;  1SHV A;  2P9V A;  4EW7 A;  1LLB A;  1SZV A;  2INW A;  4X1L A;  4PMA A;  1MKI A;  3LIE A;  5FL3 A;  3MKF A;  2OSU A;  4FSF A;  2JKR M;  1K57 A;  1UWN X;  1XGJ A;  2XF3 A;  4N92 A;  1FCO A;  1W79 A;  3NIA A;  3MQ0 A;  3D72 A;  3A3J A;  4XT2 B;  5GLB A;  3PBR A;  4OPZ A;  2IA2 A;  1KGG A;  2QHK A;  2QPN A;  2OAQ 1;  1NYY A;  2V8C A;  1OTB A;  4WZ4 A;  4MBH A;  1K4E A;  4EV4 A;  4E6W A;  2Y2O A;  2H10 A;  3M6B A;  5HL6 A;  3LI9 A;  5J4E A;  3BFC A;  4JBF A;  3C2W A;  3LEQ A;  3AGE A;  3D9Y A;  1DY6 A;  4DE0 A;  3VP0 A;  3GVB A;  4MMN A;  2BLS A;  2V0W A;  3W8K A;  3OPP A;  1MWS A;  2WKQ A;  5CGS A;  1WYB A;  3C30 A;  4EXO A;  1VEU A;  4EUV A;  3UB5 P;  3QP6 A;  3ZQ5 A;  4HES A;  3LIB A;  4Z9Q A;  3GV9 A;  5FDS A;  4C3Q A;  1NRF A;  3BM6 A;  2P74 A;  3QP5 A;  3TW8 A;  2ZQ7 A;  3DW0 A;  2DCF A;  2XFT A;  3V3R A;  4JXG A;  2ZC3 B;  1IYQ A;  2K7S A;  1TS6 A;  2A24 A;  1OME A;  2W0N A;  4WEK A;  3MF0 A;  5HX9 A;  4K91 A;  1FIK A;  2X01 A;  1K56 A;  1OT6 A;  1D7E A;  5A93 A;  2DRW A;  4GNU A;  3C7U A;  1JWP A;  3B42 A;  2VV8 A;  4PKY G;  3CUE A;  2Y2Q A;  2Y79 A;  4C75 A;  2HPB A;  2Y2J A;  2WKE A;  4PM9 A;  2J9O A;  1Q2P A;  1DJC A;  1T1B A;  3LR5 A;  5KIZ A;  1H8M A;  3EQU A;  2K31 A;  3MFX A;  3D3O A;  4OKP A;  3OLO A;  1PNE A;  2PHY A;  1IOU A;  3T1S A;  1WYC A;  3UPN A;  1CF0 A;  5GHX A;  3Q7V A;  3CPT A;  1TS0 A;  1AWI A;  3V39 A;  3N4I A;  3VSK A;  2EWV A;  1OTI A;  4KZ3 A;  4BMW A;  1SDN A;  2Y2K A;  1NY0 A;  4Q0H A;  1J9M A;  5FI6 A;  2QKP A;  1ONH A;  3OBF A;  5DJU A;  5AQ9 A;  4B9O A;  5CER A;  1DJA A;  1K6R A;  4OQI A;  4R6L A;  4FOF A;  3LYX A;  2OV5 A;  4HQA A;  4R4R A;  4ZDX A;  1ERQ A;  3PBO A;  3VP3 A;  1S4S A;  4NG2 A;  1PZP A;  1YSP A;  1RP5 A;  4OVD A;  3VFH A;  2EXB A;  3HRE A;  2XDM A;  2J3T D;  2WZZ A;  2O9A A;  4P6B A;  1S67 L;  2AVX A;  2FH5 A;  4NET A;  3ZVT A;  5M19 A;  3MQO A;  2PAV P;  4E3N A;  1MC0 A;  1KE0 A;  3MMH A;  3IT9 A;  3PBN A;  3MS6 A;  3F1O B;  4NEE D;  2R9W A;  3DAV A;  3IWI A;  2JCH A;  3LID A;  1IEM A;  3WS4 A;  2ZMV A;  4NXE A;  1N4O A;  1ESU A;  4EBN A;  4K0X A;  1S6R A;  2JKF A;  4I38 A;  1ZC2 A;  2ZM0 A;  5F82 A;  1GHI A;  1T19 A;  2B18 A;  4O01 A;  3HL9 A;  4PHT A;  3TSG A;  4LRY C;  5AQB A;  2Y2I A;  3LY3 A;  5A91 A;  3EQV A;  1YMX A;  4ESP A;  4RX2 A;  5DJT A;  1YM1 A;  2EFU A;  2WAE A;  2EXA A;  3GQZ A;  3IS2 B;  1X0O A;  4PM8 A;  4Y0O A;  4S2P A;  5CEB A;  5AQA A;  2Y4A A;  3SS3 A;  1H0M A;  3K3D A;  1TDL A;  4MDZ A;  3N7W A;  1BLS A;  4LFU A;  2J3T C;  3NDG A;  2EWW A;  5JYO A;  5DVA A;  4P87 A;  2EX9 A;  4XXR A;  2BTF P;  4ARZ B;  3U2A A;  1XGI A;  3K2N A;  5EVI D;  3S7Q A;  3HUN A;  1GSX A;  3NOU C;  4S2K A;  3VP4 A;  2OWJ A;  2C6W B;  3MXR A;  4FCF A;  1CQA A;  4D2O A;  3VOL A;  2O9C A;  1G6A A;  4KQO A;  4AFI A;  2E8J A;  4HH2 A;  4QJG A;  3HLW A;  3UB8 A;  5F69 A;  2M7U A;  1K55 C;  3H7W B;  3RFB A;  5KSH A;  3N8S A;  5F1F A;  2W3E A;  1TD5 A;  3O86 A;  4EUZ A;  4WZ5 A;  5TFQ A;  3SH8 A;  2ZC5 B;  4KZ9 A;  1FSW A;  3O5Y A;  4UA7 A;  5CRF A;  2Z6D A;  4LV0 A;  2KOI A;  3HLE A;  4WM9 A;  4DF6 A;  1S0W A;  4E04 A;  3IF6 A;  4OQ0 A;  3KO6 A;  3W4Q A;  5HWV A;  1D1J A;  4L0L A;  3HLD A;  4KZB A;  3PHY A;  4E3I A;  4ZJ2 A;  4GS9 A;  1K54 A;  5EVI C;  2PRF A;  3GSG A;  1L0F A;  3EGD C;  3EOI A;  2H0T A;  1W8Y A;  1FCN A;  3PBT A;  4DXC A;  4KQD A;  4C6Y A;  1H8Y A;  1BZA A;  3CLO A;  2XH9 A;  1ZG6 A;  1W8Q A;  5HAI A;  5DF8 A;  3IH8 A;  3RXX A;  4WMC A;  3HLF A;  1BLP A;  4O7D A;  3IBR A;  1JTG A;  3ZG0 A;  1RGY A;  2HJE A;  5FAS A;  5G18 A;  4QB8 A;  3IWO A;  4KG2 A;  5HDD A;  1TS8 A;  1ZHH B;  3UE1 A;  1OTA A;  2PT7 A;  2PU2 A;  2PYR A;  2BG1 A;  5A8B A;  4XT2 A;  3KSG A;  3HJI A;  3A0R A;  4HI4 A;  1XFN A;  5K5B A;  4OP8 A;  4BBU A;  2A2L A;  4GW9 A;  2XRO A;  1H8Z A;  3UE0 A;  2WAF A;  1CEG A;  1TVF A;  2EFX A;  2W1T B;  4B4Z A;  4DDS A;  2WUQ A;  4HNB A;  5HPF A;  1P0Z A;  4WN5 A;  3IXG A;  3C7V A;  2G2W A;  4P85 A;  5CED A;  3BQA A;  3P09 A;  4HJ4 A;  4MNR A;  1OTE A;  4I39 A;  2WAD A;  3T4S A;  5FDH A;  3ZHH A;  3M2K A;  1SKO B;  1BYW A;  1OJ5 A;  1NJ4 A;  3KYZ A;  3L9K A;  2HP6 A;  1YLT A;  4HY8 A;  3DWK A;  1O7E A;  2Q0O A;  4YWZ A;  1CI9 A;  2DNS A;  1FSY A;  5CGX A;  4R38 A;  1LHY A;  5DKK A;  5EUA A;  2P04 A;  1P9W A;  2XFS A;  4JF6 A;  4CPK A;  3JPU A;  3OPL A;  4WF0 A;  2FZ0 A;  3D4F A;  2Y2H A;  3TRC A;  1K57 C;  3GR2 A;  2JE5 A;  4CQH A;  2O99 A;  3W4P A;  3ZCZ A;  3A3F A;  1UGU A;  2ZQC A;  3K3C A;  2V8F A;  5DKL A;  1C3B A;  2V1Z A;  2Y2L A;  2XRN A;  2Z2L B;  4QHC A;  1DP8 A;  1ZG4 A;  2X02 A;  3BEC A;  4Q0J A;  3ZG9 B;  1CJF A;  4KQR A;  1LT0 A;  4ZAM A;  1KDW A;  3BFE A;  4LV1 A;  1GHM A;  4MN6 A;  1PW8 A;  1YMS A;  4Y13 A;  3MZE A;  3QP1 A;  1XA1 A;  2JHE A;  3OOV A;  1DP6 A;  3BFG A;  2ZC6 B;  4CLC B;  3GTC A;  3T1R A;  4ID4 A;  2EX8 A;  3FZC A;  2ZQ8 A;  5E2E A;  2RL3 A;  3EWK A;  4UA9 A;  5G4Y A;  2GJ3 A;  4OPR A;  3TG9 A;  1VET B;  4FTX A;  1LI0 A;  3ZNT A;  3HBR A;  3R7W B;  4O8G A;  3HLB A;  4WL9 A;  2W3D A;  2XQZ A;  4D60 A;  1FOF A;  1PI4 A;  4ZRR A;  4X56 A;  1FIL A;  3UDF A;  1LL8 A;  1MY8 A;  3ZDJ A;  4GKU A;  4Y5F A;  2XR0 A;  1NZO A;  1PZO A;  4X1M A;  1KOU A;  2OLV A;  3F1P B;  3OCL A;  5GLA A;  4DJ2 A;  3BW6 A;  4R1G A;  2G7U A;  3NOT C;  5EVE A;  5LBR A;  3BFD A;  2IWD A;  2CMN A;  2Y2M A;  1M6K A;  2QWS A;  3HLC A;  3E98 A;  3CUE C;  4O0P A;  5DFX A;  3BLM A;  4H6J B;  2UWX A;  3RTY A; 
#chains in the Genus database with same CATH homology
 1XJ2 A;  1OTI A;  2L0W A;  3SW1 A;  2HGV A;  2QJ5 A;  4BMW A;  1T1C A;  3MJQ A;  4DMZ A;  2NUP C;  2JKT I;  2HV1 A;  4IJG A;  4MCW A;  4Q0H A;  2W27 A;  2GX5 A;  4HP4 A;  2QKP A;  5HD3 A;  3E4O A;  5HPI A;  3F1O A;  3OBF A;  5DJU A;  3VE4 A;  2XA7 S;  4B9O A;  3HCY A;  1XJ3 A;  3H9W A;  5AVE A;  3UB6 A;  4I3A A;  1IFQ A;  4R6L A;  4FOF A;  3FPV A;  1LSV A;  4IUK A;  3LYX A;  4LPZ A;  4HQA A;  4P6Z S;  3UB9 A;  2JKR I;  3IBJ A;  2NUT C;  4ETZ A;  2L1M A;  3GDI A;  5AVF A;  3PBO A;  5TBM B;  3TE8 A;  1TS7 A;  1S4S A;  2BAS A;  2WKP A;  2V9A A;  2VGL M;  1YSP A;  2R78 A;  1N9O A;  2KDK A;  3EEA A;  3PYP A;  2J3T D;  2O9A A;  3LIC A;  5I5L A;  1S67 L;  4NXB A;  2FH5 A;  3FPW A;  3VV4 A;  4L9E A;  3IS2 A;  2WKR A;  1F5M A;  3A0V A;  3MQO A;  3OCN A;  4WLA A;  3S7O A;  3DBA A;  1MC0 A;  3MQQ A;  1NRJ A;  4HOI A;  3MMH A;  3NJA A;  4HIA A;  4F3L A;  3LIA A;  3PBN A;  3F1O B;  4NEE D;  2VV6 A;  3R4K A;  3LID A;  4YNR A;  2ZMV A;  4NXE A;  3C38 A;  2OWH A;  4R3A A;  4G3W A;  4ARZ A;  3KSI A;  1N9N A;  2XSS A;  4LRX C;  2HF6 A;  1F9I A;  4QPR A;  3E0Y A;  1S4R A;  4I38 A;  3EGX C;  3B33 A;  5IS1 A;  3A0S A;  3BY8 A;  1T19 A;  4O01 A;  2B18 A;  1V9Y A;  3JVU A;  1OJG A;  4PHT A;  2D01 A;  5J7E A;  4I5S A;  4LRY C;  4UEY A;  3CWF A;  1W63 M;  2PR5 A;  3EQV A;  5DJT A;  3W2Z A;  3BJN A;  3TJZ C;  3IS2 B;  1X0O A;  4JGP A;  1OPX A;  4OOM A;  2ZBB A;  1TF1 A;  3H7W A;  3V67 A;  4WEJ A;  3K3D A;  4CLC E;  4F3L B;  1UWP X;  1XJ6 A;  4MDZ A;  1S1Y A;  2J3T C;  1WA9 A;  2VKS A;  5J3W A;  2EWW A;  3KSF A;  3KYQ A;  4GHI A;  4BWI A;  5HZH A;  2Y8H A;  4ARZ B;  3U2A A;  1N9L A;  2Z6C A;  3K2N A;  2I9V A;  3S7Q A;  2O9B A;  1GSX A;  3NOU C;  1Y28 A;  2H28 A;  4R70 A;  2OWJ A;  1VB6 A;  3VOL A;  2O9C A;  4KQO A;  4AFI A;  4EU0 A;  2VGL S;  5AJG A;  4HH2 A;  2VX8 A;  5MC7 A;  2MJ6 A;  1T18 A;  1YKD A;  1P9R A;  2JN7 A;  3C8C A;  3UB7 A;  4EQ1 A;  1OT9 A;  5F69 A;  4OOL A;  3UB8 A;  3T4J A;  1XFQ A;  2J80 A;  4ME4 A;  4UQI S;  2M7U A;  3H7W B;  3PR6 A;  2V0U A;  3RFB A;  2VEA A;  5KSH A;  3LR0 A;  3LR3 A;  2W3E A;  3JVV A;  5HSQ A;  1TD5 A;  2W3G A;  4WUJ A;  4GHI B;  3G6O A;  2K2N A;  4HH3 A;  2VLG A;  3GEC A;  3O5Y A;  3LUQ A;  2Z6D A;  1DRM A;  2KOI A;  4EER A;  2GNX A;  1NLZ A;  3HJK A;  2M7V A;  4E04 A;  4IHQ A;  4K08 A;  3KO6 A;  5HWV A;  2HJ9 C;  2VJW A;  2M1C A;  4PAU A;  4BJP A;  2EA9 A;  3LIF A;  4L0L A;  3CAX A;  3PHY A;  3NOP C;  3S7N A;  3CIT A;  1NWZ A;  2B02 A;  4GS9 A;  4JGR A;  1F98 A;  3MXQ A;  4L9G A;  3ICY A;  2GZA A;  3EGD C;  1EW0 A;  3OC2 A;  3BY9 A;  4NXG A;  3EOI A;  4PKY A;  3P01 A;  4G3K A;  4KUO A;  5F6A A;  1YAX A;  3PBT A;  5IU1 A;  2ZMF A;  1LSX A;  2PDR A;  1ZTU A;  2W1T A;  4IUH A;  4KQD A;  2W3H A;  1DP9 A;  1G6O A;  1VHM A;  3CLO A;  1XJ4 A;  1P97 A;  4GJ4 A;  1GSV A;  4YOF A;  3T4L A;  2J3W A;  2XA7 M;  2OOL A;  3IBR A;  4I3J A;  2W3F A;  4KUK A;  2YKH A;  2W1R A;  4LRZ E;  3ZYT A;  2HJE A;  3T50 A;  3RH8 B;  5IT5 A;  4GS9 B;  2V1A A;  4JGQ A;  5HDD A;  1TS8 A;  1ZHH B;  4JGO A;  1OTA A;  2PT7 A;  5A8B A;  2PYR A;  5HWW A;  5F5Y A;  1MKM A;  4XT2 A;  3KSG A;  3ULF A;  3HJI A;  3A0R A;  4HI4 A;  1XFN A;  4HJ3 A;  5K5B A;  4GLQ A;  4BBU A;  2OAP 1;  3LR4 A;  2O0Y A;  2A2L A;  4GW9 A;  2XRO A;  2JKT M;  3UME A;  5G4Z A;  2W1T B;  2QJ7 A;  3H82 A;  2LB5 A;  1ODV A;  4HNB A;  2PYP A;  1P0Z A;  4MN5 A;  5HPF A;  4WN5 A;  4EW7 A;  3UE6 A;  3T4Q A;  2INW A;  2YKF A;  3LIE A;  5FL3 A;  4FSF A;  2JKR M;  1UWN X;  3BQA A;  3T4K A;  3E4P A;  4Z1W A;  3MR0 A;  1G28 A;  4HJ4 A;  3BQ8 A;  5HDS A;  1MZU A;  4EES A;  4B93 A;  1V9Z A;  2PD7 A;  1OTE A;  3MQ0 A;  2LB9 A;  4I39 A;  3D72 A;  1JNU A;  5HDC A;  4XT2 B;  3T4S A;  3PBR A;  3F1N A;  4L9F A;  2IA2 A;  2PD8 A;  1BYW A;  1OJ5 A;  3KYZ A;  1T1A A;  2QHK A;  4HY8 A;  2OAQ 1;  4YWZ A;  1OTB A;  3FC7 A;  2QYB A;  4EEP A;  5TJJ A;  4CLC D;  3PBQ A;  3NHQ A;  4R38 A;  5HL6 A;  3LI9 A;  5DKK A;  2P04 A;  2PR6 A;  1P9W A;  5J4E A;  4G3V A;  5CX7 A;  3C2W A;  3FG8 A;  2VV7 A;  1S66 L;  4DN0 A;  4M4X A;  2DMW A;  4WF0 A;  2FZ0 A;  4MMN A;  5C5K A;  4HJ6 A;  3TRC A;  2V0W A;  5EFW A;  3T4O A;  4CLC A;  4CQH A;  2O99 A;  2VZW A;  3LFV A;  2WKQ A;  4Y2F A;  1YSQ A;  3C30 A;  1UGU A;  4EXO A;  3K3C A;  5DKL A;  4EUV A;  4DJ3 A;  3P7N A;  3F1N B;  3ZQ5 A;  2L4R A;  3LIB A;  2XRN A;  3PXP A;  2V1B A;  3R7W A;  4HHD A;  4BBT A;  3B47 A;  3T4T A;  1DP8 A;  2P7J A;  3VE3 A;  4LLO B;  3TW8 A;  4Q0J A;  1LT0 A;  4UQI M;  5HWT A;  1W63 Q;  4EEU A;  2ZOH A;  3S7P A;  2K7S A;  1LSW A;  2P08 A;  3F1P A;  4MN6 A;  1TS6 A;  2A24 A;  2W0N A;  4WEK A;  4BBV A;  3EEH A;  3MF0 A;  1GSW A;  5DFY A;  2JHE A;  3OOV A;  1DP6 A;  4CLC B;  4P6Z M;  1OT6 A;  1D7E A;  4CLC C;  1S1Z A;  4Q0I A;  3EWK A;  5G4Y A;  2GJ3 A;  1H3Q A;  1NLY A;  4II7 A;  5HD5 A;  3B42 A;  3R7W B;  2VV8 A;  4O8G A;  4PKY G;  3CUE A;  3KSH A;  2Y79 A;  4WL9 A;  2W3D A;  4NXF A;  3BWL A;  4H6J A;  1STZ A;  4ETX A;  4ZRR A;  5L8M A;  3KX0 X;  1T1B A;  2KX6 A;  3LR5 A;  4HP9 A;  4MN7 A;  1LL8 A;  4Y5F A;  5KIZ A;  1KOU A;  1H8M A;  3F1P B;  3OCL A;  2A24 B;  3EQU A;  2K31 A;  1OTD A;  4DJ2 A;  3BW6 A;  4EET B;  5F68 A;  3MFX A;  3PBS A;  4I3I A;  3UMD A;  3D3O A;  2G7U A;  3NOT C;  5LBR A;  3OLO A;  5DF9 A;  2CMN A;  2KLI A;  2PHY A;  2D02 A;  4WEL A;  1IOU A;  4Y3I A;  2ZOI A;  4NKP A;  2VA0 A;  5TBM A;  3LI8 A;  2QWS A;  4GCZ A;  3E98 A;  1D06 A;  3CUE C;  3E4Q A;  1TS0 A;  4O0P A;  5DFX A;  4H6J B;  3CI6 A;  3H82 B;  4RQ9 A;  3RTY A;  3UE3 A;  2EWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...