2Y79A

Structure of the first gaf domain e87a mutant of mycobacterium tuberculosis doss
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
GAMDPDLEATLRAIVHSATSLVDARYGAMAVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRVRDESFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAVANARLYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REDOX SENSOR HISTIDINE KINASE RESPONSE REGULATOR DEVS
publication title Blockage of the Channel to Heme by the E87 Side Chain in the Gaf Domain of Mycobacterium Tuberculosis Doss Confers the Unique Sensitivity of Doss to Oxygen.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 34
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2y79A00
2M7UA 3BJNA 2OOLA 2W1TA 2VZWA 4O01A 2W3EA 2XROA 3CI6A 3KO6A 4ETXA 3NOPC 5TJJA 2VKSA 2O9CA 2LB5A 4Z1WA 3LFVA 4Y2FA 3TRCA 4Q0IA 1TF1A 5LBRA 4YOFA 3RFBA 3KSGA 1STZA 2KOIA 3HCYA 4GLQA 1ZTUA 2VEAA 2GX5A 4MDZA 1YKDA 4O0PA 2W3GA 2O9AA 5HL6A 3E98A 3OOVA 3G6OA 4Q0HA 3NOTC 2KLIA 5HPFA 3MF0A 3OBFA 4G3WA 4QPRA 4EU0A 1YSPA 5DFYA 3NOUC 2O99A 4G3VA 4MMNA 4EUVA 3IBJA 3MQ0A 3VV4A 2QYBA 2B18A 5I5LA 2O0YA 4MN7A 2ZMFA 1F5MA 3O5YA 4ETZA 5AJGA 2Y8HA 3S7NA 3EEAA 4MCWA 4Y5FA 4ME4A 4O8GA 3IBRA 3S7PA 3KSFA 2Y79A 3KSIA 5HPIA 2XRNA 3R4KA 1VHMA 3S7QA 3MMHA 2VJWA 1YSQA 4R6LA 4IUKA 4G3KA 4LRYC 3NHQA 2IA2A 4PAUA 2LB9A 2M7VA 3W2ZA 3ZQ5A 4DMZA 1TD5A 3E0YA 4FOFA 5HSQA 3D3OA 4Y3IA 5L8MA 3K2NA 3C2WA 4LRZE 2W3DA 5K5BA 3DBAA 3CITA 3S7OA 5DFXA 2W3FA 2XSSA 4DN0A 4RQ9A 2O9BA 4E04A 2W3HA 1MKMA 4Q0JA 4YNRA 4R70A 1MC0A 2W1RA 4GW9A 4IUHA 2HGVA 5C5KA 4ZRRA 2K2NA 2G7UA 4CQHA 4IJGA 2W1TB 4LRXC 2K31A 4BWIA 3KSHA
chains in the Genus database with same CATH superfamily
4CLCB 3VE3A 2AVXA 2JCHA 3EGDC 1E25A 1XJ6A 1ZHHB 2W3EA 3PBSA 2JBFA 4OOLA 5EECA 4WELA 5FATA 1WYCA 1PYYA 1FR1A 4S2NA 2H10A 4K0WA 5TBMA 3L9KA 3M2KA 3HREA 3K3CA 2ZJ9A 5CECA 4GB7A 4S2LA 4MEZA 4QD4A 3NOTC 4GDBA 1PI5A 5HPFA 4EQ1A 3MF0A 5CHUA 2WZZA 1FQGA 5FL3A 1YLJA 5HX9A 3NDEA 2DMWA 4PM5A 4EESA 4QWOA 3S7NA 3FC7A 4K08A 2VA0A 3A0VA 2NUTC 2ZM0A 1FOFA 4X25A 4JGPA 3BWLA 2PBYA 3HUMA 2XF3A 5CRFA 2Z2MB 4E3NA 2EWWA 1ODVA 1RP5A 1XA7A 3G32A 1BZAA 4WEKA 5M19A 4FUWA 5FI2A 5L8MA 4CLCD 4LGWA 2W3DA 1ZC2A 1D1JA 3DTIA 2XSSA 1QMEA 2E8IA 1L0FA 5IS1A 4HH3A 5F82A 5GHXA 5EVEA 1S67L 1PW8A 5EFWA 3HBRA 1DP6A 1IYQA 1QMFA 2J80A 3ZG9B 2A49A 3DTKA 4OLGA 3NI9A 3TE8A 1TF1A 4YOFA 4JGRA 2PAVP 2VEAA 1HLUP 3BW6A 2O9AA 3LR3A 4OH0A 4BBUA 1YLPA 5FASA 2KDKA 4HIAA 3UB6A 3MR0A 2R78A 1FIKA 3DAVA 2VX8A 4WMCA 4GNUA 5L07A 4YINA 3S4XA 4WLAA 3ZG8B 1OTAA 4DF6A 4ME4A 3S7PA 1OTBA 2PDRA 3G2YA 2NUPC 3T4KA 2VJWA 1D7EA 2A2LA 1JTDA 1PWDA 4HH2A 1XGIA 3ITAA 2PU2A 5HSQA 2IWDA 2A3UA 4UHUA 1OMEA 1JNUA 3DTMA 4P6BA 3BFGA 4C75A 3LY3A 1K38A 1ZG6A 4C6YA 2XLNA 4IJGA 3E2KA 3LUQA 4KZ3A 4LV3A 3IWIA 5FDSA 3IS2B 1HD8A 3HLGA 2ZLYA 4ARZA 1IYSA 2JKFA 4ZBEA 4IBXA 4PMAA 3FZCA 4BD1A 1ESIA 5DVAA 4QY5A 4JLFA 5FQIA 3CMZA 1GSXA 1YLTA 1KVMA 4MBKA 3MKFA 3G6OA 3GSGA 4EBNA 2ZC4B 4KZ9A 1MXOA 4P6ZM 5G18A 3MFXA 5I94A 4WZ4A 2OWJA 3Q07A 1H8MA 3UE6A 5MC7A 3R7WB 3BQ8A 4RX2A 1G6AA 2PYRA 1F5MA 4KZ7A 2XFTA 2HDRA 1F2KA 3Q7VA 1JWPA 4MCWA 3IWOA 2C6WB 2PBDP 3LICA 5FI6A 4NXBA 4P85A 4WUJA 3NC8A 4JGOA 4LRYC 3W4OA 4MBFA 2ZM2A 2JKGA 4LV2A 2EWVA 3F1OA 4HI4A 4WM9A 1RGYA 2RL3A 3BQAA 3Q81A 2OAQ1 3LR4A 1BSGA 1ERMA 2VV7A 4EW7A 2Y2LA 2HF6A 3IXGA 3IT9A 3HLCA 4DE0A 4BBVA 1XJ2A 3LR5A 1S0WA 5EM1A 5CTMA 5EOEA 4P6ZS 5L09A 1P0ZA 2VZWA 3E4PA 5DTTA 2J8YA 3LI9A 5DTSA 4II7A 5FAQA 4ETXA 3NOPC 1NRFA 1OTIA 1NXYA 1ZTUA 3BECA 4OQIA 4CLCC 3VSLA 4JGQA 3MXQA 3P09A 2ZMAA 1Q2QA 4HJ4A 3BLSA 1T19A 3P01A 4RX3A 3W4PA 5HDDA 4OPZA 3H82B 2B18A 1ACFA 3P98A 3TOIA 5JYPA 2XH9A 1IFQA 3TSGA 4I3IA 4B9OA 4NXGA 5GHZA 3EQUA 3KSFA 1BT5A 4N9KA 4BL3A 3GRJA 3VFFA 3S7QA 3T4SA 2G2WA 3SS3A 1CI9A 1TVFA 5HFOA 3PAEA 1KE0A 4BLMA 4DXBA 2WK0A 4FOFA 4EBLA 4H6JB 3K2NA 1PZOA 3N8LA 2XGNA 2Y2QA 3DBAA 4X1LA 1OT9A 2I9VA 4E6XA 1U60A 5CTNA 4DN0A 2I72A 2XD5A 2PU4A 4IBRA 4I3AA 1MKMA 2CC1A 4KZ5A 4U3TA 1SHVA 3UB5P 2W1RA 4LPZA 4LCMA 1SZVA 4CQHA 3UPNA 2H5SA 5DF8A 5DJTA 1FSWA 2DCFA 5FEGA 3PXPA 1Y4OA 1CJFA 3CI6A 1ONHA 5EVIA 5FEFA 5AQAA 4IHQA 2Y2JA 4Z1WA 2EFXA 1GHMA 4JF4A 2Z2LB 3VE4A 4E3IA 3KYEA 1S6RA 3ULFA 3IH9A 3VMAA 1SKOA 2WGWB 1XPBA 5HWWA 5IT5A 5AQ7A 4RA7A 4GCZA 1N9NA 2KLIA 4ZJ3A 5CERA 1J3WA 3OBFA 3NOUC 2HPBA 3IXDA 4OPYA 2QYBA 3IF6C 4AFIA 2O0YA 3PBOA 2X02A 1OPXA 2V9AA 1ZKJA 3HLDA 5A91A 1JWVA 1ES5A 3DWZA 5G4YA 3T1QB 2J3WA 1VHMA 4OP8A 2JN7A 1SCWA 2P9VA 4KZ4A 4LENA 2ZQ7A 1I2SA 1CF0A 4OKPA 1YAXA 3PTEA 1GCEA 3U2AA 1MWRA 4WBGA 1TDLA 4DMZA 4OP5A 4XT2B 5EVLA 3HVFA 3UMEA 3NECA 3MXSA 1P97A 2V1ZA 1O07A 4FCFA 3S22A 3N8RA 1LL9A 3T1SA 2BLSA 2L1MA 5DJUA 4Y0OA 3UY6A 3D72A 5HD3A 3UNWA 3C30A 4BWIA 1W63Q 5G4ZA 2M7UA 3QP2A 3LR0A 1JVJA 3O88A 2FFYA 2H0TA 3GR2A 5GLAA 5TBMB 5HWTA 4MDZA 2J9OA 1KGGA 3QNBA 1GSWA 3WS5A 3G2ZA 3DW0A 4Q0HA 2WUQA 4GOGA 3W8KA 5IHVA 1LL5A 4R38A 4I5SA 3D9YA 3T1XA 3CWFA 4QY6A 4M4XA 4NK3A 3B33A 3CG5A 4X55A 2FFFB 2D01A 1VQQA 2B5RA 3EGXC 4O8GA 2ACGA 5F5YA 4U0TA 4WZ5C 1MPLA 4JKTA 2W0NA 4ZJ2A 3HUOA 3T4LA 2VK3A 5E2GA 2BG1A 5FSRA 2M7VA 1IKIA 3LI8A 4HNBA 4EWFA 1JWZA 1YQSA 3ZNYA 2Y2PA 2P74A 5HL1A 5KIZA 5JYOA 3FPWA 1CEGA 4GDNA 3GECA 4CLCA 4LV0A 2Z6DA 4S2KA 3QP4A 4K91A 1W79A 4H8RA 2FZ0A 4I39A 1YLZA 2OAP1 2V2FF 2RCXA 4FTXA 2HDQA 2HGVA 2HP5A 3PYPA 2K2NA 3GV9A 5CHJA 3VP2A 1VEUB 4HESA 1TS6A 3C38A 5A93A 3F1PA 4DRTA 3UPPA 1XJ3A 3H9WA 2PYPA 3TW8A 2QZ6A 4FD8A 1RCJA 3ZHHA 2XR0A 1P9WA 5GLCA 2OWHA 1XGJA 2PHYA 2PRFA 2M1CA 3F1NA 3NJAA 2WZXA 1K57A 3B47A 2Q9NA 5A8BA 3JVVA 4L9FA 3GQZA 1L3LA 1W8YA 4Y0UA 5F1GA 1NWZA 4Y13A 3QP8A 4PM9A 1NZOA 1DJBA 5HDSA 4P87A 2J3TD 4U0XA 1WA9A 1BYWA 1E4DA 3BFFA 3BEBA 5DKLA 4UAAA 3KSIA 1WYBA 3LGOA 1E3UD 1T1BA 1M6KA 1OTEA 2BASA 3VP1A 4IVIA 5F68A 1ES4A 2Q9MA 4E3OA 2WYXA 1LLBA 2E8JA 1UWNX 2G2UA 3ICYA 4CJNA 1K56D 3NCKA 2GJ3A 4BQMA 2QKPA 2WKQA 5FAOA 1PZPA 2B95A 2Y2NA 1SDEA 3V50A 3AGEA 2KX6A 2W3FA 4KQRA 4MBHA 4E04A 2JKRM 2V1BA 1DP9A 3BFDA 5J4EA 2XQZA 2HZ5A 3WS0A 1I2WA 3IF6A 2JE5A 4ARZB 5HDCA 4DDSA 2WAEA 1X0OA 1ES3A 1LI0A 4JXVA 4DJ3A 3UE3A 4F3LA 2LB5A 5TFQA 5EV0A 1MZUA 3TRCA 4Q0IA 1IKGA 1STZA 2KOIA 5DF9A 4M3KA 1FCMA 4L9EA 1KGEA 3ZDJA 1K4EA 2W3GA 3GTCA 5EM0A 3AGDA 5F6AA 4R23A 3NY4A 4X6TA 2ZQ9A 4EV4A 5EPHA 4E3KA 4X56A 3BRMA 1PNEA 3A3DA 5AQ9A 4FSFA 3Q7VB 3VV4A 1KDSA 4MN7A 4QHCA 3O5YA 5M18A 5KSHA 1ESUA 4OQHA 1XJ4A 3LYXA 1AWIA 3HL9A 4EEPA 1LSVA 4OPQA 3VOLA 3KYZA 3NULA 1XX2A 3F1OB 4LV1A 3SH7A 4S2MA 2Y2IA 5HW3A 1F98A 3PHYA 1NLZA 3C2WA 4KG2A 2VV6A 1KVLA 1T1AA 2ZC6B 3FYZA 5DFXA 2WKHA 1GHIA 3VOZA 3MFDA 3OC2A 1UGUA 3Q7ZA 4PPRA 4MLLA 3IH8A 2A24A 2EXAA 4OLDA 3FV7A 1TEMA 2W27A 1H3QA 1K6SA 1BTLA 4NKPA 3H7WB 4S2PA 1DJCA 4RVAA 2HP6A 4NG2A 2OLUA 1HTZA 1J9MA 3Q1FA 4JF6A 3CUEC 2C5WB 2OOLA 4EEUA 3WRTA 3G31A 1K0KA 3HLFA 2WGIA 1S4RA 2V20A 1YM1A 4ID4A 2Q0OA 1YT4A 3RTYA 4B93A 1T18A 2CMNA 3G34A 4MN6A 5GLBA 4DE1A 3BFCA 3V67A 1ZG4A 4QPRA 4X69A 1NZUA 5HAIA 1XKZA 4N92A 2VGLM 5CXWA 4S2NC 4R4SA 3U4LP 3CPTA 2JKRI 4HQAA 3UB8A 3IXHA 4A5RA 4EETB 4NXEA 1FR6A 1PRQA 4QJGA 5HZHA 3ZNTA 4E3LA 3HLBA 4EQIA 2WGVA 4X1MA 3NHQA 4B4XA 2X71A 1ONGA 3N6IA 3RXXA 5J8XA 5CEBA 4JXWA 1TD5A 5GLDA 4OVDA 3C7UA 3S7OA 1H5XA 1SDNA 2ZD8A 3IX4A 1ERQA 2UV0E 3UO9A 1FCNA 4D2OA 2OLVA 3MS6A 2J3TC 1TS7A 3PAGA 3IX8A 3HUNA 4UA7A 3KX0X 5TR7A 2VGLS 5EVIB 1KE4A 1YMSA 4FH2A 2QPNA 3CJMA 2Y2OA 5A92A 4NEED 5LBRA 5DTKA 4E6WA 1XFQA 2Y55A 4KQOA 2L4RA 3PBRA 4Y7PA 3VFHA 4ZDXA 3EQVA 4KQQA 3OOVA 2J9PA 4HY8A 5L10A 3BFEA 4X53A 1P9RA 3UDIA 1UWPX 1K54C 3HJKA 4OOMA 3ZG5A 2EFUA 3DWKA 3EWKA 3TG9A 4Y0TA 3FWLA 5F83A 3UE1A 1YLYA 2P9VB 4N1HA 4BD0A 5CEDA 2XRNA 3BM6A 5IU1A 5J7EA 1FILA 1S66L 4EERA 4D60A 2JC7A 4N1XA 3UDFA 4G3KA 1OT6A 3VP0A 1NJ4A 1VETA 4PAUA 2LB9A 1PIOA 1G5UA 1NYMA 2ZL1B 3ZQ5A 3M6BA 5HAPA 2PT7A 3E0YA 4Y3IA 1PFLA 3OCLA 2PD7A 3CITA 3OPPA 1HVBA 3A0RA 3T4OA 3JVUA 4GHIA 2DRWA 1VM1A 2XEPA 4Q0JA 2UWXA 5HAQA 1MC0A 3OZHA 1XXMA 3BYDA 4KUKA 3CZDA 2Y2HA 2Y2MA 5FI7A 3SZTA 4R4RA 4BL2A 3G35A 1BLCA 4UA9A 1XFNA 3QP1A 3PR6A 4ZJ1A 2ZQCA 2OSUA 2W1TA 1NRJA 2XA7M 4JXGA 2WGWA 3VSKA 4MNRA 3MSHA 3LIDA 5TGFA 1OTDA 1W5DA 1NLYA 4HJ3A 1L0GA 3A3FA 5AVFA 3LEZA 4S2IA 5EOOA 2EA9A 2GNXA 4R3AA 4I3JA 1KE3A 1W63M 3ZGAB 3UB9A 4Z9QA 2O99A 4GZBA 1AXBA 5BOHA 1W7FA 4S2OA 3L7HA 1V9YA 5M1AA 2YKFA 1CK3A 3T4JA 1KDWA 3MJQA 3G30A 4KQDA 2Y79A 1BLSA 3AGFA 3R4KA 3NDGA 1YSQA 1Z6FA 2ZMVA 3UB7A 1DRMA 2WKEA 3ZFZA 1LSXA 3N8SA 5E2EA 1IOUA 5HD5A 2XA7S 4GS9A 4XXRA 3UMDA 3A0SA 2PR5A 2Y2KA 3D3OA 4BENA 4XUXA 3FG8A 5K5BA 3EEHA 1M40A 4RQ9A 2L0WA 2O9BA 2WAFA 3M2JA 4IVKA 3V3SA 3DTEA 1PWGA 1TDGA 2B02A 3LEQA 2Y59A 4QB8A 1NYYA 1G6OA 5C5KA 4PM6A 1FSYA 3F1PB 2MJ6A 1G68A 4KENB 3MZFA 3SH9A 4IEDA 4LFUA 2XROA 1KOUA 5TJJA 4BBTA 2VKSA 3CLOA 3F1NB 5L2FA 3LFVA 2VGJA 2Y4AA 4Y17A 3KSGA 3T4QA 3HCYA 4GD8A 2D02A 4GLQA 4KG5A 5FDHA 1IYOA 2QMIA 5FQQA 3E4QA 5FA7A 3CAXA 3K3DA 4N9LA 5HWVA 4BMWA 1BLPA 5HL6A 2P7JA 2VV8A 2IWBA 5AVEA 2K7SA 1Z09A 5D3OA 4P0MA 2OV5A 4X68A 4G3WA 2ZC3B 4HP9A 3A3JA 4G3VA 4MMNA 4KZBA 4HBTA 3G4PA 2HJEA 5I5LA 3UN7A 3IF5A 2ZMFA 3EOIA 3IHAA 3ZYTA 1DJAA 1IYPA 3WS4A 3EEAA 1ALQA 1OJGA 2Y91A 4EUZA 2ZQAA 4KG6A 4QU3A 3TJZC 4HJ6A 1GA9A 3OPRA 1E3UA 2V8FA 3LIEA 3T1RA 2PD8A 1MKIA 2H0YA 2HP9A 2V1AA 1O7EA 3LY4A 2EX6A 4L0LA 1K56A 1MWTA 4LRZE 1VEUA 1ES2A 4C3QA 5DKKA 3FKWA 2W3HA 2GDNA 5FQJA 4DXCA 3A3IA 1CI8A 4R1GA 1XP4A 5AQBA 3IF6B 3WWXA 1YLWA 1K54A 3MZEA 1MY8A 3PBQA 3MBZA 2K31A 2JKTM 2V0WA 3KYQA 3QP6A 4B88A 5KZHA 2HDSA 4F3LB 1PW1A 3NBLA 3MKEA 3ZVTA 2DNSA 3KO6A 3P7NA 3WS2A 4DJ2A 5FQKA 4S2JA 3IXBA 3VOYA 1CQAA 4ZTKA 3VP4A 4KUOA 4DE3A 3FKVA 3PBNA 4GKUA 2YKHA 1NY0A 3E98A 3RJUA 5EVIC 1S4SA 4MN5A 2GZAA 3OLOA 2HJ9C 4WN5A 4OOYA 4WMCD 3JYIA 2J7VA 3N7WA 1DY6A 1T1CA 2ZM8A 5AJGA 1TS8A 2WKPA 4L9GA 4Y5FA 5DF7A 3V39A 2XFSA 2ZBBA 4NXFA 1YMXA 3UPOA 3MMHA 3RXWA 2R9WA 1OJ5A 4KZ8A 1YPRA 5FQMA 1IELA 3MZDA 4CPKA 1GSVA 4HEFA 4KZAA 2A24B 3SS5A 3SW1A 1PI4A 3OPLA 1Q2PA 5E2FA 4GD6A 3C4PA 4RYEA 2R9XA 4HBUA 3MQQA 1K55C 1N4OA 5CGXA 4XUZA 1S1YA 3IWQA 3RH8B 3QHYA 3T50A 5F1FA 3IS2A 5GL9A 3B42A 1N9LA 4Y2FA 5EE8A 3ISGA 3RFBA 3C5AA 3CHWP 3NIAA 4WYYA 3ITBA 4PM7A 3A3EA 1TS0A 1GA0A 3LCEA 1YSPA 1I5QA 4WZ5A 2XD1A 2P08A 1N9BA 1IEMA 3CPTB 3IBJA 3MQ0A 4ETZA 3O3VA 3OCNA 3R7WA 2Y8HA 3GVBA 2FH5A 3D4FA 1BULA 3ZVWA 4E3JA 1DP8A 1G28A 3C7VA 5HPIA 4OQ0A 4PKYA 3IX3A 2JKTI 4R6LA 3T4TA 4UQIM 3W2ZA 1H8ZA 3H7WA 5FAPA 3SS4A 3C4OA 2HDUA 1FCOA 3ZCZA 1H0MA 4FH4A 4HHDA 3W4QA 1K4FA 4R70A 2X01A 4NETA 4YWZA 2WADA 1D06A 4LCLA 1H8YA 4Q8IA 1S1ZA 3UDXA 4JXSA 3V5MA 4GJ4A 2H28A 5CGWA 2HV1A 1SKFA 3IHBA 4R3JA 2PR6A 1LSWA 1W8QA 4R3BA 3WRZA 3HLEA 3LO7A 5KSCA 4UEYA 2Z6CA 3IQAA 4JF5A 4O0PA 1MBLA 1GHPA 1EROA 4UQIS 1Y28A 1K6RA 3LIFA 1K25A 1CEFA 3LIBA 2ZOHA 5J3WA 1EWZA 2V0UA 4KZ6A 3BLMA 5DFYA 1K57C 1VB6A 2EX2A 3ZG0A 3VP3A 2QJ7A 4DDYA 1SKOB 3H82A 5A90A 4OONA 5CX7A 3SH8A 4OPRA 3I7JA 2ZQ8A 1A0KA 1VETB 3E2LA 4IUKA 4K0XA 5KMWA 4EBPA 4WF0A 1EW0A 2IA2A 4CLCE 2QJ5A 3T12B 1EI5A 4EXOA 4B4ZA 1LT0A 4DE2A 4WEJA 1XA1A 4HOIA 3QNCA 5EUAA 4GHIB 3GMWA 2ZQDA 2V8CA 4PM8A 3ZG7B 4HP4A 2EX8A 3FPVA 4H6JA 3O86A 2QHKA 1JTGA 4JBFA 3E4OA 4ZAMA 3C8CA 4GW9A 4LLOB 4O7DA 5F69A 4ZRRA 2W1TB 3HJIA 2G7UA 3KSHA 3BY8A 2BTFP 2ZOIA 3BJNA 3PBTA 4ESPA 4O01A 5EVID 3Q82A 2JHEA 2O9CA 4GN2A 5GHYA 4R0QA 4OQGA 2GX5A 2WKIA 2EX9A 3B3XA 1YKDA 3GDIA 2INWA 5CGSA 3WS1A 3HLWA 1HZOA 3N4IA 5CHMA 2VGKA 4EU0A 3M6HA 3JPUA 4EUVA 2EXBA 2IWCA 4Y15A 1LL8A 5E2HA 1F9IA 4E3MA 4YFMA 4JPMA 1LI9A 2P04A 4PHTA 3OPHA 2QWSA 5U47A 4F94A 2ZL1A 3QP5A 1WE4A 1RGZA 1K55A 3IBRA 3S1YA 2ZC7A 2ZC5B 1LHYA 5HARA 1KGFA 5FQ9A 4GS9B 2Y2GA 1MWSA 1V9ZA 1L2SA 1C3BA 3SOIA 4DKIA 1MWUA 4UA6A 3MQOA 3V3RA 2VLGA 4PKYG 1L0EA 3CUEA 4XT2A 4I38A 3LIAA 1N9OA 4WL9A 1L0DA 4YNRA 1Y54A 1BUEA 5E43A 1BLHA 3BY9A 2XK1A 3O87A 4IUHA 3UE0A 3MXRA 2WKRA 4BJPA 1PWCA 2XDMA 4LRXC
chains in the Genus database with same CATH topology
4CLCB 5DJTA 3VE3A 3PXPA 2OOLA 3EGDC 4F3LB 4EEUA 1XJ6A 1ZHHB 2W3EA 3PBSA 4OOLA 3CI6A 3KO6A 3P7NA 4DJ2A 1S4RA 4IHQA 4Z1WA 4WELA 3VE4A 3RTYA 4KUOA 4B93A 1T18A 3PBNA 3ULFA 2CMNA 2YKHA 5TBMA 4MN6A 3K3CA 3E98A 5HWWA 5IT5A 1S4SA 4GCZA 1N9NA 3NOTC 4MN5A 2KLIA 3V67A 5HPFA 2GZAA 3OLOA 4EQ1A 3MF0A 3OBFA 4QPRA 2HJ9C 4WN5A 2VGLM 5FL3A 3NOUC 2QYBA 4AFIA 2O0YA 2DMWA 3PBOA 1T1CA 2JKRI 4HQAA 5AJGA 4EESA 1OPXA 3UB8A 3S7NA 1TS8A 2WKPA 2V9AA 4L9GA 4Y5FA 4EETB 3FC7A 4K08A 2VA0A 3A0VA 2NUTC 2ZBBA 4NXFA 5G4YA 4JGPA 4NXEA 2J3WA 1VHMA 3BWLA 5HZHA 3MMHA 2JN7A 3NHQA 2EWWA 1OJ5A 1YAXA 1ODVA 3U2AA 4DMZA 4WEKA 1TD5A 4XT2B 5L8MA 4CLCD 1GSVA 2W3DA 2A24B 3UMEA 3S7OA 2XSSA 1P97A 3SW1A 5IS1A 4HH3A 2L1MA 5DJUA 3D72A 1S67L 5HD3A 2J3TC 1TS7A 5EFWA 3MQQA 3C30A 4BWIA 1DP6A 1W63Q 5G4ZA 2M7UA 3KX0X 2VGLS 2J80A 1S1YA 3RH8B 3LR0A 3T50A 3IS2A 3B42A 1N9LA 3TE8A 4Y2FA 1TF1A 4NEED 5LBRA 4YOFA 3RFBA 5TBMB 4JGRA 1XFQA 2VEAA 5HWTA 4KQOA 4MDZA 2L4RA 3PBRA 1GSWA 3BW6A 2O9AA 3EQVA 3LR3A 4BBUA 3OOVA 4HY8A 4Q0HA 1TS0A 1P9RA 4R38A 2KDKA 1UWPX 4HIAA 1YSPA 4I5SA 3UB6A 3HJKA 2P08A 3MR0A 4OOMA 3IBJA 3CWFA 4M4XA 2R78A 3MQ0A 3B33A 3EWKA 2VX8A 4ETZA 3OCNA 2D01A 3R7WA 2Y8HA 2FH5A 4WLAA 3EGXC 1OTAA 4ME4A 4O8GA 3S7PA 1OTBA 1DP8A 2PDRA 1G28A 5F5YA 5HPIA 2NUPC 2XRNA 4PKYA 5IU1A 3T4KA 2W0NA 5J7EA 1S66L 2VJWA 2JKTI 4R6LA 4EERA 4G3KA 3T4TA 1D7EA 1OT6A 3T4LA 4UQIM 2A2LA 4PAUA 2LB9A 2M7VA 3LI8A 4HNBA 4HH2A 3W2ZA 3ZQ5A 3H7WA 2PT7A 3E0YA 5HSQA 4Y3IA 5KIZA 3OCLA 3FPWA 2PD7A 3CITA 3A0RA 3GECA 4HHDA 4CLCA 2Z6DA 3T4OA 3JVUA 1JNUA 4GHIA 4Q0JA 2FZ0A 4I39A 4R70A 1MC0A 2OAP1 4YWZA 4KUKA 1D06A 2HGVA 3PYPA 1S1ZA 2K2NA 1XFNA 4IJGA 3PR6A 4GJ4A 2H28A 3LUQA 2HV1A 1TS6A 3C38A 3IS2B 3F1PA 2W1TA 1NRJA 2XA7M 1XJ3A 3H9WA 2PR6A 1LSWA 2PYPA 4ARZA 3TW8A 3LIDA 1P9WA 4UEYA 2OWHA 2PHYA 1OTDA 2Z6CA 2M1CA 3F1NA 3NJAA 1NLYA 4HJ3A 3B47A 5AVFA 3JVVA 4L9FA 4O0PA 5A8BA 1GSXA 2EA9A 2GNXA 4R3AA 1Y28A 4UQIS 3G6OA 3LIFA 4I3JA 1NWZA 3LIBA 1W63M 2ZOHA 5J3WA 2V0UA 4P6ZM 3UB9A 3MFXA 5DFYA 2O99A 2OWJA 1H8MA 3UE6A 1VB6A 5MC7A 5HDSA 3R7WB 3BQ8A 2J3TD 1V9YA 2QJ7A 2YKFA 3T4JA 1WA9A 2PYRA 1F5MA 1BYWA 3MJQA 3H82A 4MCWA 5DKLA 4KQDA 5CX7A 3LICA 2Y79A 3KSIA 3R4KA 1T1BA 4NXBA 1YSQA 1OTEA 2BASA 4IUKA 4WUJA 2ZMVA 3UB7A 4JGOA 1DRMA 4LRYC 1EW0A 4WF0A 5F68A 2IA2A 4CLCE 2QJ5A 4EXOA 1LT0A 1UWNX 3ICYA 1LSXA 1IOUA 5HD5A 4WEJA 2XA7S 4HOIA 4GS9A 2EWVA 3UMDA 2GJ3A 3A0SA 3F1OA 4HI4A 2QKPA 2PR5A 3D3OA 2WKQA 3BQAA 4GHIB 3FG8A 5K5BA 2OAQ1 3LR4A 3EEHA 2KX6A 2VV7A 4EW7A 2W3FA 2HF6A 4HP4A 3FPVA 4H6JA 2L0WA 2O9BA 4RQ9A 4E04A 2JKRM 2QHKA 2V1BA 3E4OA 4BBVA 1DP9A 2B02A 3C8CA 4GW9A 4LLOB 1G6OA 1XJ2A 5F69A 5J4EA 5C5KA 3LR5A 4ZRRA 3F1PB 2W1TB 2MJ6A 3HJIA 3KSHA 2G7UA 4P6ZS 4ARZB 5HDCA 3BY8A 1P0ZA 2ZOIA 3BJNA 3PBTA 2VZWA 3E4PA 4O01A 3LI9A 1X0OA 4II7A 2XROA 1KOUA 2JHEA 4DJ3A 4ETXA 3NOPC 5TJJA 4BBTA 2VKSA 2O9CA 3UE3A 4F3LA 3CLOA 2LB5A 3F1NB 3LFVA 1MZUA 1OTIA 3TRCA 4Q0IA 3KSGA 3T4QA 1STZA 2KOIA 3HCYA 5DF9A 2D02A 4GLQA 1ZTUA 2GX5A 4L9EA 3E4QA 3CAXA 3K3DA 5HWVA 4BMWA 1YKDA 2W3GA 5HL6A 2P7JA 2VV8A 3GDIA 4CLCC 4JGQA 3MXQA 2INWA 5AVEA 5F6AA 2K7SA 4HJ4A 1T19A 3P01A 4G3WA 4EU0A 4HP9A 4G3VA 4MMNA 4EUVA 5HDDA 4FSFA 1LL8A 3VV4A 1F9IA 3H82B 2HJEA 2B18A 5I5LA 2P04A 4MN7A 2ZMFA 4PHTA 3EOIA 3O5YA 3ZYTA 1IFQA 2QWSA 4I3IA 5KSHA 4B9OA 4NXGA 3EEAA 1OJGA 3EQUA 3IBRA 3KSFA 1XJ4A 3LYXA 4EEPA 1LSVA 3S7QA 3T4SA 3VOLA 3TJZC 3KYZA 4HJ6A 3LIEA 4GS9B 3F1OB 2PD8A 1V9ZA 2V1AA 4FOFA 1F98A 3PHYA 4L0LA 1NLZA 4H6JB 3K2NA 3C2WA 3MQOA 2VV6A 4LRZE 1T1AA 3DBAA 2VLGA 4PKYG 1OT9A 5DFXA 2I9VA 3OC2A 1UGUA 3CUEA 4XT2A 4I38A 4DN0A 5DKKA 2A24A 3LIAA 4I3AA 1N9OA 1MKMA 2W3HA 4WL9A 4YNRA 2W27A 1H3QA 2W1RA 4LPZA 4NKPA 3H7WB 3BY9A 4IUHA 2WKRA 4BJPA 4CQHA 3PBQA 4LRXC 2K31A 2JKTM 2V0WA 3KYQA 3CUEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M7U A;  3BJN A;  2OOL A;  2W1T A;  2VZW A;  4O01 A;  2W3E A;  2XRO A;  3CI6 A;  3KO6 A;  4ETX A;  3NOP C;  5TJJ A;  2VKS A;  2O9C A;  2LB5 A;  4Z1W A;  3LFV A;  4Y2F A;  3TRC A;  4Q0I A;  1TF1 A;  5LBR A;  4YOF A;  3RFB A;  3KSG A;  1STZ A;  2KOI A;  3HCY A;  4GLQ A;  1ZTU A;  2VEA A;  2GX5 A;  4MDZ A;  1YKD A;  4O0P A;  2W3G A;  2O9A A;  5HL6 A;  3E98 A;  3OOV A;  3G6O A;  4Q0H A;  3NOT C;  2KLI A;  5HPF A;  3MF0 A;  3OBF A;  4G3W A;  4QPR A;  4EU0 A;  1YSP A;  5DFY A;  3NOU C;  2O99 A;  4G3V A;  4MMN A;  4EUV A;  3IBJ A;  3MQ0 A;  3VV4 A;  2QYB A;  2B18 A;  5I5L A;  2O0Y A;  4MN7 A;  2ZMF A;  1F5M A;  3O5Y A;  4ETZ A;  5AJG A;  2Y8H A;  3S7N A;  3EEA A;  4MCW A;  4Y5F A;  4ME4 A;  4O8G A;  3IBR A;  3S7P A;  3KSF A;  2Y79 A;  3KSI A;  5HPI A;  2XRN A;  3R4K A;  1VHM A;  3S7Q A;  3MMH A;  2VJW A;  1YSQ A;  4R6L A;  4IUK A;  4G3K A;  4LRY C;  3NHQ A;  2IA2 A;  4PAU A;  2LB9 A;  2M7V A;  3W2Z A;  3ZQ5 A;  4DMZ A;  1TD5 A;  3E0Y A;  4FOF A;  5HSQ A;  3D3O A;  4Y3I A;  5L8M A;  3K2N A;  3C2W A;  4LRZ E;  2W3D A;  5K5B A;  3DBA A;  3CIT A;  3S7O A;  5DFX A;  2W3F A;  2XSS A;  4DN0 A;  4RQ9 A;  2O9B A;  4E04 A;  2W3H A;  1MKM A;  4Q0J A;  4YNR A;  4R70 A;  1MC0 A;  2W1R A;  4GW9 A;  4IUH A;  2HGV A;  5C5K A;  4ZRR A;  2K2N A;  2G7U A;  4CQH A;  4IJG A;  2W1T B;  4LRX C;  2K31 A;  4BWI A;  3KSH A; 
#chains in the Genus database with same CATH topology
 4CLC B;  3VE3 A;  2AVX A;  2JCH A;  3EGD C;  1E25 A;  1XJ6 A;  1ZHH B;  2W3E A;  3PBS A;  2JBF A;  4OOL A;  5EEC A;  4WEL A;  5FAT A;  1WYC A;  1PYY A;  1FR1 A;  4S2N A;  2H10 A;  4K0W A;  5TBM A;  3L9K A;  3M2K A;  3HRE A;  3K3C A;  2ZJ9 A;  5CEC A;  4GB7 A;  4S2L A;  4MEZ A;  4QD4 A;  3NOT C;  4GDB A;  1PI5 A;  5HPF A;  4EQ1 A;  3MF0 A;  5CHU A;  2WZZ A;  1FQG A;  5FL3 A;  1YLJ A;  5HX9 A;  3NDE A;  2DMW A;  4PM5 A;  4EES A;  4QWO A;  3S7N A;  3FC7 A;  4K08 A;  2VA0 A;  3A0V A;  2NUT C;  2ZM0 A;  1FOF A;  4X25 A;  4JGP A;  3BWL A;  2PBY A;  3HUM A;  2XF3 A;  5CRF A;  2Z2M B;  4E3N A;  2EWW A;  1ODV A;  1RP5 A;  1XA7 A;  3G32 A;  1BZA A;  4WEK A;  5M19 A;  4FUW A;  5FI2 A;  5L8M A;  4CLC D;  4LGW A;  2W3D A;  1ZC2 A;  1D1J A;  3DTI A;  2XSS A;  1QME A;  2E8I A;  1L0F A;  5IS1 A;  4HH3 A;  5F82 A;  5GHX A;  5EVE A;  1S67 L;  1PW8 A;  5EFW A;  3HBR A;  1DP6 A;  1IYQ A;  1QMF A;  2J80 A;  3ZG9 B;  2A49 A;  3DTK A;  4OLG A;  3NI9 A;  3TE8 A;  1TF1 A;  4YOF A;  4JGR A;  2PAV P;  2VEA A;  1HLU P;  3BW6 A;  2O9A A;  3LR3 A;  4OH0 A;  4BBU A;  1YLP A;  5FAS A;  2KDK A;  4HIA A;  3UB6 A;  3MR0 A;  2R78 A;  1FIK A;  3DAV A;  2VX8 A;  4WMC A;  4GNU A;  5L07 A;  4YIN A;  3S4X A;  4WLA A;  3ZG8 B;  1OTA A;  4DF6 A;  4ME4 A;  3S7P A;  1OTB A;  2PDR A;  3G2Y A;  2NUP C;  3T4K A;  2VJW A;  1D7E A;  2A2L A;  1JTD A;  1PWD A;  4HH2 A;  1XGI A;  3ITA A;  2PU2 A;  5HSQ A;  2IWD A;  2A3U A;  4UHU A;  1OME A;  1JNU A;  3DTM A;  4P6B A;  3BFG A;  4C75 A;  3LY3 A;  1K38 A;  1ZG6 A;  4C6Y A;  2XLN A;  4IJG A;  3E2K A;  3LUQ A;  4KZ3 A;  4LV3 A;  3IWI A;  5FDS A;  3IS2 B;  1HD8 A;  3HLG A;  2ZLY A;  4ARZ A;  1IYS A;  2JKF A;  4ZBE A;  4IBX A;  4PMA A;  3FZC A;  4BD1 A;  1ESI A;  5DVA A;  4QY5 A;  4JLF A;  5FQI A;  3CMZ A;  1GSX A;  1YLT A;  1KVM A;  4MBK A;  3MKF A;  3G6O A;  3GSG A;  4EBN A;  2ZC4 B;  4KZ9 A;  1MXO A;  4P6Z M;  5G18 A;  3MFX A;  5I94 A;  4WZ4 A;  2OWJ A;  3Q07 A;  1H8M A;  3UE6 A;  5MC7 A;  3R7W B;  3BQ8 A;  4RX2 A;  1G6A A;  2PYR A;  1F5M A;  4KZ7 A;  2XFT A;  2HDR A;  1F2K A;  3Q7V A;  1JWP A;  4MCW A;  3IWO A;  2C6W B;  2PBD P;  3LIC A;  5FI6 A;  4NXB A;  4P85 A;  4WUJ A;  3NC8 A;  4JGO A;  4LRY C;  3W4O A;  4MBF A;  2ZM2 A;  2JKG A;  4LV2 A;  2EWV A;  3F1O A;  4HI4 A;  4WM9 A;  1RGY A;  2RL3 A;  3BQA A;  3Q81 A;  2OAQ 1;  3LR4 A;  1BSG A;  1ERM A;  2VV7 A;  4EW7 A;  2Y2L A;  2HF6 A;  3IXG A;  3IT9 A;  3HLC A;  4DE0 A;  4BBV A;  1XJ2 A;  3LR5 A;  1S0W A;  5EM1 A;  5CTM A;  5EOE A;  4P6Z S;  5L09 A;  1P0Z A;  2VZW A;  3E4P A;  5DTT A;  2J8Y A;  3LI9 A;  5DTS A;  4II7 A;  5FAQ A;  4ETX A;  3NOP C;  1NRF A;  1OTI A;  1NXY A;  1ZTU A;  3BEC A;  4OQI A;  4CLC C;  3VSL A;  4JGQ A;  3MXQ A;  3P09 A;  2ZMA A;  1Q2Q A;  4HJ4 A;  3BLS A;  1T19 A;  3P01 A;  4RX3 A;  3W4P A;  5HDD A;  4OPZ A;  3H82 B;  2B18 A;  1ACF A;  3P98 A;  3TOI A;  5JYP A;  2XH9 A;  1IFQ A;  3TSG A;  4I3I A;  4B9O A;  4NXG A;  5GHZ A;  3EQU A;  3KSF A;  1BT5 A;  4N9K A;  4BL3 A;  3GRJ A;  3VFF A;  3S7Q A;  3T4S A;  2G2W A;  3SS3 A;  1CI9 A;  1TVF A;  5HFO A;  3PAE A;  1KE0 A;  4BLM A;  4DXB A;  2WK0 A;  4FOF A;  4EBL A;  4H6J B;  3K2N A;  1PZO A;  3N8L A;  2XGN A;  2Y2Q A;  3DBA A;  4X1L A;  1OT9 A;  2I9V A;  4E6X A;  1U60 A;  5CTN A;  4DN0 A;  2I72 A;  2XD5 A;  2PU4 A;  4IBR A;  4I3A A;  1MKM A;  2CC1 A;  4KZ5 A;  4U3T A;  1SHV A;  3UB5 P;  2W1R A;  4LPZ A;  4LCM A;  1SZV A;  4CQH A;  3UPN A;  2H5S A;  5DF8 A;  5DJT A;  1FSW A;  2DCF A;  5FEG A;  3PXP A;  1Y4O A;  1CJF A;  3CI6 A;  1ONH A;  5EVI A;  5FEF A;  5AQA A;  4IHQ A;  2Y2J A;  4Z1W A;  2EFX A;  1GHM A;  4JF4 A;  2Z2L B;  3VE4 A;  4E3I A;  3KYE A;  1S6R A;  3ULF A;  3IH9 A;  3VMA A;  1SKO A;  2WGW B;  1XPB A;  5HWW A;  5IT5 A;  5AQ7 A;  4RA7 A;  4GCZ A;  1N9N A;  2KLI A;  4ZJ3 A;  5CER A;  1J3W A;  3OBF A;  3NOU C;  2HPB A;  3IXD A;  4OPY A;  2QYB A;  3IF6 C;  4AFI A;  2O0Y A;  3PBO A;  2X02 A;  1OPX A;  2V9A A;  1ZKJ A;  3HLD A;  5A91 A;  1JWV A;  1ES5 A;  3DWZ A;  5G4Y A;  3T1Q B;  2J3W A;  1VHM A;  4OP8 A;  2JN7 A;  1SCW A;  2P9V A;  4KZ4 A;  4LEN A;  2ZQ7 A;  1I2S A;  1CF0 A;  4OKP A;  1YAX A;  3PTE A;  1GCE A;  3U2A A;  1MWR A;  4WBG A;  1TDL A;  4DMZ A;  4OP5 A;  4XT2 B;  5EVL A;  3HVF A;  3UME A;  3NEC A;  3MXS A;  1P97 A;  2V1Z A;  1O07 A;  4FCF A;  3S22 A;  3N8R A;  1LL9 A;  3T1S A;  2BLS A;  2L1M A;  5DJU A;  4Y0O A;  3UY6 A;  3D72 A;  5HD3 A;  3UNW A;  3C30 A;  4BWI A;  1W63 Q;  5G4Z A;  2M7U A;  3QP2 A;  3LR0 A;  1JVJ A;  3O88 A;  2FFY A;  2H0T A;  3GR2 A;  5GLA A;  5TBM B;  5HWT A;  4MDZ A;  2J9O A;  1KGG A;  3QNB A;  1GSW A;  3WS5 A;  3G2Z A;  3DW0 A;  4Q0H A;  2WUQ A;  4GOG A;  3W8K A;  5IHV A;  1LL5 A;  4R38 A;  4I5S A;  3D9Y A;  3T1X A;  3CWF A;  4QY6 A;  4M4X A;  4NK3 A;  3B33 A;  3CG5 A;  4X55 A;  2FFF B;  2D01 A;  1VQQ A;  2B5R A;  3EGX C;  4O8G A;  2ACG A;  5F5Y A;  4U0T A;  4WZ5 C;  1MPL A;  4JKT A;  2W0N A;  4ZJ2 A;  3HUO A;  3T4L A;  2VK3 A;  5E2G A;  2BG1 A;  5FSR A;  2M7V A;  1IKI A;  3LI8 A;  4HNB A;  4EWF A;  1JWZ A;  1YQS A;  3ZNY A;  2Y2P A;  2P74 A;  5HL1 A;  5KIZ A;  5JYO A;  3FPW A;  1CEG A;  4GDN A;  3GEC A;  4CLC A;  4LV0 A;  2Z6D A;  4S2K A;  3QP4 A;  4K91 A;  1W79 A;  4H8R A;  2FZ0 A;  4I39 A;  1YLZ A;  2OAP 1;  2V2F F;  2RCX A;  4FTX A;  2HDQ A;  2HGV A;  2HP5 A;  3PYP A;  2K2N A;  3GV9 A;  5CHJ A;  3VP2 A;  1VEU B;  4HES A;  1TS6 A;  3C38 A;  5A93 A;  3F1P A;  4DRT A;  3UPP A;  1XJ3 A;  3H9W A;  2PYP A;  3TW8 A;  2QZ6 A;  4FD8 A;  1RCJ A;  3ZHH A;  2XR0 A;  1P9W A;  5GLC A;  2OWH A;  1XGJ A;  2PHY A;  2PRF A;  2M1C A;  3F1N A;  3NJA A;  2WZX A;  1K57 A;  3B47 A;  2Q9N A;  5A8B A;  3JVV A;  4L9F A;  3GQZ A;  1L3L A;  1W8Y A;  4Y0U A;  5F1G A;  1NWZ A;  4Y13 A;  3QP8 A;  4PM9 A;  1NZO A;  1DJB A;  5HDS A;  4P87 A;  2J3T D;  4U0X A;  1WA9 A;  1BYW A;  1E4D A;  3BFF A;  3BEB A;  5DKL A;  4UAA A;  3KSI A;  1WYB A;  3LGO A;  1E3U D;  1T1B A;  1M6K A;  1OTE A;  2BAS A;  3VP1 A;  4IVI A;  5F68 A;  1ES4 A;  2Q9M A;  4E3O A;  2WYX A;  1LLB A;  2E8J A;  1UWN X;  2G2U A;  3ICY A;  4CJN A;  1K56 D;  3NCK A;  2GJ3 A;  4BQM A;  2QKP A;  2WKQ A;  5FAO A;  1PZP A;  2B95 A;  2Y2N A;  1SDE A;  3V50 A;  3AGE A;  2KX6 A;  2W3F A;  4KQR A;  4MBH A;  4E04 A;  2JKR M;  2V1B A;  1DP9 A;  3BFD A;  5J4E A;  2XQZ A;  2HZ5 A;  3WS0 A;  1I2W A;  3IF6 A;  2JE5 A;  4ARZ B;  5HDC A;  4DDS A;  2WAE A;  1X0O A;  1ES3 A;  1LI0 A;  4JXV A;  4DJ3 A;  3UE3 A;  4F3L A;  2LB5 A;  5TFQ A;  5EV0 A;  1MZU A;  3TRC A;  4Q0I A;  1IKG A;  1STZ A;  2KOI A;  5DF9 A;  4M3K A;  1FCM A;  4L9E A;  1KGE A;  3ZDJ A;  1K4E A;  2W3G A;  3GTC A;  5EM0 A;  3AGD A;  5F6A A;  4R23 A;  3NY4 A;  4X6T A;  2ZQ9 A;  4EV4 A;  5EPH A;  4E3K A;  4X56 A;  3BRM A;  1PNE A;  3A3D A;  5AQ9 A;  4FSF A;  3Q7V B;  3VV4 A;  1KDS A;  4MN7 A;  4QHC A;  3O5Y A;  5M18 A;  5KSH A;  1ESU A;  4OQH A;  1XJ4 A;  3LYX A;  1AWI A;  3HL9 A;  4EEP A;  1LSV A;  4OPQ A;  3VOL A;  3KYZ A;  3NUL A;  1XX2 A;  3F1O B;  4LV1 A;  3SH7 A;  4S2M A;  2Y2I A;  5HW3 A;  1F98 A;  3PHY A;  1NLZ A;  3C2W A;  4KG2 A;  2VV6 A;  1KVL A;  1T1A A;  2ZC6 B;  3FYZ A;  5DFX A;  2WKH A;  1GHI A;  3VOZ A;  3MFD A;  3OC2 A;  1UGU A;  3Q7Z A;  4PPR A;  4MLL A;  3IH8 A;  2A24 A;  2EXA A;  4OLD A;  3FV7 A;  1TEM A;  2W27 A;  1H3Q A;  1K6S A;  1BTL A;  4NKP A;  3H7W B;  4S2P A;  1DJC A;  4RVA A;  2HP6 A;  4NG2 A;  2OLU A;  1HTZ A;  1J9M A;  3Q1F A;  4JF6 A;  3CUE C;  2C5W B;  2OOL A;  4EEU A;  3WRT A;  3G31 A;  1K0K A;  3HLF A;  2WGI A;  1S4R A;  2V20 A;  1YM1 A;  4ID4 A;  2Q0O A;  1YT4 A;  3RTY A;  4B93 A;  1T18 A;  2CMN A;  3G34 A;  4MN6 A;  5GLB A;  4DE1 A;  3BFC A;  3V67 A;  1ZG4 A;  4QPR A;  4X69 A;  1NZU A;  5HAI A;  1XKZ A;  4N92 A;  2VGL M;  5CXW A;  4S2N C;  4R4S A;  3U4L P;  3CPT A;  2JKR I;  4HQA A;  3UB8 A;  3IXH A;  4A5R A;  4EET B;  4NXE A;  1FR6 A;  1PRQ A;  4QJG A;  5HZH A;  3ZNT A;  4E3L A;  3HLB A;  4EQI A;  2WGV A;  4X1M A;  3NHQ A;  4B4X A;  2X71 A;  1ONG A;  3N6I A;  3RXX A;  5J8X A;  5CEB A;  4JXW A;  1TD5 A;  5GLD A;  4OVD A;  3C7U A;  3S7O A;  1H5X A;  1SDN A;  2ZD8 A;  3IX4 A;  1ERQ A;  2UV0 E;  3UO9 A;  1FCN A;  4D2O A;  2OLV A;  3MS6 A;  2J3T C;  1TS7 A;  3PAG A;  3IX8 A;  3HUN A;  4UA7 A;  3KX0 X;  5TR7 A;  2VGL S;  5EVI B;  1KE4 A;  1YMS A;  4FH2 A;  2QPN A;  3CJM A;  2Y2O A;  5A92 A;  4NEE D;  5LBR A;  5DTK A;  4E6W A;  1XFQ A;  2Y55 A;  4KQO A;  2L4R A;  3PBR A;  4Y7P A;  3VFH A;  4ZDX A;  3EQV A;  4KQQ A;  3OOV A;  2J9P A;  4HY8 A;  5L10 A;  3BFE A;  4X53 A;  1P9R A;  3UDI A;  1UWP X;  1K54 C;  3HJK A;  4OOM A;  3ZG5 A;  2EFU A;  3DWK A;  3EWK A;  3TG9 A;  4Y0T A;  3FWL A;  5F83 A;  3UE1 A;  1YLY A;  2P9V B;  4N1H A;  4BD0 A;  5CED A;  2XRN A;  3BM6 A;  5IU1 A;  5J7E A;  1FIL A;  1S66 L;  4EER A;  4D60 A;  2JC7 A;  4N1X A;  3UDF A;  4G3K A;  1OT6 A;  3VP0 A;  1NJ4 A;  1VET A;  4PAU A;  2LB9 A;  1PIO A;  1G5U A;  1NYM A;  2ZL1 B;  3ZQ5 A;  3M6B A;  5HAP A;  2PT7 A;  3E0Y A;  4Y3I A;  1PFL A;  3OCL A;  2PD7 A;  3CIT A;  3OPP A;  1HVB A;  3A0R A;  3T4O A;  3JVU A;  4GHI A;  2DRW A;  1VM1 A;  2XEP A;  4Q0J A;  2UWX A;  5HAQ A;  1MC0 A;  3OZH A;  1XXM A;  3BYD A;  4KUK A;  3CZD A;  2Y2H A;  2Y2M A;  5FI7 A;  3SZT A;  4R4R A;  4BL2 A;  3G35 A;  1BLC A;  4UA9 A;  1XFN A;  3QP1 A;  3PR6 A;  4ZJ1 A;  2ZQC A;  2OSU A;  2W1T A;  1NRJ A;  2XA7 M;  4JXG A;  2WGW A;  3VSK A;  4MNR A;  3MSH A;  3LID A;  5TGF A;  1OTD A;  1W5D A;  1NLY A;  4HJ3 A;  1L0G A;  3A3F A;  5AVF A;  3LEZ A;  4S2I A;  5EOO A;  2EA9 A;  2GNX A;  4R3A A;  4I3J A;  1KE3 A;  1W63 M;  3ZGA B;  3UB9 A;  4Z9Q A;  2O99 A;  4GZB A;  1AXB A;  5BOH A;  1W7F A;  4S2O A;  3L7H A;  1V9Y A;  5M1A A;  2YKF A;  1CK3 A;  3T4J A;  1KDW A;  3MJQ A;  3G30 A;  4KQD A;  2Y79 A;  1BLS A;  3AGF A;  3R4K A;  3NDG A;  1YSQ A;  1Z6F A;  2ZMV A;  3UB7 A;  1DRM A;  2WKE A;  3ZFZ A;  1LSX A;  3N8S A;  5E2E A;  1IOU A;  5HD5 A;  2XA7 S;  4GS9 A;  4XXR A;  3UMD A;  3A0S A;  2PR5 A;  2Y2K A;  3D3O A;  4BEN A;  4XUX A;  3FG8 A;  5K5B A;  3EEH A;  1M40 A;  4RQ9 A;  2L0W A;  2O9B A;  2WAF A;  3M2J A;  4IVK A;  3V3S A;  3DTE A;  1PWG A;  1TDG A;  2B02 A;  3LEQ A;  2Y59 A;  4QB8 A;  1NYY A;  1G6O A;  5C5K A;  4PM6 A;  1FSY A;  3F1P B;  2MJ6 A;  1G68 A;  4KEN B;  3MZF A;  3SH9 A;  4IED A;  4LFU A;  2XRO A;  1KOU A;  5TJJ A;  4BBT A;  2VKS A;  3CLO A;  3F1N B;  5L2F A;  3LFV A;  2VGJ A;  2Y4A A;  4Y17 A;  3KSG A;  3T4Q A;  3HCY A;  4GD8 A;  2D02 A;  4GLQ A;  4KG5 A;  5FDH A;  1IYO A;  2QMI A;  5FQQ A;  3E4Q A;  5FA7 A;  3CAX A;  3K3D A;  4N9L A;  5HWV A;  4BMW A;  1BLP A;  5HL6 A;  2P7J A;  2VV8 A;  2IWB A;  5AVE A;  2K7S A;  1Z09 A;  5D3O A;  4P0M A;  2OV5 A;  4X68 A;  4G3W A;  2ZC3 B;  4HP9 A;  3A3J A;  4G3V A;  4MMN A;  4KZB A;  4HBT A;  3G4P A;  2HJE A;  5I5L A;  3UN7 A;  3IF5 A;  2ZMF A;  3EOI A;  3IHA A;  3ZYT A;  1DJA A;  1IYP A;  3WS4 A;  3EEA A;  1ALQ A;  1OJG A;  2Y91 A;  4EUZ A;  2ZQA A;  4KG6 A;  4QU3 A;  3TJZ C;  4HJ6 A;  1GA9 A;  3OPR A;  1E3U A;  2V8F A;  3LIE A;  3T1R A;  2PD8 A;  1MKI A;  2H0Y A;  2HP9 A;  2V1A A;  1O7E A;  3LY4 A;  2EX6 A;  4L0L A;  1K56 A;  1MWT A;  4LRZ E;  1VEU A;  1ES2 A;  4C3Q A;  5DKK A;  3FKW A;  2W3H A;  2GDN A;  5FQJ A;  4DXC A;  3A3I A;  1CI8 A;  4R1G A;  1XP4 A;  5AQB A;  3IF6 B;  3WWX A;  1YLW A;  1K54 A;  3MZE A;  1MY8 A;  3PBQ A;  3MBZ A;  2K31 A;  2JKT M;  2V0W A;  3KYQ A;  3QP6 A;  4B88 A;  5KZH A;  2HDS A;  4F3L B;  1PW1 A;  3NBL A;  3MKE A;  3ZVT A;  2DNS A;  3KO6 A;  3P7N A;  3WS2 A;  4DJ2 A;  5FQK A;  4S2J A;  3IXB A;  3VOY A;  1CQA A;  4ZTK A;  3VP4 A;  4KUO A;  4DE3 A;  3FKV A;  3PBN A;  4GKU A;  2YKH A;  1NY0 A;  3E98 A;  3RJU A;  5EVI C;  1S4S A;  4MN5 A;  2GZA A;  3OLO A;  2HJ9 C;  4WN5 A;  4OOY A;  4WMC D;  3JYI A;  2J7V A;  3N7W A;  1DY6 A;  1T1C A;  2ZM8 A;  5AJG A;  1TS8 A;  2WKP A;  4L9G A;  4Y5F A;  5DF7 A;  3V39 A;  2XFS A;  2ZBB A;  4NXF A;  1YMX A;  3UPO A;  3MMH A;  3RXW A;  2R9W A;  1OJ5 A;  4KZ8 A;  1YPR A;  5FQM A;  1IEL A;  3MZD A;  4CPK A;  1GSV A;  4HEF A;  4KZA A;  2A24 B;  3SS5 A;  3SW1 A;  1PI4 A;  3OPL A;  1Q2P A;  5E2F A;  4GD6 A;  3C4P A;  4RYE A;  2R9X A;  4HBU A;  3MQQ A;  1K55 C;  1N4O A;  5CGX A;  4XUZ A;  1S1Y A;  3IWQ A;  3RH8 B;  3QHY A;  3T50 A;  5F1F A;  3IS2 A;  5GL9 A;  3B42 A;  1N9L A;  4Y2F A;  5EE8 A;  3ISG A;  3RFB A;  3C5A A;  3CHW P;  3NIA A;  4WYY A;  3ITB A;  4PM7 A;  3A3E A;  1TS0 A;  1GA0 A;  3LCE A;  1YSP A;  1I5Q A;  4WZ5 A;  2XD1 A;  2P08 A;  1N9B A;  1IEM A;  3CPT B;  3IBJ A;  3MQ0 A;  4ETZ A;  3O3V A;  3OCN A;  3R7W A;  2Y8H A;  3GVB A;  2FH5 A;  3D4F A;  1BUL A;  3ZVW A;  4E3J A;  1DP8 A;  1G28 A;  3C7V A;  5HPI A;  4OQ0 A;  4PKY A;  3IX3 A;  2JKT I;  4R6L A;  3T4T A;  4UQI M;  3W2Z A;  1H8Z A;  3H7W A;  5FAP A;  3SS4 A;  3C4O A;  2HDU A;  1FCO A;  3ZCZ A;  1H0M A;  4FH4 A;  4HHD A;  3W4Q A;  1K4F A;  4R70 A;  2X01 A;  4NET A;  4YWZ A;  2WAD A;  1D06 A;  4LCL A;  1H8Y A;  4Q8I A;  1S1Z A;  3UDX A;  4JXS A;  3V5M A;  4GJ4 A;  2H28 A;  5CGW A;  2HV1 A;  1SKF A;  3IHB A;  4R3J A;  2PR6 A;  1LSW A;  1W8Q A;  4R3B A;  3WRZ A;  3HLE A;  3LO7 A;  5KSC A;  4UEY A;  2Z6C A;  3IQA A;  4JF5 A;  4O0P A;  1MBL A;  1GHP A;  1ERO A;  4UQI S;  1Y28 A;  1K6R A;  3LIF A;  1K25 A;  1CEF A;  3LIB A;  2ZOH A;  5J3W A;  1EWZ A;  2V0U A;  4KZ6 A;  3BLM A;  5DFY A;  1K57 C;  1VB6 A;  2EX2 A;  3ZG0 A;  3VP3 A;  2QJ7 A;  4DDY A;  1SKO B;  3H82 A;  5A90 A;  4OON A;  5CX7 A;  3SH8 A;  4OPR A;  3I7J A;  2ZQ8 A;  1A0K A;  1VET B;  3E2L A;  4IUK A;  4K0X A;  5KMW A;  4EBP A;  4WF0 A;  1EW0 A;  2IA2 A;  4CLC E;  2QJ5 A;  3T12 B;  1EI5 A;  4EXO A;  4B4Z A;  1LT0 A;  4DE2 A;  4WEJ A;  1XA1 A;  4HOI A;  3QNC A;  5EUA A;  4GHI B;  3GMW A;  2ZQD A;  2V8C A;  4PM8 A;  3ZG7 B;  4HP4 A;  2EX8 A;  3FPV A;  4H6J A;  3O86 A;  2QHK A;  1JTG A;  4JBF A;  3E4O A;  4ZAM A;  3C8C A;  4GW9 A;  4LLO B;  4O7D A;  5F69 A;  4ZRR A;  2W1T B;  3HJI A;  2G7U A;  3KSH A;  3BY8 A;  2BTF P;  2ZOI A;  3BJN A;  3PBT A;  4ESP A;  4O01 A;  5EVI D;  3Q82 A;  2JHE A;  2O9C A;  4GN2 A;  5GHY A;  4R0Q A;  4OQG A;  2GX5 A;  2WKI A;  2EX9 A;  3B3X A;  1YKD A;  3GDI A;  2INW A;  5CGS A;  3WS1 A;  3HLW A;  1HZO A;  3N4I A;  5CHM A;  2VGK A;  4EU0 A;  3M6H A;  3JPU A;  4EUV A;  2EXB A;  2IWC A;  4Y15 A;  1LL8 A;  5E2H A;  1F9I A;  4E3M A;  4YFM A;  4JPM A;  1LI9 A;  2P04 A;  4PHT A;  3OPH A;  2QWS A;  5U47 A;  4F94 A;  2ZL1 A;  3QP5 A;  1WE4 A;  1RGZ A;  1K55 A;  3IBR A;  3S1Y A;  2ZC7 A;  2ZC5 B;  1LHY A;  5HAR A;  1KGF A;  5FQ9 A;  4GS9 B;  2Y2G A;  1MWS A;  1V9Z A;  1L2S A;  1C3B A;  3SOI A;  4DKI A;  1MWU A;  4UA6 A;  3MQO A;  3V3R A;  2VLG A;  4PKY G;  1L0E A;  3CUE A;  4XT2 A;  4I38 A;  3LIA A;  1N9O A;  4WL9 A;  1L0D A;  4YNR A;  1Y54 A;  1BUE A;  5E43 A;  1BLH A;  3BY9 A;  2XK1 A;  3O87 A;  4IUH A;  3UE0 A;  3MXR A;  2WKR A;  4BJP A;  1PWC A;  2XDM A;  4LRX C; 
#chains in the Genus database with same CATH homology
 4CLC B;  5DJT A;  3VE3 A;  3PXP A;  2OOL A;  3EGD C;  4F3L B;  4EEU A;  1XJ6 A;  1ZHH B;  2W3E A;  3PBS A;  4OOL A;  3CI6 A;  3KO6 A;  3P7N A;  4DJ2 A;  1S4R A;  4IHQ A;  4Z1W A;  4WEL A;  3VE4 A;  3RTY A;  4KUO A;  4B93 A;  1T18 A;  3PBN A;  3ULF A;  2CMN A;  2YKH A;  5TBM A;  4MN6 A;  3K3C A;  3E98 A;  5HWW A;  5IT5 A;  1S4S A;  4GCZ A;  1N9N A;  3NOT C;  4MN5 A;  2KLI A;  3V67 A;  5HPF A;  2GZA A;  3OLO A;  4EQ1 A;  3MF0 A;  3OBF A;  4QPR A;  2HJ9 C;  4WN5 A;  2VGL M;  5FL3 A;  3NOU C;  2QYB A;  4AFI A;  2O0Y A;  2DMW A;  3PBO A;  1T1C A;  2JKR I;  4HQA A;  5AJG A;  4EES A;  1OPX A;  3UB8 A;  3S7N A;  1TS8 A;  2WKP A;  2V9A A;  4L9G A;  4Y5F A;  4EET B;  3FC7 A;  4K08 A;  2VA0 A;  3A0V A;  2NUT C;  2ZBB A;  4NXF A;  5G4Y A;  4JGP A;  4NXE A;  2J3W A;  1VHM A;  3BWL A;  5HZH A;  3MMH A;  2JN7 A;  3NHQ A;  2EWW A;  1OJ5 A;  1YAX A;  1ODV A;  3U2A A;  4DMZ A;  4WEK A;  1TD5 A;  4XT2 B;  5L8M A;  4CLC D;  1GSV A;  2W3D A;  2A24 B;  3UME A;  3S7O A;  2XSS A;  1P97 A;  3SW1 A;  5IS1 A;  4HH3 A;  2L1M A;  5DJU A;  3D72 A;  1S67 L;  5HD3 A;  2J3T C;  1TS7 A;  5EFW A;  3MQQ A;  3C30 A;  4BWI A;  1DP6 A;  1W63 Q;  5G4Z A;  2M7U A;  3KX0 X;  2VGL S;  2J80 A;  1S1Y A;  3RH8 B;  3LR0 A;  3T50 A;  3IS2 A;  3B42 A;  1N9L A;  3TE8 A;  4Y2F A;  1TF1 A;  4NEE D;  5LBR A;  4YOF A;  3RFB A;  5TBM B;  4JGR A;  1XFQ A;  2VEA A;  5HWT A;  4KQO A;  4MDZ A;  2L4R A;  3PBR A;  1GSW A;  3BW6 A;  2O9A A;  3EQV A;  3LR3 A;  4BBU A;  3OOV A;  4HY8 A;  4Q0H A;  1TS0 A;  1P9R A;  4R38 A;  2KDK A;  1UWP X;  4HIA A;  1YSP A;  4I5S A;  3UB6 A;  3HJK A;  2P08 A;  3MR0 A;  4OOM A;  3IBJ A;  3CWF A;  4M4X A;  2R78 A;  3MQ0 A;  3B33 A;  3EWK A;  2VX8 A;  4ETZ A;  3OCN A;  2D01 A;  3R7W A;  2Y8H A;  2FH5 A;  4WLA A;  3EGX C;  1OTA A;  4ME4 A;  4O8G A;  3S7P A;  1OTB A;  1DP8 A;  2PDR A;  1G28 A;  5F5Y A;  5HPI A;  2NUP C;  2XRN A;  4PKY A;  5IU1 A;  3T4K A;  2W0N A;  5J7E A;  1S66 L;  2VJW A;  2JKT I;  4R6L A;  4EER A;  4G3K A;  3T4T A;  1D7E A;  1OT6 A;  3T4L A;  4UQI M;  2A2L A;  4PAU A;  2LB9 A;  2M7V A;  3LI8 A;  4HNB A;  4HH2 A;  3W2Z A;  3ZQ5 A;  3H7W A;  2PT7 A;  3E0Y A;  5HSQ A;  4Y3I A;  5KIZ A;  3OCL A;  3FPW A;  2PD7 A;  3CIT A;  3A0R A;  3GEC A;  4HHD A;  4CLC A;  2Z6D A;  3T4O A;  3JVU A;  1JNU A;  4GHI A;  4Q0J A;  2FZ0 A;  4I39 A;  4R70 A;  1MC0 A;  2OAP 1;  4YWZ A;  4KUK A;  1D06 A;  2HGV A;  3PYP A;  1S1Z A;  2K2N A;  1XFN A;  4IJG A;  3PR6 A;  4GJ4 A;  2H28 A;  3LUQ A;  2HV1 A;  1TS6 A;  3C38 A;  3IS2 B;  3F1P A;  2W1T A;  1NRJ A;  2XA7 M;  1XJ3 A;  3H9W A;  2PR6 A;  1LSW A;  2PYP A;  4ARZ A;  3TW8 A;  3LID A;  1P9W A;  4UEY A;  2OWH A;  2PHY A;  1OTD A;  2Z6C A;  2M1C A;  3F1N A;  3NJA A;  1NLY A;  4HJ3 A;  3B47 A;  5AVF A;  3JVV A;  4L9F A;  4O0P A;  5A8B A;  1GSX A;  2EA9 A;  2GNX A;  4R3A A;  1Y28 A;  4UQI S;  3G6O A;  3LIF A;  4I3J A;  1NWZ A;  3LIB A;  1W63 M;  2ZOH A;  5J3W A;  2V0U A;  4P6Z M;  3UB9 A;  3MFX A;  5DFY A;  2O99 A;  2OWJ A;  1H8M A;  3UE6 A;  1VB6 A;  5MC7 A;  5HDS A;  3R7W B;  3BQ8 A;  2J3T D;  1V9Y A;  2QJ7 A;  2YKF A;  3T4J A;  1WA9 A;  2PYR A;  1F5M A;  1BYW A;  3MJQ A;  3H82 A;  4MCW A;  5DKL A;  4KQD A;  5CX7 A;  3LIC A;  2Y79 A;  3KSI A;  3R4K A;  1T1B A;  4NXB A;  1YSQ A;  1OTE A;  2BAS A;  4IUK A;  4WUJ A;  2ZMV A;  3UB7 A;  4JGO A;  1DRM A;  4LRY C;  1EW0 A;  4WF0 A;  5F68 A;  2IA2 A;  4CLC E;  2QJ5 A;  4EXO A;  1LT0 A;  1UWN X;  3ICY A;  1LSX A;  1IOU A;  5HD5 A;  4WEJ A;  2XA7 S;  4HOI A;  4GS9 A;  2EWV A;  3UMD A;  2GJ3 A;  3A0S A;  3F1O A;  4HI4 A;  2QKP A;  2PR5 A;  3D3O A;  2WKQ A;  3BQA A;  4GHI B;  3FG8 A;  5K5B A;  2OAQ 1;  3LR4 A;  3EEH A;  2KX6 A;  2VV7 A;  4EW7 A;  2W3F A;  2HF6 A;  4HP4 A;  3FPV A;  4H6J A;  2L0W A;  2O9B A;  4RQ9 A;  4E04 A;  2JKR M;  2QHK A;  2V1B A;  3E4O A;  4BBV A;  1DP9 A;  2B02 A;  3C8C A;  4GW9 A;  4LLO B;  1G6O A;  1XJ2 A;  5F69 A;  5J4E A;  5C5K A;  3LR5 A;  4ZRR A;  3F1P B;  2W1T B;  2MJ6 A;  3HJI A;  3KSH A;  2G7U A;  4P6Z S;  4ARZ B;  5HDC A;  3BY8 A;  1P0Z A;  2ZOI A;  3BJN A;  3PBT A;  2VZW A;  3E4P A;  4O01 A;  3LI9 A;  1X0O A;  4II7 A;  2XRO A;  1KOU A;  2JHE A;  4DJ3 A;  4ETX A;  3NOP C;  5TJJ A;  4BBT A;  2VKS A;  2O9C A;  3UE3 A;  4F3L A;  3CLO A;  2LB5 A;  3F1N B;  3LFV A;  1MZU A;  1OTI A;  3TRC A;  4Q0I A;  3KSG A;  3T4Q A;  1STZ A;  2KOI A;  3HCY A;  5DF9 A;  2D02 A;  4GLQ A;  1ZTU A;  2GX5 A;  4L9E A;  3E4Q A;  3CAX A;  3K3D A;  5HWV A;  4BMW A;  1YKD A;  2W3G A;  5HL6 A;  2P7J A;  2VV8 A;  3GDI A;  4CLC C;  4JGQ A;  3MXQ A;  2INW A;  5AVE A;  5F6A A;  2K7S A;  4HJ4 A;  1T19 A;  3P01 A;  4G3W A;  4EU0 A;  4HP9 A;  4G3V A;  4MMN A;  4EUV A;  5HDD A;  4FSF A;  1LL8 A;  3VV4 A;  1F9I A;  3H82 B;  2HJE A;  2B18 A;  5I5L A;  2P04 A;  4MN7 A;  2ZMF A;  4PHT A;  3EOI A;  3O5Y A;  3ZYT A;  1IFQ A;  2QWS A;  4I3I A;  5KSH A;  4B9O A;  4NXG A;  3EEA A;  1OJG A;  3EQU A;  3IBR A;  3KSF A;  1XJ4 A;  3LYX A;  4EEP A;  1LSV A;  3S7Q A;  3T4S A;  3VOL A;  3TJZ C;  3KYZ A;  4HJ6 A;  3LIE A;  4GS9 B;  3F1O B;  2PD8 A;  1V9Z A;  2V1A A;  4FOF A;  1F98 A;  3PHY A;  4L0L A;  1NLZ A;  4H6J B;  3K2N A;  3C2W A;  3MQO A;  2VV6 A;  4LRZ E;  1T1A A;  3DBA A;  2VLG A;  4PKY G;  1OT9 A;  5DFX A;  2I9V A;  3OC2 A;  1UGU A;  3CUE A;  4XT2 A;  4I38 A;  4DN0 A;  5DKK A;  2A24 A;  3LIA A;  4I3A A;  1N9O A;  1MKM A;  2W3H A;  4WL9 A;  4YNR A;  2W27 A;  1H3Q A;  2W1R A;  4LPZ A;  4NKP A;  3H7W B;  3BY9 A;  4IUH A;  2WKR A;  4BJP A;  4CQH A;  3PBQ A;  4LRX C;  2K31 A;  2JKT M;  2V0W A;  3KYQ A;  3CUE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...