3L7HA

Insights into dynein assembly from a dynein intermediate chain light chain roadblock structure
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
86
structure length
86
Chain Sequence
LKRIQSHKGVVGTIVVNNEGIPVKSTLDNTTTVQYAGLMSQLADKARSVVRDLDPSNDMTFLRVRSKKHEIMVAPDKDFILIVIQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords RE64145p
publication title Insights into dynein assembly from a dynein intermediate chain light chain Roadblock structure
rcsb
source organism Drosophila melanogaster
total genus 21
structure length 86
sequence length 86
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3l7hA00
2VK3A 3T1XA 1CQAA 2BTFP 2B95A 3NULA 1CJFA 1AWIA 2ZL1A 3T12B 3U4LP 2E8JA 1SKOB 4ESPA 1D1JA 1Y4OA 2JKGA 3CPTB 1F2KA 3D9YA 1PFLA 1VETA 5FEGA 3CHWP 5EM1A 2HZ5A 1A0KA 3DAVA 1FILA 4X25A 1SZVA 3MS6A 1YPRA 2PAVP 1ACFA 3T1RA 2ACGA 3NECA 3T1SA 5EV0A 1CF0A 1G5UA 4FTXA 1VEUB 1FIKA 3T1QB 1J3WA 1K0KA 5EM0A 1PNEA 4QWOA 4D60A 4X1MA 2V8FA 1PRQA 2ZL1B 4X1LA 3L9KA 1SKOA 3CPTA 5EVEA 1HLUP 3UB5P 3MSHA 5FEFA 1VETB 2PBDP 1Z09A 2PRFA 4FUWA 2JKFA 2V8CA 3L7HA 3LGOA 3LEQA 1VEUA 3KYEA 5FDSA
chains in the Genus database with same CATH superfamily
1ONHA 1K55A 1FR6A 4GOGA 2EFXA 5HWWA 2WAFA 3QHYA 2A49A 2Y4AA 4ZBEA 3CAXA 3LI8A 5GLAA 3T12B 2ZQ9A 1SKOB 2EA9A 1Y4OA 4Y17A 5CHUA 4PM5A 4BJPA 3IHBA 3WS0A 5J4EA 1DJAA 4N1XA 3LIEA 2JKRI 3QNCA 4R3BA 2PT7A 4OQ0A 4FH2A 3FKWA 4X53A 4LCMA 2Q9NA 3QP1A 4FD8A 3O3VA 4KZ3A 2ZM2A 4X25A 2VGKA 1N9NA 1ZTUA 1OTIA 3PAGA 2HP5A 3T1SA 1CF0A 1TDGA 3EWKA 1RCJA 3R4KA 4PKYA 1NWZA 2OWHA 4JXSA 1YKDA 4HQAA 3A3EA 3V3SA 2HF6A 3IWIA 2WKHA 3BY9A 2IWBA 3UMEA 4GNUA 1O7EA 3ZG8B 4I39A 3H7WA 1KE0A 2HDUA 5HDDA 3GMWA 1IKIA 1Q2PA 3E4OA 3UDXA 4FUWA 3L7HA 1VB6A 4KZAA 3UE6A 3BQ8A 1HZOA 4Y13A 3C4OA 3OCLA 1MWTA 2VEAA 1MZUA 4I38A 3RXXA 2A2LA 2YKFA 1F5MA 3F1PA 3MR0A 2WK0A 2G2WA 3PR6A 5AQAA 3WRZA 3MFDA 5IHVA 4G3WA 1CI9A 3BY8A 3H7WB 1T19A 3VOYA 4LV0A 1W79A 3R7WA 4E3LA 4PAUA 1O07A 3HREA 2W27A 5HWVA 3S22A 1PFLA 3PBNA 2QYBA 1GSVA 2GDNA 3IXGA 3T4QA 1L0DA 3KYQA 3GSGA 1EROA 4EUZA 3DAVA 5GLCA 1FILA 5FAQA 2FZ0A 1P97A 2OAQ1 5CHJA 3HLCA 3BFEA 2ZMVA 5EM0A 3F1PB 3VSKA 3GECA 5E2GA 3UDFA 1PNEA 4UA9A 2B18A 4X1MA 4ETZA 4ZJ1A 2GNXA 4S2LA 1NLYA 1YSPA 2P04A 3G4PA 3VFHA 2W1RA 1XJ3A 4MLLA 3R7WB 1KVLA 2QHKA 4R0QA 1HLUP 4OVDA 5TGFA 4LFUA 3VP4A 1L0GA 3E2LA 4M3KA 4N9KA 1V9ZA 3B33A 3G31A 2YKHA 3MBZA 1PWCA 4K0XA 3UE3A 4BWIA 4ZRRA 2INWA 3IWQA 3LEQA 2V2FF 4HOIA 1Y28A 2DCFA 2LB9A 1MBLA 3LY4A 4EWFA 3PAEA 5D3OA 3IF6C 2XR0A 3WRTA 4K08A 1ODVA 4LENA 3EQVA 3NCKA 5AQBA 5HX9A 4PHTA 4H8RA 1KE3A 1PZOA 5FQKA 3HLFA 4ESPA 5HFOA 4JPMA 2Q0OA 1DP6A 5FEGA 1IFQA 5DF8A 3WWXA 2P08A 3QP8A 4U0TA 1TDLA 3P09A 3MJQA 4WUJA 2OOLA 2W3EA 2Y59A 1D7EA 3MMHA 2J3TD 2K31A 2FFYA 2V9AA 3RJUA 1W8YA 4R38A 4XUXA 2ZJ9A 1XA7A 3T1QB 4F3LA 5E2FA 1FOFA 2HGVA 1NYYA 1S4RA 3A3IA 1I2WA 5GHXA 2ZC7A 4GZBA 1KDWA 3UPPA 4O0PA 1JWPA 4B4ZA 5JYOA 1BUEA 3A3DA 2PDRA 4Y0UA 3UB5P 3C5AA 4JGOA 4JGPA 3HJKA 1STZA 3HUMA 2JKFA 2KX6A 4IHQA 3BLMA 3OPHA 1XFQA 2M7UA 4E6XA 1OJGA 3ZG0A 4DF6A 2Y2IA 4GHIA 4ZTKA 1RP5A 1PW8A 3G30A 3VOZA 3NDGA 1G68A 1IOUA 1TS7A 2J8YA 4KZ4A 2ZMFA 1TVFA 4PM7A 3TW8A 3UE0A 3GTCA 1XJ2A 4E6WA 3AGFA 3O88A 1K6SA 2ZC6B 3F1NA 2G7UA 2EXAA 1M40A 3SOIA 3TG9A 2Y2QA 1TF1A 3HLEA 5E2EA 4DE2A 4WELA 4QB8A 1JNUA 3IH8A 4WZ5A 2PD8A 5DVAA 1CK3A 1K56A 2X02A 2HDSA 2I72A 3WS2A 2D01A 1XGIA 2P74A 4YFMA 1DRMA 2RL3A 3HUOA 1W7FA 5EPHA 2B5RA 4GHIB 2D02A 4JKTA 5F82A 3ZDJA 1LT0A 3MZFA 3SH8A 1WE4A 3DW0A 4P85A 5C5KA 4QHCA 2HDQA 4KZ5A 5EVID 4ZDXA 3E0YA 1P9WA 4S2IA 2J3TC 3OOVA 3UMDA 1FQGA 3F1NB 3N7WA 5HL6A 2L0WA 1K6RA 3TSGA 3F1OA 5GHZA 3OLOA 1ZHHB 5E2HA 2VV7A 3IX3A 5CRFA 4KUKA 4AFIA 4KENB 3C8CA 2H28A 4CQHA 1K4FA 4HESA 4N92A 4EQIA 4BLMA 4IBXA 4IUKA 4LV3A 3NBLA 5FDSA 2JN7A 5K5BA 4GJ4A 4KZBA 2VK3A 4Q8IA 5U47A 2XA7M 3NHQA 2DNSA 2Y91A 3DWZA 5BOHA 4EERA 3S1YA 3F1OB 1F2KA 5HDCA 3B42A 4YINA 1ES4A 3Q7ZA 5J7EA 2WGIA 3O86A 1FR1A 1ERQA 1L2SA 1XX2A 3O5YA 5G4YA 5AQ9A 3FYZA 3LUQA 5HARA 2PYPA 1ALQA 4B93A 5EE8A 1S0WA 4S2MA 4S2KA 4HP9A 3IX4A 4I5SA 1T1BA 5HPFA 5HD3A 3MKEA 4WMCD 5A90A 3A0VA 4BMWA 5IS1A 4IBRA 4UQIS 4G3VA 4R4RA 3KX0X 3T4TA 4CLCE 1OJ5A 5FI6A 3VP1A 3DTMA 5E43A 1KOUA 4HBTA 2GJ3A 3IBJA 1ZG4A 1F98A 2G2UA 2EWVA 3FPVA 2WGVA 4HJ6A 4I3JA 3UY6A 3O87A 4Q0JA 3SW1A 3ZCZA 1MXOA 2PR6A 3BQAA 4PM9A 5EVIC 1JTDA 3B3XA 4CLCA 4OLDA 5F83A 3LR4A 3BWLA 4U3TA 4ZAMA 3LEZA 5HW3A 3LGOA 3G2YA 4GDBA 2NUTC 4X6TA 4NETA 1WYBA 4S2OA 3CUEC 3A0SA 3C38A 3RH8B 3T1XA 3LICA 2WKEA 4GKUA 5FA7A 3NULA 1MWRA 4LV1A 1QMFA 1DJBA 5KZHA 2LB5A 4P6ZM 1YMSA 3D9YA 1XJ6A 3PXPA 4LRZE 1H8YA 5EOOA 4ID4A 5EFWA 3RXWA 4CLCB 4QU3A 4HHDA 5HAQA 5CGSA 1G5UA 2QKPA 1FIKA 2VGLS 2EX8A 5TFQA 2OV5A 5EVLA 4P0MA 3EEAA 4NXEA 3MF0A 4DMZA 4D60A 3ITAA 5AQ7A 3M2KA 2PU4A 3UB6A 2EX2A 3WS4A 1BLHA 1JVJA 1H8ZA 2PR5A 1EI5A 5KSCA 4DDYA 1L0EA 2ZQ8A 1K55C 1XXMA 3T4JA 2P9VA 4OPRA 3V50A 2HJ9C 4XXRA 4IVIA 3A3JA 2WZZA 4NXGA 3ZFZA 4DRTA 4EESA 4R23A 1F9IA 1C3BA 4RA7A 2VGLM 2Z6DA 1YLTA 4EXOA 1NYMA 5CECA 2H10A 4GB7A 2QJ5A 3GRJA 1YLZA 1YAXA 5L2FA 2H5SA 4OQIA 4B88A 1X0OA 4D2OA 3UE1A 4YOFA 4WEJA 4BD1A 5G4ZA 5HAPA 1OTDA 4HIAA 1MKIA 1TS8A 3CMZA 3N4IA 3N8LA 4NXBA 4Y2FA 5F69A 3ZGAB 1EWZA 4E3JA 1GSWA 4OONA 3DTEA 2P9VB 3NI9A 5FI7A 1IYOA 3NY4A 1MY8A 3IX8A 4B4XA 1G28A 3EEHA 5L8MA 2OLUA 2VV6A 3MS6A 3P01A 4MMNA 2PAVP 1D06A 3G34A 3LYXA 1GA0A 4BBUA 4MNRA 1SDNA 3NC8A 2PU2A 3BECA 5L07A 4OOMA 1SKFA 2EFUA 2VGJA 3L9KA 3LR0A 4E3KA 5A93A 3W4QA 1K4EA 5M18A 1FCOA 2W3FA 4JXWA 5FI2A 3SH9A 1EW0A 2Y2KA 1DP8A 2Y79A 3QP4A 3HUNA 4KUOA 4BD0A 5M19A 3N6IA 4MBHA 4WL9A 4LRXC 3WS5A 4Y5FA 3DTIA 3N8RA 1LL9A 1GHMA 4Y15A 3G2ZA 1ES5A 4LGWA 3NOUC 3AGDA 3IWOA 1PI4A 2W3HA 3S7QA 5FDHA 3KO6A 4OOYA 1LLBA 2EX6A 1K54A 1S4SA 3PBQA 3M2JA 3T4LA 4N9LA 1YLYA 4IUHA 2PYRA 2W3DA 1XPBA 5AJGA 3VMAA 2QWSA 4EBPA 3NOTC 3LCEA 1KE4A 4R1GA 3MZDA 3OCNA 4WN5A 1YLPA 2BLSA 3ITBA 4UEYA 2JCHA 5A91A 4XUZA 1SZVA 1T1CA 3V39A 4PPRA 5FAPA 3TJZC 2ACGA 1YM1A 1K38A 4DE0A 1BLSA 3SS5A 3QP6A 3FWLA 4UAAA 1H5XA 4H6JA 3MXRA 2J3WA 1BZAA 1GSXA 1MWUA 2FH5A 1NY0A 3V67A 2BASA 4HJ3A 4Y3IA 2WKRA 5DJUA 1KDSA 4OKPA 4X68A 5TJJA 2Q9MA 1OT9A 4II7A 1K56D 1QMEA 2WKIA 3HJIA 2ZD8A 3KSGA 2XH9A 1SDEA 2ZLYA 4F94A 4CPKA 2XQZA 4ZJ2A 3BRMA 4H6JB 2O9AA 4S2JA 2EXBA 4GD8A 3ICYA 4JGRA 1JWZA 3JVUA 2ZOIA 3GR2A 5IU1A 1S6RA 3K3DA 2DRWA 1E3UA 2J9PA 1BLPA 3UB7A 4F3LB 3JPUA 5FQIA 1P0ZA 3MXSA 3P7NA 5HL1A 4E3MA 3ULFA 3ZQ5A 1HVBA 2XLNA 5CEBA 4NK3A 2HPBA 2XFSA 2XF3A 3IBRA 5L09A 4Q0IA 3D4FA 2W0NA 3PHYA 4S2NA 4HI4A 2X01A 3T50A 4MBKA 1Y54A 3G32A 4GLQA 3EQUA 4P6BA 3PBSA 2VKSA 1S66L 4EW7A 5A92A 4KG2A 4RVAA 3E98A 4WM9A 4X1LA 4HH3A 1T18A 4Q0HA 1H8MA 2O9BA 4X56A 4JBFA 5EVEA 3OC2A 3BM6A 3I7JA 5HSQA 3Q7VA 1NRJA 2QMIA 1W5DA 2Y2LA 1MC0A 1V9YA 2W1TA 4EETB 1G6OA 5FAOA 3UPOA 2XD1A 2XA7S 1BT5A 3Q82A 1VEUA 3MXQA 4CJNA 1PZPA 1P9RA 4WZ5C 1ERMA 4C3QA 5CGWA 2I9VA 4DDSA 1CQAA 4DKIA 4I3AA 2B95A 3T4KA 5L10A 5FQJA 1BLCA 3UDIA 4EBLA 1OMEA 1U60A 3MQ0A 4EEUA 1D1JA 5I94A 1BYWA 1H0MA 1DP9A 2J80A 1VETA 2XDMA 4E04A 2Y2HA 4E3IA 3Q7VB 4JLFA 1FCNA 2UWXA 3BJNA 4CLCD 2EX9A 2V1BA 2W1TB 1IKGA 4ZJ3A 3NECA 2R78A 1KGFA 1MWSA 2HV1A 5J8XA 4FTXA 1VEUB 4Y0TA 4Y0OA 2WUQA 4BL2A 3HLBA 1FSYA 3DTKA 1N9BA 4EU0A 3JVVA 1NZUA 1CI8A 4GCZA 1IEMA 1PI5A 3IF5A 2OAP1 3EOIA 2IA2A 4KQOA 5DTKA 1JWVA 1VETB 4IJGA 2JC7A 4EBNA 1FCMA 1UWNX 1YMXA 4ME4A 2VZWA 3IS2A 4EUVA 3V5MA 1MPLA 4X69A 2V20A 3Q07A 2Y8HA 3KSIA 4RX3A 3C7VA 4L9GA 4ETXA 4BQMA 3NDEA 3G6OA 2Y2OA 5GLDA 2CMNA 4GDNA 5EOEA 1LHYA 2R9XA 4P6ZS 3VV4A 1LL5A 2HP6A 3JYIA 3C30A 3MQQA 5GHYA 2VA0A 5FASA 1KVMA 2C6WB 3PBTA 4KG6A 3E4QA 1AWIA 2ZL1A 4OPQA 3SS3A 4BBVA 2R9WA 3ZNYA 1N9OA 3VE4A 3NJAA 1VQQA 3ZVWA 1WA9A 3VP3A 3UPNA 1VHMA 1K57A 2Y55A 4O8GA 1J9MA 2V0WA 3IS2B 3UB8A 2HZ5A 4LLOB 4KG5A 4KQQA 2C5WB 2V0UA 2O99A 3CLOA 4BL3A 5HZHA 2AVXA 1XP4A 2CC1A 5EV0A 2QJ7A 5DF7A 4RYEA 1E25A 4QY5A 4WZ4A 3P98A 2OSUA 4CLCC 2GZAA 3IXBA 5CTNA 4C75A 2ZL1B 2XROA 2Y2PA 1RGYA 5FQMA 1YQSA 3TRCA 2ZQAA 3GVBA 4KZ9A 4EQ1A 3S7NA 5GLBA 4A5RA 4BENA 3IQAA 4Z9QA 2H0YA 4O01A 2XK1A 2WADA 1VM1A 3CI6A 4O7DA 5FL3A 3CZDA 1W63Q 4JF4A 4DN0A 2HJEA 3BW6A 1KGEA 4OOLA 5DFXA 4KQDA 5CEDA 3FPWA 3SH7A 4KZ6A 1CEGA 2XFTA 5FATA 1RGZA 3GQZA 5DKLA 1OT6A 5F1FA 1LSWA 4KZ8A 2Y2JA 2E8JA 5CERA 3H82A 1ES2A 2QPNA 3IXHA 4R3AA 1OTEA 3ISGA 3T4OA 3H9WA 2Z2MB 3ZVTA 4OH0A 1IELA 1LSVA 3QP2A 2ZBBA 5CGXA 4MN6A 1ACFA 3EGXC 3CJMA 3VOLA 4ARZA 3LR3A 3VP2A 1IYQA 2L4RA 1J3WA 1K0KA 3NOPC 1JTGA 3LI9A 4Z1WA 4DJ2A 5FSRA 3IT9A 3K2NA 1PWGA 2ZC5B 4L9FA 4GS9A 2ZM0A 3H82B 1M6KA 4OQHA 4NEED 4JGQA 4UA6A 3MSHA 2JHEA 5I5LA 5FEFA 3VP0A 3CG5A 3W4PA 1S67L 1XJ4A 5CHMA 5HPIA 4PMAA 2WGWA 3VFFA 4WEKA 2O0YA 2A24A 3LY3A 4MN5A 4QJGA 3A0RA 1BTLA 1ESIA 3BFDA 4WLAA 3U2AA 5MC7A 3T4SA 5DTSA 3W2ZA 4ARZB 2J9OA 3RTYA 4HEFA 5DKKA 1IYSA 4HJ4A 1E4DA 3UN7A 5FQ9A 2OLVA 2VX8A 3SS4A 4M4XA 2RCXA 3N8SA 1DJCA 4X55A 4GS9B 2EWWA 1CJFA 3HLDA 3SZTA 3MQOA 1CEFA 1LI0A 3Q1FA 1BSGA 3E2KA 3VSLA 3MKFA 2WGWB 4HY8A 3IF6A 2A24B 2ZMAA 2NUPC 1IYPA 3GV9A 4JXGA 4BBTA 3LO7A 4WYYA 1PWDA 4L9EA 3D3OA 5F68A 3WS1A 4DXCA 3KYZA 4E3NA 5CTMA 1G6AA 3C2WA 2B02A 2L1MA 2O9CA 3FKVA 4NG2A 3LIDA 4GD6A 3HVFA 4RX2A 4XT2A 2WAEA 4OP8A 1YLJA 1N9LA 1PW1A 5EUAA 1E3UD 3CPTA 2Y2GA 4GN2A 4IVKA 1W63M 2PBDP 3TE8A 2PRFA 4R70A 3IF6B 1K54C 5DTTA 3HCYA 3QP5A 3LIFA 1DY6A 3BLSA 5DF9A 5DFYA 2ZQCA 4B9OA 4QY6A 4JF5A 1GA9A 1I2SA 2KDKA 4JF6A 4YWZA 2HP9A 2XSSA 3CITA 4OLGA 4NKPA 4R6LA 1TEMA 4XT2B 2WKQA 1TS6A 5DJTA 4FOFA 1LSXA 4MCWA 5HDSA 3BYDA 3A3FA 4OP5A 2JKGA 3CPTB 4MN7A 4R4SA 2X71A 3UB9A 1YT4A 3MFXA 5AVEA 3ZNTA 4MEZA 1YPRA 2FFFB 1PYYA 3T1RA 3OBFA 5HD5A 3VE3A 2W3GA 4OPZA 1XA1A 4NXFA 3HBRA 4MBFA 1HTZA 4I3IA 1PIOA 2JKTM 2V8FA 3OPLA 3S7OA 1TS0A 1NLZA 4GW9A 1H3QA 1Z6FA 2IWDA 2VV8A 3BEBA 5FQQA 2A3UA 4LV2A 4DXBA 2MJ6A 4PM8A 1XFNA 3IH9A 4HNBA 4Y7PA 4IEDA 3MZEA 3V3RA 2OWJA 3D72A 3PBOA 3AGEA 5CX7A 5KIZA 1GHPA 5GL9A 2Y2MA 3OPPA 1SCWA 2JKTI 1T1AA 2PHYA 1ZG6A 2XGNA 1GCEA 1N4OA 3FC7A 2M1CA 4RQ9A 2Z2LB 4EV4A 3B47A 1HD8A 3DBAA 2VLGA 2PD7A 1LL8A 2BTFP 2ZC3B 2JBFA 1KGGA 2J7VA 1XKZA 5KMWA 4QD4A 2PBYA 3GDIA 3C4PA 4S2NC 1AXBA 3NIAA 1YLWA 4MDZA 1Q2QA 4G3KA 4R3JA 1OPXA 3HLWA 4FCFA 3BFCA 2KOIA 5IT5A 3BFGA 3IHAA 4DE3A 3FV7A 3CHWP 2M7VA 1NJ4A 1WYCA 5TR7A 2WZXA 1A0KA 4K91A 2KLIA 5KSHA 3W4OA 2WYXA 1ESUA 4S2PA 2ZQDA 3HL9A 3PTEA 1L3LA 3FG8A 3S7PA 4L0LA 4LRYC 2P7JA 4KZ7A 3M6BA 2H0TA 3OPRA 3LIAA 4FSFA 4EEPA 4QWOA 3M6HA 4WF0A 3E4PA 2DMWA 3Q81A 3ZG9B 3RFBA 4HP4A 5TBMA 3ZHHA 4E3OA 3ZYTA 3BFFA 4UHUA 1ONGA 1K25A 2E8IA 3UNWA 1Z09A 3LFVA 4FH4A 1NZOA 2IWCA 3CWFA 2BG1A 3G35A 3HLGA 4OPYA 2V1AA 5G18A 4P87A 4HH2A 5HWTA 4YNRA 1GHIA 2XRNA 1ZKJA 4QPRA 5AVFA 2GX5A 5JYPA 3PYPA 1UGUA 1TD5A 3KSHA 3LR5A 5EVIA 2Y2NA 5TBMB 2XD5A 5EECA 1OTAA 1YSQA 2K2NA 4LCLA 3U4LP 3IXDA 1W8QA 5F1GA 5HAIA 1I5QA 3DWKA 2VJWA 4WBGA 2QZ6A 3S4XA 4UA7A 3CUEA 3QNBA 5EM1A 2Z6CA 4C6YA 4PM6A 4PKYG 2ZOHA 3ZG5A 1SHVA 2UV0E 1MKMA 1LI9A 2HDRA 3ZG7B 1L0FA 3OZHA 2WKPA 4OQGA 1S1ZA 1XGJA 4K0WA 3PBRA 1FSWA 5LBRA 5CXWA 4HBUA 1S1YA 1PRQA 1ZC2A 5EVIB 4U0XA 1ES3A 1NRFA 3K3CA 3EGDC 2XEPA 1UWPX 1SKOA 4UQIM 3W8KA 3UO9A 1BULA 4DE1A 1OTBA 3LIBA 2V8CA 2JE5A 5A8BA 3FZCA 2ZM8A 3C7UA 4LPZA 2ZQ7A 4N1HA 2V1ZA 2K7SA 4JXVA 3KSFA 2JKRM 2ZC4B 4DJ3A 5F6AA 4WMCA 4KQRA 1NXYA 5F5YA 5J3WA 5M1AA 3TOIA 1K57C 3KYEA
chains in the Genus database with same CATH topology
2VK3A 3T1XA 1CQAA 2BTFP 2B95A 3NULA 1CJFA 1AWIA 2ZL1A 3T12B 3U4LP 2E8JA 1SKOB 4ESPA 1D1JA 1Y4OA 2JKGA 3CPTB 1F2KA 3D9YA 1PFLA 1VETA 5FEGA 3CHWP 5EM1A 2HZ5A 1A0KA 3DAVA 1FILA 4X25A 1SZVA 3MS6A 1YPRA 2PAVP 1ACFA 3T1RA 2ACGA 3NECA 3T1SA 5EV0A 1CF0A 1G5UA 4FTXA 1VEUB 1FIKA 3T1QB 1J3WA 1K0KA 5EM0A 1PNEA 4QWOA 4D60A 4X1MA 2V8FA 1PRQA 2ZL1B 4X1LA 3L9KA 1SKOA 3CPTA 5EVEA 1HLUP 3UB5P 3MSHA 5FEFA 1VETB 2PBDP 1Z09A 2PRFA 4FUWA 2JKFA 2V8CA 3L7HA 3LGOA 3LEQA 1VEUA 3KYEA 5FDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VK3 A;  3T1X A;  1CQA A;  2BTF P;  2B95 A;  3NUL A;  1CJF A;  1AWI A;  2ZL1 A;  3T12 B;  3U4L P;  2E8J A;  1SKO B;  4ESP A;  1D1J A;  1Y4O A;  2JKG A;  3CPT B;  1F2K A;  3D9Y A;  1PFL A;  1VET A;  5FEG A;  3CHW P;  5EM1 A;  2HZ5 A;  1A0K A;  3DAV A;  1FIL A;  4X25 A;  1SZV A;  3MS6 A;  1YPR A;  2PAV P;  1ACF A;  3T1R A;  2ACG A;  3NEC A;  3T1S A;  5EV0 A;  1CF0 A;  1G5U A;  4FTX A;  1VEU B;  1FIK A;  3T1Q B;  1J3W A;  1K0K A;  5EM0 A;  1PNE A;  4QWO A;  4D60 A;  4X1M A;  2V8F A;  1PRQ A;  2ZL1 B;  4X1L A;  3L9K A;  1SKO A;  3CPT A;  5EVE A;  1HLU P;  3UB5 P;  3MSH A;  5FEF A;  1VET B;  2PBD P;  1Z09 A;  2PRF A;  4FUW A;  2JKF A;  2V8C A;  3L7H A;  3LGO A;  3LEQ A;  1VEU A;  3KYE A;  5FDS A; 
#chains in the Genus database with same CATH topology
 1ONH A;  1K55 A;  1FR6 A;  4GOG A;  2EFX A;  5HWW A;  2WAF A;  3QHY A;  2A49 A;  2Y4A A;  4ZBE A;  3CAX A;  3LI8 A;  5GLA A;  3T12 B;  2ZQ9 A;  1SKO B;  2EA9 A;  1Y4O A;  4Y17 A;  5CHU A;  4PM5 A;  4BJP A;  3IHB A;  3WS0 A;  5J4E A;  1DJA A;  4N1X A;  3LIE A;  2JKR I;  3QNC A;  4R3B A;  2PT7 A;  4OQ0 A;  4FH2 A;  3FKW A;  4X53 A;  4LCM A;  2Q9N A;  3QP1 A;  4FD8 A;  3O3V A;  4KZ3 A;  2ZM2 A;  4X25 A;  2VGK A;  1N9N A;  1ZTU A;  1OTI A;  3PAG A;  2HP5 A;  3T1S A;  1CF0 A;  1TDG A;  3EWK A;  1RCJ A;  3R4K A;  4PKY A;  1NWZ A;  2OWH A;  4JXS A;  1YKD A;  4HQA A;  3A3E A;  3V3S A;  2HF6 A;  3IWI A;  2WKH A;  3BY9 A;  2IWB A;  3UME A;  4GNU A;  1O7E A;  3ZG8 B;  4I39 A;  3H7W A;  1KE0 A;  2HDU A;  5HDD A;  3GMW A;  1IKI A;  1Q2P A;  3E4O A;  3UDX A;  4FUW A;  3L7H A;  1VB6 A;  4KZA A;  3UE6 A;  3BQ8 A;  1HZO A;  4Y13 A;  3C4O A;  3OCL A;  1MWT A;  2VEA A;  1MZU A;  4I38 A;  3RXX A;  2A2L A;  2YKF A;  1F5M A;  3F1P A;  3MR0 A;  2WK0 A;  2G2W A;  3PR6 A;  5AQA A;  3WRZ A;  3MFD A;  5IHV A;  4G3W A;  1CI9 A;  3BY8 A;  3H7W B;  1T19 A;  3VOY A;  4LV0 A;  1W79 A;  3R7W A;  4E3L A;  4PAU A;  1O07 A;  3HRE A;  2W27 A;  5HWV A;  3S22 A;  1PFL A;  3PBN A;  2QYB A;  1GSV A;  2GDN A;  3IXG A;  3T4Q A;  1L0D A;  3KYQ A;  3GSG A;  1ERO A;  4EUZ A;  3DAV A;  5GLC A;  1FIL A;  5FAQ A;  2FZ0 A;  1P97 A;  2OAQ 1;  5CHJ A;  3HLC A;  3BFE A;  2ZMV A;  5EM0 A;  3F1P B;  3VSK A;  3GEC A;  5E2G A;  3UDF A;  1PNE A;  4UA9 A;  2B18 A;  4X1M A;  4ETZ A;  4ZJ1 A;  2GNX A;  4S2L A;  1NLY A;  1YSP A;  2P04 A;  3G4P A;  3VFH A;  2W1R A;  1XJ3 A;  4MLL A;  3R7W B;  1KVL A;  2QHK A;  4R0Q A;  1HLU P;  4OVD A;  5TGF A;  4LFU A;  3VP4 A;  1L0G A;  3E2L A;  4M3K A;  4N9K A;  1V9Z A;  3B33 A;  3G31 A;  2YKH A;  3MBZ A;  1PWC A;  4K0X A;  3UE3 A;  4BWI A;  4ZRR A;  2INW A;  3IWQ A;  3LEQ A;  2V2F F;  4HOI A;  1Y28 A;  2DCF A;  2LB9 A;  1MBL A;  3LY4 A;  4EWF A;  3PAE A;  5D3O A;  3IF6 C;  2XR0 A;  3WRT A;  4K08 A;  1ODV A;  4LEN A;  3EQV A;  3NCK A;  5AQB A;  5HX9 A;  4PHT A;  4H8R A;  1KE3 A;  1PZO A;  5FQK A;  3HLF A;  4ESP A;  5HFO A;  4JPM A;  2Q0O A;  1DP6 A;  5FEG A;  1IFQ A;  5DF8 A;  3WWX A;  2P08 A;  3QP8 A;  4U0T A;  1TDL A;  3P09 A;  3MJQ A;  4WUJ A;  2OOL A;  2W3E A;  2Y59 A;  1D7E A;  3MMH A;  2J3T D;  2K31 A;  2FFY A;  2V9A A;  3RJU A;  1W8Y A;  4R38 A;  4XUX A;  2ZJ9 A;  1XA7 A;  3T1Q B;  4F3L A;  5E2F A;  1FOF A;  2HGV A;  1NYY A;  1S4R A;  3A3I A;  1I2W A;  5GHX A;  2ZC7 A;  4GZB A;  1KDW A;  3UPP A;  4O0P A;  1JWP A;  4B4Z A;  5JYO A;  1BUE A;  3A3D A;  2PDR A;  4Y0U A;  3UB5 P;  3C5A A;  4JGO A;  4JGP A;  3HJK A;  1STZ A;  3HUM A;  2JKF A;  2KX6 A;  4IHQ A;  3BLM A;  3OPH A;  1XFQ A;  2M7U A;  4E6X A;  1OJG A;  3ZG0 A;  4DF6 A;  2Y2I A;  4GHI A;  4ZTK A;  1RP5 A;  1PW8 A;  3G30 A;  3VOZ A;  3NDG A;  1G68 A;  1IOU A;  1TS7 A;  2J8Y A;  4KZ4 A;  2ZMF A;  1TVF A;  4PM7 A;  3TW8 A;  3UE0 A;  3GTC A;  1XJ2 A;  4E6W A;  3AGF A;  3O88 A;  1K6S A;  2ZC6 B;  3F1N A;  2G7U A;  2EXA A;  1M40 A;  3SOI A;  3TG9 A;  2Y2Q A;  1TF1 A;  3HLE A;  5E2E A;  4DE2 A;  4WEL A;  4QB8 A;  1JNU A;  3IH8 A;  4WZ5 A;  2PD8 A;  5DVA A;  1CK3 A;  1K56 A;  2X02 A;  2HDS A;  2I72 A;  3WS2 A;  2D01 A;  1XGI A;  2P74 A;  4YFM A;  1DRM A;  2RL3 A;  3HUO A;  1W7F A;  5EPH A;  2B5R A;  4GHI B;  2D02 A;  4JKT A;  5F82 A;  3ZDJ A;  1LT0 A;  3MZF A;  3SH8 A;  1WE4 A;  3DW0 A;  4P85 A;  5C5K A;  4QHC A;  2HDQ A;  4KZ5 A;  5EVI D;  4ZDX A;  3E0Y A;  1P9W A;  4S2I A;  2J3T C;  3OOV A;  3UMD A;  1FQG A;  3F1N B;  3N7W A;  5HL6 A;  2L0W A;  1K6R A;  3TSG A;  3F1O A;  5GHZ A;  3OLO A;  1ZHH B;  5E2H A;  2VV7 A;  3IX3 A;  5CRF A;  4KUK A;  4AFI A;  4KEN B;  3C8C A;  2H28 A;  4CQH A;  1K4F A;  4HES A;  4N92 A;  4EQI A;  4BLM A;  4IBX A;  4IUK A;  4LV3 A;  3NBL A;  5FDS A;  2JN7 A;  5K5B A;  4GJ4 A;  4KZB A;  2VK3 A;  4Q8I A;  5U47 A;  2XA7 M;  3NHQ A;  2DNS A;  2Y91 A;  3DWZ A;  5BOH A;  4EER A;  3S1Y A;  3F1O B;  1F2K A;  5HDC A;  3B42 A;  4YIN A;  1ES4 A;  3Q7Z A;  5J7E A;  2WGI A;  3O86 A;  1FR1 A;  1ERQ A;  1L2S A;  1XX2 A;  3O5Y A;  5G4Y A;  5AQ9 A;  3FYZ A;  3LUQ A;  5HAR A;  2PYP A;  1ALQ A;  4B93 A;  5EE8 A;  1S0W A;  4S2M A;  4S2K A;  4HP9 A;  3IX4 A;  4I5S A;  1T1B A;  5HPF A;  5HD3 A;  3MKE A;  4WMC D;  5A90 A;  3A0V A;  4BMW A;  5IS1 A;  4IBR A;  4UQI S;  4G3V A;  4R4R A;  3KX0 X;  3T4T A;  4CLC E;  1OJ5 A;  5FI6 A;  3VP1 A;  3DTM A;  5E43 A;  1KOU A;  4HBT A;  2GJ3 A;  3IBJ A;  1ZG4 A;  1F98 A;  2G2U A;  2EWV A;  3FPV A;  2WGV A;  4HJ6 A;  4I3J A;  3UY6 A;  3O87 A;  4Q0J A;  3SW1 A;  3ZCZ A;  1MXO A;  2PR6 A;  3BQA A;  4PM9 A;  5EVI C;  1JTD A;  3B3X A;  4CLC A;  4OLD A;  5F83 A;  3LR4 A;  3BWL A;  4U3T A;  4ZAM A;  3LEZ A;  5HW3 A;  3LGO A;  3G2Y A;  4GDB A;  2NUT C;  4X6T A;  4NET A;  1WYB A;  4S2O A;  3CUE C;  3A0S A;  3C38 A;  3RH8 B;  3T1X A;  3LIC A;  2WKE A;  4GKU A;  5FA7 A;  3NUL A;  1MWR A;  4LV1 A;  1QMF A;  1DJB A;  5KZH A;  2LB5 A;  4P6Z M;  1YMS A;  3D9Y A;  1XJ6 A;  3PXP A;  4LRZ E;  1H8Y A;  5EOO A;  4ID4 A;  5EFW A;  3RXW A;  4CLC B;  4QU3 A;  4HHD A;  5HAQ A;  5CGS A;  1G5U A;  2QKP A;  1FIK A;  2VGL S;  2EX8 A;  5TFQ A;  2OV5 A;  5EVL A;  4P0M A;  3EEA A;  4NXE A;  3MF0 A;  4DMZ A;  4D60 A;  3ITA A;  5AQ7 A;  3M2K A;  2PU4 A;  3UB6 A;  2EX2 A;  3WS4 A;  1BLH A;  1JVJ A;  1H8Z A;  2PR5 A;  1EI5 A;  5KSC A;  4DDY A;  1L0E A;  2ZQ8 A;  1K55 C;  1XXM A;  3T4J A;  2P9V A;  4OPR A;  3V50 A;  2HJ9 C;  4XXR A;  4IVI A;  3A3J A;  2WZZ A;  4NXG A;  3ZFZ A;  4DRT A;  4EES A;  4R23 A;  1F9I A;  1C3B A;  4RA7 A;  2VGL M;  2Z6D A;  1YLT A;  4EXO A;  1NYM A;  5CEC A;  2H10 A;  4GB7 A;  2QJ5 A;  3GRJ A;  1YLZ A;  1YAX A;  5L2F A;  2H5S A;  4OQI A;  4B88 A;  1X0O A;  4D2O A;  3UE1 A;  4YOF A;  4WEJ A;  4BD1 A;  5G4Z A;  5HAP A;  1OTD A;  4HIA A;  1MKI A;  1TS8 A;  3CMZ A;  3N4I A;  3N8L A;  4NXB A;  4Y2F A;  5F69 A;  3ZGA B;  1EWZ A;  4E3J A;  1GSW A;  4OON A;  3DTE A;  2P9V B;  3NI9 A;  5FI7 A;  1IYO A;  3NY4 A;  1MY8 A;  3IX8 A;  4B4X A;  1G28 A;  3EEH A;  5L8M A;  2OLU A;  2VV6 A;  3MS6 A;  3P01 A;  4MMN A;  2PAV P;  1D06 A;  3G34 A;  3LYX A;  1GA0 A;  4BBU A;  4MNR A;  1SDN A;  3NC8 A;  2PU2 A;  3BEC A;  5L07 A;  4OOM A;  1SKF A;  2EFU A;  2VGJ A;  3L9K A;  3LR0 A;  4E3K A;  5A93 A;  3W4Q A;  1K4E A;  5M18 A;  1FCO A;  2W3F A;  4JXW A;  5FI2 A;  3SH9 A;  1EW0 A;  2Y2K A;  1DP8 A;  2Y79 A;  3QP4 A;  3HUN A;  4KUO A;  4BD0 A;  5M19 A;  3N6I A;  4MBH A;  4WL9 A;  4LRX C;  3WS5 A;  4Y5F A;  3DTI A;  3N8R A;  1LL9 A;  1GHM A;  4Y15 A;  3G2Z A;  1ES5 A;  4LGW A;  3NOU C;  3AGD A;  3IWO A;  1PI4 A;  2W3H A;  3S7Q A;  5FDH A;  3KO6 A;  4OOY A;  1LLB A;  2EX6 A;  1K54 A;  1S4S A;  3PBQ A;  3M2J A;  3T4L A;  4N9L A;  1YLY A;  4IUH A;  2PYR A;  2W3D A;  1XPB A;  5AJG A;  3VMA A;  2QWS A;  4EBP A;  3NOT C;  3LCE A;  1KE4 A;  4R1G A;  3MZD A;  3OCN A;  4WN5 A;  1YLP A;  2BLS A;  3ITB A;  4UEY A;  2JCH A;  5A91 A;  4XUZ A;  1SZV A;  1T1C A;  3V39 A;  4PPR A;  5FAP A;  3TJZ C;  2ACG A;  1YM1 A;  1K38 A;  4DE0 A;  1BLS A;  3SS5 A;  3QP6 A;  3FWL A;  4UAA A;  1H5X A;  4H6J A;  3MXR A;  2J3W A;  1BZA A;  1GSX A;  1MWU A;  2FH5 A;  1NY0 A;  3V67 A;  2BAS A;  4HJ3 A;  4Y3I A;  2WKR A;  5DJU A;  1KDS A;  4OKP A;  4X68 A;  5TJJ A;  2Q9M A;  1OT9 A;  4II7 A;  1K56 D;  1QME A;  2WKI A;  3HJI A;  2ZD8 A;  3KSG A;  2XH9 A;  1SDE A;  2ZLY A;  4F94 A;  4CPK A;  2XQZ A;  4ZJ2 A;  3BRM A;  4H6J B;  2O9A A;  4S2J A;  2EXB A;  4GD8 A;  3ICY A;  4JGR A;  1JWZ A;  3JVU A;  2ZOI A;  3GR2 A;  5IU1 A;  1S6R A;  3K3D A;  2DRW A;  1E3U A;  2J9P A;  1BLP A;  3UB7 A;  4F3L B;  3JPU A;  5FQI A;  1P0Z A;  3MXS A;  3P7N A;  5HL1 A;  4E3M A;  3ULF A;  3ZQ5 A;  1HVB A;  2XLN A;  5CEB A;  4NK3 A;  2HPB A;  2XFS A;  2XF3 A;  3IBR A;  5L09 A;  4Q0I A;  3D4F A;  2W0N A;  3PHY A;  4S2N A;  4HI4 A;  2X01 A;  3T50 A;  4MBK A;  1Y54 A;  3G32 A;  4GLQ A;  3EQU A;  4P6B A;  3PBS A;  2VKS A;  1S66 L;  4EW7 A;  5A92 A;  4KG2 A;  4RVA A;  3E98 A;  4WM9 A;  4X1L A;  4HH3 A;  1T18 A;  4Q0H A;  1H8M A;  2O9B A;  4X56 A;  4JBF A;  5EVE A;  3OC2 A;  3BM6 A;  3I7J A;  5HSQ A;  3Q7V A;  1NRJ A;  2QMI A;  1W5D A;  2Y2L A;  1MC0 A;  1V9Y A;  2W1T A;  4EET B;  1G6O A;  5FAO A;  3UPO A;  2XD1 A;  2XA7 S;  1BT5 A;  3Q82 A;  1VEU A;  3MXQ A;  4CJN A;  1PZP A;  1P9R A;  4WZ5 C;  1ERM A;  4C3Q A;  5CGW A;  2I9V A;  4DDS A;  1CQA A;  4DKI A;  4I3A A;  2B95 A;  3T4K A;  5L10 A;  5FQJ A;  1BLC A;  3UDI A;  4EBL A;  1OME A;  1U60 A;  3MQ0 A;  4EEU A;  1D1J A;  5I94 A;  1BYW A;  1H0M A;  1DP9 A;  2J80 A;  1VET A;  2XDM A;  4E04 A;  2Y2H A;  4E3I A;  3Q7V B;  4JLF A;  1FCN A;  2UWX A;  3BJN A;  4CLC D;  2EX9 A;  2V1B A;  2W1T B;  1IKG A;  4ZJ3 A;  3NEC A;  2R78 A;  1KGF A;  1MWS A;  2HV1 A;  5J8X A;  4FTX A;  1VEU B;  4Y0T A;  4Y0O A;  2WUQ A;  4BL2 A;  3HLB A;  1FSY A;  3DTK A;  1N9B A;  4EU0 A;  3JVV A;  1NZU A;  1CI8 A;  4GCZ A;  1IEM A;  1PI5 A;  3IF5 A;  2OAP 1;  3EOI A;  2IA2 A;  4KQO A;  5DTK A;  1JWV A;  1VET B;  4IJG A;  2JC7 A;  4EBN A;  1FCM A;  1UWN X;  1YMX A;  4ME4 A;  2VZW A;  3IS2 A;  4EUV A;  3V5M A;  1MPL A;  4X69 A;  2V20 A;  3Q07 A;  2Y8H A;  3KSI A;  4RX3 A;  3C7V A;  4L9G A;  4ETX A;  4BQM A;  3NDE A;  3G6O A;  2Y2O A;  5GLD A;  2CMN A;  4GDN A;  5EOE A;  1LHY A;  2R9X A;  4P6Z S;  3VV4 A;  1LL5 A;  2HP6 A;  3JYI A;  3C30 A;  3MQQ A;  5GHY A;  2VA0 A;  5FAS A;  1KVM A;  2C6W B;  3PBT A;  4KG6 A;  3E4Q A;  1AWI A;  2ZL1 A;  4OPQ A;  3SS3 A;  4BBV A;  2R9W A;  3ZNY A;  1N9O A;  3VE4 A;  3NJA A;  1VQQ A;  3ZVW A;  1WA9 A;  3VP3 A;  3UPN A;  1VHM A;  1K57 A;  2Y55 A;  4O8G A;  1J9M A;  2V0W A;  3IS2 B;  3UB8 A;  2HZ5 A;  4LLO B;  4KG5 A;  4KQQ A;  2C5W B;  2V0U A;  2O99 A;  3CLO A;  4BL3 A;  5HZH A;  2AVX A;  1XP4 A;  2CC1 A;  5EV0 A;  2QJ7 A;  5DF7 A;  4RYE A;  1E25 A;  4QY5 A;  4WZ4 A;  3P98 A;  2OSU A;  4CLC C;  2GZA A;  3IXB A;  5CTN A;  4C75 A;  2ZL1 B;  2XRO A;  2Y2P A;  1RGY A;  5FQM A;  1YQS A;  3TRC A;  2ZQA A;  3GVB A;  4KZ9 A;  4EQ1 A;  3S7N A;  5GLB A;  4A5R A;  4BEN A;  3IQA A;  4Z9Q A;  2H0Y A;  4O01 A;  2XK1 A;  2WAD A;  1VM1 A;  3CI6 A;  4O7D A;  5FL3 A;  3CZD A;  1W63 Q;  4JF4 A;  4DN0 A;  2HJE A;  3BW6 A;  1KGE A;  4OOL A;  5DFX A;  4KQD A;  5CED A;  3FPW A;  3SH7 A;  4KZ6 A;  1CEG A;  2XFT A;  5FAT A;  1RGZ A;  3GQZ A;  5DKL A;  1OT6 A;  5F1F A;  1LSW A;  4KZ8 A;  2Y2J A;  2E8J A;  5CER A;  3H82 A;  1ES2 A;  2QPN A;  3IXH A;  4R3A A;  1OTE A;  3ISG A;  3T4O A;  3H9W A;  2Z2M B;  3ZVT A;  4OH0 A;  1IEL A;  1LSV A;  3QP2 A;  2ZBB A;  5CGX A;  4MN6 A;  1ACF A;  3EGX C;  3CJM A;  3VOL A;  4ARZ A;  3LR3 A;  3VP2 A;  1IYQ A;  2L4R A;  1J3W A;  1K0K A;  3NOP C;  1JTG A;  3LI9 A;  4Z1W A;  4DJ2 A;  5FSR A;  3IT9 A;  3K2N A;  1PWG A;  2ZC5 B;  4L9F A;  4GS9 A;  2ZM0 A;  3H82 B;  1M6K A;  4OQH A;  4NEE D;  4JGQ A;  4UA6 A;  3MSH A;  2JHE A;  5I5L A;  5FEF A;  3VP0 A;  3CG5 A;  3W4P A;  1S67 L;  1XJ4 A;  5CHM A;  5HPI A;  4PMA A;  2WGW A;  3VFF A;  4WEK A;  2O0Y A;  2A24 A;  3LY3 A;  4MN5 A;  4QJG A;  3A0R A;  1BTL A;  1ESI A;  3BFD A;  4WLA A;  3U2A A;  5MC7 A;  3T4S A;  5DTS A;  3W2Z A;  4ARZ B;  2J9O A;  3RTY A;  4HEF A;  5DKK A;  1IYS A;  4HJ4 A;  1E4D A;  3UN7 A;  5FQ9 A;  2OLV A;  2VX8 A;  3SS4 A;  4M4X A;  2RCX A;  3N8S A;  1DJC A;  4X55 A;  4GS9 B;  2EWW A;  1CJF A;  3HLD A;  3SZT A;  3MQO A;  1CEF A;  1LI0 A;  3Q1F A;  1BSG A;  3E2K A;  3VSL A;  3MKF A;  2WGW B;  4HY8 A;  3IF6 A;  2A24 B;  2ZMA A;  2NUP C;  1IYP A;  3GV9 A;  4JXG A;  4BBT A;  3LO7 A;  4WYY A;  1PWD A;  4L9E A;  3D3O A;  5F68 A;  3WS1 A;  4DXC A;  3KYZ A;  4E3N A;  5CTM A;  1G6A A;  3C2W A;  2B02 A;  2L1M A;  2O9C A;  3FKV A;  4NG2 A;  3LID A;  4GD6 A;  3HVF A;  4RX2 A;  4XT2 A;  2WAE A;  4OP8 A;  1YLJ A;  1N9L A;  1PW1 A;  5EUA A;  1E3U D;  3CPT A;  2Y2G A;  4GN2 A;  4IVK A;  1W63 M;  2PBD P;  3TE8 A;  2PRF A;  4R70 A;  3IF6 B;  1K54 C;  5DTT A;  3HCY A;  3QP5 A;  3LIF A;  1DY6 A;  3BLS A;  5DF9 A;  5DFY A;  2ZQC A;  4B9O A;  4QY6 A;  4JF5 A;  1GA9 A;  1I2S A;  2KDK A;  4JF6 A;  4YWZ A;  2HP9 A;  2XSS A;  3CIT A;  4OLG A;  4NKP A;  4R6L A;  1TEM A;  4XT2 B;  2WKQ A;  1TS6 A;  5DJT A;  4FOF A;  1LSX A;  4MCW A;  5HDS A;  3BYD A;  3A3F A;  4OP5 A;  2JKG A;  3CPT B;  4MN7 A;  4R4S A;  2X71 A;  3UB9 A;  1YT4 A;  3MFX A;  5AVE A;  3ZNT A;  4MEZ A;  1YPR A;  2FFF B;  1PYY A;  3T1R A;  3OBF A;  5HD5 A;  3VE3 A;  2W3G A;  4OPZ A;  1XA1 A;  4NXF A;  3HBR A;  4MBF A;  1HTZ A;  4I3I A;  1PIO A;  2JKT M;  2V8F A;  3OPL A;  3S7O A;  1TS0 A;  1NLZ A;  4GW9 A;  1H3Q A;  1Z6F A;  2IWD A;  2VV8 A;  3BEB A;  5FQQ A;  2A3U A;  4LV2 A;  4DXB A;  2MJ6 A;  4PM8 A;  1XFN A;  3IH9 A;  4HNB A;  4Y7P A;  4IED A;  3MZE A;  3V3R A;  2OWJ A;  3D72 A;  3PBO A;  3AGE A;  5CX7 A;  5KIZ A;  1GHP A;  5GL9 A;  2Y2M A;  3OPP A;  1SCW A;  2JKT I;  1T1A A;  2PHY A;  1ZG6 A;  2XGN A;  1GCE A;  1N4O A;  3FC7 A;  2M1C A;  4RQ9 A;  2Z2L B;  4EV4 A;  3B47 A;  1HD8 A;  3DBA A;  2VLG A;  2PD7 A;  1LL8 A;  2BTF P;  2ZC3 B;  2JBF A;  1KGG A;  2J7V A;  1XKZ A;  5KMW A;  4QD4 A;  2PBY A;  3GDI A;  3C4P A;  4S2N C;  1AXB A;  3NIA A;  1YLW A;  4MDZ A;  1Q2Q A;  4G3K A;  4R3J A;  1OPX A;  3HLW A;  4FCF A;  3BFC A;  2KOI A;  5IT5 A;  3BFG A;  3IHA A;  4DE3 A;  3FV7 A;  3CHW P;  2M7V A;  1NJ4 A;  1WYC A;  5TR7 A;  2WZX A;  1A0K A;  4K91 A;  2KLI A;  5KSH A;  3W4O A;  2WYX A;  1ESU A;  4S2P A;  2ZQD A;  3HL9 A;  3PTE A;  1L3L A;  3FG8 A;  3S7P A;  4L0L A;  4LRY C;  2P7J A;  4KZ7 A;  3M6B A;  2H0T A;  3OPR A;  3LIA A;  4FSF A;  4EEP A;  4QWO A;  3M6H A;  4WF0 A;  3E4P A;  2DMW A;  3Q81 A;  3ZG9 B;  3RFB A;  4HP4 A;  5TBM A;  3ZHH A;  4E3O A;  3ZYT A;  3BFF A;  4UHU A;  1ONG A;  1K25 A;  2E8I A;  3UNW A;  1Z09 A;  3LFV A;  4FH4 A;  1NZO A;  2IWC A;  3CWF A;  2BG1 A;  3G35 A;  3HLG A;  4OPY A;  2V1A A;  5G18 A;  4P87 A;  4HH2 A;  5HWT A;  4YNR A;  1GHI A;  2XRN A;  1ZKJ A;  4QPR A;  5AVF A;  2GX5 A;  5JYP A;  3PYP A;  1UGU A;  1TD5 A;  3KSH A;  3LR5 A;  5EVI A;  2Y2N A;  5TBM B;  2XD5 A;  5EEC A;  1OTA A;  1YSQ A;  2K2N A;  4LCL A;  3U4L P;  3IXD A;  1W8Q A;  5F1G A;  5HAI A;  1I5Q A;  3DWK A;  2VJW A;  4WBG A;  2QZ6 A;  3S4X A;  4UA7 A;  3CUE A;  3QNB A;  5EM1 A;  2Z6C A;  4C6Y A;  4PM6 A;  4PKY G;  2ZOH A;  3ZG5 A;  1SHV A;  2UV0 E;  1MKM A;  1LI9 A;  2HDR A;  3ZG7 B;  1L0F A;  3OZH A;  2WKP A;  4OQG A;  1S1Z A;  1XGJ A;  4K0W A;  3PBR A;  1FSW A;  5LBR A;  5CXW A;  4HBU A;  1S1Y A;  1PRQ A;  1ZC2 A;  5EVI B;  4U0X A;  1ES3 A;  1NRF A;  3K3C A;  3EGD C;  2XEP A;  1UWP X;  1SKO A;  4UQI M;  3W8K A;  3UO9 A;  1BUL A;  4DE1 A;  1OTB A;  3LIB A;  2V8C A;  2JE5 A;  5A8B A;  3FZC A;  2ZM8 A;  3C7U A;  4LPZ A;  2ZQ7 A;  4N1H A;  2V1Z A;  2K7S A;  4JXV A;  3KSF A;  2JKR M;  2ZC4 B;  4DJ3 A;  5F6A A;  4WMC A;  4KQR A;  1NXY A;  5F5Y A;  5J3W A;  5M1A A;  3TOI A;  1K57 C;  3KYE A; 
#chains in the Genus database with same CATH homology
 2VK3 A;  3T1X A;  1CQA A;  2BTF P;  2B95 A;  3NUL A;  1CJF A;  1AWI A;  2ZL1 A;  3T12 B;  3U4L P;  2E8J A;  1SKO B;  4ESP A;  1D1J A;  1Y4O A;  2JKG A;  3CPT B;  1F2K A;  3D9Y A;  1PFL A;  1VET A;  5FEG A;  3CHW P;  5EM1 A;  2HZ5 A;  1A0K A;  3DAV A;  1FIL A;  4X25 A;  1SZV A;  3MS6 A;  1YPR A;  2PAV P;  1ACF A;  3T1R A;  2ACG A;  3NEC A;  3T1S A;  5EV0 A;  1CF0 A;  1G5U A;  4FTX A;  1VEU B;  1FIK A;  3T1Q B;  1J3W A;  1K0K A;  5EM0 A;  1PNE A;  4QWO A;  4D60 A;  4X1M A;  2V8F A;  1PRQ A;  2ZL1 B;  4X1L A;  3L9K A;  1SKO A;  3CPT A;  5EVE A;  1HLU P;  3UB5 P;  3MSH A;  5FEF A;  1VET B;  2PBD P;  1Z09 A;  2PRF A;  4FUW A;  2JKF A;  2V8C A;  3L7H A;  3LGO A;  3LEQ A;  1VEU A;  3KYE A;  5FDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...