4BBUA

The pr2 photocycle intermediate of photoactive yellow protein
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Watching a Signaling Protein Function in Real Time Via 100-Ps Time-Resolved Laue Crystallography.
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 35
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4bbuA00
3MR0A 3NJAA 2R78A 1LSWA 3CWFA 4JGPA 5F5YA 2VV6A 4WF0A 4F3LA 2HV1A 2VV7A 5I5LA 3UE6A 2WKPA 1OTDA 3GDIA 1T1CA 3UB7A 2ZOIA 4GHIA 1F9IA 1GSVA 2D01A 3MJQA 1JNUA 3RTYA 3LI9A 2VV8A 3F1PB 5J3WA 2V0WA 4DJ2A 4MN5A 4HHDA 1T1AA 5J7EA 1S1ZA 5DJUA 1GSXA 4EQ1A 5G4YA 1X0OA 2M1CA 3LI8A 2BASA 4I3JA 4HIAA 1XJ4A 3BWLA 5IS1A 2OOLA 3NOPC 4GS9B 5HDDA 1OJ5A 3LIAA 5DJTA 1XFNA 3KX0X 2V0UA 2QWSA 4HH2A 2WKQA 3UMDA 3F1OA 4JGQA 1XJ2A 3IS2A 3D72A 1BYWA 4WL9A 3C2WA 3H82B 3K3CA 1DP8A 3NOTC 3ULFA 4L9GA 3UMEA 5HWVA 4HQAA 4R38A 1P0ZA 3ICYA 2PDRA 2PYPA 1D06A 2W27A 2KDKA 4EETB 4GCZA 5AVEA 4XT2A 2K7SA 3E4PA 1LSXA 4GW9A 3IBRA 1WA9A 4I38A 3BY8A 1KOUA 4F3LB 2INWA 2VLGA 2YKFA 1EW0A 3F1NA 1UGUA 1N9OA 3P7NA 2V1AA 1TS7A 4E04A 2VEAA 3E4QA 1OT9A 5HD5A 4WN5A 2A24B 2V1BA 1F98A 2QHKA 4EEPA 5HWTA 1TS0A 3NOUC 1S66L 5F6AA 3H7WB 3MXQA 3UB6A 1XJ3A 3LUQA 4HI4A 2CMNA 2PD7A 4WUJA 4EESA 3F1PA 3PYPA 3LIFA 4H6JB 1GSWA 1DP6A 1OTAA 1G28A 1N9LA 1T19A 5F69A 3VE3A 3UB8A 5DKKA 1XFQA 3GECA 4HNBA 4PKYG 4HY8A 1LT0A 1V9YA 5AVFA 4GS9A 2PHYA 4R3AA 1OTEA 1Y28A 3OLOA 2YKHA 4BBUA 5TBMB 1S4RA 2KX6A 2L1MA 4R6LA 2PYRA 5A8BA 2ZBBA 3VE4A 1VB6A 1T18A 4RQ9A 3FG8A 4NXEA 3LYXA 4L9EA 5IU1A 4NXFA 5HDCA 4HP4A 4EXOA 4DJ3A 2Z6DA 2QJ7A 3C8CA 3H9WA 4PKYA 2ZOHA 3MQQA 3HJKA 4MN6A 1ODVA 1UWNX 3H82A 3B33A 4WLAA 4LRYC 2QJ5A 2B02A 3T50A 3LIEA 3E4OA 4EW7A 3ZQ5A 4LRXC 5G4ZA 4EERA 3MFXA 1S67L 1MZUA 4GHIB 3NHQA 4I5SA 2V9AA 3PHYA 4HJ4A 4K08A 1OTIA 3G6OA 3LICA 4HOIA 1T1BA 4LLOB 2H28A 3CLOA 4HH3A 1OT6A 1OJGA 1UWPX 1TS8A 4HJ3A 5DKLA 1P97A 4NXBA 4KUKA 5EFWA 2QKPA 2L4RA 3HJIA 4B9OA 2D02A 4L9FA 4KUOA 1TS6A 2A24A 3MQOA 3A0RA 2EA9A 3RH8B 1XJ6A 3FC7A 2OWJA 2PD8A 3H7WA 4KQDA 3F1OB 2P7JA 4R70A 2PR5A 2WKRA 3UB9A 1LL8A 2I9VA 3IS2B 1DRMA 3EEHA 2W0NA 4LPZA 4M4XA 5HWWA 4EEUA 1D7EA 5HSQA 3SW1A 5HDSA 5KIZA 2GJ3A 2JHEA 2Z6CA 4H6JA 2L0WA 2J80A 4YWZA 3K3DA 4LRZE 4BBVA 1OTBA 5HZHA 3A0VA 1LSVA 5HD3A 4HP9A 4XT2B 4JGRA 4JGOA 4I3AA 1DP9A 1V9ZA 5TBMA 4BBTA 1NWZA 3LIBA 1S4SA 1N9NA 5F68A 3LIDA 4I3IA 4I39A 3EWKA 4HJ6A 2JN7A 5J4EA 3A0SA 4NXGA 1S1YA 3F1NB 2PR6A 2OWHA 3BY9A 3CAXA 3VOLA
chains in the Genus database with same CATH superfamily
4E3IA 5FATA 1LSWA 5DVAA 1SKOA 2Y2KA 1XGJA 5F5YA 4WF0A 1XP4A 2XSSA 4LCMA 3BW6A 3FKVA 3BYDA 5HPFA 3OZHA 3UE6A 1PFLA 2WKPA 4B88A 3OC2A 3NI9A 3IWQA 1YLTA 3CPTA 1GCEA 3GDIA 4ID4A 3UPPA 2K31A 2XK1A 5GLCA 4P85A 3D9YA 4HEFA 5EVID 3PAGA 5KSHA 2Y2NA 4OQGA 1KGEA 2HJ9C 2VV8A 4NKPA 3G35A 3OCNA 4MN5A 2WKIA 3T4JA 1GA0A 1T1AA 3O5YA 4KG2A 2WUQA 5J7EA 1QMEA 2Y2GA 3AGDA 4F94A 2VA0A 2RL3A 3EGXC 5G4YA 4MMNA 2FH5A 1O07A 2O0YA 3A3DA 2M1CA 2WKHA 4HIAA 3BWLA 3VP0A 1N4OA 3N7WA 4GS9B 4RX3A 5HDDA 2Q9NA 4CLCE 1YPRA 4EV4A 1CJFA 5F1GA 4HH2A 4QJGA 3S4XA 3QHYA 1KGFA 4UA6A 1ACFA 4S2KA 3IQAA 5BOHA 2JKGA 4D2OA 3BFFA 4JGQA 4MCWA 4PM7A 3IS2A 4KZ3A 3MF0A 2GX5A 5MC7A 1G68A 4LV2A 1YLPA 4ZJ2A 3PAEA 4BQMA 5EOEA 3NBLA 3NOTC 3LR3A 4L9GA 2MJ6A 1VQQA 1NLYA 2K2NA 3KSIA 3ZG7B 2PDRA 2DCFA 1N9BA 3C5AA 1YSQA 3CZDA 2KDKA 3T4OA 4GCZA 3E0YA 2HZ5A 2Y2MA 1W8QA 1Y4OA 3T4TA 5EV0A 4E3KA 1YMSA 1ES2A 1P9WA 1NY0A 5J8XA 3BY8A 3R7WA 3UDXA 1KOUA 5HAQA 1ZKJA 3MBZA 2HF6A 5F83A 4N1HA 1H8YA 2YKFA 3M2JA 2XFSA 1EW0A 3F1NA 5IHVA 3DTEA 2V1AA 3N8RA 5AJGA 4IBXA 3VP2A 3E4QA 1PWGA 1OT9A 5CGXA 4BENA 3FPWA 4P6ZM 3HBRA 2V1BA 1FR1A 5FI6A 4QU3A 5F6AA 5EOOA 3L9KA 4CLCD 1MC0A 3H7WB 4X56A 5FQJA 3UB6A 4ME4A 1MWUA 4HI4A 2CMNA 3LCEA 4WUJA 4QHCA 4UA7A 3F1PA 3TRCA 5FQ9A 2ZJ9A 5DTSA 5CECA 1OTAA 5L10A 1YKDA 3G2ZA 3VE3A 1ZHHB 4LV3A 1GHMA 3ZDJA 2ZL1B 2R9WA 1XFQA 4WEJA 1HTZA 1W63Q 1OTEA 1NJ4A 2HP9A 5DF9A 2QPNA 4WELA 3RJUA 3HLWA 3FV7A 4R6LA 5A8BA 3B47A 2HDRA 1T18A 3V3RA 2EX8A 3LYXA 4L9EA 5EVEA 3SS4A 2XROA 1BUEA 4EUZA 1SKFA 2DNSA 3C8CA 4ETZA 5JYOA 2ZOHA 3HJKA 1ODVA 4WZ5A 1UWNX 2NUTC 3G34A 3Q7ZA 4NG2A 3D4FA 3LEZA 5FQMA 2NUPC 1DJCA 5GHYA 4KZ8A 3MZFA 3LIEA 4OH0A 2WYXA 3LY3A 4LRXC 5G4ZA 2OAQ1 3TE8A 1S67L 3OPLA 4GHIB 3MXRA 3N4IA 3SH7A 3KSGA 4HJ4A 4RA7A 2WKEA 3MQ0A 2J9OA 4XXRA 1EI5A 3HLEA 4X25A 1BSGA 3A3IA 1J3WA 3VSLA 4HH3A 1K56D 2WZXA 1L3LA 4GOGA 2XDMA 4HJ3A 5DKLA 1EROA 4NXBA 2W1TB 4KZ6A 5HAPA 1H8ZA 4IUHA 4OP8A 2L4RA 1IOUA 1G6OA 2WGWA 2JE5A 4GKUA 1TS6A 2A24A 3RH8B 5IT5A 3O3VA 2Y79A 3QP5A 4KQDA 2M7UA 1JWZA 4R70A 4ZAMA 2PR5A 4MBKA 4S2LA 2I9VA 4X69A 3ZG8B 1VETA 2P08A 5GHXA 3G4PA 5E2HA 3WS2A 2HPBA 3IF6A 4DN0A 2J80A 3MZDA 3T4LA 4EWFA 2VKSA 5HZHA 3A0VA 3VP3A 1K0KA 1TEMA 3HUNA 4DXBA 4K0WA 5HD3A 1K4FA 4CLCC 4KZ4A 3HLGA 3UE1A 3Q82A 4JGOA 4JBFA 5CHUA 4BBTA 4OOYA 3OCLA 1HVBA 3LIDA 1KGGA 4R3JA 4GNUA 1LI9A 4HJ6A 3EGDC 1PRQA 3HUOA 2H10A 4LV0A 1CQAA 5EM1A 3IXHA 2ZLYA 4YFMA 3VOLA 4RVAA 1K4EA 5FSRA 3MR0A 3IWOA 3P09A 3W4QA 2W1RA 3IX4A 4E3MA 3V50A 1Q2PA 2ZC3B 4KG5A 4IBRA 5TR7A 5HAIA 4K91A 3HVFA 3DW0A 2WAFA 5FI7A 2XFTA 2ZC6B 1KE0A 4QY5A 2D01A 1JNUA 2WGWB 3SOIA 4KQOA 3PBTA 3QP6A 2V0WA 4DJ2A 1G5UA 3UPNA 4HHDA 1KDSA 1ES5A 2PU2A 1YM1A 4E3JA 1ONGA 4ZJ3A 4EQ1A 2A49A 4JF6A 5FDHA 3LI8A 5FASA 2BASA 4Q8IA 3BRMA 4I3JA 2HP5A 1DY6A 1K56A 4II7A 1MWTA 2OOLA 1K54A 1OJ5A 3LIAA 3Q7VA 1IFQA 5DJTA 1VEUA 1XFNA 3IF6B 1KE3A 4BLMA 1PWCA 1LI0A 3KSFA 2V8FA 2J3WA 1YLJA 1E4DA 2ZQ7A 1W7FA 3F1OA 4O7DA 4P6BA 2UWXA 5FAQA 2LB5A 3V67A 4U0TA 2IWDA 1PYYA 1E3UD 4RX2A 3VP4A 4LGWA 4U0XA 2PBYA 3TOIA 1K54C 3H82B 5CTNA 1DP8A 3MKEA 1GHPA 3ULFA 2QMIA 4LCLA 5HWVA 5FEFA 3DTMA 1MPLA 5CEDA 2PYPA 3ZNTA 4K0XA 3UE3A 4NEED 1LHYA 3SZTA 1ZG6A 2AVXA 4O01A 5AVEA 3G30A 3KYQA 3MXSA 4XT2A 2K7SA 1A0KA 1IYSA 5GLBA 3IBRA 4HBUA 2KLIA 5GHZA 3UN7A 4OPZA 4LV1A 2ZQDA 4GDNA 4B4ZA 2Y2QA 1F5MA 2INWA 2VLGA 1YMXA 4A5RA 1MXOA 1RGYA 4E3LA 5FQKA 3KO6A 3HCYA 2ZM2A 4JXSA 4FH2A 4QWOA 5EM0A 2VEAA 2VGKA 4WM9A 3B42A 4OONA 2ZMFA 4WN5A 1Z09A 1XGIA 4S2PA 3EQUA 5GL9A 4OQHA 1TS0A 3HUMA 4EUVA 2EXBA 2Y2JA 2ZM8A 2Y2PA 2G2WA 1HD8A 3AGEA 5FDSA 4MBFA 2PT7A 1W79A 2O9CA 3WRZA 4EESA 3IBJA 4Y5FA 3PYPA 1IELA 3IWIA 2OLVA 5DF8A 1N9LA 2OLUA 2EX9A 3UB8A 2Y91A 2Y2HA 4OOMA 1SZVA 5EVLA 1LT0A 4EBPA 5AVFA 4ZJ1A 4R3AA 1Y28A 4DE1A 3UPOA 3UY6A 4ETXA 4WBGA 3MZEA 1K6RA 2Y2IA 5TBMB 1SDEA 4PAUA 3RXXA 5E43A 2KX6A 4EBLA 2PYRA 3FG8A 1NYYA 1FIKA 4NXFA 1JWVA 2ACGA 3QNCA 4HP4A 2H5SA 3SS3A 3E2KA 3NECA 3VV4A 4BL2A 4PKYA 2EXAA 4BJPA 4KENB 4WLAA 4FOFA 4LRYC 3GV9A 4B4XA 1SKOB 3ZHHA 3BLMA 3IX8A 1WYBA 3WS1A 4X55A 4P6ZS 3E4OA 3CPTB 3ZQ5A 3WRTA 2O9BA 5CERA 3KSHA 2J7VA 1TD5A 4JF4A 2Y59A 3KYEA 3I7JA 3A3JA 4LFUA 1L0GA 4DDYA 1XPBA 4K08A 4S2IA 3Q1FA 3LICA 4HOIA 4ARZA 2XA7M 1XX2A 3C30A 3E98A 3QP1A 4LLOB 5DF7A 1L0EA 4GN2A 5HARA 3VMAA 1OJGA 1TS8A 5DFYA 4BD0A 4OVDA 1P97A 3BQAA 5EFWA 2QKPA 4PM8A 3HJIA 3ZG0A 1MWRA 1EWZA 4B9OA 4R1GA 5CEBA 5EPHA 3A0RA 1ONHA 5EVIA 2FFYA 5DTTA 1BLSA 2OWJA 2PD8A 3PBOA 4GLQA 4QD4A 4DKIA 4YNRA 4FUWA 3JPUA 1LL8A 3B3XA 3IS2B 2XF3A 3EEHA 2W0NA 4M4XA 4QB8A 3V39A 1ERQA 1E25A 3SW1A 2GJ3A 5HFOA 1L0FA 4H6JA 1BLHA 3RFBA 1BLCA 1GA9A 2B5RA 1ALQA 4Y13A 4YWZA 4R3BA 5EVIC 4KQRA 4E3NA 3C4OA 4ZBEA 3QP4A 3S1YA 2Y8HA 2W3FA 1OTBA 3E2LA 4OKPA 1JVJA 5CTMA 3OBFA 4R23A 5LBRA 1ZTUA 3IXDA 3PBQA 3FPVA 4BMWA 1IKIA 3C38A 3R7WB 1S4SA 4Y7PA 2WZZA 3EWKA 3NULA 2EFXA 2JKTM 4NXGA 2ZQ8A 1NYMA 3F1NB 4Q0IA 4R4SA 3BY9A 3CAXA 1XXMA 3Q81A 3T1SA 2ZQAA 1IYQA 3NJAA 2R78A 5A92A 1ES3A 3CWFA 1WE4A 4IJGA 2VV6A 1H3QA 2X71A 4F3LA 2HV1A 4GD8A 3VOZA 4N92A 3EOIA 3M6BA 3UB5P 5HPIA 5CGSA 3JYIA 2GZAA 3UE0A 4JLFA 4MEZA 4GD6A 1CF0A 2B95A 1I5QA 3NDEA 3UB7A 4O8GA 4E6WA 4BD1A 3MJQA 2JBFA 3DWKA 3F1PB 1ES4A 5J3WA 3LO7A 3UDIA 2WK0A 2VGJA 1GSXA 3G31A 1G6AA 4FD8A 3VSKA 5CXWA 2ZQ9A 1MBLA 2VGLS 2X02A 3W4PA 1XJ4A 1RCJA 3BFCA 2HJEA 2P9VA 4CQHA 2PAVP 3QP8A 5IS1A 3NOPC 4CLCA 5L07A 2Q9MA 2ZMAA 3JVUA 2PRFA 5CHMA 3KX0X 4HBTA 2VGLM 3W8KA 1TDLA 4DRTA 1XJ2A 2XGNA 3N8LA 3D72A 4P0MA 1ESUA 2M7VA 2B18A 2W3HA 4YINA 3C2WA 4IUKA 3BFDA 4DE3A 1FSWA 3HLCA 1AXBA 1O7EA 3LR5A 3WS4A 1OPXA 1P0ZA 3ICYA 4XUXA 1LL9A 3K2NA 1YLYA 3IH9A 3HLDA 1YAXA 4EU0A 4EETB 3M2KA 4KZ9A 3E4PA 1LSXA 4GW9A 3A3FA 4N9LA 1RGZA 3OOVA 4F3LB 2JKTI 1FCMA 3ZNYA 5M18A 2ZMVA 3MKFA 2ZQCA 4X68A 5E2FA 3NDGA 2XD1A 1N9OA 4S2JA 5FQIA 1FSYA 3IT9A 3SH8A 1H0MA 3D3OA 4Y0TA 3O86A 2XRNA 3PBSA 3TSGA 5HD5A 2A24B 2G7UA 4G3WA 2QHKA 3CHWP 4EEPA 5HWTA 5CX7A 4OP5A 3PTEA 5FA7A 4N9KA 3O88A 1IYOA 1XJ3A 1HLUP 4BWIA 3IHAA 2EX6A 2J8YA 4Z1WA 5HW3A 2EX2A 4CLCB 1VETB 1KVLA 2PD7A 1CI9A 3FWLA 3EEAA 4YOFA 4DXCA 2UV0E 1STZA 3LIFA 1Z6FA 4G3KA 1FCOA 3IXGA 3TG9A 5A93A 3PXPA 1T19A 2A2LA 3MSHA 5HX9A 4MDZA 3N8SA 3PBRA 4PKYG 1BLPA 1V9YA 1AWIA 4GS9A 2PHYA 5HL6A 3S7OA 4BBUA 4Y0UA 3ITAA 3NCKA 1S4RA 2BG1A 2L1MA 4Y3IA 1L2SA 2ZBBA 3VE4A 1VB6A 4NXEA 2JKFA 5HDCA 3CMZA 2Z2MB 2W3GA 3DTIA 4DJ3A 3GSGA 2V1ZA 2Z6DA 2W3DA 3BLSA 3WWXA 5CHJA 1Y54A 3ZG9B 3H9WA 4LENA 1Q2QA 3G32A 1PI5A 5GLDA 5C5KA 3MQQA 4MN6A 3RXWA 1PZPA 3GTCA 1D1JA 3B33A 3SS5A 4B93A 2B02A 3R4KA 3CG5A 4H8RA 1NRFA 3IHBA 3T50A 4QPRA 4Y15A 4IVKA 1CI8A 4MLLA 4EW7A 4AFIA 4GZBA 2IWBA 4RYEA 3WS5A 3ISGA 3S7NA 3LY4A 3GR2A 3BQ8A 4EERA 5KSCA 3MFXA 5K5BA 2HP6A 5TGFA 1L0DA 1VHMA 4CJNA 2V9AA 3PHYA 2WGVA 3HREA 1PZOA 3V5MA 1KE4A 5KMWA 1ZC2A 3ITBA 3LR4A 1NRJA 1T1BA 2H28A 1NXYA 3CLOA 1C3BA 4X6TA 3ZCZA 4KUKA 1W63M 1S0WA 4KZAA 2A3UA 3Q7VB 2D02A 2V2FF 2WGIA 1VEUB 4KUOA 2EA9A 4KZ7A 2H0TA 2HGVA 4U3TA 3AGFA 2JKRM 4Z9QA 2H0YA 3H7WA 3VFFA 3P01A 3F1OB 3U4LP 3TJZC 5TJJA 3UB9A 4PMAA 5FQQA 3UNWA 4LPZA 3VFHA 4Y0OA 1MWSA 5HWWA 1D7EA 2C6WB 5HSQA 4S2NA 3PR6A 5KIZA 3V3SA 2JHEA 2V8CA 1W8YA 2PU4A 4OLGA 3GVBA 2L0WA 1K55A 1M6KA 5FAOA 2P74A 3CUEA 3K3DA 4LRZE 4BBVA 1BZAA 2RCXA 2Y2LA 2ZL1A 2Z2LB 2J3TD 1DJBA 3OPRA 2O99A 4P87A 2E8IA 4XT2B 1MKIA 2Y2OA 3QP2A 4JGRA 4EQIA 5AQAA 3DWZA 1GHIA 4OPRA 3T4QA 1DP9A 1KDWA 4UEYA 3NY4A 4S2NC 1NWZA 3LIBA 1TF1A 1I2SA 1FOFA 2IWCA 1E3UA 1K55C 2XR0A 3CUEC 4FCFA 3C7VA 4ZRRA 2HDQA 5A91A 2ZC5B 3HL9A 1PNEA 2XA7S 1DJAA 4UHUA 2BLSA 4NK3A 2PR6A 2OWHA 2JC7A 3NC8A 1YLZA 5EECA 4E3OA 4OPYA 5TFQA 4JGPA 5AQ7A 4MN7A 2VV7A 5I5LA 2EWWA 3ZFZA 3SH9A 1CEFA 1JWPA 1NZOA 4KZBA 1P9RA 1NLZA 1OTDA 3LGOA 4OOLA 2ZD8A 4X1LA 1PI4A 1T1CA 4PM9A 1YT4A 4Y2FA 4OQIA 2ZOIA 4GHIA 1F9IA 4OLDA 1GSVA 5FAPA 5KZHA 1M40A 3MMHA 3P98A 3RTYA 2OV5A 4PM5A 3LI9A 2DMWA 2Q0OA 4E6XA 5HL1A 1WYCA 3IXBA 1PIOA 4Y17A 1S1ZA 5DJUA 3Q07A 1X0OA 4PM6A 5EE8A 3ZG5A 1ERMA 2W1TA 3GRJA 4FTXA 4G3VA 2GNXA 4S2MA 5AQBA 1U60A 2JKRI 2J9PA 4C75A 2V0UA 2QWSA 2XLNA 3FKWA 2OAP1 2WKQA 4WMCD 3UMDA 3CITA 2X01A 3VOYA 2FZ0A 2QYBA 1XA7A 1BYWA 2XD5A 5E2GA 4WL9A 5G18A 1BTLA 4JF5A 3K3CA 3T1XA 4JPMA 1PWDA 3ZVTA 4HESA 3IX3A 3UMEA 5FEGA 4HQAA 4R38A 1FQGA 3ZVWA 4OPQA 3T4KA 2W3EA 1BULA 1XA1A 4JXGA 1D06A 2W27A 2PBDP 2IA2A 3ZYTA 5I94A 4Q0HA 3UO9A 1PW8A 4PHTA 5GLAA 5F1FA 3VP1A 1WA9A 2XQZA 4I38A 3C7UA 4UAAA 1YLWA 4UQIS 1CK3A 4KG6A 3HLFA 4ARZB 1CEGA 1YSPA 1LLBA 1SCWA 4UA9A 4DMZA 1UGUA 3FYZA 3P7NA 2Y4AA 4DDSA 1TS7A 4WZ4A 3BEBA 4E04A 3WS0A 4WZ5C 1OMEA 4UQIM 4JXWA 3S7QA 3BFEA 3BFGA 2J3TC 2FFFB 3LEQA 1F98A 3A3EA 2E8JA 3G2YA 5EVIB 3NOUC 1S66L 3MXQA 4BL3A 3CI6A 4OQ0A 2G2UA 3GMWA 2QZ6A 3LUQA 2JCHA 1K25A 2EFUA 1VM1A 2KOIA 4ZDXA 4JKTA 5DTKA 4H6JB 2VK3A 3KYZA 1GSWA 3T1RA 1DP6A 3DTKA 3GQZA 1TDGA 1G28A 5CRFA 2HDSA 2VZWA 5F69A 5M19A 3MFDA 5DKKA 5L8MA 5L2FA 3GECA 4HNBA 4GB7A 3OPPA 4HY8A 5U47A 3ZGAB 3T4SA 4KZ5A 1JTDA 3OLOA 4IVIA 4MBHA 2YKHA 4S2OA 1HZOA 4JXVA 1SHVA 5CGWA 4XUZA 3M6HA 4R0QA 5E2EA 2VX8A 3O87A 4RQ9A 3DAVA 5IU1A 5D3OA 1SDNA 2ZC7A 4EXOA 2V20A 2ZM0A 2GDNA 1K57A 2QJ7A 5EUAA 4WMCA 3BM6A 4FSFA 4C3QA 1KVMA 5FI2A 3IH8A 4PPRA 3H82A 1W5DA 3CJMA 2P04A 3IF6C 3HLBA 2QJ5A 2I72A 2XEPA 4GDBA 4CPKA 3C4PA 1TVFA 4NETA 4GJ4A 1K57C 1H5XA 1YQSA 4D60A 1IKGA 3S7PA 1F2KA 1MZUA 1XKZA 3W4OA 3FZCA 3NHQA 4I5SA 3NIAA 2C5WB 1OTIA 3G6OA 1ZG4A 4FH4A 4EBNA 1OT6A 1NZUA 1UWPX 1I2WA 4IHQA 4DF6A 3LR0A 2VJWA 2WADA 2EWVA 5A90A 2P9VB 4M3KA 3QNBA 4L9FA 4IEDA 4WYYA 3MQOA 1XJ6A 1K6SA 4X1MA 3FC7A 4ZTKA 2WAEA 5L09A 1IYPA 2P7JA 2CC1A 4O0PA 5F82A 5AQ9A 5M1AA 2WKRA 1FCNA 1MKMA 3EQVA 1H8MA 3UDFA 1DRMA 1PW1A 2ZC4B 5JYPA 4EEUA 4MNRA 3PBNA 5FL3A 1BT5A 4X53A 2LB9A 5HDSA 2Z6CA 1JTGA 1ESIA 2Y55A 4KQQA 1FR6A 2R9XA 4N1XA 1IEMA 2O9AA 4WEKA 3OPHA 1MY8A 3MS6A 3DBAA 4QY6A 4R4RA 3JVVA 2XH9A 3BECA 1LSVA 3N6IA 4HP9A 3T12B 1RP5A 3IF5A 4C6YA 2DRWA 3BJNA 4I3AA 4Q0JA 1V9ZA 3U2AA 5TBMA 3W2ZA 1N9NA 1J9MA 5F68A 3S22A 4I3IA 3LFVA 2HDUA 4I39A 1S6RA 3T1QB 3L7HA 1K38A 5DFXA 4DE0A 4L0LA 2JN7A 5J4EA 3A0SA 1FILA 2OSUA 1LL5A 1S1YA 3TW8A 4DE2A 2BTFP 4ESPA 1QMFA
chains in the Genus database with same CATH topology
3MR0A 3NJAA 2R78A 1LSWA 3CWFA 4JGPA 4IJGA 5F5YA 2VV6A 4WF0A 4MN7A 1H3QA 2XSSA 4F3LA 2HV1A 2VV7A 5I5LA 2EWWA 3EOIA 3BW6A 2W1RA 5HPFA 3UE6A 2WKPA 3OC2A 5HPIA 2GZAA 1P9RA 1NLZA 1OTDA 4OOLA 3GDIA 1T1CA 2K31A 3UB7A 4Y2FA 4O8GA 2ZOIA 4GHIA 1F9IA 5KSHA 1GSVA 3MMHA 2D01A 3MJQA 1JNUA 2HJ9C 3RTYA 3LI9A 4KQOA 3PBTA 2VV8A 2DMWA 3F1PB 4NKPA 5J3WA 3OCNA 2V0WA 4DJ2A 4MN5A 3T4JA 4HHDA 1T1AA 3O5YA 5J7EA 1S1ZA 5DJUA 1GSXA 2VA0A 4EQ1A 3EGXC 5G4YA 4MMNA 1X0OA 2FH5A 2O0YA 2M1CA 3LI8A 2VGLS 2BASA 4I3JA 4HIAA 2W1TA 1XJ4A 3BWLA 2HJEA 4G3VA 4II7A 4CQHA 2GNXA 5IS1A 2OOLA 3NOPC 4CLCA 4GS9B 5HDDA 1OJ5A 3LIAA 4CLCE 3JVUA 1IFQA 5DJTA 1XFNA 2JKRI 3KX0X 2V0UA 2QWSA 3KSFA 4HH2A 2J3WA 2OAP1 2WKQA 2VGLM 3UMDA 3F1OA 3CITA 4JGQA 4MCWA 2FZ0A 1XJ2A 2QYBA 3IS2A 3D72A 2LB5A 3V67A 3MF0A 1BYWA 2GX5A 5MC7A 2M7VA 2B18A 2W3HA 4WL9A 3C2WA 4IUKA 3H82B 3K3CA 1DP8A 3NOTC 3LR3A 3ULFA 4L9GA 3UMEA 5HWVA 2MJ6A 3LR5A 1OPXA 4HQAA 4R38A 1NLYA 1P0ZA 2K2NA 3ICYA 3T4KA 3KSIA 2W3EA 3K2NA 2PDRA 1YAXA 2PYPA 1D06A 2W27A 1YSQA 3UE3A 4EU0A 4NEED 2KDKA 4EETB 3T4OA 4GCZA 2IA2A 4O01A 3ZYTA 3E0YA 5AVEA 4Q0HA 3KYQA 3T4TA 4XT2A 2K7SA 3E4PA 4PHTA 1LSXA 4GW9A 1P9WA 3IBRA 2KLIA 1WA9A 4I38A 3BY8A 3R7WA 3OOVA 1KOUA 4F3LB 4UQIS 2JKTI 2HF6A 4ARZB 1F5MA 2ZMVA 2INWA 2VLGA 1YSPA 2YKFA 3KO6A 3HCYA 4DMZA 1EW0A 3F1NA 1UGUA 1N9OA 3P7NA 2V1AA 1TS7A 5AJGA 4E04A 3D3OA 2VEAA 4UQIM 3E4QA 3B42A 2XRNA 3PBSA 3S7QA 1OT9A 2ZMFA 3FPWA 5HD5A 4WN5A 4P6ZM 2J3TC 2A24B 2V1BA 2G7UA 3EQUA 4G3WA 1F98A 2QHKA 4EEPA 5HWTA 1TS0A 3NOUC 1S66L 5CX7A 5F6AA 4EUVA 4CLCD 1MC0A 3H7WB 3MXQA 3UB6A 3CI6A 1XJ3A 4BWIA 4ME4A 3LUQA 4HI4A 4Z1WA 2PT7A 2O9CA 4CLCB 2CMNA 2PD7A 3EEAA 4WUJA 4EESA 3IBJA 4YOFA 3F1PA 4Y5FA 2KOIA 3TRCA 1STZA 3PYPA 3LIFA 4H6JB 3KYZA 1GSWA 1DP6A 1OTAA 4G3KA 1YKDA 1G28A 3PXPA 1N9LA 1T19A 2VZWA 5F69A 3VE3A 2A2LA 3UB8A 1ZHHB 4MDZA 3PBRA 5DKKA 4OOMA 5L8MA 1XFQA 3GECA 4HNBA 4PKYG 4WEJA 4HY8A 1LT0A 3T4SA 1V9YA 1W63Q 5AVFA 4GS9A 2PHYA 4R3AA 1OTEA 1Y28A 3OLOA 5HL6A 2YKHA 4ETXA 5DF9A 3S7OA 4BBUA 4WELA 5TBMB 1S4RA 4PAUA 2KX6A 2L1MA 4R6LA 2VX8A 4Y3IA 2PYRA 5A8BA 2ZBBA 3B47A 3VE4A 1VB6A 1T18A 4RQ9A 3FG8A 4NXEA 3LYXA 4L9EA 5IU1A 4NXFA 5HDCA 4HP4A 4EXOA 2XROA 2W3GA 4DJ3A 2Z6DA 2QJ7A 2W3DA 3VV4A 4FSFA 3C8CA 3H9WA 4PKYA 4ETZA 2ZOHA 5C5KA 3MQQA 3HJKA 4MN6A 1ODVA 4BJPA 1UWNX 2NUTC 3H82A 3B33A 4FOFA 4WLAA 4LRYC 2P04A 2QJ5A 2NUPC 4B93A 2B02A 3R4KA 4P6ZS 3T50A 3LIEA 3E4OA 4QPRA 4GJ4A 3ZQ5A 4AFIA 4EW7A 4LRXC 2O9BA 5G4ZA 2OAQ1 3KSHA 3S7NA 3BQ8A 4EERA 1TD5A 3TE8A 3MFXA 1S67L 3S7PA 1MZUA 5K5BA 4GHIB 3NHQA 4I5SA 1VHMA 2V9AA 3PHYA 3KSGA 4HJ4A 4K08A 1OTIA 3G6OA 3MQ0A 3LICA 4HOIA 4ARZA 3LR4A 2XA7M 1NRJA 3C30A 1T1BA 3E98A 4LLOB 2H28A 3CLOA 4HH3A 1OT6A 1OJGA 1UWPX 1TS8A 5DFYA 4HJ3A 5DKLA 4IHQA 1P97A 3LR0A 4NXBA 4KUKA 2VJWA 3BQAA 5EFWA 1W63M 2W1TB 2EWVA 2QKPA 4IUHA 2L4RA 3HJIA 1IOUA 1G6OA 4B9OA 2D02A 4L9FA 4KUOA 1TS6A 2A24A 3MQOA 3A0RA 2EA9A 3RH8B 5IT5A 2HGVA 1XJ6A 2Y79A 3FC7A 2OWJA 2PD8A 2JKRM 3PBOA 3H7WA 4KQDA 2M7UA 3P01A 3F1OB 4GLQA 2P7JA 4O0PA 4R70A 4YNRA 3TJZC 2PR5A 2WKRA 5TJJA 1MKMA 3EQVA 3UB9A 1LL8A 2I9VA 1H8MA 3IS2B 1DRMA 3EEHA 2W0NA 4LPZA 4M4XA 2P08A 5HWWA 4EEUA 1D7EA 5HSQA 3PBNA 5FL3A 3SW1A 2LB9A 3PR6A 5HDSA 5KIZA 2GJ3A 2JHEA 2Z6CA 4H6JA 3RFBA 2L0WA 4DN0A 2J80A 3CUEA 4YWZA 3K3DA 4LRZE 4BBVA 2O9AA 4WEKA 3T4LA 2VKSA 2Y8HA 2W3FA 1OTBA 2J3TD 3DBAA 3A0VA 5HZHA 2O99A 3JVVA 1LSVA 3OBFA 5HD3A 4HP9A 4XT2B 4CLCC 4JGRA 5LBRA 1ZTUA 4JGOA 3PBQA 3BJNA 4I3AA 3FPVA 4Q0JA 1DP9A 3T4QA 4BMWA 1V9ZA 4UEYA 3U2AA 5TBMA 3C38A 3R7WB 1NWZA 4BBTA 3LIBA 1S4SA 1N9NA 3W2ZA 3OCLA 5F68A 3LIDA 4I3IA 3LFVA 1TF1A 4I39A 3EWKA 4HJ6A 5DFXA 3CUEC 3EGDC 4L0LA 2JN7A 5J4EA 2JKTM 3A0SA 4NXGA 4ZRRA 1S1YA 2XA7S 3F1NB 3TW8A 4Q0IA 2PR6A 2OWHA 3BY9A 3CAXA 3VOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MR0 A;  3NJA A;  2R78 A;  1LSW A;  3CWF A;  4JGP A;  5F5Y A;  2VV6 A;  4WF0 A;  4F3L A;  2HV1 A;  2VV7 A;  5I5L A;  3UE6 A;  2WKP A;  1OTD A;  3GDI A;  1T1C A;  3UB7 A;  2ZOI A;  4GHI A;  1F9I A;  1GSV A;  2D01 A;  3MJQ A;  1JNU A;  3RTY A;  3LI9 A;  2VV8 A;  3F1P B;  5J3W A;  2V0W A;  4DJ2 A;  4MN5 A;  4HHD A;  1T1A A;  5J7E A;  1S1Z A;  5DJU A;  1GSX A;  4EQ1 A;  5G4Y A;  1X0O A;  2M1C A;  3LI8 A;  2BAS A;  4I3J A;  4HIA A;  1XJ4 A;  3BWL A;  5IS1 A;  2OOL A;  3NOP C;  4GS9 B;  5HDD A;  1OJ5 A;  3LIA A;  5DJT A;  1XFN A;  3KX0 X;  2V0U A;  2QWS A;  4HH2 A;  2WKQ A;  3UMD A;  3F1O A;  4JGQ A;  1XJ2 A;  3IS2 A;  3D72 A;  1BYW A;  4WL9 A;  3C2W A;  3H82 B;  3K3C A;  1DP8 A;  3NOT C;  3ULF A;  4L9G A;  3UME A;  5HWV A;  4HQA A;  4R38 A;  1P0Z A;  3ICY A;  2PDR A;  2PYP A;  1D06 A;  2W27 A;  2KDK A;  4EET B;  4GCZ A;  5AVE A;  4XT2 A;  2K7S A;  3E4P A;  1LSX A;  4GW9 A;  3IBR A;  1WA9 A;  4I38 A;  3BY8 A;  1KOU A;  4F3L B;  2INW A;  2VLG A;  2YKF A;  1EW0 A;  3F1N A;  1UGU A;  1N9O A;  3P7N A;  2V1A A;  1TS7 A;  4E04 A;  2VEA A;  3E4Q A;  1OT9 A;  5HD5 A;  4WN5 A;  2A24 B;  2V1B A;  1F98 A;  2QHK A;  4EEP A;  5HWT A;  1TS0 A;  3NOU C;  1S66 L;  5F6A A;  3H7W B;  3MXQ A;  3UB6 A;  1XJ3 A;  3LUQ A;  4HI4 A;  2CMN A;  2PD7 A;  4WUJ A;  4EES A;  3F1P A;  3PYP A;  3LIF A;  4H6J B;  1GSW A;  1DP6 A;  1OTA A;  1G28 A;  1N9L A;  1T19 A;  5F69 A;  3VE3 A;  3UB8 A;  5DKK A;  1XFQ A;  3GEC A;  4HNB A;  4PKY G;  4HY8 A;  1LT0 A;  1V9Y A;  5AVF A;  4GS9 A;  2PHY A;  4R3A A;  1OTE A;  1Y28 A;  3OLO A;  2YKH A;  4BBU A;  5TBM B;  1S4R A;  2KX6 A;  2L1M A;  4R6L A;  2PYR A;  5A8B A;  2ZBB A;  3VE4 A;  1VB6 A;  1T18 A;  4RQ9 A;  3FG8 A;  4NXE A;  3LYX A;  4L9E A;  5IU1 A;  4NXF A;  5HDC A;  4HP4 A;  4EXO A;  4DJ3 A;  2Z6D A;  2QJ7 A;  3C8C A;  3H9W A;  4PKY A;  2ZOH A;  3MQQ A;  3HJK A;  4MN6 A;  1ODV A;  1UWN X;  3H82 A;  3B33 A;  4WLA A;  4LRY C;  2QJ5 A;  2B02 A;  3T50 A;  3LIE A;  3E4O A;  4EW7 A;  3ZQ5 A;  4LRX C;  5G4Z A;  4EER A;  3MFX A;  1S67 L;  1MZU A;  4GHI B;  3NHQ A;  4I5S A;  2V9A A;  3PHY A;  4HJ4 A;  4K08 A;  1OTI A;  3G6O A;  3LIC A;  4HOI A;  1T1B A;  4LLO B;  2H28 A;  3CLO A;  4HH3 A;  1OT6 A;  1OJG A;  1UWP X;  1TS8 A;  4HJ3 A;  5DKL A;  1P97 A;  4NXB A;  4KUK A;  5EFW A;  2QKP A;  2L4R A;  3HJI A;  4B9O A;  2D02 A;  4L9F A;  4KUO A;  1TS6 A;  2A24 A;  3MQO A;  3A0R A;  2EA9 A;  3RH8 B;  1XJ6 A;  3FC7 A;  2OWJ A;  2PD8 A;  3H7W A;  4KQD A;  3F1O B;  2P7J A;  4R70 A;  2PR5 A;  2WKR A;  3UB9 A;  1LL8 A;  2I9V A;  3IS2 B;  1DRM A;  3EEH A;  2W0N A;  4LPZ A;  4M4X A;  5HWW A;  4EEU A;  1D7E A;  5HSQ A;  3SW1 A;  5HDS A;  5KIZ A;  2GJ3 A;  2JHE A;  2Z6C A;  4H6J A;  2L0W A;  2J80 A;  4YWZ A;  3K3D A;  4LRZ E;  4BBV A;  1OTB A;  5HZH A;  3A0V A;  1LSV A;  5HD3 A;  4HP9 A;  4XT2 B;  4JGR A;  4JGO A;  4I3A A;  1DP9 A;  1V9Z A;  5TBM A;  4BBT A;  1NWZ A;  3LIB A;  1S4S A;  1N9N A;  5F68 A;  3LID A;  4I3I A;  4I39 A;  3EWK A;  4HJ6 A;  2JN7 A;  5J4E A;  3A0S A;  4NXG A;  1S1Y A;  3F1N B;  2PR6 A;  2OWH A;  3BY9 A;  3CAX A;  3VOL A; 
#chains in the Genus database with same CATH topology
 4E3I A;  5FAT A;  1LSW A;  5DVA A;  1SKO A;  2Y2K A;  1XGJ A;  5F5Y A;  4WF0 A;  1XP4 A;  2XSS A;  4LCM A;  3BW6 A;  3FKV A;  3BYD A;  5HPF A;  3OZH A;  3UE6 A;  1PFL A;  2WKP A;  4B88 A;  3OC2 A;  3NI9 A;  3IWQ A;  1YLT A;  3CPT A;  1GCE A;  3GDI A;  4ID4 A;  3UPP A;  2K31 A;  2XK1 A;  5GLC A;  4P85 A;  3D9Y A;  4HEF A;  5EVI D;  3PAG A;  5KSH A;  2Y2N A;  4OQG A;  1KGE A;  2HJ9 C;  2VV8 A;  4NKP A;  3G35 A;  3OCN A;  4MN5 A;  2WKI A;  3T4J A;  1GA0 A;  1T1A A;  3O5Y A;  4KG2 A;  2WUQ A;  5J7E A;  1QME A;  2Y2G A;  3AGD A;  4F94 A;  2VA0 A;  2RL3 A;  3EGX C;  5G4Y A;  4MMN A;  2FH5 A;  1O07 A;  2O0Y A;  3A3D A;  2M1C A;  2WKH A;  4HIA A;  3BWL A;  3VP0 A;  1N4O A;  3N7W A;  4GS9 B;  4RX3 A;  5HDD A;  2Q9N A;  4CLC E;  1YPR A;  4EV4 A;  1CJF A;  5F1G A;  4HH2 A;  4QJG A;  3S4X A;  3QHY A;  1KGF A;  4UA6 A;  1ACF A;  4S2K A;  3IQA A;  5BOH A;  2JKG A;  4D2O A;  3BFF A;  4JGQ A;  4MCW A;  4PM7 A;  3IS2 A;  4KZ3 A;  3MF0 A;  2GX5 A;  5MC7 A;  1G68 A;  4LV2 A;  1YLP A;  4ZJ2 A;  3PAE A;  4BQM A;  5EOE A;  3NBL A;  3NOT C;  3LR3 A;  4L9G A;  2MJ6 A;  1VQQ A;  1NLY A;  2K2N A;  3KSI A;  3ZG7 B;  2PDR A;  2DCF A;  1N9B A;  3C5A A;  1YSQ A;  3CZD A;  2KDK A;  3T4O A;  4GCZ A;  3E0Y A;  2HZ5 A;  2Y2M A;  1W8Q A;  1Y4O A;  3T4T A;  5EV0 A;  4E3K A;  1YMS A;  1ES2 A;  1P9W A;  1NY0 A;  5J8X A;  3BY8 A;  3R7W A;  3UDX A;  1KOU A;  5HAQ A;  1ZKJ A;  3MBZ A;  2HF6 A;  5F83 A;  4N1H A;  1H8Y A;  2YKF A;  3M2J A;  2XFS A;  1EW0 A;  3F1N A;  5IHV A;  3DTE A;  2V1A A;  3N8R A;  5AJG A;  4IBX A;  3VP2 A;  3E4Q A;  1PWG A;  1OT9 A;  5CGX A;  4BEN A;  3FPW A;  4P6Z M;  3HBR A;  2V1B A;  1FR1 A;  5FI6 A;  4QU3 A;  5F6A A;  5EOO A;  3L9K A;  4CLC D;  1MC0 A;  3H7W B;  4X56 A;  5FQJ A;  3UB6 A;  4ME4 A;  1MWU A;  4HI4 A;  2CMN A;  3LCE A;  4WUJ A;  4QHC A;  4UA7 A;  3F1P A;  3TRC A;  5FQ9 A;  2ZJ9 A;  5DTS A;  5CEC A;  1OTA A;  5L10 A;  1YKD A;  3G2Z A;  3VE3 A;  1ZHH B;  4LV3 A;  1GHM A;  3ZDJ A;  2ZL1 B;  2R9W A;  1XFQ A;  4WEJ A;  1HTZ A;  1W63 Q;  1OTE A;  1NJ4 A;  2HP9 A;  5DF9 A;  2QPN A;  4WEL A;  3RJU A;  3HLW A;  3FV7 A;  4R6L A;  5A8B A;  3B47 A;  2HDR A;  1T18 A;  3V3R A;  2EX8 A;  3LYX A;  4L9E A;  5EVE A;  3SS4 A;  2XRO A;  1BUE A;  4EUZ A;  1SKF A;  2DNS A;  3C8C A;  4ETZ A;  5JYO A;  2ZOH A;  3HJK A;  1ODV A;  4WZ5 A;  1UWN X;  2NUT C;  3G34 A;  3Q7Z A;  4NG2 A;  3D4F A;  3LEZ A;  5FQM A;  2NUP C;  1DJC A;  5GHY A;  4KZ8 A;  3MZF A;  3LIE A;  4OH0 A;  2WYX A;  3LY3 A;  4LRX C;  5G4Z A;  2OAQ 1;  3TE8 A;  1S67 L;  3OPL A;  4GHI B;  3MXR A;  3N4I A;  3SH7 A;  3KSG A;  4HJ4 A;  4RA7 A;  2WKE A;  3MQ0 A;  2J9O A;  4XXR A;  1EI5 A;  3HLE A;  4X25 A;  1BSG A;  3A3I A;  1J3W A;  3VSL A;  4HH3 A;  1K56 D;  2WZX A;  1L3L A;  4GOG A;  2XDM A;  4HJ3 A;  5DKL A;  1ERO A;  4NXB A;  2W1T B;  4KZ6 A;  5HAP A;  1H8Z A;  4IUH A;  4OP8 A;  2L4R A;  1IOU A;  1G6O A;  2WGW A;  2JE5 A;  4GKU A;  1TS6 A;  2A24 A;  3RH8 B;  5IT5 A;  3O3V A;  2Y79 A;  3QP5 A;  4KQD A;  2M7U A;  1JWZ A;  4R70 A;  4ZAM A;  2PR5 A;  4MBK A;  4S2L A;  2I9V A;  4X69 A;  3ZG8 B;  1VET A;  2P08 A;  5GHX A;  3G4P A;  5E2H A;  3WS2 A;  2HPB A;  3IF6 A;  4DN0 A;  2J80 A;  3MZD A;  3T4L A;  4EWF A;  2VKS A;  5HZH A;  3A0V A;  3VP3 A;  1K0K A;  1TEM A;  3HUN A;  4DXB A;  4K0W A;  5HD3 A;  1K4F A;  4CLC C;  4KZ4 A;  3HLG A;  3UE1 A;  3Q82 A;  4JGO A;  4JBF A;  5CHU A;  4BBT A;  4OOY A;  3OCL A;  1HVB A;  3LID A;  1KGG A;  4R3J A;  4GNU A;  1LI9 A;  4HJ6 A;  3EGD C;  1PRQ A;  3HUO A;  2H10 A;  4LV0 A;  1CQA A;  5EM1 A;  3IXH A;  2ZLY A;  4YFM A;  3VOL A;  4RVA A;  1K4E A;  5FSR A;  3MR0 A;  3IWO A;  3P09 A;  3W4Q A;  2W1R A;  3IX4 A;  4E3M A;  3V50 A;  1Q2P A;  2ZC3 B;  4KG5 A;  4IBR A;  5TR7 A;  5HAI A;  4K91 A;  3HVF A;  3DW0 A;  2WAF A;  5FI7 A;  2XFT A;  2ZC6 B;  1KE0 A;  4QY5 A;  2D01 A;  1JNU A;  2WGW B;  3SOI A;  4KQO A;  3PBT A;  3QP6 A;  2V0W A;  4DJ2 A;  1G5U A;  3UPN A;  4HHD A;  1KDS A;  1ES5 A;  2PU2 A;  1YM1 A;  4E3J A;  1ONG A;  4ZJ3 A;  4EQ1 A;  2A49 A;  4JF6 A;  5FDH A;  3LI8 A;  5FAS A;  2BAS A;  4Q8I A;  3BRM A;  4I3J A;  2HP5 A;  1DY6 A;  1K56 A;  4II7 A;  1MWT A;  2OOL A;  1K54 A;  1OJ5 A;  3LIA A;  3Q7V A;  1IFQ A;  5DJT A;  1VEU A;  1XFN A;  3IF6 B;  1KE3 A;  4BLM A;  1PWC A;  1LI0 A;  3KSF A;  2V8F A;  2J3W A;  1YLJ A;  1E4D A;  2ZQ7 A;  1W7F A;  3F1O A;  4O7D A;  4P6B A;  2UWX A;  5FAQ A;  2LB5 A;  3V67 A;  4U0T A;  2IWD A;  1PYY A;  1E3U D;  4RX2 A;  3VP4 A;  4LGW A;  4U0X A;  2PBY A;  3TOI A;  1K54 C;  3H82 B;  5CTN A;  1DP8 A;  3MKE A;  1GHP A;  3ULF A;  2QMI A;  4LCL A;  5HWV A;  5FEF A;  3DTM A;  1MPL A;  5CED A;  2PYP A;  3ZNT A;  4K0X A;  3UE3 A;  4NEE D;  1LHY A;  3SZT A;  1ZG6 A;  2AVX A;  4O01 A;  5AVE A;  3G30 A;  3KYQ A;  3MXS A;  4XT2 A;  2K7S A;  1A0K A;  1IYS A;  5GLB A;  3IBR A;  4HBU A;  2KLI A;  5GHZ A;  3UN7 A;  4OPZ A;  4LV1 A;  2ZQD A;  4GDN A;  4B4Z A;  2Y2Q A;  1F5M A;  2INW A;  2VLG A;  1YMX A;  4A5R A;  1MXO A;  1RGY A;  4E3L A;  5FQK A;  3KO6 A;  3HCY A;  2ZM2 A;  4JXS A;  4FH2 A;  4QWO A;  5EM0 A;  2VEA A;  2VGK A;  4WM9 A;  3B42 A;  4OON A;  2ZMF A;  4WN5 A;  1Z09 A;  1XGI A;  4S2P A;  3EQU A;  5GL9 A;  4OQH A;  1TS0 A;  3HUM A;  4EUV A;  2EXB A;  2Y2J A;  2ZM8 A;  2Y2P A;  2G2W A;  1HD8 A;  3AGE A;  5FDS A;  4MBF A;  2PT7 A;  1W79 A;  2O9C A;  3WRZ A;  4EES A;  3IBJ A;  4Y5F A;  3PYP A;  1IEL A;  3IWI A;  2OLV A;  5DF8 A;  1N9L A;  2OLU A;  2EX9 A;  3UB8 A;  2Y91 A;  2Y2H A;  4OOM A;  1SZV A;  5EVL A;  1LT0 A;  4EBP A;  5AVF A;  4ZJ1 A;  4R3A A;  1Y28 A;  4DE1 A;  3UPO A;  3UY6 A;  4ETX A;  4WBG A;  3MZE A;  1K6R A;  2Y2I A;  5TBM B;  1SDE A;  4PAU A;  3RXX A;  5E43 A;  2KX6 A;  4EBL A;  2PYR A;  3FG8 A;  1NYY A;  1FIK A;  4NXF A;  1JWV A;  2ACG A;  3QNC A;  4HP4 A;  2H5S A;  3SS3 A;  3E2K A;  3NEC A;  3VV4 A;  4BL2 A;  4PKY A;  2EXA A;  4BJP A;  4KEN B;  4WLA A;  4FOF A;  4LRY C;  3GV9 A;  4B4X A;  1SKO B;  3ZHH A;  3BLM A;  3IX8 A;  1WYB A;  3WS1 A;  4X55 A;  4P6Z S;  3E4O A;  3CPT B;  3ZQ5 A;  3WRT A;  2O9B A;  5CER A;  3KSH A;  2J7V A;  1TD5 A;  4JF4 A;  2Y59 A;  3KYE A;  3I7J A;  3A3J A;  4LFU A;  1L0G A;  4DDY A;  1XPB A;  4K08 A;  4S2I A;  3Q1F A;  3LIC A;  4HOI A;  4ARZ A;  2XA7 M;  1XX2 A;  3C30 A;  3E98 A;  3QP1 A;  4LLO B;  5DF7 A;  1L0E A;  4GN2 A;  5HAR A;  3VMA A;  1OJG A;  1TS8 A;  5DFY A;  4BD0 A;  4OVD A;  1P97 A;  3BQA A;  5EFW A;  2QKP A;  4PM8 A;  3HJI A;  3ZG0 A;  1MWR A;  1EWZ A;  4B9O A;  4R1G A;  5CEB A;  5EPH A;  3A0R A;  1ONH A;  5EVI A;  2FFY A;  5DTT A;  1BLS A;  2OWJ A;  2PD8 A;  3PBO A;  4GLQ A;  4QD4 A;  4DKI A;  4YNR A;  4FUW A;  3JPU A;  1LL8 A;  3B3X A;  3IS2 B;  2XF3 A;  3EEH A;  2W0N A;  4M4X A;  4QB8 A;  3V39 A;  1ERQ A;  1E25 A;  3SW1 A;  2GJ3 A;  5HFO A;  1L0F A;  4H6J A;  1BLH A;  3RFB A;  1BLC A;  1GA9 A;  2B5R A;  1ALQ A;  4Y13 A;  4YWZ A;  4R3B A;  5EVI C;  4KQR A;  4E3N A;  3C4O A;  4ZBE A;  3QP4 A;  3S1Y A;  2Y8H A;  2W3F A;  1OTB A;  3E2L A;  4OKP A;  1JVJ A;  5CTM A;  3OBF A;  4R23 A;  5LBR A;  1ZTU A;  3IXD A;  3PBQ A;  3FPV A;  4BMW A;  1IKI A;  3C38 A;  3R7W B;  1S4S A;  4Y7P A;  2WZZ A;  3EWK A;  3NUL A;  2EFX A;  2JKT M;  4NXG A;  2ZQ8 A;  1NYM A;  3F1N B;  4Q0I A;  4R4S A;  3BY9 A;  3CAX A;  1XXM A;  3Q81 A;  3T1S A;  2ZQA A;  1IYQ A;  3NJA A;  2R78 A;  5A92 A;  1ES3 A;  3CWF A;  1WE4 A;  4IJG A;  2VV6 A;  1H3Q A;  2X71 A;  4F3L A;  2HV1 A;  4GD8 A;  3VOZ A;  4N92 A;  3EOI A;  3M6B A;  3UB5 P;  5HPI A;  5CGS A;  3JYI A;  2GZA A;  3UE0 A;  4JLF A;  4MEZ A;  4GD6 A;  1CF0 A;  2B95 A;  1I5Q A;  3NDE A;  3UB7 A;  4O8G A;  4E6W A;  4BD1 A;  3MJQ A;  2JBF A;  3DWK A;  3F1P B;  1ES4 A;  5J3W A;  3LO7 A;  3UDI A;  2WK0 A;  2VGJ A;  1GSX A;  3G31 A;  1G6A A;  4FD8 A;  3VSK A;  5CXW A;  2ZQ9 A;  1MBL A;  2VGL S;  2X02 A;  3W4P A;  1XJ4 A;  1RCJ A;  3BFC A;  2HJE A;  2P9V A;  4CQH A;  2PAV P;  3QP8 A;  5IS1 A;  3NOP C;  4CLC A;  5L07 A;  2Q9M A;  2ZMA A;  3JVU A;  2PRF A;  5CHM A;  3KX0 X;  4HBT A;  2VGL M;  3W8K A;  1TDL A;  4DRT A;  1XJ2 A;  2XGN A;  3N8L A;  3D72 A;  4P0M A;  1ESU A;  2M7V A;  2B18 A;  2W3H A;  4YIN A;  3C2W A;  4IUK A;  3BFD A;  4DE3 A;  1FSW A;  3HLC A;  1AXB A;  1O7E A;  3LR5 A;  3WS4 A;  1OPX A;  1P0Z A;  3ICY A;  4XUX A;  1LL9 A;  3K2N A;  1YLY A;  3IH9 A;  3HLD A;  1YAX A;  4EU0 A;  4EET B;  3M2K A;  4KZ9 A;  3E4P A;  1LSX A;  4GW9 A;  3A3F A;  4N9L A;  1RGZ A;  3OOV A;  4F3L B;  2JKT I;  1FCM A;  3ZNY A;  5M18 A;  2ZMV A;  3MKF A;  2ZQC A;  4X68 A;  5E2F A;  3NDG A;  2XD1 A;  1N9O A;  4S2J A;  5FQI A;  1FSY A;  3IT9 A;  3SH8 A;  1H0M A;  3D3O A;  4Y0T A;  3O86 A;  2XRN A;  3PBS A;  3TSG A;  5HD5 A;  2A24 B;  2G7U A;  4G3W A;  2QHK A;  3CHW P;  4EEP A;  5HWT A;  5CX7 A;  4OP5 A;  3PTE A;  5FA7 A;  4N9K A;  3O88 A;  1IYO A;  1XJ3 A;  1HLU P;  4BWI A;  3IHA A;  2EX6 A;  2J8Y A;  4Z1W A;  5HW3 A;  2EX2 A;  4CLC B;  1VET B;  1KVL A;  2PD7 A;  1CI9 A;  3FWL A;  3EEA A;  4YOF A;  4DXC A;  2UV0 E;  1STZ A;  3LIF A;  1Z6F A;  4G3K A;  1FCO A;  3IXG A;  3TG9 A;  5A93 A;  3PXP A;  1T19 A;  2A2L A;  3MSH A;  5HX9 A;  4MDZ A;  3N8S A;  3PBR A;  4PKY G;  1BLP A;  1V9Y A;  1AWI A;  4GS9 A;  2PHY A;  5HL6 A;  3S7O A;  4BBU A;  4Y0U A;  3ITA A;  3NCK A;  1S4R A;  2BG1 A;  2L1M A;  4Y3I A;  1L2S A;  2ZBB A;  3VE4 A;  1VB6 A;  4NXE A;  2JKF A;  5HDC A;  3CMZ A;  2Z2M B;  2W3G A;  3DTI A;  4DJ3 A;  3GSG A;  2V1Z A;  2Z6D A;  2W3D A;  3BLS A;  3WWX A;  5CHJ A;  1Y54 A;  3ZG9 B;  3H9W A;  4LEN A;  1Q2Q A;  3G32 A;  1PI5 A;  5GLD A;  5C5K A;  3MQQ A;  4MN6 A;  3RXW A;  1PZP A;  3GTC A;  1D1J A;  3B33 A;  3SS5 A;  4B93 A;  2B02 A;  3R4K A;  3CG5 A;  4H8R A;  1NRF A;  3IHB A;  3T50 A;  4QPR A;  4Y15 A;  4IVK A;  1CI8 A;  4MLL A;  4EW7 A;  4AFI A;  4GZB A;  2IWB A;  4RYE A;  3WS5 A;  3ISG A;  3S7N A;  3LY4 A;  3GR2 A;  3BQ8 A;  4EER A;  5KSC A;  3MFX A;  5K5B A;  2HP6 A;  5TGF A;  1L0D A;  1VHM A;  4CJN A;  2V9A A;  3PHY A;  2WGV A;  3HRE A;  1PZO A;  3V5M A;  1KE4 A;  5KMW A;  1ZC2 A;  3ITB A;  3LR4 A;  1NRJ A;  1T1B A;  2H28 A;  1NXY A;  3CLO A;  1C3B A;  4X6T A;  3ZCZ A;  4KUK A;  1W63 M;  1S0W A;  4KZA A;  2A3U A;  3Q7V B;  2D02 A;  2V2F F;  2WGI A;  1VEU B;  4KUO A;  2EA9 A;  4KZ7 A;  2H0T A;  2HGV A;  4U3T A;  3AGF A;  2JKR M;  4Z9Q A;  2H0Y A;  3H7W A;  3VFF A;  3P01 A;  3F1O B;  3U4L P;  3TJZ C;  5TJJ A;  3UB9 A;  4PMA A;  5FQQ A;  3UNW A;  4LPZ A;  3VFH A;  4Y0O A;  1MWS A;  5HWW A;  1D7E A;  2C6W B;  5HSQ A;  4S2N A;  3PR6 A;  5KIZ A;  3V3S A;  2JHE A;  2V8C A;  1W8Y A;  2PU4 A;  4OLG A;  3GVB A;  2L0W A;  1K55 A;  1M6K A;  5FAO A;  2P74 A;  3CUE A;  3K3D A;  4LRZ E;  4BBV A;  1BZA A;  2RCX A;  2Y2L A;  2ZL1 A;  2Z2L B;  2J3T D;  1DJB A;  3OPR A;  2O99 A;  4P87 A;  2E8I A;  4XT2 B;  1MKI A;  2Y2O A;  3QP2 A;  4JGR A;  4EQI A;  5AQA A;  3DWZ A;  1GHI A;  4OPR A;  3T4Q A;  1DP9 A;  1KDW A;  4UEY A;  3NY4 A;  4S2N C;  1NWZ A;  3LIB A;  1TF1 A;  1I2S A;  1FOF A;  2IWC A;  1E3U A;  1K55 C;  2XR0 A;  3CUE C;  4FCF A;  3C7V A;  4ZRR A;  2HDQ A;  5A91 A;  2ZC5 B;  3HL9 A;  1PNE A;  2XA7 S;  1DJA A;  4UHU A;  2BLS A;  4NK3 A;  2PR6 A;  2OWH A;  2JC7 A;  3NC8 A;  1YLZ A;  5EEC A;  4E3O A;  4OPY A;  5TFQ A;  4JGP A;  5AQ7 A;  4MN7 A;  2VV7 A;  5I5L A;  2EWW A;  3ZFZ A;  3SH9 A;  1CEF A;  1JWP A;  1NZO A;  4KZB A;  1P9R A;  1NLZ A;  1OTD A;  3LGO A;  4OOL A;  2ZD8 A;  4X1L A;  1PI4 A;  1T1C A;  4PM9 A;  1YT4 A;  4Y2F A;  4OQI A;  2ZOI A;  4GHI A;  1F9I A;  4OLD A;  1GSV A;  5FAP A;  5KZH A;  1M40 A;  3MMH A;  3P98 A;  3RTY A;  2OV5 A;  4PM5 A;  3LI9 A;  2DMW A;  2Q0O A;  4E6X A;  5HL1 A;  1WYC A;  3IXB A;  1PIO A;  4Y17 A;  1S1Z A;  5DJU A;  3Q07 A;  1X0O A;  4PM6 A;  5EE8 A;  3ZG5 A;  1ERM A;  2W1T A;  3GRJ A;  4FTX A;  4G3V A;  2GNX A;  4S2M A;  5AQB A;  1U60 A;  2JKR I;  2J9P A;  4C75 A;  2V0U A;  2QWS A;  2XLN A;  3FKW A;  2OAP 1;  2WKQ A;  4WMC D;  3UMD A;  3CIT A;  2X01 A;  3VOY A;  2FZ0 A;  2QYB A;  1XA7 A;  1BYW A;  2XD5 A;  5E2G A;  4WL9 A;  5G18 A;  1BTL A;  4JF5 A;  3K3C A;  3T1X A;  4JPM A;  1PWD A;  3ZVT A;  4HES A;  3IX3 A;  3UME A;  5FEG A;  4HQA A;  4R38 A;  1FQG A;  3ZVW A;  4OPQ A;  3T4K A;  2W3E A;  1BUL A;  1XA1 A;  4JXG A;  1D06 A;  2W27 A;  2PBD P;  2IA2 A;  3ZYT A;  5I94 A;  4Q0H A;  3UO9 A;  1PW8 A;  4PHT A;  5GLA A;  5F1F A;  3VP1 A;  1WA9 A;  2XQZ A;  4I38 A;  3C7U A;  4UAA A;  1YLW A;  4UQI S;  1CK3 A;  4KG6 A;  3HLF A;  4ARZ B;  1CEG A;  1YSP A;  1LLB A;  1SCW A;  4UA9 A;  4DMZ A;  1UGU A;  3FYZ A;  3P7N A;  2Y4A A;  4DDS A;  1TS7 A;  4WZ4 A;  3BEB A;  4E04 A;  3WS0 A;  4WZ5 C;  1OME A;  4UQI M;  4JXW A;  3S7Q A;  3BFE A;  3BFG A;  2J3T C;  2FFF B;  3LEQ A;  1F98 A;  3A3E A;  2E8J A;  3G2Y A;  5EVI B;  3NOU C;  1S66 L;  3MXQ A;  4BL3 A;  3CI6 A;  4OQ0 A;  2G2U A;  3GMW A;  2QZ6 A;  3LUQ A;  2JCH A;  1K25 A;  2EFU A;  1VM1 A;  2KOI A;  4ZDX A;  4JKT A;  5DTK A;  4H6J B;  2VK3 A;  3KYZ A;  1GSW A;  3T1R A;  1DP6 A;  3DTK A;  3GQZ A;  1TDG A;  1G28 A;  5CRF A;  2HDS A;  2VZW A;  5F69 A;  5M19 A;  3MFD A;  5DKK A;  5L8M A;  5L2F A;  3GEC A;  4HNB A;  4GB7 A;  3OPP A;  4HY8 A;  5U47 A;  3ZGA B;  3T4S A;  4KZ5 A;  1JTD A;  3OLO A;  4IVI A;  4MBH A;  2YKH A;  4S2O A;  1HZO A;  4JXV A;  1SHV A;  5CGW A;  4XUZ A;  3M6H A;  4R0Q A;  5E2E A;  2VX8 A;  3O87 A;  4RQ9 A;  3DAV A;  5IU1 A;  5D3O A;  1SDN A;  2ZC7 A;  4EXO A;  2V20 A;  2ZM0 A;  2GDN A;  1K57 A;  2QJ7 A;  5EUA A;  4WMC A;  3BM6 A;  4FSF A;  4C3Q A;  1KVM A;  5FI2 A;  3IH8 A;  4PPR A;  3H82 A;  1W5D A;  3CJM A;  2P04 A;  3IF6 C;  3HLB A;  2QJ5 A;  2I72 A;  2XEP A;  4GDB A;  4CPK A;  3C4P A;  1TVF A;  4NET A;  4GJ4 A;  1K57 C;  1H5X A;  1YQS A;  4D60 A;  1IKG A;  3S7P A;  1F2K A;  1MZU A;  1XKZ A;  3W4O A;  3FZC A;  3NHQ A;  4I5S A;  3NIA A;  2C5W B;  1OTI A;  3G6O A;  1ZG4 A;  4FH4 A;  4EBN A;  1OT6 A;  1NZU A;  1UWP X;  1I2W A;  4IHQ A;  4DF6 A;  3LR0 A;  2VJW A;  2WAD A;  2EWV A;  5A90 A;  2P9V B;  4M3K A;  3QNB A;  4L9F A;  4IED A;  4WYY A;  3MQO A;  1XJ6 A;  1K6S A;  4X1M A;  3FC7 A;  4ZTK A;  2WAE A;  5L09 A;  1IYP A;  2P7J A;  2CC1 A;  4O0P A;  5F82 A;  5AQ9 A;  5M1A A;  2WKR A;  1FCN A;  1MKM A;  3EQV A;  1H8M A;  3UDF A;  1DRM A;  1PW1 A;  2ZC4 B;  5JYP A;  4EEU A;  4MNR A;  3PBN A;  5FL3 A;  1BT5 A;  4X53 A;  2LB9 A;  5HDS A;  2Z6C A;  1JTG A;  1ESI A;  2Y55 A;  4KQQ A;  1FR6 A;  2R9X A;  4N1X A;  1IEM A;  2O9A A;  4WEK A;  3OPH A;  1MY8 A;  3MS6 A;  3DBA A;  4QY6 A;  4R4R A;  3JVV A;  2XH9 A;  3BEC A;  1LSV A;  3N6I A;  4HP9 A;  3T12 B;  1RP5 A;  3IF5 A;  4C6Y A;  2DRW A;  3BJN A;  4I3A A;  4Q0J A;  1V9Z A;  3U2A A;  5TBM A;  3W2Z A;  1N9N A;  1J9M A;  5F68 A;  3S22 A;  4I3I A;  3LFV A;  2HDU A;  4I39 A;  1S6R A;  3T1Q B;  3L7H A;  1K38 A;  5DFX A;  4DE0 A;  4L0L A;  2JN7 A;  5J4E A;  3A0S A;  1FIL A;  2OSU A;  1LL5 A;  1S1Y A;  3TW8 A;  4DE2 A;  2BTF P;  4ESP A;  1QMF A; 
#chains in the Genus database with same CATH homology
 3MR0 A;  3NJA A;  2R78 A;  1LSW A;  3CWF A;  4JGP A;  4IJG A;  5F5Y A;  2VV6 A;  4WF0 A;  4MN7 A;  1H3Q A;  2XSS A;  4F3L A;  2HV1 A;  2VV7 A;  5I5L A;  2EWW A;  3EOI A;  3BW6 A;  2W1R A;  5HPF A;  3UE6 A;  2WKP A;  3OC2 A;  5HPI A;  2GZA A;  1P9R A;  1NLZ A;  1OTD A;  4OOL A;  3GDI A;  1T1C A;  2K31 A;  3UB7 A;  4Y2F A;  4O8G A;  2ZOI A;  4GHI A;  1F9I A;  5KSH A;  1GSV A;  3MMH A;  2D01 A;  3MJQ A;  1JNU A;  2HJ9 C;  3RTY A;  3LI9 A;  4KQO A;  3PBT A;  2VV8 A;  2DMW A;  3F1P B;  4NKP A;  5J3W A;  3OCN A;  2V0W A;  4DJ2 A;  4MN5 A;  3T4J A;  4HHD A;  1T1A A;  3O5Y A;  5J7E A;  1S1Z A;  5DJU A;  1GSX A;  2VA0 A;  4EQ1 A;  3EGX C;  5G4Y A;  4MMN A;  1X0O A;  2FH5 A;  2O0Y A;  2M1C A;  3LI8 A;  2VGL S;  2BAS A;  4I3J A;  4HIA A;  2W1T A;  1XJ4 A;  3BWL A;  2HJE A;  4G3V A;  4II7 A;  4CQH A;  2GNX A;  5IS1 A;  2OOL A;  3NOP C;  4CLC A;  4GS9 B;  5HDD A;  1OJ5 A;  3LIA A;  4CLC E;  3JVU A;  1IFQ A;  5DJT A;  1XFN A;  2JKR I;  3KX0 X;  2V0U A;  2QWS A;  3KSF A;  4HH2 A;  2J3W A;  2OAP 1;  2WKQ A;  2VGL M;  3UMD A;  3F1O A;  3CIT A;  4JGQ A;  4MCW A;  2FZ0 A;  1XJ2 A;  2QYB A;  3IS2 A;  3D72 A;  2LB5 A;  3V67 A;  3MF0 A;  1BYW A;  2GX5 A;  5MC7 A;  2M7V A;  2B18 A;  2W3H A;  4WL9 A;  3C2W A;  4IUK A;  3H82 B;  3K3C A;  1DP8 A;  3NOT C;  3LR3 A;  3ULF A;  4L9G A;  3UME A;  5HWV A;  2MJ6 A;  3LR5 A;  1OPX A;  4HQA A;  4R38 A;  1NLY A;  1P0Z A;  2K2N A;  3ICY A;  3T4K A;  3KSI A;  2W3E A;  3K2N A;  2PDR A;  1YAX A;  2PYP A;  1D06 A;  2W27 A;  1YSQ A;  3UE3 A;  4EU0 A;  4NEE D;  2KDK A;  4EET B;  3T4O A;  4GCZ A;  2IA2 A;  4O01 A;  3ZYT A;  3E0Y A;  5AVE A;  4Q0H A;  3KYQ A;  3T4T A;  4XT2 A;  2K7S A;  3E4P A;  4PHT A;  1LSX A;  4GW9 A;  1P9W A;  3IBR A;  2KLI A;  1WA9 A;  4I38 A;  3BY8 A;  3R7W A;  3OOV A;  1KOU A;  4F3L B;  4UQI S;  2JKT I;  2HF6 A;  4ARZ B;  1F5M A;  2ZMV A;  2INW A;  2VLG A;  1YSP A;  2YKF A;  3KO6 A;  3HCY A;  4DMZ A;  1EW0 A;  3F1N A;  1UGU A;  1N9O A;  3P7N A;  2V1A A;  1TS7 A;  5AJG A;  4E04 A;  3D3O A;  2VEA A;  4UQI M;  3E4Q A;  3B42 A;  2XRN A;  3PBS A;  3S7Q A;  1OT9 A;  2ZMF A;  3FPW A;  5HD5 A;  4WN5 A;  4P6Z M;  2J3T C;  2A24 B;  2V1B A;  2G7U A;  3EQU A;  4G3W A;  1F98 A;  2QHK A;  4EEP A;  5HWT A;  1TS0 A;  3NOU C;  1S66 L;  5CX7 A;  5F6A A;  4EUV A;  4CLC D;  1MC0 A;  3H7W B;  3MXQ A;  3UB6 A;  3CI6 A;  1XJ3 A;  4BWI A;  4ME4 A;  3LUQ A;  4HI4 A;  4Z1W A;  2PT7 A;  2O9C A;  4CLC B;  2CMN A;  2PD7 A;  3EEA A;  4WUJ A;  4EES A;  3IBJ A;  4YOF A;  3F1P A;  4Y5F A;  2KOI A;  3TRC A;  1STZ A;  3PYP A;  3LIF A;  4H6J B;  3KYZ A;  1GSW A;  1DP6 A;  1OTA A;  4G3K A;  1YKD A;  1G28 A;  3PXP A;  1N9L A;  1T19 A;  2VZW A;  5F69 A;  3VE3 A;  2A2L A;  3UB8 A;  1ZHH B;  4MDZ A;  3PBR A;  5DKK A;  4OOM A;  5L8M A;  1XFQ A;  3GEC A;  4HNB A;  4PKY G;  4WEJ A;  4HY8 A;  1LT0 A;  3T4S A;  1V9Y A;  1W63 Q;  5AVF A;  4GS9 A;  2PHY A;  4R3A A;  1OTE A;  1Y28 A;  3OLO A;  5HL6 A;  2YKH A;  4ETX A;  5DF9 A;  3S7O A;  4BBU A;  4WEL A;  5TBM B;  1S4R A;  4PAU A;  2KX6 A;  2L1M A;  4R6L A;  2VX8 A;  4Y3I A;  2PYR A;  5A8B A;  2ZBB A;  3B47 A;  3VE4 A;  1VB6 A;  1T18 A;  4RQ9 A;  3FG8 A;  4NXE A;  3LYX A;  4L9E A;  5IU1 A;  4NXF A;  5HDC A;  4HP4 A;  4EXO A;  2XRO A;  2W3G A;  4DJ3 A;  2Z6D A;  2QJ7 A;  2W3D A;  3VV4 A;  4FSF A;  3C8C A;  3H9W A;  4PKY A;  4ETZ A;  2ZOH A;  5C5K A;  3MQQ A;  3HJK A;  4MN6 A;  1ODV A;  4BJP A;  1UWN X;  2NUT C;  3H82 A;  3B33 A;  4FOF A;  4WLA A;  4LRY C;  2P04 A;  2QJ5 A;  2NUP C;  4B93 A;  2B02 A;  3R4K A;  4P6Z S;  3T50 A;  3LIE A;  3E4O A;  4QPR A;  4GJ4 A;  3ZQ5 A;  4AFI A;  4EW7 A;  4LRX C;  2O9B A;  5G4Z A;  2OAQ 1;  3KSH A;  3S7N A;  3BQ8 A;  4EER A;  1TD5 A;  3TE8 A;  3MFX A;  1S67 L;  3S7P A;  1MZU A;  5K5B A;  4GHI B;  3NHQ A;  4I5S A;  1VHM A;  2V9A A;  3PHY A;  3KSG A;  4HJ4 A;  4K08 A;  1OTI A;  3G6O A;  3MQ0 A;  3LIC A;  4HOI A;  4ARZ A;  3LR4 A;  2XA7 M;  1NRJ A;  3C30 A;  1T1B A;  3E98 A;  4LLO B;  2H28 A;  3CLO A;  4HH3 A;  1OT6 A;  1OJG A;  1UWP X;  1TS8 A;  5DFY A;  4HJ3 A;  5DKL A;  4IHQ A;  1P97 A;  3LR0 A;  4NXB A;  4KUK A;  2VJW A;  3BQA A;  5EFW A;  1W63 M;  2W1T B;  2EWV A;  2QKP A;  4IUH A;  2L4R A;  3HJI A;  1IOU A;  1G6O A;  4B9O A;  2D02 A;  4L9F A;  4KUO A;  1TS6 A;  2A24 A;  3MQO A;  3A0R A;  2EA9 A;  3RH8 B;  5IT5 A;  2HGV A;  1XJ6 A;  2Y79 A;  3FC7 A;  2OWJ A;  2PD8 A;  2JKR M;  3PBO A;  3H7W A;  4KQD A;  2M7U A;  3P01 A;  3F1O B;  4GLQ A;  2P7J A;  4O0P A;  4R70 A;  4YNR A;  3TJZ C;  2PR5 A;  2WKR A;  5TJJ A;  1MKM A;  3EQV A;  3UB9 A;  1LL8 A;  2I9V A;  1H8M A;  3IS2 B;  1DRM A;  3EEH A;  2W0N A;  4LPZ A;  4M4X A;  2P08 A;  5HWW A;  4EEU A;  1D7E A;  5HSQ A;  3PBN A;  5FL3 A;  3SW1 A;  2LB9 A;  3PR6 A;  5HDS A;  5KIZ A;  2GJ3 A;  2JHE A;  2Z6C A;  4H6J A;  3RFB A;  2L0W A;  4DN0 A;  2J80 A;  3CUE A;  4YWZ A;  3K3D A;  4LRZ E;  4BBV A;  2O9A A;  4WEK A;  3T4L A;  2VKS A;  2Y8H A;  2W3F A;  1OTB A;  2J3T D;  3DBA A;  3A0V A;  5HZH A;  2O99 A;  3JVV A;  1LSV A;  3OBF A;  5HD3 A;  4HP9 A;  4XT2 B;  4CLC C;  4JGR A;  5LBR A;  1ZTU A;  4JGO A;  3PBQ A;  3BJN A;  4I3A A;  3FPV A;  4Q0J A;  1DP9 A;  3T4Q A;  4BMW A;  1V9Z A;  4UEY A;  3U2A A;  5TBM A;  3C38 A;  3R7W B;  1NWZ A;  4BBT A;  3LIB A;  1S4S A;  1N9N A;  3W2Z A;  3OCL A;  5F68 A;  3LID A;  4I3I A;  3LFV A;  1TF1 A;  4I39 A;  3EWK A;  4HJ6 A;  5DFX A;  3CUE C;  3EGD C;  4L0L A;  2JN7 A;  5J4E A;  2JKT M;  3A0S A;  4NXG A;  4ZRR A;  1S1Y A;  2XA7 S;  3F1N B;  3TW8 A;  4Q0I A;  2PR6 A;  2OWH A;  3BY9 A;  3CAX A;  3VOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...