4BBUA

The pr2 photocycle intermediate of photoactive yellow protein
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Watching a Signaling Protein Function in Real Time Via 100-Ps Time-Resolved Laue Crystallography.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 35
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2012-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4bbuA00
3LIBA 1OTDA 4LRZE 2V0UA 1XJ2A 5A8BA 5HWVA 3LI9A 4EESA 1XJ4A 3GDIA 3E4PA 2A24B 5F69A 4B9OA 4BBVA 1ODVA 4WLAA 2A24A 2V1AA 5J4EA 4WF0A 1T1AA 1XFNA 3H7WA 3UE6A 4I39A 4JGRA 3FG8A 3E4QA 3B33A 3LYXA 5DJTA 1EW0A 1S4SA 4GCZA 4HP9A 4EW7A 4HY8A 3F1OB 1UWPX 5DJUA 1UWNX 4KQDA 3LUQA 4NXEA 1N9LA 4GW9A 3NOTC 2M1CA 1TS8A 1LSXA 4JGPA 4I3JA 2P7JA 2JN7A 4EQ1A 1DP8A 4R38A 4NXFA 4I38A 5I5LA 2ZBBA 4MN6A 2JHEA 3IBRA 2D01A 5KIZA 3LICA 3MQQA 2BASA 2INWA 3GECA 1S66L 3D72A 3UB6A 3VE3A 5HDCA 1D06A 1P0ZA 3H82A 1OTBA 2VV6A 2L4RA 4DJ3A 4HJ3A 3LIAA 4HH3A 4HJ6A 4EXOA 4JGOA 2PD7A 1OJ5A 2R78A 3NHQA 5J3WA 2B02A 3F1PB 3VE4A 5IS1A 2OWJA 1V9YA 3A0VA 3BWLA 3P7NA 2W27A 3K3DA 3SW1A 1S67L 1G28A 2PYPA 4I5SA 5G4ZA 2Z6CA 2CMNA 5F5YA 3CLOA 3IS2A 5EFWA 1JNUA 2I9VA 3A0SA 3H9WA 3EEHA 3T50A 3NOUC 1BYWA 2PDRA 4NXBA 3H7WB 3UB8A 4LPZA 3C2WA 2VV7A 2YKFA 1LL8A 4EEUA 4GS9A 3KX0X 3HJIA 3VOLA 4GHIA 4I3AA 5F6AA 3K3CA 4HI4A 4MN5A 2QJ5A 2KX6A 3PHYA 5HDDA 1P97A 4WL9A 1OT9A 3CAXA 4R6LA 1TS7A 2QKPA 1GSXA 4XT2A 4R3AA 5IU1A 3F1NA 1Y28A 1UGUA 1XFQA 3UMDA 5TBMB 1GSWA 1WA9A 5AVFA 1N9NA 3LIFA 5TBMA 4WN5A 2L1MA 3H82B 1VB6A 3G6OA 3MXQA 1S1ZA 3MFXA 4BBUA 3OLOA 2KDKA 4LLOB 4HQAA 3EWKA 5HZHA 1T19A 4LRXC 3RH8B 1S4RA 1MZUA 4KUKA 1T1CA 2WKQA 3A0RA 1DP6A 4R70A 3UB9A 4WUJA 2GJ3A 4L9FA 4LRYC 2VLGA 1X0OA 2QJ7A 2L0WA 4JGQA 5DKLA 2HV1A 3IS2B 4HHDA 5HSQA 1F9IA 4NXGA 1OT6A 2PYRA 1T18A 3ICYA 5F68A 4BBTA 3ZQ5A 4I3IA 1OJGA 4YWZA 3NOPC 3LIDA 3MQOA 4HP4A 3UB7A 1XJ3A 3FC7A 4H6JA 2PR5A 5HD3A 4GS9B 4M4XA 1S1YA 4GHIB 1LSWA 3BY9A 1LT0A 3CWFA 3PYPA 2YKHA 2OOLA 4EEPA 4EERA 4E04A 1NWZA 5HWWA 4PKYG 1V9ZA 5AVEA 2V0WA 4K08A 4L9EA 4XT2B 3F1NB 2J80A 2WKPA 1TS0A 2ZOIA 4F3LB 4KUOA 2PR6A 1DRMA 2WKRA 3RTYA 5HDSA 1OTEA 4PKYA 4F3LA 1LSVA 1OTAA 3BY8A 3F1OA 4L9GA 4HH2A 4HIAA 2Z6DA 2OWHA 3UMEA 1GSVA 4HOIA 2QWSA 5DKKA 2VEAA 1KOUA 3MR0A 4HNBA 2V9AA 1OTIA 3NJAA 2PD8A 4EETB 1F98A 2ZOHA 3C8CA 5G4YA 4DJ2A 2W0NA 2VV8A 3LI8A 2QHKA 2V1BA 3LIEA 3HJKA 4HJ4A 1TS6A 2K7SA 5J7EA 1DP9A 2EA9A 5HD5A 2PHYA 5HWTA 2H28A 4H6JB 1N9OA 3F1PA 3MJQA 1T1BA 3E4OA 4RQ9A 3ULFA 1XJ6A 2D02A 1D7EA
chains in the Genus database with same CATH superfamily
2V0UA 3T1RA 3UY6A 3MKFA 3LI9A 1RP5A 1RGYA 4EESA 2VZWA 3KYQA 1EROA 4JXSA 2A24B 1QMEA 1CI8A 3IH8A 4B9OA 3AGFA 4E3JA 4B4ZA 4BBVA 1ODVA 4UA6A 2DCFA 1VHMA 1VM1A 3IXBA 5JYOA 1XFNA 4MDZA 4UEYA 3SOIA 3FG8A 2J8YA 3IWQA 2HP6A 3OPRA 1KVMA 4EW7A 4HY8A 4X6TA 3BYDA 4KQDA 3LUQA 3VP2A 3N6IA 1CQAA 3NOTC 4CLCD 2ZMVA 4X68A 2V2FF 2LB9A 2P7JA 2JN7A 4EQ1A 1DP8A 4I38A 1HD8A 2Y2MA 1CEFA 5HAPA 4NETA 4QD4A 3IBRA 5F82A 1YLTA 2D01A 1W79A 2JKTM 3MQQA 2BASA 2INWA 1KGFA 4KZBA 4RX3A 2W3DA 1H8ZA 1SZVA 1DJCA 3VE3A 4XXRA 1ZG6A 1JWPA 3G34A 2ZQAA 3E0YA 4MCWA 3LY3A 3SH8A 2C6WB 4H8RA 2VV6A 4S2NA 1XP4A 1K4EA 5E2HA 3O86A 4JGOA 4JBFA 2GDNA 2PD7A 3LR5A 1YM1A 2JCHA 3T4KA 4C6YA 5EVIC 3A3EA 5FQKA 1G6AA 1MC0A 2OWJA 3P7NA 3ZNTA 3GQZA 4N1HA 2W27A 2ZC3B 4KQRA 4OP8A 3SW1A 3VP3A 4DN0A 4I5SA 4AFIA 5DTSA 3NI9A 1IFQA 3CITA 5AQ7A 4QY5A 3Q7VA 1TVFA 1P9RA 3T50A 2PDRA 4PMAA 2ZL1B 5DFYA 3VP0A 3LR3A 4ZAMA 3C2WA 5IT5A 2VV7A 3P98A 1HZOA 5FI7A 3KX0X 1PI5A 2HZ5A 3DTEA 4GHIA 4I3AA 5F6AA 1S0WA 5HDDA 1I2WA 1P97A 2XRNA 2KOIA 1IOUA 1SHVA 4IHQA 3CUEA 5CGSA 1ZHHB 1MWUA 3M2JA 4XT2A 3RXXA 3F1NA 3NCKA 1Z6FA 1PFLA 3IWIA 4FD8A 2XEPA 2ZM0A 1TDLA 1WA9A 2WZZA 2M7UA 1FOFA 3OCLA 4WN5A 2L1MA 1L0GA 1VB6A 5HZHA 4EQIA 1ERMA 3ZG9B 3RH8B 2HJ9C 1S4RA 5G18A 4E6XA 4DE2A 1DP6A 3HLWA 4WUJA 2JKTI 3PAGA 1QMFA 3UNWA 3PBOA 3TOIA 3KSFA 5EM1A 4YINA 4LFUA 4CPKA 2DMWA 2VGLM 1IEMA 2QJ7A 2L0WA 1YLZA 2EX6A 5DKLA 4EBLA 1O7EA 1K56A 5E43A 3DTKA 5HSQA 1GHPA 4Y0TA 1Y54A 1DY6A 5F68A 3N7WA 4ESPA 3FWLA 2WADA 4BL2A 3BFGA 4OPZA 3T4QA 4DMZA 2O9BA 4P6BA 1XJ3A 1H3QA 4FCFA 3IHBA 3FC7A 4Y7PA 1W63M 3GTCA 4X56A 3UPNA 2PR5A 5HL6A 4BWIA 5KSCA 1FR6A 3IX3A 3OZHA 4NEED 3NC8A 3GSGA 3PYPA 1S6RA 2WGWA 3BQAA 2R9XA 3WS2A 2GNXA 5AVEA 4DE3A 2V0WA 4K08A 2DRWA 3ZG5A 4L9EA 2Y2IA 1K57A 3BLMA 3BFEA 2J80A 4KUOA 2PR6A 1Q2QA 2E8IA 4PKYA 1MXOA 4F3LA 3W8KA 1IKGA 1W63Q 2EFUA 1OTAA 2WAFA 3F1OA 1SCWA 4Q0IA 4Z9QA 1NYMA 1Y4OA 4FH4A 4N1XA 3MFDA 3R7WA 2W1TA 4R1GA 5FAQA 3O3VA 4HOIA 1OMEA 2HPBA 2VEAA 2ZMAA 4WZ5A 2H0TA 1K54A 4IUKA 4NKPA 3NJAA 2PT7A 1F98A 2ZOHA 4MLLA 5L07A 1CK3A 3S22A 4JKTA 3HL9A 3LIEA 4QY6A 1ACFA 2VGJA 2ZC6B 4EUZA 4EWFA 1TS6A 2EWVA 3GMWA 4BD0A 5E2EA 3M2KA 5L2FA 2EA9A 2Y2KA 4KZ4A 1N9OA 3MJQA 3UN7A 2DNSA 4HBTA 5CHJA 3ULFA 1XJ6A 5FDHA 3DBAA 3LIBA 1XJ2A 1SDEA 1W7FA 1XXMA 2OSUA 4KZ3A 5A8BA 5A90A 5HW3A 5MC7A 5EPHA 1XX2A 3ZVTA 1IYSA 3EGXC 1XGIA 2XK1A 3S7PA 3GDIA 3AGDA 1BT5A 1K6SA 3A3DA 5DF8A 3KYZA 2ZQ9A 1IYPA 2WYXA 1TDGA 1PWCA 2V1AA 5J4EA 4WF0A 1T1AA 2WKEA 4GDNA 5CX7A 3UE6A 4WMCA 4DRTA 1YLPA 3B33A 3WS5A 4Q0JA 5FAOA 4GCZA 4HP9A 4Q0HA 2ACGA 4KG2A 1UWPX 3A3FA 3HVFA 3TW8A 2V8CA 1N9BA 1YSQA 4JXGA 1H8YA 4CLCB 1JVJA 1N9LA 2P9VB 1K4FA 4OPQA 5EVEA 3MS6A 3OPPA 4JGPA 3N8SA 3MZEA 3VSKA 4BQMA 5TGFA 3VFFA 5I5LA 3RXWA 1YMSA 2WGVA 2ZJ9A 4JXWA 1MWTA 4OH0A 5KIZA 4S2PA 3KO6A 3LICA 3V67A 4KZ9A 3O87A 5E2FA 1ES4A 2JKGA 1OPXA 2A2LA 2FZ0A 1ES2A 3D9YA 5C5KA 4GN2A 3MKEA 4IJGA 1P0ZA 4S2OA 4DDYA 4DE0A 2VX8A 4PHTA 2Y2HA 4Z1WA 3LIAA 3C4OA 4E3IA 3UE3A 3VSLA 1YLWA 2Q9MA 3NULA 1LI9A 2XQZA 3D4FA 5CHUA 3F1PB 3VE4A 2OLUA 5IS1A 1V9YA 3A0VA 3BWLA 5FAPA 2XFSA 1VETA 3ZG0A 3HUOA 4Q8IA 4BJPA 3K3DA 5CEBA 3E2LA 5FSRA 1HLUP 2PYPA 1ERQA 3KYEA 2WGIA 2PRFA 4S2JA 4ZJ1A 5EFWA 2WUQA 2I9VA 4FUWA 2EX9A 3QHYA 2VJWA 2XLNA 3QP5A 1BYWA 3L7HA 3OOVA 4WELA 3T1XA 3H7WB 5CECA 3WRZA 4WEKA 1LL5A 1LL8A 4ME4A 4MBHA 5GHXA 4GS9A 3T4JA 4CQHA 1E3UA 4OKPA 1K55C 4P6ZS 2HP9A 3NIAA 2ZC4B 3K3CA 1NRFA 4HI4A 1N4OA 3UDIA 3IQAA 1YAXA 1SDNA 4E6WA 1JTDA 1NY0A 2BTFP 4KZ6A 5AQ9A 4WL9A 1OT9A 3CAXA 4R6LA 1FQGA 1TS7A 3QP2A 3U4LP 2QKPA 4GDBA 4YFMA 1ESUA 4ZJ2A 1BLSA 5EVLA 5EVIA 3T1SA 1DJAA 4DF6A 2O99A 4WYYA 3DTIA 3CI6A 2VK3A 4ARZA 1K25A 3LIFA 4CJNA 4R3JA 5CTNA 5HPIA 3ZG8B 1KE0A 3H82B 3G6OA 5M18A 1S1ZA 5GLAA 3OLOA 4HQAA 3EWKA 4IUHA 3QP4A 3VV4A 5EE8A 3TG9A 4LRXC 3HCYA 4KUKA 3CPTA 1SKOB 2FFFB 4X25A 2J9PA 4OQHA 3KSHA 1CI9A 5HAQA 5CRFA 4ETZA 2GJ3A 2XDMA 3JPUA 1HTZA 3FZCA 4KZ7A 2IWCA 2QZ6A 3IS2B 4HHDA 4CLCC 3Q82A 4MBKA 4QU3A 1JTGA 1OT6A 5FL3A 2PYRA 2W3FA 3MZFA 2EX8A 3ZQ5A 4KENB 1PNEA 4E3LA 4Y0UA 4E3KA 3LIDA 1PWDA 4HP4A 3UB7A 3ZG7B 1ESIA 1H8MA 2XA7S 3DW0A 2NUTC 4H6JA 4D60A 3V3RA 3UPPA 2G2UA 4IBRA 1S1YA 4ZDXA 4OLGA 4B93A 4Y13A 3ZCZA 1ONHA 2UV0E 4JF6A 2J3WA 4KZAA 3M6BA 3CWFA 1GHMA 2AVXA 4HESA 4EERA 4ZBEA 1EWZA 2XH9A 3V39A 4E04A 1NWZA 1F2KA 3BM6A 4RYEA 1V9ZA 4GD6A 2ZD8A 2J3TD 3EOIA 4ZTKA 2A49A 2WKPA 5HFOA 3V50A 4F3LB 5J8XA 2HDSA 3WS4A 3C38A 1NJ4A 2WK0A 3EQUA 1LSVA 1VEUB 4GD8A 4NG2A 1XKZA 4OLDA 3EQVA 3U2AA 5I94A 4C75A 3BFCA 4UA7A 1PIOA 5GLCA 5CHMA 4LV2A 4PM9A 3HUNA 1KOUA 4K91A 2V9AA 4DDSA 5BOHA 4OOMA 5A91A 4OOYA 1NRJA 3CG5A 4G3VA 4FH2A 4LV0A 1HVBA 3C8CA 4MNRA 3T4OA 3QP1A 1K56D 3GR2A 3IX4A 5EECA 1YT4A 5DF7A 2PU4A 4S2LA 4P85A 4EBNA 3G30A 2ZC7A 3SS4A 1O07A 3K2NA 5FASA 2HDUA 1MWSA 5L10A 1L0DA 3V5MA 3MXSA 2EFXA 5EUAA 5FQIA 2C5WB 3P01A 1T1BA 1RGZA 3E4OA 4OP5A 4GB7A 3B42A 5CGXA 5EV0A 2W3EA 4LRZE 4KZ5A 1ZC2A 4QWOA 4Y5FA 3WWXA 3E4PA 2QMIA 5FA7A 4E3MA 3BRMA 1RCJA 1LL9A 3MF0A 3IF6B 3N4IA 2X71A 3NDEA 4WLAA 2ZM8A 2ZL1A 2B5RA 4N9LA 4LCLA 4PM5A 4I39A 5FQQA 2EX2A 4JGRA 4BL3A 3E4QA 4UQIS 3LYXA 3KSIA 5DJTA 1EW0A 4YOFA 1S4SA 1J9MA 5FQ9A 1FCNA 4PPRA 5E2GA 1P9WA 1UWNX 2FFYA 5DJUA 4FTXA 1LLBA 3S7QA 2WZXA 3BQ8A 2M1CA 2Y2QA 4KG5A 1LSXA 3IX8A 3MMHA 1KGGA 1XA1A 1YPRA 1BLHA 2OLVA 2PBYA 4PM7A 1CJFA 5FEFA 4IBXA 4NXFA 2QPNA 2ZBBA 4MN6A 4U0TA 2PAVP 3OC2A 3E2KA 3VFHA 4JF4A 4GOGA 5F1FA 3D72A 3UB6A 3S7NA 4C3QA 4UQIM 2W1RA 4OPRA 5DTTA 2Y79A 3ZYTA 2PBDP 4O8GA 5TFQA 2L4RA 3SH9A 5D3OA 3MQ0A 4HH3A 1D1JA 4HJ6A 2Y2LA 3M6HA 2WAEA 1OJ5A 2ZM2A 1BUEA 2E8JA 3CHWP 2K31A 2Q9NA 3FKWA 3JYIA 3VOZA 3CJMA 3PAEA 1LI0A 4G3WA 1S67L 3NDGA 1I2SA 4PAUA 1G28A 2I72A 5M1AA 5HL1A 5G4ZA 2Z6CA 2CMNA 5F5YA 3CLOA 4R0QA 2J9OA 2W3GA 5TJJA 1W5DA 1XA7A 2MJ6A 4RA7A 4UAAA 2GX5A 3A0SA 4LENA 3H9WA 1M6KA 3EEHA 3NOUC 2Y2GA 1IYQA 3LEQA 5U47A 3UB8A 4LPZA 3ZGAB 4R3BA 3G31A 3LEZA 4WMCD 2UWXA 1W8YA 1Q2PA 4EBPA 4X69A 1VQQA 4P87A 5FI2A 3OPLA 4XUZA 3A3JA 4GLQA 3G2ZA 3PHYA 1BLPA 5AQAA 2XSSA 1FCMA 4FOFA 4L0LA 3KSGA 3TSGA 3OCNA 2ZMFA 1MKMA 3T4TA 3G4PA 1PRQA 2EXBA 5GLDA 4R3AA 1Y28A 1UGUA 1BLCA 2O9AA 3UMDA 2XF3A 4E3NA 4DKIA 3LGOA 3L9KA 3LCEA 3HREA 1SKFA 5AVFA 1KE4A 2H0YA 3C4PA 3Q7ZA 5TBMA 4WM9A 4QB8A 1TD5A 3VP4A 2XR0A 3AGEA 3MXQA 3MFXA 1IELA 5A93A 5GHYA 1AXBA 3FYZA 4DXBA 4F94A 1YKDA 1T19A 1ONGA 3IF6C 5EOOA 2Y59A 3LY4A 2P04A 2Y2OA 1CEGA 3C30A 1K0KA 3T12B 2WKQA 5FQMA 4R70A 3HLDA 4M3KA 3UB9A 1IYOA 2PU2A 1MPLA 3DAVA 3IXGA 4LRYC 4JLFA 3IXHA 3PR6A 1K55A 1X0OA 3SS3A 3HUMA 4JGQA 3G2YA 1JWZA 2HV1A 3PBQA 1MKIA 4Y15A 3OPHA 4OVDA 1STZA 4EUVA 1F9IA 1L0EA 2Q0OA 2GZAA 4OONA 4QHCA 3S1YA 4BBTA 3DTMA 3Q7VB 2XROA 3BECA 1OJGA 3ZHHA 3O5YA 3GRJA 4YWZA 3NOPC 4LV3A 2EXAA 1G68A 5KMWA 4RX2A 2HDQA 4ID4A 3FPWA 5FATA 3Q07A 4M4XA 4GHIB 4X55A 1E3UD 3BY9A 5AQBA 1PWGA 1GCEA 3W4OA 3ZNYA 3LR0A 4E3OA 2YKHA 5AJGA 4IEDA 4EEPA 2OAP1 1JWVA 4Y3IA 2JC7A 3C7VA 5HWWA 4OQGA 1I5QA 1BTLA 4PKYG 2ZQ8A 2H5SA 2Y2NA 4X1LA 1AWIA 4XT2B 3F1NB 4BD1A 1TS0A 1U60A 2IA2A 2XD1A 3TE8A 2Z2MB 1DRMA 3B3XA 3OBFA 4K0WA 5EVID 5CERA 4OOLA 2B95A 5HDSA 4N92A 3EGDC 4ZRRA 1MY8A 1WYBA 3BY8A 2Y8HA 2H10A 2JE5A 4CLCA 3ZDJA 2Y91A 2Z6DA 2HJEA 2P9VA 4P6ZM 3UMEA 3IF5A 4WBGA 1K6RA 2QWSA 3WS1A 3MR0A 1NYYA 2V8FA 4OPYA 1MBLA 3NECA 4WEJA 4U3TA 4YNRA 3S7OA 3I7JA 1BULA 2PD8A 4EETB 2KLIA 1KDSA 5G4YA 4DJ2A 2W0NA 1G6OA 2FH5A 2VV8A 3QP8A 3HBRA 2QHKA 5CEDA 2V1BA 3HJKA 4KG6A 5J7EA 2Y4AA 3PTEA 5HD5A 3HLBA 3UE0A 5HWTA 3PXPA 3F1PA 1MWRA 3T1QB 5HX9A 2WKHA 4MBFA 3O88A 3JVUA 5M19A 1D7EA 2P74A 1OTDA 4R23A 3BFFA 5HWVA 3D3OA 3ZVWA 2QYBA 2BG1A 3PBRA 4S2NC 1XJ4A 2WGWB 2Z2LB 3PBNA 3IWOA 2OAQ1 1FCOA 5F69A 3UB5P 3VOYA 4QPRA 3UPOA 3A3IA 4NK3A 1NLYA 2A24A 3VP1A 3H7WA 3G35A 4KQQA 3GV9A 1K38A 5HPFA 3W4PA 2XA7M 2G7UA 4A5RA 3F1OB 1IKIA 3BW6A 3TJZC 4XUXA 3R7WB 2W3HA 4NXEA 1FR1A 2W1TB 2P08A 3Q1FA 4GW9A 4Y2FA 1TS8A 4I3JA 5DVAA 3UO9A 2G2WA 1GHIA 3V3SA 4R38A 5L09A 4X53A 3ZFZA 1ES3A 2VGLS 5DFXA 2JHEA 5CXWA 1GA9A 2A3UA 3GECA 1S66L 5GLBA 2B18A 3EEAA 1NLZA 5HDCA 1D06A 3LFVA 2J7VA 1M40A 1BSGA 3H82A 1OTBA 4G3KA 3QNBA 5TR7A 4BMWA 4DJ3A 4HJ3A 4Y0OA 4GJ4A 2HF6A 1H5XA 4EXOA 2IWDA 1PW8A 2J3TC 4S2KA 2R78A 3CUEC 3WRTA 3NHQA 1SKOA 3P09A 5J3WA 1KVLA 2B02A 3LO7A 3N8RA 4LCMA 2VKSA 1ZKJA 3SZTA 3C5AA 1CF0A 1Z09A 2VA0A 3UDXA 4OQIA 2IWBA 4ETXA 3IH9A 2OV5A 2HDRA 3N8LA 4B4XA 3IS2A 1JNUA 1ES5A 3MBZA 4BLMA 3FV7A 4O0PA 1GA0A 5LBRA 3Q81A 5IHVA 4OQ0A 3ITBA 2O0YA 3VMAA 4BENA 5GL9A 4R4RA 3FKVA 1WE4A 3MXRA 1XPBA 3NBLA 4NXBA 3PBSA 3R4KA 1KDWA 1BZAA 2Y2JA 3QP6A 2ZLYA 2YKFA 4DE1A 3ISGA 4EEUA 2X02A 3C7UA 3HJIA 2HP5A 3UDFA 3VOLA 1ZTUA 3SS5A 4MN7A 1E4DA 5A92A 1FILA 1G5UA 2VGKA 2QJ5A 4MN5A 2KX6A 4X1MA 1NZUA 1ALQA 4MEZA 2X01A 3S4XA 1PZPA 4K0XA 3UE1A 2R9WA 2RCXA 1TEMA 4FSFA 1GSXA 4O7DA 5F83A 2XFTA 1W8QA 3MSHA 5HAIA 5IU1A 3T4LA 4WZ4A 4U0XA 1XGJA 1XFQA 1NZOA 4O01A 1PYYA 2XD5A 5TBMB 1YSPA 3G32A 1GSWA 1N9NA 1FSYA 1VEUA 1KE3A 1PI4A 2ZC5B 2JBFA 4BBUA 2Y2PA 2KDKA 4HEFA 4LLOB 1YQSA 1PW1A 1LHYA 1MZUA 4UA9A 3IXDA 1T1CA 3BEBA 1K57C 3A0RA 2JKRM 5FDSA 3T4SA 3W2ZA 4JPMA 3RJUA 1F5MA 1VETB 4L9FA 5DF9A 2ZQCA 3GVBA 3QNCA 2VLGA 4JXVA 3MZDA 2XGNA 4LV1A 3WS0A 3LR4A 3PBTA 3CMZA 5KZHA 2V20A 4NXGA 3B47A 4PM8A 1T18A 3ICYA 1L0FA 4S2IA 4EV4A 3NY4A 4I3IA 4DXCA 4WZ5C 3MQOA 2BLSA 1K54C 2K2NA 5GHZA 4UHUA 2HGVA 2RL3A 5FQJA 5HD3A 2CC1A 4GS9B 5KSHA 3IT9A 1LSWA 4CLCE 4MMNA 1C3BA 1KGEA 4R4SA 3HLGA 1LT0A 2EWWA 4PM6A 1L2SA 2OOLA 4B88A 3IHAA 3BJNA 3SH7A 5F1GA 1DJBA 1H0MA 3BFDA 4KQOA 5DTKA 5FI6A 1NXYA 3IF6A 5CGWA 4GKUA 5EVIB 2ZOIA 1E25A 3ITAA 5CTMA 1FIKA 2WKRA 2JKFA 3RTYA 1OTEA 1L3LA 4ARZB 4HBUA 3W4QA 3IBJA 3JVVA 1TF1A 3FPVA 2V1ZA 4Y17A 4L9GA 4D2OA 1YMXA 4HH2A 4HIAA 2ZQDA 4LGWA 2OWHA 3RFBA 1GSVA 4KZ8A 2ZQ7A 3CPTB 5DKKA 5EM0A 3DWKA 3HLCA 4IVKA 4HNBA 1J3WA 3HLFA 5FEGA 4ZJ3A 1PZOA 4N9KA 5EOEA 4GNUA 3TRCA 1A0KA 1OTIA 3HLEA 2M7VA 4GZBA 4QJGA 4IVIA 3BLSA 4EU0A 3LI8A 1FSWA 4P0MA 2NUPC 4HJ4A 3E98A 1ZG4A 2K7SA 1YLYA 2LB5A 5JYPA 1DP9A 3CZDA 4II7A 1WYCA 3DWZA 2O9CA 2PHYA 4JF5A 2JKRI 2Y55A 2H28A 1YLJA 5K5BA 4H6JB 1EI5A 5HARA 4S2MA 4RQ9A 2WKIA 4RVAA 2D02A 5L8MA
chains in the Genus database with same CATH topology
2W3EA 3LIBA 1OTDA 4LRZE 2V0UA 1XJ2A 5A8BA 5HWVA 5MC7A 3LI9A 3D3OA 4Y5FA 2QYBA 3EGXC 3PBRA 3S7PA 4EESA 1XJ4A 3GDIA 3E4PA 2VZWA 3KYQA 3PBNA 2A24B 2OAQ1 3KYZA 5F69A 3MF0A 4QPRA 4B9OA 4BBVA 1ODVA 4WLAA 1VHMA 1NLYA 2A24A 2V1AA 5J4EA 4WF0A 1T1AA 5CX7A 1XFNA 3H7WA 4MDZA 4UEYA 3UE6A 4I39A 4JGRA 3FG8A 3E4QA 3B33A 3LYXA 3KSIA 4UQIS 5DJTA 5HPFA 1EW0A 4Q0JA 4YOFA 1S4SA 4GCZA 4HP9A 2XA7M 4Q0HA 4EW7A 2G7UA 4HY8A 3F1OB 1UWPX 3BW6A 3TW8A 1P9WA 1UWNX 5DJUA 3TJZC 4KQDA 1YSQA 3S7QA 3R7WB 4CLCB 2W3HA 3LUQA 4NXEA 1N9LA 2W1TB 2P08A 4GW9A 3NOTC 4CLCD 4Y2FA 3BQ8A 2M1CA 2ZMVA 1TS8A 1LSXA 4JGPA 3MMHA 4I3JA 2LB9A 2P7JA 2JN7A 4EQ1A 1DP8A 4R38A 4NXFA 4I38A 5I5LA 2ZBBA 4MN6A 2VGLS 5DFXA 2JHEA 3IBRA 2D01A 5KIZA 3KO6A 2JKTM 3LICA 3OC2A 3V67A 3MQQA 2BASA 2INWA 3GECA 1S66L 3D72A 3UB6A 3S7NA 2W3DA 2B18A 4UQIM 2W1RA 1OPXA 3EEAA 3VE3A 2A2LA 2FZ0A 1NLZA 5HDCA 2Y79A 5C5KA 3E0YA 4MCWA 1D06A 3LFVA 3ZYTA 4IJGA 4O8GA 1P0ZA 3H82A 1OTBA 4G3KA 2VV6A 2VX8A 4PHTA 2L4RA 4Z1WA 3MQ0A 4BMWA 4DJ3A 4HJ3A 3LIAA 4HH3A 4GJ4A 2HF6A 4HJ6A 4EXOA 4JGOA 3UE3A 2PD7A 2J3TC 1OJ5A 2R78A 3CUEC 3LR5A 3NHQA 5J3WA 2K31A 3T4KA 2B02A 3F1PB 3VE4A 2VKSA 1MC0A 5IS1A 2OWJA 1V9YA 3A0VA 3BWLA 3P7NA 2VA0A 2W27A 4G3WA 4BJPA 3K3DA 3SW1A 1S67L 4PAUA 1G28A 4ETXA 2PYPA 4DN0A 4I5SA 4AFIA 5G4ZA 2Z6CA 2CMNA 5F5YA 3CLOA 3IS2A 1IFQA 3CITA 5EFWA 1JNUA 2W3GA 5TJJA 4O0PA 2I9VA 2MJ6A 5LBRA 2GX5A 3A0SA 3H9WA 3EEHA 1P9RA 2VJWA 3T50A 2O0YA 3NOUC 1BYWA 2PDRA 3OOVA 4WELA 4NXBA 5DFYA 3H7WB 3PBSA 3R4KA 4WEKA 3UB8A 4LPZA 3LR3A 3C2WA 5IT5A 2VV7A 2YKFA 1LL8A 4ME4A 4EEUA 4GS9A 3T4JA 4CQHA 3KX0X 3HJIA 3VOLA 1ZTUA 4GHIA 4I3AA 4P6ZS 5F6AA 4MN7A 4GLQA 3K3CA 4HI4A 4MN5A 2QJ5A 2KX6A 1YAXA 3PHYA 5HDDA 2XSSA 1P97A 4FOFA 4WL9A 1OT9A 3CAXA 4L0LA 1TS7A 3KSGA 4R6LA 2QKPA 2XRNA 3OCNA 2KOIA 4FSFA 2ZMFA 1IOUA 1MKMA 4IHQA 3T4TA 1GSXA 3CUEA 1ZHHB 4XT2A 4R3AA 5IU1A 3T4LA 3F1NA 1Y28A 1UGUA 2O9AA 1XFQA 4O01A 3UMDA 5TBMB 2O99A 1YSPA 1GSWA 1WA9A 3CI6A 2M7UA 5AVFA 4ARZA 1N9NA 3LIFA 5TBMA 5HPIA 3OCLA 1TD5A 4WN5A 2L1MA 3H82B 1VB6A 3G6OA 3MXQA 1S1ZA 3MFXA 4BBUA 3OLOA 2KDKA 4LLOB 4HQAA 3EWKA 5HZHA 4IUHA 3VV4A 1YKDA 1T19A 4LRXC 3RH8B 2HJ9C 3HCYA 1S4RA 2P04A 1MZUA 4KUKA 1T1CA 3C30A 2WKQA 3KSHA 3A0RA 1DP6A 2JKRM 4R70A 3T4SA 3UB9A 3W2ZA 4WUJA 2JKTI 4ETZA 2GJ3A 1F5MA 3PBOA 3KSFA 4L9FA 5DF9A 4LRYC 2DMWA 2VLGA 2VGLM 3PR6A 1X0OA 2QJ7A 2L0WA 4JGQA 3PBQA 5DKLA 2HV1A 3LR4A 3IS2B 3PBTA 4HHDA 4CLCC 5HSQA 1STZA 4EUVA 1F9IA 4NXGA 3B47A 1OT6A 2GZAA 5FL3A 2PYRA 1T18A 2W3FA 3ICYA 5F68A 4BBTA 2XROA 3ZQ5A 4I3IA 1OJGA 3O5YA 4YWZA 3NOPC 3LIDA 3MQOA 4HP4A 3UB7A 3T4QA 4DMZA 2O9BA 1H8MA 2XA7S 2K2NA 1XJ3A 1H3QA 2NUTC 3FC7A 2HGVA 4H6JA 1W63M 2PR5A 3FPWA 5HL6A 5HD3A 4BWIA 4GS9B 4M4XA 4NEED 5KSHA 1S1YA 4GHIB 1LSWA 4B93A 4CLCE 3BY9A 4MMNA 2J3WA 3LR0A 1LT0A 3CWFA 3PYPA 2EWWA 2YKHA 2OOLA 5AJGA 4EEPA 2OAP1 4EERA 4Y3IA 3BJNA 4E04A 3BQAA 1NWZA 5HWWA 2GNXA 4KQOA 4PKYG 1V9ZA 5AVEA 2V0WA 4K08A 4L9EA 2J3TD 4XT2B 3EOIA 3F1NB 2J80A 2WKPA 1TS0A 2IA2A 2ZOIA 3TE8A 4F3LB 4KUOA 2PR6A 1DRMA 3OBFA 2WKRA 4OOLA 3RTYA 5HDSA 1OTEA 4PKYA 3C38A 3EGDC 4ZRRA 4ARZB 4F3LA 3EQUA 1LSVA 1W63Q 1OTAA 3IBJA 3BY8A 2Y8HA 3F1OA 1TF1A 3JVVA 3FPVA 3U2AA 3EQVA 4Q0IA 4L9GA 3R7WA 4CLCA 4HH2A 4HIAA 2Z6DA 2OWHA 2HJEA 2W1TA 3RFBA 4P6ZM 3UMEA 1GSVA 4HOIA 2QWSA 5DKKA 2VEAA 1KOUA 3MR0A 4HNBA 2V9AA 4IUKA 4NKPA 3TRCA 4OOMA 1OTIA 3NJAA 4WEJA 4YNRA 1NRJA 3S7OA 2M7VA 4G3VA 2PT7A 2PD8A 4EETB 1F98A 2ZOHA 3C8CA 2KLIA 5G4YA 4DJ2A 2W0NA 1G6OA 2FH5A 2VV8A 4EU0A 3LI8A 2QHKA 3T4OA 2V1BA 3LIEA 2NUPC 3HJKA 4HJ4A 3E98A 1TS6A 2K7SA 2EWVA 2LB5A 5J7EA 1DP9A 3K2NA 4II7A 2EA9A 5HD5A 2O9CA 2PHYA 2JKRI 5HWTA 3PXPA 2H28A 5K5BA 4H6JB 1N9OA 3F1PA 3MJQA 3P01A 1T1BA 3E4OA 3JVUA 4RQ9A 3ULFA 1XJ6A 2D02A 3B42A 3DBAA 1D7EA 5L8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIB A;  1OTD A;  4LRZ E;  2V0U A;  1XJ2 A;  5A8B A;  5HWV A;  3LI9 A;  4EES A;  1XJ4 A;  3GDI A;  3E4P A;  2A24 B;  5F69 A;  4B9O A;  4BBV A;  1ODV A;  4WLA A;  2A24 A;  2V1A A;  5J4E A;  4WF0 A;  1T1A A;  1XFN A;  3H7W A;  3UE6 A;  4I39 A;  4JGR A;  3FG8 A;  3E4Q A;  3B33 A;  3LYX A;  5DJT A;  1EW0 A;  1S4S A;  4GCZ A;  4HP9 A;  4EW7 A;  4HY8 A;  3F1O B;  1UWP X;  5DJU A;  1UWN X;  4KQD A;  3LUQ A;  4NXE A;  1N9L A;  4GW9 A;  3NOT C;  2M1C A;  1TS8 A;  1LSX A;  4JGP A;  4I3J A;  2P7J A;  2JN7 A;  4EQ1 A;  1DP8 A;  4R38 A;  4NXF A;  4I38 A;  5I5L A;  2ZBB A;  4MN6 A;  2JHE A;  3IBR A;  2D01 A;  5KIZ A;  3LIC A;  3MQQ A;  2BAS A;  2INW A;  3GEC A;  1S66 L;  3D72 A;  3UB6 A;  3VE3 A;  5HDC A;  1D06 A;  1P0Z A;  3H82 A;  1OTB A;  2VV6 A;  2L4R A;  4DJ3 A;  4HJ3 A;  3LIA A;  4HH3 A;  4HJ6 A;  4EXO A;  4JGO A;  2PD7 A;  1OJ5 A;  2R78 A;  3NHQ A;  5J3W A;  2B02 A;  3F1P B;  3VE4 A;  5IS1 A;  2OWJ A;  1V9Y A;  3A0V A;  3BWL A;  3P7N A;  2W27 A;  3K3D A;  3SW1 A;  1S67 L;  1G28 A;  2PYP A;  4I5S A;  5G4Z A;  2Z6C A;  2CMN A;  5F5Y A;  3CLO A;  3IS2 A;  5EFW A;  1JNU A;  2I9V A;  3A0S A;  3H9W A;  3EEH A;  3T50 A;  3NOU C;  1BYW A;  2PDR A;  4NXB A;  3H7W B;  3UB8 A;  4LPZ A;  3C2W A;  2VV7 A;  2YKF A;  1LL8 A;  4EEU A;  4GS9 A;  3KX0 X;  3HJI A;  3VOL A;  4GHI A;  4I3A A;  5F6A A;  3K3C A;  4HI4 A;  4MN5 A;  2QJ5 A;  2KX6 A;  3PHY A;  5HDD A;  1P97 A;  4WL9 A;  1OT9 A;  3CAX A;  4R6L A;  1TS7 A;  2QKP A;  1GSX A;  4XT2 A;  4R3A A;  5IU1 A;  3F1N A;  1Y28 A;  1UGU A;  1XFQ A;  3UMD A;  5TBM B;  1GSW A;  1WA9 A;  5AVF A;  1N9N A;  3LIF A;  5TBM A;  4WN5 A;  2L1M A;  3H82 B;  1VB6 A;  3G6O A;  3MXQ A;  1S1Z A;  3MFX A;  4BBU A;  3OLO A;  2KDK A;  4LLO B;  4HQA A;  3EWK A;  5HZH A;  1T19 A;  4LRX C;  3RH8 B;  1S4R A;  1MZU A;  4KUK A;  1T1C A;  2WKQ A;  3A0R A;  1DP6 A;  4R70 A;  3UB9 A;  4WUJ A;  2GJ3 A;  4L9F A;  4LRY C;  2VLG A;  1X0O A;  2QJ7 A;  2L0W A;  4JGQ A;  5DKL A;  2HV1 A;  3IS2 B;  4HHD A;  5HSQ A;  1F9I A;  4NXG A;  1OT6 A;  2PYR A;  1T18 A;  3ICY A;  5F68 A;  4BBT A;  3ZQ5 A;  4I3I A;  1OJG A;  4YWZ A;  3NOP C;  3LID A;  3MQO A;  4HP4 A;  3UB7 A;  1XJ3 A;  3FC7 A;  4H6J A;  2PR5 A;  5HD3 A;  4GS9 B;  4M4X A;  1S1Y A;  4GHI B;  1LSW A;  3BY9 A;  1LT0 A;  3CWF A;  3PYP A;  2YKH A;  2OOL A;  4EEP A;  4EER A;  4E04 A;  1NWZ A;  5HWW A;  4PKY G;  1V9Z A;  5AVE A;  2V0W A;  4K08 A;  4L9E A;  4XT2 B;  3F1N B;  2J80 A;  2WKP A;  1TS0 A;  2ZOI A;  4F3L B;  4KUO A;  2PR6 A;  1DRM A;  2WKR A;  3RTY A;  5HDS A;  1OTE A;  4PKY A;  4F3L A;  1LSV A;  1OTA A;  3BY8 A;  3F1O A;  4L9G A;  4HH2 A;  4HIA A;  2Z6D A;  2OWH A;  3UME A;  1GSV A;  4HOI A;  2QWS A;  5DKK A;  2VEA A;  1KOU A;  3MR0 A;  4HNB A;  2V9A A;  1OTI A;  3NJA A;  2PD8 A;  4EET B;  1F98 A;  2ZOH A;  3C8C A;  5G4Y A;  4DJ2 A;  2W0N A;  2VV8 A;  3LI8 A;  2QHK A;  2V1B A;  3LIE A;  3HJK A;  4HJ4 A;  1TS6 A;  2K7S A;  5J7E A;  1DP9 A;  2EA9 A;  5HD5 A;  2PHY A;  5HWT A;  2H28 A;  4H6J B;  1N9O A;  3F1P A;  3MJQ A;  1T1B A;  3E4O A;  4RQ9 A;  3ULF A;  1XJ6 A;  2D02 A;  1D7E A; 
#chains in the Genus database with same CATH topology
 2V0U A;  3T1R A;  3UY6 A;  3MKF A;  3LI9 A;  1RP5 A;  1RGY A;  4EES A;  2VZW A;  3KYQ A;  1ERO A;  4JXS A;  2A24 B;  1QME A;  1CI8 A;  3IH8 A;  4B9O A;  3AGF A;  4E3J A;  4B4Z A;  4BBV A;  1ODV A;  4UA6 A;  2DCF A;  1VHM A;  1VM1 A;  3IXB A;  5JYO A;  1XFN A;  4MDZ A;  4UEY A;  3SOI A;  3FG8 A;  2J8Y A;  3IWQ A;  2HP6 A;  3OPR A;  1KVM A;  4EW7 A;  4HY8 A;  4X6T A;  3BYD A;  4KQD A;  3LUQ A;  3VP2 A;  3N6I A;  1CQA A;  3NOT C;  4CLC D;  2ZMV A;  4X68 A;  2V2F F;  2LB9 A;  2P7J A;  2JN7 A;  4EQ1 A;  1DP8 A;  4I38 A;  1HD8 A;  2Y2M A;  1CEF A;  5HAP A;  4NET A;  4QD4 A;  3IBR A;  5F82 A;  1YLT A;  2D01 A;  1W79 A;  2JKT M;  3MQQ A;  2BAS A;  2INW A;  1KGF A;  4KZB A;  4RX3 A;  2W3D A;  1H8Z A;  1SZV A;  1DJC A;  3VE3 A;  4XXR A;  1ZG6 A;  1JWP A;  3G34 A;  2ZQA A;  3E0Y A;  4MCW A;  3LY3 A;  3SH8 A;  2C6W B;  4H8R A;  2VV6 A;  4S2N A;  1XP4 A;  1K4E A;  5E2H A;  3O86 A;  4JGO A;  4JBF A;  2GDN A;  2PD7 A;  3LR5 A;  1YM1 A;  2JCH A;  3T4K A;  4C6Y A;  5EVI C;  3A3E A;  5FQK A;  1G6A A;  1MC0 A;  2OWJ A;  3P7N A;  3ZNT A;  3GQZ A;  4N1H A;  2W27 A;  2ZC3 B;  4KQR A;  4OP8 A;  3SW1 A;  3VP3 A;  4DN0 A;  4I5S A;  4AFI A;  5DTS A;  3NI9 A;  1IFQ A;  3CIT A;  5AQ7 A;  4QY5 A;  3Q7V A;  1TVF A;  1P9R A;  3T50 A;  2PDR A;  4PMA A;  2ZL1 B;  5DFY A;  3VP0 A;  3LR3 A;  4ZAM A;  3C2W A;  5IT5 A;  2VV7 A;  3P98 A;  1HZO A;  5FI7 A;  3KX0 X;  1PI5 A;  2HZ5 A;  3DTE A;  4GHI A;  4I3A A;  5F6A A;  1S0W A;  5HDD A;  1I2W A;  1P97 A;  2XRN A;  2KOI A;  1IOU A;  1SHV A;  4IHQ A;  3CUE A;  5CGS A;  1ZHH B;  1MWU A;  3M2J A;  4XT2 A;  3RXX A;  3F1N A;  3NCK A;  1Z6F A;  1PFL A;  3IWI A;  4FD8 A;  2XEP A;  2ZM0 A;  1TDL A;  1WA9 A;  2WZZ A;  2M7U A;  1FOF A;  3OCL A;  4WN5 A;  2L1M A;  1L0G A;  1VB6 A;  5HZH A;  4EQI A;  1ERM A;  3ZG9 B;  3RH8 B;  2HJ9 C;  1S4R A;  5G18 A;  4E6X A;  4DE2 A;  1DP6 A;  3HLW A;  4WUJ A;  2JKT I;  3PAG A;  1QMF A;  3UNW A;  3PBO A;  3TOI A;  3KSF A;  5EM1 A;  4YIN A;  4LFU A;  4CPK A;  2DMW A;  2VGL M;  1IEM A;  2QJ7 A;  2L0W A;  1YLZ A;  2EX6 A;  5DKL A;  4EBL A;  1O7E A;  1K56 A;  5E43 A;  3DTK A;  5HSQ A;  1GHP A;  4Y0T A;  1Y54 A;  1DY6 A;  5F68 A;  3N7W A;  4ESP A;  3FWL A;  2WAD A;  4BL2 A;  3BFG A;  4OPZ A;  3T4Q A;  4DMZ A;  2O9B A;  4P6B A;  1XJ3 A;  1H3Q A;  4FCF A;  3IHB A;  3FC7 A;  4Y7P A;  1W63 M;  3GTC A;  4X56 A;  3UPN A;  2PR5 A;  5HL6 A;  4BWI A;  5KSC A;  1FR6 A;  3IX3 A;  3OZH A;  4NEE D;  3NC8 A;  3GSG A;  3PYP A;  1S6R A;  2WGW A;  3BQA A;  2R9X A;  3WS2 A;  2GNX A;  5AVE A;  4DE3 A;  2V0W A;  4K08 A;  2DRW A;  3ZG5 A;  4L9E A;  2Y2I A;  1K57 A;  3BLM A;  3BFE A;  2J80 A;  4KUO A;  2PR6 A;  1Q2Q A;  2E8I A;  4PKY A;  1MXO A;  4F3L A;  3W8K A;  1IKG A;  1W63 Q;  2EFU A;  1OTA A;  2WAF A;  3F1O A;  1SCW A;  4Q0I A;  4Z9Q A;  1NYM A;  1Y4O A;  4FH4 A;  4N1X A;  3MFD A;  3R7W A;  2W1T A;  4R1G A;  5FAQ A;  3O3V A;  4HOI A;  1OME A;  2HPB A;  2VEA A;  2ZMA A;  4WZ5 A;  2H0T A;  1K54 A;  4IUK A;  4NKP A;  3NJA A;  2PT7 A;  1F98 A;  2ZOH A;  4MLL A;  5L07 A;  1CK3 A;  3S22 A;  4JKT A;  3HL9 A;  3LIE A;  4QY6 A;  1ACF A;  2VGJ A;  2ZC6 B;  4EUZ A;  4EWF A;  1TS6 A;  2EWV A;  3GMW A;  4BD0 A;  5E2E A;  3M2K A;  5L2F A;  2EA9 A;  2Y2K A;  4KZ4 A;  1N9O A;  3MJQ A;  3UN7 A;  2DNS A;  4HBT A;  5CHJ A;  3ULF A;  1XJ6 A;  5FDH A;  3DBA A;  3LIB A;  1XJ2 A;  1SDE A;  1W7F A;  1XXM A;  2OSU A;  4KZ3 A;  5A8B A;  5A90 A;  5HW3 A;  5MC7 A;  5EPH A;  1XX2 A;  3ZVT A;  1IYS A;  3EGX C;  1XGI A;  2XK1 A;  3S7P A;  3GDI A;  3AGD A;  1BT5 A;  1K6S A;  3A3D A;  5DF8 A;  3KYZ A;  2ZQ9 A;  1IYP A;  2WYX A;  1TDG A;  1PWC A;  2V1A A;  5J4E A;  4WF0 A;  1T1A A;  2WKE A;  4GDN A;  5CX7 A;  3UE6 A;  4WMC A;  4DRT A;  1YLP A;  3B33 A;  3WS5 A;  4Q0J A;  5FAO A;  4GCZ A;  4HP9 A;  4Q0H A;  2ACG A;  4KG2 A;  1UWP X;  3A3F A;  3HVF A;  3TW8 A;  2V8C A;  1N9B A;  1YSQ A;  4JXG A;  1H8Y A;  4CLC B;  1JVJ A;  1N9L A;  2P9V B;  1K4F A;  4OPQ A;  5EVE A;  3MS6 A;  3OPP A;  4JGP A;  3N8S A;  3MZE A;  3VSK A;  4BQM A;  5TGF A;  3VFF A;  5I5L A;  3RXW A;  1YMS A;  2WGV A;  2ZJ9 A;  4JXW A;  1MWT A;  4OH0 A;  5KIZ A;  4S2P A;  3KO6 A;  3LIC A;  3V67 A;  4KZ9 A;  3O87 A;  5E2F A;  1ES4 A;  2JKG A;  1OPX A;  2A2L A;  2FZ0 A;  1ES2 A;  3D9Y A;  5C5K A;  4GN2 A;  3MKE A;  4IJG A;  1P0Z A;  4S2O A;  4DDY A;  4DE0 A;  2VX8 A;  4PHT A;  2Y2H A;  4Z1W A;  3LIA A;  3C4O A;  4E3I A;  3UE3 A;  3VSL A;  1YLW A;  2Q9M A;  3NUL A;  1LI9 A;  2XQZ A;  3D4F A;  5CHU A;  3F1P B;  3VE4 A;  2OLU A;  5IS1 A;  1V9Y A;  3A0V A;  3BWL A;  5FAP A;  2XFS A;  1VET A;  3ZG0 A;  3HUO A;  4Q8I A;  4BJP A;  3K3D A;  5CEB A;  3E2L A;  5FSR A;  1HLU P;  2PYP A;  1ERQ A;  3KYE A;  2WGI A;  2PRF A;  4S2J A;  4ZJ1 A;  5EFW A;  2WUQ A;  2I9V A;  4FUW A;  2EX9 A;  3QHY A;  2VJW A;  2XLN A;  3QP5 A;  1BYW A;  3L7H A;  3OOV A;  4WEL A;  3T1X A;  3H7W B;  5CEC A;  3WRZ A;  4WEK A;  1LL5 A;  1LL8 A;  4ME4 A;  4MBH A;  5GHX A;  4GS9 A;  3T4J A;  4CQH A;  1E3U A;  4OKP A;  1K55 C;  4P6Z S;  2HP9 A;  3NIA A;  2ZC4 B;  3K3C A;  1NRF A;  4HI4 A;  1N4O A;  3UDI A;  3IQA A;  1YAX A;  1SDN A;  4E6W A;  1JTD A;  1NY0 A;  2BTF P;  4KZ6 A;  5AQ9 A;  4WL9 A;  1OT9 A;  3CAX A;  4R6L A;  1FQG A;  1TS7 A;  3QP2 A;  3U4L P;  2QKP A;  4GDB A;  4YFM A;  1ESU A;  4ZJ2 A;  1BLS A;  5EVL A;  5EVI A;  3T1S A;  1DJA A;  4DF6 A;  2O99 A;  4WYY A;  3DTI A;  3CI6 A;  2VK3 A;  4ARZ A;  1K25 A;  3LIF A;  4CJN A;  4R3J A;  5CTN A;  5HPI A;  3ZG8 B;  1KE0 A;  3H82 B;  3G6O A;  5M18 A;  1S1Z A;  5GLA A;  3OLO A;  4HQA A;  3EWK A;  4IUH A;  3QP4 A;  3VV4 A;  5EE8 A;  3TG9 A;  4LRX C;  3HCY A;  4KUK A;  3CPT A;  1SKO B;  2FFF B;  4X25 A;  2J9P A;  4OQH A;  3KSH A;  1CI9 A;  5HAQ A;  5CRF A;  4ETZ A;  2GJ3 A;  2XDM A;  3JPU A;  1HTZ A;  3FZC A;  4KZ7 A;  2IWC A;  2QZ6 A;  3IS2 B;  4HHD A;  4CLC C;  3Q82 A;  4MBK A;  4QU3 A;  1JTG A;  1OT6 A;  5FL3 A;  2PYR A;  2W3F A;  3MZF A;  2EX8 A;  3ZQ5 A;  4KEN B;  1PNE A;  4E3L A;  4Y0U A;  4E3K A;  3LID A;  1PWD A;  4HP4 A;  3UB7 A;  3ZG7 B;  1ESI A;  1H8M A;  2XA7 S;  3DW0 A;  2NUT C;  4H6J A;  4D60 A;  3V3R A;  3UPP A;  2G2U A;  4IBR A;  1S1Y A;  4ZDX A;  4OLG A;  4B93 A;  4Y13 A;  3ZCZ A;  1ONH A;  2UV0 E;  4JF6 A;  2J3W A;  4KZA A;  3M6B A;  3CWF A;  1GHM A;  2AVX A;  4HES A;  4EER A;  4ZBE A;  1EWZ A;  2XH9 A;  3V39 A;  4E04 A;  1NWZ A;  1F2K A;  3BM6 A;  4RYE A;  1V9Z A;  4GD6 A;  2ZD8 A;  2J3T D;  3EOI A;  4ZTK A;  2A49 A;  2WKP A;  5HFO A;  3V50 A;  4F3L B;  5J8X A;  2HDS A;  3WS4 A;  3C38 A;  1NJ4 A;  2WK0 A;  3EQU A;  1LSV A;  1VEU B;  4GD8 A;  4NG2 A;  1XKZ A;  4OLD A;  3EQV A;  3U2A A;  5I94 A;  4C75 A;  3BFC A;  4UA7 A;  1PIO A;  5GLC A;  5CHM A;  4LV2 A;  4PM9 A;  3HUN A;  1KOU A;  4K91 A;  2V9A A;  4DDS A;  5BOH A;  4OOM A;  5A91 A;  4OOY A;  1NRJ A;  3CG5 A;  4G3V A;  4FH2 A;  4LV0 A;  1HVB A;  3C8C A;  4MNR A;  3T4O A;  3QP1 A;  1K56 D;  3GR2 A;  3IX4 A;  5EEC A;  1YT4 A;  5DF7 A;  2PU4 A;  4S2L A;  4P85 A;  4EBN A;  3G30 A;  2ZC7 A;  3SS4 A;  1O07 A;  3K2N A;  5FAS A;  2HDU A;  1MWS A;  5L10 A;  1L0D A;  3V5M A;  3MXS A;  2EFX A;  5EUA A;  5FQI A;  2C5W B;  3P01 A;  1T1B A;  1RGZ A;  3E4O A;  4OP5 A;  4GB7 A;  3B42 A;  5CGX A;  5EV0 A;  2W3E A;  4LRZ E;  4KZ5 A;  1ZC2 A;  4QWO A;  4Y5F A;  3WWX A;  3E4P A;  2QMI A;  5FA7 A;  4E3M A;  3BRM A;  1RCJ A;  1LL9 A;  3MF0 A;  3IF6 B;  3N4I A;  2X71 A;  3NDE A;  4WLA A;  2ZM8 A;  2ZL1 A;  2B5R A;  4N9L A;  4LCL A;  4PM5 A;  4I39 A;  5FQQ A;  2EX2 A;  4JGR A;  4BL3 A;  3E4Q A;  4UQI S;  3LYX A;  3KSI A;  5DJT A;  1EW0 A;  4YOF A;  1S4S A;  1J9M A;  5FQ9 A;  1FCN A;  4PPR A;  5E2G A;  1P9W A;  1UWN X;  2FFY A;  5DJU A;  4FTX A;  1LLB A;  3S7Q A;  2WZX A;  3BQ8 A;  2M1C A;  2Y2Q A;  4KG5 A;  1LSX A;  3IX8 A;  3MMH A;  1KGG A;  1XA1 A;  1YPR A;  1BLH A;  2OLV A;  2PBY A;  4PM7 A;  1CJF A;  5FEF A;  4IBX A;  4NXF A;  2QPN A;  2ZBB A;  4MN6 A;  4U0T A;  2PAV P;  3OC2 A;  3E2K A;  3VFH A;  4JF4 A;  4GOG A;  5F1F A;  3D72 A;  3UB6 A;  3S7N A;  4C3Q A;  4UQI M;  2W1R A;  4OPR A;  5DTT A;  2Y79 A;  3ZYT A;  2PBD P;  4O8G A;  5TFQ A;  2L4R A;  3SH9 A;  5D3O A;  3MQ0 A;  4HH3 A;  1D1J A;  4HJ6 A;  2Y2L A;  3M6H A;  2WAE A;  1OJ5 A;  2ZM2 A;  1BUE A;  2E8J A;  3CHW P;  2K31 A;  2Q9N A;  3FKW A;  3JYI A;  3VOZ A;  3CJM A;  3PAE A;  1LI0 A;  4G3W A;  1S67 L;  3NDG A;  1I2S A;  4PAU A;  1G28 A;  2I72 A;  5M1A A;  5HL1 A;  5G4Z A;  2Z6C A;  2CMN A;  5F5Y A;  3CLO A;  4R0Q A;  2J9O A;  2W3G A;  5TJJ A;  1W5D A;  1XA7 A;  2MJ6 A;  4RA7 A;  4UAA A;  2GX5 A;  3A0S A;  4LEN A;  3H9W A;  1M6K A;  3EEH A;  3NOU C;  2Y2G A;  1IYQ A;  3LEQ A;  5U47 A;  3UB8 A;  4LPZ A;  3ZGA B;  4R3B A;  3G31 A;  3LEZ A;  4WMC D;  2UWX A;  1W8Y A;  1Q2P A;  4EBP A;  4X69 A;  1VQQ A;  4P87 A;  5FI2 A;  3OPL A;  4XUZ A;  3A3J A;  4GLQ A;  3G2Z A;  3PHY A;  1BLP A;  5AQA A;  2XSS A;  1FCM A;  4FOF A;  4L0L A;  3KSG A;  3TSG A;  3OCN A;  2ZMF A;  1MKM A;  3T4T A;  3G4P A;  1PRQ A;  2EXB A;  5GLD A;  4R3A A;  1Y28 A;  1UGU A;  1BLC A;  2O9A A;  3UMD A;  2XF3 A;  4E3N A;  4DKI A;  3LGO A;  3L9K A;  3LCE A;  3HRE A;  1SKF A;  5AVF A;  1KE4 A;  2H0Y A;  3C4P A;  3Q7Z A;  5TBM A;  4WM9 A;  4QB8 A;  1TD5 A;  3VP4 A;  2XR0 A;  3AGE A;  3MXQ A;  3MFX A;  1IEL A;  5A93 A;  5GHY A;  1AXB A;  3FYZ A;  4DXB A;  4F94 A;  1YKD A;  1T19 A;  1ONG A;  3IF6 C;  5EOO A;  2Y59 A;  3LY4 A;  2P04 A;  2Y2O A;  1CEG A;  3C30 A;  1K0K A;  3T12 B;  2WKQ A;  5FQM A;  4R70 A;  3HLD A;  4M3K A;  3UB9 A;  1IYO A;  2PU2 A;  1MPL A;  3DAV A;  3IXG A;  4LRY C;  4JLF A;  3IXH A;  3PR6 A;  1K55 A;  1X0O A;  3SS3 A;  3HUM A;  4JGQ A;  3G2Y A;  1JWZ A;  2HV1 A;  3PBQ A;  1MKI A;  4Y15 A;  3OPH A;  4OVD A;  1STZ A;  4EUV A;  1F9I A;  1L0E A;  2Q0O A;  2GZA A;  4OON A;  4QHC A;  3S1Y A;  4BBT A;  3DTM A;  3Q7V B;  2XRO A;  3BEC A;  1OJG A;  3ZHH A;  3O5Y A;  3GRJ A;  4YWZ A;  3NOP C;  4LV3 A;  2EXA A;  1G68 A;  5KMW A;  4RX2 A;  2HDQ A;  4ID4 A;  3FPW A;  5FAT A;  3Q07 A;  4M4X A;  4GHI B;  4X55 A;  1E3U D;  3BY9 A;  5AQB A;  1PWG A;  1GCE A;  3W4O A;  3ZNY A;  3LR0 A;  4E3O A;  2YKH A;  5AJG A;  4IED A;  4EEP A;  2OAP 1;  1JWV A;  4Y3I A;  2JC7 A;  3C7V A;  5HWW A;  4OQG A;  1I5Q A;  1BTL A;  4PKY G;  2ZQ8 A;  2H5S A;  2Y2N A;  4X1L A;  1AWI A;  4XT2 B;  3F1N B;  4BD1 A;  1TS0 A;  1U60 A;  2IA2 A;  2XD1 A;  3TE8 A;  2Z2M B;  1DRM A;  3B3X A;  3OBF A;  4K0W A;  5EVI D;  5CER A;  4OOL A;  2B95 A;  5HDS A;  4N92 A;  3EGD C;  4ZRR A;  1MY8 A;  1WYB A;  3BY8 A;  2Y8H A;  2H10 A;  2JE5 A;  4CLC A;  3ZDJ A;  2Y91 A;  2Z6D A;  2HJE A;  2P9V A;  4P6Z M;  3UME A;  3IF5 A;  4WBG A;  1K6R A;  2QWS A;  3WS1 A;  3MR0 A;  1NYY A;  2V8F A;  4OPY A;  1MBL A;  3NEC A;  4WEJ A;  4U3T A;  4YNR A;  3S7O A;  3I7J A;  1BUL A;  2PD8 A;  4EET B;  2KLI A;  1KDS A;  5G4Y A;  4DJ2 A;  2W0N A;  1G6O A;  2FH5 A;  2VV8 A;  3QP8 A;  3HBR A;  2QHK A;  5CED A;  2V1B A;  3HJK A;  4KG6 A;  5J7E A;  2Y4A A;  3PTE A;  5HD5 A;  3HLB A;  3UE0 A;  5HWT A;  3PXP A;  3F1P A;  1MWR A;  3T1Q B;  5HX9 A;  2WKH A;  4MBF A;  3O88 A;  3JVU A;  5M19 A;  1D7E A;  2P74 A;  1OTD A;  4R23 A;  3BFF A;  5HWV A;  3D3O A;  3ZVW A;  2QYB A;  2BG1 A;  3PBR A;  4S2N C;  1XJ4 A;  2WGW B;  2Z2L B;  3PBN A;  3IWO A;  2OAQ 1;  1FCO A;  5F69 A;  3UB5 P;  3VOY A;  4QPR A;  3UPO A;  3A3I A;  4NK3 A;  1NLY A;  2A24 A;  3VP1 A;  3H7W A;  3G35 A;  4KQQ A;  3GV9 A;  1K38 A;  5HPF A;  3W4P A;  2XA7 M;  2G7U A;  4A5R A;  3F1O B;  1IKI A;  3BW6 A;  3TJZ C;  4XUX A;  3R7W B;  2W3H A;  4NXE A;  1FR1 A;  2W1T B;  2P08 A;  3Q1F A;  4GW9 A;  4Y2F A;  1TS8 A;  4I3J A;  5DVA A;  3UO9 A;  2G2W A;  1GHI A;  3V3S A;  4R38 A;  5L09 A;  4X53 A;  3ZFZ A;  1ES3 A;  2VGL S;  5DFX A;  2JHE A;  5CXW A;  1GA9 A;  2A3U A;  3GEC A;  1S66 L;  5GLB A;  2B18 A;  3EEA A;  1NLZ A;  5HDC A;  1D06 A;  3LFV A;  2J7V A;  1M40 A;  1BSG A;  3H82 A;  1OTB A;  4G3K A;  3QNB A;  5TR7 A;  4BMW A;  4DJ3 A;  4HJ3 A;  4Y0O A;  4GJ4 A;  2HF6 A;  1H5X A;  4EXO A;  2IWD A;  1PW8 A;  2J3T C;  4S2K A;  2R78 A;  3CUE C;  3WRT A;  3NHQ A;  1SKO A;  3P09 A;  5J3W A;  1KVL A;  2B02 A;  3LO7 A;  3N8R A;  4LCM A;  2VKS A;  1ZKJ A;  3SZT A;  3C5A A;  1CF0 A;  1Z09 A;  2VA0 A;  3UDX A;  4OQI A;  2IWB A;  4ETX A;  3IH9 A;  2OV5 A;  2HDR A;  3N8L A;  4B4X A;  3IS2 A;  1JNU A;  1ES5 A;  3MBZ A;  4BLM A;  3FV7 A;  4O0P A;  1GA0 A;  5LBR A;  3Q81 A;  5IHV A;  4OQ0 A;  3ITB A;  2O0Y A;  3VMA A;  4BEN A;  5GL9 A;  4R4R A;  3FKV A;  1WE4 A;  3MXR A;  1XPB A;  3NBL A;  4NXB A;  3PBS A;  3R4K A;  1KDW A;  1BZA A;  2Y2J A;  3QP6 A;  2ZLY A;  2YKF A;  4DE1 A;  3ISG A;  4EEU A;  2X02 A;  3C7U A;  3HJI A;  2HP5 A;  3UDF A;  3VOL A;  1ZTU A;  3SS5 A;  4MN7 A;  1E4D A;  5A92 A;  1FIL A;  1G5U A;  2VGK A;  2QJ5 A;  4MN5 A;  2KX6 A;  4X1M A;  1NZU A;  1ALQ A;  4MEZ A;  2X01 A;  3S4X A;  1PZP A;  4K0X A;  3UE1 A;  2R9W A;  2RCX A;  1TEM A;  4FSF A;  1GSX A;  4O7D A;  5F83 A;  2XFT A;  1W8Q A;  3MSH A;  5HAI A;  5IU1 A;  3T4L A;  4WZ4 A;  4U0X A;  1XGJ A;  1XFQ A;  1NZO A;  4O01 A;  1PYY A;  2XD5 A;  5TBM B;  1YSP A;  3G32 A;  1GSW A;  1N9N A;  1FSY A;  1VEU A;  1KE3 A;  1PI4 A;  2ZC5 B;  2JBF A;  4BBU A;  2Y2P A;  2KDK A;  4HEF A;  4LLO B;  1YQS A;  1PW1 A;  1LHY A;  1MZU A;  4UA9 A;  3IXD A;  1T1C A;  3BEB A;  1K57 C;  3A0R A;  2JKR M;  5FDS A;  3T4S A;  3W2Z A;  4JPM A;  3RJU A;  1F5M A;  1VET B;  4L9F A;  5DF9 A;  2ZQC A;  3GVB A;  3QNC A;  2VLG A;  4JXV A;  3MZD A;  2XGN A;  4LV1 A;  3WS0 A;  3LR4 A;  3PBT A;  3CMZ A;  5KZH A;  2V20 A;  4NXG A;  3B47 A;  4PM8 A;  1T18 A;  3ICY A;  1L0F A;  4S2I A;  4EV4 A;  3NY4 A;  4I3I A;  4DXC A;  4WZ5 C;  3MQO A;  2BLS A;  1K54 C;  2K2N A;  5GHZ A;  4UHU A;  2HGV A;  2RL3 A;  5FQJ A;  5HD3 A;  2CC1 A;  4GS9 B;  5KSH A;  3IT9 A;  1LSW A;  4CLC E;  4MMN A;  1C3B A;  1KGE A;  4R4S A;  3HLG A;  1LT0 A;  2EWW A;  4PM6 A;  1L2S A;  2OOL A;  4B88 A;  3IHA A;  3BJN A;  3SH7 A;  5F1G A;  1DJB A;  1H0M A;  3BFD A;  4KQO A;  5DTK A;  5FI6 A;  1NXY A;  3IF6 A;  5CGW A;  4GKU A;  5EVI B;  2ZOI A;  1E25 A;  3ITA A;  5CTM A;  1FIK A;  2WKR A;  2JKF A;  3RTY A;  1OTE A;  1L3L A;  4ARZ B;  4HBU A;  3W4Q A;  3IBJ A;  3JVV A;  1TF1 A;  3FPV A;  2V1Z A;  4Y17 A;  4L9G A;  4D2O A;  1YMX A;  4HH2 A;  4HIA A;  2ZQD A;  4LGW A;  2OWH A;  3RFB A;  1GSV A;  4KZ8 A;  2ZQ7 A;  3CPT B;  5DKK A;  5EM0 A;  3DWK A;  3HLC A;  4IVK A;  4HNB A;  1J3W A;  3HLF A;  5FEG A;  4ZJ3 A;  1PZO A;  4N9K A;  5EOE A;  4GNU A;  3TRC A;  1A0K A;  1OTI A;  3HLE A;  2M7V A;  4GZB A;  4QJG A;  4IVI A;  3BLS A;  4EU0 A;  3LI8 A;  1FSW A;  4P0M A;  2NUP C;  4HJ4 A;  3E98 A;  1ZG4 A;  2K7S A;  1YLY A;  2LB5 A;  5JYP A;  1DP9 A;  3CZD A;  4II7 A;  1WYC A;  3DWZ A;  2O9C A;  2PHY A;  4JF5 A;  2JKR I;  2Y55 A;  2H28 A;  1YLJ A;  5K5B A;  4H6J B;  1EI5 A;  5HAR A;  4S2M A;  4RQ9 A;  2WKI A;  4RVA A;  2D02 A;  5L8M A; 
#chains in the Genus database with same CATH homology
 2W3E A;  3LIB A;  1OTD A;  4LRZ E;  2V0U A;  1XJ2 A;  5A8B A;  5HWV A;  5MC7 A;  3LI9 A;  3D3O A;  4Y5F A;  2QYB A;  3EGX C;  3PBR A;  3S7P A;  4EES A;  1XJ4 A;  3GDI A;  3E4P A;  2VZW A;  3KYQ A;  3PBN A;  2A24 B;  2OAQ 1;  3KYZ A;  5F69 A;  3MF0 A;  4QPR A;  4B9O A;  4BBV A;  1ODV A;  4WLA A;  1VHM A;  1NLY A;  2A24 A;  2V1A A;  5J4E A;  4WF0 A;  1T1A A;  5CX7 A;  1XFN A;  3H7W A;  4MDZ A;  4UEY A;  3UE6 A;  4I39 A;  4JGR A;  3FG8 A;  3E4Q A;  3B33 A;  3LYX A;  3KSI A;  4UQI S;  5DJT A;  5HPF A;  1EW0 A;  4Q0J A;  4YOF A;  1S4S A;  4GCZ A;  4HP9 A;  2XA7 M;  4Q0H A;  4EW7 A;  2G7U A;  4HY8 A;  3F1O B;  1UWP X;  3BW6 A;  3TW8 A;  1P9W A;  1UWN X;  5DJU A;  3TJZ C;  4KQD A;  1YSQ A;  3S7Q A;  3R7W B;  4CLC B;  2W3H A;  3LUQ A;  4NXE A;  1N9L A;  2W1T B;  2P08 A;  4GW9 A;  3NOT C;  4CLC D;  4Y2F A;  3BQ8 A;  2M1C A;  2ZMV A;  1TS8 A;  1LSX A;  4JGP A;  3MMH A;  4I3J A;  2LB9 A;  2P7J A;  2JN7 A;  4EQ1 A;  1DP8 A;  4R38 A;  4NXF A;  4I38 A;  5I5L A;  2ZBB A;  4MN6 A;  2VGL S;  5DFX A;  2JHE A;  3IBR A;  2D01 A;  5KIZ A;  3KO6 A;  2JKT M;  3LIC A;  3OC2 A;  3V67 A;  3MQQ A;  2BAS A;  2INW A;  3GEC A;  1S66 L;  3D72 A;  3UB6 A;  3S7N A;  2W3D A;  2B18 A;  4UQI M;  2W1R A;  1OPX A;  3EEA A;  3VE3 A;  2A2L A;  2FZ0 A;  1NLZ A;  5HDC A;  2Y79 A;  5C5K A;  3E0Y A;  4MCW A;  1D06 A;  3LFV A;  3ZYT A;  4IJG A;  4O8G A;  1P0Z A;  3H82 A;  1OTB A;  4G3K A;  2VV6 A;  2VX8 A;  4PHT A;  2L4R A;  4Z1W A;  3MQ0 A;  4BMW A;  4DJ3 A;  4HJ3 A;  3LIA A;  4HH3 A;  4GJ4 A;  2HF6 A;  4HJ6 A;  4EXO A;  4JGO A;  3UE3 A;  2PD7 A;  2J3T C;  1OJ5 A;  2R78 A;  3CUE C;  3LR5 A;  3NHQ A;  5J3W A;  2K31 A;  3T4K A;  2B02 A;  3F1P B;  3VE4 A;  2VKS A;  1MC0 A;  5IS1 A;  2OWJ A;  1V9Y A;  3A0V A;  3BWL A;  3P7N A;  2VA0 A;  2W27 A;  4G3W A;  4BJP A;  3K3D A;  3SW1 A;  1S67 L;  4PAU A;  1G28 A;  4ETX A;  2PYP A;  4DN0 A;  4I5S A;  4AFI A;  5G4Z A;  2Z6C A;  2CMN A;  5F5Y A;  3CLO A;  3IS2 A;  1IFQ A;  3CIT A;  5EFW A;  1JNU A;  2W3G A;  5TJJ A;  4O0P A;  2I9V A;  2MJ6 A;  5LBR A;  2GX5 A;  3A0S A;  3H9W A;  3EEH A;  1P9R A;  2VJW A;  3T50 A;  2O0Y A;  3NOU C;  1BYW A;  2PDR A;  3OOV A;  4WEL A;  4NXB A;  5DFY A;  3H7W B;  3PBS A;  3R4K A;  4WEK A;  3UB8 A;  4LPZ A;  3LR3 A;  3C2W A;  5IT5 A;  2VV7 A;  2YKF A;  1LL8 A;  4ME4 A;  4EEU A;  4GS9 A;  3T4J A;  4CQH A;  3KX0 X;  3HJI A;  3VOL A;  1ZTU A;  4GHI A;  4I3A A;  4P6Z S;  5F6A A;  4MN7 A;  4GLQ A;  3K3C A;  4HI4 A;  4MN5 A;  2QJ5 A;  2KX6 A;  1YAX A;  3PHY A;  5HDD A;  2XSS A;  1P97 A;  4FOF A;  4WL9 A;  1OT9 A;  3CAX A;  4L0L A;  1TS7 A;  3KSG A;  4R6L A;  2QKP A;  2XRN A;  3OCN A;  2KOI A;  4FSF A;  2ZMF A;  1IOU A;  1MKM A;  4IHQ A;  3T4T A;  1GSX A;  3CUE A;  1ZHH B;  4XT2 A;  4R3A A;  5IU1 A;  3T4L A;  3F1N A;  1Y28 A;  1UGU A;  2O9A A;  1XFQ A;  4O01 A;  3UMD A;  5TBM B;  2O99 A;  1YSP A;  1GSW A;  1WA9 A;  3CI6 A;  2M7U A;  5AVF A;  4ARZ A;  1N9N A;  3LIF A;  5TBM A;  5HPI A;  3OCL A;  1TD5 A;  4WN5 A;  2L1M A;  3H82 B;  1VB6 A;  3G6O A;  3MXQ A;  1S1Z A;  3MFX A;  4BBU A;  3OLO A;  2KDK A;  4LLO B;  4HQA A;  3EWK A;  5HZH A;  4IUH A;  3VV4 A;  1YKD A;  1T19 A;  4LRX C;  3RH8 B;  2HJ9 C;  3HCY A;  1S4R A;  2P04 A;  1MZU A;  4KUK A;  1T1C A;  3C30 A;  2WKQ A;  3KSH A;  3A0R A;  1DP6 A;  2JKR M;  4R70 A;  3T4S A;  3UB9 A;  3W2Z A;  4WUJ A;  2JKT I;  4ETZ A;  2GJ3 A;  1F5M A;  3PBO A;  3KSF A;  4L9F A;  5DF9 A;  4LRY C;  2DMW A;  2VLG A;  2VGL M;  3PR6 A;  1X0O A;  2QJ7 A;  2L0W A;  4JGQ A;  3PBQ A;  5DKL A;  2HV1 A;  3LR4 A;  3IS2 B;  3PBT A;  4HHD A;  4CLC C;  5HSQ A;  1STZ A;  4EUV A;  1F9I A;  4NXG A;  3B47 A;  1OT6 A;  2GZA A;  5FL3 A;  2PYR A;  1T18 A;  2W3F A;  3ICY A;  5F68 A;  4BBT A;  2XRO A;  3ZQ5 A;  4I3I A;  1OJG A;  3O5Y A;  4YWZ A;  3NOP C;  3LID A;  3MQO A;  4HP4 A;  3UB7 A;  3T4Q A;  4DMZ A;  2O9B A;  1H8M A;  2XA7 S;  2K2N A;  1XJ3 A;  1H3Q A;  2NUT C;  3FC7 A;  2HGV A;  4H6J A;  1W63 M;  2PR5 A;  3FPW A;  5HL6 A;  5HD3 A;  4BWI A;  4GS9 B;  4M4X A;  4NEE D;  5KSH A;  1S1Y A;  4GHI B;  1LSW A;  4B93 A;  4CLC E;  3BY9 A;  4MMN A;  2J3W A;  3LR0 A;  1LT0 A;  3CWF A;  3PYP A;  2EWW A;  2YKH A;  2OOL A;  5AJG A;  4EEP A;  2OAP 1;  4EER A;  4Y3I A;  3BJN A;  4E04 A;  3BQA A;  1NWZ A;  5HWW A;  2GNX A;  4KQO A;  4PKY G;  1V9Z A;  5AVE A;  2V0W A;  4K08 A;  4L9E A;  2J3T D;  4XT2 B;  3EOI A;  3F1N B;  2J80 A;  2WKP A;  1TS0 A;  2IA2 A;  2ZOI A;  3TE8 A;  4F3L B;  4KUO A;  2PR6 A;  1DRM A;  3OBF A;  2WKR A;  4OOL A;  3RTY A;  5HDS A;  1OTE A;  4PKY A;  3C38 A;  3EGD C;  4ZRR A;  4ARZ B;  4F3L A;  3EQU A;  1LSV A;  1W63 Q;  1OTA A;  3IBJ A;  3BY8 A;  2Y8H A;  3F1O A;  1TF1 A;  3JVV A;  3FPV A;  3U2A A;  3EQV A;  4Q0I A;  4L9G A;  3R7W A;  4CLC A;  4HH2 A;  4HIA A;  2Z6D A;  2OWH A;  2HJE A;  2W1T A;  3RFB A;  4P6Z M;  3UME A;  1GSV A;  4HOI A;  2QWS A;  5DKK A;  2VEA A;  1KOU A;  3MR0 A;  4HNB A;  2V9A A;  4IUK A;  4NKP A;  3TRC A;  4OOM A;  1OTI A;  3NJA A;  4WEJ A;  4YNR A;  1NRJ A;  3S7O A;  2M7V A;  4G3V A;  2PT7 A;  2PD8 A;  4EET B;  1F98 A;  2ZOH A;  3C8C A;  2KLI A;  5G4Y A;  4DJ2 A;  2W0N A;  1G6O A;  2FH5 A;  2VV8 A;  4EU0 A;  3LI8 A;  2QHK A;  3T4O A;  2V1B A;  3LIE A;  2NUP C;  3HJK A;  4HJ4 A;  3E98 A;  1TS6 A;  2K7S A;  2EWV A;  2LB5 A;  5J7E A;  1DP9 A;  3K2N A;  4II7 A;  2EA9 A;  5HD5 A;  2O9C A;  2PHY A;  2JKR I;  5HWT A;  3PXP A;  2H28 A;  5K5B A;  4H6J B;  1N9O A;  3F1P A;  3MJQ A;  3P01 A;  1T1B A;  3E4O A;  3JVU A;  4RQ9 A;  3ULF A;  1XJ6 A;  2D02 A;  3B42 A;  3DBA A;  1D7E A;  5L8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...