2Y79A

Structure of the first gaf domain e87a mutant of mycobacterium tuberculosis doss
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
GAMDPDLEATLRAIVHSATSLVDARYGAMAVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRVRDESFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAVANARLYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REDOX SENSOR HISTIDINE KINASE RESPONSE REGULATOR DEVS
publication title Blockage of the Channel to Heme by the E87 Side Chain in the Gaf Domain of Mycobacterium Tuberculosis Doss Confers the Unique Sensitivity of Doss to Oxygen.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 34
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2y79A00
4IUHA 4GLQA 1MC0A 4G3WA 4ZRRA 2M7UA 3KSHA 5HPFA 4O8GA 4QPRA 2W3FA 2LB5A 5DFYA 4MN7A 2VEAA 4G3VA 4Q0JA 3O5YA 3S7OA 1F5MA 3TRCA 4EU0A 4LRYC 5HPIA 2XRNA 4MDZA 2LB9A 4O01A 2W1TA 2G7UA 5AJGA 4IUKA 3E0YA 1TD5A 2W3HA 3IBJA 3K2NA 4MMNA 2O9BA 4ETXA 3MF0A 3S7QA 4MCWA 4YOFA 3KSFA 2O99A 5I5LA 3EEAA 3IBRA 3S7PA 1YKDA 3HCYA 3OOVA 1TF1A 2GX5A 3LFVA 2W1RA 3MQ0A 3NOTC 4YNRA 2W3GA 3C2WA 2W3DA 2OOLA 1VHMA 4BWIA 4Y2FA 4CQHA 3DBAA 3D3OA 2W1TB 1YSQA 3VV4A 2K31A 3W2ZA 4DN0A 2O9AA 2KOIA 3CI6A 3BJNA 3ZQ5A 3CITA 4DMZA 4Y3IA 5TJJA 2Y79A 1ZTUA 1YSPA 4LRZE 2QYBA 2ZMFA 5DFXA 3KSGA 4EUVA 2IA2A 4O0PA 2W3EA 1STZA 2O0YA 3NOUC 4LRXC 5K5BA 1MKMA 3S7NA 2Y8HA 2B18A 4FOFA 4E04A 4ME4A 3NOPC 2VKSA 4GW9A 4R6LA 3KO6A 3NHQA 2XSSA 4ETZA 5C5KA 5LBRA 2VJWA 4PAUA 5L8MA 2VZWA 5HSQA 3R4KA 4Q0IA 4Y5FA 2K2NA 2HGVA 4R70A 2M7VA 3MMHA 4Q0HA 4RQ9A 3E98A 3G6OA 3KSIA 3RFBA 4G3KA 2KLIA 4Z1WA 2O9CA 2XROA 5HL6A 3OBFA 4IJGA
chains in the Genus database with same CATH superfamily
2EXAA 1MBLA 4JGPA 3H9WA 4QY6A 4LV2A 3PAGA 5IU1A 2P08A 4MN7A 2ZQ7A 2HDUA 5EECA 1K38A 3O5YA 2EA9A 1PW8A 2X02A 3DWKA 4U0XA 2HP6A 3W8KA 2V8FA 3GSGA 3R7WB 4NKPA 2EFXA 5EV0A 1NYMA 3L7HA 1XFQA 5GLCA 4QWOA 3KSFA 5I5LA 4R3JA 4X68A 5AQBA 1NRFA 4Y13A 2H0YA 2W1RA 4I3IA 4NK3A 1ONHA 3UE6A 2PT7A 2W3DA 2W0NA 1ES5A 2HDRA 2JKGA 2XA7S 1LT0A 5FAQA 5G18A 1VEUA 1KGFA 1P0ZA 4WELA 1YPRA 2FFFB 4MBKA 4BD1A 3BLSA 4EERA 1PYYA 2XDMA 3VP3A 2Y2KA 4S2NA 3C8CA 3TSGA 3H7WB 3T1RA 4ZJ2A 3Q1FA 4XUZA 1MXOA 3UB6A 4WEJA 4FOFA 4UA7A 4CLCC 3ZG9B 4FH2A 4OPRA 3DWZA 4S2OA 4HP4A 2ZBBA 4WZ5A 1A0KA 5TBMB 1NZUA 4RQ9A 3GV9A 1H5XA 2ZL1A 3UMDA 3MR0A 4KZ5A 2KLIA 5IT5A 2Y4AA 2ZD8A 1RP5A 3CAXA 4P0MA 4YFMA 3HBRA 4WUJA 3WS4A 1OT6A 5U47A 3C38A 2XQZA 2BTFP 2PYRA 3WS5A 5M1AA 4GN2A 5GHYA 4OPYA 1MPLA 3EQUA 3UMEA 1KE0A 4MNRA 3K2NA 3EOIA 3N4IA 2XFSA 3PBNA 5FI2A 2Y2QA 5FAPA 4GNUA 2V0UA 4QY5A 5CHUA 3UDIA 3JVUA 4JGOA 2OAP1 3IX4A 3HVFA 2ZM8A 1ODVA 2K31A 4LV0A 2NUTC 2O9AA 3OC2A 5EFWA 2JKRM 1LHYA 2IA2A 3OPPA 1QMEA 5CHMA 4EESA 3Q81A 2WKEA 3G35A 4P85A 1PNEA 3QHYA 2I72A 2B18A 3IWQA 3ZNYA 4EEUA 3BFEA 3MZFA 1RGZA 1XXMA 1W8QA 2VJWA 5EE8A 3GQZA 2H28A 2VZWA 2HDQA 3N8LA 4OVDA 2Y91A 3VFFA 4PKYG 1DJCA 4WZ4A 1IOUA 1GA0A 2K2NA 3MQQA 2WKQA 1J3WA 5HWWA 4BQMA 2Z6DA 2OLVA 1OTAA 2DNSA 2IWBA 4UEYA 4X69A 5GL9A 5HL6A 3Q07A 2WYXA 3C4OA 3PBOA 3CMZA 2XEPA 1XKZA 3F1PB 3ZCZA 2Y2GA 5JYPA 3BQ8A 3V50A 4Q0JA 1TS7A 4S2KA 4E3LA 4Y0OA 5AQ7A 1PWGA 4GD8A 4OKPA 3BECA 1MY8A 1Q2PA 4BLMA 2PR5A 3GVBA 3NIAA 5F82A 2EXBA 4KQRA 3P7NA 4MMNA 1ALQA 3CUEC 1KDWA 2Z2MB 1ES4A 1H0MA 4MCWA 5EM0A 3FC7A 1U60A 2JC7A 3ZG7B 4JGQA 4HESA 1FQGA 5CRFA 4BWIA 4Y2FA 2Q0OA 2QPNA 1HTZA 2W1TB 4NXGA 4B93A 4BL2A 3C30A 5DTSA 1IEMA 2QZ6A 4WZ5C 2GDNA 4Y3IA 1F9IA 5EVEA 1K25A 5E2GA 2EFUA 5GLDA 2QYBA 5DFXA 3IS2B 3EWKA 2L0WA 2E8IA 1D1JA 2HF6A 3EQVA 1IYPA 3GRJA 4GW9A 4E3JA 4E3IA 4OP5A 3IF6B 2PR6A 3VE4A 4Q0IA 1L0DA 5EVIB 1KE3A 3IWIA 3JYIA 3LGOA 4Z1WA 1XJ4A 3CLOA 3SS4A 1BLSA 2PDRA 2ZC7A 2Y2PA 5HWTA 4NG2A 3UE3A 3LO7A 3E2LA 3PBTA 2LB5A 1ONGA 3ZDJA 1Y4OA 4G3VA 5E43A 2VGKA 3AGEA 3LY4A 1IELA 3QP4A 4Y15A 5HDCA 3NULA 4E3NA 5TGFA 3OLOA 4WLAA 3MZEA 4WF0A 2P9VA 4ESPA 5DVAA 4GDBA 4GD6A 2O99A 3BY8A 3OZHA 3H82B 3HCYA 4H6JA 4KZ6A 4GB7A 3TW8A 1JTDA 2JE5A 1QMFA 3A3EA 4X1LA 1O7EA 3BFFA 3ISGA 2KOIA 1P97A 4DXBA 3IXGA 4DDSA 1STZA 3UB9A 3BWLA 3WS2A 4FD8A 3EGDC 2KDKA 2Y8HA 3LI8A 3LI9A 4E3KA 5CECA 2J3TD 3BW6A 1RCJA 4DRTA 2RL3A 1PI4A 3HUOA 3E4PA 4F94A 4B4ZA 1EROA 4C6YA 4L9FA 1GHMA 2J8YA 3VE3A 2ZLYA 1LSXA 1KGEA 1GHIA 3QP6A 1CJFA 4CPKA 4EBLA 3AGDA 1IKIA 1FILA 1LI0A 1I5QA 1YLPA 4WMCD 2W3FA 5FL3A 4EEPA 4QD4A 3ZFZA 3C4PA 3T12B 2XK1A 1F5MA 5HPIA 3K3CA 2G7UA 1IYOA 4Q8IA 1DP6A 4KZBA 1TS0A 3HL9A 1DRMA 2J9PA 3UNWA 4EBPA 1TD5A 2MJ6A 3QNBA 1K6SA 2INWA 1FCOA 2ZOHA 5EOEA 1RGYA 1L0FA 2ZC5B 3G30A 4DKIA 1W7FA 3LIFA 1K57A 2PYPA 4UQIM 4RVAA 4YNRA 1T1AA 1KVMA 1WYCA 3W2ZA 1NRJA 4JF4A 3BY9A 4OLGA 3BJNA 3GTCA 2V1AA 1IYSA 2WADA 2Y79A 3LEQA 1S6RA 2X01A 3HLEA 1F2KA 4LRXC 2C6WB 4XT2B 3BQAA 3RXXA 4F3LB 3K3DA 4BD0A 1K4EA 1BZAA 1G6AA 2JKTI 2ZM2A 2QMIA 2A24B 5FA7A 3W4QA 4Q0HA 3TE8A 5J7EA 4G3KA 1DY6A 1CK3A 3DTKA 3MSHA 4KZ7A 2EX9A 4BBVA 4IUHA 2FZ0A 4N92A 2A2LA 1V9YA 2Q9MA 5FI7A 4CLCB 1IFQA 3I7JA 3T1SA 1AXBA 1M40A 4GHIB 3FPVA 1S4RA 1LLBA 3NCKA 4EU0A 3T4OA 5BOHA 1ERMA 4OQIA 2ZQDA 4E6WA 3E0YA 5CXWA 5A8BA 4K0XA 3B42A 1FOFA 4ETXA 3GR2A 1KE4A 1HZOA 4HH3A 2PD7A 2JN7A 3FKVA 3VP4A 2EWWA 1VHMA 3S22A 4JF5A 4ARZB 1N4OA 3IXBA 4QJGA 4LRZE 1WYBA 2PHYA 4X1MA 3SH8A 3Q7ZA 3HLFA 5DTTA 1JWZA 3IHBA 4LV3A 5G4ZA 4PPRA 3QNCA 5CGSA 5HARA 5DF7A 4HQAA 5AQ9A 2HPBA 4YWZA 1DJBA 2Y2MA 3T4SA 1S1YA 2XA7M 2D02A 3L9KA 2ZQ8A 3HLCA 3FV7A 5HSQA 2GNXA 5GLAA 3QP1A 3UB5P 2M7VA 3IT9A 1MKIA 2PRFA 2JHEA 4IJGA 1NYYA 2VA0A 1UWNX 4DJ2A 3FZCA 4R38A 3U4LP 1MC0A 4GOGA 4DE2A 2BG1A 4OPZA 1BLPA 2NUPC 3GECA 3VSKA 3A3FA 2VEAA 1S1ZA 4BENA 3Q82A 3IWOA 1ZG4A 1CQAA 3G2YA 1G28A 3WS1A 1W5DA 4O01A 1W63M 4OQHA 5L2FA 4Y0TA 1YLYA 4HJ4A 4KUOA 3IH9A 3LUQA 2KX6A 3BLMA 1HD8A 1VETB 4JPMA 4UAAA 3O88A 1SCWA 2D01A 2PAVP 5GLBA 3AGFA 4OPQA 1L2SA 2Y2IA 3T4QA 3MXQA 3UE1A 4JXSA 3G31A 1GSVA 1YSQA 1MWSA 1TVFA 3D4FA 2B02A 4R23A 3B3XA 2JBFA 1H8ZA 2Y2OA 4EUVA 4NXBA 4QB8A 2GJ3A 1GSWA 4X56A 4X6TA 1FCNA 2V8CA 2ZQAA 3F1PA 4JGRA 4UA9A 5L10A 4PAUA 4P87A 1JNUA 1T18A 1PZOA 3R4KA 1XGIA 4IBXA 1MWRA 3MFDA 2Y55A 2V1BA 3FG8A 4O7DA 4P6ZM 1OTBA 2XGNA 2B5RA 2ZL1B 3S4XA 2XLNA 4KQQA 1ESUA 1D06A 1CEFA 1ZKJA 1SDEA 2PBDP 3UO9A 3SW1A 1TS8A 4JF6A 3QP8A 1SKFA 4P6BA 4MBFA 5HZHA 3OCLA 5MC7A 3UB8A 2ZMVA 1NJ4A 2WGVA 2P74A 2XFTA 2W1TA 5KSHA 5HAPA 2OAQ1 2Y2LA 1K54A 1Q2QA 1ZHHB 5FSRA 2PU4A 3NJAA 4JBFA 4B88A 4FSFA 1HVBA 2G2WA 3RTYA 5GHZA 5KZHA 4R3BA 1D7EA 3T4TA 3NBLA 5AVFA 1PRQA 1GCEA 3NI9A 5HD5A 3F1OA 5EVIA 3ZQ5A 4GZBA 4HOIA 4S2NC 4D60A 1S4SA 4JXGA 4DDYA 1SKOB 2FH5A 5EVID 3LIDA 1SZVA 1PIOA 3N6IA 5CEDA 1K6RA 4R3AA 2HJ9C 3T50A 2WKPA 3WS0A 1NLYA 5HL1A 3VOZA 1KVLA 3SH9A 1H8YA 5M19A 3ULFA 1BUEA 1HLUP 4R4RA 5D3OA 4N1HA 2V1ZA 3VOYA 3HUNA 1N9BA 4L9EA 2O9CA 3EEHA 4MEZA 5M18A 3KYQA 4KQOA 4JKTA 2VGLM 4ZAMA 1FR1A 4G3WA 3VFHA 4QPRA 5DKKA 3SS3A 4WBGA 5HW3A 3CG5A 3LY3A 3M6HA 1OPXA 2WGWA 2PBYA 1YM1A 2DMWA 4MDZA 3A0SA 4HH2A 2BLSA 5FASA 4LPZA 4PM5A 2V20A 4N1XA 3PBRA 1CF0A 4YINA 3TOIA 4PM8A 2W3HA 1JWVA 1FIKA 3OPRA 3P98A 3BFDA 1TS6A 4KZAA 4R0QA 1YKDA 3GMWA 2ZC4B 3D9YA 3VP1A 2VV7A 3NOTC 3ZG0A 2W3GA 3C2WA 1YQSA 5FQKA 4GS9A 1C3BA 3DBAA 1OJ5A 3D3OA 4GJ4A 5CTNA 1KGGA 2B95A 2OV5A 1E25A 2Z2LB 1KDSA 1ESIA 1YSPA 5F6AA 1Y54A 3LIAA 1K55A 3KYEA 4BJPA 3GDIA 4HBTA 4S2JA 5CX7A 1JVJA 3E4QA 4GKUA 4R6LA 3VMAA 3KO6A 3N8RA 3NHQA 4ETZA 5LBRA 2WAEA 5F5YA 2ZQ9A 2Q9NA 1PW1A 3F1NA 3VOLA 3O3VA 5CGWA 5HAQA 2HDSA 4RX3A 3IHAA 3BFCA 3C7UA 1OJGA 4N9KA 1K54C 3A3DA 4S2LA 4LV1A 4NETA 4ZRRA 1XJ6A 4L0LA 3NC8A 3QP2A 4NXEA 1ERQA 2EX6A 4NEED 1PZPA 2EWVA 5IS1A 4LRYC 4WMCA 1P9WA 4I38A 1GHPA 1P9RA 3MS6A 3RJUA 3ZG5A 5A91A 3UPOA 3PHYA 3SS5A 2P7JA 4HEFA 4U0TA 4Y17A 1T19A 2XF3A 2J9OA 4PM9A 5CGXA 4N9LA 3IBRA 3CPTB 3MQ0A 1ZG6A 3NY4A 5G4YA 1BTLA 2UV0E 3TJZC 3LEZA 1W79A 4PM6A 5AVEA 3A0VA 1VB6A 4Y7PA 5FQQA 4QHCA 4KG6A 2EX8A 5KMWA 4EQIA 1F98A 2OWJA 2VV6A 4ZJ1A 1TEMA 3HJKA 4MBHA 1CI9A 1DP9A 1E4DA 3FPWA 4ZBEA 3CHWP 2ZJ9A 3A0RA 2ACGA 5L8MA 1N9LA 3NDEA 3PBQA 1SDNA 3DTMA 4K91A 1OTDA 4R70A 2WZZA 3MMHA 1BLHA 4CLCD 3C5AA 3E98A 5DJTA 5L09A 4OLDA 1TDGA 2RCXA 3D72A 3T4JA 2WUQA 1O07A 3WRZA 4CLCE 3T1QB 4I3AA 5DFYA 4FTXA 1YLTA 1WA9A 3B33A 5E2HA 3R7WA 1NWZA 2R78A 4JXVA 2J7VA 3SOIA 2G2UA 1OMEA 2WKRA 3RH8B 3N7WA 1UWPX 5HX9A 1H3QA 4LENA 2JCHA 4HJ6A 3WRTA 1K55C 5J8XA 1OTEA 1EI5A 1XA7A 1DJAA 3LFVA 2ZC6B 3PTEA 4I3JA 5IHVA 3UB7A 3DTIA 5FQJA 3M6BA 3A3JA 4DJ3A 1OT9A 3VV4A 2ZMAA 4E6XA 2J3TC 3DAVA 3H7WA 2E8JA 4S2IA 5F69A 1PWDA 2X71A 1SHVA 3FWLA 1PFLA 1G68A 3UDXA 3BRMA 5A93A 4ZJ3A 2C5WB 4FH4A 1LSWA 4DF6A 5DF8A 2K7SA 2QJ5A 4OOYA 4KQDA 4E3MA 5C5KA 5TBMA 4HI4A 5HD3A 3ZNTA 3ZYTA 1MWUA 3MJQA 2VX8A 4KZ4A 5FDHA 5CEBA 1Z09A 4EETB 4OOMA 3UPPA 1VETA 3HLBA 4A5RA 1IYQA 3QP5A 3HREA 2XR0A 2A3UA 4O8GA 1PI5A 1NLZA 3MXSA 3JPUA 2WGIA 1XFNA 4LCMA 4RA7A 1LSVA 2HJEA 1LL8A 2JKRI 1JWPA 3S7OA 2CC1A 1YAXA 2LB9A 2WAFA 1S0WA 5AJGA 4ID4A 2JKTM 1XPBA 4HHDA 3Q7VB 2J3WA 3BFGA 4R1GA 4EW7A 2L4RA 2O9BA 2YKHA 5EOOA 1XP4A 3DTEA 4ZTKA 5FQMA 3CUEA 5HDDA 4KENB 3W4OA 4HNBA 1K57C 3OOVA 3HLDA 4OP8A 5GHXA 4MN6A 1K56A 2WKHA 5E2FA 1YLWA 5CERA 4PHTA 4DXCA 3O87A 3T1XA 4X55A 3BEBA 3IH8A 4DN0A 3G34A 1XJ3A 4I5SA 1K56D 1UGUA 3UE0A 4O0PA 2W3EA 4WYYA 3OPHA 3MKFA 4IBRA 1MKMA 3S7NA 1T1BA 3V5MA 2V0WA 2L1MA 2ZM0A 2Y59A 4BMWA 1YLZA 4R4SA 2AVXA 2ZOIA 1FSWA 1VEUB 4AFIA 4L9GA 1XJ2A 2QKPA 5FDSA 5A90A 2I9VA 3ITBA 3RFBA 4FCFA 1ZC2A 2VLGA 3PBSA 5HPFA 4XUXA 4DE0A 3PYPA 3C7VA 4IEDA 3BM6A 5FATA 2Y2NA 4IHQA 4WN5A 5EUAA 4KZ3A 3WWXA 1FCMA 1XGJA 4C75A 4PM7A 4M3KA 3CJMA 2H10A 2VK3A 4S2PA 3IBJA 3MBZA 1Z6FA 3MF0A 4LFUA 1SKOA 4P6ZS 4MN5A 2HZ5A 1TF1A 4DE1A 3MZDA 3O86A 3V67A 3HLWA 3ZVTA 3N8SA 2M1CA 3IXHA 3ICYA 4HY8A 3IS2A 2YKFA 3CITA 4C3QA 4DMZA 3MFXA 4FUWA 1CI8A 4HIAA 3NOUC 4K08A 5EM1A 1EWZA 3V39A 3ITAA 1G5UA 3E2KA 3IF6A 3P09A 3UY6A 5KIZA 4KUKA 4JLFA 1NZOA 2H0TA 5EVLA 4Y0UA 2JKFA 3NDGA 5F68A 2QHKA 1WE4A 4K0WA 1VQQA 3UN7A 1H8MA 3PAEA 5F1FA 5HAIA 5I94A 1AWIA 1LL9A 3SH7A 1GA9A 2WKIA 3G2ZA 1N9NA 4GLQA 1XX2A 2M7UA 1X0OA 1IKGA 4B9OA 2DRWA 3LR3A 5HWVA 3MKEA 4OOLA 4RX2A 3LR4A 4EV4A 3NECA 3VSLA 3VP0A 1BT5A 4BBTA 3H82A 4WEKA 3S7QA 3EEAA 5FQIA 3S7PA 5HFOA 3M2JA 3KX0X 4QU3A 3IX3A 2VGLS 2XD1A 3DW0A 1TDLA 3OCNA 2OOLA 2Y2HA 3T4KA 1K0KA 4WL9A 4HP9A 4MLLA 5TJJA 5JYOA 1ZTUA 1YT4A 3F1OB 2ZMFA 3G32A 2R9WA 3RXWA 1YMXA 2IWCA 1G6OA 2PD8A 2CMNA 5K5BA 3FKWA 4OQ0A 2FFYA 2XD5A 3UPNA 3ZG8B 1BLCA 2GZAA 3KYZA 1BULA 1W63Q 2IWDA 3E4OA 2Z6CA 1GSXA 1Y28A 1W8YA 3EGXC 5TFQA 1L0GA 3PR6A 4OQGA 4EXOA 2HGVA 4OH0A 3FYZA 4LCLA 5F1GA 4OONA 5A92A 3V3SA 2W27A 5DTKA 2V2FF 2A49A 1FSYA 1ES3A 1LI9A 4WM9A 4D2OA 2H5SA 3KSHA 1NXYA 3CPTA 4B4XA 4ZDXA 1XA1A 3TRCA 3M2KA 4X53A 1NY0A 3IF5A 2WGWB 1LL5A 4IUKA 2P04A 5FAOA 2QWSA 5DKLA 3S1YA 1T1CA 5CTMA 4KG2A 1PWCA 3W4PA 1S67L 3A3IA 5F83A 2GX5A 4GDNA 4X25A 2EX2A 3OPLA 2BASA 1S66L 3IF6C 3VP2A 3MXRA 3B47A 2UWXA 5AQAA 5HDSA 3JVVA 5EVIC 2WZXA 4DE3A 3CI6A 4GS9B 2QJ7A 3BYDA 3LR5A 2P9VB 4XT2A 2O0YA 3LCEA 4F3LA 1OTIA 4LGWA 1L0EA 4NXFA 1YLJA 3LR0A 4M4XA 4ME4A 4H6JB 2ZC3B 2VKSA 5DJUA 1CEGA 4E3OA 2A24A 3LIBA 4UA6A 3LICA 1BSGA 2Y2JA 3CZDA 1YMSA 1N9OA 1FR6A 5FEFA 2OSUA 3G6OA 3KSIA 3F1NB 4XXRA 2HP9A 1KOUA 4U3TA 2VV8A 3OBFA 4PKYA 5J4EA 2VGJA 3ZHHA 5CHJA 4CLCA 5DF9A 3ZVWA 3LIEA 1ES2A 4GHIA 1J9MA 4KZ9A 5FEGA 1V9ZA 3ZGAB 2WK0A 3IQAA 4UQIS 4Z9QA 3HJIA 2DCFA 1JTGA 2XRNA 4JXWA 3LYXA 1MWTA 1VM1A 2ZQCA 4BBUA 3PXPA 2J80A 4KG5A 4HBUA 4YOFA 4I39A 3HLGA 2OWHA 4II7A 5E2EA 4EWFA 4ARZA 3P01A 3G4PA 4BL3A 4RYEA 3V3RA 4CQHA 5J3WA 2HP5A 5EPHA 4EUZA 3TG9A 4IVKA 1DP8A 2V9AA 4S2MA 4HJ3A 1MZUA 3KSGA 1L3LA 1K4FA 2HV1A 3IXDA 4UHUA 4EBNA 1E3UA 4KZ8A 3MQOA 4IVIA 1I2SA 5FI6A 1I2WA 4E04A 2R9XA 3HUMA 3NOPC 3UDFA 3SZTA 1E3UD 3CWFA 1M6KA 2XSSA 4LLOB 5FQ9A 3U2AA 4H8RA 4EQ1A 5KSCA 2PU2A 3IX8A 4Y5FA 3T4LA 4GCZA 4CJNA 1BYWA 1EW0A 5L07A 2OLUA 3Q7VA 2XH9A 1ACFA 5TR7A 2XROA 4PMAA
chains in the Genus database with same CATH topology
2VGLM 4G3WA 5HPFA 4QPRA 5DKKA 3PYPA 5FL3A 2W3FA 4JGPA 4EEPA 3H9WA 5IU1A 4IHQA 2P08A 4WN5A 4MN7A 1OPXA 3O5YA 2EA9A 1F5MA 2DMWA 5HPIA 4MDZA 3A0SA 4HH2A 3K3CA 2G7UA 4LPZA 1DP6A 3R7WB 1TS0A 1DRMA 3PBRA 4NKPA 1TD5A 2W3HA 2MJ6A 3IBJA 3MF0A 1XFQA 2INWA 2ZOHA 3KSFA 1TS6A 5I5LA 4P6ZS 4MN5A 1YKDA 1TF1A 3LIFA 2W1RA 4I3IA 2PYPA 4UQIM 2VV7A 3NOTC 4YNRA 1T1AA 2W3GA 2PT7A 2W3DA 3C2WA 3UE6A 2W0NA 3V67A 4GS9A 2XA7S 1LT0A 3DBAA 1OJ5A 3D3OA 4GJ4A 2M1CA 3W2ZA 1NRJA 3ICYA 1P0ZA 4HY8A 3BY9A 3IS2A 4WELA 2YKFA 3BJNA 3CITA 2V1AA 4EERA 4DMZA 2Y79A 1YSPA 3MFXA 5F6AA 3C8CA 3H7WB 3LIAA 4HIAA 3NOUC 4K08A 4BJPA 3GDIA 4LRXC 4WEJA 3UB6A 4XT2B 3BQAA 5CX7A 4FOFA 4F3LB 4CLCC 3K3DA 5KIZA 3E4QA 4KUKA 2JKTI 4R6LA 3KO6A 3NHQA 4ETZA 4HP4A 5LBRA 5F5YA 2ZBBA 2A24B 3F1NA 3VOLA 5F68A 2QHKA 5TBMB 4Q0HA 4RQ9A 3TE8A 1H8MA 5J7EA 3UMDA 3MR0A 4G3KA 2KLIA 5IT5A 1OJGA 4BBVA 3CAXA 1N9NA 4IUHA 2FZ0A 4GLQA 2A2LA 4ZRRA 2M7UA 1XJ6A 1X0OA 4L0LA 4B9OA 4NXEA 1V9YA 4WUJA 3LR3A 1OT6A 4CLCB 1IFQA 5HWVA 4NEED 2EWVA 3C38A 4OOLA 4GHIB 3FPVA 1S4RA 3LR4A 4EU0A 4LRYC 5IS1A 3T4OA 1P9WA 2PYRA 4I38A 1P9RA 3E0YA 5A8BA 3EQUA 3UMEA 4BBTA 3B42A 3H82A 3K2NA 3EOIA 4ETXA 3PHYA 2P7JA 1T19A 4WEKA 3S7QA 3PBNA 3EEAA 3IBRA 3S7PA 4HH3A 3MQ0A 3KX0X 2PD7A 2V0UA 2VGLS 5G4YA 3TJZC 2JN7A 3JVUA 2EWWA 3OCNA 2OOLA 4JGOA 2OAP1 1VHMA 5AVEA 3A0VA 1VB6A 4ARZB 1ODVA 2K31A 3T4KA 4WL9A 4HP9A 2NUTC 2O9AA 3OC2A 5EFWA 5TJJA 1ZTUA 1F98A 2JKRM 2OWJA 2VV6A 2ZMFA 3F1OB 4LRZE 2PHYA 3HJKA 2IA2A 1G6OA 2PD8A 1DP9A 4EESA 2CMNA 5G4ZA 5K5BA 2B18A 2GZAA 4HQAA 3FPWA 3KYZA 1W63Q 4YWZA 3E4OA 3T4SA 2Z6CA 4EEUA 1GSXA 3A0RA 1S1YA 1Y28A 2XA7M 2D02A 3EGXC 2VJWA 5L8MA 1N9LA 2H28A 2VZWA 5HSQA 3PBQA 4PKYG 1IOUA 2GNXA 2K2NA 3PR6A 3MQQA 2HGVA 1OTDA 2WKQA 4R70A 4EXOA 5HWWA 2M7VA 3MMHA 4CLCD 2Z6DA 3E98A 1OTAA 2W27A 5DJTA 2JHEA 4UEYA 5HL6A 4IJGA 2VA0A 1UWNX 4DJ2A 3D72A 3T4JA 4R38A 1MC0A 3KSHA 3PBOA 3F1PB 4CLCE 2NUPC 4I3AA 3GECA 3BQ8A 5DFYA 2VEAA 4Q0JA 1S1ZA 1WA9A 1TS7A 3B33A 3TRCA 3R7WA 1G28A 1NWZA 2R78A 4O01A 1W63M 3RH8B 2WKRA 4IUKA 4HJ4A 2P04A 4KUOA 2QWSA 3LUQA 2PR5A 1UWPX 2KX6A 5DKLA 1T1CA 3P7NA 4MMNA 1H3QA 3CUEC 4HJ6A 2D01A 4MCWA 3FC7A 1S67L 1OTEA 2GX5A 3LFVA 3T4QA 2BASA 4I3JA 1S66L 3UB7A 4JGQA 3MXQA 3B47A 5HDSA 4BWIA 4Y2FA 4DJ3A 1OT9A 3JVVA 4NXGA 1GSVA 1YSQA 2W1TB 3VV4A 4B93A 3C30A 2J3TC 3CI6A 2B02A 3H7WA 4GS9B 4Y3IA 1F9IA 2QJ7A 5F69A 2QYBA 3LR5A 5DFXA 3IS2B 4EUVA 4XT2A 4NXBA 2O0YA 4F3LA 2GJ3A 3EWKA 2L0WA 1LSWA 1GSWA 1OTIA 4NXFA 2K7SA 3LR0A 4M4XA 2HF6A 3EQVA 4ME4A 2QJ5A 4H6JB 3F1PA 2VKSA 5DJUA 4GW9A 4KQDA 2A24A 3LIBA 4JGRA 5C5KA 5TBMA 4PAUA 4HI4A 1JNUA 2PR6A 1T18A 3VE4A 3LICA 3R4KA 4Q0IA 5HD3A 1N9OA 3ZYTA 3MJQA 2VX8A 3G6OA 2V1BA 3F1NB 3KSIA 3FG8A 4P6ZM 4Z1WA 1XJ4A 1OTBA 1KOUA 3CLOA 4EETB 4OOMA 2VV8A 3OBFA 4PKYA 2PDRA 5HWTA 3UE3A 5J4EA 1D06A 4CLCA 5DF9A 4O8GA 1NLZA 3LIEA 3SW1A 1TS8A 3PBTA 2LB5A 1XFNA 4GHIA 1V9ZA 1LSVA 2HJEA 4G3VA 5HZHA 4UQIS 1LL8A 2JKRI 3HJIA 3OCLA 5MC7A 3S7OA 3UB8A 2ZMVA 2XRNA 1YAXA 2LB9A 2W1TA 3LYXA 5AJGA 5HDCA 5KSHA 4BBUA 2JKTM 3PXPA 2J80A 4HHDA 2OAQ1 2J3WA 1ZHHB 3OLOA 4WLAA 4WF0A 4EW7A 2L4RA 2O9BA 3NJAA 2YKHA 4FSFA 4YOFA 3CUEA 4I39A 2O99A 3BY8A 2OWHA 5HDDA 3RTYA 3H82B 4HNBA 3HCYA 3OOVA 4II7A 4H6JA 1D7EA 4MN6A 4ARZA 3TW8A 3P01A 3T4TA 5AVFA 5HD5A 4PHTA 4CQHA 5J3WA 3F1OA 4DN0A 1DP8A 2KOIA 2V9AA 1P97A 3ZQ5A 4HJ3A 1XJ3A 4HOIA 4I5SA 1MZUA 3KSGA 2HV1A 1UGUA 4O0PA 2W3EA 3MQOA 1STZA 3UB9A 1S4SA 3BWLA 2FH5A 1MKMA 3S7NA 3EGDC 2KDKA 2Y8HA 3LIDA 1T1BA 3LI8A 3LI9A 2V0WA 2L1MA 2J3TD 4E04A 4BMWA 3NOPC 3BW6A 3CWFA 2XSSA 4LLOB 4R3AA 3E4PA 2HJ9C 3T50A 2WKPA 2ZOIA 3U2AA 4EQ1A 1NLYA 4AFIA 4Y5FA 3T4LA 4GCZA 4L9GA 1XJ2A 2QKPA 4L9FA 3ULFA 1BYWA 1EW0A 2I9VA 3RFBA 4L9EA 3VE3A 2O9CA 2XROA 2VLGA 1LSXA 3EEHA 3PBSA 3KYQA 4KQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUH A;  4GLQ A;  1MC0 A;  4G3W A;  4ZRR A;  2M7U A;  3KSH A;  5HPF A;  4O8G A;  4QPR A;  2W3F A;  2LB5 A;  5DFY A;  4MN7 A;  2VEA A;  4G3V A;  4Q0J A;  3O5Y A;  3S7O A;  1F5M A;  3TRC A;  4EU0 A;  4LRY C;  5HPI A;  2XRN A;  4MDZ A;  2LB9 A;  4O01 A;  2W1T A;  2G7U A;  5AJG A;  4IUK A;  3E0Y A;  1TD5 A;  2W3H A;  3IBJ A;  3K2N A;  4MMN A;  2O9B A;  4ETX A;  3MF0 A;  3S7Q A;  4MCW A;  4YOF A;  3KSF A;  2O99 A;  5I5L A;  3EEA A;  3IBR A;  3S7P A;  1YKD A;  3HCY A;  3OOV A;  1TF1 A;  2GX5 A;  3LFV A;  2W1R A;  3MQ0 A;  3NOT C;  4YNR A;  2W3G A;  3C2W A;  2W3D A;  2OOL A;  1VHM A;  4BWI A;  4Y2F A;  4CQH A;  3DBA A;  3D3O A;  2W1T B;  1YSQ A;  3VV4 A;  2K31 A;  3W2Z A;  4DN0 A;  2O9A A;  2KOI A;  3CI6 A;  3BJN A;  3ZQ5 A;  3CIT A;  4DMZ A;  4Y3I A;  5TJJ A;  2Y79 A;  1ZTU A;  1YSP A;  4LRZ E;  2QYB A;  2ZMF A;  5DFX A;  3KSG A;  4EUV A;  2IA2 A;  4O0P A;  2W3E A;  1STZ A;  2O0Y A;  3NOU C;  4LRX C;  5K5B A;  1MKM A;  3S7N A;  2Y8H A;  2B18 A;  4FOF A;  4E04 A;  4ME4 A;  3NOP C;  2VKS A;  4GW9 A;  4R6L A;  3KO6 A;  3NHQ A;  2XSS A;  4ETZ A;  5C5K A;  5LBR A;  2VJW A;  4PAU A;  5L8M A;  2VZW A;  5HSQ A;  3R4K A;  4Q0I A;  4Y5F A;  2K2N A;  2HGV A;  4R70 A;  2M7V A;  3MMH A;  4Q0H A;  4RQ9 A;  3E98 A;  3G6O A;  3KSI A;  3RFB A;  4G3K A;  2KLI A;  4Z1W A;  2O9C A;  2XRO A;  5HL6 A;  3OBF A;  4IJG A; 
#chains in the Genus database with same CATH topology
 2EXA A;  1MBL A;  4JGP A;  3H9W A;  4QY6 A;  4LV2 A;  3PAG A;  5IU1 A;  2P08 A;  4MN7 A;  2ZQ7 A;  2HDU A;  5EEC A;  1K38 A;  3O5Y A;  2EA9 A;  1PW8 A;  2X02 A;  3DWK A;  4U0X A;  2HP6 A;  3W8K A;  2V8F A;  3GSG A;  3R7W B;  4NKP A;  2EFX A;  5EV0 A;  1NYM A;  3L7H A;  1XFQ A;  5GLC A;  4QWO A;  3KSF A;  5I5L A;  4R3J A;  4X68 A;  5AQB A;  1NRF A;  4Y13 A;  2H0Y A;  2W1R A;  4I3I A;  4NK3 A;  1ONH A;  3UE6 A;  2PT7 A;  2W3D A;  2W0N A;  1ES5 A;  2HDR A;  2JKG A;  2XA7 S;  1LT0 A;  5FAQ A;  5G18 A;  1VEU A;  1KGF A;  1P0Z A;  4WEL A;  1YPR A;  2FFF B;  4MBK A;  4BD1 A;  3BLS A;  4EER A;  1PYY A;  2XDM A;  3VP3 A;  2Y2K A;  4S2N A;  3C8C A;  3TSG A;  3H7W B;  3T1R A;  4ZJ2 A;  3Q1F A;  4XUZ A;  1MXO A;  3UB6 A;  4WEJ A;  4FOF A;  4UA7 A;  4CLC C;  3ZG9 B;  4FH2 A;  4OPR A;  3DWZ A;  4S2O A;  4HP4 A;  2ZBB A;  4WZ5 A;  1A0K A;  5TBM B;  1NZU A;  4RQ9 A;  3GV9 A;  1H5X A;  2ZL1 A;  3UMD A;  3MR0 A;  4KZ5 A;  2KLI A;  5IT5 A;  2Y4A A;  2ZD8 A;  1RP5 A;  3CAX A;  4P0M A;  4YFM A;  3HBR A;  4WUJ A;  3WS4 A;  1OT6 A;  5U47 A;  3C38 A;  2XQZ A;  2BTF P;  2PYR A;  3WS5 A;  5M1A A;  4GN2 A;  5GHY A;  4OPY A;  1MPL A;  3EQU A;  3UME A;  1KE0 A;  4MNR A;  3K2N A;  3EOI A;  3N4I A;  2XFS A;  3PBN A;  5FI2 A;  2Y2Q A;  5FAP A;  4GNU A;  2V0U A;  4QY5 A;  5CHU A;  3UDI A;  3JVU A;  4JGO A;  2OAP 1;  3IX4 A;  3HVF A;  2ZM8 A;  1ODV A;  2K31 A;  4LV0 A;  2NUT C;  2O9A A;  3OC2 A;  5EFW A;  2JKR M;  1LHY A;  2IA2 A;  3OPP A;  1QME A;  5CHM A;  4EES A;  3Q81 A;  2WKE A;  3G35 A;  4P85 A;  1PNE A;  3QHY A;  2I72 A;  2B18 A;  3IWQ A;  3ZNY A;  4EEU A;  3BFE A;  3MZF A;  1RGZ A;  1XXM A;  1W8Q A;  2VJW A;  5EE8 A;  3GQZ A;  2H28 A;  2VZW A;  2HDQ A;  3N8L A;  4OVD A;  2Y91 A;  3VFF A;  4PKY G;  1DJC A;  4WZ4 A;  1IOU A;  1GA0 A;  2K2N A;  3MQQ A;  2WKQ A;  1J3W A;  5HWW A;  4BQM A;  2Z6D A;  2OLV A;  1OTA A;  2DNS A;  2IWB A;  4UEY A;  4X69 A;  5GL9 A;  5HL6 A;  3Q07 A;  2WYX A;  3C4O A;  3PBO A;  3CMZ A;  2XEP A;  1XKZ A;  3F1P B;  3ZCZ A;  2Y2G A;  5JYP A;  3BQ8 A;  3V50 A;  4Q0J A;  1TS7 A;  4S2K A;  4E3L A;  4Y0O A;  5AQ7 A;  1PWG A;  4GD8 A;  4OKP A;  3BEC A;  1MY8 A;  1Q2P A;  4BLM A;  2PR5 A;  3GVB A;  3NIA A;  5F82 A;  2EXB A;  4KQR A;  3P7N A;  4MMN A;  1ALQ A;  3CUE C;  1KDW A;  2Z2M B;  1ES4 A;  1H0M A;  4MCW A;  5EM0 A;  3FC7 A;  1U60 A;  2JC7 A;  3ZG7 B;  4JGQ A;  4HES A;  1FQG A;  5CRF A;  4BWI A;  4Y2F A;  2Q0O A;  2QPN A;  1HTZ A;  2W1T B;  4NXG A;  4B93 A;  4BL2 A;  3C30 A;  5DTS A;  1IEM A;  2QZ6 A;  4WZ5 C;  2GDN A;  4Y3I A;  1F9I A;  5EVE A;  1K25 A;  5E2G A;  2EFU A;  5GLD A;  2QYB A;  5DFX A;  3IS2 B;  3EWK A;  2L0W A;  2E8I A;  1D1J A;  2HF6 A;  3EQV A;  1IYP A;  3GRJ A;  4GW9 A;  4E3J A;  4E3I A;  4OP5 A;  3IF6 B;  2PR6 A;  3VE4 A;  4Q0I A;  1L0D A;  5EVI B;  1KE3 A;  3IWI A;  3JYI A;  3LGO A;  4Z1W A;  1XJ4 A;  3CLO A;  3SS4 A;  1BLS A;  2PDR A;  2ZC7 A;  2Y2P A;  5HWT A;  4NG2 A;  3UE3 A;  3LO7 A;  3E2L A;  3PBT A;  2LB5 A;  1ONG A;  3ZDJ A;  1Y4O A;  4G3V A;  5E43 A;  2VGK A;  3AGE A;  3LY4 A;  1IEL A;  3QP4 A;  4Y15 A;  5HDC A;  3NUL A;  4E3N A;  5TGF A;  3OLO A;  4WLA A;  3MZE A;  4WF0 A;  2P9V A;  4ESP A;  5DVA A;  4GDB A;  4GD6 A;  2O99 A;  3BY8 A;  3OZH A;  3H82 B;  3HCY A;  4H6J A;  4KZ6 A;  4GB7 A;  3TW8 A;  1JTD A;  2JE5 A;  1QMF A;  3A3E A;  4X1L A;  1O7E A;  3BFF A;  3ISG A;  2KOI A;  1P97 A;  4DXB A;  3IXG A;  4DDS A;  1STZ A;  3UB9 A;  3BWL A;  3WS2 A;  4FD8 A;  3EGD C;  2KDK A;  2Y8H A;  3LI8 A;  3LI9 A;  4E3K A;  5CEC A;  2J3T D;  3BW6 A;  1RCJ A;  4DRT A;  2RL3 A;  1PI4 A;  3HUO A;  3E4P A;  4F94 A;  4B4Z A;  1ERO A;  4C6Y A;  4L9F A;  1GHM A;  2J8Y A;  3VE3 A;  2ZLY A;  1LSX A;  1KGE A;  1GHI A;  3QP6 A;  1CJF A;  4CPK A;  4EBL A;  3AGD A;  1IKI A;  1FIL A;  1LI0 A;  1I5Q A;  1YLP A;  4WMC D;  2W3F A;  5FL3 A;  4EEP A;  4QD4 A;  3ZFZ A;  3C4P A;  3T12 B;  2XK1 A;  1F5M A;  5HPI A;  3K3C A;  2G7U A;  1IYO A;  4Q8I A;  1DP6 A;  4KZB A;  1TS0 A;  3HL9 A;  1DRM A;  2J9P A;  3UNW A;  4EBP A;  1TD5 A;  2MJ6 A;  3QNB A;  1K6S A;  2INW A;  1FCO A;  2ZOH A;  5EOE A;  1RGY A;  1L0F A;  2ZC5 B;  3G30 A;  4DKI A;  1W7F A;  3LIF A;  1K57 A;  2PYP A;  4UQI M;  4RVA A;  4YNR A;  1T1A A;  1KVM A;  1WYC A;  3W2Z A;  1NRJ A;  4JF4 A;  3BY9 A;  4OLG A;  3BJN A;  3GTC A;  2V1A A;  1IYS A;  2WAD A;  2Y79 A;  3LEQ A;  1S6R A;  2X01 A;  3HLE A;  1F2K A;  4LRX C;  2C6W B;  4XT2 B;  3BQA A;  3RXX A;  4F3L B;  3K3D A;  4BD0 A;  1K4E A;  1BZA A;  1G6A A;  2JKT I;  2ZM2 A;  2QMI A;  2A24 B;  5FA7 A;  3W4Q A;  4Q0H A;  3TE8 A;  5J7E A;  4G3K A;  1DY6 A;  1CK3 A;  3DTK A;  3MSH A;  4KZ7 A;  2EX9 A;  4BBV A;  4IUH A;  2FZ0 A;  4N92 A;  2A2L A;  1V9Y A;  2Q9M A;  5FI7 A;  4CLC B;  1IFQ A;  3I7J A;  3T1S A;  1AXB A;  1M40 A;  4GHI B;  3FPV A;  1S4R A;  1LLB A;  3NCK A;  4EU0 A;  3T4O A;  5BOH A;  1ERM A;  4OQI A;  2ZQD A;  4E6W A;  3E0Y A;  5CXW A;  5A8B A;  4K0X A;  3B42 A;  1FOF A;  4ETX A;  3GR2 A;  1KE4 A;  1HZO A;  4HH3 A;  2PD7 A;  2JN7 A;  3FKV A;  3VP4 A;  2EWW A;  1VHM A;  3S22 A;  4JF5 A;  4ARZ B;  1N4O A;  3IXB A;  4QJG A;  4LRZ E;  1WYB A;  2PHY A;  4X1M A;  3SH8 A;  3Q7Z A;  3HLF A;  5DTT A;  1JWZ A;  3IHB A;  4LV3 A;  5G4Z A;  4PPR A;  3QNC A;  5CGS A;  5HAR A;  5DF7 A;  4HQA A;  5AQ9 A;  2HPB A;  4YWZ A;  1DJB A;  2Y2M A;  3T4S A;  1S1Y A;  2XA7 M;  2D02 A;  3L9K A;  2ZQ8 A;  3HLC A;  3FV7 A;  5HSQ A;  2GNX A;  5GLA A;  3QP1 A;  3UB5 P;  2M7V A;  3IT9 A;  1MKI A;  2PRF A;  2JHE A;  4IJG A;  1NYY A;  2VA0 A;  1UWN X;  4DJ2 A;  3FZC A;  4R38 A;  3U4L P;  1MC0 A;  4GOG A;  4DE2 A;  2BG1 A;  4OPZ A;  1BLP A;  2NUP C;  3GEC A;  3VSK A;  3A3F A;  2VEA A;  1S1Z A;  4BEN A;  3Q82 A;  3IWO A;  1ZG4 A;  1CQA A;  3G2Y A;  1G28 A;  3WS1 A;  1W5D A;  4O01 A;  1W63 M;  4OQH A;  5L2F A;  4Y0T A;  1YLY A;  4HJ4 A;  4KUO A;  3IH9 A;  3LUQ A;  2KX6 A;  3BLM A;  1HD8 A;  1VET B;  4JPM A;  4UAA A;  3O88 A;  1SCW A;  2D01 A;  2PAV P;  5GLB A;  3AGF A;  4OPQ A;  1L2S A;  2Y2I A;  3T4Q A;  3MXQ A;  3UE1 A;  4JXS A;  3G31 A;  1GSV A;  1YSQ A;  1MWS A;  1TVF A;  3D4F A;  2B02 A;  4R23 A;  3B3X A;  2JBF A;  1H8Z A;  2Y2O A;  4EUV A;  4NXB A;  4QB8 A;  2GJ3 A;  1GSW A;  4X56 A;  4X6T A;  1FCN A;  2V8C A;  2ZQA A;  3F1P A;  4JGR A;  4UA9 A;  5L10 A;  4PAU A;  4P87 A;  1JNU A;  1T18 A;  1PZO A;  3R4K A;  1XGI A;  4IBX A;  1MWR A;  3MFD A;  2Y55 A;  2V1B A;  3FG8 A;  4O7D A;  4P6Z M;  1OTB A;  2XGN A;  2B5R A;  2ZL1 B;  3S4X A;  2XLN A;  4KQQ A;  1ESU A;  1D06 A;  1CEF A;  1ZKJ A;  1SDE A;  2PBD P;  3UO9 A;  3SW1 A;  1TS8 A;  4JF6 A;  3QP8 A;  1SKF A;  4P6B A;  4MBF A;  5HZH A;  3OCL A;  5MC7 A;  3UB8 A;  2ZMV A;  1NJ4 A;  2WGV A;  2P74 A;  2XFT A;  2W1T A;  5KSH A;  5HAP A;  2OAQ 1;  2Y2L A;  1K54 A;  1Q2Q A;  1ZHH B;  5FSR A;  2PU4 A;  3NJA A;  4JBF A;  4B88 A;  4FSF A;  1HVB A;  2G2W A;  3RTY A;  5GHZ A;  5KZH A;  4R3B A;  1D7E A;  3T4T A;  3NBL A;  5AVF A;  1PRQ A;  1GCE A;  3NI9 A;  5HD5 A;  3F1O A;  5EVI A;  3ZQ5 A;  4GZB A;  4HOI A;  4S2N C;  4D60 A;  1S4S A;  4JXG A;  4DDY A;  1SKO B;  2FH5 A;  5EVI D;  3LID A;  1SZV A;  1PIO A;  3N6I A;  5CED A;  1K6R A;  4R3A A;  2HJ9 C;  3T50 A;  2WKP A;  3WS0 A;  1NLY A;  5HL1 A;  3VOZ A;  1KVL A;  3SH9 A;  1H8Y A;  5M19 A;  3ULF A;  1BUE A;  1HLU P;  4R4R A;  5D3O A;  4N1H A;  2V1Z A;  3VOY A;  3HUN A;  1N9B A;  4L9E A;  2O9C A;  3EEH A;  4MEZ A;  5M18 A;  3KYQ A;  4KQO A;  4JKT A;  2VGL M;  4ZAM A;  1FR1 A;  4G3W A;  3VFH A;  4QPR A;  5DKK A;  3SS3 A;  4WBG A;  5HW3 A;  3CG5 A;  3LY3 A;  3M6H A;  1OPX A;  2WGW A;  2PBY A;  1YM1 A;  2DMW A;  4MDZ A;  3A0S A;  4HH2 A;  2BLS A;  5FAS A;  4LPZ A;  4PM5 A;  2V20 A;  4N1X A;  3PBR A;  1CF0 A;  4YIN A;  3TOI A;  4PM8 A;  2W3H A;  1JWV A;  1FIK A;  3OPR A;  3P98 A;  3BFD A;  1TS6 A;  4KZA A;  4R0Q A;  1YKD A;  3GMW A;  2ZC4 B;  3D9Y A;  3VP1 A;  2VV7 A;  3NOT C;  3ZG0 A;  2W3G A;  3C2W A;  1YQS A;  5FQK A;  4GS9 A;  1C3B A;  3DBA A;  1OJ5 A;  3D3O A;  4GJ4 A;  5CTN A;  1KGG A;  2B95 A;  2OV5 A;  1E25 A;  2Z2L B;  1KDS A;  1ESI A;  1YSP A;  5F6A A;  1Y54 A;  3LIA A;  1K55 A;  3KYE A;  4BJP A;  3GDI A;  4HBT A;  4S2J A;  5CX7 A;  1JVJ A;  3E4Q A;  4GKU A;  4R6L A;  3VMA A;  3KO6 A;  3N8R A;  3NHQ A;  4ETZ A;  5LBR A;  2WAE A;  5F5Y A;  2ZQ9 A;  2Q9N A;  1PW1 A;  3F1N A;  3VOL A;  3O3V A;  5CGW A;  5HAQ A;  2HDS A;  4RX3 A;  3IHA A;  3BFC A;  3C7U A;  1OJG A;  4N9K A;  1K54 C;  3A3D A;  4S2L A;  4LV1 A;  4NET A;  4ZRR A;  1XJ6 A;  4L0L A;  3NC8 A;  3QP2 A;  4NXE A;  1ERQ A;  2EX6 A;  4NEE D;  1PZP A;  2EWV A;  5IS1 A;  4LRY C;  4WMC A;  1P9W A;  4I38 A;  1GHP A;  1P9R A;  3MS6 A;  3RJU A;  3ZG5 A;  5A91 A;  3UPO A;  3PHY A;  3SS5 A;  2P7J A;  4HEF A;  4U0T A;  4Y17 A;  1T19 A;  2XF3 A;  2J9O A;  4PM9 A;  5CGX A;  4N9L A;  3IBR A;  3CPT B;  3MQ0 A;  1ZG6 A;  3NY4 A;  5G4Y A;  1BTL A;  2UV0 E;  3TJZ C;  3LEZ A;  1W79 A;  4PM6 A;  5AVE A;  3A0V A;  1VB6 A;  4Y7P A;  5FQQ A;  4QHC A;  4KG6 A;  2EX8 A;  5KMW A;  4EQI A;  1F98 A;  2OWJ A;  2VV6 A;  4ZJ1 A;  1TEM A;  3HJK A;  4MBH A;  1CI9 A;  1DP9 A;  1E4D A;  3FPW A;  4ZBE A;  3CHW P;  2ZJ9 A;  3A0R A;  2ACG A;  5L8M A;  1N9L A;  3NDE A;  3PBQ A;  1SDN A;  3DTM A;  4K91 A;  1OTD A;  4R70 A;  2WZZ A;  3MMH A;  1BLH A;  4CLC D;  3C5A A;  3E98 A;  5DJT A;  5L09 A;  4OLD A;  1TDG A;  2RCX A;  3D72 A;  3T4J A;  2WUQ A;  1O07 A;  3WRZ A;  4CLC E;  3T1Q B;  4I3A A;  5DFY A;  4FTX A;  1YLT A;  1WA9 A;  3B33 A;  5E2H A;  3R7W A;  1NWZ A;  2R78 A;  4JXV A;  2J7V A;  3SOI A;  2G2U A;  1OME A;  2WKR A;  3RH8 B;  3N7W A;  1UWP X;  5HX9 A;  1H3Q A;  4LEN A;  2JCH A;  4HJ6 A;  3WRT A;  1K55 C;  5J8X A;  1OTE A;  1EI5 A;  1XA7 A;  1DJA A;  3LFV A;  2ZC6 B;  3PTE A;  4I3J A;  5IHV A;  3UB7 A;  3DTI A;  5FQJ A;  3M6B A;  3A3J A;  4DJ3 A;  1OT9 A;  3VV4 A;  2ZMA A;  4E6X A;  2J3T C;  3DAV A;  3H7W A;  2E8J A;  4S2I A;  5F69 A;  1PWD A;  2X71 A;  1SHV A;  3FWL A;  1PFL A;  1G68 A;  3UDX A;  3BRM A;  5A93 A;  4ZJ3 A;  2C5W B;  4FH4 A;  1LSW A;  4DF6 A;  5DF8 A;  2K7S A;  2QJ5 A;  4OOY A;  4KQD A;  4E3M A;  5C5K A;  5TBM A;  4HI4 A;  5HD3 A;  3ZNT A;  3ZYT A;  1MWU A;  3MJQ A;  2VX8 A;  4KZ4 A;  5FDH A;  5CEB A;  1Z09 A;  4EET B;  4OOM A;  3UPP A;  1VET A;  3HLB A;  4A5R A;  1IYQ A;  3QP5 A;  3HRE A;  2XR0 A;  2A3U A;  4O8G A;  1PI5 A;  1NLZ A;  3MXS A;  3JPU A;  2WGI A;  1XFN A;  4LCM A;  4RA7 A;  1LSV A;  2HJE A;  1LL8 A;  2JKR I;  1JWP A;  3S7O A;  2CC1 A;  1YAX A;  2LB9 A;  2WAF A;  1S0W A;  5AJG A;  4ID4 A;  2JKT M;  1XPB A;  4HHD A;  3Q7V B;  2J3W A;  3BFG A;  4R1G A;  4EW7 A;  2L4R A;  2O9B A;  2YKH A;  5EOO A;  1XP4 A;  3DTE A;  4ZTK A;  5FQM A;  3CUE A;  5HDD A;  4KEN B;  3W4O A;  4HNB A;  1K57 C;  3OOV A;  3HLD A;  4OP8 A;  5GHX A;  4MN6 A;  1K56 A;  2WKH A;  5E2F A;  1YLW A;  5CER A;  4PHT A;  4DXC A;  3O87 A;  3T1X A;  4X55 A;  3BEB A;  3IH8 A;  4DN0 A;  3G34 A;  1XJ3 A;  4I5S A;  1K56 D;  1UGU A;  3UE0 A;  4O0P A;  2W3E A;  4WYY A;  3OPH A;  3MKF A;  4IBR A;  1MKM A;  3S7N A;  1T1B A;  3V5M A;  2V0W A;  2L1M A;  2ZM0 A;  2Y59 A;  4BMW A;  1YLZ A;  4R4S A;  2AVX A;  2ZOI A;  1FSW A;  1VEU B;  4AFI A;  4L9G A;  1XJ2 A;  2QKP A;  5FDS A;  5A90 A;  2I9V A;  3ITB A;  3RFB A;  4FCF A;  1ZC2 A;  2VLG A;  3PBS A;  5HPF A;  4XUX A;  4DE0 A;  3PYP A;  3C7V A;  4IED A;  3BM6 A;  5FAT A;  2Y2N A;  4IHQ A;  4WN5 A;  5EUA A;  4KZ3 A;  3WWX A;  1FCM A;  1XGJ A;  4C75 A;  4PM7 A;  4M3K A;  3CJM A;  2H10 A;  2VK3 A;  4S2P A;  3IBJ A;  3MBZ A;  1Z6F A;  3MF0 A;  4LFU A;  1SKO A;  4P6Z S;  4MN5 A;  2HZ5 A;  1TF1 A;  4DE1 A;  3MZD A;  3O86 A;  3V67 A;  3HLW A;  3ZVT A;  3N8S A;  2M1C A;  3IXH A;  3ICY A;  4HY8 A;  3IS2 A;  2YKF A;  3CIT A;  4C3Q A;  4DMZ A;  3MFX A;  4FUW A;  1CI8 A;  4HIA A;  3NOU C;  4K08 A;  5EM1 A;  1EWZ A;  3V39 A;  3ITA A;  1G5U A;  3E2K A;  3IF6 A;  3P09 A;  3UY6 A;  5KIZ A;  4KUK A;  4JLF A;  1NZO A;  2H0T A;  5EVL A;  4Y0U A;  2JKF A;  3NDG A;  5F68 A;  2QHK A;  1WE4 A;  4K0W A;  1VQQ A;  3UN7 A;  1H8M A;  3PAE A;  5F1F A;  5HAI A;  5I94 A;  1AWI A;  1LL9 A;  3SH7 A;  1GA9 A;  2WKI A;  3G2Z A;  1N9N A;  4GLQ A;  1XX2 A;  2M7U A;  1X0O A;  1IKG A;  4B9O A;  2DRW A;  3LR3 A;  5HWV A;  3MKE A;  4OOL A;  4RX2 A;  3LR4 A;  4EV4 A;  3NEC A;  3VSL A;  3VP0 A;  1BT5 A;  4BBT A;  3H82 A;  4WEK A;  3S7Q A;  3EEA A;  5FQI A;  3S7P A;  5HFO A;  3M2J A;  3KX0 X;  4QU3 A;  3IX3 A;  2VGL S;  2XD1 A;  3DW0 A;  1TDL A;  3OCN A;  2OOL A;  2Y2H A;  3T4K A;  1K0K A;  4WL9 A;  4HP9 A;  4MLL A;  5TJJ A;  5JYO A;  1ZTU A;  1YT4 A;  3F1O B;  2ZMF A;  3G32 A;  2R9W A;  3RXW A;  1YMX A;  2IWC A;  1G6O A;  2PD8 A;  2CMN A;  5K5B A;  3FKW A;  4OQ0 A;  2FFY A;  2XD5 A;  3UPN A;  3ZG8 B;  1BLC A;  2GZA A;  3KYZ A;  1BUL A;  1W63 Q;  2IWD A;  3E4O A;  2Z6C A;  1GSX A;  1Y28 A;  1W8Y A;  3EGX C;  5TFQ A;  1L0G A;  3PR6 A;  4OQG A;  4EXO A;  2HGV A;  4OH0 A;  3FYZ A;  4LCL A;  5F1G A;  4OON A;  5A92 A;  3V3S A;  2W27 A;  5DTK A;  2V2F F;  2A49 A;  1FSY A;  1ES3 A;  1LI9 A;  4WM9 A;  4D2O A;  2H5S A;  3KSH A;  1NXY A;  3CPT A;  4B4X A;  4ZDX A;  1XA1 A;  3TRC A;  3M2K A;  4X53 A;  1NY0 A;  3IF5 A;  2WGW B;  1LL5 A;  4IUK A;  2P04 A;  5FAO A;  2QWS A;  5DKL A;  3S1Y A;  1T1C A;  5CTM A;  4KG2 A;  1PWC A;  3W4P A;  1S67 L;  3A3I A;  5F83 A;  2GX5 A;  4GDN A;  4X25 A;  2EX2 A;  3OPL A;  2BAS A;  1S66 L;  3IF6 C;  3VP2 A;  3MXR A;  3B47 A;  2UWX A;  5AQA A;  5HDS A;  3JVV A;  5EVI C;  2WZX A;  4DE3 A;  3CI6 A;  4GS9 B;  2QJ7 A;  3BYD A;  3LR5 A;  2P9V B;  4XT2 A;  2O0Y A;  3LCE A;  4F3L A;  1OTI A;  4LGW A;  1L0E A;  4NXF A;  1YLJ A;  3LR0 A;  4M4X A;  4ME4 A;  4H6J B;  2ZC3 B;  2VKS A;  5DJU A;  1CEG A;  4E3O A;  2A24 A;  3LIB A;  4UA6 A;  3LIC A;  1BSG A;  2Y2J A;  3CZD A;  1YMS A;  1N9O A;  1FR6 A;  5FEF A;  2OSU A;  3G6O A;  3KSI A;  3F1N B;  4XXR A;  2HP9 A;  1KOU A;  4U3T A;  2VV8 A;  3OBF A;  4PKY A;  5J4E A;  2VGJ A;  3ZHH A;  5CHJ A;  4CLC A;  5DF9 A;  3ZVW A;  3LIE A;  1ES2 A;  4GHI A;  1J9M A;  4KZ9 A;  5FEG A;  1V9Z A;  3ZGA B;  2WK0 A;  3IQA A;  4UQI S;  4Z9Q A;  3HJI A;  2DCF A;  1JTG A;  2XRN A;  4JXW A;  3LYX A;  1MWT A;  1VM1 A;  2ZQC A;  4BBU A;  3PXP A;  2J80 A;  4KG5 A;  4HBU A;  4YOF A;  4I39 A;  3HLG A;  2OWH A;  4II7 A;  5E2E A;  4EWF A;  4ARZ A;  3P01 A;  3G4P A;  4BL3 A;  4RYE A;  3V3R A;  4CQH A;  5J3W A;  2HP5 A;  5EPH A;  4EUZ A;  3TG9 A;  4IVK A;  1DP8 A;  2V9A A;  4S2M A;  4HJ3 A;  1MZU A;  3KSG A;  1L3L A;  1K4F A;  2HV1 A;  3IXD A;  4UHU A;  4EBN A;  1E3U A;  4KZ8 A;  3MQO A;  4IVI A;  1I2S A;  5FI6 A;  1I2W A;  4E04 A;  2R9X A;  3HUM A;  3NOP C;  3UDF A;  3SZT A;  1E3U D;  3CWF A;  1M6K A;  2XSS A;  4LLO B;  5FQ9 A;  3U2A A;  4H8R A;  4EQ1 A;  5KSC A;  2PU2 A;  3IX8 A;  4Y5F A;  3T4L A;  4GCZ A;  4CJN A;  1BYW A;  1EW0 A;  5L07 A;  2OLU A;  3Q7V A;  2XH9 A;  1ACF A;  5TR7 A;  2XRO A;  4PMA A; 
#chains in the Genus database with same CATH homology
 2VGL M;  4G3W A;  5HPF A;  4QPR A;  5DKK A;  3PYP A;  5FL3 A;  2W3F A;  4JGP A;  4EEP A;  3H9W A;  5IU1 A;  4IHQ A;  2P08 A;  4WN5 A;  4MN7 A;  1OPX A;  3O5Y A;  2EA9 A;  1F5M A;  2DMW A;  5HPI A;  4MDZ A;  3A0S A;  4HH2 A;  3K3C A;  2G7U A;  4LPZ A;  1DP6 A;  3R7W B;  1TS0 A;  1DRM A;  3PBR A;  4NKP A;  1TD5 A;  2W3H A;  2MJ6 A;  3IBJ A;  3MF0 A;  1XFQ A;  2INW A;  2ZOH A;  3KSF A;  1TS6 A;  5I5L A;  4P6Z S;  4MN5 A;  1YKD A;  1TF1 A;  3LIF A;  2W1R A;  4I3I A;  2PYP A;  4UQI M;  2VV7 A;  3NOT C;  4YNR A;  1T1A A;  2W3G A;  2PT7 A;  2W3D A;  3C2W A;  3UE6 A;  2W0N A;  3V67 A;  4GS9 A;  2XA7 S;  1LT0 A;  3DBA A;  1OJ5 A;  3D3O A;  4GJ4 A;  2M1C A;  3W2Z A;  1NRJ A;  3ICY A;  1P0Z A;  4HY8 A;  3BY9 A;  3IS2 A;  4WEL A;  2YKF A;  3BJN A;  3CIT A;  2V1A A;  4EER A;  4DMZ A;  2Y79 A;  1YSP A;  3MFX A;  5F6A A;  3C8C A;  3H7W B;  3LIA A;  4HIA A;  3NOU C;  4K08 A;  4BJP A;  3GDI A;  4LRX C;  4WEJ A;  3UB6 A;  4XT2 B;  3BQA A;  5CX7 A;  4FOF A;  4F3L B;  4CLC C;  3K3D A;  5KIZ A;  3E4Q A;  4KUK A;  2JKT I;  4R6L A;  3KO6 A;  3NHQ A;  4ETZ A;  4HP4 A;  5LBR A;  5F5Y A;  2ZBB A;  2A24 B;  3F1N A;  3VOL A;  5F68 A;  2QHK A;  5TBM B;  4Q0H A;  4RQ9 A;  3TE8 A;  1H8M A;  5J7E A;  3UMD A;  3MR0 A;  4G3K A;  2KLI A;  5IT5 A;  1OJG A;  4BBV A;  3CAX A;  1N9N A;  4IUH A;  2FZ0 A;  4GLQ A;  2A2L A;  4ZRR A;  2M7U A;  1XJ6 A;  1X0O A;  4L0L A;  4B9O A;  4NXE A;  1V9Y A;  4WUJ A;  3LR3 A;  1OT6 A;  4CLC B;  1IFQ A;  5HWV A;  4NEE D;  2EWV A;  3C38 A;  4OOL A;  4GHI B;  3FPV A;  1S4R A;  3LR4 A;  4EU0 A;  4LRY C;  5IS1 A;  3T4O A;  1P9W A;  2PYR A;  4I38 A;  1P9R A;  3E0Y A;  5A8B A;  3EQU A;  3UME A;  4BBT A;  3B42 A;  3H82 A;  3K2N A;  3EOI A;  4ETX A;  3PHY A;  2P7J A;  1T19 A;  4WEK A;  3S7Q A;  3PBN A;  3EEA A;  3IBR A;  3S7P A;  4HH3 A;  3MQ0 A;  3KX0 X;  2PD7 A;  2V0U A;  2VGL S;  5G4Y A;  3TJZ C;  2JN7 A;  3JVU A;  2EWW A;  3OCN A;  2OOL A;  4JGO A;  2OAP 1;  1VHM A;  5AVE A;  3A0V A;  1VB6 A;  4ARZ B;  1ODV A;  2K31 A;  3T4K A;  4WL9 A;  4HP9 A;  2NUT C;  2O9A A;  3OC2 A;  5EFW A;  5TJJ A;  1ZTU A;  1F98 A;  2JKR M;  2OWJ A;  2VV6 A;  2ZMF A;  3F1O B;  4LRZ E;  2PHY A;  3HJK A;  2IA2 A;  1G6O A;  2PD8 A;  1DP9 A;  4EES A;  2CMN A;  5G4Z A;  5K5B A;  2B18 A;  2GZA A;  4HQA A;  3FPW A;  3KYZ A;  1W63 Q;  4YWZ A;  3E4O A;  3T4S A;  2Z6C A;  4EEU A;  1GSX A;  3A0R A;  1S1Y A;  1Y28 A;  2XA7 M;  2D02 A;  3EGX C;  2VJW A;  5L8M A;  1N9L A;  2H28 A;  2VZW A;  5HSQ A;  3PBQ A;  4PKY G;  1IOU A;  2GNX A;  2K2N A;  3PR6 A;  3MQQ A;  2HGV A;  1OTD A;  2WKQ A;  4R70 A;  4EXO A;  5HWW A;  2M7V A;  3MMH A;  4CLC D;  2Z6D A;  3E98 A;  1OTA A;  2W27 A;  5DJT A;  2JHE A;  4UEY A;  5HL6 A;  4IJG A;  2VA0 A;  1UWN X;  4DJ2 A;  3D72 A;  3T4J A;  4R38 A;  1MC0 A;  3KSH A;  3PBO A;  3F1P B;  4CLC E;  2NUP C;  4I3A A;  3GEC A;  3BQ8 A;  5DFY A;  2VEA A;  4Q0J A;  1S1Z A;  1WA9 A;  1TS7 A;  3B33 A;  3TRC A;  3R7W A;  1G28 A;  1NWZ A;  2R78 A;  4O01 A;  1W63 M;  3RH8 B;  2WKR A;  4IUK A;  4HJ4 A;  2P04 A;  4KUO A;  2QWS A;  3LUQ A;  2PR5 A;  1UWP X;  2KX6 A;  5DKL A;  1T1C A;  3P7N A;  4MMN A;  1H3Q A;  3CUE C;  4HJ6 A;  2D01 A;  4MCW A;  3FC7 A;  1S67 L;  1OTE A;  2GX5 A;  3LFV A;  3T4Q A;  2BAS A;  4I3J A;  1S66 L;  3UB7 A;  4JGQ A;  3MXQ A;  3B47 A;  5HDS A;  4BWI A;  4Y2F A;  4DJ3 A;  1OT9 A;  3JVV A;  4NXG A;  1GSV A;  1YSQ A;  2W1T B;  3VV4 A;  4B93 A;  3C30 A;  2J3T C;  3CI6 A;  2B02 A;  3H7W A;  4GS9 B;  4Y3I A;  1F9I A;  2QJ7 A;  5F69 A;  2QYB A;  3LR5 A;  5DFX A;  3IS2 B;  4EUV A;  4XT2 A;  4NXB A;  2O0Y A;  4F3L A;  2GJ3 A;  3EWK A;  2L0W A;  1LSW A;  1GSW A;  1OTI A;  4NXF A;  2K7S A;  3LR0 A;  4M4X A;  2HF6 A;  3EQV A;  4ME4 A;  2QJ5 A;  4H6J B;  3F1P A;  2VKS A;  5DJU A;  4GW9 A;  4KQD A;  2A24 A;  3LIB A;  4JGR A;  5C5K A;  5TBM A;  4PAU A;  4HI4 A;  1JNU A;  2PR6 A;  1T18 A;  3VE4 A;  3LIC A;  3R4K A;  4Q0I A;  5HD3 A;  1N9O A;  3ZYT A;  3MJQ A;  2VX8 A;  3G6O A;  2V1B A;  3F1N B;  3KSI A;  3FG8 A;  4P6Z M;  4Z1W A;  1XJ4 A;  1OTB A;  1KOU A;  3CLO A;  4EET B;  4OOM A;  2VV8 A;  3OBF A;  4PKY A;  2PDR A;  5HWT A;  3UE3 A;  5J4E A;  1D06 A;  4CLC A;  5DF9 A;  4O8G A;  1NLZ A;  3LIE A;  3SW1 A;  1TS8 A;  3PBT A;  2LB5 A;  1XFN A;  4GHI A;  1V9Z A;  1LSV A;  2HJE A;  4G3V A;  5HZH A;  4UQI S;  1LL8 A;  2JKR I;  3HJI A;  3OCL A;  5MC7 A;  3S7O A;  3UB8 A;  2ZMV A;  2XRN A;  1YAX A;  2LB9 A;  2W1T A;  3LYX A;  5AJG A;  5HDC A;  5KSH A;  4BBU A;  2JKT M;  3PXP A;  2J80 A;  4HHD A;  2OAQ 1;  2J3W A;  1ZHH B;  3OLO A;  4WLA A;  4WF0 A;  4EW7 A;  2L4R A;  2O9B A;  3NJA A;  2YKH A;  4FSF A;  4YOF A;  3CUE A;  4I39 A;  2O99 A;  3BY8 A;  2OWH A;  5HDD A;  3RTY A;  3H82 B;  4HNB A;  3HCY A;  3OOV A;  4II7 A;  4H6J A;  1D7E A;  4MN6 A;  4ARZ A;  3TW8 A;  3P01 A;  3T4T A;  5AVF A;  5HD5 A;  4PHT A;  4CQH A;  5J3W A;  3F1O A;  4DN0 A;  1DP8 A;  2KOI A;  2V9A A;  1P97 A;  3ZQ5 A;  4HJ3 A;  1XJ3 A;  4HOI A;  4I5S A;  1MZU A;  3KSG A;  2HV1 A;  1UGU A;  4O0P A;  2W3E A;  3MQO A;  1STZ A;  3UB9 A;  1S4S A;  3BWL A;  2FH5 A;  1MKM A;  3S7N A;  3EGD C;  2KDK A;  2Y8H A;  3LID A;  1T1B A;  3LI8 A;  3LI9 A;  2V0W A;  2L1M A;  2J3T D;  4E04 A;  4BMW A;  3NOP C;  3BW6 A;  3CWF A;  2XSS A;  4LLO B;  4R3A A;  3E4P A;  2HJ9 C;  3T50 A;  2WKP A;  2ZOI A;  3U2A A;  4EQ1 A;  1NLY A;  4AFI A;  4Y5F A;  3T4L A;  4GCZ A;  4L9G A;  1XJ2 A;  2QKP A;  4L9F A;  3ULF A;  1BYW A;  1EW0 A;  2I9V A;  3RFB A;  4L9E A;  3VE3 A;  2O9C A;  2XRO A;  2VLG A;  1LSX A;  3EEH A;  3PBS A;  3KYQ A;  4KQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...