2Y79A

Structure of the first gaf domain e87a mutant of mycobacterium tuberculosis doss
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
GAMDPDLEATLRAIVHSATSLVDARYGAMAVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRVRDESFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAVANARLYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords REDOX SENSOR HISTIDINE KINASE RESPONSE REGULATOR DEVS
publication title Blockage of the Channel to Heme by the E87 Side Chain in the Gaf Domain of Mycobacterium Tuberculosis Doss Confers the Unique Sensitivity of Doss to Oxygen.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 34
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2y79A00
3IBJA 2XRNA 3MMHA 4O01A 5AJGA 3S7PA 2LB5A 3S7QA 3BJNA 3KSIA 3KSFA 4E04A 4LRXC 3R4KA 2IA2A 5C5KA 4DN0A 2VJWA 3MF0A 4IJGA 3KSGA 3KSHA 2W1RA 5HPIA 4ZRRA 2M7VA 5LBRA 2XROA 1TF1A 4PAUA 3G6OA 3E0YA 5DFYA 5HSQA 3KO6A 3S7OA 3OOVA 2GX5A 4Y3IA 1F5MA 3IBRA 3K2NA 2LB9A 2W3HA 2B18A 2O9BA 4LRYC 2VEAA 2M7UA 4YNRA 5DFXA 2KLIA 2W3EA 3S7NA 2W3DA 5I5LA 4ETZA 4LRZE 4IUKA 4MDZA 4Y2FA 4IUHA 3NHQA 4YOFA 2O9CA 4CQHA 2W3GA 2XSSA 4FOFA 4MN7A 4Q0IA 2O0YA 3DBAA 2W3FA 4Q0HA 5K5BA 2KOIA 2W1TB 4BWIA 4GW9A 4O8GA 3RFBA 3E98A 5HL6A 3NOUC 1MKMA 2ZMFA 1ZTUA 2W1TA 4GLQA 2Y79A 3O5YA 3CITA 4ETXA 4Y5FA 4RQ9A 2O9AA 2O99A 5HPFA 1YSPA 2K2NA 3OBFA 2VKSA 4R70A 4EU0A 3TRCA 3NOTC 3CI6A 3C2WA 3ZQ5A 3HCYA 4Z1WA 2Y8HA 4MCWA 1YSQA 4DMZA 2HGVA 2OOLA 2K31A 2QYBA 4QPRA 4R6LA 1VHMA 4EUVA 1TD5A 1STZA 3W2ZA 4G3WA 3D3OA 3LFVA 1YKDA 3NOPC 4Q0JA 3EEAA 4ME4A 4MMNA 4G3KA 1MC0A 5TJJA 2G7UA 5L8MA 2VZWA 3VV4A 3MQ0A 4O0PA 4G3VA
chains in the Genus database with same CATH superfamily
2Y2QA 1BLSA 3T4OA 1FIKA 4Y15A 3HLBA 1YMXA 1PWDA 2JHEA 1XKZA 1JTDA 3DTKA 5HWWA 2HP6A 4X68A 1GSWA 3DWKA 2BASA 1PW8A 4EWFA 1G68A 2AVXA 4BBVA 5HSQA 2GJ3A 2WGWA 2JKTM 2W3HA 5A93A 2HV1A 4RX2A 2M7UA 4YFMA 1SDNA 2W3DA 4BBTA 3LR4A 1BLPA 4WZ5A 4N9LA 4ETZA 1H0MA 3P01A 4GCZA 3ZNTA 3PXPA 5IS1A 4LV0A 1LSWA 3T4SA 1G28A 4C3QA 1Z09A 1K25A 4E3JA 5DF7A 3HLEA 4KZ4A 2ZQDA 2OLVA 4ZDXA 3PTEA 1K56A 4MN6A 3LIAA 2WGIA 5EM1A 3ZG0A 1IYOA 4FH2A 2OSUA 5FASA 2WZZA 2DCFA 3T50A 3FWLA 3C4OA 3QP8A 1TDLA 1ZC2A 3BYDA 1PIOA 1ONGA 2OOLA 1FQGA 2P74A 2JE5A 4NXEA 4XUXA 3W2ZA 5I94A 1N9BA 3BFDA 3CJMA 3OPLA 4PPRA 5HD3A 4EQIA 4Q0JA 2EWWA 2L4RA 1L0DA 4LFUA 4OPYA 3ZDJA 4NETA 3UN7A 4G3VA 3BQ8A 2H28A 3M6HA 3MMHA 3QP1A 2WKPA 5KSHA 3EOIA 5TBMB 1NLZA 3ZG8B 1XGIA 1LL9A 2H5SA 2PYRA 2E8JA 5C5KA 2ZC7A 2V1ZA 1Q2QA 3WS5A 3GVBA 1ES3A 5LBRA 2XROA 3MFDA 3F1OB 5HW3A 4HP4A 2GX5A 1DP9A 1FILA 3HUNA 3NC8A 2LB9A 2B5RA 2B18A 2QMIA 3VSLA 2K7SA 5FAQA 3E4QA 4KQRA 2UV0E 2B02A 3U2AA 3V67A 3C38A 1FOFA 1PNEA 2OWHA 3DBAA 3UE0A 2W3FA 1IYQA 3EQVA 3FG8A 3ZCZA 2ZQ8A 1MKMA 3LIBA 2HPBA 3O87A 4HOIA 5AQAA 2DMWA 3FPWA 2NUPC 5CGWA 4CLCB 4PM8A 3ZG5A 4DMZA 4JXVA 2G2WA 1NZOA 3GDIA 1TEMA 1XJ2A 2PT7A 3JPUA 3C7UA 2Y2OA 4QJGA 5U47A 5HX9A 2ZM8A 1S4RA 3CUEA 3NOPC 4OOMA 2JKGA 1TS8A 3E4PA 2HP5A 4E3NA 1OTDA 1IELA 3C7VA 5IU1A 3BECA 3S7PA 4BENA 1I5QA 1NWZA 2ZBBA 5L09A 1P97A 1A0KA 1J9MA 2C5WB 3H82A 1K6RA 2P9VA 3LIEA 4F3LA 2EA9A 3TE8A 5AVFA 3UB7A 3OLOA 1GCEA 2XEPA 3EEHA 3IBRA 4P6ZS 1KVLA 3B3XA 1BT5A 3W4QA 2C6WB 1ACFA 3C5AA 1KVMA 3QP4A 4LV3A 3HUOA 1LLBA 5EVIC 3IHBA 1MPLA 2IWBA 4FOFA 1CI8A 4HI4A 3Q81A 4QHCA 1NRJA 4Q0IA 4HJ6A 2P08A 2UWXA 2ZMFA 2W1TA 4IEDA 4X25A 4JF4A 5DF9A 4P6BA 3Q7VB 4X6TA 3GSGA 1ESUA 3CI6A 3WS0A 1W63M 1KDSA 2EFUA 2JKRM 4A5RA 2Y2KA 4U0XA 3HREA 3BWLA 1E25A 3RTYA 4EBLA 5DKKA 3FV7A 2WYXA 1XFNA 5EVEA 3MKEA 4NXFA 3S4XA 3A3FA 2ZLYA 1VEUB 4JF6A 4HJ3A 2OWJA 3IH9A 1ES2A 4WLAA 3HVFA 3TG9A 5EE8A 1F98A 2Y2JA 2Q0OA 3QNBA 1P0ZA 2P7JA 3MR0A 5CHUA 2CMNA 5A91A 3TJZC 3VOYA 3BW6A 3BY8A 3N4IA 2M7VA 3GRJA 5FL3A 4E3MA 4R3AA 1H8YA 1W7FA 5HWTA 1AXBA 4QWOA 3LR5A 2VX8A 4GDNA 3PAGA 3PBTA 4GHIB 2Y2MA 3ULFA 4WZ5C 1DY6A 3G31A 2Q9NA 2WAEA 3LI9A 4Y2FA 2QPNA 3DWZA 2Q9MA 5F83A 1NLYA 1OTIA 3UB5P 1RGZA 3LIDA 3W4OA 4XT2A 3ZG9B 4S2KA 1YLYA 3G30A 3FC7A 4KENB 3PHYA 5CTMA 2Y79A 4UQIM 3EWKA 4N1HA 4DE1A 1XJ6A 3NOTC 4B93A 1TS6A 2ZM0A 1UGUA 3HL9A 3MBZA 5KMWA 4F94A 1MZUA 2ZQAA 1QMEA 3G35A 2V2FF 3ITBA 3M2KA 4EUVA 1TD5A 5JYPA 2QHKA 4UA9A 4DDSA 4QU3A 2IWDA 3AGDA 3DTIA 3VV4A 4E3LA 4BD1A 3T4LA 1OTEA 4DE2A 2ZL1A 1BYWA 3H82B 3R4KA 3SS5A 4HHDA 5HFOA 3OC2A 1XGJA 4FSFA 2YKFA 4CLCE 4MBHA 1H8ZA 4IBRA 3LCEA 5GHZA 5MC7A 2JC7A 1Y28A 2FZ0A 2Y2LA 5JYOA 1H3QA 1LL5A 3GECA 4OLGA 4ZBEA 3S1YA 4HBUA 3WWXA 1YT4A 3NBLA 4CLCD 1IFQA 1MWRA 4GD6A 3Q82A 5DKLA 4WELA 2W3GA 4PM6A 3A3JA 4Y17A 4JXSA 1YLPA 4R3JA 5FEFA 4Q0HA 1PRQA 2W1TB 4HESA 1SKFA 2JKTI 2Z6CA 5J7EA 4I3IA 4P6ZM 2Y2HA 3CITA 2PHYA 1L0FA 3CAXA 5CXWA 2WK0A 4JGOA 4EU0A 4GZBA 2J9OA 1UWPX 4PKYA 4OQ0A 4OP8A 2HGVA 5AQ7A 2QYBA 4U0TA 2ZC3B 4EXOA 1GSVA 1K54A 1XX2A 4BLMA 1GA9A 2WAFA 4MMNA 2I9VA 3HJIA 3ZGAB 4II7A 2VZWA 2XDMA 4B4XA 1GHMA 4O01A 5AJGA 2PRFA 2GDNA 3B47A 3W8KA 1AWIA 4KZBA 3LY4A 1G6OA 2VJWA 3IF6A 3T1RA 3DW0A 4L9GA 3ZHHA 2V1AA 2J3WA 4FTXA 2VGLS 2PD8A 4Y3IA 3SZTA 3K2NA 3UO9A 3OZHA 5F69A 3T12B 2HZ5A 5CTNA 1TDGA 1S1ZA 1ERMA 3IWOA 3H7WA 4OLDA 3V3RA 1F9IA 3O3VA 4EETB 1G6AA 4S2MA 3UPNA 3WS4A 1LSVA 1KE3A 1XPBA 4H8RA 3A0RA 3RFBA 2Y59A 2XFSA 1ZTUA 2FFYA 2ZJ9A 3TOIA 4X69A 3WRZA 4Y5FA 1WYCA 1ODVA 1PZOA 2WADA 2K2NA 3OBFA 4LCLA 4R70A 1EWZA 3IS2B 3NIAA 4E3KA 3ZQ5A 5HDCA 4B9OA 2XA7S 2A2LA 4MCWA 4EW7A 1JWVA 2V8FA 5EM0A 4QD4A 5DTTA 2Z6DA 1PI5A 4ARZB 5L2FA 2EXAA 1L2SA 3FPVA 1M6KA 4OH0A 4MN5A 3R7WA 3VP2A 2J3TC 1DP8A 1ZG6A 3PBOA 1PWGA 1E3UD 1S66L 4DF6A 3SH9A 2LB5A 2XF3A 3B42A 1NYMA 1IKIA 5F82A 3MF0A 4IJGA 4JXGA 1T1BA 2VA0A 3NJAA 3PAEA 1YAXA 3OPPA 5EOOA 2QJ5A 1S0WA 1MXOA 3S7OA 1JWZA 4NKPA 2GNXA 4WEKA 1W8QA 4ZJ1A 1SKOA 2WKIA 4JGPA 4LRYC 5F1FA 1ES5A 4NG2A 3WS1A 1K57C 3UE1A 1VB6A 5J8XA 4UAAA 3CPTB 4IUKA 3A3DA 4EERA 3KYQA 4BL3A 2XSSA 5KSCA 4MN7A 4Y0UA 2KOIA 1O7EA 4PKYG 4KZ9A 4GW9A 4I3JA 2Y2IA 4GS9B 2MJ6A 2Y55A 3O5YA 5FQIA 4ETXA 5GLAA 3VFFA 1K4EA 4WL9A 1RP5A 5DF8A 2PYPA 3NDEA 5HL1A 5EVIB 4JBFA 4KUKA 3C2WA 3N8LA 3HLWA 4KZAA 5L07A 2PBYA 1EI5A 1NXYA 4HH2A 4NXBA 4KQQA 3NCKA 2EX2A 3LIFA 1KE4A 1VHMA 2ZOIA 3BFFA 4MBFA 1ZKJA 3MXQA 5HD5A 2ZOHA 1E3UA 1JNUA 2A24A 1IOUA 4WUJA 2ZMAA 4G3KA 5M18A 1SDEA 1MWTA 4HP9A 2WKHA 3K3DA 4H6JA 1FR1A 3CHWP 1T19A 2JKRI 1RGYA 4E3OA 3VE3A 5F6AA 3F1PB 4R38A 2J80A 4P87A 2IA2A 4DN0A 3GQZA 3KSGA 5DTSA 5E2EA 4KG6A 2QZ6A 5BOHA 1TF1A 5E2FA 3UMDA 1K38A 1DJBA 4M3KA 3GMWA 5HAQA 4LGWA 2VLGA 3H7WB 2VEAA 5E43A 1FCOA 2EX9A 3D9YA 4L9EA 1CQAA 3ZYTA 3GTCA 4WZ4A 3CLOA 1LI0A 1KOUA 2P04A 2W27A 4HIAA 1LL8A 3IHAA 3I7JA 4Y13A 2R78A 2WGWB 1J3WA 3VFHA 1ZHHB 4JLFA 2O0YA 2Y2PA 4GD8A 4O7DA 4R23A 5HL6A 3NOUC 3HLCA 3F1NA 2V0WA 2RCXA 4EV4A 1MBLA 4MNRA 5CEDA 2VKSA 3BFEA 3UY6A 4R4RA 4OPZA 3T4QA 1OMEA 2HDQA 4KZ7A 1XFQA 1K54C 1STZA 4BBUA 1UWNX 5FQMA 3QNCA 4IBXA 1Z6FA 3MXRA 1GA0A 4G3WA 4Z9QA 2R9WA 1I2SA 1T18A 5FI6A 1OTBA 1N9LA 5FI7A 2VV8A 4WN5A 4K0XA 1OJGA 3LR0A 2WZXA 2XGNA 3V5MA 3PYPA 1CJFA 3NY4A 1CEFA 2EX6A 4LRXC 1U60A 3ICYA 1BTLA 1VETA 1NJ4A 1DJAA 4DDYA 3AGFA 4MBKA 3VOLA 3ISGA 1IYSA 2EXBA 1VQQA 5FQQA 1TS0A 2H10A 3C4PA 1EW0A 2KLIA 2W3EA 1L0EA 3TW8A 1FCMA 5EFWA 3VSKA 2RL3A 4QY5A 4IUHA 2HJEA 3N6IA 2HJ9C 1M40A 3SOIA 2NUTC 3ZFZA 3LYXA 5TFQA 4O8GA 1WYBA 4L0LA 1YPRA 3IX4A 1S4SA 3PBSA 1CEGA 1MKIA 2O9AA 2R9XA 3CG5A 4QB8A 4RVAA 1W5DA 3O88A 5DVAA 3O86A 2H0YA 2Y8HA 1ERQA 3B33A 5FQ9A 3V39A 3UPOA 1PW1A 4DJ3A 3IT9A 1YKDA 5A92A 4GB7A 3SH8A 3JYIA 1MC0A 4PM9A 5FAPA 1X0OA 1SZVA 4XUZA 5KIZA 3HUMA 3IBJA 5G18A 2X71A 3MJQA 4U3TA 3NI9A 2M1CA 4BQMA 4DE3A 3KSIA 3W4PA 1NZUA 1OT9A 3CWFA 2WKEA 2YKHA 4MEZA 5J3WA 5HPIA 5GLBA 4DRTA 2ZQ7A 3LICA 4ID4A 4LV1A 3T4JA 2JN7A 1Y54A 3E4OA 2E8IA 3ZG7B 2EFXA 5J4EA 2J8YA 3IWIA 5EVID 5A90A 2P9VB 4HEFA 4KG2A 3RXXA 4F3LB 1VM1A 4PM5A 5DTKA 1D7EA 1K55A 4MDZA 3NHQA 1CK3A 4YOFA 4C6YA 1NYYA 3OCLA 5F1GA 4CPKA 4BJPA 2OAQ1 3ZNYA 3N7WA 4KQOA 4KZ6A 2ZD8A 3HJKA 3OPRA 4GLQA 1W79A 1FSYA 2O99A 5HPFA 4EESA 3Q1FA 1OT6A 2VK3A 3P09A 3G32A 3HCYA 3QP2A 4JKTA 4UEYA 4JGQA 1L3LA 1KDWA 4QPRA 2PU2A 3VOZA 3M6BA 3FYZA 3WRTA 5TBMA 1HLUP 1PFLA 4RA7A 3MQQA 5L10A 3EEAA 1MWSA 5EUAA 1GHIA 5FAOA 4EBPA 2XR0A 5GLDA 1BSGA 1T1AA 1BLCA 3UDFA 3E2KA 3BY9A 4IVIA 5FA7A 3F1OA 2OV5A 3U4LP 4BMWA 4KZ5A 1ALQA 3BLMA 3KSFA 3CUEC 3T1QB 4WEJA 1XJ4A 4HQAA 3FKWA 5HAPA 1YLJA 1LI9A 2OAP1 1DJCA 3UNWA 2XH9A 1HTZA 3G34A 3P7NA 3QHYA 3KYZA 4P85A 3P98A 4K08A 2PD7A 3IH8A 3IWQA 4OOLA 2H0TA 1K56D 1JVJA 4ZTKA 5AQ9A 2PR6A 3UDXA 4Y0TA 4CLCA 2QJ7A 4FCFA 4S2OA 2HDRA 1DRMA 4LENA 5CGSA 4GN2A 3S22A 4LV2A 2PU4A 1L0GA 1S1YA 1JWPA 3LUQA 4GDBA 3DTEA 1K6SA 4XT2B 2XFTA 3PBRA 1MY8A 5IHVA 4FD8A 4JPMA 4OQGA 1Y4OA 4I3AA 3HLDA 4DXCA 5CERA 3LR3A 1ZG4A 2FH5A 2Y2NA 5TJJA 3A3IA 4OPRA 5L8MA 2JCHA 3LY3A 5A8BA 4LPZA 4EUZA 2XRNA 1FSWA 4OPQA 2V1BA 5KZHA 4LLOB 5FI2A 2JBFA 4MLLA 1YQSA 2W1RA 2QWSA 4B88A 3BFCA 4DE0A 1I2WA 2ZQCA 3M2JA 4GNUA 4S2JA 3G6OA 4OOYA 1OJ5A 1W8YA 1WE4A 2ZL1B 3AGEA 1D1JA 1NY0A 1BLHA 3VP4A 3V3SA 4HJ4A 1C3BA 1DP6A 4BL2A 2L1MA 1XXMA 2ZC5B 4XXRA 1K4FA 4C75A 4BD0A 3Q7VA 3SW1A 4R4SA 3V50A 2XD5A 5DJUA 1W63Q 1N9OA 2X01A 2XD1A 3GV9A 5GHXA 4JF5A 3SS4A 3WS2A 3IXDA 2A49A 2L0WA 3T4TA 3UPPA 4K0WA 3NECA 3H9WA 1VEUA 3UDIA 1IYPA 4WBGA 3EQUA 3KYEA 1H8MA 3MS6A 4UHUA 5EOEA 1GHPA 2PBDP 3T1SA 2A3UA 4S2NA 1SHVA 2XQZA 4ME4A 2V0UA 1GSXA 2DNSA 2VV6A 5TR7A 5E2HA 3QP5A 1D06A 4E3IA 4UQIS 2Y4AA 3BJNA 2GZAA 5GLCA 5G4YA 1OTAA 3T1XA 3CMZA 1Q2PA 4S2PA 2EWVA 4GHIA 2JKFA 2WKQA 4WM9A 5EPHA 3UE6A 5HWVA 5GL9A 5FEGA 3MZFA 4OQHA 5DFYA 4X53A 3OPHA 3OOVA 3Q7ZA 3BRMA 5FATA 1F5MA 1PWCA 1OPXA 2INWA 4N92A 3EGDC 3UB8A 3G2ZA 2PAVP 3IF6B 1ESIA 4YNRA 1KGEA 3QP6A 4GJ4A 1HVBA 4PMAA 2WUQA 1F2KA 1K55C 5CX7A 4LCMA 1YM1A 5HAIA 1P9RA 4YINA 4HNBA 4RX3A 4HH3A 4R0QA 5K5BA 3RH8B 3PBNA 4E6WA 4BWIA 4ZJ2A 1IEMA 3E98A 4B4ZA 4ZJ3A 4FUWA 3ZVWA 3IF5A 5FQKA 4I5SA 1EROA 4R3BA 3A0VA 4Z1WA 3UB9A 3EGXC 1ONHA 3ITAA 1HD8A 1XJ3A 3MXSA 2PDRA 3DTMA 2K31A 4R6LA 3CZDA 1PI4A 4DJ2A 2HF6A 4WMCD 2VGLM 3VMAA 5HDDA 2J3TD 1LHYA 4UA7A 5AVEA 2PR5A 3FZCA 5HARA 3JVUA 5F5YA 2BLSA 3G2YA 1HZOA 3JVVA 3MQ0A 4O0PA 3IX8A 3NULA 2VGJA 2Z2LB 4RYEA 1PZPA 2KDKA 3T4KA 4D2OA 1BZAA 4E6XA 4OP5A 3R7WB 1BUEA 2D01A 4UA6A 3UB6A 3MSHA 4DKIA 4X56A 5CEBA 2ZC6B 4IVKA 2VGKA 1XA1A 2XA7M 1YLWA 3IF6C 5FSRA 3LI8A 1TVFA 4CQHA 5EECA 4M4XA 2B95A 3IX3A 3G4PA 4CLCC 1SKOB 2G2UA 3DAVA 3IXGA 2X02A 5FDHA 2ACGA 4KZ3A 1BULA 1CI9A 5CHJA 3IXBA 2IWCA 2WKRA 1E4DA 1RCJA 2ZQ9A 3BFGA 4EEUA 4AFIA 1YSPA 4L9FA 1FCNA 1JTGA 4WMCA 3TRCA 3UE3A 5G4ZA 4JXWA 2W0NA 3VP0A 2Y2GA 2ZMVA 4Y7PA 3C8CA 2HDSA 1YLZA 3MFXA 4NXGA 3BLSA 4WYYA 3D3OA 3SS3A 5CGXA 3N8RA 4S2LA 2D02A 1KGFA 1CF0A 3MQOA 2XK1A 5EVLA 2HP9A 4KZ8A 2ZC4B 4X55A 3S7QA 1SCWA 2CC1A 3C30A 4E04A 2A24B 2V20A 3RXWA 1K57A 2HDUA 1S6RA 4GKUA 3LEQA 4H6JB 5FDSA 3KO6A 4EEPA 4I39A 1ES4A 5GHYA 3UMEA 4X1MA 1O07A 1FR6A 3VP1A 4NEED 3GR2A 4PHTA 4EBNA 3VP3A 3S7NA 4PM7A 4Q8IA 4OKPA 4DXBA 1P9WA 2Y91A 4JGRA 5D3OA 3MKFA 4HBTA 1WA9A 3LO7A 1YLTA 3IS2A 4HY8A 3KX0X 3D4FA 3N8SA 1XA7A 1LSXA 3PR6A 3VE4A 3SH7A 5HDSA 4ARZA 4RQ9A 3LGOA 2XLNA 2V8CA 5F68A 5CECA 2J7VA 3F1NB 2KX6A 4I38A 2ZM2A 5HZHA 1KE0A 1XP4A 4S2NC 4X1LA 3NDGA 2Z2MB 3MZDA 4FH4A 1QMFA 3E2LA 2WGVA 4OQIA 1LT0A 4R1GA 5AQBA 4ZAMA 4WF0A 5CHMA 4QY6A 5E2GA 4S2IA 4CJNA 3K3CA 1IKGA 1K0KA 4GOGA 3ZVTA 3KSHA 4KG5A 3Q07A 4ZRRA 3IQAA 1NRFA 2VV7A 4N9KA 4PAUA 3E0YA 1YMSA 3CPTA 4OVDA 3BM6A 3A3EA 4IHQA 3TSGA 2O9BA 1VETB 3BEBA 3HLFA 1V9ZA 2BTFP 5DFXA 1N4OA 4GS9A 2V9AA 2DRWA 5I5LA 4D60A 4Y0OA 5M19A 3HLGA 4LRZE 5DJTA 1T1CA 1TS7A 2O9CA 3L7HA 4NK3A 4OONA 5EVIA 3L9KA 2I72A 2FFFB 2OLUA 1MWUA 5EV0A 3IXHA 5FQJA 4ESPA 2QKPA 4YWZA 1PYYA 1V9YA 5TGFA 3OCNA 3RJUA 3D72A 4P0MA 4N1XA 1YSQA 4KQDA 2J9PA 1G5UA 3LEZA 3BQAA 3PBQA 1KGGA 1N9NA 3HBRA 1S67L 3LFVA 2EX8A 4K91A 4KUOA 3A0SA 3F1PA 3FKVA 4EQ1A 5CRFA 5M1AA 5IT5A 2G7UA 2BG1A 3MZEA 1H5XA
chains in the Genus database with same CATH topology
1OJGA 3LR0A 4UQIS 3PYPA 3T4LA 1OTEA 3BJNA 3T4OA 2GZAA 1BYWA 4LRXC 3H82B 5G4YA 3R4KA 1OTAA 3ICYA 2JHEA 4HHDA 5HWWA 2EWVA 4GHIA 3OC2A 2WKQA 1GSWA 3UE6A 2BASA 5HWVA 4FSFA 2YKFA 5DFYA 4BBVA 4CLCE 5HSQA 3VOLA 3OOVA 2GJ3A 1F5MA 5MC7A 1Y28A 2JKTM 1OPXA 2FZ0A 2INWA 3EGDC 1H3QA 2W3HA 3GECA 3UB8A 2HV1A 1TS0A 2M7UA 4YNRA 1EW0A 4GJ4A 2KLIA 2W3EA 2W3DA 3TW8A 4BBTA 3LR4A 4CLCD 1IFQA 5CX7A 4ETZA 5EFWA 3P01A 4GCZA 4IUHA 5DKLA 3PXPA 2HJEA 4WELA 1P9RA 2HJ9C 5IS1A 2W3GA 1LSWA 4HNBA 3T4SA 1G28A 4HH3A 4Q0HA 5K5BA 3RH8B 2NUTC 3PBNA 3LYXA 2W1TB 4BWIA 4O8GA 3E98A 2JKTI 2Z6CA 4MN6A 5J7EA 4I3IA 3LIAA 4L0LA 1S4SA 4P6ZM 3PBSA 3CITA 2PHYA 2O9AA 3CAXA 4I5SA 4JGOA 4EU0A 3A0VA 3T50A 4Z1WA 3UB9A 2Y8HA 3B33A 1UWPX 3EGXC 4PKYA 1XJ3A 2HGVA 2PDRA 2OOLA 2K31A 2QYBA 4R6LA 4EXOA 4DJ2A 2HF6A 4NXEA 3W2ZA 1GSVA 2VGLM 4DJ3A 5HDDA 2J3TD 5AVEA 1YKDA 5HD3A 4Q0JA 2EWWA 2L4RA 2PR5A 4MMNA 2I9VA 3JVUA 1MC0A 5F5YA 3HJIA 1X0OA 4II7A 2VZWA 3JVVA 3MQ0A 4O0PA 5KIZA 4G3VA 3IBJA 3BQ8A 2H28A 3MMHA 4O01A 5AJGA 3MJQA 3B47A 2WKPA 5KSHA 3EOIA 5TBMB 1NLZA 2M1CA 3T4KA 2KDKA 3KSIA 1G6OA 1OT9A 2PYRA 3CWFA 5C5KA 2VJWA 3R7WB 2YKHA 2D01A 5J3WA 4L9GA 3UB6A 5HPIA 5LBRA 2V1AA 3LICA 2XROA 2J3WA 3F1OB 3T4JA 2JN7A 4HP4A 3E4OA 2VGLS 2GX5A 2PD8A 4Y3IA 1DP9A 3K2NA 2LB9A 2XA7M 5F69A 2B18A 5J4EA 2K7SA 3E4QA 1S1ZA 4F3LB 3H7WA 2B02A 3U2AA 3V67A 1D7EA 4MDZA 3C38A 3NHQA 3LI8A 4YOFA 4CQHA 4M4XA 1F9IA 2OWHA 3OCLA 4CLCC 4EETB 3DBAA 2W3FA 1LSVA 3EQVA 3FG8A 3A0RA 3RFBA 1MKMA 4BJPA 2OAQ1 3LIBA 1ZTUA 4KQOA 2WKRA 4GLQA 3HJKA 4HOIA 4Y5FA 2DMWA 4AFIA 4EEUA 2O99A 5HPFA 1YSPA 1ODVA 4EESA 2K2NA 3FPWA 3OBFA 1OT6A 4L9FA 4R70A 2NUPC 3TRCA 3IS2B 3UE3A 3ZQ5A 3HCYA 5HDCA 4B9OA 2XA7S 4UEYA 4JGQA 5G4ZA 2A2LA 4CLCB 4MCWA 2W0NA 4EW7A 2ZMVA 4DMZA 4QPRA 2Z6DA 3GDIA 1XJ2A 2PT7A 3C8CA 4ARZB 5TBMA 3MFXA 4NXGA 3CUEA 1S4RA 3D3OA 3MQQA 3FPVA 3NOPC 4OOMA 3EEAA 1TS8A 3E4PA 4MN5A 3R7WA 1T1AA 1OTDA 2D02A 2J3TC 3MQOA 1DP8A 3PBOA 5IU1A 3BY9A 3F1OA 3S7PA 4BMWA 1S66L 2LB5A 3S7QA 1NWZA 3C30A 3B42A 2ZBBA 2A24B 3KSFA 4E04A 1P97A 3CUEC 3MF0A 4IJGA 1XJ4A 4HQAA 3H82A 1T1BA 4WEJA 2VA0A 3LIEA 3NJAA 4F3LA 1YAXA 2EA9A 2OAP1 3TE8A 5AVFA 2QJ5A 4H6JB 3P7NA 3UB7A 3OLOA 3KO6A 3S7OA 3KYZA 4EEPA 4NKPA 2GNXA 4I39A 4WEKA 3UMEA 3EEHA 3IBRA 4P6ZS 4K08A 4NEED 2PD7A 4JGPA 4PHTA 4LRYC 3S7NA 1VB6A 4OOLA 1P9WA 4IUKA 4EERA 4JGRA 3KYQA 2XSSA 1WA9A 4FOFA 4HI4A 3IS2A 2PR6A 4HY8A 1NRJA 4MN7A 4Q0IA 3KX0X 4HJ6A 2KOIA 4CLCA 2QJ7A 4PKYG 2P08A 4GW9A 4I3JA 2ZMFA 2W1TA 4GS9B 1LSXA 3PR6A 2MJ6A 3VE4A 3O5YA 5HDSA 4ARZA 4ETXA 1DRMA 4RQ9A 5DF9A 4WL9A 2PYPA 1S1YA 3CI6A 3LUQA 3C2WA 4KUKA 5F68A 4XT2B 3PBRA 4HH2A 1W63M 4NXBA 3LIFA 2JKRM 1VHMA 3F1NB 2ZOIA 5HD5A 3BWLA 3MXQA 2KX6A 4I38A 3RTYA 5HZHA 5DKKA 2ZOHA 4I3AA 1JNUA 2A24A 1IOUA 3LR3A 4WUJA 1XFNA 2FH5A 4G3KA 4NXFA 5TJJA 4HP9A 5L8MA 4HJ3A 2OWJA 5A8BA 4LPZA 3K3DA 1LT0A 2XRNA 4H6JA 4WLAA 1T19A 2JKRI 4WF0A 3VE3A 2V1BA 1F98A 4LLOB 5F6AA 3K3CA 3F1PB 4R38A 2J80A 1P0ZA 2IA2A 2P7JA 3MR0A 4DN0A 2CMNA 3TJZC 3BW6A 3KSGA 3BY8A 3KSHA 2W1RA 2QWSA 4ZRRA 2M7VA 2VV7A 5FL3A 1TF1A 4R3AA 4PAUA 3G6OA 3E0YA 5HWTA 3UMDA 1OJ5A 3LR5A 4IHQA 2VX8A 2VLGA 2O9BA 3H7WB 2VEAA 3PBTA 4GHIB 1V9ZA 4L9EA 5DFXA 3ULFA 3ZYTA 3CLOA 1KOUA 4GS9A 4HJ4A 2V9AA 1DP6A 5I5LA 3LI9A 2L1MA 2P04A 2W27A 4HIAA 4LRZE 4Y2FA 1T1CA 1TS7A 5DJTA 1LL8A 2O9CA 2R78A 3SW1A 1NLYA 1OTIA 3LIDA 1ZHHB 2O0YA 4XT2A 5DJUA 1W63Q 1N9OA 5HL6A 3NOUC 3F1NA 3FC7A 2V0WA 3PHYA 2Y79A 4UQIM 3EWKA 2QKPA 4YWZA 1V9YA 2VKSA 2L0WA 1XJ6A 3T4TA 3NOTC 4B93A 3OCNA 1TS6A 3D72A 3T4QA 1UGUA 3H9WA 1MZUA 1YSQA 1XFQA 4KQDA 3EQUA 1H8MA 4EUVA 1TD5A 3BQAA 3PBQA 2QHKA 1STZA 4BBUA 1N9NA 1UWNX 1S67L 4G3WA 3LFVA 4KUOA 3A0SA 3F1PA 4ME4A 4EQ1A 2V0UA 5IT5A 1T18A 1GSXA 1OTBA 1N9LA 2G7UA 2VV8A 3VV4A 4WN5A 2VV6A 1D06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IBJ A;  2XRN A;  3MMH A;  4O01 A;  5AJG A;  3S7P A;  2LB5 A;  3S7Q A;  3BJN A;  3KSI A;  3KSF A;  4E04 A;  4LRX C;  3R4K A;  2IA2 A;  5C5K A;  4DN0 A;  2VJW A;  3MF0 A;  4IJG A;  3KSG A;  3KSH A;  2W1R A;  5HPI A;  4ZRR A;  2M7V A;  5LBR A;  2XRO A;  1TF1 A;  4PAU A;  3G6O A;  3E0Y A;  5DFY A;  5HSQ A;  3KO6 A;  3S7O A;  3OOV A;  2GX5 A;  4Y3I A;  1F5M A;  3IBR A;  3K2N A;  2LB9 A;  2W3H A;  2B18 A;  2O9B A;  4LRY C;  2VEA A;  2M7U A;  4YNR A;  5DFX A;  2KLI A;  2W3E A;  3S7N A;  2W3D A;  5I5L A;  4ETZ A;  4LRZ E;  4IUK A;  4MDZ A;  4Y2F A;  4IUH A;  3NHQ A;  4YOF A;  2O9C A;  4CQH A;  2W3G A;  2XSS A;  4FOF A;  4MN7 A;  4Q0I A;  2O0Y A;  3DBA A;  2W3F A;  4Q0H A;  5K5B A;  2KOI A;  2W1T B;  4BWI A;  4GW9 A;  4O8G A;  3RFB A;  3E98 A;  5HL6 A;  3NOU C;  1MKM A;  2ZMF A;  1ZTU A;  2W1T A;  4GLQ A;  2Y79 A;  3O5Y A;  3CIT A;  4ETX A;  4Y5F A;  4RQ9 A;  2O9A A;  2O99 A;  5HPF A;  1YSP A;  2K2N A;  3OBF A;  2VKS A;  4R70 A;  4EU0 A;  3TRC A;  3NOT C;  3CI6 A;  3C2W A;  3ZQ5 A;  3HCY A;  4Z1W A;  2Y8H A;  4MCW A;  1YSQ A;  4DMZ A;  2HGV A;  2OOL A;  2K31 A;  2QYB A;  4QPR A;  4R6L A;  1VHM A;  4EUV A;  1TD5 A;  1STZ A;  3W2Z A;  4G3W A;  3D3O A;  3LFV A;  1YKD A;  3NOP C;  4Q0J A;  3EEA A;  4ME4 A;  4MMN A;  4G3K A;  1MC0 A;  5TJJ A;  2G7U A;  5L8M A;  2VZW A;  3VV4 A;  3MQ0 A;  4O0P A;  4G3V A; 
#chains in the Genus database with same CATH topology
 2Y2Q A;  1BLS A;  3T4O A;  1FIK A;  4Y15 A;  3HLB A;  1YMX A;  1PWD A;  2JHE A;  1XKZ A;  1JTD A;  3DTK A;  5HWW A;  2HP6 A;  4X68 A;  1GSW A;  3DWK A;  2BAS A;  1PW8 A;  4EWF A;  1G68 A;  2AVX A;  4BBV A;  5HSQ A;  2GJ3 A;  2WGW A;  2JKT M;  2W3H A;  5A93 A;  2HV1 A;  4RX2 A;  2M7U A;  4YFM A;  1SDN A;  2W3D A;  4BBT A;  3LR4 A;  1BLP A;  4WZ5 A;  4N9L A;  4ETZ A;  1H0M A;  3P01 A;  4GCZ A;  3ZNT A;  3PXP A;  5IS1 A;  4LV0 A;  1LSW A;  3T4S A;  1G28 A;  4C3Q A;  1Z09 A;  1K25 A;  4E3J A;  5DF7 A;  3HLE A;  4KZ4 A;  2ZQD A;  2OLV A;  4ZDX A;  3PTE A;  1K56 A;  4MN6 A;  3LIA A;  2WGI A;  5EM1 A;  3ZG0 A;  1IYO A;  4FH2 A;  2OSU A;  5FAS A;  2WZZ A;  2DCF A;  3T50 A;  3FWL A;  3C4O A;  3QP8 A;  1TDL A;  1ZC2 A;  3BYD A;  1PIO A;  1ONG A;  2OOL A;  1FQG A;  2P74 A;  2JE5 A;  4NXE A;  4XUX A;  3W2Z A;  5I94 A;  1N9B A;  3BFD A;  3CJM A;  3OPL A;  4PPR A;  5HD3 A;  4EQI A;  4Q0J A;  2EWW A;  2L4R A;  1L0D A;  4LFU A;  4OPY A;  3ZDJ A;  4NET A;  3UN7 A;  4G3V A;  3BQ8 A;  2H28 A;  3M6H A;  3MMH A;  3QP1 A;  2WKP A;  5KSH A;  3EOI A;  5TBM B;  1NLZ A;  3ZG8 B;  1XGI A;  1LL9 A;  2H5S A;  2PYR A;  2E8J A;  5C5K A;  2ZC7 A;  2V1Z A;  1Q2Q A;  3WS5 A;  3GVB A;  1ES3 A;  5LBR A;  2XRO A;  3MFD A;  3F1O B;  5HW3 A;  4HP4 A;  2GX5 A;  1DP9 A;  1FIL A;  3HUN A;  3NC8 A;  2LB9 A;  2B5R A;  2B18 A;  2QMI A;  3VSL A;  2K7S A;  5FAQ A;  3E4Q A;  4KQR A;  2UV0 E;  2B02 A;  3U2A A;  3V67 A;  3C38 A;  1FOF A;  1PNE A;  2OWH A;  3DBA A;  3UE0 A;  2W3F A;  1IYQ A;  3EQV A;  3FG8 A;  3ZCZ A;  2ZQ8 A;  1MKM A;  3LIB A;  2HPB A;  3O87 A;  4HOI A;  5AQA A;  2DMW A;  3FPW A;  2NUP C;  5CGW A;  4CLC B;  4PM8 A;  3ZG5 A;  4DMZ A;  4JXV A;  2G2W A;  1NZO A;  3GDI A;  1TEM A;  1XJ2 A;  2PT7 A;  3JPU A;  3C7U A;  2Y2O A;  4QJG A;  5U47 A;  5HX9 A;  2ZM8 A;  1S4R A;  3CUE A;  3NOP C;  4OOM A;  2JKG A;  1TS8 A;  3E4P A;  2HP5 A;  4E3N A;  1OTD A;  1IEL A;  3C7V A;  5IU1 A;  3BEC A;  3S7P A;  4BEN A;  1I5Q A;  1NWZ A;  2ZBB A;  5L09 A;  1P97 A;  1A0K A;  1J9M A;  2C5W B;  3H82 A;  1K6R A;  2P9V A;  3LIE A;  4F3L A;  2EA9 A;  3TE8 A;  5AVF A;  3UB7 A;  3OLO A;  1GCE A;  2XEP A;  3EEH A;  3IBR A;  4P6Z S;  1KVL A;  3B3X A;  1BT5 A;  3W4Q A;  2C6W B;  1ACF A;  3C5A A;  1KVM A;  3QP4 A;  4LV3 A;  3HUO A;  1LLB A;  5EVI C;  3IHB A;  1MPL A;  2IWB A;  4FOF A;  1CI8 A;  4HI4 A;  3Q81 A;  4QHC A;  1NRJ A;  4Q0I A;  4HJ6 A;  2P08 A;  2UWX A;  2ZMF A;  2W1T A;  4IED A;  4X25 A;  4JF4 A;  5DF9 A;  4P6B A;  3Q7V B;  4X6T A;  3GSG A;  1ESU A;  3CI6 A;  3WS0 A;  1W63 M;  1KDS A;  2EFU A;  2JKR M;  4A5R A;  2Y2K A;  4U0X A;  3HRE A;  3BWL A;  1E25 A;  3RTY A;  4EBL A;  5DKK A;  3FV7 A;  2WYX A;  1XFN A;  5EVE A;  3MKE A;  4NXF A;  3S4X A;  3A3F A;  2ZLY A;  1VEU B;  4JF6 A;  4HJ3 A;  2OWJ A;  3IH9 A;  1ES2 A;  4WLA A;  3HVF A;  3TG9 A;  5EE8 A;  1F98 A;  2Y2J A;  2Q0O A;  3QNB A;  1P0Z A;  2P7J A;  3MR0 A;  5CHU A;  2CMN A;  5A91 A;  3TJZ C;  3VOY A;  3BW6 A;  3BY8 A;  3N4I A;  2M7V A;  3GRJ A;  5FL3 A;  4E3M A;  4R3A A;  1H8Y A;  1W7F A;  5HWT A;  1AXB A;  4QWO A;  3LR5 A;  2VX8 A;  4GDN A;  3PAG A;  3PBT A;  4GHI B;  2Y2M A;  3ULF A;  4WZ5 C;  1DY6 A;  3G31 A;  2Q9N A;  2WAE A;  3LI9 A;  4Y2F A;  2QPN A;  3DWZ A;  2Q9M A;  5F83 A;  1NLY A;  1OTI A;  3UB5 P;  1RGZ A;  3LID A;  3W4O A;  4XT2 A;  3ZG9 B;  4S2K A;  1YLY A;  3G30 A;  3FC7 A;  4KEN B;  3PHY A;  5CTM A;  2Y79 A;  4UQI M;  3EWK A;  4N1H A;  4DE1 A;  1XJ6 A;  3NOT C;  4B93 A;  1TS6 A;  2ZM0 A;  1UGU A;  3HL9 A;  3MBZ A;  5KMW A;  4F94 A;  1MZU A;  2ZQA A;  1QME A;  3G35 A;  2V2F F;  3ITB A;  3M2K A;  4EUV A;  1TD5 A;  5JYP A;  2QHK A;  4UA9 A;  4DDS A;  4QU3 A;  2IWD A;  3AGD A;  3DTI A;  3VV4 A;  4E3L A;  4BD1 A;  3T4L A;  1OTE A;  4DE2 A;  2ZL1 A;  1BYW A;  3H82 B;  3R4K A;  3SS5 A;  4HHD A;  5HFO A;  3OC2 A;  1XGJ A;  4FSF A;  2YKF A;  4CLC E;  4MBH A;  1H8Z A;  4IBR A;  3LCE A;  5GHZ A;  5MC7 A;  2JC7 A;  1Y28 A;  2FZ0 A;  2Y2L A;  5JYO A;  1H3Q A;  1LL5 A;  3GEC A;  4OLG A;  4ZBE A;  3S1Y A;  4HBU A;  3WWX A;  1YT4 A;  3NBL A;  4CLC D;  1IFQ A;  1MWR A;  4GD6 A;  3Q82 A;  5DKL A;  4WEL A;  2W3G A;  4PM6 A;  3A3J A;  4Y17 A;  4JXS A;  1YLP A;  4R3J A;  5FEF A;  4Q0H A;  1PRQ A;  2W1T B;  4HES A;  1SKF A;  2JKT I;  2Z6C A;  5J7E A;  4I3I A;  4P6Z M;  2Y2H A;  3CIT A;  2PHY A;  1L0F A;  3CAX A;  5CXW A;  2WK0 A;  4JGO A;  4EU0 A;  4GZB A;  2J9O A;  1UWP X;  4PKY A;  4OQ0 A;  4OP8 A;  2HGV A;  5AQ7 A;  2QYB A;  4U0T A;  2ZC3 B;  4EXO A;  1GSV A;  1K54 A;  1XX2 A;  4BLM A;  1GA9 A;  2WAF A;  4MMN A;  2I9V A;  3HJI A;  3ZGA B;  4II7 A;  2VZW A;  2XDM A;  4B4X A;  1GHM A;  4O01 A;  5AJG A;  2PRF A;  2GDN A;  3B47 A;  3W8K A;  1AWI A;  4KZB A;  3LY4 A;  1G6O A;  2VJW A;  3IF6 A;  3T1R A;  3DW0 A;  4L9G A;  3ZHH A;  2V1A A;  2J3W A;  4FTX A;  2VGL S;  2PD8 A;  4Y3I A;  3SZT A;  3K2N A;  3UO9 A;  3OZH A;  5F69 A;  3T12 B;  2HZ5 A;  5CTN A;  1TDG A;  1S1Z A;  1ERM A;  3IWO A;  3H7W A;  4OLD A;  3V3R A;  1F9I A;  3O3V A;  4EET B;  1G6A A;  4S2M A;  3UPN A;  3WS4 A;  1LSV A;  1KE3 A;  1XPB A;  4H8R A;  3A0R A;  3RFB A;  2Y59 A;  2XFS A;  1ZTU A;  2FFY A;  2ZJ9 A;  3TOI A;  4X69 A;  3WRZ A;  4Y5F A;  1WYC A;  1ODV A;  1PZO A;  2WAD A;  2K2N A;  3OBF A;  4LCL A;  4R70 A;  1EWZ A;  3IS2 B;  3NIA A;  4E3K A;  3ZQ5 A;  5HDC A;  4B9O A;  2XA7 S;  2A2L A;  4MCW A;  4EW7 A;  1JWV A;  2V8F A;  5EM0 A;  4QD4 A;  5DTT A;  2Z6D A;  1PI5 A;  4ARZ B;  5L2F A;  2EXA A;  1L2S A;  3FPV A;  1M6K A;  4OH0 A;  4MN5 A;  3R7W A;  3VP2 A;  2J3T C;  1DP8 A;  1ZG6 A;  3PBO A;  1PWG A;  1E3U D;  1S66 L;  4DF6 A;  3SH9 A;  2LB5 A;  2XF3 A;  3B42 A;  1NYM A;  1IKI A;  5F82 A;  3MF0 A;  4IJG A;  4JXG A;  1T1B A;  2VA0 A;  3NJA A;  3PAE A;  1YAX A;  3OPP A;  5EOO A;  2QJ5 A;  1S0W A;  1MXO A;  3S7O A;  1JWZ A;  4NKP A;  2GNX A;  4WEK A;  1W8Q A;  4ZJ1 A;  1SKO A;  2WKI A;  4JGP A;  4LRY C;  5F1F A;  1ES5 A;  4NG2 A;  3WS1 A;  1K57 C;  3UE1 A;  1VB6 A;  5J8X A;  4UAA A;  3CPT B;  4IUK A;  3A3D A;  4EER A;  3KYQ A;  4BL3 A;  2XSS A;  5KSC A;  4MN7 A;  4Y0U A;  2KOI A;  1O7E A;  4PKY G;  4KZ9 A;  4GW9 A;  4I3J A;  2Y2I A;  4GS9 B;  2MJ6 A;  2Y55 A;  3O5Y A;  5FQI A;  4ETX A;  5GLA A;  3VFF A;  1K4E A;  4WL9 A;  1RP5 A;  5DF8 A;  2PYP A;  3NDE A;  5HL1 A;  5EVI B;  4JBF A;  4KUK A;  3C2W A;  3N8L A;  3HLW A;  4KZA A;  5L07 A;  2PBY A;  1EI5 A;  1NXY A;  4HH2 A;  4NXB A;  4KQQ A;  3NCK A;  2EX2 A;  3LIF A;  1KE4 A;  1VHM A;  2ZOI A;  3BFF A;  4MBF A;  1ZKJ A;  3MXQ A;  5HD5 A;  2ZOH A;  1E3U A;  1JNU A;  2A24 A;  1IOU A;  4WUJ A;  2ZMA A;  4G3K A;  5M18 A;  1SDE A;  1MWT A;  4HP9 A;  2WKH A;  3K3D A;  4H6J A;  1FR1 A;  3CHW P;  1T19 A;  2JKR I;  1RGY A;  4E3O A;  3VE3 A;  5F6A A;  3F1P B;  4R38 A;  2J80 A;  4P87 A;  2IA2 A;  4DN0 A;  3GQZ A;  3KSG A;  5DTS A;  5E2E A;  4KG6 A;  2QZ6 A;  5BOH A;  1TF1 A;  5E2F A;  3UMD A;  1K38 A;  1DJB A;  4M3K A;  3GMW A;  5HAQ A;  4LGW A;  2VLG A;  3H7W B;  2VEA A;  5E43 A;  1FCO A;  2EX9 A;  3D9Y A;  4L9E A;  1CQA A;  3ZYT A;  3GTC A;  4WZ4 A;  3CLO A;  1LI0 A;  1KOU A;  2P04 A;  2W27 A;  4HIA A;  1LL8 A;  3IHA A;  3I7J A;  4Y13 A;  2R78 A;  2WGW B;  1J3W A;  3VFH A;  1ZHH B;  4JLF A;  2O0Y A;  2Y2P A;  4GD8 A;  4O7D A;  4R23 A;  5HL6 A;  3NOU C;  3HLC A;  3F1N A;  2V0W A;  2RCX A;  4EV4 A;  1MBL A;  4MNR A;  5CED A;  2VKS A;  3BFE A;  3UY6 A;  4R4R A;  4OPZ A;  3T4Q A;  1OME A;  2HDQ A;  4KZ7 A;  1XFQ A;  1K54 C;  1STZ A;  4BBU A;  1UWN X;  5FQM A;  3QNC A;  4IBX A;  1Z6F A;  3MXR A;  1GA0 A;  4G3W A;  4Z9Q A;  2R9W A;  1I2S A;  1T18 A;  5FI6 A;  1OTB A;  1N9L A;  5FI7 A;  2VV8 A;  4WN5 A;  4K0X A;  1OJG A;  3LR0 A;  2WZX A;  2XGN A;  3V5M A;  3PYP A;  1CJF A;  3NY4 A;  1CEF A;  2EX6 A;  4LRX C;  1U60 A;  3ICY A;  1BTL A;  1VET A;  1NJ4 A;  1DJA A;  4DDY A;  3AGF A;  4MBK A;  3VOL A;  3ISG A;  1IYS A;  2EXB A;  1VQQ A;  5FQQ A;  1TS0 A;  2H10 A;  3C4P A;  1EW0 A;  2KLI A;  2W3E A;  1L0E A;  3TW8 A;  1FCM A;  5EFW A;  3VSK A;  2RL3 A;  4QY5 A;  4IUH A;  2HJE A;  3N6I A;  2HJ9 C;  1M40 A;  3SOI A;  2NUT C;  3ZFZ A;  3LYX A;  5TFQ A;  4O8G A;  1WYB A;  4L0L A;  1YPR A;  3IX4 A;  1S4S A;  3PBS A;  1CEG A;  1MKI A;  2O9A A;  2R9X A;  3CG5 A;  4QB8 A;  4RVA A;  1W5D A;  3O88 A;  5DVA A;  3O86 A;  2H0Y A;  2Y8H A;  1ERQ A;  3B33 A;  5FQ9 A;  3V39 A;  3UPO A;  1PW1 A;  4DJ3 A;  3IT9 A;  1YKD A;  5A92 A;  4GB7 A;  3SH8 A;  3JYI A;  1MC0 A;  4PM9 A;  5FAP A;  1X0O A;  1SZV A;  4XUZ A;  5KIZ A;  3HUM A;  3IBJ A;  5G18 A;  2X71 A;  3MJQ A;  4U3T A;  3NI9 A;  2M1C A;  4BQM A;  4DE3 A;  3KSI A;  3W4P A;  1NZU A;  1OT9 A;  3CWF A;  2WKE A;  2YKH A;  4MEZ A;  5J3W A;  5HPI A;  5GLB A;  4DRT A;  2ZQ7 A;  3LIC A;  4ID4 A;  4LV1 A;  3T4J A;  2JN7 A;  1Y54 A;  3E4O A;  2E8I A;  3ZG7 B;  2EFX A;  5J4E A;  2J8Y A;  3IWI A;  5EVI D;  5A90 A;  2P9V B;  4HEF A;  4KG2 A;  3RXX A;  4F3L B;  1VM1 A;  4PM5 A;  5DTK A;  1D7E A;  1K55 A;  4MDZ A;  3NHQ A;  1CK3 A;  4YOF A;  4C6Y A;  1NYY A;  3OCL A;  5F1G A;  4CPK A;  4BJP A;  2OAQ 1;  3ZNY A;  3N7W A;  4KQO A;  4KZ6 A;  2ZD8 A;  3HJK A;  3OPR A;  4GLQ A;  1W79 A;  1FSY A;  2O99 A;  5HPF A;  4EES A;  3Q1F A;  1OT6 A;  2VK3 A;  3P09 A;  3G32 A;  3HCY A;  3QP2 A;  4JKT A;  4UEY A;  4JGQ A;  1L3L A;  1KDW A;  4QPR A;  2PU2 A;  3VOZ A;  3M6B A;  3FYZ A;  3WRT A;  5TBM A;  1HLU P;  1PFL A;  4RA7 A;  3MQQ A;  5L10 A;  3EEA A;  1MWS A;  5EUA A;  1GHI A;  5FAO A;  4EBP A;  2XR0 A;  5GLD A;  1BSG A;  1T1A A;  1BLC A;  3UDF A;  3E2K A;  3BY9 A;  4IVI A;  5FA7 A;  3F1O A;  2OV5 A;  3U4L P;  4BMW A;  4KZ5 A;  1ALQ A;  3BLM A;  3KSF A;  3CUE C;  3T1Q B;  4WEJ A;  1XJ4 A;  4HQA A;  3FKW A;  5HAP A;  1YLJ A;  1LI9 A;  2OAP 1;  1DJC A;  3UNW A;  2XH9 A;  1HTZ A;  3G34 A;  3P7N A;  3QHY A;  3KYZ A;  4P85 A;  3P98 A;  4K08 A;  2PD7 A;  3IH8 A;  3IWQ A;  4OOL A;  2H0T A;  1K56 D;  1JVJ A;  4ZTK A;  5AQ9 A;  2PR6 A;  3UDX A;  4Y0T A;  4CLC A;  2QJ7 A;  4FCF A;  4S2O A;  2HDR A;  1DRM A;  4LEN A;  5CGS A;  4GN2 A;  3S22 A;  4LV2 A;  2PU4 A;  1L0G A;  1S1Y A;  1JWP A;  3LUQ A;  4GDB A;  3DTE A;  1K6S A;  4XT2 B;  2XFT A;  3PBR A;  1MY8 A;  5IHV A;  4FD8 A;  4JPM A;  4OQG A;  1Y4O A;  4I3A A;  3HLD A;  4DXC A;  5CER A;  3LR3 A;  1ZG4 A;  2FH5 A;  2Y2N A;  5TJJ A;  3A3I A;  4OPR A;  5L8M A;  2JCH A;  3LY3 A;  5A8B A;  4LPZ A;  4EUZ A;  2XRN A;  1FSW A;  4OPQ A;  2V1B A;  5KZH A;  4LLO B;  5FI2 A;  2JBF A;  4MLL A;  1YQS A;  2W1R A;  2QWS A;  4B88 A;  3BFC A;  4DE0 A;  1I2W A;  2ZQC A;  3M2J A;  4GNU A;  4S2J A;  3G6O A;  4OOY A;  1OJ5 A;  1W8Y A;  1WE4 A;  2ZL1 B;  3AGE A;  1D1J A;  1NY0 A;  1BLH A;  3VP4 A;  3V3S A;  4HJ4 A;  1C3B A;  1DP6 A;  4BL2 A;  2L1M A;  1XXM A;  2ZC5 B;  4XXR A;  1K4F A;  4C75 A;  4BD0 A;  3Q7V A;  3SW1 A;  4R4S A;  3V50 A;  2XD5 A;  5DJU A;  1W63 Q;  1N9O A;  2X01 A;  2XD1 A;  3GV9 A;  5GHX A;  4JF5 A;  3SS4 A;  3WS2 A;  3IXD A;  2A49 A;  2L0W A;  3T4T A;  3UPP A;  4K0W A;  3NEC A;  3H9W A;  1VEU A;  3UDI A;  1IYP A;  4WBG A;  3EQU A;  3KYE A;  1H8M A;  3MS6 A;  4UHU A;  5EOE A;  1GHP A;  2PBD P;  3T1S A;  2A3U A;  4S2N A;  1SHV A;  2XQZ A;  4ME4 A;  2V0U A;  1GSX A;  2DNS A;  2VV6 A;  5TR7 A;  5E2H A;  3QP5 A;  1D06 A;  4E3I A;  4UQI S;  2Y4A A;  3BJN A;  2GZA A;  5GLC A;  5G4Y A;  1OTA A;  3T1X A;  3CMZ A;  1Q2P A;  4S2P A;  2EWV A;  4GHI A;  2JKF A;  2WKQ A;  4WM9 A;  5EPH A;  3UE6 A;  5HWV A;  5GL9 A;  5FEG A;  3MZF A;  4OQH A;  5DFY A;  4X53 A;  3OPH A;  3OOV A;  3Q7Z A;  3BRM A;  5FAT A;  1F5M A;  1PWC A;  1OPX A;  2INW A;  4N92 A;  3EGD C;  3UB8 A;  3G2Z A;  2PAV P;  3IF6 B;  1ESI A;  4YNR A;  1KGE A;  3QP6 A;  4GJ4 A;  1HVB A;  4PMA A;  2WUQ A;  1F2K A;  1K55 C;  5CX7 A;  4LCM A;  1YM1 A;  5HAI A;  1P9R A;  4YIN A;  4HNB A;  4RX3 A;  4HH3 A;  4R0Q A;  5K5B A;  3RH8 B;  3PBN A;  4E6W A;  4BWI A;  4ZJ2 A;  1IEM A;  3E98 A;  4B4Z A;  4ZJ3 A;  4FUW A;  3ZVW A;  3IF5 A;  5FQK A;  4I5S A;  1ERO A;  4R3B A;  3A0V A;  4Z1W A;  3UB9 A;  3EGX C;  1ONH A;  3ITA A;  1HD8 A;  1XJ3 A;  3MXS A;  2PDR A;  3DTM A;  2K31 A;  4R6L A;  3CZD A;  1PI4 A;  4DJ2 A;  2HF6 A;  4WMC D;  2VGL M;  3VMA A;  5HDD A;  2J3T D;  1LHY A;  4UA7 A;  5AVE A;  2PR5 A;  3FZC A;  5HAR A;  3JVU A;  5F5Y A;  2BLS A;  3G2Y A;  1HZO A;  3JVV A;  3MQ0 A;  4O0P A;  3IX8 A;  3NUL A;  2VGJ A;  2Z2L B;  4RYE A;  1PZP A;  2KDK A;  3T4K A;  4D2O A;  1BZA A;  4E6X A;  4OP5 A;  3R7W B;  1BUE A;  2D01 A;  4UA6 A;  3UB6 A;  3MSH A;  4DKI A;  4X56 A;  5CEB A;  2ZC6 B;  4IVK A;  2VGK A;  1XA1 A;  2XA7 M;  1YLW A;  3IF6 C;  5FSR A;  3LI8 A;  1TVF A;  4CQH A;  5EEC A;  4M4X A;  2B95 A;  3IX3 A;  3G4P A;  4CLC C;  1SKO B;  2G2U A;  3DAV A;  3IXG A;  2X02 A;  5FDH A;  2ACG A;  4KZ3 A;  1BUL A;  1CI9 A;  5CHJ A;  3IXB A;  2IWC A;  2WKR A;  1E4D A;  1RCJ A;  2ZQ9 A;  3BFG A;  4EEU A;  4AFI A;  1YSP A;  4L9F A;  1FCN A;  1JTG A;  4WMC A;  3TRC A;  3UE3 A;  5G4Z A;  4JXW A;  2W0N A;  3VP0 A;  2Y2G A;  2ZMV A;  4Y7P A;  3C8C A;  2HDS A;  1YLZ A;  3MFX A;  4NXG A;  3BLS A;  4WYY A;  3D3O A;  3SS3 A;  5CGX A;  3N8R A;  4S2L A;  2D02 A;  1KGF A;  1CF0 A;  3MQO A;  2XK1 A;  5EVL A;  2HP9 A;  4KZ8 A;  2ZC4 B;  4X55 A;  3S7Q A;  1SCW A;  2CC1 A;  3C30 A;  4E04 A;  2A24 B;  2V20 A;  3RXW A;  1K57 A;  2HDU A;  1S6R A;  4GKU A;  3LEQ A;  4H6J B;  5FDS A;  3KO6 A;  4EEP A;  4I39 A;  1ES4 A;  5GHY A;  3UME A;  4X1M A;  1O07 A;  1FR6 A;  3VP1 A;  4NEE D;  3GR2 A;  4PHT A;  4EBN A;  3VP3 A;  3S7N A;  4PM7 A;  4Q8I A;  4OKP A;  4DXB A;  1P9W A;  2Y91 A;  4JGR A;  5D3O A;  3MKF A;  4HBT A;  1WA9 A;  3LO7 A;  1YLT A;  3IS2 A;  4HY8 A;  3KX0 X;  3D4F A;  3N8S A;  1XA7 A;  1LSX A;  3PR6 A;  3VE4 A;  3SH7 A;  5HDS A;  4ARZ A;  4RQ9 A;  3LGO A;  2XLN A;  2V8C A;  5F68 A;  5CEC A;  2J7V A;  3F1N B;  2KX6 A;  4I38 A;  2ZM2 A;  5HZH A;  1KE0 A;  1XP4 A;  4S2N C;  4X1L A;  3NDG A;  2Z2M B;  3MZD A;  4FH4 A;  1QMF A;  3E2L A;  2WGV A;  4OQI A;  1LT0 A;  4R1G A;  5AQB A;  4ZAM A;  4WF0 A;  5CHM A;  4QY6 A;  5E2G A;  4S2I A;  4CJN A;  3K3C A;  1IKG A;  1K0K A;  4GOG A;  3ZVT A;  3KSH A;  4KG5 A;  3Q07 A;  4ZRR A;  3IQA A;  1NRF A;  2VV7 A;  4N9K A;  4PAU A;  3E0Y A;  1YMS A;  3CPT A;  4OVD A;  3BM6 A;  3A3E A;  4IHQ A;  3TSG A;  2O9B A;  1VET B;  3BEB A;  3HLF A;  1V9Z A;  2BTF P;  5DFX A;  1N4O A;  4GS9 A;  2V9A A;  2DRW A;  5I5L A;  4D60 A;  4Y0O A;  5M19 A;  3HLG A;  4LRZ E;  5DJT A;  1T1C A;  1TS7 A;  2O9C A;  3L7H A;  4NK3 A;  4OON A;  5EVI A;  3L9K A;  2I72 A;  2FFF B;  2OLU A;  1MWU A;  5EV0 A;  3IXH A;  5FQJ A;  4ESP A;  2QKP A;  4YWZ A;  1PYY A;  1V9Y A;  5TGF A;  3OCN A;  3RJU A;  3D72 A;  4P0M A;  4N1X A;  1YSQ A;  4KQD A;  2J9P A;  1G5U A;  3LEZ A;  3BQA A;  3PBQ A;  1KGG A;  1N9N A;  3HBR A;  1S67 L;  3LFV A;  2EX8 A;  4K91 A;  4KUO A;  3A0S A;  3F1P A;  3FKV A;  4EQ1 A;  5CRF A;  5M1A A;  5IT5 A;  2G7U A;  2BG1 A;  3MZE A;  1H5X A; 
#chains in the Genus database with same CATH homology
 1OJG A;  3LR0 A;  4UQI S;  3PYP A;  3T4L A;  1OTE A;  3BJN A;  3T4O A;  2GZA A;  1BYW A;  4LRX C;  3H82 B;  5G4Y A;  3R4K A;  1OTA A;  3ICY A;  2JHE A;  4HHD A;  5HWW A;  2EWV A;  4GHI A;  3OC2 A;  2WKQ A;  1GSW A;  3UE6 A;  2BAS A;  5HWV A;  4FSF A;  2YKF A;  5DFY A;  4BBV A;  4CLC E;  5HSQ A;  3VOL A;  3OOV A;  2GJ3 A;  1F5M A;  5MC7 A;  1Y28 A;  2JKT M;  1OPX A;  2FZ0 A;  2INW A;  3EGD C;  1H3Q A;  2W3H A;  3GEC A;  3UB8 A;  2HV1 A;  1TS0 A;  2M7U A;  4YNR A;  1EW0 A;  4GJ4 A;  2KLI A;  2W3E A;  2W3D A;  3TW8 A;  4BBT A;  3LR4 A;  4CLC D;  1IFQ A;  5CX7 A;  4ETZ A;  5EFW A;  3P01 A;  4GCZ A;  4IUH A;  5DKL A;  3PXP A;  2HJE A;  4WEL A;  1P9R A;  2HJ9 C;  5IS1 A;  2W3G A;  1LSW A;  4HNB A;  3T4S A;  1G28 A;  4HH3 A;  4Q0H A;  5K5B A;  3RH8 B;  2NUT C;  3PBN A;  3LYX A;  2W1T B;  4BWI A;  4O8G A;  3E98 A;  2JKT I;  2Z6C A;  4MN6 A;  5J7E A;  4I3I A;  3LIA A;  4L0L A;  1S4S A;  4P6Z M;  3PBS A;  3CIT A;  2PHY A;  2O9A A;  3CAX A;  4I5S A;  4JGO A;  4EU0 A;  3A0V A;  3T50 A;  4Z1W A;  3UB9 A;  2Y8H A;  3B33 A;  1UWP X;  3EGX C;  4PKY A;  1XJ3 A;  2HGV A;  2PDR A;  2OOL A;  2K31 A;  2QYB A;  4R6L A;  4EXO A;  4DJ2 A;  2HF6 A;  4NXE A;  3W2Z A;  1GSV A;  2VGL M;  4DJ3 A;  5HDD A;  2J3T D;  5AVE A;  1YKD A;  5HD3 A;  4Q0J A;  2EWW A;  2L4R A;  2PR5 A;  4MMN A;  2I9V A;  3JVU A;  1MC0 A;  5F5Y A;  3HJI A;  1X0O A;  4II7 A;  2VZW A;  3JVV A;  3MQ0 A;  4O0P A;  5KIZ A;  4G3V A;  3IBJ A;  3BQ8 A;  2H28 A;  3MMH A;  4O01 A;  5AJG A;  3MJQ A;  3B47 A;  2WKP A;  5KSH A;  3EOI A;  5TBM B;  1NLZ A;  2M1C A;  3T4K A;  2KDK A;  3KSI A;  1G6O A;  1OT9 A;  2PYR A;  3CWF A;  5C5K A;  2VJW A;  3R7W B;  2YKH A;  2D01 A;  5J3W A;  4L9G A;  3UB6 A;  5HPI A;  5LBR A;  2V1A A;  3LIC A;  2XRO A;  2J3W A;  3F1O B;  3T4J A;  2JN7 A;  4HP4 A;  3E4O A;  2VGL S;  2GX5 A;  2PD8 A;  4Y3I A;  1DP9 A;  3K2N A;  2LB9 A;  2XA7 M;  5F69 A;  2B18 A;  5J4E A;  2K7S A;  3E4Q A;  1S1Z A;  4F3L B;  3H7W A;  2B02 A;  3U2A A;  3V67 A;  1D7E A;  4MDZ A;  3C38 A;  3NHQ A;  3LI8 A;  4YOF A;  4CQH A;  4M4X A;  1F9I A;  2OWH A;  3OCL A;  4CLC C;  4EET B;  3DBA A;  2W3F A;  1LSV A;  3EQV A;  3FG8 A;  3A0R A;  3RFB A;  1MKM A;  4BJP A;  2OAQ 1;  3LIB A;  1ZTU A;  4KQO A;  2WKR A;  4GLQ A;  3HJK A;  4HOI A;  4Y5F A;  2DMW A;  4AFI A;  4EEU A;  2O99 A;  5HPF A;  1YSP A;  1ODV A;  4EES A;  2K2N A;  3FPW A;  3OBF A;  1OT6 A;  4L9F A;  4R70 A;  2NUP C;  3TRC A;  3IS2 B;  3UE3 A;  3ZQ5 A;  3HCY A;  5HDC A;  4B9O A;  2XA7 S;  4UEY A;  4JGQ A;  5G4Z A;  2A2L A;  4CLC B;  4MCW A;  2W0N A;  4EW7 A;  2ZMV A;  4DMZ A;  4QPR A;  2Z6D A;  3GDI A;  1XJ2 A;  2PT7 A;  3C8C A;  4ARZ B;  5TBM A;  3MFX A;  4NXG A;  3CUE A;  1S4R A;  3D3O A;  3MQQ A;  3FPV A;  3NOP C;  4OOM A;  3EEA A;  1TS8 A;  3E4P A;  4MN5 A;  3R7W A;  1T1A A;  1OTD A;  2D02 A;  2J3T C;  3MQO A;  1DP8 A;  3PBO A;  5IU1 A;  3BY9 A;  3F1O A;  3S7P A;  4BMW A;  1S66 L;  2LB5 A;  3S7Q A;  1NWZ A;  3C30 A;  3B42 A;  2ZBB A;  2A24 B;  3KSF A;  4E04 A;  1P97 A;  3CUE C;  3MF0 A;  4IJG A;  1XJ4 A;  4HQA A;  3H82 A;  1T1B A;  4WEJ A;  2VA0 A;  3LIE A;  3NJA A;  4F3L A;  1YAX A;  2EA9 A;  2OAP 1;  3TE8 A;  5AVF A;  2QJ5 A;  4H6J B;  3P7N A;  3UB7 A;  3OLO A;  3KO6 A;  3S7O A;  3KYZ A;  4EEP A;  4NKP A;  2GNX A;  4I39 A;  4WEK A;  3UME A;  3EEH A;  3IBR A;  4P6Z S;  4K08 A;  4NEE D;  2PD7 A;  4JGP A;  4PHT A;  4LRY C;  3S7N A;  1VB6 A;  4OOL A;  1P9W A;  4IUK A;  4EER A;  4JGR A;  3KYQ A;  2XSS A;  1WA9 A;  4FOF A;  4HI4 A;  3IS2 A;  2PR6 A;  4HY8 A;  1NRJ A;  4MN7 A;  4Q0I A;  3KX0 X;  4HJ6 A;  2KOI A;  4CLC A;  2QJ7 A;  4PKY G;  2P08 A;  4GW9 A;  4I3J A;  2ZMF A;  2W1T A;  4GS9 B;  1LSX A;  3PR6 A;  2MJ6 A;  3VE4 A;  3O5Y A;  5HDS A;  4ARZ A;  4ETX A;  1DRM A;  4RQ9 A;  5DF9 A;  4WL9 A;  2PYP A;  1S1Y A;  3CI6 A;  3LUQ A;  3C2W A;  4KUK A;  5F68 A;  4XT2 B;  3PBR A;  4HH2 A;  1W63 M;  4NXB A;  3LIF A;  2JKR M;  1VHM A;  3F1N B;  2ZOI A;  5HD5 A;  3BWL A;  3MXQ A;  2KX6 A;  4I38 A;  3RTY A;  5HZH A;  5DKK A;  2ZOH A;  4I3A A;  1JNU A;  2A24 A;  1IOU A;  3LR3 A;  4WUJ A;  1XFN A;  2FH5 A;  4G3K A;  4NXF A;  5TJJ A;  4HP9 A;  5L8M A;  4HJ3 A;  2OWJ A;  5A8B A;  4LPZ A;  3K3D A;  1LT0 A;  2XRN A;  4H6J A;  4WLA A;  1T19 A;  2JKR I;  4WF0 A;  3VE3 A;  2V1B A;  1F98 A;  4LLO B;  5F6A A;  3K3C A;  3F1P B;  4R38 A;  2J80 A;  1P0Z A;  2IA2 A;  2P7J A;  3MR0 A;  4DN0 A;  2CMN A;  3TJZ C;  3BW6 A;  3KSG A;  3BY8 A;  3KSH A;  2W1R A;  2QWS A;  4ZRR A;  2M7V A;  2VV7 A;  5FL3 A;  1TF1 A;  4R3A A;  4PAU A;  3G6O A;  3E0Y A;  5HWT A;  3UMD A;  1OJ5 A;  3LR5 A;  4IHQ A;  2VX8 A;  2VLG A;  2O9B A;  3H7W B;  2VEA A;  3PBT A;  4GHI B;  1V9Z A;  4L9E A;  5DFX A;  3ULF A;  3ZYT A;  3CLO A;  1KOU A;  4GS9 A;  4HJ4 A;  2V9A A;  1DP6 A;  5I5L A;  3LI9 A;  2L1M A;  2P04 A;  2W27 A;  4HIA A;  4LRZ E;  4Y2F A;  1T1C A;  1TS7 A;  5DJT A;  1LL8 A;  2O9C A;  2R78 A;  3SW1 A;  1NLY A;  1OTI A;  3LID A;  1ZHH B;  2O0Y A;  4XT2 A;  5DJU A;  1W63 Q;  1N9O A;  5HL6 A;  3NOU C;  3F1N A;  3FC7 A;  2V0W A;  3PHY A;  2Y79 A;  4UQI M;  3EWK A;  2QKP A;  4YWZ A;  1V9Y A;  2VKS A;  2L0W A;  1XJ6 A;  3T4T A;  3NOT C;  4B93 A;  3OCN A;  1TS6 A;  3D72 A;  3T4Q A;  1UGU A;  3H9W A;  1MZU A;  1YSQ A;  1XFQ A;  4KQD A;  3EQU A;  1H8M A;  4EUV A;  1TD5 A;  3BQA A;  3PBQ A;  2QHK A;  1STZ A;  4BBU A;  1N9N A;  1UWN X;  1S67 L;  4G3W A;  3LFV A;  4KUO A;  3A0S A;  3F1P A;  4ME4 A;  4EQ1 A;  2V0U A;  5IT5 A;  1T18 A;  1GSX A;  1OTB A;  1N9L A;  2G7U A;  2VV8 A;  3VV4 A;  4WN5 A;  2VV6 A;  1D06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...